Sequence alignment for CL0373

PF09950

Q9P9P2_XYLFA/84-327--------------------------------GRG-.KRH.SGRGEDIPTVDVAY-------------------------
E1VAC6_HALED/80-318--------------------------------GMA-.KFI.SNYADDLPRVDVTG-------------------------
A9C0G0_DELAS/60-320--------------------------------GRA-.NWQ.SGYAKDIPLADVNQ-------------------------
A6TKD0_ALKMQ/60-304--------------------------------GAA-.KIFAYGASDDIPLVDADV-------------------------
H6NDU4_9BACL/55-298--------------------------------GVA-.KIL.ANNADDVPFVDVDT-------------------------
Q7N327_PHOLL/62-316--------------------------------KD.-.GII.GNKTNSLKTIDSDI-------------------------
Q6FAE7_ACIAD/80-324--------------------------------GIG-.KDY.SGTGGDLPLAEVEY-------------------------
R6PG10_9CLOT/91-341--------------------------------GMA-.KII.HNYATDLPRADVKG-------------------------
G9ARJ4_PANAN/73-313--------------------------------...-.NWV.GKDSTAIAGVNVNI-------------------------
B4EG48_BURCJ/103-345--------------------------------...-.SWI.GKDASAIAGLSLDI-------------------------
C5AFU5_BURGB/112-366--------------------------------...-.NWI.SNEGNAIAGPSVDI-------------------------
R6AF56_9FIRM/26-279--------------------------------NDL-.SIV.GTASNTIPVMQVST-------------------------
K8E4M7_CARML/57-293--------------------------------GAA-.KII.ANGADDLPLVDTDL-------------------------
E3HGR1_ACHXA/80-315--------------------------------GMA-.TIV.ANYADNLPRADVKG-------------------------
C9LU84_SELS3/82-338--------------------------------GQA-.DGV.GGIQNAVRRIQADL-------------------------
R7JXV9_9CLOT/86-336--------------------------------GMA-.AII.NNYATDLPRVDVQG-------------------------
B8IDG5_METNO/63-315--------------------------------GQA-.TWL.HGAADDVPKAEVLR-------------------------
R6R1V3_9FIRM/101-351--------------------------------GFA-.AII.ANYASDLPRVDVKG-------------------------
H8L668_FRAAD/90-334--------------------------------...-.AWV.GKDASAITGLGLDI-------------------------
R6RQ09_9CLOT/93-346--------------------------------...-.GIVHAGGSNGIPMVQADF-------------------------
Q0BRS5_GRABC/66-316--------------------------------GRA-.QWF.NGQAQDVPRADIVR-------------------------
Q2NSP7_SODGM/17-247--------------------------------GEP-.KII.SDNADDLPTIDRGL-------------------------
B8IIV0_METNO/63-315--------------------------------GRA-.KWI.TGQAHDVPRADVLR-------------------------
Q6XQD3_BPT1/82-319--------------------------------GTA-.QII.ADYTDDLPLVDALG-------------------------
A9I906_BORPD/80-320--------------------------------GMA-.KII.ANYADDLPRVDVYG-------------------------
Q2G4R3_NOVAD/111-362--------------------------------GQA-.EFM.GGGAFDMPYASTQM-------------------------
W8UFX7_YEREN/64-311--------------------------------GEL-.QIF.GPNSTDVPTVDIAM-------------------------
A7ILG8_XANP2/103-352--------------------------------...-.SWA.SLEATARPRAVLDI-------------------------
Q32EP9_SHIDS/73-313--------------------------------...-.NWV.GKDSTAIAGVNVDI-------------------------
G2IHV9_9SPHN/64-315--------------------------------GRA-.EYI.SAKGFDIPNVSKQM-------------------------
Q835B4_ENTFA/57-293--------------------------------GAA-.KII.ANGADDLPLVDIDM-------------------------
D0UIJ0_AGGAD/58-304--------------------------------D..-.GLI.TVGTSTLDQVEVGF-------------------------
Q984H1_RHILO/86-339--------------------------------GQA-.QWF.NGNAHDVPKVELTR-------------------------
Q2NRY5_SODGM/73-317--------------------------------ADG-ESWI.SHSTNVIAGIDLDI-------------------------

PF04454

D4H156_DENA2/1-251----------MN.LLRKDFAPIGSAAWDEI..NTI-AKETLKANLSARRFADVEGPYGINFAAVNLGRLKIS--------
C8WPL7_EGGLE/1-257----------MD.YLARESADLSDGLWNRI..DET-VIGTARAQLTCRRFLKVFGPLGAGVTTVAVDGVNKE--------
D0LZ74_HALO1/1-251----------MD.LLKRHLAPIVPDAWSAI..DEE-AKEIFQGHLAGRKLVDFRGPFGWEYAAVNTGELRPI--------
D1B7I4_THEAS/1-249----------MD.VLKRGFAPISQEAWGVL..DQQ-ARVILRENLSARRFVDVEGPKGWDFPGFGTGRLVLP--------
A1B987_PARDP/1-251----------MD.NLHRKLAPISDAAWAQI..EDE-AARTLKRYLGARRVVDVHGPEGFGLSAVGTGHLRPA--------
A3DFK3_CLOTH/1-257----------MD.FLSREGSPISAELWEKI..DEA-VVSAAKKILTGRRFISIYGPLGAGIQAINVDNISEL--------
A6TWC5_ALKMQ/1-250----------MD.ILKRDMAPLTESVWEEI..DQR-AAEVLKTHLSARRVVNIVGPKGWDYTVVPEGRLKKI--------
A7HIB4_ANADF/2-255----------TT.WLDREGAPFAQEVWDRI..DAV-ARSAADEVRAGRRLLEVVGPLGFGARAGVAEDLPLG--------
A7I7A2_METB6/2-249----------ANVYLGRDEAPIGAESWKLI..DDV-AVQAAKGQLAGRRLLAIEGPYGFGLKAIPLGDYALE--------
A8F8I8_THELT/3-247----------NK.YLMQEDAPFDPKLWQLF..NET-MTDIAKAQLVGRRILSVKGPFGLGLKQISITDVQIE--------
A8L1F1_FRASN/1-253----------MN.HLLRGHAPLSEEAWKAV..DEE-ARSRLTTNLAARKLIDFAGPHGWAYSATPIGRVTAL--------
A9BEM3_PETMO/1-251----------MD.FLKRELAPITEEAWEEL..DER-AKEIFKNKLKIRPIIDVEGPYGWDYSSYNLGTNELI--------
A9FWS5_SORC5/3-254----------MD.LLKRELAPILPAAWDLI..DHE-ATRVLKLHLAGRKVVDFRGPFGWEVAAVNTGRLRAI--------
A9H5P1_GLUDA/1-251----------MN.NLHRELAPISEAAWAQI..EEE-ASRTLKRYLAARRVVDVPEAKGFGFSAVGTGHVERI--------
B1VSP7_STRGG/1-251----------MN.NLHRELAPVTPSAWEEI..EEE-ARRTFRRHVAGRRVVDVSDPAGPTLAAVGDGHLTDI--------
B2A6K6_NATTJ/8-259----------MN.LFKEQLAPLTNAAWNEI..NDR-AAQVIKSNLSTRKVFKINGPKGLDYPAVSEGRLSEI--------
B2GID2_KOCRD/1-252----------MN.NLHRDLAPISSAAWADM..GDE-ARRTFAARAAARRTVDMPEPAGAEFSALGTGHVSRV--------
B2JNZ6_BURP8/1-251----------MN.NLHRELAPISSEAWSQI..EEE-VARTFKRSVAGRRVVDVKGPGGVDLSGVGTGHQSTI--------
B2V6Y3_SULSY/1-265----------ME.FLKRNEAPLSESDWEKI..DKV-VVETAKRVLVGRRFIEISGPYDPSVQFVPYDYIEDG--------
B4UA40_HYDS0/1-265----------MN.FLHREESPLTAQEWQTI..DNI-VVNTARNHLVGRRFIELTQALDPAIQSVAYDTIPSL--------
B8CYH7_HALOH/1-249----------MV.NLKRSLAPITPDAWEFI..DKE-ARRVLKLKLSARKAVDFVGPKGIKYAAVNTGRRTAL--------
B8EQK3_METSB/1-251----------MN.NLHRELAPISDAAWAQI..EEE-TTRTLKRYLAGRRVVDMPQTGGVALSAVGTGHLLSI--------
B8GHL2_METPE/5-250----------S..YLGRSDAPITAETWTII..DTT-MVEAAKSMLTGRRLLHLEGPYGLGLKAIPLQDSVSE--------
B9JHD1_AGRRK/1-251----------MN.NLHRQLAPISDSAWAQI..EEE-ASRTLKRHLAARRVVDVQDPGGVELSAVGTGHLKPI--------
C0R0J8_BRAHW/1-256----------MD.YLARESSPFEESFWQNI..DKV-VVETASRTLIGRRFLSIYGPLGAGAISVQYDKSDRE--------
C0ZHN4_BREBN/1-265----------MDKLRKYPDSPLTTEEWNQL..DAT-VVDMARRQLVGRRFIDIYGPLGEGIQTITNDVYEES--------
C0ZVK4_RHOE4/1-251----------MT.NLHRDLAPISAAAWAEI..EEE-ASRTFKRHVAGRRVVDVEGPSGDDLAAIPLGHQVPI--------
D5UVK7_TSUPD/1-251----------MN.NLYRDLAPVTSAAWSEI..ETE-ATRTFKRNIAGRRVVDLGDPLGPTASAVGTGHLLEV--------
C4XPM7_DESMR/1-251----------MD.ILKRDLAPVTAAAWQAV..DSR-ARQTLTTMLSGRRVVDVAGPLGWEYAAVPLGRIEYA--------
C5B5H8_METEA/1-251----------MN.NLHRELAPISDAAWAQI..EDE-ASRTLKRYLAARRVVDVVGPKGPGYAAAGTGHTRPI--------
O67639_AQUAE/1-267----------ME.FLQRDQAPLTAEEWEQI..DKT-AYEVFKSTVVCRKFMPVVGPFGAGHQVVSYDVLYGV--------
Q08WR7_STIAD/2-266----------PD.FLGHAENPLREEEWARL..NET-VIQVARRSLVGRRILDIYGPLGAGVQSVPHDEYQGV--------
Q0RH88_FRAAA/1-253----------MN.HLLRGHAPLTDAAWKAV..DDE-AKARLTTNLAARKVVDFAGPHGWEYSATALGRVAAL--------
Q2RVS0_RHORT/1-258----------MN.DLMRDLAPISAKAWAEI..ETE-ARGTLTVTLAARKVVDFKGPLGWDASSVSLGRTEAL--------
Q5YPL3_NOCFA/1-252----------MN.NLHRELAPITSEAWAAI..EEE-AGRTFKRHIAGRRVVDVAGPHGVDFSAVGLGRTTGI--------
Q7MSM9_WOLSU/1-252----------MD.ILRRENAQFPASIWSAI..EKE-AGLVFGKHLTGRKVVDFKGGLGIGFSSLPTGRVISS--------
Q97V86_SULSO/96-329----------ET.....KDFPLIPTSSKEISKDHI-VSWITEGIVSSRIMRNIGNTIKYEFTTIPLSEIKED--------
B2HH42_MYCMM/1-251----------MN.NLYRDLAPVTEAAWAEI..ELE-ATRTFKRHIAGRRVVDVSDPGGPVTAAVSTGRLIDV--------
Q0SE23_RHOSR/5-254----------.S.NLHRNLAPVTEVAWQQI..GEE-AARTFKRHVAGRRVVDVAGPFGYSYSAHNLGRVTPI--------
Q2IH48_ANADE/1-259----------MS.WQDRDGAPFGQQVWDRI..DEA-IEAAAAEARAGRRLLRVIGPLGFEARAGVADDAPAG--------
Q5L1H9_GEOKA/8-264----------.......PEAPLTSSQWGEL..DEL-VIETARRQLVGRRFIDLYGPLGEGVQSVANDIYMNP--------
MARIT_THEMA/1-251----------ME.FLKRSFAPLTEKQWQEI..DNR-AREIFKTQLYGRKFVDVEGPYGWEYAAHPLGEVEVL--------

PF05065

E0THR4_PARBH/115-394----------GAVLSPQET.S-----------DVI.DLKLRDASP.MRQLATVRR..IS.ANVFRK.PVPLT.PI.....
Q1GG15_RUEST/131-399----------VGDGVAPTR.L-----------PGI.QGLPQRRLT.IRDLLAQGRMDGNTIEYVQE.TGFNN........
Q1DCZ9_MYXXD/94-361----------AGVLVPIQQ.S-----------GEV.IEFLRPDAA.MLKLGVRTQ..TF.KGELHM.GKQTG.TS.....
Q0AAI8_ALKEH/83-374----------QGVTVRSDW.A-----------DQI.FKKIRESSP.VRQVANNLS..TN.SNELEV.LVDRG.EP.....
Q3J4R6_RHOS4/160-429----------AGPLIAPQR.E-----------TEI.VGLPRRQVF.VRDLLSRSTTNSNLVQYARM.KARTN........
A1T829_MYCVP/9-278----------HGIVVPDEL.G-----------DLV.IAAAARASVALRASVVVTT..ASREYRVPV.LSGLP........
Q982R8_RHILO/176-465----------GGYLVPTET.E-----------KTI.DRIMGVTST.MRQLATILP..IG.TSEYKK.LVNMG.GA.....
A1AYY2_PARDP/166-435----------GGGLIWSDR.E-----------TEI.VGLPRRQMT.IRNLLSQGRTGSNAIEYARQ.TTRTN........
Q1ILS6_KORVE/495-776----------GTNFVQTTIRP-----------DEF.IDLLRNRLV.VMKMGARKL..GDLQGNLQL.PKQTA.AA.....
Q1GH34_RUEST/388-661----------GGNTIANPLLT-----------QSF.IQMLRNRTI.LLQL.ATPL..MGLVGNPDI.PTQEG.GA.....
Q2GAM7_NOVAD/185-459----------AGDLIVPQR.Q-----------PGI.IGLPQRRMT.IRDLLTPGNTGSNAIQYVKE.TGFTN........
Q8XYS4_RALSO/130-408----------GGYTVPRTF.L-----------AKV.VEQLVTYGG.MASVMQNLT..TDGGEPIDW.PVALGVAE.....
Q3J3K4_RHOS4/110-395----------GGYLVDPQT.S-----------DAI.RSMLLSTAS.IRQIAGVVH..VE.ATSFDV.LIDRT.EV.....
Q1QLS4_NITHX/103-379----------GGYLAPAEF.S-----------AEV.VKGIVEMSP.IRQAARVGS..TS.SGEVLL.PKRTG.RP.....
Q8ED08_SHEON/122-393----------GAGLVRPDR.M-----------AGI.VAGPERRLT.IRDLIAPGETESNTIEYVKE.TGFTN........
Q813J9_BACCR/150-424----------GSVTIPDFL.S-----------KEI.ITYAQEENF.LRRLGTGVK..TKENIKYPV.LVK...KA.....
Q3J5Z4_RHOS4/150-439----------GGVTIPRPQ.A-----------AEL.IEMLRARVV.VRASGARTL..PMPAGEMRH.AKQVG.SA.....
A1B638_PARDP/102-387----------GGFLAAPTV.A-----------MQV.QEALNVTAS.LRRVANVVA..VE.SASYEV.LVDMG.DI.....
Q0AWY3_SYNWW/43-310----------GALTLNPKG.Q-----------SRY.MAALEKEGL.FRSLATDIR..AY.NYNYNI.KTANG.ND.....
A4YU30_BRASO/140-423----------EGVLVPTEW.R-----------EQI.WSLVFADND.LLGFCNPEP...TQGNTVGI.VKDET.TPWGA.A
Q2NV28_SODGM/127-397----------TGTIVAPDR.Q-----------ADI.LTKPKQRLF.IRDLIASGKTQSNTIYYVKQ.KGFTN........
Q1GHS2_RUEST/113-395----------GGFLVDPQT.A-----------DVV.RSVLHSTAS.IRAVASVVN..VE.ATSFDV.LIDHS.DV.....
Q2L2B0_BORA1/123-401----------GGYTVPRTF.W-----------AKV.VESMKQYGG.IASVAQILT..TDGGGPIEW.PTSNGTED.....
A2SD63_METPP/97-385----------GGYMVLPQM.S-----------DEV.TRVMLETSP.LLSSVRLVD..LEPTDEFEE.IVDRD.EV.....
A1TML8_ACIAC/138-428----------GGVLVPENF.A-----------TSV.IESLRPKSV.IRRLGAVSI..PLNNGNMTL.PRIMG.NT.....
Q1QKG8_NITHX/112-388----------GGYLAPAEF.S-----------TEF.IRDLVQFSP.IRALAIVRD..TL.APSVSY.PRRTG.IT.....
Q0S2A4_RHOSR/9-273----------ENAFTPEDY.G-----------KLI.DTEVDAKSV.AFQAATVVN.TDKHQIRVPI.LVSDP........
Q6LSF8_PHOPR/134-417----------GGYTTAPEW.I-----------RQV.EQAMKAYGG.MYDVSTVMR..TATGNTINF.PTTDATAE.....
A5N1H4_CLOK5/152-424----------TDAIIPEAV.I-----------DMI.QARLGDYSA.LYSEVYVQPL....TGTARI.IMDGA.IP.....
A7HRJ6_PARL1/148-433----------GGYLVPVET.E-----------KLI.DRIISEVSP.IRAIAGIRQ..IG.SASYKK.PFAAG.GM.....
Q2YMS9_BRUA2/137-422----------GGYLVPAEL.E-----------TEI.GRRLAVLSP.IRGISGVRQ..VS.GAVLKK.PFSIS.GP.....
Q73HT5_WOLPM/107-395----------GGYLVTPHI.V-----------KRI.NKRVTDSSP.MRQICSSQR..IS.TETLDY.IIEDFDRA.....
Q9A4P7_CAUCR/53-338----------GGYVAPPEL.E-----------RLI.LRRLAATSP.MREICQVRT..IG.AGTFRK.PVSPT.GL.....
Q3Z7J9_DEHM1/124-397----------GGYLVPDEY.E-----------KQL.IDALQEENF.FRSLATVIQ..TQ.SGTHTI.PVVAS.HG.....
Q830G6_ENTFA/163-444----------GSVTVPEVI.A-----------SEV.ISYAQEENL.LRKYGTVIR..TAGDVKYPI.LVK...KA.....
A7MP72_CROS8/125-401----------GGFTVPKQF.R-----------NRV.VEAMKAYGG.IAGVCQILS..TSNGQDIDW.TYSDGTAD.....
A7ILP2_XANP2/167-448----------GGYLVPTAT.S-----------ARI.LTRIWETSP.LRQLSTVET..IG.TDKIEI.PIDDD.EA.....
B0T632_CAUSK/96-391----------GGITVPTNI.H-----------TDV.VEKLRKSSP.LLGLSTVTSLKGLQKLLLKTSAAQAN........
Q11H37_CHESB/111-386----------GGFLVPDNF.V-----------AEM.LRNVVQFSP.VRQYARVMN..VA.GANVRM.PKRTG.TM.....
Q88G49_PSEPK/193-483----------GGVLVPQNF.S-----------SEV.IELLRPKSV.VRKLGAVSL..PLENGNLTV.PRIKG.GA.....
Q72BY4_DESVH/118-395----------GGYTVPRET.A-----------TSI.IEALKAFGG.MRDVATIIT..TASGAPLNY.PTSDGTSE.....
B2JU92_BURP8/137-421----------GGFLVPPQF.A-----------SEI.FTLSLEEQA.LLPMTDSTP...ISGNSMVFPKDETT...PWGTD
Q81Z09_BACAN/121-392----------GS.VIPQTV.L-----------DKI.IEKIEAVGM.ILPLITRTA..IKGGVTVPT.SAVKP........
Q3SS55_NITWN/107-382----------GGYLAPTEM.A-----------TEF.IRDLVQYSP.IRGLASVRS..TS.APAVSY.PKRIG.RT.....
Q2GDU5_NEOSM/81-367----------NGFPLTDTL.I-----------NSI.HEQMKKLSP.IRKLASVNT..IS.TDCITY.ISNGD.AL.....
Q3SSD8_NITWN/135-418----------GGFVVPDQM.E-----------AAI.DRVLGTVSA.MRAISRVMS..IS.SGTYKK.LVNQG.GA.....
A6VNQ3_ACTSZ/129-407----------GGYTVPKEM.Q-----------ARI.VEQMKAYGG.IAQVAQILT..TSDGRTIEW.ITADGTTE.....
A5N291_CLOK5/33-297----------GAYVAPDEF.R-----------EGF.NTALAKENI.LRRFATVIN..LS.SAEGKI.QAVSS.TG.....
Q5WID4_BACSK/129-404----------GGYTVPEDI.S-----------REI.LKSIHEMNT.VRNLVTVVP.KNTSYGNYTV.RKGVA........
A4XZF1_PSEMY/131-410----------GGYLVPREF.S-----------ANL.LEALKDFGG.MRAVAQVIR..TETGAAMDW.PTTDATSE.....
Q2N5Z6_ERYLH/94-380----------GGYAVPQQI.D-----------AMI.ARELVEISP.IRALAQVVQ..TG.SAGYRK.LVSTG.GT.....
Q2GJL3_ANAPZ/114-389----------FSYLIPKKI.H-----------LHF.DKLLSQNSI.MRKLCSIEK..IS.SDSLEY.LISNNQET.....
A9BYD9_DELAS/120-394----------AGDLIVPDR.V-----------PGI.VAPGLRRLT.IRDLLNWGRTGSNAVDFARE.LVFTN........
Q5Z3V6_NOCFA/148-434----------GAFVVPE...Q-----------TGI.VEMLGRRPLTIRNLVSVRRTGSDAVEYVEQ.TSHTN........
A5CD71_ORITB/88-365----------GCYLVQPTL.H-----------QKI.VGGIKHKSP.MRQLASLEL..IS.SSALDT.VIEDN.EF.....
A8FGQ6_BACP2/20-302----------GG.LMNATQ.S-----------NTF.IRMMQNTPT.VLNDARIIPMESDSQKIEKIGFGQRI........
A1TD88_MYCVP/110-388----------GGFLVPMQLDP-----------TII.LTANGSFNQ.VRQISRVVQ...ATGKSWTGVTSAGV........
A9CJN8_AGRT5/134-419----------GGFLLPSET.D-----------GEI.GRRMTAISP.IRALATVRQ..VS.AAVLKK.PFALG.GM.....
A3DG61_CLOTH/127-416----------GGFLLENEF.I-----------NDL.FESMMAQSQ.VANRIRMIPIGANTNRLRALGIDENSRANGSRWG
Q2SDM1_HAHCH/110-393----------GGFGVPEEL.D-----------RQI.LELERELSP.MRALCRNIQ..VS.TDGYKR.LVNLG.GA.....
B2JL19_BURP8/113-379----------NQYPVPSDR.R-----------TTI.IPPGMNDVW.IRDLLPGGTTTSNLIEYPRE.KAAQL........
B7GIM9_ANOFW/146-418----------GELTIPEVV.V-----------NRI.MDIMGDYTT.LYPLVDKIR...V.KGTTRI.LVDTD.TS.....
B9KI56_ANAMF/104-375----------.AYLMPREI.S-----------MHI.DKRLSQSSV.MRKLCSVEKVSGDSLEYFTT.NNKDT........
C5AYR6_METEA/135-420----------GGYLVPPTI.E-----------REV.LRRLAEISP.IRAIATVRVV..S.GGQYKR.AVSVN.GP.....
P71947_MYCTU/196-475----------GGFLIPAAL.D-----------PAILLSGDGSTNP.IRQVARVVQ..TT.SEVWRGVTSEG...A.....
Q2FX56_STAA8/38-311----------...TLLNDF.T-----------TPI.LQEVMENSK.IMQLGKYEPMEGT.EKKFTF.WADKP........
Q2G1W8_STAA8/130-399----------.FVVIPEEI.V-----------TDI.LKLKEVEFN.LDKYVTVKRVTNG.SGKYPV.VRQSE.VA.....
Q3J3W7_RHOS4/239-509----------GGYLAPKEF.G-----------DEL.FKNLIEFSP.IRKYARVVQ..IS.APEITY.PKRVT.GT.....
Q81X82_BACAN/69-344----------GAITVPTSL.S-----------NVI.VEKLVEEAA.LFGRAKSFT..PV.SGTLEV.LREKN.IG.....
Q81XY0_BACAN/102-381----------GNVVLPKHS.A-----------TDI.RPTFNEVST.LIDRVSSKTLKGGESYQQPY.IKSYG........
Q88MK4_PSEPK/141-410----------.GVAIQPTR.V-----------PGI.VVGPEREFT.IRDLIMPGRTGSNAVEFVQE.TGFQN........
Q9CFS0_LACLA/124-389----------AGLTIPQDI.R-----------TMI.NTLVRQYDS.LQQYVRVESVSTS.NGSRVY.EKWTDVTP.....
Q9P9R2_XYLFA/357-623----------GGNIIATELHA-----------SSF.IEILRNKTW.VMQRATVMG..GL.VGNVDI.PRQKG.TT.....
Q9ZWV6_BPPHC/121-387----------...VLSRTL.Y-----------GQL.IAQAVERSA.IMRGGASTFTTSD.ANPMDF.TVITG.RA.....
W6SDV8_9CLOT/124-396----------GGYLVPDEF.E-----------RTL.VQTLEEENV.FRKLAKIIQ..TS.SGDRKI.PVVVT.KG.....

PF06673

Q9MCB6_9VIRU/1-347----------MGVNETQEMMKQAIEAGVKVRELETKVEELNKEREELKKEREANIPSEKPQDVERKFMRELGDKM-----
Q9MCB8_9VIRU/1-347----------MGANETQEIMKQAIEAGVKVRELEAKVEELNKEREELKKEREASIPSEKPEDAERKFMRELGSKM-----

PF05125

D3UZQ7_XENBS/11-324.LQNYSVGLAKAYGVTDT....SRYFALSDPKETALRAALLES.VEFLNMITCADVDHLSGQVVSVGNPGLF--------
A6TE73_KLEP7/8-340KFNAYLSRVAELNGIDPDDV..SKKFSVEPSVTQTMMNTVQMS.SAFLQKINIVPVDELKGEKIGVGVNGTI--------
D5CFH7_ENTCC/11-326.LDNYTAGMAQHFGTQNP....GRYFSLNDPQETALRLAMLES.VEFLNWITTLDVDQLSGQVVNVGASVLH--------
M9X6X0_PASHA/8-336KYNAYLARQAELNNLPFNALATGIKFTVQPSVQQKLYEKVRES.SDFLKSISFVFVDEQTGETLGLDSAHTV--------
Q5E389_VIBF1/11-331...GYKKAVAASNNVSDV....TEKFNVTPNGAQKIIAQIRER.NWLLGKINIVPVSNQKGEAIGLGVTGMI--------
Q2S7I3_HAHCH/8-327LFNDMCAAMAATYGVGSV....AEQFNVEPTIAQELQDKITES.SEFLQLINVVAVDELKGEKVIGSVTGFV--------
Q15Y13_PSEA6/12-335.FAVMLGLMAQTYGVDSV....AETFSATPEVHQMLMDKIVLQ.SSFLQQINVMPVTEIKGQKILGSASGLV--------
H2IY53_RAHAC/8-339LFDKYIQRQAELNHISPAHI..TKAYSIDPSVEQTLEDKVQQS.SEMLKLINIYGVNDQNGEKIGLGVSGPI--------
B8J319_DESDA/15-323......SALAQGYSVPSV....GEHFAIEPSVAQRLNDKIVEQ.STFLPRINIVPVDELVGENLLGYAKEPV--------
W8UNE7_YEREN/11-324.LANYSAGLASEYGVNDP....SRYFALTDPKETAMRSALLER.ADFLSMITCADVDQLQGQVVSVGNPGIF--------
C1DBL5_LARHH/8-337QYTQFVTQLARLNSVPSAE....KSFTVAPSIQQTLESRIQQS.SEFLSRINVIGVPEMAGEKIGLGVTGTI--------
E6WE37_PANSA/8-338KFNAFLIQLAKINDVAVPDI..SAKFTVEPSVAQKLESKIQES.AAFLQMINIIPVDEQSGEVLGLGVGSTI--------
C5BH00_EDWI9/18-332KFSDTFNDCGRSG.........DMQFTLTEPRAIALRKALLES.TEFLRLINLMDVPHPQGQVVTVGESTLR--------
B2FIZ5_STRMK/8-334LFDGFTQQIATLNNVSGVV....NTFAVEPTVQQALEARMQEN.STFLQAINMPGVAELKGEKIGVGINGTI--------
C1DS28_AZOVD/8-332LFDAYLGQIAQLNGVADVS....RKFTATPTVAQRLETRIQES.SEFLGRINMIGVAEQSGEKIGLGVSGPV--------
Q8XY26_RALSO/8-332LFTAYKDAIAKLNGVARVD....EKFSVAPSVQQKLETKVQES.SDFLTRINFYGVPEQEAEKIGLGVSGPV--------
D8MKI1_ERWBE/9-341.WDAYNLRQAQLNGAKPEHVANSKHFSITPSVAQKLEDKIQDS.SELLKKINVVPVSEQEGEKLGLGISGPI--------
F6IH75_9SPHN/8-355LFKSYVSQIALLNGIDVEDA..VTKFSVSPAVEQTLEEKIQES.SDFLSEINIVGVPQQTGQKVGVTVTRPM--------
J7TAL9_MORMO/8-339KFNDYLMRLSALYEVPVEEL..TSKVEITPSVAQTLEDNVQQS.AAFLGFVNIVPVPEKTGQVIGLGVGSSI--------
B2VH98_ERWT9/8-339KLNAYMSVLAEINKINLSAL..NSKFTVESSIAQTLETKIQES.SAFLQAINITPVDEQSGERLGLGIGQTI--------
F4HA06_GALAU/6-327EFYSFLRNVANYYGTDVDALIRGESFALEVPKAAELGENIQQR.SEFLKSINLDYVTDVSGYKLRGATEKSI--------
G0AIP5_COLFT/8-331AFEGYTSQIAQLNATSSVQ....HTFSVVPTVQQKLEDKIQES.SEFLKKINIIGVTEQEGEKLGLGVSGPI--------
D5CB73_ENTCC/8-338AFNAYLQQLARLNGVEIEEL..SSKFTVEPSVQQTLEDQIQQS.AAFLTLINITPVTEQSGQLLGLGVGSTI--------
F0LXI5_VIBFN/8-332KLSAYVQAVAQQNGVENA....TEMFNVSPNGTQRIIAAIRES.NWFLSRINIITVKNQIGEAIGLGVSGMI--------
B0UTP6_HISS2/8-335TLMNYIQGISNDNQEDFSRIARGAKFNVTPSVQQRLENAVQES.SDFLKLINIVPVDEQQGEILGLGVSGTI--------
VPN_BPP2/8-340KFNAYLSRVAELNGIDAGDV..SKKFTVEPSVTQTLMNTMQES.SDFLTRINIVPVSEMKGEKIGIGVTGSI--------
H2IRH6_RAHAC/8-340KFNAYLSRLAELNGVDVEDL..SKKFSVEPSVTQTLITTVQES.SEFLSRINMVPVDEQEGEKIGLGVTGSI--------
B4F0K8_PROMH/8-339KFNAYLTQLGKIYGVSAQAFS.DTKVQIEPSAAQTLETNIQQS.AEFLTHVNIVPVDEQVGEAIGLGIGSTI--------
B0UW33_HISS2/6-327IYNAFIQAIAQHYNVPFAEVRLGEEFSLEAPKAALLGSNIQQS.SDFLKEINMVQVTDLKGLKLWGATEKGI--------
E6VXL3_DESAO/8-324KFSELCAALAEGYGVETAKV..TQGFTVAPTVEQRLQDAITEQ.SEFLPLINVITVSELVGQNVLGSASGPV--------
A6VSU1_MARMS/18-341....HFADTAEAFNVTPRDPSVGQHFSATPSVAQTIYEKIVEHGDDFLKLINVIGVRDIKGEKVGMSLSGRS--------
C5AGA6_BURGB/8-333ALTRYMDNIAKLNGVASVA....EKFAVAPSVQQTLEKRIQES.AAFLQRINVQGVTEQMGEKLGLLIGAPI--------
J7SK37_MORMO/10-341AYLSYLDNQARLNHAVRDGK..SLQFSVDPSVQQKIEKAVMES.SPFLKEINSFGVTEQEGSTILVASSQPI--------
R9VFP8_9ENTR/8-340KFNAYLTRLAELNGVGVEDL..SKKFSVEPSVTQTLFDKIQQS.SSFLQKINMVVVGELTEEKIGIDVNGTI--------
W0L880_SERFO/8-339KFDQYLSRQAELNHIPVSSV..TAKFSVDPSITQTLENRIQES.SEFLTRINISSVSEQEGEKLGLGIDAPI--------
Q1QXQ6_CHRSD/8-331LFNQFADQVAKLNGVPDAT....QKFAVDPTIQQRLEKRIQES.SDFLNRINMIGVDELKGEKLALGVSGPI--------
C5BAR3_EDWI9/8-332KYNAYVETIAGLSGIQSAA....VEFTVEPSVQQTLETKIQAS.VEFLTKINVHEVVDQEGEKIGIGVDRPT--------
F4HB41_GALAU/8-340LFTGYVDRIAQLNNVAAEDV..KEGFSVEPTAEQKLVDKITLS.SDFLQRINVISVTNQIGERIGLSVANAI--------
Q63LE5_BURPS/8-332AYEKYAAQIAKLNDTGDVS....KKFAVEPTVQQRLETKMQES.SEFLKRINVLPVTELEGEKLGLSVSGPI--------
A7MN35_CROS8/15-328....YHKKLTKDTAYREGE...NRRFALAPPAENMLRAAILES.GWMMNNITLRDVNAQSGNAINIGASELH--------
A1VSG1_POLNA/8-331AYNSFLQRQEQLNGVPSAR....ESFTVVPSVQQTLESKMQES.SALLAAINVIGVREMSGEKLGLGITGPI--------
F0LQ00_VIBFN/14-328...AYSSQVIANAGVQEG....SLMFNLTPPMETKLRQAIMQS.DSFLGQITLLPVQQITGQVVDVGQDGLS--------
Q6D3X2_PECAS/8-339LFDQYVARQAQLNGVSSAAI..AAKFAVDPTVQQRLESAAQES.DTFLRKINVFGVTQQIGQKVLIGSKGPM--------
VPN_BPHC1/5-328AYYALAAALAKHFNQPLDSVLRGESFALKAPEAALLGENIQQR.SDFLKQINMIQVAHTKGQKLFGATEKGV--------
D8J087_HERSS/8-337AYNAYTTRLASLNDVAGGAV..HSTFSVEPSVQQTLEDKMQES.SEFLGSINIIGVDELEGEKIGLGVSGPV--------
H2FUC0_OCESG/13-333.LDKYSARLAQAYGIDTSKL..EQQFSVTGPQETRLRAALLES.ADFLRMITLADVDQIKGQVVDVGIGSIH--------
Q8P6J5_XANCP/8-334QFNQFAEQIAKLNGITSAF....HSFAVDPTVQQKLETRMQES.SEFLSKINIIPVDELSGQKVGIGVTGSI--------
E0SAM8_DICD3/25-338YLSAYSAGLAQEYGVADT....ARYFALTDPKETQLRAALLER.VDFLSMINVLDVDQLSGQVVSVGSSALH--------
D3VKM6_XENNA/8-339KFNAYLTRLGEIHGVDAGAF..SGKVEVQPSVAQTLEDEIQRS.AEFLQKVNVVPVSEQSGQAIGLGIGSTV--------

PF11651

B7KXS0_METC4/1-419----------MPNNFLT..-------------ANVIAKAAVKILDNELVAASKVHRGYEDEFSSTVNGYQKGASVTIKRP
A5VES4_SPHWW/1-413----------MANSLLT..-------------IDVIAKEALSVLENELVAAKAVHRGLESEFGNAKNGYSSGATVTIKRP
E8NPD4_SALET/1-428----------MALNEGQ.L-------------VTYALDEIIETVQNLTPMASKVTK.YTPPA....ESMQ.RSSNTVWMP
B2U8F8_RALPJ/1-419----------MANTILT..-------------IDMITREALRLFKNSNAFLKSIDRQYDEDF..AKSGAKIGSALRVRLP
A5VW72_9CAUD/1-416----------MANQLAK.D-------------LEIMFENYVEGFEAACVVSRNAKK.FRPGD....TAMQ.RAGDVLYRP
A4E782_9ACTN/1-291----------MSNTILT..-------------PNIIANEALDVLRTNAVMANLVHRDYSSEF.....VAGVGDTITVRKP
A4JD31_BURVG/1-395----------MANSLLT..-------------INMITNEAVRLFTQTNAFLRTVNRQYDDQF..ARSGAKIGNTLRIRLP
Q2G3Y7_NOVAD/1-418----------MATSFTK.Q-------------EQVMFDNVIEGFDDMLVIGKAAEV.YQPLD....AQEQVNAQDKFWLP
B0U721_XYLFM/1-409----------MGTQALT..-------------HQMIARESAKMLVEQNNVVTNINTTRSKEFGEEINGYKKGDTVKIMVP
E9Z5W1_ESCFE/1-421----------MPNNLDSNV-------------SQIVLKKFLPGFMSDLVLAKTVDRQLLAGE....INSSTGDSVSFKRP
Q5YSR9_NOCFA/1-303----------MANTFLT..-------------PDVIAREVLANLYENLVMVPLVHTGYSTEF....TSAKIGDTVNVRKP
A0A017QUU9_SALET/1-427----------MALNEGQ.I-------------VTLAVDEIIETISAITPMAQKAKK.YTPPA....ASMQ.RSSNTIWMP

PF09950

Q9P9P2_XYLFA/84-327--------------------------------------------AQKSVPVVL--------GTIGY-DYTTEE--LRQSA
E1VAC6_HALED/80-318--------------------------------------------KEETLKLKS--------LGDAY-GYSLDE--MRLAN
A9C0G0_DELAS/60-320--------------------------------------------DMQTKTFQL--------AAIGY-QWNLEE--VNTTM
A6TKD0_ALKMQ/60-304--------------------------------------------ERHTQKVYG--------VVVGF-TIGIQE--KRAAQ
H6NDU4_9BACL/55-298--------------------------------------------RREFQRIYS--------IVAGF-AYTVQE--QRAAQ
Q7N327_PHOLL/62-316--------------------------------------------EWHKAPVGQ--------WGKSA-TWTQQE--LEKIA
Q6FAE7_ACIAD/80-324--------------------------------------------DTVSLPIKV--------GVISY-QYSIME--VAAAQ
R6PG10_9CLOT/91-341--------------------------------------------EPETAHIKS--------IGGSY-GYSVQE--MRASR
G9ARJ4_PANAN/73-313--------------------------------------------DKSGNPLNL--------WGMEL-GWTVIE--LKAAE
B4EG48_BURCJ/103-345--------------------------------------------GKTPNPLTL--------WGMQI-GWTIPE--LESAQ
C5AFU5_BURGB/112-366--------------------------------------------GKTPQPMRL--------WGAEV-KYTVPE--LVKSQ
R6AF56_9FIRM/26-279--------------------------------------------EKNLYKVFT--------WMHMM-RINFVD--MAKAK
K8E4M7_CARML/57-293--------------------------------------------QRFQQPIYT--------IAAGI-RISVQE--LRQAQ
E3HGR1_ACHXA/80-315--------------------------------------------EEKVAQIKN--------IGDSY-GYSVME--LRAAA
C9LU84_SELS3/82-338--------------------------------------------SKDLYKVLP--------YEVSM-SIKIQD--QLRGA
R7JXV9_9CLOT/86-336--------------------------------------------ESHTASIKS--------VGDSY-GYNVQE--MRASR
B8IDG5_METNO/63-315--------------------------------------------RQHETAVAM--------AGIGY-GYDLEE--LGKAQ
R6R1V3_9FIRM/101-351--------------------------------------------TPHRAEIVN--------IGDSY-GYNVQE--LRACR
H8L668_FRAAD/90-334--------------------------------------------GKTMHPLSL--------WAMQI-GWTIPE--LASAQ
R6RQ09_9CLOT/93-346--------------------------------------------SKGTYKAHM--------IAAGT-RVMWVD--MQRGN
Q0BRS5_GRABC/66-316--------------------------------------------DRLRVTVSM--------AAIGY-GYDLAE--LEHAR
Q2NSP7_SODGM/17-247--------------------------------------------NAHATRAHL--------LGASY-CYSVPE--LEKVR
B8IIV0_METNO/63-315--------------------------------------------SQFESSVSM--------AGIGY-GYDLEE--IGKAQ
Q6XQD3_BPT1/82-319--------------------------------------------TSEFGKVFR--------LGNAY-LISIDE--IKAGQ
A9I906_BORPD/80-320--------------------------------------------QEVTARIKD--------IGDSY-GYNVGE--LRAST
Q2G4R3_NOVAD/111-362--------------------------------------------NQATRNFHL--------AAIGY-EWNTQE--MQRAA
W8UFX7_YEREN/64-311--------------------------------------------NQGFHEIKT--------AALGY-TYSIEE--IGFAM
A7ILG8_XANP2/103-352--------------------------------------------GKVVSPLHL--------WSMDV-AYTLPE--LESAR
Q32EP9_SHIDS/73-313--------------------------------------------GKSGNPLNL--------WGMEL-GWTVIE--LQAAQ
G2IHV9_9SPHN/64-315--------------------------------------------SQGVTNFFL--------AGCGY-ELSLQE--VNRAS
Q835B4_ENTFA/57-293--------------------------------------------KRYQSPIFT--------IAAGI-RYSRQE--IRQAQ
D0UIJ0_AGGAD/58-304--------------------------------------------TPTRSYIVP--------WAKSV-TWTKPE--LEQGK
Q984H1_RHILO/86-339--------------------------------------------EKFETTVSM--------AAIGY-GYNLEE--LGTAQ
Q2NRY5_SODGM/73-317--------------------------------------------NKTTLPLTP--------WSRQL-SWTVFE--LASAM

PF04454

D4H156_DENA2/1-251--DNKSPK......--------------------.....DVVYGVNTVLPLVE--------ARINF-SLDIWE--LDNID
C8WPL7_EGGLE/1-257--EVLEDG......--------------------.....IGRIVGRTQLELPL--------FYEDF-TLLSRD--MEYAA
D0LZ74_HALO1/1-251--DDTPED......--------------------......VDMKLRQVQPLAE--------VRVPF-TLDVTE--LDSVA
D1B7I4_THEAS/1-249--EGQQKG......--------------------.....AVRFGVRQFQPMIE--------TRVSF-EISIWD--LDDIS
A1B987_PARDP/1-251--TALAEG......--------------------......VESHRREVNPLLE--------LRVPF-TLTRAA--IDDVA
A3DFK3_CLOTH/1-257--DETEEN......--------------------.....ISVIRGRTYRHIPL--------INEDF-SLLWRD--LEFSE
A6TWC5_ALKMQ/1-250--EDNPGN......--------------------......VCTGMYQVKPLVE--------ARISF-KLDRWE--MDNLI
A7HIB4_ANADF/2-255--EEPEG.......--------------------......AHVHVPRVRPLPV--------IHRTF-ALGARA--LEADA
A7I7A2_METB6/2-249--D...........--------------------.......GISASVSLPLSL--------IRTEF-SLGKRD--LAAYE
A8F8I8_THELT/3-247--P...........--------------------.......GVFSNKTLPLFY--------IHKTF-NISKRD--IASYE
A8L1F1_FRASN/1-253--QAPPGE......--------------------.....GVRARLRRVLPVME--------LRAAF-SIDRGE--LDAID
A9BEM3_PETMO/1-251--ENPRDG......--------------------......LGWGIRQVLPIVE--------IRNPF-VLKQWE--LDNIE
A9FWS5_SORC5/3-254--ERKEGP......--------------------.....AVSAGVRLVRPLVE--------FRAPI-RLELAE--LDAVG
A9H5P1_GLUDA/1-251--DAPGSD......--------------------......IRAVRRNVLPLVE--------LRVPF-TLARDA--IDDVE
B1VSP7_STRGG/1-251--DPPTPD......--------------------......VAARARTSTPVIE--------WRVPF-TVTRQA--VDDVE
B2A6K6_NATTJ/8-259--FHGHQQG.....--------------------.....EVKAGLHQVKPLME--------TRITF-KLDRWE--LDNIE
B2GID2_KOCRD/1-252--AADTPG......--------------------......VEALQRHVVRVVE--------LRAPF-TLKRSD--IDDVE
B2JNZ6_BURP8/1-251--AAPHHG......--------------------......VIAKLSEVKALVQ--------LTVPF-ELSRDA--IDAVE
B2V6Y3_SULSY/1-265--NSGACGLFGE..--------------------.VDCGVVKVKERKILPLPI--------IYKDF-KIHWRD--VESSK
B4UA40_HYDS0/1-265--DNGACGLFGD..--------------------.KECGIAKIKSRKFLPIPQ--------IYKDF-KIHWRD--IETSR
B8CYH7_HALOH/1-249--EDKAEG......--------------------......ASIFQRQVLPLVE--------VEIPF-RLHLEE--LEAFV
B8EQK3_METSB/1-251--AAPAEG......--------------------......VLARQREVKPLVE--------LRVPF-ELSRAA--IDDVE
B8GHL2_METPE/5-250--G...........--------------------.......NLIRSGFAPVDL--------IQTSF-SLSKRD--LAAYE
B9JHD1_AGRRK/1-251--PGPGDG......--------------------......VQTALREVKTLVE--------LRVPF-KLTRQA--IDDVE
C0R0J8_BRAHW/1-256--EVFEDG......--------------------.....FVKTSGRKSVELPQ--------IYQDF-TLLWRD--LENNI
C0ZHN4_BREBN/1-265--RFGGLSLRGE..--------------------..SLEMTQPSRRVSMTIPI--------LYKDF-MLYWRD--VAQAR
C0ZVK4_RHOE4/1-251--NPLADG......--------------------......VIAHARQSQPVIE--------LRVPF-TVSRQA--IDDVE
D5UVK7_TSUPD/1-251--GGPAEG......--------------------......VQAHLRDSRPLVR--------LRVPF-TLSRKA--IDSVE
C4XPM7_DESMR/1-251--KTQSVS......--------------------.....GITYGLHQVKPLVE--------VKVPF-TLDIAE--IDNAA
C5B5H8_METEA/1-251--EAPGEG......--------------------......IRSLLREAQPLVE--------LRVPF-TLTRQA--IDDVE
O67639_AQUAE/1-267--EPGVCEVKPGQE--------------------YKVCEPVRTGERKHVPVPT--------LYKDF-VISWRD--LEHWR
Q08WR7_STIAD/2-266--SSGAIDIVGE..--------------------.QETATVFTDVRKFKTIPI--------IYKDF-LLHWRD--IEAAR
Q0RH88_FRAAA/1-253--SAPPAA......--------------------.....GVQARVRQVQPVIE--------LRVGF-TLDRAE--LADAD
Q2RVS0_RHORT/1-258--AEEPKAAGS...--------------------...AAVVTVRKRAVQPLIE--------LCVPF-TLKRAE--LEAIA
Q5YPL3_NOCFA/1-252--AAPDEG......--------------------......VQARQRVVAPLVE--------LRVPF-TLSREE--LDNVE
Q7MSM9_WOLSU/1-252--KEKLGE......--------------------......ASVGVRMNTPVIE--------LKIPF-SFPESE--VEAIL
Q97V86_SULSO/96-329--SGDI........--------------------......IQSKSASLYEVPL--------INSQV-KFYLGQ--KSDSR
B2HH42_MYCMM/1-251--KAPTDG......--------------------......VIAHLRASKPLVR--------LRVPF-TLSRNE--IDDVE
Q0SE23_RHOSR/5-254--KTSDSR......--------------------......IRAQQRQVNPLVE--------LRFPF-TLSRAE--VDDVA
Q2IH48_ANADE/1-259--GEDEPEAG....--------------------....DETHVHVPSVRALPV--------LHRTF-RLGARA--VEALE
Q5L1H9_GEOKA/8-264--EQGDMSFHGK..--------------------..ELSLSEPARRVHLTIPL--------LYKDF-ILYWRD--IEQAK
MARIT_THEMA/1-251--SDENEV......--------------------......VKWGLRKSLPLIE--------LRATF-TLDLWE--LDNLE

PF05065

E0THR4_PARBH/115-394..GAGWVG.....E............T..AA...RPETTTP.TLVAIDFPAME--------LYAMP.AATQAL..LDDTV
Q1GG15_RUEST/131-399..NAAPVAE...GA.....................AKPSSDIKLDVKTTTAKV--------IAHWM.KASRQA..LDDVS
Q1DCZ9_MYXXD/94-361..VFKWVG.....E............G..ET...VPKSAP..KYGKIVLKAHK--------GMVLT.DISNDL..LRTPG
Q0AAI8_ALKEH/83-374..DSAWVA.....E............K..GD...RDPTAAS.FMSRHKIAVHE--------HYSYP.SVTQQF..LEDSR
Q3J4R6_RHOS4/160-429..AAGVVAE...GA.....................LKPESGLEYEAADAPVRT--------IAHWI.PVSRQA..LEDAD
A1T829_MYCVP/9-278..SSSFVA.....E...............GQ....ELALNDAVIEELTIVPAK--------IGHVA.PLSREL..VRDSF
Q982R8_RHILO/176-465..GSGWVG.....E............E..EA...RPQTGTP.TLRELIFTVME--------LYANP.ATTRTM..LDDGI
A1AYY2_PARDP/166-435..NARPVTE...GA.....................QKPESDYVWAQESALVRT--------IAHFV.HVSRQA..MEDAQ
Q1ILS6_KORVE/495-776..TLYWTG.....E............NPGSA...VTATDQ..TTGSVTLSPKQ--------AMAQT.AYSRQF..IIQSS
Q1GH34_RUEST/388-661..TGYWIG.....E............D..IE...ATEDLL..SLGQRQFSPKT--------VAAYS.EITRRT..LKQSS
Q2GAM7_NOVAD/185-459..NAATVTET.AGT.....................AKPQSEIKFDIVTSSVTT--------IAHWV.LATKQI..LDDVP
Q8XYS4_RALSO/130-408..EGELLG.....E............G..EA...TGEDDI..DFGIGTLGAHK--------LSSKVVRVSEEL..LSDSS
Q3J3K4_RHOS4/110-395..GSGWAT.....E............A..AT...ISESASP.TIERISIKLHE--------LSAMP.KASQRL..LDDSA
Q1QLS4_NITHX/103-379..TGSWVG.....E............T..DA...RPGTES..SYGQIEVPIHE--------MACYV.DVSQRL..LEDAA
Q8ED08_SHEON/122-393..NAAPVAE...GA.....................AKPYSEITFGLVSAGVRT--------IAHLF.KASRQI..LDDSK
Q813J9_BACCR/150-424..EAQGHK.....N............E..RTNNEMPETDI..EFDEIELSPTE--------FDALA.TVTKKL..LARTG
Q3J5Z4_RHOS4/150-439..VAAYAA.....E............N..AA...IAPSQP..SFDKIDQSFKK--------LVGMV.PIGNSL..LRHSG
A1B638_PARDP/102-387..AHGWAS.....E............A..AA...QAETGTP.SVQRVVIPVHE--------LSAMP.KASQRL..LDDAA
Q0AWY3_SYNWW/43-310..VAAWVE.....E............G..GT...IPIADGMGDFNDIALKIHK--------LVVFL.KLEEAF..VKDAT
A4YU30_BRASO/140-423GVQAAWRS.....E...............GT....QMIASKAALTPEILQLHE--------LYAFV.LATNEV..LDDAP
Q2NV28_SODGM/127-397..NAKTVAE...NT.....................AKPYSTIEFEEATVPVRT--------IAHMF.KASKQI..LDDFS
Q1GHS2_RUEST/113-395..GAGWAT.....E............T..GS...VTETGTP.SIDRIVIPLHE--------LSALP.KASQRL..LDDSA
Q2L2B0_BORA1/123-401..EGELIG.....E............N..TD...AGEKDV..EFGHDALGAHK--------LTSKVIRISNEL..LADTG
A2SD63_METPP/97-385..GVTWVG.....E............L..DS...RSETTAP.ALGKFIVPLHE--------VYAMP.AVSQKL..IDTAS
A1TML8_ACIAC/138-428..TVSYVG.....T............E..QD...IPVTDM..TFGDMKLSAKK--------AAAIV.PIANDL..LAYAG
Q1QKG8_NITHX/112-388..NAKWKG.....E............T..QS...QEGSEP..AFGQTEITVRE--------VNTYV.DISNQL..LADSA
Q0S2A4_RHOSR/9-273..STGWFA.....E...............NT....EITLVDPETDELVIVPTK--------VAGRT.QISNEA..ADDTD
Q6LSF8_PHOPR/134-417..EGEIVG.....Q............N..ES...AGTKDT..TFGNKTIGSYM--------YSSKSIAIPWEL..LQDSF
A5N1H4_CLOK5/152-424..EGIWTE.....M...............TD....AVQELSAGFSQTELDGFK--------VGGFI.PVANAI..LEDSM
A7HRJ6_PARL1/148-433..QTGWVG.....E............T..EA...RPQTATP.SLAEIEFPAME--------LYAMP.AATPTL..LDDAA
Q2YMS9_BRUA2/137-422..ATGWVG.....E............T..DA...RPQTASS.KLAELQFPTME--------IYAMP.AATSSL..LDDSA
Q73HT5_WOLPM/107-395..GAGWSS.....ETVDDEDGGNKSKY..DF...AKDTDTP.KIQKISVTTYE--------LYAQP.QISQKL..LDDAF
Q9A4P7_CAUCR/53-338..AAAWVA.....E............T..AA...RPETTAP.TLDVIDFPAGE--------LYASP.AATQAL..LDDAY
Q3Z7J9_DEHM1/124-397..TAAWMD.....E............N..GL...YPESDD..TFDQISLSAYK--------LGTAI.KVSEEL..MNDSV
Q830G6_ENTFA/163-444..EANVNK.....K............E..RTT.DITETAI..QFDEILLDPAE--------FDALA.TVTKKL..LKMSG
A7MP72_CROS8/125-401..MGVMLG.....E............N..EE...ASEGDV..TFEPITIGAKK--------MTSKIIRVSNEL..LLDSG
A7ILP2_XANP2/167-448..SAGWVG.....E............T..EG...RPETGTP.AIGVQTIPVFE--------IYAKP.RATQSM..LEDAS
B0T632_CAUSK/96-391..TRSERG.....A.....................FTDNTVEGFAGITLGSKD--------VYDRQAHTVESV..EGDSV
Q11H37_CHESB/111-386..TAAWVA.....E............T..GD...RASTQP..AYGEVELTPFE--------AACYV.DISNQL..LEDSA
Q88G49_PSEPK/193-483..VVGYIG.....T............E..ED...MPATDM..QFDDLKLSSKK--------LAALV.PISNDL..LGYSG
Q72BY4_DESVH/118-395..EGEIVD.....Q............N..AA...ASDADA..SFGTVGLPVYK--------FSSKTIAVPIEL..LQDSG
B2JU92_BURP8/137-421GIRAYWQA.....E...............AS....VATATKPKLGVSTNRLHK--------LMALV.PVTDEL..LDDAS
Q81Z09_BACAN/121-392..VATWVA.....E...............SS....GSDKQKKTTGSITFNYHK--------LRCAV.AVSLEVETMSLAV
Q3SS55_NITWN/107-382..NAQWRG.....E............T..QA...QTTGEP..TFGQLEIPVRE--------INTYV.DISNQL..LADSA
Q2GDU5_NEOSM/81-367..EAQWVS.....E...............DE...ITNSDAKEHIITTEINTYE--------LYTQP.KTTQKV..LDDPS
Q3SSD8_NITWN/135-418..VGGWVG.....E............R..QA...RPATATP.TLVELAFQAME--------LYANP.AATQTL..LDDSR
A6VNQ3_ACTSZ/129-407..EGELIG.....E............N..TA...ATESDT..AFGVGSLGAKK--------LSSKIIRVSNEL..LQDSA
A5N291_CLOK5/33-297..TADWVE.....D............G..DP...IPESADT..FTQFLVKSYK--------LASLV.KLNRSF..VTDMN
Q5WID4_BACSK/129-404..QKLYNTA..EKE...............QI....KELKNM.EFDQITWNIKK--------FAGFL.PISSEL..LDDSF
A4XZF1_PSEMY/131-410..EGEIVG.....E............N..AE...VDSQDA..TFGTLAHVVYK--------FSSKDIAVPFEL..LQDSA
Q2N5Z6_ERYLH/94-380..ASGWVS.....E............T..AG...RPETDTP.SFEEIAPPTGE--------LYANP.AASQAM..LDDAG
Q2GJL3_ANAPZ/114-389..FVGWSG.....D...........HN..TI...VSKSLTP.KLSHINIRLFE--------LYAQP.QLAKNL..LEDTC
A9BYD9_DELAS/120-394..NAGPVGEN.PSG.....................GKPESNITFEAAQVPVVT--------IAHWV.PASKQV..LSDVP
Q5Z3V6_NOCFA/148-434..AAAVVPEATSAAAPTAPGTAGALVLNPNG...GYKPEGSWAFVRKTAVVKT--------IAEWV.PATKRA..LADVA
A5CD71_ORITB/88-365..ITGWVA.....E............Q..DE...RAETKSP.TLLRRKIAVHE--------LYAQP.KATQKL..LDDSN
A8FGQ6_BACP2/20-302..LRPAEEGQALDA......................KDRVVPATSTVHLNAKE--------VIAEI.HMTYDS..IENNI
A1TD88_MYCVP/110-388..SGSWDGE..AVE.....................VSDDSP.ELQQPEIPVHK--------LQIWV.EFSHEL..QHDAA
A9CJN8_AGRT5/134-419..TTGWVS.....E............T..AA...RPQTATP.QLAELSFPTME--------LYAMP.AATQGL..LDDAA
A3DG61_CLOTH/127-416GVQAYWVA.....E...............AE....TAAQSKPKFREIEMSLQK--------LLALC.YVTDDL..LQDTT
Q2SDM1_HAHCH/110-393..GSGWVG.....E............T..DA...RPETNTP.KLAQIEAFMGE--------IYANP.ATTQKA..LDDVY
B2JL19_BURP8/113-379..NADYQTE...GQ.....................LKAQSDLSFEMAQAPIVT--------LAHWL.LASRQV..LDDVA
B7GIM9_ANOFW/146-418..PAVWIE.....Q............A..GA...LPTGDVG.TIASVDFDGFK--------VGKVT.FVDNYL..LQDSI
B9KI56_ANAMF/104-375..FVGWGG.....E...............VQ....SDTAAP.KMSKTTIYLHE--------LYAQP.QIAKKL..LDDSL
C5AYR6_METEA/135-420..AAGWVA.....E............T..AP...RPQTDAP.NLSELSFPAME--------LYAMP.AATQTL..LDDAV
P71947_MYCTU/196-475..EAHWYS.....E............A..QE....VSDDSP.TLAQPAVPSYR--------GSCWI.PFSLEI..EGDAA
Q2FX56_STAA8/38-311..GAYWVG.....E............G..QK....IETSKA.TWVNATMRAFK--------LGVIL.PVTKEF..LNYTY
Q2G1W8_STAA8/130-399..ALEKVE.....E............L..EE...NPELAVK.PFFQLAYDINT--------HRGYF.RISREA..IEDAK
Q3J3W7_RHOS4/239-509..SATWVS.....E............V..GD...RTGSEP..SFDQVTLTPHE--------LATFT.DISNAL..LEDNA
Q81X82_BACAN/69-344..DATFIG.....E............M..ED.....ASMSDFTFDKVTLEQRR--------AATAI.ELSQQL..VNDSG
Q81XY0_BACAN/102-381..EGDYTT.....E............G..ND...YNTSET..TFGYADITKAK--------VTAYS.EDTEEL..QKLPA
Q88MK4_PSEPK/141-410..MAAPQA....GE...............GA....AKAQSDLSFGLKTTNVIT--------IAHWF.RASKQV..LSDIP
Q9CFS0_LACLA/124-389..LTVMDA.....E............D..GK...IPDLDNP.QLTIIKYLIKR--------YAGII.TATNTL..LKDTA
Q9P9R2_XYLFA/357-623..QAYWVG.....E............G..DS....PEKSKP.ALDQIHFTPKS--------LAAYT.DITRRL..LLQST
Q9ZWV6_BPPHC/121-387..TAGIVG.....E............T..AE...IPESYP..ATTQRSMGGFK--------YGFAS.VVSYEF..ATDQV
W6SDV8_9CLOT/124-396..TAAWLD.....E............G..EE...FDESDS..VFGQTSIGAYK--------LGTMI.KVSDEL..LNDSV

PF06673

Q9MCB6_9VIRU/1-347--TEMPEQ------------------GFLREFANASALNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTF
Q9MCB8_9VIRU/1-347--AEMPEQ------------------GFLREFANGADLNVVNSLGSITSKYARKSGIYDGAMKARFQGLTLAEDGVDDTF

PF05125

D3UZQ7_XENBS/11-324--TGRKKD.....G--------------------RFMRATGI..DGNEYKLVE--------TDSGA-ALKWDL--LSIWA
A6TE73_KLEP7/8-340--ASTTDTN.SGKE--------------------RKTADFTAL.ESKKYECDQ--------VNFDF-HFKYKK--LDLWA
D5CFH7_ENTCC/11-326--TGRSET.....G--------------------RFVRQVGV..DGNTYSLVE--------TDSCA-ALRWDL--LSVWA
M9X6X0_PASHA/8-336--ASTTDTS.GDGE--------------------RKTTSIAKL.VKQTYHCQQ--------INFDT-HINYKQ--LDMWA
Q5E389_VIBF1/11-331--ASRTNTK.AGKE--------------------RQTKAVYNM.KPMPYLCEK--------VDFDS-HIRYEQ--LDAFA
Q2S7I3_HAHCH/8-327--PKRTDTD..SAD--------------------RQTSDVLAL.GSKGYELHP--------VEYDT-HIKYKT--IDSWA
Q15Y13_PSEA6/12-335--TTRTNTT.GAGE--------------------RKGRHLLDL.DAQGYELHQ--------TDMDT-ALLYSM--IDSWA
H2IY53_RAHAC/8-339--SSTNNST..TDR--------------------RQPTNLAAL.DSNKYTCNK--------VNADT-FTPYTQ--LDAWA
B8J319_DESDA/15-323--TSRTDTS.GSGE--------------------RKPKDVLGL.GKYDYQLHK--------TDSDV-AIRYNT--IDVWA
W8UNE7_YEREN/11-324--TGRKEG.....G--------------------RFIRETNV..DGNEYKLVK--------TDSGA-ALTWDL--LSIWA
C1DBL5_LARHH/8-337--AGRTRTG.PGKP--------------------RVARSVADL.DSHKYQCAK--------TNFDT-AIPYQQ--LDVWA
E6WE37_PANSA/8-338--AGTTDTS..SQE--------------------RQPTDPTYI.DGTGYKCTQ--------TNFDT-ALPYAK--LDLWA
C5BH00_EDWI9/18-332--TGRVKD.....G--------------------RFTKGSGI..SGNEFRLVE--------TDSCC-VITWAQ--LAIWA
B2FIZ5_STRMK/8-334--AGRTDTS.GNGE--------------------RNPSDPTAL.DAQGYECQK--------TDFDT-ALPYAR--LDAWA
C1DS28_AZOVD/8-332--ASTTNTA..TTD--------------------RATTDLSTL.DDRGYTCSQ--------TNFDT-HLTYAR--LDAWA
Q8XY26_RALSO/8-332--ASNTDTT..QQD--------------------RQTSDIATL.DGRRYRCEQ--------TNSDT-HITYQR--LDAWA
D8MKI1_ERWBE/9-341--ASSNTSS..TER--------------------RTPRSVHTL.DDDKYRCEQ--------TNYDT-FISYPQ--LDMWA
F6IH75_9SPHN/8-355--ASRTDTA.GGNR--------------------RTPTDPTDTGDNGSYFCRQ--------TNYDH-AIKYAK--LDAWR
J7TAL9_MORMO/8-339--AGTTDTT..KTD--------------------REATDPSEM.TDIKYECQQ--------TNYDT-ALTYQK--LDLWA
B2VH98_ERWT9/8-339--AGTTDTT..QKE--------------------REPTDPTYI.DGDGYKCTQ--------TNFDT-ALPYSK--LDMWA
F4HA06_GALAU/6-327--TGRKKD.....G--------------------RYLARLDH..TQGKYQLTE--------TDSGI-IVPWAM--FDNFA
G0AIP5_COLFT/8-331--ASRTDTS..KAE--------------------RQTRDVSTM.DGHRYRCEK--------TNFDT-HIGYAK--LDAWA
D5CB73_ENTCC/8-338--AGTTDTT..TKE--------------------REPTDPTLM.EDVEYKCEQ--------TNFDT-VLTYAK--LDLWA
F0LXI5_VIBFN/8-332--ASRTDTS.GDGE--------------------RKPKDYHGM.KAMPYACVQ--------TNFDT-AIRYAK--LDAWA
B0UTP6_HISS2/8-335--AGTTDTN..ATG--------------------RKTQAIHAL.NKIPYHCQQ--------INYDT-HLKYAI--LDMWA
VPN_BPP2/8-340--ASTTDTA.GGTE--------------------RQPKDFSKL.ASNKYECDQ--------INFDF-YIRYKT--LDLWA
H2IRH6_RAHAC/8-340--ASTTDTD.GGSE--------------------RKTADFQAL.ASRKYKCEQ--------VNFDF-HIRYNT--LDLWA
B4F0K8_PROMH/8-339--AGTTDTT..AKE--------------------RETSDPIKL.TKNSYHCQK--------TNYDT-HLDYAK--IDMWA
B0UW33_HISS2/6-327--TGRKPT.....E--------------------RHIATLNH..TQTGYELAR--------TDSGI-LVPWDM--FDQFA
E6VXL3_DESAO/8-324--SGRTDTKVDGNE--------------------RTPRDVLGL.GSFPYQLYQ--------TNSDV-YIRYDT--LDAWA
A6VSU1_MARMS/18-341--AGRTNTD.GGIE--------------------RKPKHLVKT.DSKGYELHH--------TEFDV-ALKYSK--IDAWS
C5AGA6_BURGB/8-333--ASTTDTT..KAD--------------------RTTVDLTDM.DPNAYVCAQ--------TNYDT-HLKYSK--LDAWA
J7SK37_MORMO/10-341--ASRNTST..TDR--------------------REPAQAFGM.EENTFKCAQ--------TNFDT-MIPYTQ--LDAWA
R9VFP8_9ENTR/8-340--ASTADTS.NGVE--------------------RKTADFSKM.DAYRYFCQP--------VNFDF-HMKYNK--LDLWA
W0L880_SERFO/8-339--ASTTDTT..VER--------------------RQPASVDNL.DSGKYRCEQ--------TNSDT-FIRYAR--LDAFA
Q1QXQ6_CHRSD/8-331--AGRTNVS..NQD--------------------RQTRDLSTL.DPQGYECRM--------TEFDT-HLGYNK--IDAWA
C5BAR3_EDWI9/8-332--ASRTDTS..QRE--------------------REPVDPIRL.TANRYRCEK--------TNYDT-ALPYAR--LDAWA
F4HB41_GALAU/8-340--ASTTDTD..GKE--------------------RETKSISQL.DSRKYHCES--------VNFDT-HISYQL--LDQWA
Q63LE5_BURPS/8-332--ASRTDTT..KAA--------------------RQPIDPTAL.DSNRYRCEK--------TDYDT-AIPYRK--LDMWA
A7MN35_CROS8/15-328--TGRTAG.....G--------------------RFRKKVTI..NGSEFWLSE--------TDTCA-SISYGE--MADIY
A1VSG1_POLNA/8-331--ASRTNTA..TTD--------------------RSPRSVETL.DNTTYACKQ--------TNYDT-AIKYAV--LDAWA
F0LQ00_VIBFN/14-328--TGRAA......E--------------------RFSVEVGQ..EGNTYTLVK--------TDSGS-HIKWET--MTQWA
Q6D3X2_PECAS/8-339--AGVNNGT..TVR--------------------RNPGMNHTM.EPFNYTCRK--------VNYDY-GISYEQ--LDAWA
VPN_BPHC1/5-328--TGRKQT.....G--------------------RNLANLDH..TQNGFELAE--------TDSGI-IVPWAL--FDSFA
D8J087_HERSS/8-337--ASRTDTS.GDKR--------------------RSTRDASAM.SNRRYRCEK--------TNFDT-HITYAK--LDAWA
H2FUC0_OCESG/13-333--SGRKAS.....G--------------------RFIKAVGV..GGHNYELTE--------TDSGA-LLSWAT--LAVWA
Q8P6J5_XANCP/8-334--ASRTDTG.AGKT--------------------RTPRNVAAL.DKNEYVAKK--------TDFDT-AIPYAL--LDAWA
E0SAM8_DICD3/25-338--TGRKEG.....G--------------------RFIRQVGV..EGNDYKLVE--------TDSCA-ALPWDL--LSVWA
D3VKM6_XENNA/8-339--AGTTDTD..SQD--------------------RITTDPTRL.TAVEYKCEQ--------TNFDT-SLSYAK--LDLWA

PF11651

B7KXS0_METC4/1-419PQFQVRDGATA...--------------------...QPQDITEGTTSVTVDK--------MKGIDLRISSTDRTLSIGE
A5VES4_SPHWW/1-413TDFTVRSGANA...--------------------...SVQDVIEGSTTITVDQ--------QKGVDFAFTSAELTLSIKD
E8NPD4_SALET/1-428VEQEAPTQTGWDLT--------------------G..NATGILELSVKCNMGD--------PDNDFFELRADD..LRDER
B2U8F8_RALPJ/1-419NDFTVRRGAAA...--------------------...SVQGTNEQKTSLVMAN--------QIGVDIQFSSAERALSLDD
A5VW72_9CAUD/1-416QHYHMNIEEGLDLS--------------------SK.TPTALVQRLVPSVFKE--------PKNILYTLDARE..MRDPE
A4E782_9ACTN/1-291ATFEAKEFTTEV..--------------------...EVQDATEGKVPVKMDK--------LLDVTFAVTSKELTMGIVD
A4JD31_BURVG/1-395NDYVVNDGPAI...--------------------...TPQGTNEQNTTLTVAK--------QKNVPVSFGTAEKTMSLDD
Q2G3Y7_NOVAD/1-418APMIGASYDGFDQS--------------------A..NFDGLTQLNVPASVGY--------HKSVPKTLSSKN..LRNAF
B0U721_XYLFM/1-409PMPVSFSGANFAGD--------------------RFANAPSVSETYVNLVVDQ--------QYHVPLTFTAKEKKLDLTD
E9Z5W1_ESCFE/1-421HQFSSLRTPTGDIS--------------------GQ.NKNNLISGKATGRVGN--------YITVAVEYQQLEEAIKLNQ
Q5YSR9_NOCFA/1-303PVLTAQLFDRATGI--------------------...QIQDATESSVPVKLDK--------IADVSLEITTEQALLELES
A0A017QUU9_SALET/1-427VEQESPTQEGWDLT--------------------D..KATGLLELNVAVNMGE--------PDNDFFQLRADD..LRDET

PF09950

Q9P9P2_XYLFA/84-327F---L.R.....KP-LN-TA---RADAAMDAYERHINDVALF.....G-----ED...ELTG.LYTH.------------
E1VAC6_HALED/80-318A---M.G.....TN-LP-ER---KGRTARRAIDQLINKVAMV.....G-----DA.KHGFYG.FTNH.------------
A9C0G0_DELAS/60-320A---FPG.....AS-LS-DR---RARAARLAYMKFMFDLTLK.....G-----SP.EKGMGG.LINY.------------
A6TKD0_ALKMQ/60-304M---A.N.....RT-ID-IT---KAIAARRAVAEKENRFFYV.....G-----SE.AHQAEG.LLNF.------------
H6NDU4_9BACL/55-298M---T.G.....QT-ID-ST---KAGVARRAVAEKENRLAWI.....G-----DP.DFNIPG.LINA.------------
Q7N327_PHOLL/62-316R---L.N.....IN-LQ-TK---KQDDLYANATATIQYAGYV.....G-----HEGVKGQEG.LLTG.------------
Q6FAE7_ACIAD/80-324Q---M.G.....IQ-LE-GD---KVQAARLAAEKHLSQIAWY.....G-----NS.LTGVKG.FLNQ.------------
R6PG10_9CLOT/91-341K---S.G.....KG-LD-HR---KAEAARYAVDVALNKIAWA.....G-----DP.ENRLMGVLTTS.------------
G9ARJ4_PANAN/73-313Q---V.G.....RP-ID-TQ---KYEGMQLKWQMDNDEQVYI.....G-----DS.ALNLKG.LLNL.------------
B4EG48_BURCJ/103-345K---L.G.....RP-VD-QQ---KFEGMQLKHNMDVDEQVYI.....G-----DP.VLGVTG.LVNA.------------
C5AFU5_BURGB/112-366K---L.G.....MP-ID-AQ---KVDAMNLKRNMDIDQIVYF.....G-----DP.QIGFTG.LVNSN------------
R6AF56_9FIRM/26-279Q---I.G.....RS-LE-DM---LNKGIRLNYNKSLDMNVYK.....G-----FE.KLGTTG.LVND.------------
K8E4M7_CARML/57-293L---V.G.....QS-VD-AT---KTETARRAIAEKENSIIFT.....G-----DP.KVNVKG.IANA.------------
E3HGR1_ACHXA/80-315A---N.R.....TD-LP-TR---KSMAARKAVEIKLNQMALI.....G-----DT.KFGLYG.LVNH.------------
C9LU84_SELS3/82-338V---T.G.....RS-IE-DI---YNDGIRLDYDKYMDINTYL.....G-----QE.AYGTTG.LLND.------------
R7JXV9_9CLOT/86-336M---A.G.....KS-LD-AR---KGAAARRASDYMVNKIAFA.....G-----DK.KHNLVGIFSDG.------------
B8IDG5_METNO/63-315L---M.G.....MN-LG-TD---KAEAARLASEEFIDQVALF.....G-----DP.AKGFSG.LLNH.------------
R6R1V3_9FIRM/101-351R---N.AVLGIMKS-LD-AV---RAEAARRVYDVKVNHLIWS.....G-----DE.KAKIVGILSSD.------------
H8L668_FRAAD/90-334Q---L.G.....RP-VD-QQ---KFAGMNLKHQMDIDEQVYI.....G-----DT.VLGLEG.LVNS.------------
R6RQ09_9CLOT/93-346M---T.G.....RN-LD-SL---LRDGLRMAYDKHLEENTYV.....G-----FK.RYGTTG.LLNN.------------
Q0BRS5_GRABC/66-316Q---Y.G.....ID-LG-PE---KAEAARRAYEEFVDDIVLR.....G-----DA.ARGFSG.LLSH.------------
Q2NSP7_SODGM/17-247A---N.G.....LE-LP-TD---KAIYVRQEMDRKIATIGVY.....G-----DA.DYAMQG.LLTY.------------
B8IIV0_METNO/63-315L---M.G.....LN-LS-AD---KADAARRASEEFIDQVALF.....G-----DP.AKGYSG.LINN.------------
Q6XQD3_BPT1/82-319A---T.G.....RP-LS-TR---KASACQLAHDQLVNRLVFK.....G-----SA.PHKIVS.VFNH.------------
A9I906_BORPD/80-320A---M.R.....TS-LP-QR---RAAAARRAIEVKQNQIAMV.....G-----DA.QHKLYG.LTNH.------------
Q2G4R3_NOVAD/111-362K---L.G.....RS-LS-SD---KAQGAVLAADRFIYGIAMTGKTPRG-----ES.EKGWTG.FINN.------------
W8UFX7_YEREN/64-311L---N.N.....VN-LD-AE---RGQAVRDVVEQGLNKIYLL.....G-----HS.DIG.EG.LYTS.------------
A7ILG8_XANP2/103-352L---T.G.....RP-ID-TQ---MLSALNRKNQMDTDQVVYI.....G-----DS.SIGTTG.LLNS.------------
Q32EP9_SHIDS/73-313Q---V.G.....RP-ID-TQ---KYDGMQLKWQMDNDEQVYV.....G-----DS.ALNLKG.LVTL.------------
G2IHV9_9SPHN/64-315K---M.G.....VD-LA-SR---DASDARKIAEKFIFDRGMT.....G-----ST.EKGFTG.LINN.------------
Q835B4_ENTFA/57-293M---M.G.....TS-ID-AT---KAEVARRTIAEKENSFIFV.....G-----DP.KVNHKG.VANA.------------
D0UIJ0_AGGAD/58-304L---L.G.....LA-LN-TA---KIMALNKNAQQTLQKVAFL.....G-----HAKDSRLTG.LLNN.------------
Q984H1_RHILO/86-339L---L.G.....MN-LN-PD---KATTARRAAEERIDSTAFI.....G-----DA.AKGFSG.LVNS.------------
Q2NRY5_SODGM/73-317Q---L.G.....RP-VD-SQ---KLDAMNQVYQLNVDRQVYV.....G-----SK.LLSVQG.LLNQ.------------

PF04454

D4H156_DENA2/1-251R---G-A-----KD-IA-LD---DLAEAARKMADFEENAVYN-----G-----FK-DSGIVG-LNQV-------------
C8WPL7_EGGLE/1-257Q---T-G-----YP-LD-LS---VAIAAAKKASRREDDLILN-----G-----SK-ALGTDG-LLTV-------------
D0LZ74_HALO1/1-251R---G-A-----TN-PD-LD---DVARAAERMVEAEDSAIFH-----G-----WA-QAGIKG-IVDS-------------
D1B7I4_THEAS/1-249R---G-A-----VD-VD-LS---SLEDAARKMAEFEERAIYH-----G-----LD-EGCIEG-IVKS-------------
A1B987_PARDP/1-251R---G-S-----ND-SD-WQ---PLKDAARKIALAEDRLVFL-----G-----HG-DAGIRG-ILPE-------------
A3DFK3_CLOTH/1-257Q---M-G-----LP-VD-LS---SASRAATQCALREDKLIFY-----G-----ND-ELGYKG-LLTE-------------
A6TWC5_ALKMQ/1-250R---G-A-----KD-IK-LD---ALEEAAEKMAIFEENMLYN-----G-----YK-PGDIEG-LIEA-------------
A7HIB4_ANADF/2-255A---C-G-----EP-LV-LS---EASEAARQIARAEDRIVFE-----G-----LP-RAGVSG-LLGH-------------
A7I7A2_METB6/2-249R---D-H-----LI-LD-TA---PVACAAMDAAAKEDRIIFN-----G-----LA-..GTPG-LLNA-------------
A8F8I8_THELT/3-247R---E-G-----VT-LD-LK---NLITAVRECATIEDRLIFE-----G-----IN-...SHG-LVSA-------------
A8L1F1_FRASN/1-253R---G-A-----DD-ID-LS---ALEEAARRVATTENSVVFH-----G-----YA-EAGIIG-ITEA-------------
A9BEM3_PETMO/1-251R---G-L-----KT-PD-LE---GLETAAKQLASFENKLILK-----G-----IE-KANIIG-LQTL-------------
A9FWS5_SORC5/3-254R---G-A-----QE-PN-IE---DVVRAAEHAARFEDGAIFN-----G-----LA-AAGIEG-ILEV-------------
A9H5P1_GLUDA/1-251R---G-A-----GD-SD-WQ---PLKDAAKKIAFAEDRAVFD-----G-----YA-AAGILG-LREG-------------
B1VSP7_STRGG/1-251R---G-S-----AD-SD-WQ---PVKDAARTCAFAEDMAIID-----G-----YG-AAGITG-LRDG-------------
B2A6K6_NATTJ/8-259R---G-A-----QD-ID-LE---PLEDAARKIALFEENAIYN-----G-----HN-DGQIPG-LKTV-------------
B2GID2_KOCRD/1-252R---G-A-----AD-PD-WQ---PVKDAAVALASAEDRTVFY-----G-----SD-SAGIQG-IAPA-------------
B2JNZ6_BURP8/1-251R---G-A-----ND-SD-WQ---AAKDAAKELAYAEDRAIFD-----G-----YK-AAGIVG-IREG-------------
B2V6Y3_SULSY/1-265K---F-N-----IP-ID-FS---VAAAAASQVAIAEDRLIFH-----G-----DI-ETGFPG-LLNV-------------
B4UA40_HYDS0/1-265K---L-N-----IP-LD-VS---VVALATREVALAEDRFIFH-----G-----DS-EIGYPG-LLNV-------------
B8CYH7_HALOH/1-249R---G-A-----ED-VN-ID---NLLESANELARIENKAIFF-----G-----MD-SAGISG-LVNS-------------
B8EQK3_METSB/1-251R---G-A-----DD-SD-WQ---PAKDAAKTIAFAEDRAIFD-----G-----YA-DAAITG-VRQG-------------
B8GHL2_METPE/5-250R---D-G-----ML-PN-TS---AVAVAAIEAARQEDAVIFT-----G-----TD-..QVKG-LMNT-------------
B9JHD1_AGRRK/1-251R---G-A-----ED-SD-WS---PVKDAARKIAFAEDRSVFD-----G-----YA-AAGIQG-IREG-------------
C0R0J8_BRAHW/1-256S---N-K-----LP-LD-LS---IVSQAAQTLANKEDNLIFN-----G-----ND-FLELKG-ILNA-------------
C0ZHN4_BREBN/1-265T---L-G-----MP-LD-MS---AAANAAAGGALMEDDLIFN-----G-----AA-EFDLPG-LMNV-------------
C0ZVK4_RHOE4/1-251R---G-A-----KD-SD-WQ---PVKDAAKQIAFAEDRAIFE-----G-----YP-AASITG-VRAS-------------
D5UVK7_TSUPD/1-251R---G-A-----QD-AD-WD---PVKDAARSLAYAEDRAIFE-----G-----YP-DASIPG-IRTT-------------
C4XPM7_DESMR/1-251R---G-G-----KD-ID-LA---ALDEAAEKLARFEEEALYH-----G-----FA-PAGIKG-LSEV-------------
C5B5H8_METEA/1-251R---G-S-----ED-SD-WQ---PLKDAARMLAFAEDRAVFE-----G-----YA-AAGIGG-IGKG-------------
O67639_AQUAE/1-267Q---F-N-----LP-VD-TT---GVAAAASSLAVAEDKLILF-----G-----NQ-EMGIEG-FLTA-------------
Q08WR7_STIAD/2-266I---H-N-----MP-LD-VS---AAAGAAALCAQQEDELIFY-----G-----DP-KLGHEG-LMTA-------------
Q0RH88_FRAAA/1-253R---G-A-----DD-LD-LA---PLEEAVRRIAVTENSVVFH-----G-----YQ-EAGLVG-ITQA-------------
Q2RVS0_RHORT/1-258R---G-A-----SD-AD-LD---PVIEAARAIAIAEDRAVFH-----G-----FA-AGGITG-IGEA-------------
Q5YPL3_NOCFA/1-252R---G-A-----KD-TD-LD---AVKEAARRIAFAEDRAIFE-----G-----YP-AAGITG-IRAA-------------
Q7MSM9_WOLSU/1-252R---E-A-----NA-FD-IS---SIEKAAKKVCVAENELVFY-----G-----LK-KEGIEG-LIPS-------------
Q97V86_SULSO/96-329R---.-.-----..-..-..---TAVLAGKSFAKMENYLLLK-----N-----HP-......-LSPL-------------
B2HH42_MYCMM/1-251R---G-S-----QD-SD-WD---PVKAAAKQLAFVEDRTIFE-----G-----YG-AASIEG-IRSS-------------
Q0SE23_RHOSR/5-254R---G-S-----LD-SD-WQ---PVKDAAKAVAFAEDQSIFQ-----G-----FD-EAGIRG-LGPS-------------
Q2IH48_ANADE/1-259R---R-G-----EP-LT-LT---EAAEAARRIARAEDRLLFE-----G-----HA-GAGVRG-LLEH-------------
Q5L1H9_GEOKA/8-264Q---L-G-----SP-ID-FS---AAANAAQQCALLEDDLIFN-----G-----ST-EFDVPG-IMNV-------------
MARIT_THEMA/1-251R---G-K-----PN-VD-LS---SLEETVRKVAEFEDEVIFR-----G-----CE-KSGVKG-LLSF-------------

PF05065

E0THR4_PARBH/115-394V---D-------..-LS.AW...LAEEIQAEFAAQESAAFVS-----G.DG..VN...KPRG-ILDYSTAPDD......T
Q1GG15_RUEST/131-399A---.-------..-LR.SM...IDQRLLFGLALAEENQLLN-----G.....DGTGQNLSG-LI...............
Q1DCZ9_MYXXD/94-361V---G-------..-.D.AG...VGEDIRATVADGLDDAGFN-----G.DG..TGA..APKG-LFAQ.............
Q0AAI8_ALKEH/83-374L---D-------..-LE.QW...LQDKIGTRFGRQEAESFIK-----G.DG..NG...KPRG-ILDYDTVPDGDFEWGAD
Q3J4R6_RHOS4/160-429Q---.-------..-LQ.GE...IDGELRYGLDLTEEAEILS-----G.....DGEGQHLSG-LI...............
A1T829_MYCVP/9-278N---E-------..-GAPEI...VATAQGIDIARKVDEAFFG-----......ADNPVANDG-LQAL.............
Q982R8_RHILO/176-465I---D-------..-IG.AW...LADEVNITFAEQEGAAFVT-----G.NG..LK...RPRG-ILAYPTVANA......N
A1AYY2_PARDP/166-435Q---.-------..-LQ.TE...IDTELRYGLMLAEEGQLLK-----G.....DGVGQNLEG-LV...............
Q1ILS6_KORVE/495-776I---D-------..-AE.QF...VREDLANIFALGVDLAALV-----G.SG..TSN..QPKG-IVNQ.............
Q1GH34_RUEST/388-661L---D-------..-IE.AL...VRSDLALALATSLDFAGFY-----G.TG..AND..QPLG-IANT.............
Q2GAM7_NOVAD/185-459Q---.-------..-LR.SY...IDGRLRYGLEYVEEGQLLN-----G.....GGTGTDLNG-IY...............
Q8XYS4_RALSO/130-408V---D-------..-IE.AF...LAGRIAARIGRAESRLVVQ-----G.TG..DGKPQQPQG-LAAS.............
Q3J3K4_RHOS4/110-395F---D-------..-VE.SW...LAGKIATRFMRAESAAFVS-----G.DG..ID...KPRG-FLAPAKVANA......S
Q1QLS4_NITHX/103-379V---N-------..-VE.SE...VASDLSEEFGRLEGLGFSQ-----G.DG..VK...KPIG-IMEAA............
Q8ED08_SHEON/122-393Q---.-------..-LQ.SF...INARARYGLMLKEEVQLLY-----G.....NNTGANLHG-IM...............
Q813J9_BACCR/150-424L---P-------..-IE.QI...VMDELKKAYVRKETQYMVN-----G.DE..AN.......-....NIND.........
Q3J5Z4_RHOS4/150-439V---A-------..-MA.QL...VRDDLLKVMALREDLAFLR-----G.DG..SAD..TPKG-LRHWMLP..........
A1B638_PARDP/102-387F---D-------..-VE.TW...LAGRIAEKFARAEATAFIS-----G.DG..VN...KPRG-ILTHAKAPNG......S
Q0AWY3_SYNWW/43-310F---K-------..-IE.DY...LVSRLAKNFGRAEDNGFIN-----G.TG..EN...MPTG-ILAA.............
A4YU30_BRASO/140-423R---.-------..-LQ.NR...ITVQAARAIRWKLFEAVCF-----G.....DGNG.KPLG-FM...............
Q2NV28_SODGM/127-397Q---.-------..-LA.SL...IDMELRYGLKYVEEQQILF-----G.....DGTGSNLNG-IF...............
Q1GHS2_RUEST/113-395F---D-------..-IE.GW...LAGRIADKFARAEAQSFIS-----G.DG..VD...KPTG-ILTHPTVDNG......S
Q2L2B0_BORA1/123-401I---D-------..-ME.SF...LAGRVASRIGRAESRLIVM-----G.TG..TGSPAQPKG-LAAS.............
A2SD63_METPP/97-385F---N-------..-VM.DW...LNTKIGEKFGFSFGASIIA-----G.DG..AA...RPSG-FTNYPIAATAD....AT
A1TML8_ACIAC/138-428V---N-------PR-VD.AI...VVGDLQTSMALSEDQHFLR-----S.DG..AGN..KPKG-LLYWALA..........
Q1QKG8_NITHX/112-388G---S-------..-AQ.AE...VQLALSEDFGAKEGLAFVS-----G.VG..PL...APEG-IMSNA............
Q0S2A4_RHOSR/9-273P---A-------..-AA.SI...IGKALARDIANKTDAAFFG-----......NTVTNGPSG-LLSV.............
Q6LSF8_PHOPR/134-417F---D-------..-ID.GY...IQDLLGMRIGRITNRHFTV-----G.TG..IN...EPAG-IVPGA............
A5N1H4_CLOK5/152-424I---N-------..-LA.NY...IETRLSMAIAKALDKAILT-----G.....AAASKQPTG-II...............
A7HRJ6_PARL1/148-433V---N-------..-ID.QW...LAEEVQTAFAEQEGAAFVI-----G.DG..VK...KPRG-FLDYDMVAEN......A
Q2YMS9_BRUA2/137-422V---N-------..-VE.QW...IAEEVEAAFAEQEGAAFVS-----G.DG..VN...KPRG-FLSYETVADD......A
Q73HT5_WOLPM/107-395V---D-------..-VE.SW...LVEKIAETFSKEESEAFIK-----G.EG..TF...QPKG-ILAYENGN.........
Q9A4P7_CAUCR/53-338V---S-------..-ID.EW...LAEEVQDAFAAQETTAFVT-----G.DG..VN...KPKG-LLAYTAAPDA......S
Q3Z7J9_DEHM1/124-397F---D-------..-LE.KY...ISTEFARRIGAAEEEAFLI-----G.DG..NK...KPEG-VFTK.............
Q830G6_ENTFA/163-444V---P-------..-VE.DI...VVEELKKAYVRKEINYMFN-----G.DD..AG.......-....NENP.........
A7MP72_CROS8/125-401I---D-------..-MN.GY...LAARIAQRLGRGEAAQIVN-----G.DG..TGK..NVKG-LAKW.............
A7ILP2_XANP2/167-448I---N-------..-IE.GW...LATKISDKFARIEASAFIV-----G.NG..VK...KPRG-ILTYPAAPAG......T
B0T632_CAUSK/96-391L---D-------..-FQQVLLASMNAGIAEKMASELLNSTVT-----NAVENVAGTTTIPAG-ILNR.............
Q11H37_CHESB/111-386F---N-------..-LE.SE...LAFDAAEEFGRLESVAFVA-----G.DG..TG...KPKG-ILADT............
Q88G49_PSEPK/193-483T---N-------PN-VD.RL...VVNDLTASVALAEDLSFLR-----G.AG..TGN..LPKG-LRFWAPA..........
Q72BY4_DESVH/118-395V---D-------..-IE.AF...IRSRIATRVARIQNRMFTL-----G.TG..TG...QPSG-ILKDI............
B2JU92_BURP8/137-421A---.-------..-LA.SY...LPGKTAASIRWKTDESILF-----G.....TGAG.QPWG-VM...............
Q81Z09_BACAN/121-392F---E-------..-...TT...LINNIVEAMTKAIEQAIVS-----G.....DGSG.KPKG-ILAETP...........
Q3SS55_NITWN/107-382G---A-------..-AE.SE...VRMALAEDFGLKEGLSFLK-----G.TG..PL...QPEG-LLINA............
Q2GDU5_NEOSM/81-367I---N-------..-VE.KW...LIEQAALAFTQLENETFIT-----G.DG..KN...KPHG-ILQHNTDS.........
Q3SSD8_NITWN/135-418V---N-------..-IE.QW...LADEVSITFAEMEGASFII-----G.DG..VG...KPRG-LLSYDTVADT......S
A6VNQ3_ACTSZ/129-407I---N-------..-IE.AY...LADRIAQRIGRAEAKYLIQ-----G.TG..AGTPAQPKG-LAAS.............
A5N291_CLOK5/33-297F---N-------..-LE.KY...LMGDFAKRFGKAEENALLN-----G.NG..TT...QPTG-ILT..............
Q5WID4_BACSK/129-404L---N-------..-FT.RE...IIDWLSESALTTENDEIFY-----G.....KGDE.NVEG-LLT..............
A4XZF1_PSEMY/131-410I---D-------..-LE.AH...INQRLTERLGRITNRMFTT-----G.TG..TN...QPHG-VVTGA............
Q2N5Z6_ERYLH/94-380F---D-------..-LE.AW...LASEIAMEFARAEGAAFVN-----G.SG..ID...QPDG-FLTVPHSTSDD....QA
Q2GJL3_ANAPZ/114-389I---D-------..-LE.RW...LMNNLVDAFSRKENQAFIS-----G.SG..AS...QPTG-ILSYDEGT.........
A9BYD9_DELAS/120-394M---.-------..-LQ.SY...IDGRLRYGLKLKEELQLLK-----G.....SGVGLNMDG-IY...............
Q5Z3V6_NOCFA/148-434A---.-------..-LE.GL...INDELRADVAEAEEGQILN-----G.....DGSGENFTG-INNWS............
A5CD71_ORITB/88-365I---N-------..-IE.NW...LIERLEDSFANAENKSFIL-----G.NG..IS...QPHG-ILYNPE...........
A8FGQ6_BACP2/20-302E---K-------DG-IQ.QT...IMQMLAERAAVDIEELIVN-----GDTTSSDPFLAQMDG-VR...............
A1TD88_MYCVP/110-388G---.-------..-LA.DD...IAKMIAFEKDVKESIAFAT-----G.....SGVG.QPRG-VITA.............
A9CJN8_AGRT5/134-419V---D-------..-IE.AW...IASEVDIAFAEQEAAAFIA-----G.DG..VN...KPKG-FLSYTAIAND......G
A3DG61_CLOTH/127-416A---.-------..-LE.AI...VRQAYADEMSFKIDDAIIN-----G.....TGVG.MPLG-IL...............
Q2SDM1_HAHCH/110-393F---N-------..-VE.QW...IADEVAQEFVDREADAFLN-----G.DG..VG...KPKG-ILAYAMDTAPD....AS
B2JL19_BURP8/113-379Q---.-------..-LQ.SY...INMRMTYGLRMKEDKELLT-----G.....DGATGHIAG-LI...............
B7GIM9_ANOFW/146-418I---N-------..-LD.EY...VTKKIARAIAKALDLGIVK-----G.TG..ATNK.QPLG-IIPSL............
B9KI56_ANAMF/104-375V---D-------..-LE.GW...LIDNLVDAFSRKENEAFIS-----G.DG..DK...KPSG-ILSS.............
C5AYR6_METEA/135-420L---D-------..-ID.AW...LAEEVETAFAEQESVAFVT-----G.NG..VG...RPKG-FLSYDTVANA......N
P71947_MYCTU/196-475G---.-------..-FV.AE...VGRVLADSVEQLQAAAFVS-----G.SG..NG...EPTG-FVSA.............
Q2FX56_STAA8/38-311S---Q-------..-FF.EE...MKPMIAEAFYKKFDEAGIL-----N.....QGN..NPFG-KS...............
Q2G1W8_STAA8/130-399V---N-------..-VL.QE...LKLWMARTIAATRNKAIID-----VITK..GSTGSTSSG-FEKE.............
Q3J3W7_RHOS4/239-509Y---N-------..-LE.GE...LMADFAESFGRAESAAFVN-----G.DG..VG...KPKG-IMAA.............
Q81X82_BACAN/69-344I---D-------..-VV.NY...AVGVMTRRLARKLDETVLN-----G.....DKTKKQFEG-ILTS.............
Q81XY0_BACAN/102-381A---D-------..-YD.AE...VMKGITVATRKKLTREILI-----G.....TGATNRLVG-IFS..............
Q88MK4_PSEPK/141-410L---.-------..-LQ.SY...INGRAIYGLKYKEEEQLLA-----G.....DGTGQNLLG-LI...............
Q9CFS0_LACLA/124-389E---N-------..-IL.AW...LSSWIAKKVVVTRNQAII.-----...............-.................
Q9P9R2_XYLFA/357-623P---D-------..-AE.QI...VRSDLLNVMALEVDRAAIY-----G.....SGSDMQPTG-VKHH.............
Q9ZWV6_BPPHC/121-387L---D-------..-LV.GF...LVSDAGPAIGDAMGRHFLT-----G.TG..TG...QPRG-ILTD.............
W6SDV8_9CLOT/124-396F---D-------..-LE.NY...ISTEFARRIGAKEEEAFLV-----G.DG..DG...KPTG-IFNA.............

PF06673

Q9MCB6_9VIRU/1-347I---E-------GT-FKAGTDKNKAQTASKRSLRPQMAEAYL-----------QMDKATVRG-VNDSGALSEYVMSEMVN
Q9MCB8_9VIRU/1-347I---S-------GT-FKAGTDKNKSQTATKRSLRPQMAEAYL-----------QMDKATVRG-VNDSGALSEYVMSEMVN

PF05125

D3UZQ7_XENBS/11-324NSG.S-------EEEFF-LR---MQAFTNESFALDMLRVGFN-----GQRIA.ETTNPDENP-NGEDVNKGWHQIAKEWN
A6TE73_KLEP7/8-340R...F-------QD.FQ-RR---IRDAIIQRQALDFIMAGFN-----GVERA.ETSDRATHP-MLQDVAVGWLQKYRN.E
D5CFH7_ENTCC/11-326NAGKE-------ENEFY-NL---VQTFSTQAFAMDMLRIGFN-----GTHRA.KTTDPKANP-NGEDVNIGWHEIMKTML
M9X6X0_PASHA/8-336K...F-------PD.FQ-QK---VANVAAKQRKRDLIMIGFN-----GTSRA.ATSDRNSNP-LLQDVAKGWLQKMRE.D
Q5E389_VIBF1/11-331H...L-------PN.FN-QL---INSQTREQIDMNKVTIGWY-----GKSCA.EDTDASANP-NGEDVCKGWFQAIRD.N
Q2S7I3_HAHCH/8-327K...F-------PD.FQ-AR---YGGWVRKAISLSKLRVGWL-----GTSCALPATKPGDHP-NGEDVNKGWLQQLREFK
Q15Y13_PSEA6/12-335K...F-------PD.LA-DR---YANYINRAIATNKAMIGWH-----GTSVA.ATTDPTANP-MGQDVNKGWLQILRE.Q
H2IY53_RAHAC/8-339K...F-------QD.FQ-KR---LSNQIIKRIALDRIMIGFN-----GTSYA.EKSDRAANP-LLQDCGVGWLQQYRT.N
B8J319_DESDA/15-323K...F-------PD.LA-DH---YARYVQERIAADRELIGWY-----GERAV.ATTDLVANP-LMQDVNKGWLQYMRD.N
W8UNE7_YEREN/11-324NAG.D-------ENEFF-QR---MQDFTNESFALDMIRIGWN-----GKTAE.KSTDPIKFP-NGEDVNIGWHEIVRKYN
C1DBL5_LARHH/8-337K...F-------PD.FQ-TR---LRDAILKQQALDRIMIGFN-----GTSVA.EDTDRDSNP-LLQDVNKGWLQQYRE.H
E6WE37_PANSA/8-338K...F-------QD.FQ-TR---IRDAIIQRQALDRIMIGFN-----GVKRE.KTSNRLENP-LLQDVNIGWLEKIRQ.E
C5BH00_EDWI9/18-332NAG.T-------PGEFF-NL---MNSTAVINFALDMLRIGFN-----GTHAA.ENSNPTDYP-SGEDINIGWHQIARNWG
B2FIZ5_STRMK/8-334H...R-------PE.FQ-TL---IRDAIIQRQALDRIMIGWN-----GTSIA.KNTDRVANP-LLQDVNKGWLQKYRE.H
C1DS28_AZOVD/8-332K...F-------PD.FQ-AR---VRDAIVKRQALDRIMIGWN-----GISRA.ATSNPATNQ-LRQDVNIGWLQKMRT.E
Q8XY26_RALSO/8-332K...F-------PD.FQ-TR---IRDAIIKRQALDRIMIGFN-----GVSRA.ATSNRVVNP-MLQDVNKGWLQNLRE.Q
D8MKI1_ERWBE/9-341K...F-------PD.FQ-QR---ITNQIIKRRALDRIMIGFN-----GTSRA.GKSDLAANP-LLQDVNIGWMQKYRA.N
F6IH75_9SPHN/8-355H...K-------PQ.FQ-TL---LRDVILKQQGRDRIMIGFN-----GTSAA.ASTDVVANP-LLQDVNEGWLHKIRT.H
J7TAL9_MORMO/8-339K...F-------KD.FQ-LR---IRNAIIRRQALDRIMIGFN-----GTHRA.KTSDRAANK-MLEDVNIGWLQKVRT.D
B2VH98_ERWT9/8-339K...F-------SD.FQ-VR---IRDVIVKRQALDRIMIGFN-----GLKRE.KTSNRVQNP-LLQDVNIGWLEKIRQ.E
F4HA06_GALAU/6-327R...F-------GDRLA-AL---YAEFVQTQIALDQLKVGWY-----GKSVA.ENTSAAD..-.MSDVNKGWMQLERE.E
G0AIP5_COLFT/8-331K...F-------QD.FQ-SR---IANQILIRQGLDRMVIGFN-----GTKIA.SDTDIAAYP-MLQDVNKGWLQHFRE.D
D5CB73_ENTCC/8-338K...F-------QD.FQ-VR---IRNAIVKRQALDRIMIGFN-----GVKRA.KTSNRAENP-LLQDVNKGWLQKIRE.D
F0LXI5_VIBFN/8-332H...M-------KS.FN-QI---VSKHTREQIDANKITVGWF-----GQTAA.ANTDAAANP-NGEDVNKGWFQAMRE.H
B0UTP6_HISS2/8-335K...F-------PD.FA-KR---IGTLKAERMALDRIMIGFN-----GTSRA.ATSNRKTNP-LLQDVAVGWLKKIED.N
VPN_BPP2/8-340R...Y-------QD.FQ-LR---IRNAIIKRQSLDFIMAGFN-----GVKRA.ETSDRSSNP-MLQDVAVGWLQKYRN.E
H2IRH6_RAHAC/8-340R...Y-------QD.FQ-TR---LRDAIAKRQALDYIMAGFN-----GVSRA.ETSDRSKFQ-MLQDVAVGWLQKLRN.E
B4F0K8_PROMH/8-339K...F-------TD.FQ-TR---IRDAIIRRQALDRIMIGFN-----GTHRA.DNSDRTKYP-LLQDVNSGWLQKVRE.R
B0UW33_HISS2/6-327R...F-------GDKLP-AL---YAEFFNKQVALDMLQVGWH-----GKSVA.PTTSQSD..-.LSDVNKGWLALLKE.Q
E6VXL3_DESAO/8-324K...F-------KD.FA-ER---YTRYVQERIANDREMAGWY-----GVDAA.ADTDMTANP-LLQDVNKGWLQYMRA.H
A6VSU1_MARMS/18-341K...F-------KD.FA-NR---YMKMVRASIGDDMLQTGWT-----GISAE.TFTDLEANP-LLQDLNKGWLQIMREFK
C5AGA6_BURGB/8-333Q...F-------PN.FQ-TT---VRDVNATQQALDRIRIGFN-----GVGRA.ATSDRTKNP-NLEDVNKGWLQTYRD.Q
J7SK37_MORMO/10-341G...H-------PQ.FQ-SL---INQQIIQREGLDRLMIGFN-----GVKCA.AKSDRQKNP-LLQDVNIGWLQLVRE.R
R9VFP8_9ENTR/8-340R...F-------QD.FQ-TR---IRDAIVKRQALDYITIGFN-----GVSRA.PTSDRQKNP-LLQDVATGWLQKYRN.D
W0L880_SERFO/8-339K...F-------KD.FQ-AR---VTNQIIKRRGLDRIMIGLN-----GVSRA.AKSNKAQNP-LLQDVNIGWLQKYRL.Y
Q1QXQ6_CHRSD/8-331K...F-------PN.FQ-AL---IRDAVIRQQALDRMTIGFN-----GTSAA.TQTDRAANP-MLEDVNIGWLQQYRN.N
C5BAR3_EDWI9/8-332A...H-------PD.FQ-IR---VRDSITRRQGLDRILIGFN-----GTHVA.VQTNFQQYP-LLQDVNKGWLQQYRD.H
F4HB41_GALAU/8-340K...F-------PD.FQ-TR---LAKQTQKTIGLNLIMMGFN-----GTSRS.ENSDLSRNK-LLQDVKKGFLQKIRE.E
Q63LE5_BURPS/8-332K...F-------AD.FQ-QR---IRDVILNQGALDRIMIGWN-----GVKAA.ATTDRQANP-LLQDVNIGWLQQYRE.R
A7MN35_CROS8/15-328NIGAA-------GD.FD-KA---MDAFFAEALALDMLRTGFN-----GMAIA.DTTDPETCK-KGEDVNIGWHALAKQYE
A1VSG1_POLNA/8-331K...F-------PD.FQ-TR---LRDLIIKRQALDRIVIGLN-----GVSAA.VATNLATYP-LLQDVNIGWLQHIRT.D
F0LQ00_VIBFN/14-328NSG.S-------KDEWM-KM---MKAAISRRFALDMLRIGFN-----GTSVA.AITNPVENP-LGQDVNKGWLTLVKE.K
Q6D3X2_PECAS/8-339H...Q-------PN.FQ-PL---ISSAMARQMSLDRIMIGFN-----GTSYA.DPSDRAANP-LLQDCGVGWLQKIRT.E
VPN_BPHC1/5-328I...F-------KDRLV-EL---YSEYFQNQVALDILQIGWN-----GQSVA.DNTTKAD..-.LSDVNKGWLKLLQE.Q
D8J087_HERSS/8-337K...F-------KD.FQ-TR---VATAILKRQALDRIMIGFN-----GVKVA.ADTNLAQYP-LLQDVNKGWLQQIRE.H
H2FUC0_OCESG/13-333NAG.N-------EGEFL-RL---VNEFINRSFALDMIRVGFN-----GTSIA.TNTDPEANP-LGQDVNKGWQQLVREWN
Q8P6J5_XANCP/8-334K...F-------PD.FQ-AR---LRDAIVKRQALDRLQIGFN-----GTHAA.ADTDRAAFP-LLEDVNIGWMQQYRT.N
E0SAM8_DICD3/25-338NAG.G-------EDEFF-QL---VQAFSNEAFALDMLRIGFN-----GNSVA.KSTNPDKNP-NGEDVNIGWHQRMKDFK
D3VKM6_XENNA/8-339K...F-------RD.FQ-LR---IRNAIIRRQALDRIMIGFN-----GTQRA.KTSNRAQYP-MLEDVNIGWLEKVRK.D

PF11651

B7KXS0_METC4/1-419L---S-------------ER---VIKPAMVSLANQVDQDVM..............SLYSSIPNWVG....TPGTVLSS.Y
A5VES4_SPHWW/1-413L---S-------------ER---VIKPAMVQLANKIDSDVL..............SLAAKVPNWVG....TPGQIVNS.F
E8NPD4_SALET/1-428S---Y-------------RR---RIQASAKKLANNIESAIAK.............QATEMGSLVVHDTRAIGPSTGLSGW
B2U8F8_RALPJ/1-419Y---S-------------ER---ILKPAINDIAGQIAADIMGGMDGLVPAGTLYPDTQLPASNLVGKFDGSNNLLNAD.L
A5VW72_9CAUD/1-416H---K-------------TE---AGRAAGMRLAAQIDSDLIS.............MVTQRATNVITMADSTAGTQGRDLW
A4E782_9ACTN/1-291F---S-------------AQ---FLVPAMQAFADKIDGYLL..............ALEKDVTNRVDH...AKGAIA...V
A4JD31_BURVG/1-395F---S-------------ER---ILAPAVNRLAAAVAADLM..............NVAASSSNIVAK...SNASASPD.A
Q2G3Y7_NOVAD/1-418A---M-------------GQ---YGKAAKQKLSSDVNLALFN.............TVALYGSVFSKRTGAATG......Y
B0U721_XYLFM/1-409F---S-------------KR---FLRPAMNSLSSKVNAYLLK.............SMYLQTPNVVGTWGTIPGT.....R
E9Z5W1_ESCFE/1-421L---.-------------EE---ILAPVRQRIVTDLETELAH.............FMMNNGALSLG....SPNTPITK.W
Q5YSR9_NOCFA/1-303M---Q-------------DQ---IARPAAEALAQYVDRAIIA.............HIKTATSAFAGV...TPAGFEWDKP
A0A017QUU9_SALET/1-427A---Y-------------RR---RIQSAARKLANNVELKVAN.............MAAEMGSLVITSPDAIGTNTADA.W

PF09950

Q9P9P2_XYLFA/84-327-----PGVPVL---LN....------------....TAGPWIG......QSPAQVL.ALFNQLIS...SAWMN..THY..
E1VAC6_HALED/80-318-----PNLGET---A.....------------....VNGDWTNSA....TTGQQIL.DDLLAMYD...AVQIQ..SYD..
A9C0G0_DELAS/60-320-----NGVVVA---NAPADG------------TG..GSTLWVNAAGVGQKTPAQIV.RDINIALQ...GISLA..TFE..
A6TKD0_ALKMQ/60-304-----TGIQTM---PVALNA------------GE..TSTKWKD......KTSEEII.EDIRLARK...KVNAL..PGL..
H6NDU4_9BACL/55-298-----TGIQTT---NVPPRA------------DG..TSTKWKD......KTGEEIV.EDVRIVRS...LVSVL..PGH..
Q7N327_PHOLL/62-316-----SKVQLI---AEVTGK------------.................SIKDMSAEEFINMVLNAYNVAWAK..SGY..
Q6FAE7_ACIAD/80-324-----TGVTVV---T.....------------....AQHDWAT......ATIEQIL.SDFNASLSDSEDLFDG.....DI
R6PG10_9CLOT/91-341-----NNIPVT---TATAGK------------G...GSAKWKD......KTADEIL.ADINGYMA...TVSRN..TKN..
G9ARJ4_PANAN/73-313-----DGVTLN---N.....------------....APQTWAA......STNDQIL.DSVNSVLT...DAWKA..SAY..
B4EG48_BURCJ/103-345-----ASVTNT---SNA...------------....IAGNWGS......ATPAQML.ADVNELLN...SVWAA..SAY..
C5AFU5_BURGB/112-366-----SAVASV---TNVANG------------AS..GTPQWTT......KTPDEIL.RDVNEILT...SAWQA..SGW..
R6AF56_9FIRM/26-279-----PNVVVA---TADNGA------------S...GKATWKD......KTPDEIL.DDINQAIT...AAWVA..SEYDL
K8E4M7_CARML/57-293-----DGIQVV---N.....------------....VSKTWKT......ATSDEIV.EQVRTTRA...KITVI..PGY..
E3HGR1_ACHXA/80-315-----PNVPLV---VG....------------....LHGDWLNPT....TTADQIL.ADLDMIYD...AVVNQ..SKN..
C9LU84_SELS3/82-338-----KQITAT---AVTAGA------------S...GQTDWAH......KTPTEIL.NDIDEAII...AGWTG..AQYDN
R7JXV9_9CLOT/86-336-----TDIPLY---TLSEVE------------VDGKKYTDWAH......KTADQIL.EDINGMQK...FVDKI..TMS..
B8IDG5_METNO/63-315-----PAVTTG---TAAATG------------EG..GSPAWAR......KTAEQIL.ADVNTELT...GLFTA..SST..
R6R1V3_9FIRM/101-351-----NNIPVY---TLQNGA------------G...GKADWAS......KTADEIA.ADIAGILN...YIDTL..TQS..
H8L668_FRAAD/90-334-----SAVTTT---NVVNGA------------S...GSPLWSS......KTPKEIL.ADFNAILN...LAWEA..SAY..
R6RQ09_9CLOT/93-346-----PDVVVL---DAASNG------------ADS.ASTKFKD......KTPDMIL.KDINDAIL...YAWSQ..CEYDR
Q0BRS5_GRABC/66-316-----PAVTAG---TVANGA------------S...GNPDWAH......KTVDEII.DDVNAALT...GIQTA..SLR..
Q2NSP7_SODGM/17-247-----PFTTIE---DSVGT.------------.................KTALAKITSFINQHWNLKGGVFPV.......
B8IIV0_METNO/63-315-----PGVTQG---SAAATG------------TG..SSTRWVD......KTADQVL.ADVNGQLT...GIYTG..SST..
Q6XQD3_BPT1/82-319-----PNITKI---......------------....TSGKWIDVSTMKPETAE....AELTQAIE...TIETI..TRG..
A9I906_BORPD/80-320-----PNIGMT---TG....------------....LNGDWANPA....TTADQIL.DDLNALYN...AVRLQ..SKG..
Q2G4R3_NOVAD/111-362-----GSAPSA---QVAADG------------TG..SSRLWAD......KTPDLIL.RDINAALT...AVETG..TGE..
W8UFX7_YEREN/64-311-----SNVGVE---AAPATL------------ADLVAAIPT........KGTQPII.DFFGAAYN...QVYLK...NTVT
A7ILG8_XANP2/103-352-----ASVTNV---SNVAAG------------AS..SSMAWTS......KTADEIR.KDVNELLI...SVWAA..SGY..
Q32EP9_SHIDS/73-313-----DGVPVN---N.....------------....AAKTWAT......STPDEIR.ASINQVLS...DAWAA..SGY..
G2IHV9_9SPHN/64-315-----GGVPTA---NVPADG------------TG..SATAWST......KDADKKV.RDVNLAIT...DVFTN..TKE..
Q835B4_ENTFA/57-293-----EGIQVI---N.....------------....SPKKWKE......MTSEEIV.EQLRTSRA...KITII..PGF..
D0UIJ0_AGGAD/58-304-----KSVEVY---AIKGAA------------Q................NTKVQAM..DFDKAVAFFKEIFLKGMEKTKR
Q984H1_RHILO/86-339-----STPTAT---QAPADG------------TG..SARTFAS......KTADQVL.RDVNTQIT...GIATD..TLG..
Q2NRY5_SODGM/73-317-----ASVKRS---K.....------------....AGKPWKQ......STADEIR.AAIDAGLT...TAWKQ..TGR..

PF04454

D4H156_DENA2/1-251-----AAKNRI---NMT..------------------------------LDKDNLV-DAISEAQG---RMRKE------G
C8WPL7_EGGLE/1-257-----KGSSKI---KKSDW------------------------------SQGENSF-ADITAGVA---QLAKT------G
D0LZ74_HALO1/1-251-----TPHEAL---AVA..------------------------------.SVSDFP-RAVLSAAD---TLRKA------G
D1B7I4_THEAS/1-249-----AGYTAE---LSV..------------------------------SKSKDMI-MGIAKGVR---TMGAS------.
A1B987_PARDP/1-251-----TSNPIV---ALP..------------------------------ANVADYP-EAVASAVS---ELRLA------G
A3DFK3_CLOTH/1-257-----DGIVKF---PISNW------------------------------SEGENPF-KDISIGLA---KFIEN------G
A6TWC5_ALKMQ/1-250-----SSHKLS---QFG..------------------------------NNGEEIM-ENLAQGMI---LLKEA------Y
A7HIB4_ANADF/2-255-----EGAVEL---PAGDW------------------------------SDPARVA-DDLLGALA---KLDEA------G
A7I7A2_METB6/2-249-----EGAGSL---TLSKW------------------------------DKVGAAA-DQIIDAVT---KLDAA------G
A8F8I8_THELT/3-247-----PGTISM---ELSDW------------------------------KNVGQAA-SDVIEAVT---KLDEA------G
A8L1F1_FRASN/1-253-----SSHPVL---ELG..------------------------------ADTDSYP-RTVAKAVA---LLRRA------G
A9BEM3_PETMO/1-251-----AKQNSV---ESSK.------------------------------ESLKDFV-KSLFEVKK---RFMEQ------G
A9FWS5_SORC5/3-254-----APHKPV---VIP..------------------------------.APEAWP-RAVAEARE---VLRAA------G
A9H5P1_GLUDA/1-251-----TSNPKL---ALP..------------------------------SSASDYP-AAIAAALN---QLRLA------G
B1VSP7_STRGG/1-251-----SSHDPL---PLP..------------------------------ADARDYP-VAVSQAVT---RLRLA------G
B2A6K6_NATTJ/8-259-----LTQDLI---PLG..------------------------------NTGSEIM-ESITRGII---TLRKA------Y
B2GID2_KOCRD/1-252-----SDNERL---SLP..------------------------------QDVREFP-NAVAKAKT---ELRLA------G
B2JNZ6_BURP8/1-251-----SSNTSL---ALP..------------------------------ADVADYP-NAIGGALQ---QLRLA------G
B2V6Y3_SULSY/1-265-----EGKNSI---SISDW------------------------------NQTGEAF-KDILNAIV---KLNEN------G
B4UA40_HYDS0/1-265-----EGRSII---KNKNF------------------------------DEEGGIF-KTALACVE---TLVEK------G
B8CYH7_HALOH/1-249-----SGQTLD---.....------------------------------TPATGLI-SSVAEGIN---NLVKA------G
B8EQK3_METSB/1-251-----TSNPIM---TLP..------------------------------ADVRDYP-DAIAHALS---QLRLV------G
B8GHL2_METPE/5-250-----GGSQSV---KLASW------------------------------EKIGAAA-DDLIKAVT---ALDLA------G
B9JHD1_AGRRK/1-251-----SSNPIL---PLP..------------------------------SNVRGYP-DAIAKAVS---QLRLA------G
C0R0J8_BRAHW/1-256-----EGAQKL---QISDW------------------------------GQGENPY-TDIVKAIN---MIREK------G
C0ZHN4_BREBN/1-265-----KGRLTH---LKSDW------------------------------MESGNAF-ADIVEARN---KLLKM------G
C0ZVK4_RHOE4/1-251-----GSNPEL---KLP..------------------------------IDAKDYP-EAISQAIT---SLRLA------G
D5UVK7_TSUPD/1-251-----AAGSDL---KLP..------------------------------DDPRDIP-DVVSQALS---DLRLA------G
C4XPM7_DESMR/1-251-----SSQTRL---QVS..------------------------------SNPEDIA-EKVSKALT---ALRKT------S
C5B5H8_METEA/1-251-----SSNAAV---PLP..------------------------------ATLDDYP-EAVARALN---DLKLA------G
O67639_AQUAE/1-267-----KGTLRE---ELSDW------------------------------EKVGNAF-QDVVKGIS---RLVEK------G
Q08WR7_STIAD/2-266-----TDRLTV---PLGDW------------------------------ATPGAGY-VAIVEATR---KLNEH------G
Q0RH88_FRAAA/1-253-----SSHPQL---TLE..------------------------------AGTDTYP-RTVAKAVA---LLRRA------G
Q2RVS0_RHORT/1-258-----SAEHAL---DLP..------------------------------ADLADFP-GVLVRALA---VLRDR------G
Q5YPL3_NOCFA/1-252-----GSNAPI---TVP..------------------------------DDARLVP-EAITQALT---ALRLA------G
Q7MSM9_WOLSU/1-252-----IPHKPI---K....------------------------------AKGDEIL-PAVAEGIK---ELVNS------E
Q97V86_SULSO/96-329-----KIGLKI---TGSDW------------------------------NVAGNIL-LDVLRAYE---NLTRE------G
B2HH42_MYCMM/1-251-----SSNPPL---TLP..------------------------------EDPREIP-DVITQALS---ELRLA------G
Q0SE23_RHOSR/5-254-----SDNPVL---SLP..------------------------------EDPLLIP-DAVASALS---ALRLA------G
Q2IH48_ANADE/1-259-----PGLVEV---PAGDW------------------------------ADPGRAG-DALLAALT---ALDDA------G
Q5L1H9_GEOKA/8-264-----KGKIAH---IRSDW------------------------------MKSGNAF-TDVVEARN---KLLQL------G
MARIT_THEMA/1-251-----EE.RKI---ECG..------------------------------STPKDLL-EAIVRALS---IFSKD------G

PF05065

E0THR4_PARBH/115-394RAADELGTTPS...SGATID------------...........------..ADDLI....DLIY.---TLPQAYR...Q.
Q1GG15_RUEST/131-399.....TNATAY...SAAFAP------------A...SETAI..------...DKMRLAMLQAALA---EYPATG......
Q1DCZ9_MYXXD/94-361.........LD...AAHTFA------------....STGTTAA------AYLSDVD....KAVEL---PLTAHVR...M.
Q0AAI8_ALKEH/83-374PADYTIGAIYT...GESGDF------------........PSN------NPDNVLY....DVVD.---ALKSDYL...G.
Q3J4R6_RHOS4/160-429.....TNASAY...SGVYEP------------A...GATAI..------...DKLRFALLEASLA---LYPADG......
A1T829_MYCVP/9-278.....TGVQEV...DAGSV.------------...........------...LNLD.........---SFAAAQALSEDV
Q982R8_RHILO/176-465YSWGNVGYVVT...GAASDF------------....LAPTSTV------SPADALL....DLLY.---GLKQGYR...N.
A1AYY2_PARDP/166-435.....TAATAF...VPAFAV------------A...GETMI..------...DTLRLALLQASLA---EYPADG......
Q1ILS6_KORVE/495-776.....SGVGTE...AIATDG------------....GA.....------ITYSIIT....KAQE.---DLEESSI...P.
Q1GH34_RUEST/388-661.....SGVNVV...DFGGAA------------....SGGGSAL------PTWAEVI....QMES.---EISAANA...D.
Q2GAM7_NOVAD/185-459.....TQATAF...AAPITP------------TAAGMMTKI..------...DIIRLAILQAALA---ELPANG......
Q8XYS4_RALSO/130-408....VTLTKST...ANAAKL------------...........------.TWQEVN....TLIH.---AVDPAYR...N.
Q3J3K4_RHOS4/110-395WSWGSIGYVPS...GAASDF------------........LAT------NPADCII....TLIY.---SLGADYR...A.
Q1QLS4_NITHX/103-379....GVAYTAT...GNASTL------------.........GT------APADTLI....DVFY.---SLPAYYR...N.
Q8ED08_SHEON/122-393.....LQASAY...VKPTGA------------TV.DTEQHI..------...DRIRLALLQAALA---EYAADG......
Q813J9_BACCR/150-424.GALAKKAVEF...KTD...------------.........EK------NLYDALV....KMKNT---PVKEVRK...K.
Q3J5Z4_RHOS4/150-439.ANWSAAPVAA...TPA...------------...........------AAEAAIR....RAVS.---LVEDADV...G.
A1B638_PARDP/102-387ATNVQIGTIPS...GGTGDF------------........AAT------NPANALI....DLVY.---ALGAQYR...A.
Q0AWY3_SYNWW/43-310.........SG...GAEVGV------------....TT...NA------ITYEDVV....KLFF.---SVKPEYR...R.
A4YU30_BRASO/140-423......ASPAL...VTAPAE------------....GGQSAGT------IVTANIL.........---KMMARLF...EM
Q2NV28_SODGM/127-397.....TQATAF...KAELKP------------A...HRTAI..------...DDLRLAMLQAQLA---RIPATG......
Q1GHS2_RUEST/113-395WSWGNIGYVAT...GSDGGI------------...........------GSADAIV....DLVY.---ALDARYR...A.
Q2L2B0_BORA1/123-401....AVVGKQT...ASAATF------------...........------.TWKEVN....GLIH.---SVDPAYR...N.
A2SD63_METPP/97-385RPWGTLQYLPT...GTDGAF------------........NST------TKTDVLV....DTVA.---ALKPQYR...T.
A1TML8_ACIAC/138-428.ANKVAAPAAP...TLA...------------...........------QADAFLS....GLML.---RIEMANV...D.
Q1QKG8_NITHX/112-388....DVAATTT...GNAATL------------.........GT------NPADLLI....DHMY.---SLPAAYR...G.
Q0S2A4_RHOSR/9-273.....SGVQVV...DTGAGW------------...........------...TTLD.........---YVHDAKSEALAN
Q6LSF8_PHOPR/134-417...ALGKKGKT...GQTALV------------...........------.TYEDLV....SLEH.---SVDPAYR...N.
A5N1H4_CLOK5/152-424.....TALGGTGLEAHNVTS------------...........------...DGTLKNIVSHMSV---IDDGEDG...AP
A7HRJ6_PARL1/148-433WEWGKLGFIAT...GNAGGF------------........PTS------NPADKLI....DLVY.---AVKAGYR...A.
Q2YMS9_BRUA2/137-422WAWGKIGHVAT...GVAGAL------------........PPE------DPSDKLI....ELIY.---TLKAGYR...Q.
Q73HT5_WOLPM/107-395.SYNKIEQVKT....E..KL------------...........------D.SDSIM....MLYY.---SLDEYYS...K.
Q9A4P7_CAUCR/53-338YTWGQVGYLAT...GVAGGW------------........TAS------NPTDRLI....DLIY.---ATKTQYR...Q.
Q3Z7J9_DEHM1/124-397.........VA...ATTGAT------------....TEINNAT------VSFDDIM....DVFH.---SLRSVYR...N.
Q830G6_ENTFA/163-444.GALAKKAVAF...EKPVDL------------....TAAGAGQ------KLYDALI....EFKNT---PVTEVMK...K.
A7MP72_CROS8/125-401....VTKTTSA...AAADAF------------...........------.TWEELL....ALKH.---SVDPAYR...N.
A7ILP2_XANP2/167-448YARGKILQVNS...GHATNI------------...........------.TADGLV....NMTF.---SLKEAYL...A.
B0T632_CAUSK/96-391.....VTEVAADRFTGSIGK------------TPCLTTAGINL------VTFEDMI.....KLYN---SLHTKYR...NS
Q11H37_CHESB/111-386....GIATVVS...GNASTL------------.........GT------APADKLI....DLLY.---KLAPAYR...R.
Q88G49_PSEPK/193-483.FNVFAAPAAV...TLE...------------...........------AVEFALS....ALIL.---RLENANS...N.
Q72BY4_DESVH/118-395...SAGKVGAT...GQAATV------------...........------.TYDDLV....DLEH.---SVDPAYR...A.
B2JU92_BURP8/137-421......KSGAL...IVVAKD------------....SGQATNT------LTPTNIS.........---NMISRLP...VG
Q81Z09_BACAN/121-392...FE.........GQALDV------------...........------...AKINYKTLTDAEA---ALPLEYE...AS
Q3SS55_NITWN/107-382....DISIVAT...GNASTL------------.........GS------GPADMLI....DTFY.---SLPAAYR...N.
Q2GDU5_NEOSM/81-367.TGKQICKITS...KEKDKI------------...........------.TPADIL....SLYY.---GLQREFS...V.
Q3SSD8_NITWN/135-418YAWGKLGYVVS...GVAAAM------------......TDSSH------NGADALT....DLVY.---SIKQGYR...Q.
A6VNQ3_ACTSZ/129-407....VTGTTTS...KTTGKV------------...........------.DWLDIN....ALLH.---SVDPAYR...N.
A5N291_CLOK5/33-297...............ADADV------------....TTADNST------ISFDEII....SLYF.---SLKDEYR...N.
Q5WID4_BACSK/129-404....................------------....NDKFKKI------DAPDEVTIKFLRRVKN---SIVQGYR...RN
A4XZF1_PSEMY/131-410...AAGKVGAT...GKATSV------------...........------.GWEDLV....DLEH.---SVDPAYR...R.
Q2N5Z6_ERYLH/94-380RSFGTLQYVGT...GDDAGF------------.........GS------NPDAKLI....DLVH.---TMKAGHR...Q.
Q2GJL3_ANAPZ/114-389.GPGQIERVKV....E..TL------------...........------N.TDAII....KLFY.---SLNENFS...S.
A9BYD9_DELAS/120-394.....TQATPY...VNPGVV------------V..QAETRI..------...DRLRLALLQVELA---DYWADG......
Q5Z3V6_NOCFA/148-434....GVQTQAF...DTDLF.------------...........------...TSVRKAITKARTV---GRVNPNG.....
A5CD71_ORITB/88-365..EYGIEIIPC...HKIDL.------------...........------...EALL....SLIN.---SLDDYYH...A.
A8FGQ6_BACP2/20-302.....KQAVTH...IVDANG------------...........------...AEISRQMLKQAYK---AMPSKYLRVPQD
A1TD88_MYCVP/110-388....LMGSDSV...VNSAVT------------...........------...DTFAAGDVHNLDG---DLPQRYA...FN
A9CJN8_AGRT5/134-419WNWGNIGYVAT...GVSAGF------------........ASA------GPMDVLL....DAVY.---ALKAGHR...Q.
A3DG61_CLOTH/127-416......NSDAL...VTVPKE------------....KDQGAGT------IKYENIL.....KMWS---SMPARLR...AN
Q2SDM1_HAHCH/110-393REFGKLQRVIS...GKAGDF------------...........------.NADNLL....SVIY.---RLKKAFR...R.
B2JL19_BURP8/113-379.....TQAAPF...APTDPA------------.....LNGV..------...DNIRLAMAQVQAA---FYNPTF......
B7GIM9_ANOFW/146-418....PA.QNQV.........------------.....TIEADN------NLLKNLV....KQIG.---LIDTGTD...S.
B9KI56_ANAMF/104-375....ED........GKDEGQ------------I...ERVSAKQ------LNSDAII....SLYY.---SLDEYFA...GR
C5AYR6_METEA/135-420WASGRLGFIAT...GAAGAF------------........PAS------NPSDVLF....DLIY.---ALRAGYR...Q.
P71947_MYCTU/196-475....LTGTADY...TVTGAG------------........TEA------VVAADVY....ALQS.---ALPPRFQ...S.
Q2FX56_STAA8/38-311.....IA.QSI...EKTN..------------.....KVIKGD------FTQDNII....DLEAL---LEDDELE...A.
Q2G1W8_STAA8/130-399.....GKKLEV...KKAK..------------...........------.SLDDIK....DAINL---NVKPNYE...H.
Q3J3W7_RHOS4/239-509.....AGIATL...SGGAGT------------...........------ITVASLI....EAYH.---AIPTVYA...Q.
Q81X82_BACAN/69-344.....TVAEVV...GTHE..------------........AGK------ISLDNLL....DMTL.---AVHPDHL...A.
Q81XY0_BACAN/102-381.....AAATAI...DSETDL------------....EISAIDA------STLDEII....YSYG.---.GDEDVE...D.
Q88MK4_PSEPK/141-410.....PQATAF...NNALRK------------........AGD------TKIDTLR....RAILQ---VRIAEYR...A.
Q9CFS0_LACLA/124-389.....EVMKAA...PKKPTI------------...........------AKFDDVI....TMINT---AVDPAII...A.
Q9P9R2_XYLFA/357-623.....SGINAV...SFAQK.------------.........GQ------PTFAELV....QMET.---QIALNNA...DV
Q9ZWV6_BPPHC/121-387.........AT...GANAAF------------....GEADADS------KVSDALI....DLFH.---EVPSAYR...K.
W6SDV8_9CLOT/124-396.....TGGAQL...GVTAGS------------........ATA------ITADEII....DLVY.---SLKAPYR...K.

PF06673

Q9MCB6_9VIRU/1-347RVIQKVEHNMI---LGSADG------------SNGFYGLKTATDGWTKQIEYTDLFDGITDAVAE-------------CS
Q9MCB8_9VIRU/1-347RVIQKVEYNMI---LGSVDG------------SNGFYGLKTATDGWTKQIEYTDLFEGITDAVAE-------------CS

PF05125

D3UZQ7_XENBS/11-324GG....KQVIT---T.................PVTL.DQ..HG.......DHKSLDSMASDLINT---CIPQQFIHDPRL
A6TE73_KLEP7/8-340AP....TRVMS---KIVDEEGNVVSA......VIRV.GK..NG.......DYVNLDALVMDATDN---LIDEIYQEDAEL
D5CFH7_ENTCC/11-326DG....KQIMT---D.................PVVL.DQ..AG.......DYKSLDAMASDLINA---KIPAQFRNDPRL
M9X6X0_PASHA/8-336AK....ERVMN---GESTDN............QVLV.GK..GQ.......EYANLDALVMDATEE---LIDEWHRDDTDL
Q5E389_VIBF1/11-331NP....DAMLT---QGETAN............EIRI.GE..GG.......DFINLDLAVMNVK.G---LLADECANANDL
Q2S7I3_HAHCH/8-327SG....SQWFV---EGATAG............QIRI.GE..GG.......DFANLDAAVHACL.Q---MVDELHRDGGDL
Q15Y13_PSEA6/12-335AA....AQVLT---EGDTAG............KVIL.GA..SG.......DFENLNSIVHGAL.S---MIPEEHADSGDL
H2IY53_RAHAC/8-339AA....QRVMK---DVTVTSRDDTN.......QVVA.....KG.......DYGNYDSIVFDAVNS---LMDEWYKDSPDL
B8J319_DESDA/15-323LP....ANILT---EGEHAG............EIRI.GK..GG.......DYSCLDVAINDMV.E---GIPYYLQK..DL
W8UNE7_YEREN/11-324KG....NQIIS---T.................PVTL.DE..KG.......DYKSLDAMASDLIND---KIPQQFRNDPRL
C1DBL5_LARHH/8-337AP....ERVMS---EVAESSG...........KVKI.GPAVTG.....AEGYRNLDALVFDAVEN---LIDEAFAEHPDL
E6WE37_PANSA/8-338SP....VHVIK---GIPQDDGSLSS.......SIRV.GK..NG.......DFANLDALVMDAVNR---KIGVQYQDDTDL
C5BH00_EDWI9/18-332DNEGRVSRILT---T.................PVTV.GE..GG.......DYISLDAMASDLIHA---SIPPQYHNDPRL
B2FIZ5_STRMK/8-334AP....ERVMK---EGAAGSG...........KIKVGGT..DA.......DYGNIDALVMDLVAN---LIDPWHQDDTSL
C1DS28_AZOVD/8-332NA....ARVLA---EVVADSD...........EITI.GA..TG.......DYKNIDALVFDLVAD---MLEPWYQEDTDL
Q8XY26_RALSO/8-332AP....QRVME---EGKKAAG...........KIIV.GA..GG.......DYGNLDALVFDVVNQ---LVEPWYAEDPEL
D8MKI1_ERWBE/9-341AP....QRVMT---GAKLTSRDDSN.......KVIA.....KG.......DYGSLDSLVFDATSS---LLDEWFKSSDEL
F6IH75_9SPHN/8-355AG....SRVLN---DGDLSVDPTKAIYVAAGVEVVD.GD..ATNTASAEADYANLDALAFDAL.D---LLDPWHRSDTDL
J7TAL9_MORMO/8-339AE....AHVIS---DVRDDAGNVISA......VIRV.GK..DG.......DFNNLDALVMSAVDE---VIDEEYRDDTEL
B2VH98_ERWT9/8-339KP....SQVIS---QRIDNSGKVVAG......NITI.GK..GG.......VFNNLDAVVMGAVSE---KIAVQYQDDTEL
F4HA06_GALAU/6-327KP....ENVMK---DGATVG............KIKIFGE..GA.......DFENLDHLAAELK.S---GIDLRHRDRNDL
G0AIP5_COLFT/8-331AP....QRVMS---QGEAKPG...........KLLI.GT..GG.......DYLNLDAAVADGI.N---LLDPWYQEDTGL
D5CB73_ENTCC/8-338AP....DHVMG---STTKDGATTAG.......AVKV.GK..GG.......DYANLDAVVMDAVNE---LIDAVYQDDDDL
F0LXI5_VIBFN/8-332NA....ERLIT---EGVEGSG...........VIQI.GE..GG.......DFANLDLAVLNLK.N---LLHPACENDSDL
B0UTP6_HISS2/8-335AP....ERVMT---EDKKSSG...........KIEV.GE..GK.......TYKNLDALVFSAVSD---LIAPQFQDDTKL
VPN_BPP2/8-340AP....ARVMS---KVTDEEGRTTSE......VIRV.GK..GG.......DYASLDALVMDATNN---LIEPWYQEDPDL
H2IRH6_RAHAC/8-340AA....ERVMD---KITDDTGAVVSD......TVRI.GV..KG.......DFENIDAAVMNATDF---LLDAWHSEDPGL
B4F0K8_PROMH/8-339AP....EHVMG---SETKDGATTAQ.......PILV.GK..GQ.......AYQNLDALVQDTVDT---AIDPEYQDDTGL
B0UW33_HISS2/6-327KS....ANVYT---GNSSH.............KINLYGT..DA.......EFANLDELALDLK.Q---GLDLRHQNRTDL
E6VXL3_DESAO/8-324LP....ANILI---EGATTG............EIRI.GT..TG.......DFANLDHAVSDLL.Q---GIPRYLRK..GL
A6VSU1_MARMS/18-341DG....QQYLK---ATAEV.............PIVLGSD...........SIKNLDVLVHQAK.Q---MLPIYHRKRKDL
C5AGA6_BURGB/8-333AK....DRVIS---EGKKGSG...........KLVIGGA..DG.......DYKNLDALVYEATNS---LIEPWYAESPEL
J7SK37_MORMO/10-341AP....QRVMK---NISLTSRDEDG.......KIIK.....KG.......SYANIDAVVYDAVNN---LIDPWHRNAAGL
R9VFP8_9ENTR/8-340AP....ARVMD---KVVDDTGAVIST......TIKV.GK..KG.......HYKNLDALVMDAHET---LIAEIHRENPEM
W0L880_SERFO/8-339SP....QRVLA---EITVTSRDEDN.......VIIA.....KG.......DYGNLDSLAYDAVNS---LIEPWFQDDTGL
Q1QXQ6_CHRSD/8-331AP....ARVMT---GGATAD............TVQV.GK..GG.......DYVNLDALVYDAVNS---LLEPWYRRVPGL
C5BAR3_EDWI9/8-332AP....ERVMR---EGVEDSG...........KIII.GR..GG.......DYENLDAMVNDGEEN---LIDEWHVDGADL
F4HB41_GALAU/8-340AP....LKVMD---GKNSEN............KIKV.GK..GQGTGEDAKGYENLDALVFDATNK---IIAEEYADDTEL
Q63LE5_BURPS/8-332AA....QRVLH---EGAKQAG...........KVLI.GK..AG.......DYENLDALVMDIVSS---MIDPWFQEDTGL
A7MN35_CROS8/15-328NG....KQIMA---E.................PLTL.GE..TG.......EWKNIDLLANHLITN---FIAEPFREDPRL
A1VSG1_POLNA/8-331AP....TRVMD---EGAVPG............AVSV.GA..SG.......DYKNLDALVFDAAQT---LLDPWYQNDGGL
F0LQ00_VIBFN/14-328KA....AQVLA---..................TAVL.DP..TGTTED...SYKNLDSLAQDLINT---TIAPEHREDPDL
Q6D3X2_PECAS/8-339AS....HRRIS---DVTITARDEDN.......KVIA.....KG.......TYGNLSAAVYDAKNS---LMDEWHKRNPDN
VPN_BPHC1/5-328RA....ANFMT---ESTKSSG...........KITIFGD..NA.......DYANLDDLAFDLK.Q---GLDFRHQNRNDL
D8J087_HERSS/8-337SP....QRVMG---LVGPELPG..........KVVI.GSGEGA.......DYANLDAAVYDAVTN---L.DPWYQDDTSL
H2FUC0_OCESG/13-333GG....SQIIG---SAQS..............KVYF.DPDGNG.......DYNTLDAMASDLINS---TIDPAFRNDPRL
Q8P6J5_XANCP/8-334AA....QRVLA---SGKTAG............KMVI.GAGDGA.......DYRNLDALVFDVVSN---LLDPWHRKDPSL
E0SAM8_DICD3/25-338DG....QQIIT---D.................RVVL.DE..NG.......DYKSLDAMASDLINA---KIPQQYRNDPRL
D3VKM6_XENNA/8-339AP....DHVIS---SITDDQGKVISA......VIRI.GK..GG.......DFHNLDALVMDSVNN---AIDAEYQDDTEL

PF11651

B7KXS0_METC4/1-419SGFLRGTTRMN---NGSVPKD.NRFCMLSPDDEAGLADSQTKFLNDK..LVGEAYRDGAV.GRIAQVDTYMSQNVPVHVT
A5VES4_SPHWW/1-413QDFAPAPQRLD---EQGVMSD.GRTAILSPADQWGMLGSQTNLYIQG..AASDAYRKGDL.GTIGGIDTRMSQNVQSITT
E8NPD4_SALET/1-428DFVSDAERLMF---SRELNRDMGISYFLNPDDYRKAGRNLVDGDIFG.RVPEEAYRNGTIQRQIAGFDEILRSPKLPAVT
B2U8F8_RALPJ/1-419NTFLSANARLN---KLSAPG..NRKIVLDPITEARMVGSLAGLLNPS.NEISEQFLTGQM.KRGLGFTWMMDQTVLAHTT
A5VW72_9CAUD/1-416NCAAGIDATMT---AIGVPQGINRRSFWNPFNYKDLAGELGHRAYAQ.GATLTAYEKAQI.PPVASFDSYKTDISGRLPK
A4E782_9ACTN/1-291ADIIAARKFLV---DAKAPST.ERRFVYGSQAEADLLNTEAFTNASAVGDNGTALKEASL.GRKYGLDFYCDQNVQKTTA
A4JD31_BURVG/1-395STWLLAGAALD---QALAPRM.DRKIILDPLTQARTVGTLAGLLNPQ.RKISDQYETGMITTDTLGFDWMSDQTTKVHTV
Q2G3Y7_NOVAD/1-418DDVADIDSRLT---RIGVPTD.GRMAFYSPTNMNAMAGNLAGRSEAT.ERSRTAFERAMIRSDVAGIEVFKNDQEIRLAA
B0U721_XYLFM/1-409PPWRAAASVLD---NHLAPEA.DRCAHFSTDANDALAETNVTLFHTS.DEIRGEFSKNAV.GMFAGLEFYKQLALPTHTN
E9Z5W1_ESCFE/1-421SDVAQTASFLK---DLGVNEG.ENYAVMDPWSAQRLADAQTGLHASD.QLVRTAWENAQIPTNFGGIRALMSNGLASRTQ
Q5YSR9_NOCFA/1-303EVLIEAGRQLD---IKNVPSM.GRHAVVGPTARAKWLNSDLLKVPDG.VGSTAALRQGSIGRNLFGFDAYMTQNIVQPAT
A0A017QUU9_SALET/1-427NFVADAEEIMF---SRELNRDMGTSYFFNPQDYKKAGYDLTKRDIFG.RIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLT

PF09950

Q9P9P2_XYLFA/84-327VEMIDTVLLPGRVM-NY--------------------------------------LV--STP---RSDNS...DKTIL..
E1VAC6_HALED/80-318YHTPNTLALAPTRR-SA--------------------------------------LM--RKN---VNEGG..NWESVW..
A9C0G0_DELAS/60-320TELADTILLPVEAF-NY--------------------------------------IA--ATP---YSATT...METIL..
A6TKD0_ALKMQ/60-304..TVDTLLLPPNQY-ED--------------------------------------LD--KPV---NAENY...NMTIR..
H6NDU4_9BACL/55-298MTAPLALALPPNQF-EI--------------------------------------LN--SRY---NEYDS....RTVL..
Q7N327_PHOLL/62-316RIQPTHVAIDASDF-M.--------------------------------------LA--MQK---FDTNSVIVGVDLLPV
Q6FAE7_ACIAD/80-324SVQPDTYLMASNQY-SS--------------------------------------LS--NRV---VPDSG...GKTFL..
R6PG10_9CLOT/91-341VERPDTLALPTDVF-ID--------------------------------------IA--TRR---IDHTN....TTVK..
G9ARJ4_PANAN/73-313SVVPTELRVPPEQY-AL--------------------------------------LA--SRK---VSEAG...NMSLL..
B4EG48_BURCJ/103-345AVCPERLLIDPLNF-SR--------------------------------------LN--SEI---VSSAG...NISIL..
C5AFU5_BURGB/112-366KVKPNRLMLPPAQL-GW--------------------------------------VA--SQV---ISSAG...NKSIL..
R6AF56_9FIRM/26-279DGMPNHILIPPQQY-TL--------------------------------------LV--TRK---VSEAG...NCSLL..
K8E4M7_CARML/57-293RTASLKMLVSSTQY-EE--------------------------------------LN--RRY---SDFDS....RTIL..
E3HGR1_ACHXA/80-315VHTPTRIVMPTEQR-SK--------------------------------------IF--SRR---VPDAN...GKTVG..
C9LU84_SELS3/82-338SAIPNHILIDPANF-AY--------------------------------------IN--RTM---VSVNGYPTPVSIM..
R7JXV9_9CLOT/86-336IEKPDTLALPSYIY-MD--------------------------------------LS--TRR---IPDTE....TTVL..
B8IDG5_METNO/63-315VEMADTLLLPYEQM-LG--------------------------------------IG--LRR---IDSLS...PITIL..
R6R1V3_9FIRM/101-351VEHPDSWVMPNDLY-TA--------------------------------------LN--LRR---IDGTG....ESVL..
H8L668_FRAAD/90-334AVCPTKVLIAPAKY-SI--------------------------------------L.--TQP---VSEAG...NISIL..
R6RQ09_9CLOT/93-346DAVPNHIIMPYEQF-NY--------------------------------------LA--TTK---VTDLA...EKTIL..
Q0BRS5_GRABC/66-316VEMADTVLLPVDRW-LK--------------------------------------LS--QTR---IPATS....ETAL..
Q2NSP7_SODGM/17-247....THIVLPQALY-DD--------------------------------------IS--ITL---SNPNT...NLTVL..
B8IIV0_METNO/63-315VELADTVLLPYDQM-IA--------------------------------------LS--LRR---IDPTS...QMTLL..
Q6XQD3_BPT1/82-319QHRATNILIPPSMR-KV--------------------------------------LA--IRM---PETTM.....SYL..
A9I906_BORPD/80-320VHTPNVLAIPSTQH-AA--------------------------------------LY--SKR---LSDSG...GLTVG..
Q2G4R3_NOVAD/111-362THIANTLALPTSRY-NY--------------------------------------IA--TTR---VGDTN....ATIL..
W8UFX7_YEREN/64-311VHRPNGFVLPSEQH-QL--------------------------------------LM--RTL---LSTHN.ASNVTLL..
A7ILG8_XANP2/103-352VAPPTKLALSPTAF-GY--------------------------------------IS--TTI---ASSAA...NATIL..
Q32EP9_SHIDS/73-313SVVPRDLLILPEQF-AL--------------------------------------LS--SII---VSSAG...NQSLL..
G2IHV9_9SPHN/64-315TEMADTLLLPTSSF-LD--------------------------------------AS--TAR---VGDTG....MTVL..
Q835B4_ENTFA/57-293KGSSLKLMVAPEQY-EE--------------------------------------LN--RRY---GEYDA....RSIM..
D0UIJ0_AGGAD/58-304IEAPNTFAIDSLDL-AH--------------------------------------LA--LVQ---RANTD....TTAL..
Q984H1_RHILO/86-339NELADTILLPYSIM-LD--------------------------------------LS--QRR---IDTVN...QTTIL..
Q2NRY5_SODGM/73-317AVVPDKMLVSPDEY-AL--------------------------------------LV--STI---VSSAG...NRSLL..

PF04454

D4H156_DENA2/1-251IASGANLVVNPALW-QF--------------------------------------LA--HVV---P..GG----------
C8WPL7_EGGLE/1-257YLGRYALVVSPDLF-LD--------------------------------------LQ--RLQ---PNTGL----------
D0LZ74_HALO1/1-251VTGPYALVLGPKAY-DD--------------------------------------LF--AAT---QD.GY----------
D1B7I4_THEAS/1-249VEGPFALVGGDKLF-AA--------------------------------------ID--GFS---EP..Y----------
A1B987_PARDP/1-251VNGPYALILGTTAF-TA--------------------------------------AN--GGA---ED.GY----------
A3DFK3_CLOTH/1-257IVGRKALVVSPNLF-VQ--------------------------------------LQ--RIQ---PGTGT----------
A6TWC5_ALKMQ/1-250VDQPVTLVVGIDAW-KR--------------------------------------IN--REM---Q..GH----------
A7HIB4_ANADF/2-255RHGPYALAVSPGRF-YQ--------------------------------------LL--RPY---PGTAL----------
A7I7A2_METB6/2-249FHGPYSLALAPAQY-NL--------------------------------------LL--RRY---PQGDG----------
A8F8I8_THELT/3-247FHGPYLLALSPDRY-NL--------------------------------------LF--RRY---ESGNQ----------
A8L1F1_FRASN/1-253IGGPYGLAIDPDGY-TA--------------------------------------IL--EAT---EHGGY----------
A9BEM3_PETMO/1-251IEGPYTLVINKELW-QD--------------------------------------LF--TMN---LS..Y----------
A9FWS5_SORC5/3-254VDGPYALALGPKAY-DE--------------------------------------LA--AAA---ED.GY----------
A9H5P1_GLUDA/1-251VNGPYAVVLGAGVY-TA--------------------------------------LS--GGD---DE.GY----------
B1VSP7_STRGG/1-251VDGPYRLLLGADAF-TE--------------------------------------AA--ETS---DH.GY----------
B2A6K6_NATTJ/8-259ISQNMTLIVGEEAW-RK--------------------------------------IN--KEM---S..GE----------
B2GID2_KOCRD/1-252VAGPYNLLLPAELY-TE--------------------------------------VT--ETT---DH.GY----------
B2JNZ6_BURP8/1-251VDGPYSVLLGADAY-TA--------------------------------------LG--EAS---DQ.GY----------
B2V6Y3_SULSY/1-265FYNNFALVLNPQDY-AM--------------------------------------LN--RLY---GNSGI----------
B4UA40_HYDS0/1-265FSKNLAYILNPKDY-TK--------------------------------------AF--RIY---GNSGV----------
B8CYH7_HALOH/1-249VNGPYTLLLGPELY-HS--------------------------------------LY--TRN---DR.GY----------
B8EQK3_METSB/1-251VNGPYAVLFGAEAY-TA--------------------------------------LA--ETS---DH.GF----------
B8GHL2_METPE/5-250FHGPYALALSPARY-NL--------------------------------------LF--RRY---PQGST----------
B9JHD1_AGRRK/1-251VNGPYALVLGTEAY-TA--------------------------------------AS--GGS---DD.GY----------
C0R0J8_BRAHW/1-256IVGRFVLCLSQSLY-FD--------------------------------------LQ--RIQ---QGTGM----------
C0ZHN4_BREBN/1-265HSGPYALVVSPELY-SL--------------------------------------LH--RVH---KGTNV----------
C0ZVK4_RHOE4/1-251VNGPYSLLLNADAF-TA--------------------------------------IN--ETS---DH.GY----------
D5UVK7_TSUPD/1-251VDGPYSVLLSADVY-TR--------------------------------------VS--ETS---DH.GY----------
C4XPM7_DESMR/1-251VEGPYALVVGPELW-VA--------------------------------------LS--GHV---R..GY----------
C5B5H8_METEA/1-251CNGPYVLVLGGDVY-RA--------------------------------------AS--GGN---EE.GY----------
O67639_AQUAE/1-267FYTNYYLIVNPKRY-FL--------------------------------------LN--RIH---DNTGL----------
Q08WR7_STIAD/2-266HYGPYAVVLSPRLY-SL--------------------------------------LH--RIF---EKTGV----------
Q0RH88_FRAAA/1-253IAGPYALALEPDSY-TA--------------------------------------VI--ETA---EHGGY----------
Q2RVS0_RHORT/1-258VDGPYALVLGRTVY-QQ--------------------------------------LM--ETT---TPGGY----------
Q5YPL3_NOCFA/1-252VDGPYSVLLSAELY-TE--------------------------------------VS--ETS---DH.GY----------
Q7MSM9_WOLSU/1-252IEGPYALLIQPQYF-GK--------------------------------------LF--GVA---GNSGY----------
Q97V86_SULSO/96-329FGKDVYILMSSLNY-SK--------------------------------------TF--RVV---DRSGT----------
B2HH42_MYCMM/1-251VDGPYSVLLAADVY-TK--------------------------------------VS--ETT---EH.GY----------
Q0SE23_RHOSR/5-254VEGPYSVVLDADAY-TA--------------------------------------VS--ETR---DE.GH----------
Q2IH48_ANADE/1-259RHGPYAAAVSPARF-YQ--------------------------------------LF--RPF---AGTAL----------
Q5L1H9_GEOKA/8-264HTGPYALVLSPELY-AL--------------------------------------IH--RVH---EGTHV----------
MARIT_THEMA/1-251IEGPYTLVINTDRW-IN--------------------------------------FL--KEE---AG.HY----------

PF05065

E0THR4_PARBH/115-394NG..R.FMMNRSTL.AS--------------------------------------IR..KLK...D.TEG----------
Q1GG15_RUEST/131-399......HVMHPTDW.AR--------------------------------------IE..LTK...D.GNA----------
Q1DCZ9_MYXXD/94-361GN..AAWVLHPTRA.TA--------------------------------------LL..QLQ.....NSG----------
Q0AAI8_ALKEH/83-374NA..R.FMMSRATM.NK--------------------------------------IR..KLR...D.GDD----------
Q3J4R6_RHOS4/160-429......MVLNEIDW.AL--------------------------------------IE..TAK...D.SEN----------
A1T829_MYCVP/9-278GGTITSFVANPETA.LT--------------------------------------LA..QLK..RSGDSN----------
Q982R8_RHILO/176-465NA..S.YLSTDATM.AK--------------------------------------IR..KFK...D.GQG----------
A1AYY2_PARDP/166-435......IVLHPTNW.AQ--------------------------------------IE..LTK...D.GEF----------
Q1ILS6_KORVE/495-776LIAPG.IATTPGVK.KK--------------------------------------LR..NTA...E.LSN----------
Q1GH34_RUEST/388-661VNSMA.YVQNAKMR.GH--------------------------------------FK..STQ...K.FSG----------
Q2GAM7_NOVAD/185-459......IVMHPSDW.AD--------------------------------------IE..LTK...T.DDG----------
Q8XYS4_RALSO/130-408APMYR.LAFNDQTL.KV--------------------------------------LE..ELV...D.GNG----------
Q3J3K4_RHOS4/110-395NA..T.FVMNSKTA.GA--------------------------------------VR..KMK...D.SDG----------
Q1QLS4_NITHX/103-379RG..V.WLMNSKTI.AA--------------------------------------VR..KLK...DGSTG----------
Q8ED08_SHEON/122-393......IVLNPIDW.AV--------------------------------------IE..TLK...D.SNK----------
Q813J9_BACCR/150-424AR....WVLNTAAL.TK--------------------------------------IE..TMK...T.DDG----------
Q3J5Z4_RHOS4/150-439MVSPG.WIMRASTK.NW--------------------------------------LA..SLK...D.ANG----------
A1B638_PARDP/102-387NA..S.FVMNSKTA.AA--------------------------------------VR..KMR...D.ADG----------
Q0AWY3_SYNWW/43-310NG..V.WLMNDETA.LA--------------------------------------LR..TLK...D.DGG----------
A4YU30_BRASO/140-423PGGNPIWLANRDTI.PQ--------------------------------------LG..TMT.....IGN----------
Q2NV28_SODGM/127-397......HVLHFTNW.AQ--------------------------------------IE..LIK...D.TLG----------
Q1GHS2_RUEST/113-395GA..S.FVMNSKTA.GL--------------------------------------IR..KLK...D.ADG----------
Q2L2B0_BORA1/123-401APKFR.LAFNDATL.QI--------------------------------------LE..EME...D.GNG----------
A2SD63_METPP/97-385GA..S.WVMNRSTA.AT--------------------------------------LR..KLK...T.TDG----------
A1TML8_ACIAC/138-428MSSCG.WVMAPRTI.RW--------------------------------------LG..SLR...D.GNG----------
Q1QKG8_NITHX/112-388RG..T.WLMNARTL.AA--------------------------------------IR..KLK...DGTTG----------
Q0S2A4_RHOSR/9-273GAELTHIVLAPDVA.LA--------------------------------------LA..KAK..TATGSN----------
Q6LSF8_PHOPR/134-417SPGVG.YMFHDTTL.EA--------------------------------------LR..VIK...D.KND----------
A5N1H4_CLOK5/152-424IGEVI.AVMKRSFYYSQ--------------------------------------IAPQTFL...PTSDG----------
A7HRJ6_PARL1/148-433NG..R.FVMNRSTQ.SS--------------------------------------IR..KFK...D.TDG----------
Q2YMS9_BRUA2/137-422NA..N.FVMNRKTQ.SV--------------------------------------LR..KLK...D.KDG----------
Q73HT5_WOLPM/107-395NA..S.FLMNRSTL.KD--------------------------------------IR..LLK...S.QTG----------
Q9A4P7_CAUCR/53-338NG..R.FVMNRRTV.SA--------------------------------------VR..KFK...D.AQG----------
Q3Z7J9_DEHM1/124-397KA..I.WILNDTTI.KA--------------------------------------LR..KIK...D.NNG----------
Q830G6_ENTFA/163-444GR....FIINRAAL.TA--------------------------------------IE..KMK...T.DDG----------
A7MP72_CROS8/125-401SPKFR.FAFNDNTL.LK--------------------------------------IS..SMK...D.AQG----------
A7ILP2_XANP2/167-448NG..S.WLMKRGTV.GS--------------------------------------VA..LLK...D.AQG----------
B0T632_CAUSK/96-391AT....FVTGSDIE.LQ--------------------------------------LM..LVK...D.STG----------
Q11H37_CHESB/111-386NA..T.WALNSTTL.AL--------------------------------------VR..KLK...D.SQG----------
Q88G49_PSEPK/193-483MTSPG.FVMAPRTK.RW--------------------------------------LA..ALR...D.GNG----------
Q72BY4_DESVH/118-395LG.AR.WMFHDLTL.KA--------------------------------------VK..KLK...D.GDG----------
B2JU92_BURP8/137-421SFGRSFWLINPDVL.PA--------------------------------------LD..NLT.....LGN----------
Q81Z09_BACAN/121-392AI....WTMTKKTF.ME--------------------------------------FS..AMT...D.ADG----------
Q3SS55_NITWN/107-382AG..T.WLMNSTTL.AA--------------------------------------IR..KLK...DGTTG----------
Q2GDU5_NEOSM/81-367NG..T.FLMHSTTI.QL--------------------------------------IR..GLK...YEQTG----------
Q3SSD8_NITWN/135-418NA..R.FLMNRKTQ.AA--------------------------------------IR..KFK...SKTEE----------
A6VNQ3_ACTSZ/129-407VGNSR.LAFNDNTF.KA--------------------------------------LK..ELV...D.GQN----------
A5N291_CLOK5/33-297NA..V.FIMHDNTA.ML--------------------------------------LR..TLK...D.TSG----------
Q5WID4_BACSK/129-404AV....WVMNTEAF.ET--------------------------------------LA..NI....EDKNG----------
A4XZF1_PSEMY/131-410SGNCS.LMFHDTTL.RE--------------------------------------LK..KLK...D.ADG----------
Q2N5Z6_ERYLH/94-380GA..S.FVMNSATL.AE--------------------------------------VR..KLK...T.ADG----------
Q2GJL3_ANAPZ/114-389RA..A.FLMNRSIL.QE--------------------------------------IR..SLK...S.NTG----------
A9BYD9_DELAS/120-394......IVISPLDW.AA--------------------------------------IE..LTK...T.ADN----------
Q5Z3V6_NOCFA/148-434......IVVNPADA.EA--------------------------------------ID..LAK...D.ANE----------
A5CD71_ORITB/88-365NS..T.LLMHRTTL.AK--------------------------------------IQ..TIQ...D.SSG----------
A8FGQ6_BACP2/20-302FR....FYTSPSLEVEW--------------------------------------KD..QVANRQT.TLG----------
A1TD88_MYCVP/110-388AS....WLAHRKIY.SK--------------------------------------IR..QF....DTNGG----------
A9CJN8_AGRT5/134-419NG..T.FLMNRKTQ.GA--------------------------------------LR..RFK...D.TSG----------
A3DG61_CLOTH/127-416AV....WYINQEIE.PQ--------------------------------------LY..TMALNIG.AGG----------
Q2SDM1_HAHCH/110-393NA..N.WMMTGTTV.EK--------------------------------------VR..KFK...D.ADG----------
B2JL19_BURP8/113-379......AVMNPLDW.AS--------------------------------------IQ..LMK...N.AQG----------
B7GIM9_ANOFW/146-418VGEIV.AVMKRSTYYNR--------------------------------------LV..EFSIQVD.SNG----------
B9KI56_ANAMF/104-375GA....FIMHRSVL.QA--------------------------------------IR..SLK...S.GSG----------
C5AYR6_METEA/135-420GA..S.FVMNRRVQ.SA--------------------------------------IR..KFK...D.ADG----------
P71947_MYCTU/196-475NS..A.FAANLSTI.NV--------------------------------------LR..QAE...T.ANG----------
Q2FX56_STAA8/38-311NA....FISKTQNR.SL--------------------------------------LR..KIV...DPETK----------
Q2G1W8_STAA8/130-399NV....AIVSQTMF.AK--------------------------------------LD..KMK...D.KLG----------
Q3J3W7_RHOS4/239-509NA..V.WVMNRTTL.AK--------------------------------------LR..TYF...N.GMG----------
Q81X82_BACAN/69-344GS..V.FVMGRPAF.NQ--------------------------------------VA..KLK...D.AQG----------
Q81XY0_BACAN/102-381AA..V.LILNKLDL.KS--------------------------------------FA..KLR...T.SDG----------
Q88MK4_PSEPK/141-410SA....IALNPVDW.AD--------------------------------------IE..LTK...D.ANG----------
Q9CFS0_LACLA/124-389TS..S.LLTNQSGL.NK--------------------------------------LA..LVK...T.AEG----------
Q9P9R2_XYLFA/357-623NA.MS.YAFNAGIR.GY--------------------------------------AK..TAL...K.FPQ----------
Q9ZWV6_BPPHC/121-387NA..K.FVVNDLRA.AQ--------------------------------------MR..KLK...D.ANG----------
W6SDV8_9CLOT/124-396NA..V.FLMNDATV.KA--------------------------------------IR..KLK...D.GQG----------

PF06673

Q9MCB6_9VIRU/1-347ISDAITIVMSPQTF-AE--------------------------------------LR--KAK----GTDG----------
Q9MCB8_9VIRU/1-347ISDAITIVMSPQTF-AE--------------------------------------LR--KAK----GTDG----------

PF05125

D3UZQ7_XENBS/11-324VVLVGADLVAAEQY-RL--------------------------------------YQ...SA---DRPTE----------
A6TE73_KLEP7/8-340VAIVGRKLLADKYF-PI--------------------------------------VN...KD---QPNSE----------
D5CFH7_ENTCC/11-326VVLVGADLVAAEQY-RL--------------------------------------FQ...AA---DRPTE----------
M9X6X0_PASHA/8-336VVITGRKLLADKYF-PI--------------------------------------VN...QQ---NAPTE----------
Q5E389_VIBF1/11-331VALIGSDLLAYDKA-KF--------------------------------------YTAHGNT---PSEKS----------
Q2S7I3_HAHCH/8-327VVIMGRDLLAEDKA-QL--------------------------------------YAAQGHK---PTEKE----------
Q15Y13_PSEA6/12-335VAIVGRDLITRDKG-RR--------------------------------------YAQHGEL---PSEKQ----------
H2IY53_RAHAC/8-339VVITGRNLTVNRSF-PI--------------------------------------INAVSTN---NPNSE----------
B8J319_DESDA/15-323VALIGRDLIVRERA-ML--------------------------------------FEAVQGT---PTEKA----------
W8UNE7_YEREN/11-324VVLVGADLVAAEQY-RL--------------------------------------YQ...KA---DRPTE----------
C1DBL5_LARHH/8-337VVIVGRSLLADKYF-PI--------------------------------------IN...KD---NPPTE----------
E6WE37_PANSA/8-338VVVCGRGLLADKYF-PL--------------------------------------VN...QQ---QPNTE----------
C5BH00_EDWI9/18-332VVLVGADLIAAESL-RL--------------------------------------FN...KE---DKPSE----------
B2FIZ5_STRMK/8-334VVICGRSLVHDKYF-PI--------------------------------------VN...GN---NTPTE----------
C1DS28_AZOVD/8-332VVICGRQLLADKYF-PI--------------------------------------IN...QN---HAPTE----------
Q8XY26_RALSO/8-332VVLCGRNLLADKYF-PL--------------------------------------VN...KD---RDPVQ----------
D8MKI1_ERWBE/9-341VVLCGRNIVTAREF-PL--------------------------------------INGISES---NPNSE----------
F6IH75_9SPHN/8-355VVIVGWKLVKDKYL-NL--------------------------------------LQ..AAG---ETATE----------
J7TAL9_MORMO/8-339VVICGRKLLSDKYF-PL--------------------------------------VN...KE---QENSE----------
B2VH98_ERWT9/8-339VVICGRQLLADKYF-PI--------------------------------------VN...KD---QPNTE----------
F4HA06_GALAU/6-327VFLVGADLIGKEAE-LI--------------------------------------NKAHGLT---PTEKA----------
G0AIP5_COLFT/8-331VAFVGRKLLNDKYF-PL--------------------------------------IN...TK---QAPTE----------
D5CB73_ENTCC/8-338VVVCGRELLSDKYF-PL--------------------------------------VN...KE---QDNSE----------
F0LXI5_VIBFN/8-332IAIIGSDLLAYEKA-KF--------------------------------------YDAHGNT---PTEKS----------
B0UTP6_HISS2/8-335VAIMSRDLLADKYF-PL--------------------------------------LN....Q---SKASE----------
VPN_BPP2/8-340VVIVGRQLLADKYF-PI--------------------------------------VN...KE---QDNSE----------
H2IRH6_RAHAC/8-340VVICGRKMLSDKYF-PL--------------------------------------IN...KS---QENSE----------
B4F0K8_PROMH/8-339VVICGRKLLADKYF-PL--------------------------------------VN...KD---QDNSE----------
B0UW33_HISS2/6-327VFLVGADLVNVESK-YI--------------------------------------SKASKLT---ATERA----------
E6VXL3_DESAO/8-324ITLVGDELISHEHA-GL--------------------------------------YKAIGNT---PSEK.----------
A6VSU1_MARMS/18-341VVIVGDDILSSQEE-TY--------------------------------------FEVNGNT---PTEKA----------
C5AGA6_BURGB/8-333VVLCGRDTLLDKYF-PI--------------------------------------LD...RD---NPPTE----------
J7SK37_MORMO/10-341VAIVGRQLVTQKNF-KI--------------------------------------INQHSQQ---NPNME----------
R9VFP8_9ENTR/8-340VVVCGRRILTDKYF-PM--------------------------------------IN...KF---QPNTE----------
W0L880_SERFO/8-339IVICGRNLLSDKYF-PI--------------------------------------LNTLSKT---NPNSE----------
Q1QXQ6_CHRSD/8-331VVIVGRDLLSDKYF-PL--------------------------------------LN...TE---QPPTE----------
C5BAR3_EDWI9/8-332VAICGRGVLHDKYF-PI--------------------------------------LN...QH---NENSE----------
F4HB41_GALAU/8-340VVICGRNILADKYF-QM--------------------------------------IN...KT---NQPTE----------
Q63LE5_BURPS/8-332VVICGRELLHDKYF-PI--------------------------------------VN...AT---QAPTE----------
A7MN35_CROS8/15-328VVLVGAELAAQQRL-KL--------------------------------------FN...AA---DRAAD----------
A1VSG1_POLNA/8-331VAIVGRTLMHDKLF-PL--------------------------------------VS...DP---TAPTE----------
F0LQ00_VIBFN/14-328VVMVGHNLVSAEQH-RL--------------------------------------LE...SA---NTPTE----------
Q6D3X2_PECAS/8-339VVILAGDLLTTSNF-PA--------------------------------------INAMSQT---NPNSE----------
VPN_BPHC1/5-328VFLVGADLVSKETK-LI--------------------------------------QQKHGLT---PTEKA----------
D8J087_HERSS/8-337VVIVGRELLHDKYF-PM--------------------------------------IN...KD---NKPTE----------
H2FUC0_OCESG/13-333TVMVGADLVAAAQG-RL--------------------------------------YQ...QA---DKPTE----------
Q8P6J5_XANCP/8-334VVVLGRDLMHDKYF-PM--------------------------------------VN...KD---QAASE----------
E0SAM8_DICD3/25-338VVLVGADLVAAEQY-RL--------------------------------------FQ...KA---DRPTE----------
D3VKM6_XENNA/8-339VVICGRELLADKYF-PL--------------------------------------VN...QA---QPNTE----------

PF11651

B7KXS0_METC4/1-419GSRTNG.TVNGAGQNVT..YTQVLSNGVAVKDFGGQLLNVSGLGNGGV.......VAKGDVF---TIAGV----------
A5VES4_SPHWW/1-413GSRAGSILIDLSITGSTIDYAT.......VKDTMIQTIHMDSFTNATDT......VKAGEVF---TIAGV----------
E8NPD4_SALET/1-428KSTATGVTVSGAQKFKPQAYTLDTDGNKENVDNRVATVTVSTTTG..........FKRGDKI---SFTGV----------
B2U8F8_RALPJ/1-419GAYGTPPTVSGANQSGSGLGTM..............TLNVSALNGP.........VNAGDVF---TIAGV----------
A5VW72_9CAUD/1-416GS.TESLTVSGQPEHKVEA....KDSNGMPVDNRQGTITVSASG...........LQVGDAF---TIAGV----------
A4E782_9ACTN/1-291ET............................................................---.....----------
A4JD31_BURVG/1-395GTFTAG.TVNGAGQTGN...................TLVTNAITGT.........LNAGDII---MIDGV----------
Q2G3Y7_NOVAD/1-418AG.GGATTVNGANQRTVPAATVTSAGVTENKDNRYTDLVITATTYAN........VKIGDAF---TIAGV----------
B0U721_XYLFM/1-409GP.GSGLVVTGTGNQGA...................TLAIDDT..KGDTRTALVVLSKGTIF---TLAGV----------
E9Z5W1_ESCFE/1-421GAFGGTLTVKTQPTVTYNA..........VKDSYQFTVTLTGATTSVTGF.....LKAGDQV---KFTNT----------
Q5YSR9_NOCFA/1-303SP............................................................---.....----------
A0A017QUU9_SALET/1-427KSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTG..........MKRGDKI---SFAGV----------

PF09950

Q9P9P2_XYLFA/84-327....HYVLE---NNI------------A-----KAERGLDLTVRTGYG.LETAGE....GGT.......TRAMVYTKNP-
E1VAC6_HALED/80-318....SRFKA---LYP------------N-----V.......SLIASTE.LEPSDA....NGQQ......SSAVMYERDV-
A9C0G0_DELAS/60-320....SFVMR---TNL------------Y-----TMQTGRPLTIRTVRELGTGAAN....GTT.......GRMVAYKNDG-
A6TKD0_ALKMQ/60-304....KWLQE---QKW------------F-----T.......NIIRVAD.LEGAGD....SST.......DCLAVFDSSK-
H6NDU4_9BACL/55-298....QVIQS---YNW------------F-----R.......SIDRAPE.LRGAGT....GGT.......DSMLIFDASS-
Q7N327_PHOLL/62-316SAMDRIMAA---LRK------------A-----SNNDSFSITFVKVPSNFAKNIV....KGK.......TRLAIYTYSE-
Q6FAE7_ACIAD/80-324....KFIEE---NNI------------F-----.ATQSKPLTIRGLGR.SNGKGT....AGA.......DRSIIYRRDP-
R6PG10_9CLOT/91-341....DFVLE---HAP------------Y-----LK......EIVAAAE.LNSDSVETNPYAKSSDGQ..NVAFFFTKDP-
G9ARJ4_PANAN/73-313....TYLST---NTI------------A-----FHNNGQPLEIKAIKW.LKGRGV....GGK.......DRMIAYTNDK-
B4EG48_BURCJ/103-345....QFLKN---NSL------------S-----NAINGRPLEIYPSKW.LTNRGA....SNT.......NRMVAYTKDK-
C5AFU5_BURGB/112-366....TYLLE---NNI------------C-----.TQQGVKLEILPLKW.LIGAGT....GGTPGTLGTVDRMVAYNNDK-
R6AF56_9FIRM/26-279....EYLMN---NNI------------A-----.KNQGRSISIYPSRW.CIKAGA....GQT.......DRMVAYVNDE-
K8E4M7_CARML/57-293....KVIEE---NQW------------F-----E.......SIIPVSD.LDKAGT....NKT.......DCFIIMDTRS-
E3HGR1_ACHXA/80-315....QFFQD---KHP------------G-----L.......QIMGAAE.FKGAGA....GGK.......DLILAYEYSE-
C9LU84_SELS3/82-338....QYLVD---HNI------------A-----.KAKGVDLVIAECRF.CIGAGI....GKK.......NRMVAYVNQR-
R7JXV9_9CLOT/86-336....SFIKD---HAP------------Y-----LK......NFESMAE.LQDSATDINPTGK.......NVAFMYTKDP-
B8IDG5_METNO/63-315....DWIRR---HNI------------Y-----TLETGQDLTVIGVRA.LETAGA....GGS.......ARMVAYRRDP-
R6R1V3_9FIRM/101-351....SYIKE---HTP------------Q-----IK......NWETAGE.LSKSNKDYNTTGK.......NIGLLYTKDA-
H8L668_FRAAD/90-334....EYVRT---NCI------------S-----HNVNGRPLDIQPVKW.LAGRGT....SGT.......DRMVAYTQEM-
R6RQ09_9CLOT/93-346....TFLLE---NNV------------A-----.KQNGADLFIGATSW.CKGAGD....ESE.......DRMVVYCNRE-
Q0BRS5_GRABC/66-316....SFLAR---TNI------------Y-----TLTTGLPLTVRGIPG.LESAGA....SGV.......GRMIVYRRAP-
Q2NSP7_SODGM/17-247.........---..V------------A-----LKQANPGIEFVKANE.LNAAGK....SGK.......GSIVIGTIRN-
B8IIV0_METNO/63-315....DWIQQ---KNV------------Y-----TIETQRPLNVFGVRG.LETAGA....GGT.......TRMVAYRRDP-
Q6XQD3_BPT1/82-319....DYFKS---QNS------------G-----IEID....SIAELED.IDGAGT..............KGVLVYEKNP-
A9I906_BORPD/80-320....EFFVK---QHP------------G-----L.......RIEEVPE.LSDAGT....GGV.......SLAIMYERSE-
Q2G4R3_NOVAD/111-362....SFLLA---NNV------------A-----....GEALTILKSRE.LETAGT....GST.......TRMIAYDNNP-
W8UFX7_YEREN/64-311....EFLRT---NFK------------D-----MDFDDDVL........LAGAGA....AKK.......DRLVVYKKDM-
A7ILG8_XANP2/103-352....TFLKE---NNI------------L-----TAEKGIPLDIVSVKW.LDKANR....SGASY.....DRMVAYSQQP-
Q32EP9_SHIDS/73-313....TYLQT---NTI------------S-----YHQNGVPLNIRAVKW.LKGRGV....GNK.......DRMVAYTNDK-
G2IHV9_9SPHN/64-315....AYIQA---NNA------------Y-----TAISRQPLNILPMQW.LETAGA....SST.......KRMIAYARNP-
Q835B4_ENTFA/57-293....KVVQE---NGW------------F-----S.......SIEQVYD.LKGVGT....DNS.......DSFIIMDTKP-
D0UIJ0_AGGAD/58-304....EFLTK---HLS------------A-----AA..GRQVAIKALPSNYGTRVT....DGK.......TRAMVYVNSK-
Q984H1_RHILO/86-339....EWVMQ---KNV------------Y-----TLTTGAPLTVRGLFGYLETAGT....GSS.......KRMVAYRRSP-
Q2NRY5_SODGM/73-317....DYLNE---NTI------------A-----FKQNGKPLDIQPVKW.LEKGDE....FTA.......NRAVLYSQDR-

PF04454

D4H156_DENA2/1-251-----TLGD---TVR------------R-----QI.KGDIIYSETVDG---------------------..ALLVADRE-
C8WPL7_EGGLE/1-257-----LEID---RIK------------K-----LI.GDNVYMTSVMGP---------------------GKAVLVCAEP-
D0LZ74_HALO1/1-251-----PVAK---QVQ------------R-----LVVDGPLVRANALAG---------------------..ALVMSMRG-
D1B7I4_THEAS/1-249-----PMRK---NLA------------E-----LV..DKVIYAPALDG---------------------..ALLVSLAG-
A1B987_PARDP/1-251-----PVLK---HLE------------R-----LV.DVPVVWSQALEG---------------------..GAVVTTRG-
A3DFK3_CLOTH/1-257-----TEYD---RIN------------K-----LL.DGNIFSTPVLKD---------------------DKAVLVCSEP-
A6TWC5_ALKMQ/1-250-----PLIN---RIQ------------E-----LT.GSKVIYSPVVEG---------------------..ALLLPYDH-
A7HIB4_ANADF/2-255-----TPHQ---QLQ------------P-----AF.AGGIVKAPAIQD---------------------G.AVIVMRTP-
A7I7A2_METB6/2-249-----TELD---HVS------------S-----IV.GDGVIKAPVLKK---------------------G.GVLVASGS-
A8F8I8_THELT/3-247-----TEYE---HLS------------M-----II..KGIYKAPVLKN---------------------S.GVLMSDSE-
A8L1F1_FRASN/1-253-----LLLN---HLK------------Q-----IL.DGPVVRAPGVRG---------------------..AVVLSQRG-
A9BEM3_PETMO/1-251-----PLDL---VVK------------E-----II.DAKVKPMHEVDE---------------------..SFVVSNRG-
A9FWS5_SORC5/3-254-----PLRK---HIE------------G-----QLIDGPIVWAPALEG---------------------..GVLLSTRG-
A9H5P1_GLUDA/1-251-----PVFR---HIE------------S-----LI.DGKIVWAPAIEG---------------------..GFVLSTRG-
B1VSP7_STRGG/1-251-----PVKT---HLS------------R-----LV.DDEILWAPAVKG---------------------..GVLLSTRG-
B2A6K6_NATTJ/8-259-----PLIE---RIH------------E-----LT.GSKVVISPIVDG---------------------..AYLVPYDH-
B2GID2_KOCRD/1-252-----PVHE---HVS------------R-----ILGEGSIIWAPALDD---------------------..ALLVSARG-
B2JNZ6_BURP8/1-251-----PVIE---HIK------------R-----IV.NGEIIWAPALEG---------------------..GSVLSMRG-
B2V6Y3_SULSY/1-265-----LEID---QIK------------K-----LF.DVGVFTTPVIPQ---------------------FTAVVVSTGI-
B4UA40_HYDS0/1-265-----LEIT---HIK------------E-----LF.DVGVFTSHAVDE---------------------GKTIAVATGV-
B8CYH7_HALOH/1-249-----PLEK---RIS------------D-----II.GGDILFTPDLEG---------------------Y.GLLLSKRG-
B8EQK3_METSB/1-251-----PVLE---HVK------------R-----LV.EDQIFWAPAIAG---------------------..AFVLTTRG-
B8GHL2_METPE/5-250-----TELE---HLQ------------Q-----MI.TDGIFKAPVLKD---------------------G.GVLIATGQ-
B9JHD1_AGRRK/1-251-----PVFH---HIE------------R-----VV.DGGIIWAPAIEG---------------------..GFVLTTRG-
C0R0J8_BRAHW/1-256-----TEAQ---RIS------------S-----MI..GNLYNVPVIKG---------------------KKAALICAEP-
C0ZHN4_BREBN/1-265-----LEIE---HVR------------N-----LV.TDGVFQSPTIKG---------------------RSGVLVATGR-
C0ZVK4_RHOE4/1-251-----PIRE---HLR------------R-----VL.DGEIIWAPAIDG---------------------..AFLLSTRG-
D5UVK7_TSUPD/1-251-----PVRE---HLN------------R-----LV.DGDIIWAPAIDG---------------------..AFVLTTRG-
C4XPM7_DESMR/1-251-----PLSQ---YLE------------T-----ML.GGQVIVSPFIEE---------------------..AYLLSTRG-
C5B5H8_METEA/1-251-----PIFH---HLE------------R-----IV.DGGVIWAPAIAG---------------------..GFVLTTRG-
O67639_AQUAE/1-267-----LELE---QIK------------K-----VV..KEVYQTPIIPE---------------------DIVLLVSASP-
Q08WR7_STIAD/2-266-----LEIE---TIR------------Q-----LA.SDGVFQSNRLRG---------------------DSGVVVSTGR-
Q0RH88_FRAAA/1-253-----LLLT---HLQ------------H-----IL.DGPVVQAPGVTG---------------------..AVVLSLRG-
Q2RVS0_RHORT/1-258-----PVLQ---HVR------------R-----LF.EGPLIWAPGVDG---------------------..AMLISQRG-
Q5YPL3_NOCFA/1-252-----PIRT---HIE------------R-----LIPDGEIIWAPAIDG---------------------..AFVLTTRG-
Q7MSM9_WOLSU/1-252-----PLTL---KLA------------E-----LLQGNNIIVAPALKS---------------------G.ALLVSLRG-
Q97V86_SULSO/96-329-----YEIE---MIK------------E-----I...GNVVPTDIVSN---------------------DEIYVISKQG-
B2HH42_MYCMM/1-251-----PIRE---HLN------------R-----LV.DGDIIWAPAIDG---------------------..AFVLTTRG-
Q0SE23_RHOSR/5-254-----PVFH---HLR------------D-----LV.AGDIIWAPAISG---------------------..GYVLSTRG-
Q2IH48_ANADE/1-259-----TPYQ---QLL------------P-----AF.EGGIVKAPGLRD---------------------G.AVVVVRSA-
Q5L1H9_GEOKA/8-264-----LEIE---HIR------------E-----LM.TAGIYQTPVIKG---------------------KRGVVIDTGR-
MARIT_THEMA/1-251-----PLEK---RVE------------E-----CLRGGKIITTPRIED---------------------..ALVVSERG-

PF05065

E0THR4_PARBH/115-394----NYLWS...PGL....GGQT....A-----SLLGFSITESEHMPDV........ANGETP..----...IAFG.DF.
Q1GG15_RUEST/131-399----NYIIGKPQGTIA.P..........-----TLWGLPVVATQAI.................T.----VDKFLTG.AFN
Q1DCZ9_MYXXD/94-361----VWVFR...QEM...LDRG......-----TIRGFPFVMTTRVPV..........SRI....----...TFSA.DW.
Q0AAI8_ALKEH/83-374----RALLQ...MSL...AEGRP....N-----TLLGFPVVIAEDMPDP........AADSES..----...ILFG.DF.
Q3J4R6_RHOS4/160-429----RYIFANPLQLAG.P..........-----VLWGRPVVPTTEI.................D.----EDKFLVG.AFR
A1T829_MYCVP/9-278----EPLLQ...ASVDPTQPTAR.....-----MILGSQLLVSPAV...................----DADVIWAIPQ.
Q982R8_RHILO/176-465----NYVWA...PPS...ANEKV....P-----TIFGKPAYTDDNMNEI........GTNTFP..----...VAVG.DF.
A1AYY2_PARDP/166-435----RYIFANVMQLAG.P..........-----QLWGHPVVQTQSM.................D.----LDEFLTG.AFK
Q1ILS6_KORVE/495-776----TISL....PIW...HSDDT.....-----.VAGYPAMSSNQLPSNTS.....KGSGTNL..----.HTMIVG.DW.
Q1GH34_RUEST/388-661----TNGA....PIW...ESDNT.....-----.VNGYRGEVTNQIK.............D....----.GDVFHG.DF.
Q2GAM7_NOVAD/185-459----AYLFANPQGGSE.A..........-----RLWRLPVVETQAM.................T.----VDKFLTG.AFQ
Q8XYS4_RALSO/130-408----RPLWL...PGL...ESSAP....P-----TILKRQYVIDQAIDDI........GAGKKF..----...MYGG.DF.
Q3J3K4_RHOS4/110-395----RFLWS...DGL...AAAEP....A-----RLMGYPVLLCEDMPDI........AAGAFA..----...IAFG.DF.
Q1QLS4_NITHX/103-379----AYLWQ...PGL...AQGDP....A-----TILGRPLIEDPTMDDI........GSAAEP..----...ILFG.SV.
Q8ED08_SHEON/122-393----NYLIGKPQGQTV.P..........-----TLWNRPVVETQSI.................V.----QNEFLVG.AFQ
Q813J9_BACCR/150-424----FPLLR...PFN...QAEGGI..GY-----TLLGFPVEEEDAIDI..........PDSPD..----TPVFYFG.DF.
Q3J5Z4_RHOS4/150-439----NPLFP...SIG...ASAQ......-----.LMGFPIRTSSQIPDNLG.....AGGDE....----.TEIYFG.DF.
A1B638_PARDP/102-387----RFLWA...DSL...AMGQP....A-----QLLGYPVLVCEDMPDI........AQGSHS..----...IAFG.DF.
Q0AWY3_SYNWW/43-310----NYIWN...HA........N....D-----TILGKKVCISEFMPSA........GTGAKP..----...IAFG.DF.
A4YU30_BRASO/140-423----NAAFL...PVN...QALTGSPFKN-----TLAGDPLLFNEHCQ............TVGT..----TGDIVLA.DL.
Q2NV28_SODGM/127-397----RYLLSNPAALTT.P..........-----TLWGLPVVVTEAA.................EF----KDKFLVG.AFN
Q1GHS2_RUEST/113-395----RFLWS...DGL...QAGEP....A-----RLMGYPVLVAEDMPDV........ASDSLS..----...IAFG.DF.
Q2L2B0_BORA1/123-401----RPLWI...PGL...DAGAP....A-----RLLKYQYVVDQAIPAL........AAGAKF..----...MFAG.DF.
A2SD63_METPP/97-385----ESLWA...AST...TAGLP....S-----TLLGYPVIEDDQMASI........ATNSLS..----...IAFG.NF.
A1TML8_ACIAC/138-428----NKAFP...EI....ESGR......-----.LKGYPVALTTQIPVNLG.....AGGDA....----.SEIYFG.NF.
Q1QKG8_NITHX/112-388----VYLWQ...PSY...VSGQP....E-----TILGRPVIEIPDMADI........GAGAEP..----...ILFG.DI.
Q0S2A4_RHOSR/9-273----QGLLETVDDGV.............-----KLAGLIALVSPYV...................----TAGNAWALDS.
Q6LSF8_PHOPR/134-417----RPIFV...PGY...ETGNPGGAPD-----RILNRPITINQHMAEM........AADAKS..----...ILFG.AL.
A5N1H4_CLOK5/152-424----RLVIQ.........TAQSP....R-----LPDGTRIVFSQYM.................P.----ANTILLG.DF.
A7HRJ6_PARL1/148-433----NYLWQ...PAV...AAGQP....P-----TLLNYAVTEAEDMPSM........EAGAPA..----...VAFG.DF.
Q2YMS9_BRUA2/137-422----NYLWQ...PPA...AIGEK....A-----SFMGVGLVEAEHMPDI........AADAAA..----...IAFG.DF.
Q73HT5_WOLPM/107-395----QYLWQ...PSL...SLEAP....D-----TLMGIPVYQSADMPPA........PNNQLP..----..VIAMA.DF.
Q9A4P7_CAUCR/53-338----NYIWN...AAL...QPGQS....A-----SLLGFPVTEIEAMPDM........AANSLS..----...VAFG.DF.
Q3Z7J9_DEHM1/124-397----NYIWQ...PSV...VAGQP....D-----TILNRPYKTSIYAPEL........AAGNTA..----...ILFG.DF.
Q830G6_ENTFA/163-444----FPLLR...PFT...QAEGGI..GY-----QLVGYPVDWTDAADK..........KGEPD..----TPVLYFG.DF.
A7MP72_CROS8/125-401----RPLWL...PDV...VGMAP....A-----TVLNVPYVIDQAIADI........GAGKQF..----...VYCG.DF.
A7ILP2_XANP2/167-448----QYLWR...PGL...EAGKP....S-----ILLGYPVRQADDMPVV........GAGALP..----...IAFG.DF.
B0T632_CAUSK/96-391----NYIWQPAVG.....QTYQA.....-----VIQGRPVVIDDFMPG...........VTGSAG----VPRVLFA.DF.
Q11H37_CHESB/111-386----NFLWQ...PGI...ANGQP....E-----TILGRPVAEMPDMPDV........TADALP..----...ILIG.DF.
Q88G49_PSEPK/193-483----NKAYP...EL....DQNM......-----.LKGFPVGSTTQIPINLG.....AEGDA....----.SEIHFA.DF.
Q72BY4_DESVH/118-395----RPLWM...PDV...AGSAP....A-----TILGYGYAINQNMAVM........AANAKS..----...ILFG.HL.
B2JU92_BURP8/137-421----YPIYM...PVGGGDRAAGGSP.YG-----MLKGRPIVLSEHAS............PFSS..----QSDISLL.DL.
Q81Z09_BACAN/121-392----QPIAR...TNYGISGKPER.....-----ILLGRPVVLCNYVDS..........FATATEG----TAFAFLF.NY.
Q3SS55_NITWN/107-382----TYLWS...PGF....QGQA....D-----TILGRPVIDCPDMDDV........GSGTTP..----...IAFG.DI.
Q2GDU5_NEOSM/81-367----HYMFQ...PGI...LVGQP....D-----TLMGIPVIECSEMPIIPISDKSTSSTKKYP..----...IIFG.DF.
Q3SSD8_NITWN/135-418----LYLWQ...PSI...QAGQP....A-----TILGYPVTDDDNMPDAT.......AGGNFP..----...IAFG.DF.
A6VNQ3_ACTSZ/129-407----RPLWL...PDV...AGVAP....S-----TILGKQYVIDQGIADI........GVGNKF..----...AYFG.DF.
A5N291_CLOK5/33-297----SYLWN...SS........D....N-----TIFGKPVVTSPYMPTV........SAGAKS..----...IVFG.DL.
Q5WID4_BACSK/129-404----RGILA.....ADPRNEDAF.....-----NLFGRPVHVYDEIVT..........DDETK..----TTQILFG.DI.
A4XZF1_PSEMY/131-410----RPIWL...PGV...DVAEP....A-----TLIGMRYTINQDMPVM........AANAKS..----...ILFG.DF.
Q2N5Z6_ERYLH/94-380----AFLWQ...PGM...VEGQP....D-----RLLGYPVVEAEDMPDI........ANGECP..----...VAFG.NF.
Q2GJL3_ANAPZ/114-389----QYLLQ...VG....NSGD.....E-----MLLGIPVYQTSDMPMY........SDGSNS..----..IIAIA.DF.
A9BYD9_DELAS/120-394----AYLFTNPRTQEL.P..........-----SLWGRNVVPTQAM.................D.----PAEFLVG.AFG
Q5Z3V6_NOCFA/148-434----RYYFGGPQAITQ.R..........-----TLWGLPVIESESQ.................A.----AGEALVG.DF.
A5CD71_ORITB/88-365----RFIWQ...PKL...SRNLP....Q-----TILGIPVICASDMPTTQ......LTNDSIP..----CYPIILA.DF.
A8FGQ6_BACP2/20-302----DAVI..........QGGLS.....-----SAFGVPVKGLANMQT..........YDEAGTD----VSDILLT.HP.
A1TD88_MYCVP/110-388----ASLWG...QLA...EGRKS.....-----ELLGRPDYVAEAMDSS........ITNGQD..----NHVLAFG.DF.
A9CJN8_AGRT5/134-419----AYLWH...PPA...AAGQP....A-----SLMGFPVTEAEDMPGV........AANSFA..----...IAFG.DF.
A3DG61_CLOTH/127-416----APVFMPSGGAA...ASQYS.....-----TLLNRPIIPIEQCS............PLGK..----KGDIILA.DP.
Q2SDM1_HAHCH/110-393----NYMWR...PGI...EAGQP....S-----LLLGYGIEENEDMPEV........AADANA..----...ILFG.DF.
B2JL19_BURP8/113-379----EYLFGSPLAPVT.P..........-----RLWNINIDATYAM.................A.----QGQFLVG.D.A
B7GIM9_ANOFW/146-418----NVVGK..LPNL...RIP.......-----DLLGLRVVFNNFL................D..----DDTVLFG.EF.
B9KI56_ANAMF/104-375----QYLLQ...PGP....SGEE.....-----TLLGAPVYQTSDMPA..........IANAK..----LPIIAFG.DF.
C5AYR6_METEA/135-420----NYLWQ...PPL...AADRA....A-----TLMGFPLVEAEAMPD...........IAAG..----SHAIAFG.DF.
P71947_MYCTU/196-475----ALKF....PSL...HASPP.....-----MLAGKHIWEVSNMDTVDA....AVTATNY...----..PLVLG.DW.
Q2FX56_STAA8/38-311----ERIY..........DRNSD.....-----SLDGLPVVNLKSS..............NLK..----RGELITG.DF.
Q2G1W8_STAA8/130-399----NYLIQ...PDV...KEKTQ....Q-----RLLGAKIEILPDEVL...........GQKG..----NNTLIIG.NL.
Q3J3W7_RHOS4/239-509----EPLLL...DSI...SEKAP....T-----TLLGRPVVEAPDMPNM........TAGATP..----...ILFG.DL.
Q81X82_BACAN/69-344----NYHVV...KDV...VNGKPV...Y-----KIFGHEILIQDKMPS...........AAAG..----SITVVFI.NF.
Q81XY0_BACAN/102-381----KKVYN...VVS...QGNSG.....-----TIDGVPFIINSACKAVSD....AKTTAGQ...----.YSMAYG.PL.
Q88MK4_PSEPK/141-410----SYIWV....NV...QEGGV....Q-----RLWKLPVVDSNAV................P..----EGEFLVG.AMN
Q9CFS0_LACLA/124-389----KYLLE...PDP...TKPNS....Y-----LIKGKQVIVVADRWLPN......TGSTVYP..----...LYYG.DM.
Q9P9R2_XYLFA/357-623----TAASG...TIW...ESGN......-----TVNGYPASVSNQI................K..----AGDVFFG.NW.
Q9ZWV6_BPPHC/121-387----QYLWQ...SAL...TVGAP....D-----TFNGKVVETDDGM................P..----ADKVLFA.DL.
W6SDV8_9CLOT/124-396----QYLWQ...PSL...TAGTP....D-----TLLNRPVYTSAYAPTI.........EAGA...----.KTIAFG.DF.

PF06673

Q9MCB6_9VIRU/1-347----HSRFNELATKE------------Q-----IAQSFGAVNLETRVWMPK------------------DEVAVYNHDEY
Q9MCB8_9VIRU/1-347----HSRFNELATKE------------Q-----IAQSFGAVNLETRVWMPK------------------DEVAVYNHDEY

PF05125

D3UZQ7_XENBS/11-324----KIAAQMLGS..------------.-----SIAGRPAMVPPFMPG-----------------------KRMVVTML-
A6TE73_KLEP7/8-340----ALAADIIIS.Q------------K-----RIGNLPAVRVPYFPA-----------------------NAIMVTRL-
D5CFH7_ENTCC/11-326----KIAAQMLGN..------------.-----TIAGRKAIIPPFMPG-----------------------KRMVVTPL-
M9X6X0_PASHA/8-336----ELAADIVIS.Q------------K-----RIGGLKAVRVPFFPA-----------------------NAILITKL-
Q5E389_VIBF1/11-331----LIEDKQVIG..------------.-----TYGGLPAFCPPSFPP-----------------------TGIFVTSF-
Q2S7I3_HAHCH/8-327----RLENQAIIR..------------.-----TYGGLPAITAPFFPA-----------------------RGLLVTSL-
Q15Y13_PSEA6/12-335----RIEMAQTID..------------.-----TYGGLNAFTVPHFPA-----------------------RGVLVTSM-
H2IY53_RAHAC/8-339----ALAGQLIAS.R------------K-----TIGNLPSFIAPFFPD-----------------------GSMFITSW-
B8J319_DESDA/15-323----AMD.....SFS------------Q-----KYGGLPWETPSFFPA-----------------------RGLVITPL-
W8UNE7_YEREN/11-324----KIAAQMLSD..------------.-----SIAGRPAMVPPFMPG-----------------------KRMVVTML-
C1DBL5_LARHH/8-337----QLAADMVIS.Q------------K-----RIGNLPAVRAPFMKA-----------------------GSMLVTPL-
E6WE37_PANSA/8-338----ALAADLIIS.Q------------K-----RMGGLQAVRAPYFPA-----------------------DALLITRL-
C5BH00_EDWI9/18-332----QVAARQLGK..------------.-----DIAGRRAIVPPFMPG-----------------------KRMVITML-
B2FIZ5_STRMK/8-334----KVAAELILG.T------------K-----RIGGLQPVIVPFFPA-----------------------KSLMVTSL-
C1DS28_AZOVD/8-332----QLAADVVTS.Q------------K-----RIGNLPAVRVPYFPP-----------------------KALLVTRL-
Q8XY26_RALSO/8-332----QIAADLIIS.Q------------K-----RIGNLQAVRVPYFPA-----------------------NGLLVTRL-
D8MKI1_ERWBE/9-341----ALAGQLIAS.R------------K-----TIGNIPSLIAPSFPD-----------------------GTLFITSL-
F6IH75_9SPHN/8-355----REAAHRILTLP------------K-----QLAGKRAVIVPFFPE-----------------------TSMLITSL-
J7TAL9_MORMO/8-339----KLAADMIIS.Q------------K-----RIGGLQAVRAPYFPE-----------------------NALFITRL-
B2VH98_ERWT9/8-339----ALAADLIIS.Q------------K-----RIGGLPAVRASFFPA-----------------------DALLITRL-
F4HA06_GALAU/6-327----VLGSQNLLG..------------.-----SFGGMRGIVPPNFPA-----------------------RGAVVTTL-
G0AIP5_COLFT/8-331----TLAADIIIS.Q------------K-----RIGGLPAVRVPFFPD-----------------------NAILITRF-
D5CB73_ENTCC/8-338----KIAADLIIS.Q------------K-----RMGGLQAVRAPYFPA-----------------------NALLITRL-
F0LXI5_VIBFN/8-332----KIQERQVIG..------------.-----TYGGLPAVSVPGFPS-----------------------TGIMVTSY-
B0UTP6_HISS2/8-335----QVAGDIIMS.T------------K-----RVGGLQAVQAPFVPK-----------------------GTILITRL-
VPN_BPP2/8-340----MLAADVIIS.Q------------K-----RIGNLPAVRVPYFPA-----------------------DAMLITKL-
H2IRH6_RAHAC/8-340----KLAGDIIVS.Q------------K-----RIGNLPAVRVPYFPD-----------------------NALLITRL-
B4F0K8_PROMH/8-339----KLAADTIIS.Q------------K-----RIGGLPAVRAPFFPG-----------------------NAFFITRL-
B0UW33_HISS2/6-327----ALGSHNLVN..------------.-----TFAGMRAIIPPNFPA-----------------------KGAAVTTL-
E6VXL3_DESAO/8-324----VLATQSLSL..------------.-----.LGGLPWMTPSNFPG-----------------------RGLVITPL-
A6VSU1_MARMS/18-341----VLANRITKA..------------.-----.YGNLPIVYAPFFPD-----------------------GSLLVTPL-
C5AGA6_BURGB/8-333----SLAASMVIS.Q------------K-----RIGNLQAMRVPFMPR-----------------------GKLFITIP-
J7SK37_MORMO/10-341----LMAGNELMK.L------------S-----SVGGIPSVQVPYFPD-----------------------GAVLITTM-
R9VFP8_9ENTR/8-340----QLAGELIIS.Q------------K-----TIGQLQAVRAPFFPA-----------------------NSILITTL-
W0L880_SERFO/8-339----ALAGQVLLS.Q------------Q-----QIGAMPTYRVPYFPP-----------------------NAMLITRF-
Q1QXQ6_CHRSD/8-331----QMAADLVIS.Q------------K-----RIGGLQGMDVPFFPD-----------------------NALMVTTL-
C5BAR3_EDWI9/8-332----KLAGQILVS.Q------------K-----TIGGRPAVRVPGFPR-----------------------NTILVTAF-
F4HB41_GALAU/8-340----ELAGQVILS.Q------------K-----QIGGLKAIRVPYFPA-----------------------NSMLITRL-
Q63LE5_BURPS/8-332----RLAADLIVS.Q------------K-----RIGNLPAVRVPFFPK-----------------------RALMVTKL-
A7MN35_CROS8/15-328----ISAAQLAGS..------------.-----SVAGRFAFIPPFMPG-----------------------RRLAVTTL-
A1VSG1_POLNA/8-331----MLAADIVRS.Q------------R-----RLGGLQAITVPYFPA-----------------------NTVLITRL-
F0LQ00_VIBFN/14-328----HKAAQTLAK..------------.-----TIAGRTAITPPFFPA-----------------------NGIWVTNT-
Q6D3X2_PECAS/8-339----MLAGQLIVA.Q------------E-----RVGNMPTFIAPYFPV-----------------------SGVLITPF-
VPN_BPHC1/5-328----ALGSHNLMG..------------.-----SFGGMNAITPPNFPA-----------------------RAAAVTTL-
D8J087_HERSS/8-337----ALATDIIVS.Q------------K-----RIGGLPAVRVPSFPA-----------------------NAMLITRL-
H2FUC0_OCESG/13-333----QIAAQQLAT..------------.-----SVAGRRAITPPFFPG-----------------------KRMVVTIP-
Q8P6J5_XANCP/8-334----KIATDLILS.Q------------R-----RVGGLQVAEVPYLPD-----------------------GALMVTSL-
E0SAM8_DICD3/25-338----KIAAQMLDS..------------.-----TIAGRPAIVPPFMPG-----------------------KRMTVTTL-
D3VKM6_XENNA/8-339----QMAADIIIS.Q------------K-----RIGHLPAVRVPYFPP-----------------------KALFITRL-

PF11651

B7KXS0_METC4/1-419----FAVNHVTKQVL...PYLRQFTVLAAAVADGTGNATLQISPAIIAPAAFPNGA....FTAVSAAPAAGAVVAWMGAA
A5VES4_SPHWW/1-413----YAVNPVTKARL...PWLKQFTVVADATC.ASNETDVVIYPAMIWTGAFQNVS......VVGVTDLNNQAVTFLGSA
E8NPD4_SALET/1-428----KFLSQMAKNVL...TDDATFSITR.....VIDGTHIEITPKPIALDDASLTKEEKAYANVNTSLAETTPVNVLNVA
B2U8F8_RALPJ/1-419----FAVNRVTKQAY...PELQQFTVVQAA...AAGATSLSIYPSINPPVGGNPVQ....YQTVTASPANGAQITFLTNA
A5VW72_9CAUD/1-416----NSVHQITKDTT...GQPQVFRVL......AVSGTTVTISPKILPVENTDVAS..RPYANVDAKPAESAAITILNKN
A4E782_9ACTN/1-291----............................................................................
A4JD31_BURVG/1-395----EAINRLTGETY...GQLQQFVVTADV...ASGATSIPLYPAIVPAPAA........FNTVTASPANSAAISLVIPA
Q2G3Y7_NOVAD/1-418----NEIHLITKQDT...GNLKTFRVVD.....KPAANTIRIWPAIIDAAEGSIGS..KEYANVSATPANGANITWLNTT
B0U721_XYLFM/1-409----FETHPITGEAT...TRLRQFLVTTDY...RRGEYGVTIYPPIVLTSTTTIGT.......VTALPKDRTALTIVGAP
E9Z5W1_ESCFE/1-421----YWLQQQTKQALYNGATPISFTATVTADANSDSSGDVTVTLSGVPIYDTTNPQ....YNSVSRQVAAGDAVSVVGTA
Q5YSR9_NOCFA/1-303----.............................ATGQPTTEV......................................
A0A017QUU9_SALET/1-427----KFLGQMAKNVL...AQDATFSVVR.....VVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNVK

PF09950

Q9P9P2_XYLFA/84-327---TKLVLHL-PMP-IRF.LPPQ.---------------PKGLRFDIPGEYKYSGVEFRYPKSALYADGI----------
E1VAC6_HALED/80-318---DNLSIEI-PRP-FEQ.LPAE.---------------KRNLEMVIDCIAKCSGVAVYRPLSLTKA...----------
A9C0G0_DELAS/60-320---EYVKLHL-PMP-HRF.LPVYQ---------------DGPLNYAVPGIFRTGGVELLTTVAMRYIDQI----------
A6TKD0_ALKMQ/60-304---DVVEMAL-PLD-ITR.HPEVM---------------LANMSSQINLEERTGGAIVRFPMGICRADGI----------
H6NDU4_9BACL/55-298---EVMELLL-PMD-MMR.HDPE.---------------WEFPKWKFVVEERCGGVVIRYPMAIARGDGI----------
Q7N327_PHOLL/62-316---DYIEMKV-HMP-ELL.AVRQ.---------------RDLLTFECGYRSAFGGAMWKQPKSAVYVDY.----------
Q6FAE7_ACIAD/80-324---SCIQMKC-D.D-VSF.LAAQ.---------------PDGLDVKVPGHYKYQGVWLKRVDSLRYLDHV----------
R6PG10_9CLOT/91-341---DKLAVED-PMP-YYQ.YPVQ.---------------ERNLEMIVPCEARTAGVIIYYPLSALIA...----------
G9ARJ4_PANAN/73-313---KYVRYPL-.VA-LRS.IPIQ.---------------YRGLYQLVTYYGKLGAIEPVYRETIAYKDGI----------
B4EG48_BURCJ/103-345---NRVRFPL-.VP-LQR.TPLE.---------------YRDIRQLTTYFGRLGVVEVVYPETIGYRDGV----------
C5AFU5_BURGB/112-366---KYVQYPM-.TD-LQR.TPLE.---------------YRSLFQITTYWSRLGQIEWRYGTTGAYRDGI----------
R6AF56_9FIRM/26-279---DKVNFDI-TVP-ITRAMSSPN---------------LSAAAYDTLYAAQIGQVKFNYYQPVRYIDGI----------
K8E4M7_CARML/57-293---STCEILL-PMD-VVR.FEQE.---------------WAYPNWKVPFEERCGGALIRTPYAIVRADGI----------
E3HGR1_ACHXA/80-315---ENLAMEL-PMP-FNQ.LAAQ.---------------ARGLELVVPCLARAGGVVVYYPLSLA.....----------
C9LU84_SELS3/82-338---RFVGMDV-PVP-MSRVMTQPN---------------VNTASYDSLYMANVGQVKIHYFEPFIYRDGI----------
R7JXV9_9CLOT/86-336---EKFSLEI-PLP-FYQ.YPLQ.---------------VQKLETEIPCETRTAGLIIYYPLSMLLAYG.----------
B8IDG5_METNO/63-315---SVLKLWL-PMP-FRF.FPAWQ---------------TGPWRFEVPGAFRLGGLDIRRPGAFRYLDGI----------
R6R1V3_9FIRM/101-351---DKMYHDV-PMA-FLQ.HAPQ.---------------DRNLEIVINCEGRDAGMVIPYPLSACLV...----------
H8L668_FRAAD/90-334---DRVRFPY-.VP-LQR.TPLE.---------------YRDLRQLVTYFGRLGAVEFVYPETLAYADG.----------
R6RQ09_9CLOT/93-346---KYLAMDE-LVP-LTRAMTGPN---------------TAEFCYDTAYAGNLSEVEVFYDQTMVYVDGI----------
Q0BRS5_GRABC/66-316---DVMKLHI-PMP-LQF.LAPWQ---------------SGPMRFEVPGIFRLGGVDIRKPGAIRYLDGV----------
Q2NSP7_SODGM/17-247---DILCNRV-PVA-FTA.LPAQ.---------------ARNINVYVPCYCKVVELEVLQKDALLRVD.L----------
B8IIV0_METNO/63-315---AVVKLWM-PMP-FRF.FPAWQ---------------TGPFKFDVPGAFRLGGVDIRRPGAFRYLDGI----------
Q6XQD3_BPT1/82-319---MNMSIEI-PEA-FNM.LPAQ.---------------PKDLHFKVPCTSKCTGLTIYRPMTIVLITGV----------
A9I906_BORPD/80-320---ENLSMEN-PMP-FNQ.LAAQ.---------------ARNLELVVPCLARTGGVAVYYPLALTKAEGI----------
Q2G4R3_NOVAD/111-362---QVLKFML-PGA-HQF.LPAFQ---------------KSSLVYEVGGIMNVGGCDVRLPKAIVYRDS.----------
W8UFX7_YEREN/64-311---RVVKGHD-VMP-LRF.LAPAT---------------PDNVNFKVPAVLRTGGTEWRIPKAAHYVDGV----------
A7ILG8_XANP2/103-352---EYVRFPF-.VP-LIP.ATTQ.---------------YEGIWVKVPYYGKLGQVEVVYPEVIGYRDGI----------
Q32EP9_SHIDS/73-313---KYVRYPL-.VP-LQS.VPVQ.---------------YRGLYQIVTYYGKLGAVEPVYKETISYVDGI----------
G2IHV9_9SPHN/64-315---GVLEFFL-PGA-FTF.MPMHP---------------ISSLAWRVDGIMNVGQLEIYRPKAVSYRDGI----------
Q835B4_ENTFA/57-293---STCEILL-PED-IVR.LEVE.---------------WSFPNWKVPFVERCGGALIRTPYAIVRVDGI----------
D0UIJ0_AGGAD/58-304---EHVIFDV-PMS-PTV.LDAQP---------------KGLLAFESGLRMAFGGVTFMEPDSALYVDY.----------
Q984H1_RHILO/86-339---EVLKMHV-PMP-FRF.LPAWQ---------------TGPIKFDVPGIFRVGGVDIRRPKAVRYLDGI----------
Q2NRY5_SODGM/73-317---KYVQFPL-.VP-LQR.TPME.---------------YRDLRQIVTYYSKVGAVELRYSDTMHYVDGI----------

PF04454

D4H156_DENA2/1-251---GDVELTT-GQD-FAIGYHSHD---------------ASKVNLFLTESFT----------------------------
C8WPL7_EGGLE/1-257---EYLDLAI-GLD-LSVGYLELA---------------DFNHTFRIMETAA----------------------------
D0LZ74_HALO1/1-251---GDYELTV-GQD-LSIGYAFHD---------------RSKVELFVAESFT----------------------------
D1B7I4_THEAS/1-249---GHLQLTL-GQD-MSLGYEAHD---------------STTVRLFFTETFA----------------------------
A1B987_PARDP/1-251---GDFDLWL-GQD-ISIGYLSHD---------------AASVTLYLQESLT----------------------------
A3DFK3_CLOTH/1-257---QNIDLVI-GQD-MITSYLETK---------------NLNHYFRIMETIL----------------------------
A6TWC5_ALKMQ/1-250---EDLELTI-GRD-FSIGYEYHD---------------AKTVQLFITESLT----------------------------
A7HIB4_ANADF/2-255---SGPRILV-GQE-LAAAYDGRE---------------GIFHQISLVESVT----------------------------
A7I7A2_METB6/2-249---QYASVAL-GQD-LAVGYNGPV---------------GDLLEFQIYESLA----------------------------
A8F8I8_THELT/3-247---AYASIIL-GQD-LSIGFIGPA---------------EERFEFSISESLA----------------------------
A8L1F1_FRASN/1-253---GDFILES-GQD-LSVGYSSHT---------------AEEVELYLEQSFS----------------------------
A9BEM3_PETMO/1-251---GDFKLIL-GQD-ISLGYESKF---------------DEQLKFFFTESLT----------------------------
A9FWS5_SORC5/3-254---GDFELTV-GED-LSIGYDGHD---------------RQVVELFLTESFT----------------------------
A9H5P1_GLUDA/1-251---GDFELDI-GQD-FSIGYSSHS---------------ADSVELYLQESFT----------------------------
B1VSP7_STRGG/1-251---GDFELCL-GQD-LSIGYADHD---------------ATSVHLYFQQAFT----------------------------
B2A6K6_NATTJ/8-259---DDLELTI-GLD-FSIGYEHHD---------------EHHVQLFITESFT----------------------------
B2GID2_KOCRD/1-252---GDYELHL-GQD-AAIGYTSHT---------------AETVELYLRETLT----------------------------
B2JNZ6_BURP8/1-251---GDYELHL-GQD-VSIGYQSHT---------------DSTVRLYLRETLT----------------------------
B2V6Y3_SULSY/1-265---ENLDLFI-SQD-MITSYLNYD---------------NMDHYFRVFEILA----------------------------
B4UA40_HYDS0/1-265---ENMDIFL-VQD-MISAFIDYE---------------NMDYYFRVFEILA----------------------------
B8CYH7_HALOH/1-249---GDFELIV-GQD-IAIGFSGQF---------------GDELEFFLLESFT----------------------------
B8EQK3_METSB/1-251---GDFELTL-GQD-VSIGYLSHT---------------AETVQLYLQESFT----------------------------
B8GHL2_METPE/5-250---QYAAIVL-GQD-MTIGFTGPS---------------KESLDFTISESLA----------------------------
B9JHD1_AGRRK/1-251---GDFELDI-GQD-ISIGYLSHS---------------STVVELYLQETFT----------------------------
C0R0J8_BRAHW/1-256---QYMDLAV-GID-MSTAYLEQK---------------DLNHSFRIMETII----------------------------
C0ZHN4_BREBN/1-265---HNLDLAI-AED-FDSAFLGDE---------------QMNSLFRVYECVV----------------------------
C0ZVK4_RHOE4/1-251---GDYELHL-GQD-LSIGYLSHD---------------ANSVELYFQESMT----------------------------
D5UVK7_TSUPD/1-251---GDFDLRL-GTD-VEIGYLSHT---------------ADTVDLYLQETFT----------------------------
C4XPM7_DESMR/1-251---GDLEMTL-GGD-IAIGYASHD---------------TEKVALFFLESFT----------------------------
C5B5H8_METEA/1-251---GDFELDI-GQD-ISIGYLSHS---------------ATTVELYLQESFT----------------------------
O67639_AQUAE/1-267---ANFDLAI-ALD-VNVAFVETS---------------NMNHTFRVMEMVV----------------------------
Q08WR7_STIAD/2-266---ENMDLTV-AMD-MVTAYLGAS---------------RMNHPFRVLEALI----------------------------
Q0RH88_FRAAA/1-253---GDFVLES-GQD-LSIGYASHT---------------ADTVDLYLEESFT----------------------------
Q2RVS0_RHORT/1-258---GDFELTV-GRD-FSIGYHDHD---------------AQSVHLYLQESMT----------------------------
Q5YPL3_NOCFA/1-252---GDYELTL-GQD-VSIGYLSHD---------------ADTVRLYFQQTMQ----------------------------
Q7MSM9_WOLSU/1-252---GDYELYS-GMD-IGVGYSEKK---------------STNHELFFFETLT----------------------------
Q97V86_SULSO/96-329---..FDILV-FSD-LNVEYLSKE---------------KDYEVYLITEQIA----------------------------
B2HH42_MYCMM/1-251---GDFDLQL-GTD-VAIGYTSHD---------------ADTVQLYLQETLT----------------------------
Q0SE23_RHOSR/5-254---GDNQLTL-GTD-LSIGYDSHT---------------ATDVTLYLEETFT----------------------------
Q2IH48_ANADE/1-259---SGPQAVV-GQE-LTAAYDGRE---------------GIFHLVSLAESVT----------------------------
Q5L1H9_GEOKA/8-264---QNIDLAV-AVD-VQTAFLDTE---------------NMNYLFRVYESV.----------------------------
MARIT_THEMA/1-251---GDFKLIL-GQD-LSIGYEDRE---------------KDAVRLFITETFT----------------------------

PF05065

E0THR4_PARBH/115-394..QRGYLIVD.RAG.VGV..LRDP............YS..AKPYVLFYTTKRVGGGIQDY.AALKLLQM-----------
Q1GG15_RUEST/131-399..MGAQIFDR.WDATVETGYEN...............DDFTKNLVTILAEERLALAIFRP.EAFIYGDL-----------
Q1DCZ9_MYXXD/94-361..RQFIYGID.EDLILSEHDVRA.................EYDETTVRAIVKGDFKVRQP.KAFSSITY-----------
Q0AAI8_ALKEH/83-374..GQAYTIVD.RIG.VSV..LRDP............YT..LPGWVRWYVRKRIGGALTNP.EALKAVVF-----------
Q3J4R6_RHOS4/160-429..AAATIYDR.MDTEVLISSEDR..............DNFVKNMLTVRAEKRLALAIKRA.AALIYGDF-----------
A1T829_MYCVP/9-278...LHSLVVV.RED.VETEVSTD..............VFFTSDRVAVKTTARLGWDWPHP.SSIVKINL-----------
Q982R8_RHILO/176-465..KRAYLIVD.RQG.VRV..LRDE............LT..NKPYVHFYTTKRVGGGISNF.EAIKLLKC-----------
A1AYY2_PARDP/166-435..AAATIYDR.MDPEVIASSEDR..............DNFIKNMITVRAEERLALAIKRP.AALITGEF-----------
Q1ILS6_KORVE/495-776...AQLILGE.WGA.LEI..IADPY..........TQAG..KGNVVLTGSMLVDIAVRYA.QAFVVIND-----------
Q1GH34_RUEST/388-661...ANVLVGM.WGG.LDI..TVDPY..........THSR..RGRLRIVTMQDADYVLRHP.AGLCFGTD-----------
Q2GAM7_NOVAD/185-459..MGAQVFDR.EEANVEISTEDS..............DNFRKNLVTIRAEERLALAVYRP.EAFIKGDF-----------
Q8XYS4_RALSO/130-408...NQFILRR.VRS.MAIKRLVER............YA..EYGQVGFLAFHRFGCVLQDT.SAIAALVG-----------
Q3J3K4_RHOS4/110-395..AAGYTIAE.RPE.VRV..LRDP............FS..AKPHVLFYATKRVGGDVSDY.AAIKLLKI-----------
Q1QLS4_NITHX/103-379..SDAYRIYD.RLN.LSI..MRDP............YSQATSGVVRFHARRRTGGALVLA.DALRKIKC-----------
Q8ED08_SHEON/122-393..MGAQIYDR.MDIEVLISTEND..............KDFENNMVSIRAEERLALAVYRP.EAFVKGNF-----------
Q813J9_BACCR/150-424...SKFYIQD.VIGSLEVQKLVE..............LFSRTNRVGFRIWNLLDAQLIH..SPFEVPVY-----------
Q3J5Z4_RHOS4/150-439...DEAMIGD.SMA.LVV..GSSTDASFV.DGNGATVSAFQNDLTLMRAISEHDFAPAHD.EAFAGFNA-----------
A1B638_PARDP/102-387..RSAYTIVE.RPD.LRV..LRDP............FS..AKPHVLFYASKRVGGGVTDA.RAVKLMVF-----------
Q0AWY3_SYNWW/43-310...SYYWIVD.RRP.LSIRTLTEQ............YA..LEDCIGYLAYEFLDGKLVRP.EAIKVMEM-----------
A4YU30_BRASO/140-423...SGYALATKQGGGIDFAASIH..............LFFDQNLTAFRWIIRAGGQPYLS.KPVQPAKG-----------
Q2NV28_SODGM/127-397..LGAQLFDR.EEASVVISTENT..............DDFEKNMISIRCEERLALAVYRP.EAFIKGDL-----------
Q1GHS2_RUEST/113-395..AAGYTIAE.RPD.LRV..LRDP............FS..AKPHVLFYASKRVGGDVSDF.AAIKLMKF-----------
Q2L2B0_BORA1/123-401...DQFILRR.VRY.MVLKRLVER............YA..EYDQTGFLAFHRFGCVLQDT.AAIKALQG-----------
A2SD63_METPP/97-385..RRGYTFVR.RLG.TRF..LVDP............YT..NKPKVNLYAYQRVGGAVANF.EAIKLVRF-----------
A1TML8_ACIAC/138-428...ADMFIGE.DMQ.LTV..AYSTEASYK.DGAGNVISSFQRDQTLVRVIAKHDFAPRHV.ESIVVATG-----------
Q1QKG8_NITHX/112-388..ATAFRIVD.RLA.LSL..LVNP............YIRATDGMTRIHATRRTGSAVVQP.AAIKKIRC-----------
Q0S2A4_RHOSR/9-273...SQVLTVR.RKG.TTLATSKD..............AAFGSDATQIRAVSRVGFGFANP.AGIVRLHD-----------
Q6LSF8_PHOPR/134-417...NKYRIRL.VMD.LRLFRMTDS...........KYT..EKAQTGFIGYQRADGALIDVGGAVKYYQN-----------
A5N1H4_CLOK5/152-424...KKYLLGE.RKG.VQLAVSDQ..............VRFIEDQTVFKGTARYDGKPVYP.SYFVKITV-----------
A7HRJ6_PARL1/148-433..RRGYLIVD.RLG.VRV..LRDP............YS..AKPYVLFYTTKRVGGGVQNF.EAIKLLKF-----------
Q2YMS9_BRUA2/137-422..GRGYLVVD.RIG.VRV..LRDP............YS..AKPYVLFYTTKRVGGGVQDF.EAIKLLKF-----------
Q73HT5_WOLPM/107-395..KQAYKIVD.NRG.MRI..LRDP............YT..NKPYVRFFVTKRVGGEVVNT.SAIKLLKI-----------
Q9A4P7_CAUCR/53-338..EKGYLIVD.RAG.VRV..LRDP............YS..AKPHVLFYTTKRVGGGVQNF.DAIKLLKF-----------
Q3Z7J9_DEHM1/124-397...SFYWIAD.RQG.RSFKRLSEL............YA..ANGQIGFLASERVDGKLILP.EAVKGLSV-----------
Q830G6_ENTFA/163-444...SAFKIQE.VIGALEIQKLVE..............KFSGKNQVGFQIYNLLDGQLVY..SPFEPAVY-----------
A7MP72_CROS8/125-401...DRFILRR.VAY.MTLMRLTER............YA..EYDQVGFLAFHRFDCALEDA.AAVKALVG-----------
A7ILP2_XANP2/167-448..RAGYTVVD.RLG.ITT..LRDP............YS..AKPFVEFYSRRRVGGDVTNF.EAFALMVV-----------
B0T632_CAUSK/96-391...SENYVNF..SGPMQWVVDPY................TAPGYVKYTARQRFGSVFRDS.QAIRGLLL-----------
Q11H37_CHESB/111-386..QQGYRIVD.RVS.LAV..LRDP............YTMASKGQTRFHMRRRVGGGVVKA.EAFKALKI-----------
Q88G49_PSEPK/193-483...ADCFIGE.DDA.MVI..DFSKEATYK.DGSGNVISAFQRDQTLVRVIAKHDFGPRHV.ESVAVMTD-----------
Q72BY4_DESVH/118-395...KAYTIRD.AMS.VEMYRFTDS...........AFM..KKGQIGFLAFCRSGGVNTDT.NAIKFYQN-----------
B2JU92_BURP8/137-421...SYYRSIT.SRGGIQTATSMH..............VYFDADATAFRTTFRVDGGPKIE.NAITPPKS-----------
Q81Z09_BACAN/121-392...KDYILNT.NYQ.MGVKKYED................NETDDQVTKAIMIVDGKVVDK.NSLVVLKK-----------
Q3SS55_NITWN/107-382..AATYRILD.RIG.LSI..LANP............YLLATTGTTRIHATRRVGGAVVQP.AAMKKIVC-----------
Q2GDU5_NEOSM/81-367..KRGYQIVD.RSE.MRV..LRDP............YS..AKPYVSFYITKRVGAKVINP.KAFVFLEM-----------
Q3SSD8_NITWN/135-418..QRGYLIVD.RMG.VRV..LRDP............FT..NKPYVHFYTT......CPSS.DNLRLIRH-----------
A6VNQ3_ACTSZ/129-407...NRFVVRR.VAY.MTLKRLVER............YA..EFDQTAFLAFHRFDCVLEDT.SAIKALVG-----------
A5N291_CLOK5/33-297...SYYWLIE.RQP.ITIKKLSEL............YA..LQGQIGFSAYERLDGKLIQP.DALKILQI-----------
Q5WID4_BACSK/129-404..KRCYRMFD.RKR.FEIKSTDVG............ADAFLTDQTYFRGIERFDGRIVDP.EGVVIVEG-----------
A4XZF1_PSEMY/131-410...SRYIIRD.VMQ.VLLFRMTDS...........AYT..RKGQVGFLAFMRSGGRLMDVGGALKYYQN-----------
Q2N5Z6_ERYLH/94-380..RHGYLIAE.RTA.TQI..LRDP............FT..NKPFVHFYATKRVGGQVLDS.NAIKLLKI-----------
Q2GJL3_ANAPZ/114-389..KSAYKIVE.NKD.MRI..LRDP............YT..EKSFVKFYTTKRIGGAAVNC.NAIKLLTV-----------
A9BYD9_DELAS/120-394GGLAAQGWDR.EDVSVSISFEDR..............DNFVKNMATVLCEERIALTVFRP.ASFVKGAF-----------
Q5Z3V6_NOCFA/148-434..AKAVLWDR.EETTVTITDSHA..............DFFIRNLVAILAEERLAFAVTRP.AAFVKTDI-----------
A5CD71_ORITB/88-365..KLAYKIVD.HAANIKM..TRDP............YT..EKPFVKFYAVKRVGGDIVVS.KAIKILQF-----------
A8FGQ6_BACP2/20-302...KNIIVGF.SRH.IRIEVEKD................IRSRKFIIVLTAKLDSKFEEE.DAV..AKV-----------
A1TD88_MYCVP/110-388...QNFVIAD.RLG.TTLSYIPNLM..........GPNGRPVGKAGWHAWIRVGSDVVNP.GAFRLLNV-----------
A9CJN8_AGRT5/134-419..RAGYLVVD.RTG.VRI..LRDP............YS..AKPYVLFYTTKRVGGGVQNF.EAIKLVKF-----------
A3DG61_CLOTH/127-416...TQYIGID.KKG.LTSDVSIH..............VRFLYDEQVFRFIYKFNGMPYKN.KPIMPYKG-----------
Q2SDM1_HAHCH/110-393..MRGYSIVD.RIG.ARM..LRDP............YT..HKPFVHFYTTKRVGGMLVDS.NAIKVLTL-----------
B2JL19_BURP8/113-379..RQAMVWDR.QAINIEVSREDV..............DNFRRNMVTILVEERLGLSVFAQ.AAFATGSL-----------
B7GIM9_ANOFW/146-418...QQYTLVE.RES.ITIDSSTH..............VKFTEDQTAFRGKGRFDGKPVKP.EAFVLVTI-----------
B9KI56_ANAMF/104-375..KNAYKIVE.NRN.MKI..LRDP............FT..SKAFVAFYTTKRVGGSIING.SAIKLLKI-----------
C5AYR6_METEA/135-420..KRGYLVVD.RAG.LRT..LRDP............YS..AKPYVLFYTTKRVGGGVQDF.SAIKLLRF-----------
P71947_MYCTU/196-475...KQFIITD.RVG.STVELVPHVF..........GGNRRPTGQRGFFCWFRVGSDVLVD.NAFRVLKV-----------
Q2FX56_STAA8/38-311...DKLIYGI.PQL.IEYKIDETAQLSTVKNEDGTPVNLFEQDMVALRATMHVALHIADD.KAFAKLV.-----------
Q2G1W8_STAA8/130-399..KDAIVLFD.RSQ.YQASWTDY.................MHFGECLMIAVRQDCRILDY.KSAIVI..-----------
Q3J3W7_RHOS4/239-509...SGYRIVD.RVG.LAIMRDPF..............SLATKGQVRFHARKRVGADLTHP.DRFVKLKV-----------
Q81X82_BACAN/69-344..AEAYATMI.KKG.AQMKRISDD............TKQALRGSHMLMLDMYCDGKILNE.DAIKFLK.-----------
Q81XY0_BACAN/102-381...SNYQLTI.FSD.MDVQRSTD..............FKFKQGMIAHRGSVFAGGNVISK.NGFLRV..-----------
Q88MK4_PSEPK/141-410..IAAQVFDR.EEAAVEV..STED............GDNFRTNMVTIRAEERLALAVYRP.ESFVHGEF-----------
Q9CFS0_LACLA/124-389..SQAITLFD.REN.MSLLPTNIG............AGAFETDTTKIRVIDRFDVKATDS.EALVAGS.-----------
Q9P9R2_XYLFA/357-623...ADLIIAM.WGG.LDITVDPY..............SLSTSGGTRIVVFQDVDFNIRRT.ESFCYG..-----------
Q9ZWV6_BPPHC/121-387...SKYRVRF.AGS.LRVDRSVD..............AKFSTDQIVYRFLQRADGLLVDA.RGAKVLT.-----------
W6SDV8_9CLOT/124-396...GYYWIAD.RQG.RSFKRLNE..............LFATTGQVGFLASQRVDGKLILP.EAIKVLQ.-----------

PF06673

Q9MCB6_9VIRU/1-347VLIGDLNVEN-YND-FDLRYNVEQ---------------------WLSETLVGGSIRGKNRSAYLTKKAS----------
Q9MCB8_9VIRU/1-347VLIGDLNVEN-YND-FDLRYNVEQ---------------------WLSETLVGGSIRGKNRSAYLKKKGS----------

PF05125

D3UZQ7_XENBS/11-324---PNLQILT-QRNTRQRKA.EFV---------------DDRKQFENKYLRNEGYALETP-ELYAAYD..----------
A6TE73_KLEP7/8-340---DNLSIYF-MDESHRRSI.IEN---------------PKLDQVENYESMNIDYVVETY-SAGCFIENI----------
D5CFH7_ENTCC/11-326---SNLHIYT-QRNTRQRKA.RFE---------------DDRKQFENSYLRNEGYAIEEP-ELYAAIDE.----------
M9X6X0_PASHA/8-336---ENLAIYV-QEGTTRKHI.ENV---------------PKKDRIETYESENIDYVVEDY-GCAALIENI----------
Q5E389_VIBF1/11-331---KNLSLYI-QKDSIRRSVAVKN---------------DKRDQIENFESMNMAYVVEQL-AKAAALE..----------
Q2S7I3_HAHCH/8-327---DNLSLYY-QADSLRRQV.IDN---------------PKRNRVEDFNSLNEGYVIEDE-TKA......----------
Q15Y13_PSEA6/12-335---SNLSLYY-QESSIRRQI.VDE---------------PKKNQYADYRSQNEGYVVETL-EKAAYIEGA----------
H2IY53_RAHAC/8-339---ENLSIYW-QEGGHRRRI.VEE---------------PEYNRVSTYSSSNDAYVIEDY-GYGCLIEGI----------
B8J319_DESDA/15-323---ANLSLYH-QDTSWRRKI.EDN---------------AKKDQYEDYLSRNEGYVVETP-EQL......----------
W8UNE7_YEREN/11-324---SNLHIYT-QRNTRQRKA.EFV---------------EDRTQYENKYLRNEGYAIEFP-EMYAAFD..----------
C1DBL5_LARHH/8-337---SNLSIYW-QEGGRRRHV.REE---------------PDYDRIANYESSNDAYVVERY-EAGCLIENI----------
E6WE37_PANSA/8-338---DNLSIYW-QDESRRRAV.IDN---------------PKRDRVENFESVNEAYVVEDY-ECVCLVENI----------
C5BH00_EDWI9/18-332---PNLQILT-LKGSRRRKA.EDA---------------GERKQFENSYWRYEGYALGDP-DLYAAVDE.----------
B2FIZ5_STRMK/8-334---SNLSLYW-QIGGRRRHI.MEQ---------------PNKNRVANFESSNDDYVIEDY-GLGAIAENI----------
C1DS28_AZOVD/8-332---DNLSIYW-QEGTRRRQV.VDN---------------AKRDRIENYESVNDAYVIEDL-GGAALAENI----------
Q8XY26_RALSO/8-332---DNLSIYY-QENARRRTI.LDN---------------AKRDRIENYESSNDAYVIEDL-ACAAMAENI----------
D8MKI1_ERWBE/9-341---SNLSIYW-MEEKQRRLL.KDE---------------PEYNRVATYESSNDAYVIEDY-GFGCLIEGI----------
F6IH75_9SPHN/8-355---DNLSIYW-QEETRRRQI.RDE---------------PALDQIENYESVNEDYVVEDY-GRTALVENV----------
J7TAL9_MORMO/8-339---DNLSIYW-QSETRRRHI.IDN---------------PKRDRIENYESVNEAYVVEDY-RGTALIENI----------
B2VH98_ERWT9/8-339---DNLSIYW-QEETRRRSI.IDN---------------PKRDRIENFESVNEAYVVEDY-DCTCLIENI----------
F4HA06_GALAU/6-327---SNLSIYV-QDASVRRSY.RND---------------EDRKGIIDSYYRNEGYVVEDA-GLFTAIEF.----------
G0AIP5_COLFT/8-331---DNLSVYF-QDGARRRRV.EDV---------------AKRDRIENYESSNDAYVVEDF-GLGALLENI----------
D5CB73_ENTCC/8-338---DNLSIYW-QEDTRRRSV.IDN---------------PKRDRIENFESVNEAYVVEDY-RCAALVENI----------
F0LXI5_VIBFN/8-332---DNLSIYI-QEDSVRRTVGKKN---------------DAKDQMENFESMNMAYVIEQL-EKVAAVE..----------
B0UTP6_HISS2/8-335---DNLSIYY-QEGAMRRTL.KDN---------------AEYDRYEDYTSSNDDFVVENY-ESVALLKNI----------
VPN_BPP2/8-340---ENLSIYY-MDDSHRRVI.EEN---------------PKLDRVENYESMNIDYVVEDY-AAGCLVEKI----------
H2IRH6_RAHAC/8-340---DNLSIYI-MDSSHRRHI.EEV---------------ARRDRIENYESLKIDFVIEDY-GCAAMIENI----------
B4F0K8_PROMH/8-339---DNLSIYF-LADSRRRQV.LDN---------------PKRDRIENYESVNEDFVVEDF-RGVALVENI----------
B0UW33_HISS2/6-327---NNLSIYT-QSSSVRRRF.ESN---------------QDKMGIITSYYRNEGYVVEDT-GLMTAIEAE----------
E6VXL3_DESAO/8-324---KNLSIYV-QEESWRRKV.EDN---------------PKKDRIEDYNSRNEGYVVEVP-EQ.......----------
A6VSU1_MARMS/18-341---DNLSIYF-QDTSVRRLQ.KDK---------------PELNEVQDFNSANQGYVVEDE-EMAAFIEGI----------
C5AGA6_BURGB/8-333---KNLSIYW-QIGGRRRTV.IDN---------------PKRDQVEFFESSNEAYVVEDF-GAGCLIENV----------
J7SK37_MORMO/10-341---KNLSIYW-QKGKLNRFI.KNE---------------PEYNRIATYAQSNDGYAVEDY-GLACLIEGI----------
R9VFP8_9ENTR/8-340---DNLSIYL-YEDGHRRHI.IEN---------------PKLDQVENYEQVKVDFVIEDY-EAGCLIENI----------
W0L880_SERFO/8-339---DNLSIYW-QEDTHRRMI.RDE---------------PEWDRIATYESSNDAYVVEDY-GCGCLIEGI----------
Q1QXQ6_CHRSD/8-331---DNLSIYW-QTGARRRYV.TEN---------------PKRNRIENYESSNDAYVIEDF-GAGCLIENI----------
C5BAR3_EDWI9/8-332---SNLSIYV-QKGSRRRAI.IDN---------------PKRDRVENFESSNDAFVVEDF-GCGCLFENI----------
F4HB41_GALAU/8-340---DNLSIYL-QEGSLRRAI.INN---------------PKRNRIEDFISKNIDFIVENY-DCAALIENI----------
Q63LE5_BURPS/8-332---SNLSIYY-QEGARRRTL.KEV---------------PERDRIENYESSNDAYVVEDF-GCGCVAENI----------
A7MN35_CROS8/15-328---SNLHIYT-QANTRYFRV.EFD---------------EENAEYVRSCLRNEGYALGNP-ELYAAVDES----------
A1VSG1_POLNA/8-331---DNLSIYY-QSSSRRRSI.IDN---------------PKRDQIENLESSNDAFVVEDY-GLCALVENI----------
F0LQ00_VIBFN/14-328---KNLQILT-QEGTQWRRQ.QNN---------------EDKLRFENNHIRMEGYAVGNM-KKFAAIENV----------
Q6D3X2_PECAS/8-339---KNLSVYY-QRGGLRRTI.KEE---------------SEYNRIATYQSSNDDFVIEDY-GNVAFIDGI----------
VPN_BPHC1/5-328---KNLSVYT-EAESVRRSL.RND---------------EDKKGLVTSYYRQEGYVVEDL-GLMTAIDHT----------
D8J087_HERSS/8-337---DNLSIYF-QNGGRRRRV.VDE---------------PKADRIENYESSNDAYVIEDE-GLAALVENV----------
H2FUC0_OCESG/13-333---ANLHLYT-QRGTRQRSA.AHN---------------QDRKGFESQYWRMEGYAVGEY-RAYASFD..----------
Q8P6J5_XANCP/8-334---ANLSIYY-QTGGRRRYI.QEV---------------PARDRIENYESSNDAYVVEDY-GLGCVVEHI----------
E0SAM8_DICD3/25-338---SNLHIYT-QRNTRQRKA.EFV---------------EDRKQFENKYLRNEGYAVEYP-ELYASF...----------
D3VKM6_XENNA/8-339---DNLSIYY-QDGTRRRTV.LDN---------------PRRDRIENFESVNEAYVVEDY-RGVALIEHI----------

PF11651

B7KXS0_METC4/1-419NTPFTQNIMA-HKSAFALTCVPLVKP.DGAVSCERESY....KGLSVRLIPYYDGTNDVSNWRLDILYGV.KAVDPRL.G
A5VES4_SPHWW/1-413ATTYAQNLVF-HKNAFALAIVPMVSP.PGAKDVARQSY....SGTSVRLIPFYNGSNDVSTMRLDVLYGF.KALDPRL.A
E8NPD4_SALET/1-428TTTA..NVFW-ADDSIRLLSQPIPVTHELFAGMKTSSFSIPSIGVNGIFATQGDINTLSGKCRIAVWYSA.CAVRPEAIG
B2U8F8_RALPJ/1-419SAQYRMNLAY-VPEAITMVTADLELP.KGVHEAYRETY....DNTSMRIVTAYNVQTDQFITRLDILYGF.KALRPEW.I
A5VW72_9CAUD/1-416AAPA..NLFW-ADGSVELMYGKLAFPTGQGPQVMTATT...EQGATLIMSYAFDHIKGVTTARFTTLYGC.SVLVPEYTG
A4E782_9ACTN/1-291.ANYTPSIAF-HKNAFALVTRQLEMP.LGAPKAYSTSY....DGFGLRVVQGYDQKTKTDTVSIDMLCGV.KTLSPEL.A
A4JD31_BURVG/1-395GTKYRKNLAY-FPEAFTLATADLEMPTSGVVESARAEF....DGVAMRMITAYDVMSDNLITRLDLLYGY.AAIRPEW.S
Q2G3Y7_NOVAD/1-418AAPL..NPFF-RKESLLLIPGSFTVNPDDGWQVMTATT...DLGISITYTRQGAINDLSVKARWDIDFGT.ALLSPEMAG
B0U721_XYLFM/1-409STAAVQNLVF-HEDAFATAFVPL..PVLANCDGYTATV....KSISVRVMSFGDGKADVEHTRIDVLFGTPVAVRPDH.A
E9Z5W1_ESCFE/1-421SQTMKPNLFY-NKFFCGLGSIPL..PKLHSIDSAVATY....EGFSIRVHKYADGDANVQKMRFDLLPAY.VCFNPHM.G
Q5YSR9_NOCFA/1-303......GLAF-HETAFTFTSVPLPRPLDGSHWYAIESY....KGISLRVTRDYDQKFKKDIISFDILYGV.STLDANR.S
A0A017QUU9_SALET/1-427DART..NVFW-ADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDISTLSGLCRIALWYGV.NATRPEAIG

PF09950

Q9P9P2_XYLFA/84-327-----
E1VAC6_HALED/80-318-----
A9C0G0_DELAS/60-320-----
A6TKD0_ALKMQ/60-304-----
H6NDU4_9BACL/55-298-----
Q7N327_PHOLL/62-316-----
Q6FAE7_ACIAD/80-324-----
R6PG10_9CLOT/91-341-----
G9ARJ4_PANAN/73-313-----
B4EG48_BURCJ/103-345-----
C5AFU5_BURGB/112-366-----
R6AF56_9FIRM/26-279-----
K8E4M7_CARML/57-293-----
E3HGR1_ACHXA/80-315-----
C9LU84_SELS3/82-338-----
R7JXV9_9CLOT/86-336-----
B8IDG5_METNO/63-315-----
R6R1V3_9FIRM/101-351-----
H8L668_FRAAD/90-334-----
R6RQ09_9CLOT/93-346-----
Q0BRS5_GRABC/66-316-----
Q2NSP7_SODGM/17-247-----
B8IIV0_METNO/63-315-----
Q6XQD3_BPT1/82-319-----
A9I906_BORPD/80-320-----
Q2G4R3_NOVAD/111-362-----
W8UFX7_YEREN/64-311-----
A7ILG8_XANP2/103-352-----
Q32EP9_SHIDS/73-313-----
G2IHV9_9SPHN/64-315-----
Q835B4_ENTFA/57-293-----
D0UIJ0_AGGAD/58-304-----
Q984H1_RHILO/86-339-----
Q2NRY5_SODGM/73-317-----

PF04454

D4H156_DENA2/1-251-----
C8WPL7_EGGLE/1-257-----
D0LZ74_HALO1/1-251-----
D1B7I4_THEAS/1-249-----
A1B987_PARDP/1-251-----
A3DFK3_CLOTH/1-257-----
A6TWC5_ALKMQ/1-250-----
A7HIB4_ANADF/2-255-----
A7I7A2_METB6/2-249-----
A8F8I8_THELT/3-247-----
A8L1F1_FRASN/1-253-----
A9BEM3_PETMO/1-251-----
A9FWS5_SORC5/3-254-----
A9H5P1_GLUDA/1-251-----
B1VSP7_STRGG/1-251-----
B2A6K6_NATTJ/8-259-----
B2GID2_KOCRD/1-252-----
B2JNZ6_BURP8/1-251-----
B2V6Y3_SULSY/1-265-----
B4UA40_HYDS0/1-265-----
B8CYH7_HALOH/1-249-----
B8EQK3_METSB/1-251-----
B8GHL2_METPE/5-250-----
B9JHD1_AGRRK/1-251-----
C0R0J8_BRAHW/1-256-----
C0ZHN4_BREBN/1-265-----
C0ZVK4_RHOE4/1-251-----
D5UVK7_TSUPD/1-251-----
C4XPM7_DESMR/1-251-----
C5B5H8_METEA/1-251-----
O67639_AQUAE/1-267-----
Q08WR7_STIAD/2-266-----
Q0RH88_FRAAA/1-253-----
Q2RVS0_RHORT/1-258-----
Q5YPL3_NOCFA/1-252-----
Q7MSM9_WOLSU/1-252-----
Q97V86_SULSO/96-329-----
B2HH42_MYCMM/1-251-----
Q0SE23_RHOSR/5-254-----
Q2IH48_ANADE/1-259-----
Q5L1H9_GEOKA/8-264-----
MARIT_THEMA/1-251-----

PF05065

E0THR4_PARBH/115-394-----
Q1GG15_RUEST/131-399-----
Q1DCZ9_MYXXD/94-361-----
Q0AAI8_ALKEH/83-374-----
Q3J4R6_RHOS4/160-429-----
A1T829_MYCVP/9-278-----
Q982R8_RHILO/176-465-----
A1AYY2_PARDP/166-435-----
Q1ILS6_KORVE/495-776-----
Q1GH34_RUEST/388-661-----
Q2GAM7_NOVAD/185-459-----
Q8XYS4_RALSO/130-408-----
Q3J3K4_RHOS4/110-395-----
Q1QLS4_NITHX/103-379-----
Q8ED08_SHEON/122-393-----
Q813J9_BACCR/150-424-----
Q3J5Z4_RHOS4/150-439-----
A1B638_PARDP/102-387-----
Q0AWY3_SYNWW/43-310-----
A4YU30_BRASO/140-423-----
Q2NV28_SODGM/127-397-----
Q1GHS2_RUEST/113-395-----
Q2L2B0_BORA1/123-401-----
A2SD63_METPP/97-385-----
A1TML8_ACIAC/138-428-----
Q1QKG8_NITHX/112-388-----
Q0S2A4_RHOSR/9-273-----
Q6LSF8_PHOPR/134-417-----
A5N1H4_CLOK5/152-424-----
A7HRJ6_PARL1/148-433-----
Q2YMS9_BRUA2/137-422-----
Q73HT5_WOLPM/107-395-----
Q9A4P7_CAUCR/53-338-----
Q3Z7J9_DEHM1/124-397-----
Q830G6_ENTFA/163-444-----
A7MP72_CROS8/125-401-----
A7ILP2_XANP2/167-448-----
B0T632_CAUSK/96-391-----
Q11H37_CHESB/111-386-----
Q88G49_PSEPK/193-483-----
Q72BY4_DESVH/118-395-----
B2JU92_BURP8/137-421-----
Q81Z09_BACAN/121-392-----
Q3SS55_NITWN/107-382-----
Q2GDU5_NEOSM/81-367-----
Q3SSD8_NITWN/135-418-----
A6VNQ3_ACTSZ/129-407-----
A5N291_CLOK5/33-297-----
Q5WID4_BACSK/129-404-----
A4XZF1_PSEMY/131-410-----
Q2N5Z6_ERYLH/94-380-----
Q2GJL3_ANAPZ/114-389-----
A9BYD9_DELAS/120-394-----
Q5Z3V6_NOCFA/148-434-----
A5CD71_ORITB/88-365-----
A8FGQ6_BACP2/20-302-----
A1TD88_MYCVP/110-388-----
A9CJN8_AGRT5/134-419-----
A3DG61_CLOTH/127-416-----
Q2SDM1_HAHCH/110-393-----
B2JL19_BURP8/113-379-----
B7GIM9_ANOFW/146-418-----
B9KI56_ANAMF/104-375-----
C5AYR6_METEA/135-420-----
P71947_MYCTU/196-475-----
Q2FX56_STAA8/38-311-----
Q2G1W8_STAA8/130-399-----
Q3J3W7_RHOS4/239-509-----
Q81X82_BACAN/69-344-----
Q81XY0_BACAN/102-381-----
Q88MK4_PSEPK/141-410-----
Q9CFS0_LACLA/124-389-----
Q9P9R2_XYLFA/357-623-----
Q9ZWV6_BPPHC/121-387-----
W6SDV8_9CLOT/124-396-----

PF06673

Q9MCB6_9VIRU/1-347-----
Q9MCB8_9VIRU/1-347-----

PF05125

D3UZQ7_XENBS/11-324-----
A6TE73_KLEP7/8-340-----
D5CFH7_ENTCC/11-326-----
M9X6X0_PASHA/8-336-----
Q5E389_VIBF1/11-331-----
Q2S7I3_HAHCH/8-327-----
Q15Y13_PSEA6/12-335-----
H2IY53_RAHAC/8-339-----
B8J319_DESDA/15-323-----
W8UNE7_YEREN/11-324-----
C1DBL5_LARHH/8-337-----
E6WE37_PANSA/8-338-----
C5BH00_EDWI9/18-332-----
B2FIZ5_STRMK/8-334-----
C1DS28_AZOVD/8-332-----
Q8XY26_RALSO/8-332-----
D8MKI1_ERWBE/9-341-----
F6IH75_9SPHN/8-355-----
J7TAL9_MORMO/8-339-----
B2VH98_ERWT9/8-339-----
F4HA06_GALAU/6-327-----
G0AIP5_COLFT/8-331-----
D5CB73_ENTCC/8-338-----
F0LXI5_VIBFN/8-332-----
B0UTP6_HISS2/8-335-----
VPN_BPP2/8-340-----
H2IRH6_RAHAC/8-340-----
B4F0K8_PROMH/8-339-----
B0UW33_HISS2/6-327-----
E6VXL3_DESAO/8-324-----
A6VSU1_MARMS/18-341-----
C5AGA6_BURGB/8-333-----
J7SK37_MORMO/10-341-----
R9VFP8_9ENTR/8-340-----
W0L880_SERFO/8-339-----
Q1QXQ6_CHRSD/8-331-----
C5BAR3_EDWI9/8-332-----
F4HB41_GALAU/8-340-----
Q63LE5_BURPS/8-332-----
A7MN35_CROS8/15-328-----
A1VSG1_POLNA/8-331-----
F0LQ00_VIBFN/14-328-----
Q6D3X2_PECAS/8-339-----
VPN_BPHC1/5-328-----
D8J087_HERSS/8-337-----
H2FUC0_OCESG/13-333-----
Q8P6J5_XANCP/8-334-----
E0SAM8_DICD3/25-338-----
D3VKM6_XENNA/8-339-----

PF11651

B7KXS0_METC4/1-419VRLNG
A5VES4_SPHWW/1-413TRISG
E8NPD4_SALET/1-428VGLPN
B2U8F8_RALPJ/1-419VRVAD
A5VW72_9CAUD/1-416IVIAG
A4E782_9ACTN/1-291AVITD
A4JD31_BURVG/1-395VVVAD
Q2G3Y7_NOVAD/1-418VQMFG
B0U721_XYLFM/1-409CRVTQ
E9Z5W1_ESCFE/1-421GQFFG
Q5YSR9_NOCFA/1-303VLLRG
A0A017QUU9_SALET/1-427VGLPG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window