Sequence alignment for CL0373

PF09950

A3M3U3_ACIBT/79-324-------------------------------------------------------------VGMG..KDHS.GTGN----
A6UAP6_SINMW/63-317-------------------------------------------------------------VGQA..QWFS.GLAH----
Q9P9P2_XYLFA/83-327-------------------------------------------------------------SGRG..KRHS.GRGE----
Q0T6M7_SHIF8/67-313-------------------------------------------------------------ANPNGKNWVG.KDST----
A7ILG8_XANP2/97-352-------------------------------------------------------------AAPSGLSWAS.LEAT----
A3L742_PSEAI/62-309-------------------------------------------------------------VGKA..DWVN.GNAD----
A9ABK3_BURM1/97-345-------------------------------------------------------------PSPAGKSWVG.KDAN----
Q7N327_PHOLL/60-317-------------------------------------------------------------SLKD..GIIG.NKTN----
A5PIZ3_9CAUD/86-326-------------------------------------------------------------VGHA..KIIA.DYTD----
Q2G4R3_NOVAD/110-363-------------------------------------------------------------VGQA..EFMG.GGAF----
Q2NRY5_SODGM/71-317-------------------------------------------------------------VGADGESWIS.HSTN----
Q2NSP7_SODGM/16-248-------------------------------------------------------------VGEP..KIIS.DNAD----
A4N6E6_HAEIF/55-278-------------------------------------------------------------SLDD..GLIT.TGTS----
Q333F7_9CAUD/77-311-------------------------------------------------------------VGIA..QIIA.DYSD----
A5UGK3_HAEIG/78-315-------------------------------------------------------------VGMA..KVVA.NYAD----
Q0BRS5_GRABC/65-316-------------------------------------------------------------VGRA..QWFN.GQAQ----
B0UJ01_METS4/61-314-------------------------------------------------------------VGQA..AWLH.GAAS----
Q6XQD3_BPT1/81-319-------------------------------------------------------------VGTA..QIIA.DYTD----
A6TKD0_ALKMQ/59-304-------------------------------------------------------------RGAA..KIFAYGASD----
Q835B4_ENTFA/56-293-------------------------------------------------------------SGAA..KIIA.NGAD----
Q45PZ1_9CAUD/59-293-------------------------------------------------------------VGIA..QIVA.DYTD----
A2WAD9_9BURK/103-363-------------------------------------------------------------INPNGLNWIS.NEGN----
Q46YM7_CUPPJ/97-345-------------------------------------------------------------ASPNGKSWIG.KDAS----
A9C0G0_DELAS/59-320-------------------------------------------------------------TGRA..NWQS.GYAK----
Q984H1_RHILO/85-339-------------------------------------------------------------VGQA..QWFN.GNAH----
A8ATG6_9CAUD/56-301-------------------------------------------------------------SGAA..KIIA.NGAD----

PF04454

C9RYB7_GEOSY/5-265-------------------------KL....Y-P-EAPLTSSQWGEL..DELVIETARRQLVGRRFIDLYG-PLGE----
D4H156_DENA2/1-251-------------------------MN.LLRK-D-FAPIGSAAWDEI..NTIAKETLKANLSARRFADVEG-PYGI----
D2Z797_9BACT/1-250-------------------------MD.LLRR-S-LAPITQEAWDAI..DEQARDVLKGCLSARRVVDVKG-PFGW----
C8WPL7_EGGLE/1-257-------------------------MD.YLAR-E-SADLSDGLWNRI..DETVIGTARAQLTCRRFLKVFG-PLGA----
D0LZ74_HALO1/1-251-------------------------MD.LLKR-H-LAPIVPDAWSAI..DEEAKEIFQGHLAGRKLVDFRG-PFGW----
D1B7I4_THEAS/1-249-------------------------MD.VLKR-G-FAPISQEAWGVL..DQQARVILRENLSARRFVDVEG-PKGW----
A0KD92_BURCH/1-251-------------------------MN.NLHR-E-LAPISSAAWEQI..EEEVARTFKRSVAGRRVVDVEG-PAGP----
A0PLA3_MYCUA/1-251-------------------------MN.NLYR-D-LAPVTEAGWAEI..ELEATRTFKRHIAGRRVVDVSD-PGGP----
A1B987_PARDP/1-251-------------------------MD.NLHR-K-LAPISDAAWAQI..EDEAARTLKRYLGARRVVDVHG-PEGF----
A3DFK3_CLOTH/1-257-------------------------MD.FLSR-E-GSPISAELWEKI..DEAVVSAAKKILTGRRFISIYG-PLGA----
A4WHF5_PYRAR/156-358-------------------------TY.....-.-....................................-EAGP----
MARIT_THEP1/1-251-------------------------ME.FLKR-S-FAPLTEKQWQEI..DNRAREIFKTQLYGRKFVDVEG-PYGW----
A6TWC5_ALKMQ/1-250-------------------------MD.ILKR-D-MAPLTESVWEEI..DQRAAEVLKTHLSARRVVNIVG-PKGW----
A7HIB4_ANADF/2-255-------------------------TT.WLDR-E-GAPFAQEVWDRI..DAVARSAADEVRAGRRLLEVVG-PLGF----
A7I7A2_METB6/2-249-------------------------ANVYLGR-D-EAPIGAESWKLI..DDVAVQAAKGQLAGRRLLAIEG-PYGF----
A8F8I8_THELT/3-247-------------------------NK.YLMQ-E-DAPFDPKLWQLF..NETMTDIAKAQLVGRRILSVKG-PFGL----
A8L1F1_FRASN/1-253-------------------------MN.HLLR-G-HAPLSEEAWKAV..DEEARSRLTTNLAARKLIDFAG-PHGW----
A8UW07_9AQUI/3-269-------------------------MD.FLGR-D-EAPLTQEEWEQI..DEAVVKVAKENLVCRRFVPVMG-PIGP----
A9BEM3_PETMO/1-251-------------------------MD.FLKR-E-LAPITEEAWEEL..DERAKEIFKNKLKIRPIIDVEG-PYGW----
A9FWS5_SORC5/3-254-------------------------MD.LLKR-E-LAPILPAAWDLI..DHEATRVLKLHLAGRKVVDFRG-PFGW----
A9H5P1_GLUDA/1-251-------------------------MN.NLHR-E-LAPISEAAWAQI..EEEASRTLKRYLAARRVVDVPE-AKGF----
B1CAJ4_9FIRM/1-257-------------------------MK.YLAR-E-DAPFSSDVWDEI..DKTVVDTLKKHLVCRRFLSLFG-PLGA----
B1L4G8_KORCO/136-346-------------------------SI.....-.-.........................RRVRPSLPVT.-SLGR----
B1VSP7_STRGG/1-251-------------------------MN.NLHR-E-LAPVTPSAWEEI..EEEARRTFRRHVAGRRVVDVSD-PAGP----
B2A6K6_NATTJ/8-259-------------------------MN.LFKE-Q-LAPLTNAAWNEI..NDRAAQVIKSNLSTRKVFKING-PKGL----
B2GID2_KOCRD/1-252-------------------------MN.NLHR-D-LAPISSAAWADM..GDEARRTFAARAAARRTVDMPE-PAGA----
B2JNZ6_BURP8/1-251-------------------------MN.NLHR-E-LAPISSEAWSQI..EEEVARTFKRSVAGRRVVDVKG-PGGV----
B2V6Y3_SULSY/1-265-------------------------ME.FLKR-N-EAPLSESDWEKI..DKVVVETAKRVLVGRRFIEISG-PYDP----
B4UA40_HYDS0/1-265-------------------------MN.FLHR-E-ESPLTAQEWQTI..DNIVVNTARNHLVGRRFIELTQ-ALDP----
B4UI59_ANASK/1-259-------------------------MS.WQDR-D-GAPFGQQVWDRI..DGAVEAAAAEARAGRRLLKVVG-PLGF----
B8CYH7_HALOH/1-249-------------------------MV.NLKR-S-LAPITPDAWEFI..DKEARRVLKLKLSARKAVDFVG-PKGI----
B8D495_DESK1/120-343-------------------------QG.....-.-........IELV..GKIFLNIVNETRSLRKYIPVV.-DLGK----
B8EQK3_METSB/1-251-------------------------MN.NLHR-E-LAPISDAAWAQI..EEETTRTLKRYLAGRRVVDMPQ-TGGV----
B8GHL2_METPE/5-250-------------------------S..YLGR-S-DAPITAETWTII..DTTMVEAAKSMLTGRRLLHLEG-PYGL----
B9JHD1_AGRRK/1-251-------------------------MN.NLHR-Q-LAPISDSAWAQI..EEEASRTLKRHLAARRVVDVQD-PGGV----
B9MNM0_ANATD/1-251-------------------------MY.FMGR-D-QSPLKSEHWKVI..DEIVINTAKKVLVGRRFLHLFG-PLGP----
B9YCJ8_9FIRM/1-256-------------------------MD.VLGR-E-SAPINAVLWNQI..DEAVIETARKLLTGRRFLSLAG-PLGA----
C0R0J8_BRAHW/1-256-------------------------MD.YLAR-E-SSPFEESFWQNI..DKVVVETASRTLIGRRFLSIYG-PLGA----
C0ZHN4_BREBN/1-265-------------------------MDKLRKY-P-DSPLTTEEWNQL..DATVVDMARRQLVGRRFIDIYG-PLGE----
C0ZVK4_RHOE4/1-251-------------------------MT.NLHR-D-LAPISAAAWAEI..EEEASRTFKRHVAGRRVVDVEG-PSGD----
C1B1V8_RHOOB/4-254-------------------------SS.NLHR-N-LAPVTEAAWQQI..GEEATRTFKRHVAGRRVVDVAG-PFGY----
C1DV98_SULAA/1-265-------------------------ME.FLKR-E-EAPLTAADWERL..DKIVIETVKKNLVGRRFIELSG-PYDA----
D5UVK7_TSUPD/1-251-------------------------MN.NLYR-D-LAPVTSAAWSEI..ETEATRTFKRNIAGRRVVDLGD-PLGP----
C3MM35_SULIL/96-329-------------------------ES.....-K-DFPLIQPTPSESRKDPIVSWIIEGIMSNRVVRNIGN-MIKY----
C4XPM7_DESMR/1-251-------------------------MD.ILKR-D-LAPVTAAAWQAV..DSRARQTLTTMLSGRRVVDVAG-PLGW----
C5B5H8_METEA/1-251-------------------------MN.NLHR-E-LAPISDAAWAQI..EDEASRTLKRYLAARRVVDVVG-PKGP----
O67639_AQUAE/1-267-------------------------ME.FLQR-D-QAPLTAEEWEQI..DKTAYEVFKSTVVCRKFMPVVG-PFGA----
Q08WR7_STIAD/2-266-------------------------PD.FLGH-A-ENPLREEEWARL..NETVIQVARRSLVGRRILDIYG-PLGA----
Q0RH88_FRAAA/1-253-------------------------MN.HLLR-G-HAPLTDAAWKAV..DDEAKARLTTNLAARKVVDFAG-PHGW----
Q1K2C9_DESAC/1-251-------------------------MD.LLRR-E-LAPISPQGWSEI..DTMARETLVANLSGRKFIDMDG-PHGI----
Q2RVS0_RHORT/1-258-------------------------MN.DLMR-D-LAPISAKAWAEI..ETEARGTLTVTLAARKVVDFKG-PLGW----
Q401P1_9EURY/136-332-------------------------VT.....-.-................................RIEG-....----
LIN18_BRELN/1-252-------------------------MN.NLYR-E-LAPIPGPAWAEI..EEEARRTFKRNIAGRRIVDVAG-PTGF----
Q4JC29_SULAC/153-340-------------------------DE.....-.-....................................-....----
Q5YPL3_NOCFA/1-252-------------------------MN.NLHR-E-LAPITSEAWAAI..EEEAGRTFKRHIAGRRVVDVAG-PHGV----
Q7MSM9_WOLSU/1-252-------------------------MD.ILRR-E-NAQFPASIWSAI..EKEAGLVFGKHLTGRKVVDFKG-GLGI----
Q835B4_ENTFA/4-243-------------------------DV.....-.-TATLEARDLQEI..DKVIYQAPQEELVARTMFNVKT-DINP----
Q972Z8_SULTO/108-304-------------------------EL.....-.-......TNEKTK..VEKSDAMSEKNYVKSSLKSLSN-IIKW----
Q97V86_SULSO/96-329-------------------------ET.....-K-DFPLIPTSSKEISKDHIVSWITEGIVSSRIMRNIGN-TIKY----

PF11651

B7KXS0_METC4/1-419-------------------------MPNNFLT..-ANVIAKAAVKILDNELVAASKVHRGYEDEFSSTVNGYQKGA----
Q3RBQ2_XYLFA/1-408-------------------------MGTQALT..-HQMIAREAAKMLVEQNNVVTNINTERSKEFGEEINGYKKGD----
A5VES4_SPHWW/1-413-------------------------MANSLLT..-IDVIAKEALSVLENELVAAKAVHRGLESEFGNAKNGYSSGA----
Q57SP8_SALCH/1-428-------------------------MALNEGQ.L-VTYALDEIIETVQNLTPMASKVTK.YTPPA....ESMQ.RS----
B2U8F8_RALPJ/1-419-------------------------MANTILT..-IDMITREALRLFKNSNAFLKSIDRQYDEDF..AKSGAKIGS----
Q1R947_ECOUT/1-416-------------------------MANQLAK.D-LEIMFENYVEGFEAACVVSRNAKK.FRPGD....TAMQ.RA----
A4E782_9ACTN/1-291-------------------------MSNTILT..-PNIIANEALDVLRTNAVMANLVHRDYSSEF.....VAGVGD----
A4JD31_BURVG/1-395-------------------------MANSLLT..-INMITNEAVRLFTQTNAFLRTVNRQYDDQF..ARSGAKIGN----
Q2G3Y7_NOVAD/1-418-------------------------MATSFTK.Q-EQVMFDNVIEGFDDMLVIGKAAEV.YQPLD....AQEQVNA----
Q3RHM5_XYLFA/1-409-------------------------MGTQALT..-HQMIARESAKMLVEQNNVVTNINTTRSKEFGEEINGYKKGD----
Q9AYZ7_BPHK6/1-421-------------------------MPNNLDSNV-SQIVLKKFLPGFMSDLVLAKTVDRQLLAGE....INSSTGD----
Q5YSR9_NOCFA/1-303-------------------------MANTFLT..-PDVIAREVLANLYENLVMVPLVHTGYSTEF....TSAKIGD----
B5NXL6_SALET/1-427-------------------------MALNEGQ.I-VTLAVDEIIETISAITPMAQKAKK.YTPPA....ASMQ.RS----

PF06673

Q9MCB6_9VIRU/1-347-------------------------MGVNETQEMMKQAIEAGVK-----VRELETKVEELNKEREELKK-E-REAN----
Q9MCB8_9VIRU/1-347-------------------------MGANETQEIMKQAIEAGVK-----VRELEAKVEELNKEREELKK-E-REAS----

PF05065

A5IR70_STAA9/36-312-------------------------DG.TLMNEF.TTPILQEVMENSK.IMQLGKYEP.MEGTEKKFTF.W-ADKP....
E0THR4_PARBH/115-394-------------------------GAVLSPQET.SDVIDLKLRDASP.MRQLATVRR..IS.ANVFRK.P-VPLT....
A5MBG7_STRPN/137-417-------------------------NK.ILPEPV.LIAIQNAFNDYDG.ILNHVTKDPRYAVRVALQTKQA-KAKG....
B1J5N2_PSEPW/144-414-------------------------VGVGIQPTR.VPGIVVGPEREFT.IRDLIMPGRTGSNAVEFVQE.T-GFQN....
Q1GG15_SILST/131-399-------------------------VGDGVAPTR.LPGIQGLPQRRLT.IRDLLAQGRMDGNTIEYVQE.T-GFNN....
Q3HL14_9CAUD/114-381-------------------------GGLVIPQDI.QTQINELARSFDA.LEQYVTVEPVRTR.SGSRVL.E-KNSD....
Q1DCZ9_MYXXD/94-361-------------------------AGVLVPIQQ.SGEVIEFLRPDAA.MLKLGVRTQ..TF.KGELHM.G-KQTG....
Q3R2V6_XYLFA/355-623-------------------------GSNIIATELHASSFIEILRNKTW.VMQR.ATVM..GGLVGNVDI.P-RQKG....
Q7Y4I4_9CAUD/8-297-------------------------KGNLFNPEL.VTKVINKVKGHSS.IAKLSPQKPIPFNGQREFVFDF-DS......
Q6GAL1_STAAS/126-378-------------------------GDKLLPKTL.SKEIVSEPFAKNQ.LREKARLTNIKGLEIPRVSYTL-DDDD....
B0K6S2_THEPX/124-397-------------------------GGYLVPDEF.ERTLVQTLEEENV.FRKLAKIIQ..TS.SGDRKI.P-VVVT....
Q1CQW9_STRPC/140-392-------------------------VKPVSSEEI.LYTPAREVKTVVD.LKQFTSIHPAKKA.SGKWPV.L-QC.A....
Q0AAI8_ALHEH/83-374-------------------------QGVTVRSDW.ADQIFKKIRESSP.VRQVANNLS..TN.SNELEV.L-VDRG....
A4WC36_ENT38/128-406-------------------------GGYTVPTQM.LNKIVDSMKAYGG.IASVAQILN..TSTGQDITW.S-TSDG....
Q3EL79_BACTI/115-382-------------------------GGYIVPEDI.TTTINQLKQTVDN.LEQYVNVQPVSTN.KGARTL.E-KRAA....
Q139N4_RHOPS/143-428-------------------------GGYLVPEEL.ERSIAARLSAISP.IRGLASVRQ..IS.GSVYKK.P-FMTA....
A5F9J3_CLOK5/135-393-------------------------GDKLLPSTM.TQELLTEPMATNP.LRGISTFTNITNLEIPKLLFTL-DDDD....
Q6G7X2_STAAS/129-401-------------------------GFVVIPEEI.VTDILKLKEVEFN.LDKYVTVKRVTNGSGKYPVVRQ-SEVA....
A0AI11_LISW6/136-390-------------------------VGVVIPEEI.IYSPEREVKTVTN.LAELVSKTKVNTA.SGKYPI.L-KR.A....
Q3J4R6_RHOS4/160-429-------------------------AGPLIAPQR.ETEIVGLPRRQVF.VRDLLSRSTTNSNLVQYARM.K-ARTN....
A5VKJ7_LACRD/107-373-------------------------GGLTIPDDI.QYAIHQLVRQFAT.LQNLVNVESVTTT.TGTRTY.E-KLSD....
Q92CB8_LISIN/19-306-------------------------AGGRMNPAQ.ASKFIRMVQDTPT.ILKDARLVQMESDRQIIEKIGF-GQRI....
A5KJS3_9FIRM/124-396-------------------------GGYLVPDEY.ERTLVEALNDEVF.FRNLATVIK..TS.SGDRKI.P-IVTS....
A1VBS2_DESVV/113-404-------------------------GGYALPIEQ.DRTILRLLREQSP.MRQVCRVLT..IG.TEDYRK.L-VNLG....
A1T829_MYCVP/9-278-------------------------HGIVVPDEL.GDLVIAAAARASVALRASVVVTT..ASREYRVPV.L-SGLP....
Q982R8_RHILO/176-465-------------------------GGYLVPTET.EKTIDRIMGVTST.MRQLATILP..IG.TSEYKK.L-VNMG....
Q5HTE1_CAMJR/118-386-------------------------GGILVPTTL.QSKIREKLNDLSV.IRKIATVQK.....SSSNQI.I-PVFD....
A1AYY2_PARDP/166-435-------------------------GGGLIWSDR.ETEIVGLPRRQMT.IRNLLSQGRTGSNAIEYARQ.T-TRTN....
Q7WLQ0_BORBR/118-390-------------------------AGSLIQPTR.VPGIVATPNQRLF.VRDLLTWGPTDSSDVEFVRE.T-LFTN....
A3LM59_PSEAI/122-402-------------------------AGIVVPNY..DPTIQPGIRQELR.IRDLLTSIPVSGQSYTYYRE.L-LHTR....
Q8X755_ECO57/100-380-------------------------GGYTVIPEL.NTEIMRMLTDEST.MRRICTVKK..IS.SNEFKQ.L-VSAG....
Q1ILS6_KORVE/495-776-------------------------GTNFVQTTIRPDEFIDLLRNRLV.VMKMGARKL..GDLQGNLQL.P-KQTA....
B8FNY7_DESHD/107-369-------------------------SGAILPQGF.VNQVQVLTDGFPS.LKKYCHVIPTTTT.SGKMPI.S-SGST....
Q1GH34_SILST/388-661-------------------------GGNTIANPLLTQSFIQMLRNRTI.LLQL.ATPL..MGLVGNPDI.P-TQEG....
Q2GAM7_NOVAD/185-459-------------------------AGDLIVPQR.QPGIIGLPQRRMT.IRDLLTPGNTGSNAIQYVKE.T-GFTN....
Q8XYS4_RALSO/130-408-------------------------GGYTVPRTF.LAKVVEQLVTYGG.MASVMQNLT..TDGGEPIDW.P-VALG....
Q3J3K4_RHOS4/110-395-------------------------GGYLVDPQT.SDAIRSMLLSTAS.IRQIAGVVH..VE.ATSFDV.L-IDRT....
Q1NB79_9SPHN/81-368-------------------------GGYAVPREI.DQLIGSTLKGMSP.IRAIANVVR..TG.SAGYRK.L-VSAG....
Q5PB65_ANAMM/103-375-------------------------LAYLMPREI.SMHIDKRLSQSSV.MRKLCSVEK..VS.GDSLEY.F-TTNN....
Q1QLS4_NITHX/103-379-------------------------GGYLAPAEF.SAEVVKGIVEMSP.IRQAARVGS..TS.SGEVLL.P-KRTG....
Q65ES7_BACLD/133-400-------------------------GGLIVPQDI.STKINEKRRQFDT.LANLVDVIPVSTN.KGSRVL.E-KLAD....
Q8ED08_SHEON/122-393-------------------------GAGLVRPDR.MAGIVAGPERRLT.IRDLIAPGETESNTIEYVKE.T-GFTN....
Q813J9_BACCR/150-424-------------------------GSVTIPDFL.SKEIITYAQEENF.LRRLGTGVK..TKENIKYPV.L-VK......
Q3J5Z4_RHOS4/150-439-------------------------GGVTIPRPQ.AAELIEMLRARVV.VRASGARTL..PMPAGEMRH.A-KQVG....
Q3F193_BACTI/24-317-------------------------ANILIPKVI.STVVLEAAEPLTL.VSNLFQKVT..LNEGRSMEFIH-FGAI....
A1B638_PARDP/102-387-------------------------GGFLAAPTV.AMQVQEALNVTAS.LRRVANVVA..VE.SASYEV.L-VDMG....
A5WQQ4_MYCTF/196-475-------------------------GGFLIPAALDPAILLSGDGSTNP.IRQVARVVQ...TTSEVWRGVT-SEGA....
Q1R877_ECOUT/115-398-------------------------GGYAVPEAL.DRNILTLLKDEVV.MRQEATVIT..VG.GSDYKK.L-VNLG....
A4IS66_GEOTN/24-302-------------------------GSSRLTPAK.QRLFVRTVSEATR.ILDEARRIDMTSHTHDIDRIAF-GSRI....
Q17ZS7_CLOD6/178-435-------------------------GSTLIPSEL.SAGIIDLARNKMA.LSNINVI....PMETNNLTL.A-KVKS....
Q854Z2_9CAUD/258-539-------------------------GGYLVPFQLDPTVIITSNGSLND.IRRFARQVV...ATGDVWHGVS-SAAV....
Q9AZS7_9CAUD/124-390-------------------------AGLTIPQDI.RTMINTLVRQYDS.LQQYVRVESVSTS.NGSRVY.E-KWTD....
Q0AWY3_SYNWW/43-310-------------------------GALTLNPKG.QSRYMAALEKEGL.FRSLATDIR..AY.NYNYNI.K-TANG....
A4YU30_BRASO/140-423-------------------------EGVLVPTEW.REQIWSLVFADND.LLGFCNPEP...TQGNTVGI.V-KDET....
Q1B5C3_MYCSS/9-280-------------------------GSILKPEEV.HDLIVQPTQEQSV.AMQTATVVP.TSSAEFRFPV.V-VEDA....
Q2NV28_SODGM/127-397-------------------------TGTIVAPDR.QADILTKPKQRLF.IRDLIASGKTQSNTIYYVKQ.K-GFTN....
Q1B7W7_MYCSS/9-278-------------------------NPELLQEQV.ANILVQPLEAASV.VLSSGVRIF...DTSGPLRI.P-KLTA....
A3T0Y2_9RHOB/165-433-------------------------GG.LIVPDQ.DRQVTSMPMQRLA.VRSLLSQATTESDLVKYARQ.T-VRTS....
Q1GHS2_SILST/113-395-------------------------GGFLVDPQT.ADVVRSVLHSTAS.IRAVASVVN..VE.ATSFDV.L-IDHS....
Q2L2B0_BORA1/123-401-------------------------GGYTVPRTF.WAKVVESMKQYGG.IASVAQILT..TDGGGPIEW.P-TSNG....
A2SD63_METPP/97-385-------------------------GGYMVLPQM.SDEVTRVMLETSP.LLSSVRLVD..LEPTDEFEE.I-VDRD....
Q3J223_RHOS4/110-368-------------------------LANVIPRTV.SDEVIAAARGYSA.LAGLAKYVVTGTSEFGIMVS..-........
A5TX36_FUSNP/106-365-------------------------GGYLVPIEQ.FEKIKELKRERVE.LKALCNVVSVKSL.SGNMPI.E-KGGD....
A1TML8_ACIAC/138-428-------------------------GGVLVPENF.ATSVIESLRPKSV.IRRLGAVSI..PLNNGNMTL.P-RIMG....
Q3DFH6_STRAG/127-397-------------------------GGHLVPDEY.EKKLVQGLQEENF.FRSLATVIK..TS.SGERKI.P-VVTG....
Q637B0_BACCZ/101-383-------------------------SGNVVLPKHSATDIRPTFNEVST.LIDRVSSKTLKGGESYQQPY.I-KSYG....
Q14M91_SPICI/321-590-------------------------ASPLVPTTI.WKNILNEIKLTSN.LINEVTILE..HRGKLDIAY.E-KDST....
Q1QKG8_NITHX/112-388-------------------------GGYLAPAEF.STEFIRDLVQFSP.IRALAIVRD..TL.APSVSY.P-RRTG....
A3KA53_9RHOB/140-434-------------------------GGFLIPEDV.STEVIELLRPASV.VTAMSPRIV..PMPNGNMTM.N-RRAT....
A5M4C8_STRPN/8-299-------------------------TGTLFKPEV.VKQLISKVQGKSV.LAKLSAQTPIPFNGVEQFIFNL-EG......
Q0S2A4_RHOSR/9-273-------------------------ENAFTPEDY.GKLIDTEVDAKSV.AFQAATVVN.TDKHQIRVPI.L-VSDP....
A3X0R0_9BRAD/133-422-------------------------GGYLVPEET.EAGIDRVLGTVST.IRSLARTIS..IS.TNTYKK.L-VNMG....
Q6LSF8_PHOPR/134-417-------------------------GGYTTAPEW.IRQVEQAMKAYGG.MYDVSTVMR..TATGNTINF.P-TTDA....
A5N1H4_CLOK5/152-424-------------------------TDAIIPEAV.IDMIQARLGDYSA.LYSEVYVQPL....TGTARI.I-MDGA....
Q859C1_9CAUD/118-386-------------------------NPNVLSRTL.YGQLIAQAVERSAIMRGGATTFT..TSDANPLDF.T-VITG....
A3W815_9RHOB/115-386-------------------------GGYLAPGEM.SAEFIRDLVEYSP.IRTVASVRS..IA.SPSVKY.P-KRTA....
Q6J1Y2_9CAUD/119-381-------------------------AGVLIPEEI.IYDPTAEVNSVVD.LSTLVTKTPVTTP.KGTYPI.L-KR.A....
A7HRJ6_PARL1/148-433-------------------------GGYLVPVET.EKLIDRIISEVSP.IRAIAGIRQ..IG.SASYKK.P-FAAG....
A4WS92_RHOS5/111-382-------------------------GGYLAPAEM.STEFIRDLVEFSP.VRAVASVRQ..TG.SPSIIY.P-ARTG....
Q9XJ79_9CAUD/117-382-------------------------AGLTIPQDI.RTAINTLVRQFDS.LQEYVNVENVTTL.TGSRVY.E-KWAD....
Q2YMS9_BRUA2/137-422-------------------------GGYLVPAEL.ETEIGRRLAVLSP.IRGISGVRQ..VS.GAVLKK.P-FSIS....
A3SMP9_9RHOB/146-433-------------------------GGVTIPQPL.AQEVIDLLRPKVV.VRKAGAQPS..PIPAGKMRH.A-RLAS....
Q73HT5_WOLPM/107-395-------------------------GGYLVTPHI.VKRINKRVTDSSP.MRQICSSQR..IS.TETLDY.I-IEDF....
B1ZCX2_METPB/163-460-------------------------GGVLLPTPL.AAEVVPFLRPETT.FLQLNPVRVPLTAGQYNQPV.G-ATGA....
Q9A4P7_CAUCR/53-338-------------------------GGYVAPPEL.ERLILRRLAATSP.MREICQVRT..IG.AGTFRK.P-VSPT....
Q3Z7J9_DEHE1/124-397-------------------------GGYLVPDEY.EKQLIDALQEENF.FRSLATVIQ..TQ.SGTHTI.P-VVAS....
Q9B0A7_BPMB1/19-303-------------------------TGYLDPVQ..AKDYFAEAEKTSI.VQRVAQKIPMGATGIVIPHWTG-DV......
Q6UAX6_9CAUD/134-425-------------------------GGVLIPQNI.HSEVIELLRDRTI.VRKLGARSI..PLPNGNMSL.P-RLAG....
A6VBQ1_PSEA7/140-406-------------------------ATDLVGTDHRADQYIGPLRDRLL.ARSLGVRVL..SGLQGDVSI.P-KFGT....
A7B3D6_RUMGN/128-405-------------------------SGAVIPTTI.MNEIIQKLESYGS.IYAKVRKIN..VQGGVSIPI.A-DLKP....
Q12EX8_POLSJ/63-302-------------------------GSELEAQSA.VAEFLEIVKPLTI.IGRMENLRR..VPVNAPVVK.Q-SSGA....
Q830G6_ENTFA/163-444-------------------------GSVTVPEVI.ASEVISYAQEENL.LRKYGTVIR..TAGDVKYPI.L-VK......
A7MP72_CROS8/125-401-------------------------GGFTVPKQF.RNRVVEAMKAYGG.IAGVCQILS..TSNGQDIDW.T-YSDG....
A0JQM6_LACS1/116-372-------------------------GSKLLPVTI.ANDIIAEPTDTNP.LRDDELVTAVTNLERPRIDVTI-DDDS....
A4EPK1_9RHOB/132-412-------------------------EGYLLPPQY.RDQIWELVNDFDE.FGPLIDEEP...TGKREVKLGA-DEST....
A3XTC6_9VIBR/12-299-------------------------TE.LTQENL.VDKYTAKAVENEV.ILSSVGMKPAKSSKHKIPVLKE-YVSV....
Q3JTL8_BURP1/144-412-------------------------NS.LVVADR.QAGIIAPPQRKMT.IRDLLMPGQTSSSSIEYTVE.T-GFTN....
A7ILP2_XANP2/167-448-------------------------GGYLVPTAT.SARILTRIWETSP.LRQLSTVET..IG.TDKIEI.P-IDDD....
Q77WA0_BPHK0/112-381-------------------------AGSLIQPMQ.IPGIIMPGLRRLT.IRDLLAQGRTSSNALEYVRE.E-VFTN....
Q7Y5K8_9CAUD/121-389-------------------------AGALTTPNR.LPGFITQPDARLT.VRDLIGSGRTDSALIEYVQE.T-GFVN....
B0T632_CAUSK/96-391-------------------------GGITVPTNI.HTDVVEKLRKSSP.LLGLSTVTSLKGLQKLLLKTSA-AQAN....
Q6HR18_BACAN/82-358-------------------------GAITVPTSL.SNVIVEKLVEEAA.LFGRAKSFTPVSGTLEVLREKN-IG......
Q855V6_9CAUD/7-307-------------------------GTFQLPKHL.VPGVWQKAQGQSV.LARLSMAEPQEFGEQQYMTLTA-PP......
Q11H37_MESSB/111-386-------------------------GGFLVPDNF.VAEMLRNVVQFSP.VRQYARVMN..VA.GANVRM.P-KRTG....
Q88G49_PSEPK/193-483-------------------------GGVLVPQNF.SSEVIELLRPKSV.VRKLGAVSL..PLENGNLTV.P-RIKG....
Q9MBJ9_9CAUD/128-407-------------------------GGYGTTWNR...NIIYRRREKLV.VADLMDNLTMTNTTIKYLMEKA-NRVV....
Q9ZXF6_BPPH1/131-394-------------------------GGILIPEDI.GRQIHEFKRQFEP.LEQYVTVEPVTTR.SGTRLL.E-KNAD....
Q72BY4_DESVH/118-395-------------------------GGYTVPRET.ATSIIEALKAFGG.MRDVATIIT..TASGAPLNY.P-TSDG....
A5ZPL8_9FIRM/99-375-------------------------GGYTVPEDI.QTRINERRAAKFS.LVDLVDVEVVTTN.KGSRTY.K-KRAQ....
A5ZRV5_9FIRM/125-407-------------------------GGFTVPEDV.STDIIELRRTEND.LEQYVNVEKVATM.SGSRVI.E-VDAD....
A6NQ27_9FIRM/74-343-------------------------SAVLFPEYI.ARAVRQGMEEANL.LPSIVATTTRIEGMDYRSVASV-PGKE....
Q9AZM2_9CAUD/164-424-------------------------GKVIIPETI.LT.PEKEVHQFPR.LGSLVRTESVTTT.TGKLPI.F-N..N....
Q0FZ25_9RHIZ/128-413-------------------------GGFLVPDET.ETEIGRRLAAISP.VRAAATVRT..VS.AAVLKK.P-FAIS....
B2JU92_BURP8/137-421-------------------------GGFLVPPQF.ASEIFTLSLEEQA.LLPMTDSTP...ISGNSMVFPK-DETT....
Q81Z09_BACAN/121-392-------------------------GS.VIPQTV.LDKIIEKIEAVGM.ILPLITRTA..IKGGVTVPT.S-AVKP....
Q3SS55_NITWN/107-382-------------------------GGYLAPTEM.ATEFIRDLVQYSP.IRGLASVRS..TS.APAVSY.P-KRIG....
B8I8R8_CLOCE/60-320-------------------------NSAVIPKQF.VNQVIEIQKGYGS.LKQLCDVIPVTKN.EGTIPV.I-DLDQ....
Q2GDU5_NEOSM/81-367-------------------------NGFPLTDTL.INSIHEQMKKLSP.IRKLASVNT..IS.TDCITY.I-SNGD....
Q8XLC0_CLOPE/109-375-------------------------EGYILPQTV.STKIVELIRQYKS.LRDVVGHMETSTL.TGSFPI.E-NFET....
A4L2R1_LACRE/100-373-------------------------GGFLVPDEF.ENQLIQKLQKANV.LRTISHVIQ..TN.SGEHKI.P-VVAS....
Q8W6U5_9CAUD/140-430-------------------------GGVLVPENL.SSEVIELLRPKSV.VRKLGARTL..PLSNGNITI.P-RLKG....
Q3SSD8_NITWN/135-418-------------------------GGFVVPDQM.EAAIDRVLGTVSA.MRAISRVMS..IS.SGTYKK.L-VNQG....
A3WSQ9_9BRAD/101-392-------------------------GGYLVTPTI.SKQIQRKVFDVSP.LGRLARRVT..IERGDSFEE.P-IDPS....
Q0H261_9CAUD/146-418-------------------------GELTIPEVV.VNRIMDIMGDYTT.LYPLVDKIRV....KGTTRI.L-VDTD....
Q38K95_LACRE/117-373-------------------------VVATIPESI.LYNPENEVKSVTD.LSQLVTQFQATTA.SGKYPV.L-KR.A....
Q0SPK4_9VIRU/118-397-------------------------GGYAVPEDI.QTKINTRLKDTTD.LYNMVDYEPVFTR.SGSRTY.E-KRSK....
A7DYB2_9CAUD/103-361-------------------------QKAALPEYI.SSKIIERVRDYTQ.LSKLMTVVNVSQEAGHEAIEPA-SAVS....
Q9AZY5_9CAUD/140-394-------------------------GGALIPQEL.L.QPQLEPKDIVD.LSKYVRSVPVNSA.SGKFPV.I-SK.S....
A6VNQ3_ACTSZ/129-407-------------------------GGYTVPKEM.QARIVEQMKAYGG.IAQVAQILT..TSDGRTIEW.I-TADG....
B1JZG6_BURCC/143-413-------------------------AAGIVPNDFRADQFIGPLRNALV.MRALGARVL..TGLRGDVEI.P-KFKT....
Q857K6_BPMB2/17-320-------------------------FSAFLTPEQ.SQDYFAEIEKTSI.VQRIARKVPMGPTGISIPHWTG-AV......
A5N291_CLOK5/33-297-------------------------GAYVAPDEF.REGFNTALAKENI.LRRFATVIN..LS.SAEGKI.Q-AVSS....
Q5WID4_BACSK/129-404-------------------------GGYTVPEDI.SREILKSIHEMNT.VRNLVTVVP.KNTSYGNYTV.R-KGVA....
A4EKP0_9RHOB/156-445-------------------------GGVTIPRAQ.SEQIIELLRPMVA.VRALGARVM..PMPAGQVRH.A-QLTG....
A4XZF1_PSEMY/131-410-------------------------GGYLVPREF.SANLLEALKDFGG.MRAVAQVIR..TETGAAMDW.P-TTDA....
Q5HBR1_EHRRW/126-404-------------------------ESYFIPKNV.SYYIDKNLTKNSV.MRQLCSIEK..IS.GDSLDC.F-VTNN....
Q2N5Z6_ERYLH/94-380-------------------------GGYAVPQQI.DAMIARELVEISP.IRALAQVVQ..TG.SAGYRK.L-VSTG....
A1KTF7_NEIMF/343-623-------------------------GGNVIENDFREDLFIELLRNRLA.VAQLGATVL..DGLVGDITI.P-KHLT....
A7KUP9_9CAUD/79-375-------------------------AQILIPRVI.VGTMREAAEPLYI.GTKMLQKIR..LKSGQSMIFPS-IGIM....
Q9L8M6_HAEIF/114-400-------------------------GGYTVIPQL.DKDVMKRLTDDSV.MRQICNVVRLPVG.AKEYKK.L-VSAG....
A8GXG9_RICB8/224-495-------------------------GGFLILQTL.YNSIITEVNARSP.MRQLASIET..IS.TNALDI.I-SEDG....
Q8SBP8_9CAUD/122-380-------------------------NGAVIPQEF.VNEFEKLKEGYPS.LKEHCHVIPVNRN.AGKMPV.R-AGAS....
A7A701_BIFAD/6-292-------------------------SKVLLPKEV.ATVITKRAKDTST.IAALSPSEPQLFLDKEYMVFTG-NS......
Q81X81_BACAN/7-286-------------------------NPNILTIDI.KKDVLEGNPYGYYNIPSLFKIIPTEGKTTKQILSNE-PKGI....
Q2GJL3_ANAPZ/114-389-------------------------FSYLIPKKI.HLHFDKLLSQNSI.MRKLCSIEK..IS.SDSLEY.L-ISNN....
A3XTC7_9VIBR/76-390-------------------------AGDVIEATI.SRELSELAIKNQI.VLQKVRSGVLPDGSAYTLPKIK-NRPN....
A9W2M6_METEP/135-420-------------------------GGYLVPPTI.EREVLRRLAEISP.IRAIATVRA..VS.GGQYKR.A-VSVN....
A7GEE5_CLOBL/122-400-------------------------GGFTVPEDI.KTEINKRLRDTTD.ISNLVNFEKVYTR.SGQRTY.E-KRKK....
A3UK25_9RHOB/114-399-------------------------GGHVAPAEL.ETRIERLIREVSP.IRSIATVKQ..TT.SHTFRK.P-VSAG....
A9BYD9_DELAS/120-394-------------------------AGDLIVPDR.VPGIVAPGLRRLT.IRDLLNWGRTGSNAVDFARE.L-VFTN....
Q892H0_CLOTE/99-365-------------------------GGYIVPQDI.STAINELRQSKDA.LQNLITVEPVQTL.SGSRVF.K-SRSQ....
Q5ZGF6_9CAUD/117-376-------------------------GAQ..PKDYNFDVVLNPSQ.....MLNVSDIVGAVSISGGTYTFVR-ENGA....
Q5Z3V6_NOCFA/148-434-------------------------GAFVVPE...QTGIVEMLGRRPLTIRNLVSVRRTGSDAVEYVEQ.T-SHTN....
Q6R4V3_9CAUD/365-630-------------------------GGELVATELLSEEFIDILRNKAI.IGQMGARML..PGLVGDVDI.P-KKTS....
A6XMJ6_9CAUD/157-445-------------------------AELTIPDVM.LELLRDNMHRYSK.LISKVRLRPLKGTARQNIAGAI-PEGV....
A5CD71_ORITB/88-365-------------------------GCYLVQPTL.HQKIVGGIKHKSP.MRQLASLEL..IS.SSALDT.V-IEDN....
A8FGQ6_BACP2/20-302-------------------------GG.LMNATQ.SNTFIRMMQNTPT.VLNDARIIPMESDSQKIEKIGF-GQRI....
Q3Y1P7_ENTFC/243-499-------------------------AAAVVPEEV.IGEVFDLKRSNYN.LAQYATVKTVSNG.QGKYPV.A-TN.Q....
A1EAE9_9CAUD/18-293-------------------------DG.TLHKEF.TDIIMKEVAQNSL.VMQLGQYQE.MEGEQEKTVYVQ-TDGI....
A3PHD9_RHOS1/126-396-------------------------AEGVVEPQR.LPGIDVAPKQRLF.IRDLIAPGSTESPAIFWVQQ.T-GFTN....
Q3J3W7_RHOS4/148-418-------------------------GGYLAPKEF.GDELFKNLIEFSP.IRKYARVVQ..IS.APEITY.P-KRVT....
Q857Z9_9CAUD/161-490-------------------------PG..ILPTF.LPGIVEQLFYELS.LADLISSRPVTSPNLSYLTE.S-AAHN....
A6F0K0_9ALTE/127-405-------------------------GGYTVPTEM.LNMIYESMKDYGG.LASVAQILN..TENGQPIEW.P-TSDG....
A1TD88_MYCVP/110-388-------------------------GGFLVPMQLDPTIILTANGSFNQ.VRQISRVVQ...ATGKSWTGVT-SAGV....
B4SNH6_STRM5/129-412-------------------------GGYLAPIEW.DRSITDRLVIVSD.MRQLANVQP..CS.GAGLTK.L-YNTG....
A6BER6_9FIRM/23-314-------------------------AESLIPVQE.SNEIIQGVIAQSA.VLSRGRKLPNMTSKQYKMPV.L-DMLP....
A5VJB3_LACRD/236-497-------------------------AEAVIPEEV.VTPVLDLKNSAYN.LAKYATVKTVGTG.SGHYPI.A-TRYN....
Q5L2L4_GEOKA/120-373-------------------------GEKFLPKTL.STEILTEPFVKNP.LREISTVTQITNLEIPKLSFTL-DDDD....
Q0AG17_NITEC/123-405-------------------------GGHTVPTEV.VASIIEVLKAYGG.VREVASVIS..TAAGNQMNF.P-TSDG....
A9CJN8_AGRT5/134-419-------------------------GGFLLPSET.DGEIGRRMTAISP.IRALATVRQ..VS.AAVLKK.P-FALG....
A3DG61_CLOTH/127-416-------------------------GGFLLENEF.INDLFESMMAQSQ.VANRIRMIPIGANTNRLRALGI-DENS....
A4TCV1_MYCGI/152-412-------------------------GSVVVGQEF.EASPVELGRPANS.LLAVLPSKIRSVGEYAYLRQ.S-VRTN....
A3WWM5_9BRAD/96-387-------------------------GGYAVYPTL.SSSITTRVFESSP.LRRFARVVT..IG.SDSFEE.L-VDIN....
Q2SDM1_HAHCH/110-393-------------------------GGFGVPEEL.DRQILELERELSP.MRALCRNIQ..VS.TDGYKR.L-VNLG....
Q5J5U0_9CAUD/24-332-------------------------PSDLLPKEI.VGPIFDKAQESSL.VLRLGENIPISYGETIIPTTVK-RPEV....
B3XQ47_LACRE/128-385-------------------------GGKLLPINV.SNQLISEPFAKNP.LRQMETVSTITNLILPRIAFDI-ADDS....
B3XLQ0_LACRE/117-374-------------------------ASVTIPESI.IYNPENEIKTVTD.LSQFVQVFNATTA.SGSYPI.L-KK.A....
A6C3V3_9PLAN/122-410-------------------------GGIAVLPEF.HQEILTRIYANDI.....FSRTDHYRVAGNNMTFPT-DSET...S
A6XRQ5_VIBCL/392-657-------------------------GANLIATEHLAGSFIDMLYNKSS.VMQY.ATTL..TGLVGDLSI.P-TQEG....
A6U954_SINMW/144-422-------------------------GGYLAPAEY.VREIIKGVTELSP.VRSMVRVRQ..TS.SKAIMI.P-KRTG....
A7GI70_CLOBL/117-372-------------------------GEKILPRTM.TNELLHEPFVKNP.LRDVSVFTNITNLEVPRIDFTL-DDDE....
A3WZW4_9BRAD/137-425-------------------------GGYTVVPDV.SGRMIKRVYETTP.MRQVASVVT..IG.TDRLEG.F-NDLG....
Q8LTC0_9CAUD/142-396-------------------------AASTIPETI.SNTPQRELQTVVD.LKPFTNVFQASTQ.KGTYPT.V-AN.A....
Q9T1F6_9CAUD/115-380-------------------------AGLTIPEDI.QLQIRTLTRSFTS.LESLANVENVTTS.HGSRVY.E-KLAD....
A5LFN8_STRPN/129-383-------------------------GEAIIPVEL.M.TPKEAKQDKTD.LTSLVNIVNVKNA.SGKWSV.V-KL.T....
Q5Z394_NOCFA/119-388-------------------------GATVTDVPMVAESPIALGRPALS.LLDALTLRS.QPPKYKYLRQ.N-TRTN....
A6FF94_9GAMM/101-399-------------------------GGNAVAEIL.DRSILKRARETTA.IIGNVGSRGMTRNTRRTVTTSF-TSVEDGFE
B2JL19_BURP8/113-379-------------------------NQYPVPSDR.RTTIIPPGMNDVW.IRDLLPGGTTTSNLIEYPRE.K-AAQL....
A6M951_9VIRU/99-368-------------------------GGYTVPQDI.QTRINELRESKDA.LQNLITVEPVTTL.SGSRVF.K-KRSQ....

PF05125

VPN_BPP2/6-342RFKFNAYLSRVAELNGIDAGDVSK..KFTVEPSV-TQTLMNTMQESSD-FLTRINIVPVSEMKGEKIGI-G-VTGS----
VPN_BPHP1/3-330KQAYYALAAALAKHFNQPLDSVLRGESFALKAPE-AALLGENIQQRSD-FLKQINMIQVAHTKGQKLFG-A-TEKG----
O80304_BP186/6-342RFKFNAYLTQLAKLNGISVDDVSK..KFTVEPSV-TQTLMNTVQASSA-FLQMINILPVAEMKGEKIGV-G-VTGT----
Q48277_HAESO/6-337AQTLMNYIQGISNDNQEDFSRIARGAKFNVTPSV-QQRLENAVQESSD-FLKLINIVPVDEQQGEILGL-G-VSGT----
Q9ZXM3_9CAUD/6-336RKQFDAYLAQLAKLNGVNS.AVQT...FAVEPSV-QQKLEQRIQESSE-FLKQINVYGVDELQGEKIGI-G-VSGT----

PF09950

A3M3U3_ACIBT/79-324----------DIPVAEVE----------------------------------YD-TVQL---PVKVGTISY-MYSVFE--
A6UAP6_SINMW/63-317----------DVPKVELT----------------------------------RE-KFET---TVSMAAIGY-GYTLEE--
Q9P9P2_XYLFA/83-327----------DIPTVDVA----------------------------------YA-QKSV---PVVLGTIGY-DYTTEE--
Q0T6M7_SHIF8/67-313----------AIAGVNVD----------------------------------IG-KSGN---PLNLWGMEL-GWTVIE--
A7ILG8_XANP2/97-352----------ARPRAVLD----------------------------------IG-KVVS---PLHLWSMDV-AYTLPE--
A3L742_PSEAI/62-309----------DLPLASTE----------------------------------RS-KFES---SVHMAAIGY-GYGLEE--
A9ABK3_BURM1/97-345----------AIQSLGLD----------------------------------IG-KTPN---PLTLWGMQI-GWTIPE--
Q7N327_PHOLL/60-317----------SLKTIDSD----------------------------------IE-WHKA---PVGQWGKSA-TWTQQE--
A5PIZ3_9CAUD/86-326----------DLSTVDAL----------------------------------MT-SEFG---KVFRLGNAF-LISIDE--
Q2G4R3_NOVAD/110-363----------DMPYASTQ----------------------------------MN-QATR---NFHLAAIGY-EWNTQE--
Q2NRY5_SODGM/71-317----------VIAGIDLD----------------------------------IN-KTTL---PLTPWSRQL-SWTVFE--
Q2NSP7_SODGM/16-248----------DLPTIDRG----------------------------------LN-AHAT---RAHLLGASY-CYSVPE--
A4N6E6_HAEIF/55-278----------TLDQVEVG----------------------------------FT-PTRS---YIVPWAKSV-TWTTPE--
Q333F7_9CAUD/77-311----------DLPLVDAF----------------------------------MT-EKQG---KVFRFGNAF-LISTDE--
A5UGK3_HAEIG/78-315----------DLPRADVA----------------------------------MT-ERAV---KVKNIGAAY-GYNLQE--
Q0BRS5_GRABC/65-316----------DVPRADIV----------------------------------RD-RLRV---TVSMAAIGY-GYDLAE--
B0UJ01_METS4/61-314----------DVPRAEVL----------------------------------RR-QSET---AVAMAGIGY-GYDLEE--
Q6XQD3_BPT1/81-319----------DLPLVDAL----------------------------------GT-SEFG---KVFRLGNAY-LISIDE--
A6TKD0_ALKMQ/59-304----------DIPLVDAD----------------------------------VE-RHTQ---KVYGVVVGF-TIGIQE--
Q835B4_ENTFA/56-293----------DLPLVDID----------------------------------MK-RYQS---PIFTIAAGI-RYSRQE--
Q45PZ1_9CAUD/59-293----------DLPLVDAL----------------------------------AT-ERQG---KVFRFGNAF-LISIDE--
A2WAD9_9BURK/103-363----------AIAGPSVD----------------------------------IG-KTPQ---PMRLWGAEV-KYTVPE--
Q46YM7_CUPPJ/97-345----------AIAGIALD----------------------------------IG-KTAN---PLTLWGMQI-GWTIPE--
A9C0G0_DELAS/59-320----------DIPLADVN----------------------------------QD-MQTK---TFQLAAIGY-QWNLEE--
Q984H1_RHILO/85-339----------DVPKVELT----------------------------------RE-KFET---TVSMAAIGY-GYNLEE--
A8ATG6_9CAUD/56-301----------DLPLVDVD----------------------------------MV-RKSV---PIYSIGIGL-SYTIQD--

PF04454

C9RYB7_GEOSY/5-265----------GVQSVANDIYMNPEQGDMSF--------HGK....ELSLSEPAR-RVHL---TIPLLYKDF-ILYWRD--
D4H156_DENA2/1-251----------NFAAVNLGRLKISDNKSPK.--------..........DVVYGV-NTVL---PLVEARINF-SLDIWE--
D2Z797_9BACT/1-250----------DYHGWPMGRLDVSESPFVE.--------..........GASHGI-RRIQ---PLVEVRVPF-AMSRWD--
C8WPL7_EGGLE/1-257----------GVTTVAVDGVNKEEVLEDG.--------..........IGRIVG-RTQL---ELPLFYEDF-TLLSRD--
D0LZ74_HALO1/1-251----------EYAAVNTGELRPIDDTPED.--------...........VDMKL-RQVQ---PLAEVRVPF-TLDVTE--
D1B7I4_THEAS/1-249----------DFPGFGTGRLVLPEGQQKG.--------..........AVRFGV-RQFQ---PMIETRVSF-EISIWD--
A0KD92_BURCH/1-251----------ELSAVGTGHLLDVAAPREL.--------...........VNARL-REVR---TIVELTVPF-ELSRDA--
A0PLA3_MYCUA/1-251----------VTAAVSTGRLIDVKAPTDG.--------...........VIAHL-RASK---PLVRLRVPF-TLSRNE--
A1B987_PARDP/1-251----------GLSAVGTGHLRPATALAEG.--------...........VESHR-REVN---PLLELRVPF-TLTRAA--
A3DFK3_CLOTH/1-257----------GIQAINVDNISELDETEEN.--------..........ISVIRG-RTYR---HIPLINEDF-SLLWRD--
A4WHF5_PYRAR/156-358----------GVDAVPLEEAAPGP......--------...........TIAAN-RSVV---PLKELSVKF-SISQRQ--
MARIT_THEP1/1-251----------EYAAHPLGEVEVLSDENEV.--------...........VKWGL-RKSL---PLIELRATF-TLDLWE--
A6TWC5_ALKMQ/1-250----------DYTVVPEGRLKKIEDNPGN.--------...........VCTGM-YQVK---PLVEARISF-KLDRWE--
A7HIB4_ANADF/2-255----------GARAGVAEDLPLGEEPEG..--------...........AHVHV-PRVR---PLPVIHRTF-ALGARA--
A7I7A2_METB6/2-249----------GLKAIPLGDYALED......--------............GISA-SVSL---PLSLIRTEF-SLGKRD--
A8F8I8_THELT/3-247----------GLKQISITDVQIEP......--------............GVFS-NKTL---PLFYIHKTF-NISKRD--
A8L1F1_FRASN/1-253----------AYSATPIGRVTALQAPPGE.--------..........GVRARL-RRVL---PVMELRAAF-SIDRGE--
A8UW07_9AQUI/3-269----------GHQMVSYDVIYGMEPGVCEI--------KPGQEYETCEPVRTGV-RKHI---PIPTIYKDF-VISWRD--
A9BEM3_PETMO/1-251----------DYSSYNLGTNELIENPRDG.--------...........LGWGI-RQVL---PIVEIRNPF-VLKQWE--
A9FWS5_SORC5/3-254----------EVAAVNTGRLRAIERKEGP.--------..........AVSAGV-RLVR---PLVEFRAPI-RLELAE--
A9H5P1_GLUDA/1-251----------GFSAVGTGHVERIDAPGSD.--------...........IRAVR-RNVL---PLVELRVPF-TLARDA--
B1CAJ4_9FIRM/1-257----------GVSFIPIDSVDKTEALSNG.--------..........FGEITG-RKIV---QMPQLYEDF-SLLWRD--
B1L4G8_KORCO/136-346----------GIDAVPVEEVSLDG......--------...........SIKSR-RYIV---QLREISQTF-EIAQAS--
B1VSP7_STRGG/1-251----------TLAAVGDGHLTDIDPPTPD.--------...........VAARA-RTST---PVIEWRVPF-TVTRQA--
B2A6K6_NATTJ/8-259----------DYPAVSEGRLSEIFHGHQQG--------..........EVKAGL-HQVK---PLMETRITF-KLDRWE--
B2GID2_KOCRD/1-252----------EFSALGTGHVSRVAADTPG.--------...........VEALQ-RHVV---RVVELRAPF-TLKRSD--
B2JNZ6_BURP8/1-251----------DLSGVGTGHQSTIAAPHHG.--------...........VIAKL-SEVK---ALVQLTVPF-ELSRDA--
B2V6Y3_SULSY/1-265----------SVQFVPYDYIEDGNSGACGL--------FGE...VDCGVVKVKE-RKIL---PLPIIYKDF-KIHWRD--
B4UA40_HYDS0/1-265----------AIQSVAYDTIPSLDNGACGL--------FGD...KECGIAKIKS-RKFL---PIPQIYKDF-KIHWRD--
B4UI59_ANASK/1-259----------DARAGVAEDAPAAGEDEPEA--------S........DETHVHV-PSVR---PLPVLHRTF-RLGARA--
B8CYH7_HALOH/1-249----------KYAAVNTGRRTALEDKAEG.--------...........ASIFQ-RQVL---PLVEVEIPF-RLHLEE--
B8D495_DESK1/120-343----------GIESVVLEKT..........--------...........GETLQ-RIVV---PLRELSVYF-RITQRS--
B8EQK3_METSB/1-251----------ALSAVGTGHLLSIAAPAEG.--------...........VLARQ-REVK---PLVELRVPF-ELSRAA--
B8GHL2_METPE/5-250----------GLKAIPLQDSVSEG......--------............NLIR-SGFA---PVDLIQTSF-SLSKRD--
B9JHD1_AGRRK/1-251----------ELSAVGTGHLKPIPGPGDG.--------...........VQTAL-REVK---TLVELRVPF-KLTRQA--
B9MNM0_ANATD/1-251----------QTHTIFADVVEEAE......--------...........SKKAV-RRYY---PLKQIYEDF-KLSWND--
B9YCJ8_9FIRM/1-256----------GAQSVIVDSAAMTEELEAG.--------..........LGQIRG-RRFQ---PLIQLFEDF-TLLWRD--
C0R0J8_BRAHW/1-256----------GAISVQYDKSDREEVFEDG.--------..........FVKTSG-RKSV---ELPQIYQDF-TLLWRD--
C0ZHN4_BREBN/1-265----------GIQTITNDVYEESRFGGLSL--------RGE....SLEMTQPSR-RVSM---TIPILYKDF-MLYWRD--
C0ZVK4_RHOE4/1-251----------DLAAIPLGHQVPINPLADG.--------...........VIAHA-RQSQ---PVIELRVPF-TVSRQA--
C1B1V8_RHOOB/4-254----------SYSAHNLGRVNPIKASDSR.--------...........IRAQQ-RQVD---PLVELRFPF-TLSRAE--
C1DV98_SULAA/1-265----------GVQFVPQDTIESGNNGACGL--------FGE...SDCGVVKVKE-RKFL---PIPIIYKDF-KIHWRD--
D5UVK7_TSUPD/1-251----------TASAVGTGHLLEVGGPAEG.--------...........VQAHL-RDSR---PLVRLRVPF-TLSRKA--
C3MM35_SULIL/96-329----------ESTTVPFSEVKEDSGDT...--------...........VQSKS-VTLY---EVPLISSQV-KFYSGQ--
C4XPM7_DESMR/1-251----------EYAAVPLGRIEYAKTQSVS.--------..........GITYGL-HQVK---PLVEVKVPF-TLDIAE--
C5B5H8_METEA/1-251----------GYAAAGTGHTRPIEAPGEG.--------...........IRSLL-REAQ---PLVELRVPF-TLTRQA--
O67639_AQUAE/1-267----------GHQVVSYDVLYGVEPGVCEV--------KPGQEYKVCEPVRTGE-RKHV---PVPTLYKDF-VISWRD--
Q08WR7_STIAD/2-266----------GVQSVPHDEYQGVSSGAIDI--------VGE...QETATVFTDV-RKFK---TIPIIYKDF-LLHWRD--
Q0RH88_FRAAA/1-253----------EYSATALGRVAALSAPPAA.--------..........GVQARV-RQVQ---PVIELRVGF-TLDRAE--
Q1K2C9_DESAC/1-251----------GHACVTLGRLAVSKDSSDG.--------..........NVGYGL-HQVQ---PLMEARVNF-SLETWE--
Q2RVS0_RHORT/1-258----------DASSVSLGRTEALAEEPKAA--------GS......AAVVTVRK-RAVQ---PLIELCVPF-TLKRAE--
Q401P1_9EURY/136-332----------..QSFRVDIIKFEDG.....--------...........VRVVK-QEYK---PIPLLKKKF-YVGIRE--
LIN18_BRELN/1-252----------ETSAVTTGHIRDVQSETSG.--------...........LQVKQ-RIVQ---EYIELRTPF-TVTRQA--
Q4JC29_SULAC/153-340----------...SISLFDFEETEREV...--------...........TQKMD-SQLY---KIEYLSVEF-KI.RSD--
Q5YPL3_NOCFA/1-252----------DFSAVGLGRTTGIAAPDEG.--------...........VQARQ-RVVA---PLVELRVPF-TLSREE--
Q7MSM9_WOLSU/1-252----------GFSSLPTGRVISSKEKLGE.--------...........ASVGV-RMNT---PVIELKIPF-SFPESE--
Q835B4_ENTFA/4-243----------GAETYAYNVMTRSGAAKIIA--------NGAD..DLPLVDIDMK-RYQS---PIFTIAAGI-RYSRQE--
Q972Z8_SULTO/108-304----------DQQAIPFYETKVQDNAI...--------...........IQSDK-QVPY---PLSIINTLF-KV.MPD--
Q97V86_SULSO/96-329----------EFTTIPLSEIKEDSGDI...--------...........IQSKS-ASLY---EVPLINSQV-KFYLGQ--

PF11651

B7KXS0_METC4/1-419----------SVTIKRPPQFQVRDGATA..........QPQDITEGTTSVTVDK-MKGI---DLRISSTDR-TLSIGE--
Q3RBQ2_XYLFA/1-408----------TVKIMIPPVPVTYSGSVFAASGATSAPLSAPPISESYVNLQLDQ-QHHV---PLTFTAKEK-KLDLTD--
A5VES4_SPHWW/1-413----------TVTIKRPTDFTVRSGANA..........SVQDVIEGSTTITVDQ-QKGV---DFAFTSAEL-TLSIKD--
Q57SP8_SALCH/1-428----------SNTVWMPVEQEAPTQTGWDLTG......NATGILELSVKCNMGD-PDND---FFELRADD.-.LRDER--
B2U8F8_RALPJ/1-419----------ALRVRLPNDFTVRRGAAA..........SVQGTNEQKTSLVMAN-QIGV---DIQFSSAER-ALSLDD--
Q1R947_ECOUT/1-416----------GDVLYRPQHYHMNIEEGLDLSSK.....TPTALVQRLVPSVFKE-PKNI---LYTLDARE.-.MRDPE--
A4E782_9ACTN/1-291----------TITVRKPATFEAKEFTTEV.........EVQDATEGKVPVKMDK-LLDV---TFAVTSKEL-TMGIVD--
A4JD31_BURVG/1-395----------TLRIRLPNDYVVNDGPAI..........TPQGTNEQNTTLTVAK-QKNV---PVSFGTAEK-TMSLDD--
Q2G3Y7_NOVAD/1-418----------QDKFWLPAPMIGASYDGFDQSA......NFDGLTQLNVPASVGY-HKSV---PKTLSSKN.-.LRNAF--
Q3RHM5_XYLFA/1-409----------TVKIMVPPMPVSFSGANFAGDRFA....NAPSVSETYVNLVVDQ-QYHV---PLTFTAKEK-KLDLTD--
Q9AYZ7_BPHK6/1-421----------SVSFKRPHQFSSLRTPTGDISGQ.....NKNNLISGKATGRVGN-YITV---AVEYQQLEE-AIKLNQ--
Q5YSR9_NOCFA/1-303----------TVNVRKPPVLTAQLFDRATGI.......QIQDATESSVPVKLDK-IADV---SLEITTEQA-LLELES--
B5NXL6_SALET/1-427----------SNTIWMPVEQESPTQEGWDLTD......KATGLLELNVAVNMGE-PDND---FFQLRADD.-.LRDET--

PF06673

Q9MCB6_9VIRU/1-347-IPSEKPQDVERKFMRELGDKMTEMPEQGFLREFANASALNVVNSLGSITSKYARKSGIYDGAMKARFQGL-TLAEDG--
Q9MCB8_9VIRU/1-347-IPSEKPEDAERKFMRELGSKMAEMPEQGFLREFANGADLNVVNSLGSITSKYARKSGIYDGAMKARFQGL-TLAEDG--

PF05065

A5IR70_STAA9/36-312..........GAYWVGEG..QK......................IETSKA.TWV.NATM...RAFKLGVIL.PVTKEF..
E0THR4_PARBH/115-394.PI.......GAGWVG.....E............T..AA...R.PETTTP.TLV.AIDF...PAMELYAMP.AATQAL..
A5MBG7_STRPN/137-417..........HQN...............................GKTKKDESFV.FIDY...TINSAAVYI.KYSFEYAD
B1J5N2_PSEPW/144-414..........MAAPQAGE..GA......................AKAQSDLSFG.LKTT...NVITIAHWF.RASKQV..
Q1GG15_SILST/131-399..........NAAPVA.E..GA......................AKPSSDIKLD.VKTT...TAKVIAHWM.KASRQA..
Q3HL14_9CAUD/114-381MIP.......FAEI.T.....E............M..GE...I.PETDNP.KFS.NVQY...AVKDRAGIL.PLSRSL..
Q1DCZ9_MYXXD/94-361.TS.......VFKWVG.....E............G..ET...V.PKSAP..KYG.KIVL...KAHKGMVLT.DISNDL..
Q3R2V6_XYLFA/355-623.TT.......QAYWVG.....E............G..ES...P.EKSKP..ALD.QIHF...TPKSLAAYT.DITRRL..
Q7Y4I4_9CAUD/8-297..........DIDIVA.....E...............NG.....KKTHGGVSLD.PVTI...VPLKVEYGA.RVSDEFLH
Q6GAL1_STAAS/126-378.............FIT.D..VE......................TAKELKAKGD.TVKF...TTNKFKVFA.AISDTV..
B0K6S2_THEPX/124-397.KG.......TAAWLD.....E............G..EE...F.DESDS..VFG.QTSI...GAYKLGTMI.KVSDEL..
Q1CQW9_STRPC/140-392TEK.......MVSV.E.....E............L..EK...N.PKLAKP.KFK.DVEW...KVETYRGAI.PLSQES..
Q0AAI8_ALHEH/83-374.EP.......DSAWVA.....E............K..GD...R.DPTAAS.FMS.RHKI...AVHEHYSYP.SVTQQF..
A4WC36_ENT38/128-406TAE.......EGELLG.....E............N..TE...T.TDEDV..TFG.TAVL...GAKKLSSKIIKVSNEL..
Q3EL79_BACTI/115-382STP.......FAPL.S.....E............Y..GNPNAM.QEIASP.QFD.RLPY...VIEDYAGFL.PVPNDL..
Q139N4_RHOPS/143-428.GP.......ATGWVG.....E............A..AA...R.PQTSSP.TLD.ALSF...PAMELYAMP.AATATL..
A5F9J3_CLOK5/135-393.............FLADD..SA......................TAKELVAEGD.TVSF...IRNKFKVFC.DITETV..
Q6G7X2_STAAS/129-401..........ALEKVEEL...E......................ENPELAVKPFFQLAY...DINTHRGYF.RISREA..
A0AI11_LISW6/136-390TSR.......LNSV.T.....E............L..TA...N.PELAKP.EFV.QVNW...EVETYRGAI.PISQES..
Q3J4R6_RHOS4/160-429..........AAGVVA.E..GA......................LKPESGLEYE.AADA...PVRTIAHWI.PVSRQA..
A5VKJ7_LACRD/107-373ITP.......MTDLDD.....E............T..AT...I.PDMDDP.ELT.LIKY...AIHRYAAIQ.TVTNSL..
Q92CB8_LISIN/19-306..........MRAASEGVGLTE.......................ADRTKPSTS.KVTL...NAKEVIAEI.NLTYDT..
A5KJS3_9FIRM/124-396.KG.......EAAWID.....E............G..GQ...F.TESND..SFG.QTTI...GAHKLATMI.KVSDEL..
A1VBS2_DESVV/113-404.GT.......GSGWVG.....E............K..AA...R.PETGTP.TLA.EIKP...FMGEVYANP.AVTQKA..
A1T829_MYCVP/9-278..........SSSFVA.....E...............GQ.....ELALNDAVIE.ELTI...VPAKIGHVA.PLSREL..
Q982R8_RHILO/176-465.GA.......GSGWVG.....E............E..EA...R.PQTGTP.TLR.ELIF...TVMELYANP.ATTRTM..
Q5HTE1_CAMJR/118-386EMG.......EFSWLG.....E............Q..ES...F.TEVSA..KFS.SLSI...GAHKLGGII.KISEEL..
A1AYY2_PARDP/166-435..........NARPVT.E..GA......................QKPESDYVWA.QESA...LVRTIAHFV.HVSRQA..
Q7WLQ0_BORBR/118-390..........NANVVA.ENPTD......................PKPESDIKFE.LDSE...KVATIAHWI.RASKQV..
A3LM59_PSEAI/122-402..........GAGPVA.E..GA......................LKPTSNVTFE.SVTD...RVKKLAVWM.PVTDEA..
Q8X755_ECO57/100-380.GA.......TVNHGE.....E............G..KT...R.EQTSTP.QIN.EVSI...KLYPVYAYP.RTTQEI..
Q1ILS6_KORVE/495-776.AA.......TLYWTG.....E............NPGSA...V.TATDQ..TTG.SVTL...SPKQAMAQT.AYSRQF..
B8FNY7_DESHD/107-369SKK.......LAKL.A.....T............D..NE...M.VK.EMI.TTK.PVEY...ATEDYGKII.PVENSV..
Q1GH34_SILST/388-661.GA.......TGYWIG.....E............D..IE...A.TEDLL..SLG.QRQF...SPKTVAAYS.EITRRT..
Q2GAM7_NOVAD/185-459..........NAATVT.ETAGT......................AKPQSEIKFD.IVTS...SVTTIAHWV.LATKQI..
Q8XYS4_RALSO/130-408VAE.......EGELLG.....E............G..EA...T.GEDDI..DFG.IGTL...GAHKLSSKVVRVSEEL..
Q3J3K4_RHOS4/110-395.EV.......GSGWAT.....E............A..AT...I.SESASP.TIE.RISI...KLHELSAMP.KASQRL..
Q1NB79_9SPHN/81-368.GI.......VSGWAS.....E............T..GA...R.GETGTP.SFN.EIVP...PGGELFANP.AASQAM..
Q5PB65_ANAMM/103-375KDT.......FVGWGG.....E................V...Q.SDTAAP.KMS.KTTI...YLHELYAQP.QIAKKL..
Q1QLS4_NITHX/103-379.RP.......TGSWVG.....E............T..DA...R.PGTES..SYG.QIEV...PIHEMACYV.DVSQRL..
Q65ES7_BACLD/133-400ITP.......LVNL.E.....E............L..AD...I.EELENP.KFE.NIKY...SIKDYAGIL.VLSNDL..
Q8ED08_SHEON/122-393..........NAAPVA.E..GA......................AKPYSEITFG.LVSA...GVRTIAHLF.KASRQI..
Q813J9_BACCR/150-424.KA.......EAQGHK.....N............E..RTNNEM.PETDI..EFD.EIEL...SPTEFDALA.TVTKKL..
Q3J5Z4_RHOS4/150-439.SA.......VAAYAA.....E............N..AA...I.APSQP..SFD.KIDQ...SFKKLVGMV.PIGNSL..
Q3F193_BACTI/24-317..........RAFEIGEG..QE............YPNQA.....LDLAQG.GIG.SVDV...KVKKYGLKI.AITDEM..
A1B638_PARDP/102-387.DI.......AHGWAS.....E............A..AA...Q.AETGTP.SVQ.RVVI...PVHELSAMP.KASQRL..
A5WQQ4_MYCTF/196-475..........EAHWYSEA..QE......................VSDDSP.TLA.QPAV...PSYRGSCWI.PFSLEI..
Q1R877_ECOUT/115-398.GT.......ASGWVG.....E............T..DA...R.SQTATS.KLG.LIEP...FMGEIYGNP.QATQKM..
A4IS66_GEOTN/24-302..........LQGATEDQA.........................PSGETKPDFS.TNKL...ESVEVIGIS.GITDST..
Q17ZS7_CLOD6/178-435.DP.......KFSFKK.....E............L..EV...A.SQSDM..EFE.GINL...KTKTVYGYM.KISLEL..
Q854Z2_9CAUD/258-539..........QWSWDAEF..EE......................VSDDSP.EFG.QPEI...PVKKAQGFV.PISIEA..
Q9AZS7_9CAUD/124-390VTP.......LTVMDA.....E............D..GK...I.PDLDNP.QLT.IIKY...LIKRYAGII.TATNTS..
Q0AWY3_SYNWW/43-310.ND.......VAAWVE.....E............G..GT...I.PIADGMGDFN.DIAL...KIHKLVVFL.KLEEAF..
A4YU30_BRASO/140-423.TP.WGAAGVQAAWRS.....E...............GT.....QMIASKAALT.PEIL...QLHELYAFV.LATNEV..
Q1B5C3_MYCSS/9-280..........AAQWLS.....E...............GE.....EIPLTDPTVD.EVVA...RPKKIASLT.KVSREL..
Q2NV28_SODGM/127-397..........NAKTVA.E..NT......................AKPYSTIEFE.EATV...PVRTIAHMF.KASKQI..
Q1B7W7_MYCSS/9-278.GA.......SVGFVA.....E............G..GL...I.PEADV..DFG.EISLMPSTLKSLKVLI.RFTNEL..
A3T0Y2_9RHOB/165-433..........GAAPTA.E..GG......................TMPELVVEWS.AEEA...AVRKIAATV.HASDEA..
Q1GHS2_SILST/113-395.DV.......GAGWAT.....E............T..GS...V.TETGTP.SID.RIVI...PLHELSALP.KASQRL..
Q2L2B0_BORA1/123-401TED.......EGELIG.....E............N..TD...A.GEKDV..EFG.HDAL...GAHKLTSKVIRISNEL..
A2SD63_METPP/97-385.EV.......GVTWVG.....E............L..DS...R.SETTAP.ALG.KFIV...PLHEVYAMP.AVSQKL..
Q3J223_RHOS4/110-368..........GGSAVT............................RGGETTVRGE.NTTS...LVSKKPIWT.DVGSNVAV
A5TX36_FUSNP/106-365GE........LISF.E.....E............L..NT...L.NK.SDI.DFG.QVSY...KTKDYGDII.PVSNSL..
A1TML8_ACIAC/138-428.NT.......TVSYVG.....T............E..QD...I.PVTDM..TFG.DMKL...SAKKAAAIV.PIANDL..
Q3DFH6_STRAG/127-397.HG.......SASWMD.....E............N..GL...Y.PETDE..TFG.QVTL...DSHKIGTAI.RISEEL..
Q637B0_BACCZ/101-383..........EGDYTA.....E............G..ND.....YNTSET.TFG.YADI...TKAKVTAYS.EDTEELQK
Q14M91_SPICI/321-590..........AAKFVT.....E...............GE......EIKGSTGSD.SIKF...DGHIIATSL.EFSETTRF
Q1QKG8_NITHX/112-388.IT.......NAKWKG.....E............T..QS...Q.EGSEP..AFG.QTEI...TVREVNTYV.DISNQL..
A3KA53_9RHOB/140-434.GA.......TFAYGE.....E............Q..TD...A.PATGV..TFG.QVRL...SAKKLHGII.PISNDL..
A5M4C8_STRPN/8-299..........NAQIVG.....E...............GE.....QKFGNKAKLT.SKVI...KPLKFVYQA.RITDEFKY
Q0S2A4_RHOSR/9-273..........STGWFA.....E...............NT.....EITLVDPETD.ELVI...VPTKVAGRT.QISNEA..
A3X0R0_9BRAD/133-422.GA.......TSGWVG.....E............E..QD...R.PGTATP.TLR.EIAI...NTGEIYAMP.GATQTS..
Q6LSF8_PHOPR/134-417TAE.......EGEIVG.....Q............N..ES...A.GTKDT..TFG.NKTI...GSYMYSSKSIAIPWEL..
A5N1H4_CLOK5/152-424.IP.......EGIWTE.....M...............TD.....AVQELSAGFS.QTEL...DGFKVGGFI.PVANAI..
Q859C1_9CAUD/118-386.RS.......SASIVG.....E............T..AE...I.PESYP..ATA.QRSM...GGFKYGFAS.VVSYEF..
A3W815_9RHOB/115-386.GT.......NAQWEG.....E...............AE.....ESEESTVTFG.QVEV...TARKLMTHV.DISNEL..
Q6J1Y2_9CAUD/119-381TDR.......FSSV.A.....E............L..AE...N.PALAEP.EFE.QVDW...SVSTYRGAI.PLSEEA..
A7HRJ6_PARL1/148-433.GM.......QTGWVG.....E............T..EA...R.PQTATP.SLA.EIEF...PAMELYAMP.AATPTL..
A4WS92_RHOS5/111-382.IT.......NARWKG.....E............A..QA...Q.EGSEP..GFG.QAEV...VVKEVNTFV.DISNQL..
Q9XJ79_9CAUD/117-382ITG.......LAKLDD.....E............G..GQ...I.GQNDDP.KLS.LIRY...AIKRYAGIS.TVTNSL..
Q2YMS9_BRUA2/137-422.GP.......ATGWVG.....E............T..DA...R.PQTASS.KLA.ELQF...PTMEIYAMP.AATSSL..
A3SMP9_9RHOB/146-433.GA.......TAGYGT.....E............A..AA...I.VESEP..SFD.NVDM...AFKKLTALV.PISNDL..
Q73HT5_WOLPM/107-395DRA.......GAGWSS.....ETVDDEDGGNKSKY..DF...A.KDTDTP.KIQ.KISV...TTYELYAQP.QISQKL..
B1ZCX2_METPB/163-460..........VAQYVG.....E...............GQ.....KKPVTDVTFD.KLGL...KAKKLAAII.LLTKEA..
Q9A4P7_CAUCR/53-338.GL.......AAAWVA.....E............T..AA...R.PETTAP.TLD.VIDF...PAGELYASP.AATQAL..
Q3Z7J9_DEHE1/124-397.HG.......TAAWMD.....E............N..GL...Y.PESDD..TFD.QISL...SAYKLGTAI.KVSEEL..
Q9B0A7_BPMB1/19-303..........SAQWIG.....E...............GD.....MKPITKGNMT.KRDV...HPAKIATIF.VASAETVR
Q6UAX6_9CAUD/134-425.GA.......TASYTG.....E............N..QD...A.KVSEA..RFD.DVKL...TAKTMIAMV.PISNAL..
A6VBQ1_PSEA7/140-406.GL.......TTGWVA.....E............G..GA...V.PEGNM..TFD.AVTL...TPRHVGGKT.EMSRQL..
A7B3D6_RUMGN/128-405..........TAHWIT.....E...............EK.....SSDDQKASAKNSVTF...NYYGLEC...KISQSI..
Q12EX8_POLSJ/63-302..........TGYWVA.....Q............G..RA...T.PLSSM..AFD.RTKL...EARMRVGALVVVSNDL..
Q830G6_ENTFA/163-444.KA.......EANVNK.....K............E..RT.TDI.TETAI..QFD.EILL...DPAEFDALA.TVTKKL..
A7MP72_CROS8/125-401TAD.......MGVMLG.....E............N..EE...A.SEGDV..TFE.PITI...GAKKMTSKIIRVSNEL..
A0JQM6_LACS1/116-372.............FVN.D..QE......................VAKEIGLKGD.TVKF...GRNKTKLKV.AISEAI..
A4EPK1_9RHOB/132-412...PWSSAGIVAHWRG.....E...............GS.....KMDPSKMEGQ.ERNV...PLHELYTFA.LATEEL..
A3XTC6_9VIBR/12-299.QN.......GAQGVN............................PVPSSKSVWV.SQEP...TFKKVESLV.ELTHDV..
Q3JTL8_BURP1/144-412..........NAAAVA.E..GA......................QKPTSDLKFN.LKNQ...PVRTIAHLF.KASRQI..
A7ILP2_XANP2/167-448.EA.......SAGWVG.....E............T..EG...R.PETGTP.AIG.VQTI...PVFEIYAKP.RATQSM..
Q77WA0_BPHK0/112-381..........NADVVA.E..KA......................LKPESDITFS.KQTA...NVKTIAHWV.QASRQV..
Q7Y5K8_9CAUD/121-389..........NAAIVA.E..GA......................LKPESSLKFA.KKTD...TTHVIAHTM.KATRQI..
B0T632_CAUSK/96-391..........TRSERG.....A......................FTDNTVEGFA.GITL...GSKDVYDRQAHTVESV..
Q6HR18_BACAN/82-358..........DATFIGEM..ED......................ASMSDF.TFD.KVTL...EQRRAATAI.ELSQQL..
Q855V6_9CAUD/7-307..........RGEVVG.....E...............GA.....QKSESTATFA.PVTA...IPRKVQVTQ.RFSQEVKW
Q11H37_MESSB/111-386.TM.......TAAWVA.....E............T..GD...R.ASTQP..AYG.EVEL...TPFEAACYV.DISNQL..
Q88G49_PSEPK/193-483.GA.......VVGYIG.....T............E..ED...M.PATDM..QFD.DLKL...SSKKLAALV.PISNDL..
Q9MBJ9_9CAUD/128-407..........EGGFKTVAEGGK......................KPYMRFADFD.IVTE...SLSKIAGLT.KITDEM..
Q9ZXF6_BPPH1/131-394MVP.......FSPV.E.....E............L..GN...L.PEIDQP.RFT.KVSY...SIIDYGGIM.TLSNSM..
Q72BY4_DESVH/118-395TSE.......EGEIVD.....Q............N..AA...A.SDADA..SFG.TVGL...PVYKFSSKTIAVPIEL..
A5ZPL8_9FIRM/99-375QTG.......FTKV.G.....E............G..AK...I.PAGNTP.QFE.RVGY...EIEKYTGYY.PVTNEL..
A5ZRV5_9FIRM/125-407STP.......WGDV.D.....E............G..GE...F.GEEETP.NLK.QIKY...AIKKKGGIL.KTTREL..
A6NQ27_9FIRM/74-343..........EKELRNVE...E...............GA.....AIPQTEVKTQ.ENLV...KLHKRGRML.VASYEA..
Q9AZM2_9CAUD/164-424STD.......LLTAHT.....E............Y..GQ...T.TKNATP.VIT.PILW...DLKTYTGGY.VFSQEL..
Q0FZ25_9RHIZ/128-413.GA.......QTGWVG.....E............T..EI...R.PETSAP.QLA.ELSF...PTMELYAMP.AATNAL..
B2JU92_BURP8/137-421...PWGTDGIRAYWQA.....E...............AS.....VATATKPKLG.VSTN...RLHKLMALV.PVTDEL..
Q81Z09_BACAN/121-392..........VATWVA.....E...............SS.....GSDKQKKTTG.SITF...NYHKLRCAV.AVSLEVET
Q3SS55_NITWN/107-382.RT.......NAQWRG.....E............T..QA...Q.TTGEP..TFG.QLEI...PVREINTYV.DISNQL..
B8I8R8_CLOCE/60-320NE........MAEV.A.....E............G..AD...I.VD.GTF.VST.DVPF...KCAKVGLIQ.SLTSET..
Q2GDU5_NEOSM/81-367.AL.......EAQWVS.....E...............DE...I.TNSDAKEHII.TTEI...NTYELYTQP.KTTQKV..
Q8XLC0_CLOPE/109-375VSG.......LVDF.A.....E............D..GSAE.L.TEAKDI.KFK.NVTY...ALKEKGAFV.ALSNTL..
A4L2R1_LACRE/100-373.EG.......TAAWLE.....E............E..AA...Y.TESNT..QFS.QVSL...GAHKLGTLI.KVSEEL..
Q8W6U5_9CAUD/140-430.GA.......IVGYIG.....A............D..TD...I.PTTQQ..QFD.DLKL...TAKKMAALV.PIANDL..
Q3SSD8_NITWN/135-418.GA.......VGGWVG.....E............R..QA...R.PATATP.TLV.ELAF...QAMELYANP.AATQTL..
A3WSQ9_9BRAD/101-392.DI.......GAEWVG.....E............R..EE...R.PSLTTS.SLR.YLSV...PLHEIYTSQ.PITQRL..
Q0H261_9CAUD/146-418.TS.......PATWIE.....Q............S..GA...L.PTGDVG.TIA.SIDF...DGFKVGKVT.FVDNYL..
Q38K95_LACRE/117-373TER.......MNSV.E.....E............L..QK...N.PELAKP.EFE.EVDW...KVSTYRGAI.PLSQES..
Q0SPK4_9VIRU/118-397QKP.......MKPL.S.....E............N..QQ...IPTNGDNG.KLE.RFNF...KLKDLADFM.SIPNDL..
A7DYB2_9CAUD/103-361..........ALGVIT.....P...............GQ.....PVPDQKVADLIQLDF...NIKDYGQLV.HIYQSI..
Q9AZY5_9CAUD/140-394GSK.......MATV.Q.....Q............L..EK...N.PQLANP.KMV.EIDY...SVATRRGYI.PISQEM..
A6VNQ3_ACTSZ/129-407TTE.......EGELIG.....E............N..TA...A.TESDT..AFG.VGSL...GAKKLSSKIIRVSNEL..
B1JZG6_BURCC/143-413.GM.......TAGWVS.....E............N..EP...L.QRSGM..SFDNPVTL...KPRHVGALT.ELSRQL..
Q857K6_BPMB2/17-320..........SASWTG.....E...............AE.....RKPITKGSFG.KQEL...EPVKITTIF.AESAEVVR
A5N291_CLOK5/33-297.TG.......TADWVE.....D............G..DP...I.PESADT..FT.QFLV...KSYKLASLV.KLNRSF..
Q5WID4_BACSK/129-404..........QKLYNTAE..KE...............QI.....KELKNM.EFD.QITW...NIKKFAGFL.PISSEL..
A4EKP0_9RHOB/156-445.SA.......TASYGP.....E............N..GA...A.IESEQ..TFA.PIDQ...AFKTLKALV.PVGNAL..
A4XZF1_PSEMY/131-410TSE.......EGEIVG.....E............N..AE...V.DSQDA..TFG.TLAH...VVYKFSSKDIAVPFEL..
Q5HBR1_EHRRW/126-404DKT.......SVNWRA.....E............HKTEN.....IQQSLP.EVN.KHTI...NLHELYAQP.KITKKL..
Q2N5Z6_ERYLH/94-380.GT.......ASGWVS.....E............T..AG...R.PETDTP.SFE.EIAP...PTGELYANP.AASQAM..
A1KTF7_NEIMF/343-623.GN.......TVQWVD.....E............N..GS...A.TESNA..TFG.QMSL...KPKTVTANT.ELSRKF..
A7KUP9_9CAUD/79-375..........RAYDVAEG..QE............IPEDS.....IDWQTH...E.SPEI...RVGKSGIRL.RFTDEM..
Q9L8M6_HAEIF/114-400.GA.......VVAHGE.....E............G..QA...R.NDTATP.KLH.EVTI...ALNPIYAYP.KTTQEI..
A8GXG9_RICB8/224-495.KF.......NSGWIG.....E............V..EA...R.DETNAA.KLK.QQRI...FVHELYAQP.KASQAL..
Q8SBP8_9CAUD/122-380VDK.......LANL.A.....K............D..TE...L.VK.AML.KTQ.PMAY...DIDDYGLLA.PIDNSL..
A7A701_BIFAD/6-292..........EAEVVA.....E...............GE.....QKSSYEETLA.PVVG...KRFKVQTTT.RVSNELQW
Q81X81_BACAN/7-286..........RAKFVGEY..EE.......................IPYQNVRLR.EAIL...NSKRIGAAI.ELSEEF..
Q2GJL3_ANAPZ/114-389QET.......FVGWSG.....D...........HN..TI...V.SKSLTP.KLS.HINI...RLFELYAQP.QLAKNL..
A3XTC7_9VIBR/76-390..........ILEALENV..NA...............DV.....INFTDTQSYV.ETSA...NFSKSMSFP.SFTHEA..
A9W2M6_METEP/135-420.GP.......AAGWVA.....E............T..AP...R.PQTDTP.NLS.ELSF...PAMELYAMP.AATQTL..
A7GEE5_CLOBL/122-400QTE.......LTNL.D.....E............Y..GK...I.QEVDYR.QLE.RISF...KLHDCAGLK.TIPNDL..
A3UK25_9RHOB/114-399.GA.......TGAWAA.....E............T..AS...R.PETDAS.ALE.LLEF...PTAELYAMP.AATPAI..
A9BYD9_DELAS/120-394..........NAGPVG.ENPSG......................GKPESNITFE.AAQV...PVVTIAHWV.PASKQV..
Q892H0_CLOTE/99-365QTG.......FAEV.A.....E............S..GE...I.KENATP.KFT.QLPY...SVKKYAGFF.KVTNEL..
Q5ZGF6_9CAUD/117-376..........GEGAIGAQ..VE...............GA.....TKGQKDYDIS.MIDV...NTDFIAGFT.RYSKKM..
Q5Z3V6_NOCFA/148-434..........AAAVVPEATSAAAPTAPGTAGALVLNPNGG....YKPEGSWAFV.RKTA...VVKTIAEWV.PATKRA..
Q6R4V3_9CAUD/365-630.GA.......NFYWIG.....E............D..ED...V.QDSDF..DFT.TLSF...SPKTIAGAV.PVTRKL..
A6XMJ6_9CAUD/157-445..........WTEAVA............................NLNELSLSFS.QIEV...DGYKVGGFI.PIPNST..
A5CD71_ORITB/88-365.EF.......ITGWVA.....E............Q..DE...R.AETKSP.TLL.RRKI...AVHELYAQP.KATQKL..
A8FGQ6_BACP2/20-302..........LRPAEEGQALDA.......................KDRVVPATS.TVHL...NAKEVIAEI.HMTYDS..
Q3Y1P7_ENTFC/243-499QAV.......LATK.A.....E............L..AE...I.GDIDAE.MFT.SVDY...KVETRAGKI.ALSNEV..
A1EAE9_9CAUD/18-293..........SAYWVNET..EK......................IKTDKP.EVV.PVTL...KAHKLGIIL.VTSREA..
A3PHD9_RHOS1/126-396..........AARVVP.E..GT......................AKPYSDIEFA.TKIT...PVVTVAHMF.KASKQI..
Q3J3W7_RHOS4/148-418.GT.......SATWVS.....E............V..GD...R.TGSEP..SFD.QVTL...TPHELATFT.DISNAL..
Q857Z9_9CAUD/161-490..........NAAAVAEA..GT.......................YPFSSEEFA.RVYE...QVGKVANAL.TITDEG..
A6F0K0_9ALTE/127-405TAE.......EGELLG.....E............N..TA...A.TEGDV..AFG.MENL...GAKKLSSKVIRVSNEL..
A1TD88_MYCVP/110-388..........SGSWDGEA..VE......................VSDDSP.ELQ.QPEI...PVHKLQIWV.EFSHEL..
B4SNH6_STRM5/129-412.GT.......SSGWVG.....E............E..DP...R.PETATA.KLR.PLSF...GWGEIYANP.AATQQL..
A6BER6_9FIRM/23-314..........IAYFVN.....G............D..SG...Q.KKTTKQ.AWD.KKFI...IAEEIAVIV.PIPESV..
A5VJB3_LACRD/236-497TAV.......LTTK.E.....E............Q..AE...I.ADVDAN.MFE.DVKF...DVKTRAGKI.ALSNEV..
Q5L2L4_GEOKA/120-373.............FIA.D..TE......................TAKELEATGD.VVTF...GRHKFKVFA.GISETV..
Q0AG17_NITEC/123-405TSE.......TGELIA.....E............N..TT...A.TAQDP..TFG.VVTL...NTYKFSSKIVAAPFEL..
A9CJN8_AGRT5/134-419.GM.......TTGWVS.....E............T..AA...R.PQTATP.QLA.ELSF...PTMELYAMP.AATQGL..
A3DG61_CLOTH/127-416RANGSRWGGVQAYWVA.....E...............AE.....TAAQSKPKFR.EIEM...SLQKLLALC.YVTDDL..
A4TCV1_MYCGI/152-412..........NAAVVADG..GT.......................KPTSVYTTV.RVED...KLDVVAHLSEGVPRYW..
A3WWM5_9BRAD/96-387.EP.......DAGWVG.....E............K..QA...R.PDTNTP.DLG.KLRI...PVREIYAMP.KVTQKL..
Q2SDM1_HAHCH/110-393.GA.......GSGWVG.....E............T..DA...R.PETNTP.KLA.QIEA...FMGEIYANP.ATTQKA..
Q5J5U0_9CAUD/24-332..........GQVGVGTS..NE............QREGG.....TKPLSGTAWD.TRSV...APIKLATIV.TVSEEFAR
B3XQ47_LACRE/128-385.............FVD.D..GE......................IAKEMSLKGD.QINF...ERHQVKVRA.GISDTV..
B3XLQ0_LACRE/117-374TAQ.......MHTV.E.....E............L..AK...N.PDLQKP.EFL.KVAW...QIETYRGAI.PISQES..
A6C3V3_9PLAN/122-410RMDGSRSGGLRAYWVG.....E...............GD.....PLTGSSPKLG.ETTL...KLNKLAVLV.YLTEEL..
A6XRQ5_VIBCL/392-657.GA.......TGYWLG.....E............D..AD...A.TLSEI..TFG.ERTL...QNRTCAALV.EMTRKM..
A6U954_SINMW/144-422.QF.......SARWTA.....E............Q..AT...R.TETDGL.RYG.MWEI...PTHELYALV.DISEQN..
A7GI70_CLOBL/117-372.............FIK.D..TE......................TAKELEVKTP.TVQF...GRHKFKVFS.SLSETI..
A3WZW4_9BRAD/137-425.EG.......TAGWVG.....E............T..QA...R.PATGTP.QLG.KWEI...PVHELYAFP.QVTQKL..
Q8LTC0_9CAUD/142-396TTK.......MVTV.A.....E............L..EK...N.PAMAKP.EFK.PVNW...SVETYRQAL.PVSQES..
Q9T1F6_9CAUD/115-380ITP.......LKDLDD.....E............S..AL...I.GDNDDP.ELT.VVKY...LIHRYAGIT.TVTNTL..
A5LFN8_STRPN/129-383DQA.......MNTV.E.....E............L..EE...N.PELAKP.TFT.KVNY...EIKTRRGHL.PVSQEF..
Q5Z394_NOCFA/119-388..........NAAPVAQG..AT.......................KPTSVLGLA.EIDA...ELRVIAHMSEPIPKYW..
A6FF94_9GAMM/101-399NVA.......GSSW..............................PESDTP.NTG.EIRS...HVFKRHGKY.PITDEA..
B2JL19_BURP8/113-379..........NADYQT.E..GQ......................LKAQSDLSFE.MAQA...PIVTLAHWL.LASRQV..
A6M951_9VIRU/99-368QTG.......FVEV.A.....E............G..AA...I.GEKATP.QFT.LLQY...QVKKYAGFF.RVTNEL..

PF05125

VPN_BPP2/6-342----------IASTTDTAGGTE----------------------RQPKDFSKLA-SNKY---ECDQINFDF-YIRYKT--
VPN_BPHP1/3-330----------VTGRKQTG....----------------------.RNLANLDHT-QNGF---ELAETDSGI-IVPWAL--
O80304_BP186/6-342----------IASTTDTSGDKE----------------------RQTADFTALE-SNKY---ECNQINFDF-HLTYKR--
Q48277_HAESO/6-337----------IAGTTDTN.ATG----------------------RKTQAIHALN-KIPY---HCQQINYDT-HLKYAI--
Q9ZXM3_9CAUD/6-336----------IASRTDTTGDGV----------------------RKPRDVSALD-NQRY---ECKHTDFDT-AITYAM--

PF09950

A3M3U3_ACIBT/79-324LQAAQKL.NLA------LEADKVEAARLAA-------------EKHLSNIAWYG.....NALTG---V-----KGFLNQ.
A6UAP6_SINMW/63-317LGTAQLL.GMN------LTSEKASSARRIA-------------EEKIDQVAFVG.....DTGKG---F-----SGLVNS.
Q9P9P2_XYLFA/83-327LRQSAFL.RKP------LNTARADAAMDAY-------------ERHINDVALFG.......EDE---L-----TGLYTH.
Q0T6M7_SHIF8/67-313LQAAQQV.GRP------IDTQKYDGMQLKW-------------QMDNDEQVYVG.....DSALN---L-----KGLVTL.
A7ILG8_XANP2/97-352LESARLT.GRP------IDTQMLSALNRKN-------------QMDTDQVVYIG.....DSSIG---T-----TGLLNS.
A3L742_PSEAI/62-309ISQAQML.GIN------LTGDDAAAARRAY-------------EEFVDRVALAG.....DAPKG---F-----SGLFNY.
A9ABK3_BURM1/97-345LESAQKL.GRP------VDQQKFEGMQLKH-------------NMDVDEQVYIG.....DSVLG---V-----TGLVNS.
Q7N327_PHOLL/60-317LEKIARL.NIN------LQTKKQDDLYANA-------------TATIQYAGYVG....HEGVKG---Q-----EGLLTG.
A5PIZ3_9CAUD/86-326IKAGQRT.GKS------LSTRKANAAQNAH-------------DQLVNHLVFKG.....SKPHK---I-----ISVFEH.
Q2G4R3_NOVAD/110-363MQRAAKL.GRS------LSSDKAQGAVLAA-------------DRFIYGIAMTGKTPRGESEKG---W-----TGFINN.
Q2NRY5_SODGM/71-317LASAMQL.GRP------VDSQKLDAMNQVY-------------QLNVDRQVYVG.....SKLLS---V-----QGLLNQ.
Q2NSP7_SODGM/16-248LEKVRAN.GLE------LPTDKAIYVRQEM-------------DRKIATIGVYG.....DADYA---M-----QGLLTY.
A4N6E6_HAEIF/55-278LEQGKLL.GLA------LDTAKIMALNKNA-------------QQTLQKVAFLG....HAKDTR---L-----TGLLNN.
Q333F7_9CAUD/77-311IKAGAAT.GQS------LSARKQALAFEAH-------------DNLLDKLVWSG.....SAPHG---I-----VSVFDQ.
A5UGK3_HAEIG/78-315LKAASAN.QTD------LPSSKARAARRAV-------------EVKMNEIALLG.....DKEFG---L-----NGFINH.
Q0BRS5_GRABC/65-316LEHARQY.GID------LGPEKAEAARRAY-------------EEFVDDIVLRG.....DAARG---F-----SGLLSH.
B0UJ01_METS4/61-314LGKAQLL.GMN------LGSEKAEAARLAS-------------EEFIDQVALFG.....DAGKG---F-----SGLLNH.
Q6XQD3_BPT1/81-319IKAGQAT.GRP------LSTRKASACQLAH-------------DQLVNRLVFKG.....SAPHK---I-----VSVFNH.
A6TKD0_ALKMQ/59-304KRAAQMA.NRT------IDITKAIAARRAV-------------AEKENRFFYVG.....SEAHQ---A-----EGLLNF.
Q835B4_ENTFA/56-293IRQAQMM.GTS------IDATKAEVARRTI-------------AEKENSFIFVG.....DPKVN---H-----KGVANA.
Q45PZ1_9CAUD/59-293IKVGQAT.GQS------LSTRKQSLAFEAH-------------DKLLDKLVWSG.....STAHG---I-----PSVFDY.
A2WAD9_9BURK/103-363LVKSQAL.GMP------IDAQKVEAMNLKR-------------NMDLDQIVYYG.....DPQLG---F-----TGLVNSI
Q46YM7_CUPPJ/97-345LESAQKL.GRP------VDQQKFAGMQLKH-------------NMDVDEQVYIG.....DTVLG---V-----TGLVNN.
A9C0G0_DELAS/59-320VNTTMAFPGAS------LSDRRARAARLAY-------------MKFMFDLTLKG.....SPEKG---M-----GGLINY.
Q984H1_RHILO/85-339LGTAQLL.GMN------LNPDKATTARRAA-------------EERIDSTAFIG.....DAAKG---F-----SGLVNS.
A8ATG6_9CAUD/56-301LRAARMQ.GTT------VDAAKATTVRRAI-------------AEKENSIAFRG.....EKKYA---I-----KGAFEA.

PF04454

C9RYB7_GEOSY/5-265IEQAKQL-GSP------IDFSAAANAAQQC-------------ALLEDDLIFNG-----STEFD---V-----PGIMNV-
D4H156_DENA2/1-251LDNIDRG-AKD------IALDDLAEAARKM-------------ADFEENAVYNG-----FKDSG---I-----VGLNQV-
D2Z797_9BACT/1-250LDDISRG-SET------TDMSPLEEAARKI-------------ALFEEKAIYTG-----MDSSC---I-----LGMENS-
C8WPL7_EGGLE/1-257MEYAAQT-GYP------LDLSVAIAAAKKA-------------SRREDDLILNG-----SKALG---T-----DGLLTV-
D0LZ74_HALO1/1-251LDSVARG-ATN------PDLDDVARAAERM-------------VEAEDSAIFHG-----WAQAG---I-----KGIVDS-
D1B7I4_THEAS/1-249LDDISRG-AVD------VDLSSLEDAARKM-------------AEFEERAIYHG-----LDEGC---I-----EGIVKS-
A0KD92_BURCH/1-251IDSVERG-ARD------ADWQPAKEAAQRL-------------AFAEDNAIFDG-----YPAAG---I-----VGIREG-
A0PLA3_MYCUA/1-251IDDVERG-SQD------SDWDPVKAAAKQL-------------AFVEDRTIFEG-----YGAAS---I-----EGIRSS-
A1B987_PARDP/1-251IDDVARG-SND------SDWQPLKDAARKI-------------ALAEDRLVFLG-----HGDAG---I-----RGILPE-
A3DFK3_CLOTH/1-257LEFSEQM-GLP------VDLSSASRAATQC-------------ALREDKLIFYG-----NDELG---Y-----KGLLTE-
A4WHF5_PYRAR/156-358IEYARAR-GEA------VYSTSADRAAVRL-------------AYEEDATI...-----.....---L-----GDILGN-
MARIT_THEP1/1-251LDNLERG-KPN------VDLSSLEETVRKV-------------AEFEDEVIFRG-----CEKSG---V-----KGLLSF-
A6TWC5_ALKMQ/1-250MDNLIRG-AKD------IKLDALEEAAEKM-------------AIFEENMLYNG-----YKPGD---I-----EGLIEA-
A7HIB4_ANADF/2-255LEADAAC-GEP------LVLSEASEAARQI-------------ARAEDRIVFEG-----LPRAG---V-----SGLLGH-
A7I7A2_METB6/2-249LAAYERD-HLI------LDTAPVACAAMDA-------------AAKEDRIIFNG-----LA..G---T-----PGLLNA-
A8F8I8_THELT/3-247IASYERE-GVT------LDLKNLITAVREC-------------ATIEDRLIFEG-----IN...---S-----HGLVSA-
A8L1F1_FRASN/1-253LDAIDRG-ADD------IDLSALEEAARRV-------------ATTENSVVFHG-----YAEAG---I-----IGITEA-
A8UW07_9AQUI/3-269LEYFRQF-NMP------IDTSNAVAAAVAT-------------AVAEDTLILLG-----NKNLG---L-----EGLMTA-
A9BEM3_PETMO/1-251LDNIERG-LKT------PDLEGLETAAKQL-------------ASFENKLILKG-----IEKAN---I-----IGLQTL-
A9FWS5_SORC5/3-254LDAVGRG-AQE------PNIEDVVRAAEHA-------------ARFEDGAIFNG-----LAAAG---I-----EGILEV-
A9H5P1_GLUDA/1-251IDDVERG-AGD------SDWQPLKDAAKKI-------------AFAEDRAVFDG-----YAAAG---I-----LGLREG-
B1CAJ4_9FIRM/1-257MEQSEKS-GWP------FDLSSAAAAAQKA-------------AKKEDDLILFG-----NKELG---M-----EGLFNA-
B1L4G8_KORCO/136-346LDYSKSI-GK.------LEVPQALTAASKL-------------IFEEEKTILDG-----.....---.-----...IKE-
B1VSP7_STRGG/1-251VDDVERG-SAD------SDWQPVKDAARTC-------------AFAEDMAIIDG-----YGAAG---I-----TGLRDG-
B2A6K6_NATTJ/8-259LDNIERG-AQD------IDLEPLEDAARKI-------------ALFEENAIYNG-----HNDGQ---I-----PGLKTV-
B2GID2_KOCRD/1-252IDDVERG-AAD------PDWQPVKDAAVAL-------------ASAEDRTVFYG-----SDSAG---I-----QGIAPA-
B2JNZ6_BURP8/1-251IDAVERG-AND------SDWQAAKDAAKEL-------------AYAEDRAIFDG-----YKAAG---I-----VGIREG-
B2V6Y3_SULSY/1-265VESSKKF-NIP------IDFSVAAAAASQV-------------AIAEDRLIFHG-----DIETG---F-----PGLLNV-
B4UA40_HYDS0/1-265IETSRKL-NIP------LDVSVVALATREV-------------ALAEDRFIFHG-----DSEIG---Y-----PGLLNV-
B4UI59_ANASK/1-259VEALQRR-GEP------LALTEAAEAARRI-------------ARAEDRLLFEG-----HAGAG---V-----RGLLEH-
B8CYH7_HALOH/1-249LEAFVRG-AED------VNIDNLLESANEL-------------ARIENKAIFFG-----MDSAG---I-----SGLVNS-
B8D495_DESK1/120-343LEYSYRT-KTS------IDAPDMYQAALKL-------------ATMEDSLI...-----.....---I-----GSILDS-
B8EQK3_METSB/1-251IDDVERG-ADD------SDWQPAKDAAKTI-------------AFAEDRAIFDG-----YADAA---I-----TGVRQG-
B8GHL2_METPE/5-250LAAYERD-GML------PNTSAVAVAAIEA-------------ARQEDAVIFTG-----TD..Q---V-----KGLMNT-
B9JHD1_AGRRK/1-251IDDVERG-AED------SDWSPVKDAARKI-------------AFAEDRSVFDG-----YAAAG---I-----QGIREG-
B9MNM0_ANATD/1-251LEYILSG-TGP------YDFSQVARATLEC-------------AKKEDEFIFWG-----CKELG---L-----EGILTA-
B9YCJ8_9FIRM/1-256LESVES.-GAS------LDRSRILEAARKL-------------ARREDELIFFG-----NPAAG---V-----SGLVNT-
C0R0J8_BRAHW/1-256LENNISN-KLP------LDLSIVSQAAQTL-------------ANKEDNLIFNG-----NDFLE---L-----KGILNA-
C0ZHN4_BREBN/1-265VAQARTL-GMP------LDMSAAANAAAGG-------------ALMEDDLIFNG-----AAEFD---L-----PGLMNV-
C0ZVK4_RHOE4/1-251IDDVERG-AKD------SDWQPVKDAAKQI-------------AFAEDRAIFEG-----YPAAS---I-----TGVRAS-
C1B1V8_RHOOB/4-254VDDVARG-SLD------SDWQPVKDAAKAV-------------AFAEDQSIFQG-----FDEAG---I-----RGLGPS-
C1DV98_SULAA/1-265IETAKKL-GVP------VDFSVAAVAASDV-------------ALAEDKLIFHG-----DKETG---F-----EGLLNV-
D5UVK7_TSUPD/1-251IDSVERG-AQD------ADWDPVKDAARSL-------------AYAEDRAIFEG-----YPDAS---I-----PGIRTT-
C3MM35_SULIL/96-329KNDSRR.-...------....TAIVAGKSF-------------AKTENQLLLKN-----HP...---.-----..LSPL-
C4XPM7_DESMR/1-251IDNAARG-GKD------IDLAALDEAAEKL-------------ARFEEEALYHG-----FAPAG---I-----KGLSEV-
C5B5H8_METEA/1-251IDDVERG-SED------SDWQPLKDAARML-------------AFAEDRAVFEG-----YAAAG---I-----GGIGKG-
O67639_AQUAE/1-267LEHWRQF-NLP------VDTTGVAAAASSL-------------AVAEDKLILFG-----NQEMG---I-----EGFLTA-
Q08WR7_STIAD/2-266IEAARIH-NMP------LDVSAAAGAAALC-------------AQQEDELIFYG-----DPKLG---H-----EGLMTA-
Q0RH88_FRAAA/1-253LADADRG-ADD------LDLAPLEEAVRRI-------------AVTENSVVFHG-----YQEAG---L-----VGITQA-
Q1K2C9_DESAC/1-251LDNIERG-AKD------IQLDALVQACRDI-------------ALFEERAIYQG-----FEPAA---I-----AGLHDT-
Q2RVS0_RHORT/1-258LEAIARG-ASD------ADLDPVIEAARAI-------------AIAEDRAVFHG-----FAAGG---I-----TGIGEA-
Q401P1_9EURY/136-332LND....-.GT------YDVSIATKAGELL-------------VKDEESLV...-----.....---I-----REILST-
LIN18_BRELN/1-252IDDVARG-SGD------SDWQPVKDAATTI-------------AMAEDRAILHG-----LDAAG---I-----GGIVPG-
Q4JC29_SULAC/153-340LPVNRT.-...------..LNIIHRAGVKY-------------SLMEDELLLSK-----HP...---.-----..LSII-
Q5YPL3_NOCFA/1-252LDNVERG-AKD------TDLDAVKEAARRI-------------AFAEDRAIFEG-----YPAAG---I-----TGIRAA-
Q7MSM9_WOLSU/1-252VEAILRE-ANA------FDISSIEKAAKKV-------------CVAENELVFYG-----LKKEG---I-----EGLIPS-
Q835B4_ENTFA/4-243IRQAQMM-GTS------IDATKAEVARRTI-------------AEKENSFIFVG-----DPKVN---H-----KGVANA-
Q972Z8_SULTO/108-304LPKEETQ-PV.------.....FMKAYLTH-------------SRKEDLLIYRE-----HP...---.-----..LSIL-
Q97V86_SULSO/96-329KSDSRR.-...------....TAVLAGKSF-------------AKMENYLLLKN-----HP...---.-----..LSPL-

PF11651

B7KXS0_METC4/1-419LSERVIK-PAM------VSLANQVDQDVM..............SLYSSIPNWVG....TPGTVLSS.Y-----SGFLRGT
Q3RBQ2_XYLFA/1-408FSKRFLR-PAM------TSLSSKVNAILLA.............SMYQQTPNVVGTWGTVPGT.....R-----TPWRSAA
A5VES4_SPHWW/1-413LSERVIK-PAM------VQLANKIDSDVL..............SLAAKVPNWVG....TPGQIVNS.F-----QDFAPAP
Q57SP8_SALCH/1-428SYRRRIQ-ASA------KKLANNIESAIAK.............QATEMGSLVVHDTRAIGPSTGLSGW-----DFVSDAE
B2U8F8_RALPJ/1-419YSERILK-PAI------NDIAGQIAADIMGGMDGLVPAGTLYPDTQLPASNLVGKFDGSNNLLNAD.L-----NTFLSAN
Q1R947_ECOUT/1-416HKTEAGR-AAG------MRLAAQIDSDLIS.............MVTQRATNVITMADSTAGTQGRDLW-----NCAAGID
A4E782_9ACTN/1-291FSAQFLV-PAM------QAFADKIDGYLL..............ALEKDVTNRVDH...AKGAIA...V-----ADIIAAR
A4JD31_BURVG/1-395FSERILA-PAV------NRLAAAVAADLM..............NVAASSSNIVAK...SNASASPD.A-----STWLLAG
Q2G3Y7_NOVAD/1-418AMGQYGK-AAK------QKLSSDVNLALFN.............TVALYGSVFSKRTGAATG......Y-----DDVADID
Q3RHM5_XYLFA/1-409FSKRFLR-PAM------NSLSSKVNAYLLK.............SMYLQTPNVVGTWGTIPGT.....R-----PPWRAAA
Q9AYZ7_BPHK6/1-421L.EEILA-PVR------QRIVTDLETELAH.............FMMNNGALSLG....SPNTPITK.W-----SDVAQTA
Q5YSR9_NOCFA/1-303MQDQIAR-PAA------EALAQYVDRAIIA.............HIKTATSAFAGV...TPAGFEWDKP-----EVLIEAG
B5NXL6_SALET/1-427AYRRRIQ-SAA------RKLANNVELKVAN.............MAAEMGSLVITSPDAIGTNTADA.W-----NFVADAE

PF06673

Q9MCB6_9VIRU/1-347VDDTFIEGTFKAGT---DKNKAQTASKRSL-------------RPQMAEAYLQMDKA---TVRGVND------SGALSEY
Q9MCB8_9VIRU/1-347VDDTFISGTFKAGT---DKNKSQTATKRSL-------------RPQMAEAYLQMDKA---TVRGVND------SGALSEY

PF05065

A5IR70_STAA9/36-312LNYTYSQ..FF.EE...MKPM....IAEAF-------------YKKFDEAGILNQGN...NPFG...------.......
E0THR4_PARBH/115-394LDDTVVD..LS.AW...LAEE....IQAEF-------------AAQESAAFVSG.DG...VN...KP------RGILDY.
A5MBG7_STRPN/137-417LKKDTTG.....AYFNYVMNE....LAQGF-------------IRAVERAVVIG......DGKNSDD------DDKITE.
B1J5N2_PSEPW/144-414LSDIPL...LQ.SY...INGR....AIYGL-------------KYKEEEQLLAG......DGTGQNL------LGLI...
Q1GG15_SILST/131-399LDDVSA...LR.SM...IDQR....LLFGL-------------ALAEENQLLNG......DGTGQNL------SGLI...
Q3HL14_9CAUD/114-381LQDSDQN..IL.KY...VTKW....LGKKS-------------KVTRNVLIL...............------.......
Q1DCZ9_MYXXD/94-361LRTPGVG...D.AG...VGED....IRATV-------------ADGLDDAGFNG.DG...TGA..AP------KGLFAQ.
Q3R2V6_XYLFA/355-623LLQSTPD..AE.QI...VRSD....LLNVM-------------ALEVDRAAIYG.SG...SDM..QP------TGVKHH.
Q7Y4I4_9CAUD/8-297ASEEAKV.....DMLTDFVEG....FSKKL-------------ARGLDIMSIHGINP..........------.......
Q6GAL1_STAAS/126-378IHGSDVD..LV.NW...VENA....LQSGL-------------AAKERKDALAVSPK...SGL....------.......
B0K6S2_THEPX/124-397LNDSVFD..LE.NY...ISTE....FARRI-------------GAKEEEAFLVG.DG...DG...KP------TGIFNA.
Q1CQW9_STRPC/140-392IDDADVD..LV.GI...VAET....IGQMK-------------VNTTNDAIA...............------.......
Q0AAI8_ALHEH/83-374LEDSRLD..LE.QW...LQDK....IGTRF-------------GRQEAESFIKG.DG...NG...KP------RGILDY.
A4WC36_ENT38/128-406LQDSGVD..IE.AY...LASR....IGQRI-------------GRGEAKYLVQG.TG...AGAPVQP------KGLVAS.
Q3EL79_BACTI/115-382LNDTDQA..LE.AY...LRQW....IAKKS-------------IATRNYLIL...............------.......
Q139N4_RHOPS/143-428LDDAAVN..LD.DW...LTGE....IDTVF-------------AEQEGAAFVSG.DG...IN...KP------KGFLAA.
A5F9J3_CLOK5/135-393LNGTETN..LV.AT...VQAG....LQSGL-------------AKKEKKVAFESTTP..........------.......
Q6G7X2_STAAS/129-401IEDAKVN..........VLQELKLWMARTI-------------AATRNKAIIDVITK...GSTGSTS------SGFEKE.
A0AI11_LISW6/136-390IDDAAVD..LV.SI...VSEN....AQEQK-------------VNTTNYAIS...............------.......
Q3J4R6_RHOS4/160-429LEDADQ...LQ.GE...IDGE....LRYGL-------------DLTEEAEILSG......DGEGQHL------SGLI...
A5VKJ7_LACRD/107-373LKDTVEN..IL.AW...LSNW....VAKKV-------------TVTRNAKII...............------.......
Q92CB8_LISIN/19-306LENNIEKRNLK.DT...IMQM....LAERA-------------AVDIEELMVNGDTSNTTDSYLAQL------DGIR...
A5KJS3_9FIRM/124-396LNDSVFN..IE.QY...ISRE....FGRRI-------------GAKEEEAFFIG.DG...AG...KP------TGIFNA.
A1VBS2_DESVV/113-404LDDLFFN..VE.AE...LSAD....IVTEF-------------AEQEGSAFLSG.DG...TN...KP------KGLLAYP
A1T829_MYCVP/9-278VRDSFNE..GAPEI...VATA....QGIDI-------------ARKVDEAFFG.......ADNPVAN------DGLQAL.
Q982R8_RHILO/176-465LDDGIID..IG.AW...LADE....VNITF-------------AEQEGAAFVTG.NG...LK...RP------RGILAY.
Q5HTE1_CAMJR/118-386LSDNIAN..LE.SF...IVRK....AAEKI-------------SKTEELSFING.DG...NK...KP------TGLKN..
A1AYY2_PARDP/166-435MEDAQQ...LQ.TE...IDTE....LRYGL-------------MLAEEGQLLKG......DGVGQNL------EGLV...
Q7WLQ0_BORBR/118-390LRNARQ...LQ.TY...INGR....LMYGL-------------DLKEELQILKG......SGVGLNM------NGIL...
A3LM59_PSEAI/122-402LDDVPQ...LF.GY...IQEL....LRYDL-------------KLEEEAQILKG......DGTGENL------NGLM...
Q8X755_ECO57/100-380VDFSDVD..IL.SW...LTGE....IGDTF-------------TETEESDLVVG.DG...DK...KA------KGFLSVP
Q1ILS6_KORVE/495-776IIQSSID..AE.QF...VRED....LANIF-------------ALGVDLAALVG.SG...TSN..QP------KGIVNQ.
B8FNY7_DESHD/107-369LEDTTVD..FFNSL...IAPD....FAECA-------------VNSENEEII...............------.......
Q1GH34_SILST/388-661LKQSSLD..IE.AL...VRSD....LALAL-------------ATSLDFAGFYG.TG...AND..QP------LGIANT.
Q2GAM7_NOVAD/185-459LDDVPQ...LR.SY...IDGR....LRYGL-------------EYVEEGQLLNG......GGTGTDL------NGIY...
Q8XYS4_RALSO/130-408LSDSSVD..IE.AF...LAGR....IAARI-------------GRAESRLVVQG.TG...DGKPQQP------QGLAAS.
Q3J3K4_RHOS4/110-395LDDSAFD..VE.SW...LAGK....IATRF-------------MRAESAAFVSG.DG...ID...KP------RGFLAP.
Q1NB79_9SPHN/81-368LDDAQFD..VE.GW...LASE....IAREF-------------AVAEGAAFVSG.NG...TN...KP------KGFLTYT
Q5PB65_ANAMM/103-375LDDSLVD..LE.GW...LIDN....LVDAF-------------SRKENEAFISG.DG...DK...KP------SGILSSE
Q1QLS4_NITHX/103-379LEDAAVN..VE.SE...VASD....LSEEF-------------GRLEGLGFSQG.DG...VK...KP------IGIMEAA
Q65ES7_BACLD/133-400LADTQEA..LL.QY...LSNW....LAKKS-------------AVTRNTLIL...............------.......
Q8ED08_SHEON/122-393LDDSKQ...LQ.SF...INAR....ARYGL-------------MLKEEVQLLYG......NNTGANL------HGIM...
Q813J9_BACCR/150-424LARTGLP..IE.QI...VMDE....LKKAY-------------VRKETQYMVNG.DE...AN.....------.......
Q3J5Z4_RHOS4/150-439LRHSGVA..MA.QL...VRDD....LLKVM-------------ALREDLAFLRG.DG...SAD..TP------KGLRHW.
Q3F193_BACTI/24-317ISDSQWD..VI.GL...HLRA....AGRAM-------------AAKKEEICFNEFKK...TGHVVYD------AELFP..
A1B638_PARDP/102-387LDDAAFD..VE.TW...LAGR....IAEKF-------------ARAEATAFISG.DG...VN...KP------RGILTH.
A5WQQ4_MYCTF/196-475EGDAAG...FV.AE...VGRV....LADSV-------------EQLQAAAFVSG......SGNG.EP------TGFVS..
Q1R877_ECOUT/115-398LDDAFFN..VE.AW...INSE....LATEF-------------AEQEEIAFTTG.DG...TK...KP------KGFLAYE
A4IS66_GEOTN/24-302LEDNIEREGFE.DT...LIQL....IADRV-------------GVDLEELFLNGDKSSS.DSFLAKT------DGWL...
Q17ZS7_CLOD6/178-435LESAGN...ID.AI...ISNA....IAESI-------------ASAIDKAGLYG.VG...ED...EP------KGVLTY.
Q854Z2_9CAUD/258-539LQDEAN...VT.ET...VALL....FAEGK-------------DELEAVTLTTG......TGQGNQP------TGIVTAL
Q9AZS7_9CAUD/124-390LKDTAEN..IL.AW...LSSW....IAKKV-------------VVTRNQAII...............------.......
Q0AWY3_SYNWW/43-310VKDATFK..IE.DY...LVSR....LAKNF-------------GRAEDNGFING.TG...EN...MP------TGILAA.
A4YU30_BRASO/140-423LDDAPR...LQ.NR...ITVQ....AARAI-------------RWKLFEAVCFG......DGNG.KP------LGFM...
Q1B5C3_MYCSS/9-280AEDSSPE..AT.AL...VGAS....VARDM-------------ARRIDAAWFA.......ASTAKGP------AGLASL.
Q2NV28_SODGM/127-397LDDFSQ...LA.SL...IDME....LRYGL-------------KYVEEQQILFG......DGTGSNL------NGIF...
Q1B7W7_MYCSS/9-278LRQSVIG..LD.AT...LRQR....LVTDV-------------SNALDDALLTG......AGTSNTI------TGLINQ.
A3T0Y2_9RHOB/165-433LADAGQ...LQ.AL...IDQE....LRYDL-------------DLEEEAQIIAG......DGLNQNL------LGLT...
Q1GHS2_SILST/113-395LDDSAFD..IE.GW...LAGR....IADKF-------------ARAEAQSFISG.DG...VD...KP------TGILTH.
Q2L2B0_BORA1/123-401LADTGID..ME.SF...LAGR....VASRI-------------GRAESRLIVMG.TG...TGSPAQP------KGLAAS.
A2SD63_METPP/97-385IDTASFN..VM.DW...LNTK....IGEKF-------------GFSFGASIIAG.DG...AA...RP------SGFTNYP
Q3J223_RHOS4/110-368TKHSAMD..LQTDVISFIADQ....FAEDF-------------AADMADGFING......TGLNDDP------QGIL...
A5TX36_FUSNP/106-365LADETAN..LT.AH...IGKR....FAKKA-------------VNTENKKIL...............------.......
A1TML8_ACIAC/138-428LAYAGVNPRVD.AI...VVGD....LQTSM-------------ALSEDQHFLRS.DG...AGN..KP------KGLLYW.
Q3DFH6_STRAG/127-397LNDSVFD..LE.SY...MTSE....FARRI-------------GTEEEKSFLVG.DG...SK...KP------TGIFTQ.
Q637B0_BACCZ/101-383LPAADYD.....AE...VMKG....ITVAT-------------RKKLTREILIG......TGATNRL------VGIFS..
Q14M91_SPICI/321-590MTIEDFE.....AF...VIRV....ITNRI-------------KEGIEQSLATG......TGKG.QP------TGILSD.
Q1QKG8_NITHX/112-388LADSAGS..AQ.AE...VQLA....LSEDF-------------GAKEGLAFVSG.VG...PL...AP------EGIMSNA
A3KA53_9RHOB/140-434LRQSSTA..VD.RL...IRDD....AVADA-------------AQIQDRFFLRG.IG...TES..AP------KGLRYQL
A5M4C8_STRPN/8-299ASEEKQM.....NFLSAYMDG....FAKKI-------------AEAFDLAALHGLEP..........------.......
Q0S2A4_RHOSR/9-273ADDTDPA..AA.SI...IGKA....LARDI-------------ANKTDAAFFG.......NTVTNGP------SGLLSV.
A3X0R0_9BRAD/133-422LDDARID..LA.AW...LADE....VSIEF-------------AEQEGAAFANG.DG...IN...KP------RGILAY.
Q6LSF8_PHOPR/134-417LQDSFFD..ID.GY...IQDL....LGMRI-------------GRITNRHFTVG.TG...IN...EP------AGIVPGA
A5N1H4_CLOK5/152-424LEDSMIN..LA.NY...IETR....LSMAI-------------AKALDKAILTG......AAASKQP------TGII...
Q859C1_9CAUD/118-386ATDQVLD..LV.GF...LVSD....AGPAI-------------GDAMGRHFITG.TG........QP------RGILTD.
A3W815_9RHOB/115-386LSDSGGT..AE.AE...VRLA....LAEDF-------------GKKEGAAFVNG.TG...AG...QP------EGLMTHP
Q6J1Y2_9CAUD/119-381IADSAVD..LT.SL...VGQS....INEKS-------------VNTYNAMIA...............------.......
A7HRJ6_PARL1/148-433LDDAAVN..ID.QW...LAEE....VQTAF-------------AEQEGAAFVIG.DG...VK...KP------RGFLDY.
A4WS92_RHOS5/111-382LADSAGQ..AE.AE...VRMA....LAEDF-------------GQKEGAAFVSG.DG...IL...EP------AGFMTHA
Q9XJ79_9CAUD/117-382LADSAEN..IL.AW...LSGW....IAKKV-------------VVTRNKAIL...............------.......
Q2YMS9_BRUA2/137-422LDDSAVN..VE.QW...IAEE....VEAAF-------------AEQEGAAFVSG.DG...VN...KP------RGFLSY.
A3SMP9_9RHOB/146-433LRQSAVA..MA.RV...VRND....VVMQM-------------AAREDIAFLRN.DG...TSG..TP------KGLKSW.
Q73HT5_WOLPM/107-395LDDAFVD..VE.SW...LVEK....IAETF-------------SKEESEAFIKG.EG...TF...QP------KGILAYE
B1ZCX2_METPB/163-460KKWTIID..IQ.AY...IERE....LRNAG-------------GQTLDLNGWLGT.....GANADTP------TGILNV.
Q9A4P7_CAUCR/53-338LDDAYVS..ID.EW...LAEE....VQDAF-------------AAQETTAFVTG.DG...VN...KP------KGLLAY.
Q3Z7J9_DEHE1/124-397MNDSVFD..LE.KY...ISTE....FARRI-------------GAAEEEAFLIG.DG...NK...KP------EGVFTK.
Q9B0A7_BPMB1/19-303ANPA........NYLGTMRTK....VATAI-------------AMAFDNAALHG......TNAPSAF------QGYLDQ.
Q6UAX6_9CAUD/134-425IGRAGFN..VE.QL...VLQD....ILTAI-------------SVREDKAFMRD.DG...TGD..TP------IGMKAR.
A6VBQ1_PSEA7/140-406IQQSAPA..IE.QL...VRDD....LAYLI-------------AKQIDSALIYG.GG...T.N..EP------VGVLNT.
A7B3D6_RUMGN/128-405LANVVTLKMFT.DL...FVPM....ATEAM-------------VKAIEIAIFNG......TGEG.QP------LGVLKD.
Q12EX8_POLSJ/63-302LEAAGGD.....NI...LRGD....LALAV-------------ATATDLAFIDYLNA...GVAGKMP------AGI....
Q830G6_ENTFA/163-444LKMSGVP..VE.DI...VVEE....LKKAY-------------VRKEINYMFNG.DD...AG.....------.......
A7MP72_CROS8/125-401LLDSGID..MN.GY...LAAR....IAQRL-------------GRGEAAQIVNG.DG...TGK..NV------KGLAKW.
A0JQM6_LACS1/116-372LNGTDTN..LV.EH...VNAQ....LQAGL-------------ARKEKKVAFAETAK...PGE....------.......
A4EPK1_9RHOB/132-412LEDAPR...LN.NR...LGKK....AAGAI-------------AWKKNQAIIDG......TGAG.QP------LGWM...
A3XTC6_9VIBR/12-299LKDAKID..LINSTFEQVGKM....TAIKI-------------SQNLVNDADFGIASYCIDRANSFA------KGLVPDA
Q3JTL8_BURP1/144-412LDDAPA...LQ.SY...IDGR....ARYGL-------------QLTEEGQILKG......DGTGANI------LGIL...
A7ILP2_XANP2/167-448LEDASIN..IE.GW...LATK....ISDKF-------------ARIEASAFIVG.NG...VK...KP------RGILTY.
Q77WA0_BPHK0/112-381MDDAPM...LQ.SY...INNR....LMYGL-------------ALKEEGQLLNG......DGTGDNL------EGLN...
Q7Y5K8_9CAUD/121-389LSDAPQ...LA.SY...MNNR....LIRGL-------------KVKEDAEILRG......TGANDGL------LGLI...
B0T632_CAUSK/96-391EGDSVLD..FQQVLLASMNAG....IAEKM-------------ASELLNSTVTNAVENV.AGTTTIP------AGILNR.
Q6HR18_BACAN/82-358VNDSGID..VV.NY...AVGV....MTRRL-------------ARKLDETVLNG......DKTKKQF------EGILTS.
Q855V6_9CAUD/7-307ADESRQL.....GVLQTMADL....SGVAL-------------GRALDLIGIHGINPLTGAALSGSP------AKIL...
Q11H37_MESSB/111-386LEDSAFN..LE.SE...LAFD....AAEEF-------------GRLESVAFVAG.DG...TG...KP------KGILADT
Q88G49_PSEPK/193-483LGYSGTNPNVD.RL...VVND....LTASV-------------ALAEDLSFLRG.AG...TGN..LP------KGLRFW.
Q9MBJ9_9CAUD/128-407IEDYDF...LV.SY...INAR....LLEEL-------------AIEEERQLLLG......DGTGNNL------TGLLKR.
Q9ZXF6_BPPH1/131-394LNDSDQA..IM.TY...VAKW....FAKKS-------------VVTRNNLIL...............------.......
Q72BY4_DESVH/118-395LQDSGVD..IE.AF...IRSR....IATRV-------------ARIQNRMFTLG.TG...TG...QP------SGILKDI
A5ZPL8_9FIRM/99-375LEDSDAN..IA.DA...LIIW....IGDES-------------RVTRNRIIR...............------.......
A5ZRV5_9FIRM/125-407LQDTATN..IL.AY...LNKW....IAKKS-------------RATRNAAIL...............------.......
A6NQ27_9FIRM/74-343IRWQKLD..........LFSV....TLRQI-------------GAHINRMLLEDAIDVLINGDGNNN------A......
Q9AZM2_9CAUD/164-424ISDSSYD..WQ.AE...LQSR....LIELR-------------DNTDDSLII...............------.......
Q0FZ25_9RHIZ/128-413LDDAAVD..LD.RW...IGEE....VEQAF-------------AAQESQAFVNG.DG...VN...KP------RGFMTY.
B2JU92_BURP8/137-421LDDASA...LA.SY...LPGK....TAASI-------------RWKTDESILFG......TGAG.QP------WGVM...
Q81Z09_BACAN/121-392MSLAVFE.....TT...LINN....IVEAM-------------TKAIEQAIVSG......DGSG.KP------KGILAET
Q3SS55_NITWN/107-382LADSAGA..AE.SE...VRMA....LAEDF-------------GLKEGLSFLKG.TG...PL...QP------EGLLINA
B8I8R8_CLOCE/60-320VEDAEVE..ME.NL...VKKN....FTNIA-------------TAKENTKIL...............------.......
Q2GDU5_NEOSM/81-367LDDPSIN..VE.KW...LIEQ....AALAF-------------TQLENETFITG.DG...KN...KP------HGILQHN
Q8XLC0_CLOPE/109-375LNMSDND..LI.GY...VANV....FAKKA-------------IITENKMAI...............------.......
A4L2R1_LACRE/100-373LNDSAFD..LM.SY...ISDE....FGRRL-------------GNAEEQAFLTG.NS...TG...QP------TGILTD.
Q8W6U5_9CAUD/140-430IKYAGVNPNVD.QI...VVGD....LTAAI-------------GAREDKAFIRD.DG...TAN..TP------KGLRFW.
Q3SSD8_NITWN/135-418LDDSRVN..IE.QW...LADE....VSITF-------------AEMEGASFIIG.DG...VG...KP------RGLLSY.
A3WSQ9_9BRAD/101-392LDDSEIN..VG.QW...LEGK....IADKF-------------ARTEGKGYVTG.DG...IK...KP------RGLLTYS
Q0H261_9CAUD/146-418LQDSIIN..LD.DY...VTKK....IARAI-------------AKALDLAIVKG.TG...AANK.QP------LGII...
Q38K95_LACRE/117-373IDDSAID..LT.SL...VATN....ANEQK-------------INTTNFAIA...............------.......
Q0SPK4_9VIRU/118-397LKFADKS..LE.DW...IINW....FVDKV-------------RITRNAEILYG.AG...GD.....------.......
A7DYB2_9CAUD/103-361LDDTDQN..FY.SY...LVDL....FAKKM-------------AVAEATAFYN..............------.......
Q9AZY5_9CAUD/140-394IDDASYD..VT.GL...IADE....IQDQS-------------LNTKNADIA...............------.......
A6VNQ3_ACTSZ/129-407LQDSAIN..IE.AY...LADR....IAQRI-------------GRAEAKYLIQG.TG...AGTPAQP------KGLAAS.
B1JZG6_BURCC/143-413IQQSSPD..IN.GL...VRDD....LSAVM-------------GEALDSALLSG.DG...Q.K..QP------LGLLNM.
Q857K6_BPMB2/17-320LNPL........NYLNTMRTK....IAEAI-------------ALKFDAAAIHG......IDKPSAF------KGYLAE.
A5N291_CLOK5/33-297VTDMNFN..LE.KY...LMGD....FAKRF-------------GKAEENALLNG.NG...TT...QP------TGILT..
Q5WID4_BACSK/129-404LDDSFLN..FT.RE...IIDW....LSESA-------------LTTENDEIFYG......KGDE.NV------EGLLT..
A4EKP0_9RHOB/156-445LRHSTAA..VA.AL...IRDD....MLQVM-------------RLREDLGFMRD.AG...AAN..TP------FGLRFW.
A4XZF1_PSEMY/131-410LQDSAID..LE.AH...INQR....LTERL-------------GRITNRMFTTG.TG...TN...QP------HGVVTGA
Q5HBR1_EHRRW/126-404LEDSSID..MG.KW...LIDH....LIDAF-------------SRTENAAFISG.DG...NG...KP------KGIISYT
Q2N5Z6_ERYLH/94-380LDDAGFD..LE.AW...LASE....IAMEF-------------ARAEGAAFVNG.SG...ID...QP------DGFLTVP
A1KTF7_NEIMF/343-623ILQSSLS..AE.QF...ARSE....LLKAM-------------MLGIDLAAING.KG...TGN..EP------TGILNT.
A7KUP9_9CAUD/79-375ISDSQWD..LM.SM...MIKQ....AGRAM-------------GRHKEQKAYHQFRS...HGHTVFD------N..YS..
Q9L8M6_HAEIF/114-400LDFSSID..VL.GW...LTDE....ITESF-------------TETEETDLTGG.DG...TK...KS------KGFLSYE
A8GXG9_RICB8/224-495LDDATIK..IE.TW...LSER....LRDSF-------------VKAENEAFING.DG...VK...KS------RGILSPD
Q8SBP8_9CAUD/122-380LEDSEIN..FL.EF...VNEE....FAEFA-------------VNTENAEIV...............------.......
A7A701_BIFAD/6-292ADEDAKL.....EIISKIQAD....QAAAM-------------GRVLDYVIYHAFDPKNKTTL....------.......
Q81X81_BACAN/7-286VNNTAID..IE.EY...LKQV....FTQRI-------------LDEIENQMISTG.....TTDGTEP------KNIQ...
Q2GJL3_ANAPZ/114-389LEDTCID..LE.RW...LMNN....LVDAF-------------SRKENQAFISG.SG...AS...QP------TGILSYD
A3XTC7_9VIBR/76-390LLDSVRD..........VEGDCLRLISEER-------------GFHFISQLLFG......DGTDNNL------RGLLTSR
A9W2M6_METEP/135-420LDDAVLD..ID.AW...LAEE....VEAAF-------------AEQESVAFVTG.NG...VG...RP------KGFLSY.
A7GEE5_CLOBL/122-400LEFAGEG..LK.NF...IIEW....LVDKV-------------RFTKNIKVLYG.TG...GE.....------.......
A3UK25_9RHOB/114-399LDDALVD..LE.QW...LAEE....VRDVF-------------AEAEGRAFVLG.DG...VN...KP------RGFLDY.
A9BYD9_DELAS/120-394LSDVPM...LQ.SY...IDGR....LRYGL-------------KLKEELQLLKG......SGVGLNM------DGIY...
Q892H0_CLOTE/99-365LKDNDQA..IR.GA...LIKW....IGDES-------------RVTRNKLIL...............------.......
Q5ZGF6_9CAUD/117-376ANNLPF...LT.SF...IPNA....LRRDY-------------AKAENAAF................------.......
Q5Z3V6_NOCFA/148-434LADVAA...LE.GL...INDE....LRADV-------------AEAEEGQILNG......DGSGENF------TGINNWS
Q6R4V3_9CAUD/365-630RKQSSIH..VE.NL...IRED....LIEGI-------------GVALDLAMLTG.TG...LAN..DP------VGLLNM.
A6XMJ6_9CAUD/157-445LEDSDLN..LA.DE...ILDA....IGQAI-------------GFALDKAILYG......TGTK.MP------VGIVTRL
A5CD71_ORITB/88-365LDDSNIN..IE.NW...LIER....LEDSF-------------ANAENKSFILG.NG...IS...QP------HGILYNP
A8FGQ6_BACP2/20-302IENNIEKDGIQ.QT...IMQM....LAERA-------------AVDIEELIVNGDTTSS.DPFLAQM------DGVR...
Q3Y1P7_ENTFC/243-499VEDSAVN..IV.QE...VKDQ....LAKLV-------------ENTDNKHIM...............------.......
A1EAE9_9CAUD/18-293LNYTWKK..FF.ED...MKPQ....IVEAF-------------YKKIDEAGLLGH.D...TPFA...------.......
A3PHD9_RHOS1/126-396LDDFRQ...LQ.SM...IDAE....MRYGL-------------KYVEEQEILFG......AGGAGNI------EGIV...
Q3J3W7_RHOS4/148-418LEDNAYN..LE.GE...LMAD....FAESF-------------GRAESAAFVNG.DG...VG...KP------KGIMAA.
Q857Z9_9CAUD/161-490LRDAPE...LF.NF...VQGR....LLEGI-------------QRKEEVQLLAGGGYPGVNGLLQRS------TGFTASS
A6F0K0_9ALTE/127-405LNDSGIN..IQ.AF...LAGR....IGQRL-------------GRGEARYLVQG.TG...AGTPEQP------SGLETS.
A1TD88_MYCVP/110-388QHDAAG...LA.DD...IAKM....IAFEK-------------DVKESIAFATG......SGVG.QP------RGVITAL
B4SNH6_STRM5/129-412LDDAEID..LE.AW...LAGE....VELEF-------------AKQEGDAFFSG.NG...VN...KP------FGILTYV
A6BER6_9FIRM/23-314LDDSDYD..IW.GE...VKPR....VTEAF-------------GTKIDGAALFGV.D...KPSTWRD------D......
A5VJB3_LACRD/236-497VDDSEVD..IV.SE...VKNQ....LQKLV-------------DNTDNAEII...............------.......
Q5L2L4_GEOKA/120-373LNGSDSN..LV.MH...VERA....LQSGV-------------AAKEKKVAFATTPK...TGE....------.......
Q0AG17_NITEC/123-405LQDSAVD..IQ.AF...ISRR....LGERL-------------ARVLNTYFTTG.TG...TN...QP------KGVVTAA
A9CJN8_AGRT5/134-419LDDAAVD..IE.AW...IASE....VDIAF-------------AEQEAAAFIAG.DG...VN...KP------KGFLSY.
A3DG61_CLOTH/127-416LQDTTA...LE.AI...VRQA....YADEM-------------SFKIDDAIING......TGVG.MP------LGIL...
A4TCV1_MYCGI/152-412FKDNDT...LE.QF...IADE....LLYGL-------------EKAVEAMALADI.....DGTSG..------.......
A3WWM5_9BRAD/96-387LDDSSID..IG.AW...LVDK....CGKKF-------------TRMETSAFFNG.DG...VL...RP------RGFLTYP
Q2SDM1_HAHCH/110-393LDDVYFN..VE.QW...IADE....VAQEF-------------VDREADAFLNG.DG...VG...KP------KGILAYA
Q5J5U0_9CAUD/24-332MNPSGLY.....TK...LQAD....LAYAI-------------GRGIDLAVFHG.............------.......
B3XQ47_LACRE/128-385LLGTDTG..LV.QY...VNDC....LASAL-------------QLKERNMSLGTSNP...TGL....------.......
B3XLQ0_LACRE/117-374IDDSAID..LT.GL...VARN....AKEQS-------------LNTKNAAIA...............------.......
A6C3V3_9PLAN/122-410INDNGMA..LE.SY...VNKK....VTEEM-------------EFMLGDSIFNG......NGVG.KP------LGVM...
A6XRQ5_VIBCL/392-657IMQSSND..VE.ML...ARGD....IAKAL-------------ALTIDKAALYG.TG...G.D..QP------LGLAGI.
A6U954_SINMW/144-422LEDSAFD..ME.AE...IRLE....AGEQF-------------AVAEGAAVVSG.DG...NG...KP------EGWMTA.
A7GI70_CLOBL/117-372LRGTNTN..LV.QT...VDAA....LESGI-------------AAKEKKVAFTKTPK...SGE....------.......
A3WZW4_9BRAD/137-425LDDSMFN..IE.SW...LADK....TADKF-------------ARTENAAFLNG.TG...VG...QP------RGLLTYP
Q8LTC0_9CAUD/142-396IDDSAID..LV.GL...IAQN....GQQIK-------------VNTTNGAVA...............------.......
Q9T1F6_9CAUD/115-380LKDTVDN..II.QW...LVNW....AAKKD-------------VVTRNAKIL...............------.......
A5LFN8_STRPN/129-383IDDADYD..VM.GL...VAKQ....TKNQE-------------RITKNKEIA...............------.......
Q5Z394_NOCFA/119-388LEDSDA...LE.LF...VADE....LLFGL-------------RQAIEAQVIAG......DGTGENM------TGLVNVS
A6FF94_9GAMM/101-399MVGTDIN..LW.SD...LMYE....IQIVE-------------NEYLEKSILFGDGSD..TGSKRSM------RGILSS.
B2JL19_BURP8/113-379LDDVAQ...LQ.SY...INMR....MTYGL-------------RMKEDKELLTG......DGATGHI------AGLI...
A6M951_9VIRU/99-368LNDSTEA..IV.NT...LVRW....IGDES-------------RVTRNGLII...............------.......

PF05125

VPN_BPP2/6-342LDLWAR.--YQ-DFQLRIRNA----IIKRQ-------------SLDFIMAGFNGVKRAETSDRSSNPMLQDVAVGWLQKY
VPN_BPHP1/3-330FDSFAIF--KD-RLVELYSEY----FQNQV-------------ALDILQIGWNGQSVADNTTKAD...LSDVNKGWLKLL
O80304_BP186/6-342LDLWAR.--FQ-DFQRRIRDA----IVQRQ-------------ALDFIMAGFNGTTRADTSDRVKNPMLQDVAVGWLQKY
Q48277_HAESO/6-337LDMWAK.--FP-DFAKRIGTL----KAERM-------------ALDRIMIGFNGTSRAATSNRATNPLLQDVAVGWLKKI
Q9ZXM3_9CAUD/6-336LDAWAK.--FP-EFQALLRDA----ILKRQ-------------ALDRLMIGFNGTSAAATTNRAANPLLQDVNIGWFQQY

PF09950

A3M3U3_ACIBT/79-324-------------------TGVTIV-------TAQHN.......W......A--------------TATIEEVLSDFNAS
A6UAP6_SINMW/63-317-------------------SMPTAT-------TAPADGASSATTF......A--------------SKTPDQILRDINGQ
Q9P9P2_XYLFA/83-327-------------------PGVPVL-------LNTAGP......W......I--------------GQSPAQVLALFNQL
Q0T6M7_SHIF8/67-313-------------------DGVPVN-------NAAKT.......W......A--------------TSTPDEIRASINQV
A7ILG8_XANP2/97-352-------------------ASVTNV-------SNVAAGASSSMAW......T--------------SKTADEIRKDVNEL
A3L742_PSEAI/62-309-------------------PGVTAG-------SAVTGN......W......E--------------TATADQILADVNTA
A9ABK3_BURM1/97-345-------------------SAVENV-------SNAQTGN.....W......V--------------SATPDQMLDDVNEL
Q7N327_PHOLL/60-317-------------------SKVQLI-------AEVTGKS....I.......K--------------DMSAEEFINMVLNA
A5PIZ3_9CAUD/86-326-------------------PNLTTI-------NSAG........WNN.AAGT--------------GKKPETAQDELEQA
Q2G4R3_NOVAD/110-363-------------------GSAPSA-------QVAADGTGSSRLW......A--------------DKTPDLILRDINAA
Q2NRY5_SODGM/71-317-------------------ASVKRS-------KAGKP.......W......K--------------QSTADEIRAAIDAG
Q2NSP7_SODGM/16-248-------------------PFTTIE-------DSVGT...............--------------....KTALAKITSF
A4N6E6_HAEIF/55-278-------------------KSVEVY-------NIKGTAANT.KV.......Q--------------AMDFDKSVAFFKEI
Q333F7_9CAUD/77-311-------------------PNINNV-------VATPN.......W.......--------------.SVPQNAIDDVTAM
A5UGK3_HAEIG/78-315-------------------PNLGET-------SVTGG.......W......K--------------TATADAVLADLDNL
Q0BRS5_GRABC/65-316-------------------PAVTAG-------TV.ANGASGNPDW......A--------------HKTVDEIIDDVNAA
B0UJ01_METS4/61-314-------------------PAVTTG-------LAAATGEGGATAF......A--------------RKTPEQILADVNGQ
Q6XQD3_BPT1/81-319-------------------PNITKI-------TSGK........WI...DVS--------------TMKPETAEAELTQA
A6TKD0_ALKMQ/59-304-------------------TGIQTM-------PVALNAGETSTKW......K--------------DKTSEEIIEDIRLA
Q835B4_ENTFA/56-293-------------------EGIQVI-------NSPKK.......W......K--------------EMTSEEIVEQLRTS
Q45PZ1_9CAUD/59-293-------------------PNINNV-------VSGGS.......W.......--------------.SQPTTAVSDITSL
A2WAD9_9BURK/103-363-------------------GAVGSV-------SNVANGAAGTPQW......E--------------TKTPSEILKDVNEI
Q46YM7_CUPPJ/97-345-------------------TLVTNV-------SNAATGN.....W......A--------------TATPDQILADVNEL
A9C0G0_DELAS/59-320-------------------NGVVVA-------NAPADGTGGSTLWVNAAGVG--------------QKTPAQIVRDINIA
Q984H1_RHILO/85-339-------------------STPTAT-------QAPADGTGSARTF......A--------------SKTADQVLRDVNTQ
A8ATG6_9CAUD/56-301-------------------TGIQID-------VSPTTGVGNVSKW......E--------------KKTAEQIIDEIGEA

PF04454

C9RYB7_GEOSY/5-265-------------------KGKIAH-------IRSDWMK------------S--------------GNAFTDVVEARNKL
D4H156_DENA2/1-251-------------------AAKNRI-------NMT..LD------------K--------------DNLVDAISEAQGRM
D2Z797_9BACT/1-250-------------------SENGAV-------KVS..SD------------D--------------DGAIQAIADAVMTL
C8WPL7_EGGLE/1-257-------------------KGSSKI-------KKSDWSQ------------G--------------ENSFADITAGVAQL
D0LZ74_HALO1/1-251-------------------TPHEAL-------AVA...S------------V--------------SDFPRAVLSAADTL
D1B7I4_THEAS/1-249-------------------AGYTAE-------LSV..SK------------S--------------KDMIMGIAKGVRTM
A0KD92_BURCH/1-251-------------------TSNRRL-------TLP..AD------------V--------------GAYPDAISDALEAL
A0PLA3_MYCUA/1-251-------------------SSNPPL-------TLP..ED------------P--------------REIPDVITQALSEL
A1B987_PARDP/1-251-------------------TSNPIV-------ALP..AN------------V--------------ADYPEAVASAVSEL
A3DFK3_CLOTH/1-257-------------------DGIVKF-------PISNWSE------------G--------------ENPFKDISIGLAKF
A4WHF5_PYRAR/156-358-------------------PKVKTM-------GITSWDA------------P--------------GSAVAEVSNAVNLL
MARIT_THEP1/1-251-------------------.EERKI-------ECG..ST------------P--------------KDLLEAIVRALSIF
A6TWC5_ALKMQ/1-250-------------------SSHKLS-------QFG..NN------------G--------------EEIMENLAQGMILL
A7HIB4_ANADF/2-255-------------------EGAVEL-------PAGDWSD------------P--------------ARVADDLLGALAKL
A7I7A2_METB6/2-249-------------------EGAGSL-------TLSKWDK------------V--------------GAAADQIIDAVTKL
A8F8I8_THELT/3-247-------------------PGTISM-------ELSDWKN------------V--------------GQAASDVIEAVTKL
A8L1F1_FRASN/1-253-------------------SSHPVL-------ELG..AD------------T--------------DSYPRTVAKAVALL
A8UW07_9AQUI/3-269-------------------EGVNSM-------SMSDWSK------------V--------------GNAFSDVIEGISKL
A9BEM3_PETMO/1-251-------------------AKQNSV-------ESSK.ES------------L--------------KDFVKSLFEVKKRF
A9FWS5_SORC5/3-254-------------------APHKPV-------VIP...A------------P--------------EAWPRAVAEAREVL
A9H5P1_GLUDA/1-251-------------------TSNPKL-------ALP..SS------------A--------------SDYPAAIAAALNQL
B1CAJ4_9FIRM/1-257-------------------EGTFGI-------KRGNWKE------------N--------------EDAFKDVAHGIAYL
B1L4G8_KORCO/136-346-------------------KAGMKM-------GISSWDE------------P--------------GSAVNEVASALSKL
B1VSP7_STRGG/1-251-------------------SSHDPL-------PLP..AD------------A--------------RDYPVAVSQAVTRL
B2A6K6_NATTJ/8-259-------------------LTQDLI-------PLG..NT------------G--------------SEIMESITRGIITL
B2GID2_KOCRD/1-252-------------------SDNERL-------SLP..QD------------V--------------REFPNAVAKAKTEL
B2JNZ6_BURP8/1-251-------------------SSNTSL-------ALP..AD------------V--------------ADYPNAIGGALQQL
B2V6Y3_SULSY/1-265-------------------EGKNSI-------SISDWNQ------------T--------------GEAFKDILNAIVKL
B4UA40_HYDS0/1-265-------------------EGRSII-------KNKNFDE------------E--------------GGIFKTALACVETL
B4UI59_ANASK/1-259-------------------PGLVEV-------PAGDWAD------------P--------------ARAADALLAALAAL
B8CYH7_HALOH/1-249-------------------SGQTLD-------.....TP------------A--------------TGLISSVAEGINNL
B8D495_DESK1/120-343-------------------NDVSRS-------KLSDWRT------------E--------------DAPVIDVVNAVNKL
B8EQK3_METSB/1-251-------------------TSNPIM-------TLP..AD------------V--------------RDYPDAIAHALSQL
B8GHL2_METPE/5-250-------------------GGSQSV-------KLASWEK------------I--------------GAAADDLIKAVTAL
B9JHD1_AGRRK/1-251-------------------SSNPIL-------PLP..SN------------V--------------RGYPDAIAKAVSQL
B9MNM0_ANATD/1-251-------------------TGTNRL-------KKGNWNE------------G--------------ETAYSEIVKGIELL
B9YCJ8_9FIRM/1-256-------------------EGAVHC-------ARGDWSQ------------S--------------ENAFADIAKGLNEL
C0R0J8_BRAHW/1-256-------------------EGAQKL-------QISDWGQ------------G--------------ENPYTDIVKAINMI
C0ZHN4_BREBN/1-265-------------------KGRLTH-------LKSDWME------------S--------------GNAFADIVEARNKL
C0ZVK4_RHOE4/1-251-------------------GSNPEL-------KLP..ID------------A--------------KDYPEAISQAITSL
C1B1V8_RHOOB/4-254-------------------SDNPVL-------SLP..ED------------P--------------LLIPDAVASALSAL
C1DV98_SULAA/1-265-------------------KGRNIC-------KIKDWSK------------E--------------GEAFSNILEAVVKL
D5UVK7_TSUPD/1-251-------------------AAGSDL-------KLP..DD------------P--------------RDIPDVVSQALSDL
C3MM35_SULIL/96-329-------------------KMGSQI-------TASDWNI------------S--------------GNILLDVLKAYENL
C4XPM7_DESMR/1-251-------------------SSQTRL-------QVS..SN------------P--------------EDIAEKVSKALTAL
C5B5H8_METEA/1-251-------------------SSNAAV-------PLP..AT------------L--------------DDYPEAVARALNDL
O67639_AQUAE/1-267-------------------KGTLRE-------ELSDWEK------------V--------------GNAFQDVVKGISRL
Q08WR7_STIAD/2-266-------------------TDRLTV-------PLGDWAT------------P--------------GAGYVAIVEATRKL
Q0RH88_FRAAA/1-253-------------------SSHPQL-------TLE..AG------------T--------------DTYPRTVAKAVALL
Q1K2C9_DESAC/1-251-------------------VKGEEI-------DLS..LD------------M--------------DVIVDAVSEGQTRM
Q2RVS0_RHORT/1-258-------------------SAEHAL-------DLP..AD------------L--------------ADFPGVLVRALAVL
Q401P1_9EURY/136-332-------------------EGIKKM-------KLSSWDN------------P--------------EEALNDLMNALQEA
LIN18_BRELN/1-252-------------------SSNAAV-------AIP..DA------------V--------------EDFADAVAQALSVL
Q4JC29_SULAC/153-340-------------------ERGRKE-------KASDWDI------------P--------------GSIANDVIRGIQIL
Q5YPL3_NOCFA/1-252-------------------GSNAPI-------TVP..DD------------A--------------RLVPEAITQALTAL
Q7MSM9_WOLSU/1-252-------------------IPHKPI-------K....AK------------G--------------DEILPAVAEGIKEL
Q835B4_ENTFA/4-243-------------------EGIQVI-------NSPK.KW------------K--------------EMTSEEIVEQLRTS
Q972Z8_SULTO/108-304-------------------QRSKKM-------NRSDWNI------------P--------------GNIVNDIVRAYEQV
Q97V86_SULSO/96-329-------------------KIGLKI-------TGSDWNV------------A--------------GNILLDVLRAYENL

PF11651

B7KXS0_METC4/1-419-------------------TRMNNG-------SVPKD.NRFCML-------S--------------PDDEAGLADSQTKF
Q3RBQ2_XYLFA/1-408-------------------STLDRH-------LAPEE.DRCAHF-------S--------------TEANDALAEANAAL
A5VES4_SPHWW/1-413-------------------QRLDEQ-------GVMSD.GRTAIL-------S--------------PADQWGMLGSQTNL
Q57SP8_SALCH/1-428-------------------RLMFSR-------ELNRDMGISYFL-------N--------------PDDYRKAGRNLVDG
B2U8F8_RALPJ/1-419-------------------ARLNKL-------SAPG..NRKIVL-------D--------------PITEARMVGSLAGL
Q1R947_ECOUT/1-416-------------------ATMTAI-------GVPQGINRRSFW-------N--------------PFNYKDLAGELGHR
A4E782_9ACTN/1-291-------------------KFLVDA-------KAPST.ERRFVY-------G--------------SQAEADLLNTEAFT
A4JD31_BURVG/1-395-------------------AALDQA-------LAPRM.DRKIIL-------D--------------PLTQARTVGTLAGL
Q2G3Y7_NOVAD/1-418-------------------SRLTRI-------GVPTD.GRMAFY-------S--------------PTNMNAMAGNLAGR
Q3RHM5_XYLFA/1-409-------------------SVLDNH-------LAPEA.DRCAHF-------S--------------TDANDALAETNVTL
Q9AYZ7_BPHK6/1-421-------------------SFLKDL-------GVNEG.ENYAVM-------D--------------PWSAQRLADAQTGL
Q5YSR9_NOCFA/1-303-------------------RQLDIK-------NVPSM.GRHAVV-------G--------------PTARAKWLNSDLLK
B5NXL6_SALET/1-427-------------------EIMFSR-------ELNRDMGTSYFF-------N--------------PQDYKKAGYDLTKR

PF06673

Q9MCB6_9VIRU/1-347VMSEMVNRVIQKVEHNMILGSADGS----NGFYGLKTATDGWTKQIEYTDLF--------------DGIT---DAVAECS
Q9MCB8_9VIRU/1-347VMSEMVNRVIQKVEYNMILGSVDGS----NGFYGLKTATDGWTKQIEYTDLF--------------EGIT---DAVAECS

PF05065

A5IR70_STAA9/36-312.........................----...KSIAQSIEKTNKVIKGDFTQ..............DNII....DLEALL
E0THR4_PARBH/115-394.STAPDDTRAAD......ELGTTPS----...SGATID.............A..............DDLI....DLIY.T
A5MBG7_STRPN/137-417...................IKSIAE----ETLDQLFDTQEISVDGEFDSTVL..............ETLVKGIDKLAANT
B1J5N2_PSEPW/144-414...................PQATAF----...NEALRKAG...DTKI...................DTLRRAILQVRVAE
Q1GG15_SILST/131-399...................TNATAY----...SAAFAPAS...ETAI...................DKMRLAMLQAALAE
Q3HL14_9CAUD/114-381...................GVIE..----...KLTK.......QAIKS...L..............DDIK....DVLNVK
Q1DCZ9_MYXXD/94-361.......................LD----...AAHTFA....STGTTAAAYL..............SDVD....KAVELP
Q3R2V6_XYLFA/355-623...................SGINAV----...SFAQKG....Q......PSF..............AELV....QMET.Q
Q7Y4I4_9CAUD/8-297.........................----...RTKQASTIIGDNCFDKKV................TQTVPFKDTNPDES
Q6GAL1_STAAS/126-378...................EHMSFY----...NGS.......VKEVEGADMY..............DAII.....NALAD
B0K6S2_THEPX/124-397.......................TG----...GAQLGV....TAGSATAITA..............DEII....DLVY.S
Q1CQW9_STRPC/140-392...................KVLK..----...TFEP.......KADVK..TL..............DEIK....KILNVD
Q0AAI8_ALHEH/83-374.DTVPDGDFEWGADPADYTIGAIYT----...GESGDF........PSNNPD..............NVLY....DVVD.A
A4WC36_ENT38/128-406..................VTGTVNT----...AAAAAF............TW..............QEMN....KLKH.A
Q3EL79_BACTI/115-382...................QEIN..----...KLTK.......VDLKD...Y..............KGIK....TALNVT
Q139N4_RHOPS/143-428.PTVANAAWSWG......NLGFVAT----...GAAGAF........PASNPS..............DVLI....DLMF.A
A5F9J3_CLOK5/135-393...................TDMSFY----...KKNEAGTDYLITKKTGSTMY..............EAIM.....AALAD
Q6G7X2_STAAS/129-401...................GKKLEV----...KKAKSL............................DDIK....DAINLN
A0AI11_LISW6/136-390...................EVLK..----...TFTA.......KTVAN...T..............DDIK....QILNVT
Q3J4R6_RHOS4/160-429...................TNASAY----...SGVYEPAG...ATAI...................DKLRFALLEASLAL
A5VKJ7_LACRD/107-373...................EAMG..----...KPAK......KPTIAS...F..............DDIK....DLENNT
Q92CB8_LISIN/19-306...................KLATSH----...LVNNSS............................GEISRTAFKNAKKI
A5KJS3_9FIRM/124-396.......................TG----...GAETGV....TAAN.TTITF..............DDVM....DLYY.S
A1VBS2_DESVV/113-404QAATADGTRAFG......TLQFLIT----...GVAGGF....KSPSTTVHPA..............DDLV....DLIY.A
A1T829_MYCVP/9-278...................TGVQEV----...DAGSV.............................LNLD.........S
Q982R8_RHILO/176-465.PTVANANYSWG......NVGYVVT----...GAASDF....LAPTSTVSPA..............DALL....DLLY.G
Q5HTE1_CAMJR/118-386..................AKKAFTL----...ASNQGI............TS..............NDII....DAFF.S
A1AYY2_PARDP/166-435...................TAATAF----...VPAFAVAG...ETMI...................DTLRLALLQASLAE
Q7WLQ0_BORBR/118-390...................TQAIAY----...ANPGVVVQG..ETRL...................DRLRIAMLQVTLAE
A3LM59_PSEAI/122-402...................TQATTY----...DTALNKAG...DTSI...................DIVRRGIYQVRKQS
Q8X755_ECO57/100-380RAEKNDKERDFG......TLQVIKP----...SESLAW...........TSA..............DPLI....DLKF.A
Q1ILS6_KORVE/495-776...................SGVGTE----...AIATDG....GA.....ITY..............SIIT....KAQE.D
B8FNY7_DESHD/107-369...................NIVEAN----...SVE........FEATD...Y..............KGIV....KCLNTK
Q1GH34_SILST/388-661...................SGVNVV----...DFGGAA....SGGGSALPTW..............AEVI....QMES.E
Q2GAM7_NOVAD/185-459...................TQATAF----...AAPITPTAAGMMTKI...................DIIRLAILQAALAE
Q8XYS4_RALSO/130-408..................VTLTKST----...ANAAKL............TW..............QEVN....TLIH.A
Q3J3K4_RHOS4/110-395.AKVANASWSWG......SIGYVPS----...GAASDF........LATNPA..............DCII....TLIY.S
Q1NB79_9SPHN/81-368TTNEGDGVRAFG......SLQYVAS----...GAAGGF........AASNPQ..............DRLI....DLIQ.S
Q5PB65_ANAMM/103-375DGKDE......G......QIERVSA----....K..QL...........N.S..............DAII....SLYY.S
Q1QLS4_NITHX/103-379..................GVAYTAT----...GNASTL.........GTAPA..............DTLI....DVFY.S
Q65ES7_BACLD/133-400...................NQLG..----...TLAK.......TTVSK...Q..............DDIK....DILNVK
Q8ED08_SHEON/122-393...................LQASAY----...VKPTGATVDT.EQHI...................DRIRLALLQAALAE
Q813J9_BACCR/150-424...........NINDGALAKKAVEF----...KTD............EKNLY..............DALV....KMKNTP
Q3J5Z4_RHOS4/150-439...MLPANWS.........AAPVAA----...TPA..............AAE..............AAIR....RAVS.L
Q3F193_BACTI/24-317...................AGTDGH----...PTGRGF....DGELNGTLSA..............EDII....DMAVSI
A1B638_PARDP/102-387.AKAPNGSATNV......QIGTIPS----...GGTGDF........AATNPA..............NALI....DLVY.A
A5WQQ4_MYCTF/196-475...................ALTGTA----DYTVTGAGT............................EAVVAADVYALQSA
Q1R877_ECOUT/115-398STDETDKVRAFG......KLQHIVS----...GEATAV............TA..............DAII....KLIY.T
A4IS66_GEOTN/24-302...................KKAANL----VQGDTDFDA............................KDVE.AMFDAMIQA
Q17ZS7_CLOD6/178-435.........................----...TGINKV....NESLISTSKY..............NGLV....K....G
Q854Z2_9CAUD/258-539...................AGTAAE----...IAPVTA............................ETFALADVYAVYEQ
Q9AZS7_9CAUD/124-390...................EVMK..----...AAPK......KPTIAK...F..............DDVI....TMINTA
Q0AWY3_SYNWW/43-310.......................SG----...GAEVGV....TT...NAITY..............EDVV....KLFF.S
A4YU30_BRASO/140-423....................ASPAL----...VTAPAE....GGQSAGTIVT..............ANIL.........K
Q1B5C3_MYCSS/9-280...................IGTAQS----...VAGGAY............................TNLD.........A
Q2NV28_SODGM/127-397...................TQATAF----...KAELKPAH...RTAI...................DDLRLAMLQAQLAR
Q1B7W7_MYCSS/9-278...................TGVQTG----...TLDVAD............................ADSLLDAIALASAA
A3T0Y2_9RHOB/165-433...................SVAASF----...VAPGGLPN...ETRI...................DRLRLGLLQIALSN
Q1GHS2_SILST/113-395.PTVDNGSWSWG......NIGYVAT----...GSDGGI...........GSA..............DAIV....DLVY.A
Q2L2B0_BORA1/123-401..................AVVGKQT----...ASAATF............TW..............KEVN....GLIH.S
A2SD63_METPP/97-385IAATADATRPWG......TLQYLPT----...GTDGAF........NSTTKT..............DVLV....DTVA.A
Q3J223_RHOS4/110-368...................TAGIEL----...SGASVT............................PELIIDLAYKVKTV
A5TX36_FUSNP/106-365...................DILK.T----...LTP........KTIAD...Y..............TGIN....TALNVD
A1TML8_ACIAC/138-428...ALAANKV.........AAPAAP----...TLA..............QAD..............AFLS....GLML.R
Q3DFH6_STRAG/127-397.........................----....ADVEG....PTTTTKDITF..............DDMI....ELYH.S
Q637B0_BACCZ/101-383...................AAATAI----...DSETDL....EISAIDASTL..............DEII....YSYGGD
Q14M91_SPICI/321-590...................TSIKSV----................KIKELNY..............DAII....EMIK.S
Q1QKG8_NITHX/112-388..................DVAATTT----...GNAATL.........GTNPA..............DLLI....DHMY.S
A3KA53_9RHOB/140-434VGTSFATSNILT......FTDATAP----...TIQ..............QVD..............NDLG....SLEL.A
A5M4C8_STRPN/8-299.........................----...KSMTDATFRATNSFDGVIS...............GSVVTYDETKIDEN
Q0S2A4_RHOSR/9-273...................SGVQVV----...DTGAGW............................TTLD.........Y
A3X0R0_9BRAD/133-422.DKVANASHAWG......KIGFVAS----...GKADGF....LAPTASVSPA..............DALI....DLYY.A
Q6LSF8_PHOPR/134-417A.................LGKKGKT----...GQTALV............TY..............EDLV....SLEH.S
A5N1H4_CLOK5/152-424...................TALGGT----GLEAHNVTS............................DGTLKNIVSHMSVI
Q859C1_9CAUD/118-386.......................AS----...PATATF....LATDTDSKVS..............DALI....DLFH.E
A3W815_9RHOB/115-386..................DIDEFVN----...GSTTAV............SA..............DNMI....KLMY.S
Q6J1Y2_9CAUD/119-381...................PVLQ..----...SFTA.......KATTTDTLV..............DSLK....HILNVD
A7HRJ6_PARL1/148-433.DMVAENAWEWG......KLGFIAT----...GNAGGF........PTSNPA..............DKLI....DLVY.A
A4WS92_RHOS5/111-382..................GIAHTVS----...GAAAGI............TA..............DALV....KLLY.A
Q9XJ79_9CAUD/117-382...................EAIG..----...TLPN......KPTLAK...W..............DDII....DL.QAK
Q2YMS9_BRUA2/137-422.ETVADDAWAWG......KIGHVAT----...GVAGAL........PPEDPS..............DKLI....ELIY.T
A3SMP9_9RHOB/146-433...CLAPNWK.........VE.TAK----...TAD..............AVE..............ALIN....SLVN.L
Q73HT5_WOLPM/107-395NGNSY......N......KIEQVKT----....E..KL...........D.S..............DSIM....MLYY.S
B1ZCX2_METPB/163-460...................SGVGVV----THTFADPKA............................PTLKELDAAASKLI
Q9A4P7_CAUCR/53-338.TAAPDASYTWG......QVGYLAT----...GVAGGW........TASNPT..............DRLI....DLIY.A
Q3Z7J9_DEHE1/124-397.......................VA----...ATTGAT....TEINNATVSF..............DDIM....DVFH.S
Q9B0A7_BPMB1/19-303.........................----...SNKTQSISPNAYQGLGVSGL..............TKLV..........
Q6UAX6_9CAUD/134-425...ATQWNRLLP......WAADAAV----...NLD..............TID..............TYLD....SIIL.M
A6VBQ1_PSEA7/140-406...................AGIQTA----...NLAT.............LTW..............ANVL....GMLE.K
A7B3D6_RUMGN/128-405...................SRVTAV----...ITLTPE............................EYASWNGWHKVKGK
Q12EX8_POLSJ/63-302...................AYGAPA----...IAASGT....DAAAFKADIA..............NALEAFTGSLVN..
Q830G6_ENTFA/163-444...........NENPGALAKKAVAF----...EKPVDL....TAAGAGQKLY..............DALI....EFKNTP
A7MP72_CROS8/125-401..................VTKTTSA----...AAADAF............TW..............EELL....ALKH.S
A0JQM6_LACS1/116-372...................EEMSFY----...STQNN.....IKKVSGSTLF..............DAIT.....QAAGD
A4EPK1_9RHOB/132-412....................KSKAL----...IKIAKE....DGQGAKSVTP..............KNIV.........K
A3XTC6_9VIBR/12-299TRD................DDIFSV----...SKSGVSGSWGTDTTAKVQFL..............GSLI........AS
Q3JTL8_BURP1/144-412...................PQASAF----...MPSITLAN...ATPI...................DKIRLALLQAVLAE
A7ILP2_XANP2/167-448.PAAPAGTYARG......KILQVNS----...GHATNI............TA..............DGLV....NMTF.S
Q77WA0_BPHK0/112-381...................KVATAY----...DTSLNATG...DTRA...................DIIAHAIYQVTESE
Q7Y5K8_9CAUD/121-389...................PQATTY----...AAPTTIAG...ATRV...................DQLRLAMLQASLAE
B0T632_CAUSK/96-391...................VTEVAA----DRFTGSIGKTPCLTTAGINLVTF..............EDMI.....KLYNS
Q6HR18_BACAN/82-358...................TVAEVV----...GTHEAG..........KISL..............DNLLDMTLAVHPDH
Q855V6_9CAUD/7-307.........................----...DTTNI.............................VELTTGTSATPDLA
Q11H37_MESSB/111-386..................GIATVVS----...GNASTL.........GTAPA..............DKLI....DLLY.K
Q88G49_PSEPK/193-483...APAFNVF.........AAPAAV----...TLE..............AVE..............FALS....ALIL.R
Q9MBJ9_9CAUD/128-407...................DGIQTL----AVSNKDELA............................DSIYKAMTNISLAT
Q9ZXF6_BPPH1/131-394...................AAIA..----...SLKK.......VDIDG...L..............DGIK....KALNVT
Q72BY4_DESVH/118-395S.................AGKVGAT----...GQAATV............TY..............DDLV....DLEH.S
A5ZPL8_9FIRM/99-375...................DVIK..----...EKEE.......TAIAS...L..............DDIK....KILNVT
A5ZRV5_9FIRM/125-407...................NVIN..----...TITKGK....EVAVAT...F..............DDFK....DVFNVK
A6NQ27_9FIRM/74-343.........................----...AKQYQVGTSPIGGESGTLTY..............DDLVDFWAQFDPYE
Q9AZM2_9CAUD/164-424...................TALT..----...DGIK.......KTTST.YLL..............GDLK....KVLNVT
Q0FZ25_9RHIZ/128-413.PTVAEHAWSWG......NVGSLNT----...GADGAF........AAGEAA..............DKLI....DLVY.A
B2JU92_BURP8/137-421....................KSGAL----...IVVAKD....SGQATNTLTP..............TNIS.........N
Q81Z09_BACAN/121-392PFE......................----...GQALDV............................AKINYKTLTDAEAA
Q3SS55_NITWN/107-382..................DISIVAT----...GNASTL.........GSGPA..............DMLI....DTFY.S
B8I8R8_CLOCE/60-320...................KVITDN----...ATVI.......EGAVD...Y..............TDLE....NAIDGS
Q2GDU5_NEOSM/81-367TDSTGK............QICKITS----...KEKDKI............TP..............ADIL....SLYY.G
Q8XLC0_CLOPE/109-375...................ETLG..----...KGKV......KKPLAD...H..............KALK....KSLSVD
A4L2R1_LACRE/100-373.......................TN----...GASAGS....TAAKADTLTF..............DDLI....DLFY.S
Q8W6U5_9CAUD/140-430...ALPSNVI.........TASDAS----...TLQ..............KIE..............TDLG....KVIL.A
Q3SSD8_NITWN/135-418.DTVADTSYAWG......KLGYVVS----...GVAAAM......TDSSHNGA..............DALT....DLVY.S
A3WSQ9_9BRAD/101-392TSTDKDGVRPWG......TIQHIIT----...GVDGGF....AAASTSVNGG..............DALF....NVVY.S
Q0H261_9CAUD/146-418...................PSLP..----.....PENQ....VTVEADNNLL..............KNL.VKQIGLIDTG
Q38K95_LACRE/117-373...................AVLK..----...AFTA.......KSVAG.ESV..............DDIK....HILNVD
Q0SPK4_9VIRU/118-397..................EHATGIM----...TANKFK....KITLPKSPAL..............KDFK....KCKNVE
A7DYB2_9CAUD/103-361...................IVKDVT----AKTNAKATA............................KDVVKLTTDVDLGL
Q9AZY5_9CAUD/140-394...................AVLK..----...TATA.......KSVVG...V..............DGLK....DLINKE
A6VNQ3_ACTSZ/129-407..................VTGTTTS----...KTTGKV............DW..............LDIN....ALLH.S
B1JZG6_BURCC/143-413...................VGIQTA----...SLAA.............PSW..............DGVQ....RIVE.K
Q857K6_BPMB2/17-320.........................----...TTKVVSLADTNLTTASGPQG..............NAYL.........A
A5N291_CLOK5/33-297.........................----....ADADV....TTADNSTISF..............DEII....SLYF.S
Q5WID4_BACSK/129-404.........................----.............NDKFKKIDAP..............DEVTIKFLRRVKNS
A4EKP0_9RHOB/156-445...TPVANLL.........TG.VAN----...DAA..............AVE..............TAIR....FLVS.R
A4XZF1_PSEMY/131-410A.................AGKVGAT----...GKATSV............GW..............EDLV....DLEH.S
Q5HBR1_EHRRW/126-404DDSH..............TITSTKI----...DS................................DTII....KLYY.S
Q2N5Z6_ERYLH/94-380HSTSDDQARSFG......TLQYVGT----...GDDAGF.........GSNPD..............AKLI....DLVH.T
A1KTF7_NEIMF/343-623...................AGIGAV----...EIGANG....GA.....PEW..............KHIV....ALES.A
A7KUP9_9CAUD/79-375...................TNKLAH----...TTGLDK....NGVQNDTFSA..............EDFL....DLIIAV
Q9L8M6_HAEIF/114-400RSTEADRVRAFG......KLQKLDV----...AGADKI...........T.A..............DTLI....DLFY.T
A8GXG9_RICB8/224-495HD................KIEKVKM----...GNKITT............................DNLL....DFIN.S
Q8SBP8_9CAUD/122-380...................KQAKAV----...LAE........ETIND...Y..............AGLV....KTINSL
A7A701_BIFAD/6-292...................EGFNAL----...AKSAVSVPATDDRVADIDSL..............AEAV..........
Q81X81_BACAN/7-286.........................----...KLTPGRNRTATTQEGQPLSF..............EDMVESYELFINNP
Q2GJL3_ANAPZ/114-389EGTGP......G......QIERVKV----....E..TL...........N.T..............DAII....KLFY.S
A3XTC7_9VIBR/76-390IDSANTYTEALKEDDLRDQEFLKVI----...KTGVAG....ELGSDETAIL..............DLLV.....DVQQD
A9W2M6_METEP/135-420.DTVANANWASG......RLGFIAT----...GAAGAF........PASNPS..............DVLF....DLIY.A
A7GEE5_CLOBL/122-400..................NEVQGIM----...TYKDIK....VIDLSATATI..............KDFK....KLINVE
A3UK25_9RHOB/114-399.EVAAVGSESWG......KLGFVAA----...GVSGGF........SASDPA..............DALI....DLIY.A
A9BYD9_DELAS/120-394...................TQATPY----...VNPGVVVQA..ETRI...................DRLRLALLQVELAD
Q892H0_CLOTE/99-365...................AELN..----...KKPK.......TAIAK...I..............DDIK....DVLNVQ
Q5ZGF6_9CAUD/117-376...................NAVLAA----...NATAST.....EIITNKNKV..............EMLINEIAKQENLD
Q5Z3V6_NOCFA/148-434G..................VQTQAF----...DTDLF.............................TSVRKAITKARTVG
Q6R4V3_9CAUD/365-630...................TGVPAL----...TYPAGG...........VDW..............ASVV....DMET.K
A6XMJ6_9CAUD/157-445AQTTQPPNWGTKAPAWTNLSTTNLL----KIDPTGKSA............................EEFF....SELVLK
A5CD71_ORITB/88-365EEY...............GIEIIPC----...HKIDL.............................EALL....SLIN.S
A8FGQ6_BACP2/20-302...................KQAVTH----...IVDANG............................AEISRQMLKQAYKA
Q3Y1P7_ENTFC/243-499...................DLLK..----...TFTK.......KTAAT...L..............DDLK....QLYNVA
A1EAE9_9CAUD/18-293.........................----...NSVAKAAKDANKVIGGPINY..............DNIL....KLQDAL
A3PHD9_RHOS1/126-396...................PQASAF----...APAFAPEM...RTPI...................DDLRLALLQAQLAR
Q3J3W7_RHOS4/148-418..................AGIATLS----...GGAGTI............TV..............ASLI....EAYH.A
Q857Z9_9CAUD/161-490ASSLFGATSATVSNVKFPADGTNGA----FVGQDTVASLKYGRVVTGAAGSGSGVAGSYPTAAEIAENVFDAFVDIQLTL
A6F0K0_9ALTE/127-405..................VTATTTA----...ASSSEF............TW..............QEVN....ALIH.S
A1TD88_MYCVP/110-388...................MGSDSV----...VNSAVT............................DTFAAGDVHNLDGD
B4SNH6_STRM5/129-412DGGANAGKHPFG......AIKVVNS----...GLAAGI............NG..............DSIL....DLVY.D
A6BER6_9FIRM/23-314....................IVTTA----...TKAGSV....VTLGSADPLY..............DKIM....AEEGVL
A5VJB3_LACRD/236-497...................KVLQGD----...NFTK.......KTVAN...V..............DDLK....QVFNVD
Q5L2L4_GEOKA/120-373...................EHMSFY----...STG.......IKEVTGENLY..............KAIK.....AAIAD
Q0AG17_NITEC/123-405A.................SGKVGTT----...GQTTTV............IF..............DDLV....DLIH.S
A9CJN8_AGRT5/134-419.TAIANDGWNWG......NIGYVAT----...GVSAGF........ASAGPM..............DVLL....DAVY.A
A3DG61_CLOTH/127-416....................NSDAL----...VTVPKE....KDQGAGTIKY..............ENIL.....KMWSS
A4TCV1_MYCGI/152-412...................IQTQAY----...ATSPL.............................VTLRKTLTKLETVG
A3WWM5_9BRAD/96-387TASTDDDTRAWG......TLQYVPT----...ADAAGF....KVATATVSPA..............DCLI....DLQS.E
Q2SDM1_HAHCH/110-393MDTAPDASREFG......KLQRVIS----...GKAGDF............NA..............DNLL....SVIY.R
Q5J5U0_9CAUD/24-332.....................KSPL----...TGSALQGIDTNNVIVNTTNV..............DYLQTGTTPLLDRF
B3XQ47_LACRE/128-385...................EHMSFY----...DKTTVK....IKEVAGSDLF..............HAIR.....KAIAD
B3XLQ0_LACRE/117-374...................TIFK..----...GFSA.......KTVDGSNAI..............DDLK....KIWNVD
A6C3V3_9PLAN/122-410....................QSSAR----...VTVSKE....SGQAANTILA..............ENIL.........Q
A6XRQ5_VIBCL/392-657...................TGVNPV----...NLAGTH...........PNY..............QEFI....EMET.S
A6U954_SINMW/144-422...........S......GVGENNS----...GSATTI.......ADADGQA..............NGLL....TLKH.A
A7GI70_CLOBL/117-372...................EHMSFY----...SPQNN.....IKIIEGENLY..............KAIK.....GALAD
A3WZW4_9BRAD/137-425TAATADATRAWG......TFQHVLT----...GTDGTF.......GTTTNGT..............DKLI....DLVY.S
Q8LTC0_9CAUD/142-396...................TLLK..----...GFTA.......KTISS...V..............DDLK....HINNVD
Q9T1F6_9CAUD/115-380...................EVMG..----...KAPK......KPTISQ...F..............DNIK....DLENNT
A5LFN8_STRPN/129-383...................KVLK..----...TATS.......KSAAG...L..............DGLK....DILNVE
Q5Z394_NOCFA/119-388G..................GQAQAF----...ATDLL.............................TTTRSAVTRLETAG
A6FF94_9GAMM/101-399...................NRLDIT----...NTTGQSWKPTYGADSRDLDFYPAFATGVS.....TGLPVDDLDIVNWL
B2JL19_BURP8/113-379...................TQAAPF----...APTDPA.....LNGV...................DNIRLAMAQVQAAF
A6M951_9VIRU/99-368...................NVLN..----...TKAK.......TAIAD...L..............DGLK....QIINVQ

PF05125

VPN_BPP2/6-342RNE----------------APARVMSKVTDEEGRTTSEV...IRV.GKGGDY--------------ASLDALVMDATNNL
VPN_BPHP1/3-330QEQ----------------RAANFM....TESTKSSGKI...TIF.GDNADY--------------ANLDDLAFDLKQG.
O80304_BP186/6-342RNE----------------APARVM....SNITDADGKVVSAVIRVGKNGDY--------------ENLDALVMDGTNTL
Q48277_HAESO/6-337EDN----------------APERVM....TEDKKSSGKI...EVG..EGKTY--------------KNLDALVFSAVSDL
Q9ZXM3_9CAUD/6-336RNN----------------APARVL....K.EGKTTGKV...VVGNGADADY--------------KNLDALVFDVVSSL

PF09950

A3M3U3_ACIBT/79-324LADA-EDLVDGDVSVQPDTYLMASNQYLHLST--RV--------------------------------------------
A6UAP6_SINMW/63-317LTGI-FTGTLG..AEIADTLLLPYSVLLDLST--RR--------------------------------------------
Q9P9P2_XYLFA/83-327ISSA-WMNTHY..VEMIDTVLLPGRVMNYLVS--TP--------------------------------------------
Q0T6M7_SHIF8/67-313LSDA-WAASGY..SVVPRDLLIPPEQFALLSS--II--------------------------------------------
A7ILG8_XANP2/97-352LISV-WAASGY..VAPPTKLALSPTAFGYIST--TI--------------------------------------------
A3L742_PSEAI/62-309LTLQ-TQGTLF..TAFSDTLLLPYAKFLLIAT--RK--------------------------------------------
A9ABK3_BURM1/97-345LNSA-WAAAGY..AVCPSRVLLDPTSFSLLVQ--RK--------------------------------------------
Q7N327_PHOLL/60-317YNVA-WAKSGY..RIQPTHVAIDASDF.MLAM--QK--------------------------------------------
A5PIZ3_9CAUD/86-326IEKI-ETLTNG..QHRANMILIPPSMRKVLMV--RM--------------------------------------------
Q2G4R3_NOVAD/110-363LTAV-ETGTGE..THIANTLALPTSRYNYIAT--TR--------------------------------------------
Q2NRY5_SODGM/71-317LTTA-WKQTGR..AVVPDKMLVSPDEYALLVS--TI--------------------------------------------
Q2NSP7_SODGM/16-248INQH-WNLKGG..VFPVTHIVLPQALYDDISI--TL--------------------------------------------
A4N6E6_HAEIF/55-278FLQG-MEKTKR..IEAPNTFAIDSLDLAHLAL--TQ--------------------------------------------
Q333F7_9CAUD/77-311IDAV-ESSTQG..LHHVTDILLPASARRVMQG--LV--------------------------------------------
A5UGK3_HAEIG/78-315HDTV-VLQSKG..VHQPTHLLLSLTDYQTLSS--KY--------------------------------------------
Q0BRS5_GRABC/65-316LTGI-QTASLR..VEMADTVLLPVDRWLKLSQ--TR--------------------------------------------
B0UJ01_METS4/61-314LVGL-FTASAT..VEMADTLLLPYEQMLGLGL--RR--------------------------------------------
Q6XQD3_BPT1/81-319IETI-ETITRG..QHRATNILIPPSMRKVLAI--RM--------------------------------------------
A6TKD0_ALKMQ/59-304RKKV-NALPGL....TVDTLLLPPNQYEDLDK--PV--------------------------------------------
Q835B4_ENTFA/56-293RAKI-TIIPGF..KGSSLKLMVAPEQYEELN.--RR--------------------------------------------
Q45PZ1_9CAUD/59-293LDII-ETSTNG..QHRATHLLLPTTARRIMQN--LV--------------------------------------------
A2WAD9_9BURK/103-363LTSA-WQATGW..KVKPNRVMLPPAKLGYIAS--QV--------------------------------------------
Q46YM7_CUPPJ/97-345LTSV-WGASAY..AYCPSELRLPPAKFSILVS--AK--------------------------------------------
A9C0G0_DELAS/59-320LQGI-SLATFE..TELADTILLPVEAFNYIAA--TP--------------------------------------------
Q984H1_RHILO/85-339ITGI-ATDTLG..NELADTILLPYSIMLDLSQ--RR--------------------------------------------
A8ATG6_9CAUD/56-301HTKI-TVLPGY..GTASLKLCLPPKQFELINK--KR--------------------------------------------

PF04454

C9RYB7_GEOSY/5-265LQL.-....GH--TG.PYALVLSPELYALIH---RV--------------------------------------------
D4H156_DENA2/1-251RKE.-....GI--AS.GANLVVNPALWQFLA---HV--------------------------------------------
D2Z797_9BACT/1-250KAS.-....SV--EG.PYVLIAQKELWKRIA---TL--------------------------------------------
C8WPL7_EGGLE/1-257AKT.-....GY--LG.RYALVVSPDLFLDLQ---RL--------------------------------------------
D0LZ74_HALO1/1-251RKA.-....GV--TG.PYALVLGPKAYDDLF---AA--------------------------------------------
D1B7I4_THEAS/1-249GAS.-.....V--EG.PFALVGGDKLFAAID---GF--------------------------------------------
A0KD92_BURCH/1-251RLA.-....GV--DG.PYSVVLGSDAYTALS---EA--------------------------------------------
A0PLA3_MYCUA/1-251RLA.-....GV--DG.PYSVLLAADVYTKVS---ET--------------------------------------------
A1B987_PARDP/1-251RLA.-....GV--NG.PYALILGTTAFTAAN---GG--------------------------------------------
A3DFK3_CLOTH/1-257IEN.-....GI--VG.RKALVVSPNLFVQLQ---RI--------------------------------------------
A4WHF5_PYRAR/156-358YSN.-....YV--PE.PYVLFVSPGRFTKLL---TV--------------------------------------------
MARIT_THEP1/1-251SKD.-....GI--EG.PYTLVINTDRWVSFL---KE--------------------------------------------
A6TWC5_ALKMQ/1-250KEA.-....YV--DQ.PVTLVVGIDAWKRIN---RE--------------------------------------------
A7HIB4_ANADF/2-255DEA.-....GR--HG.PYALAVSPGRFYQLL---RP--------------------------------------------
A7I7A2_METB6/2-249DAA.-....GF--HG.PYSLALAPAQYNLLL---RR--------------------------------------------
A8F8I8_THELT/3-247DEA.-....GF--HG.PYLLALSPDRYNLLF---RR--------------------------------------------
A8L1F1_FRASN/1-253RRA.-....GI--GG.PYGLAIDPDGYTAIL---EA--------------------------------------------
A8UW07_9AQUI/3-269VEQ.-....GF--YG.NYYLVVNPKQYFQLN---RM--------------------------------------------
A9BEM3_PETMO/1-251MEQ.-....GI--EG.PYTLVINKELWQDLF---TM--------------------------------------------
A9FWS5_SORC5/3-254RAA.-....GV--DG.PYALALGPKAYDELA---AA--------------------------------------------
A9H5P1_GLUDA/1-251RLA.-....GV--NG.PYAVVLGAGVYTALS---GG--------------------------------------------
B1CAJ4_9FIRM/1-257SSN.-....CF--LG.RYALVLSPDVYLDLQ---RI--------------------------------------------
B1L4G8_KORCO/136-346LSN.-....GF--PG.PFLLFLSPSRYAKLV---SV--------------------------------------------
B1VSP7_STRGG/1-251RLA.-....GV--DG.PYRLLLGADAFTEAA---ET--------------------------------------------
B2A6K6_NATTJ/8-259RKA.-....YI--SQ.NMTLIVGEEAWRKIN---KE--------------------------------------------
B2GID2_KOCRD/1-252RLA.-....GV--AG.PYNLLLPAELYTEVT---ET--------------------------------------------
B2JNZ6_BURP8/1-251RLA.-....GV--DG.PYSVLLGADAYTALG---EA--------------------------------------------
B2V6Y3_SULSY/1-265NEN.-....GF--YN.NFALVLNPQDYAMLN---RL--------------------------------------------
B4UA40_HYDS0/1-265VEK.-....GF--SK.NLAYILNPKDYTKAF---RI--------------------------------------------
B4UI59_ANASK/1-259DAA.-....GR--HG.PYAAAVSPARFYQLF---RP--------------------------------------------
B8CYH7_HALOH/1-249VKA.-....GV--NG.PYTLLLGPELYHSLY---TR--------------------------------------------
B8D495_DESK1/120-343YSA.-....GA--TR.PFVLVINPANYVNMV---KS--------------------------------------------
B8EQK3_METSB/1-251RLV.-....GV--NG.PYAVLFGAEAYTALA---ET--------------------------------------------
B8GHL2_METPE/5-250DLA.-....GF--HG.PYALALSPARYNLLF---RR--------------------------------------------
B9JHD1_AGRRK/1-251RLA.-....GV--NG.PYALVLGTEAYTAAS---GG--------------------------------------------
B9MNM0_ANATD/1-251LRK.-....GY--IG.KLVLILSPDIYVQLS---RI--------------------------------------------
B9YCJ8_9FIRM/1-256ESR.-....GY--VS.GITLVLSPDRMLDLQ---RI--------------------------------------------
C0R0J8_BRAHW/1-256REK.-....GI--VG.RFVLCLSQSLYFDLQ---RI--------------------------------------------
C0ZHN4_BREBN/1-265LKM.-....GH--SG.PYALVVSPELYSLLH---RV--------------------------------------------
C0ZVK4_RHOE4/1-251RLA.-....GV--NG.PYSLLLNADAFTAIN---ET--------------------------------------------
C1B1V8_RHOOB/4-254RLA.-....GV--EG.PYSVVLDADAYTAVS---ET--------------------------------------------
C1DV98_SULAA/1-265NES.-....GF--YS.NFALVLNPKDYASLH---RL--------------------------------------------
D5UVK7_TSUPD/1-251RLA.-....GV--DG.PYSVLLSADVYTRVS---ET--------------------------------------------
C3MM35_SULIL/96-329AKE.-....GF--GK.DIYVLISSSNYSKTF---RV--------------------------------------------
C4XPM7_DESMR/1-251RKT.-....SV--EG.PYALVVGPELWVALS---GH--------------------------------------------
C5B5H8_METEA/1-251KLA.-....GC--NG.PYVLVLGGDVYRAAS---GG--------------------------------------------
O67639_AQUAE/1-267VEK.-....GF--YT.NYYLIVNPKRYFLLN---RI--------------------------------------------
Q08WR7_STIAD/2-266NEH.-....GH--YG.PYAVVLSPRLYSLLH---RI--------------------------------------------
Q0RH88_FRAAA/1-253RRA.-....GI--AG.PYALALEPDSYTAVI---ET--------------------------------------------
Q1K2C9_DESAC/1-251LKE.-....GV--EG.GANLVVSPTIWKFLA---RS--------------------------------------------
Q2RVS0_RHORT/1-258RDR.-....GV--DG.PYALVLGRTVYQQLM---ET--------------------------------------------
Q401P1_9EURY/136-332SNA.-.....S--AG.PFGLIINPKRYAKLL---KI--------------------------------------------
LIN18_BRELN/1-252RTV.-....GV--DG.PYSLLLSSAEYTKVS---ES--------------------------------------------
Q4JC29_SULAC/153-340ETN.-....GY--TD.PVT.IISPELYTRLF---RV--------------------------------------------
Q5YPL3_NOCFA/1-252RLA.-....GV--DG.PYSVLLSAELYTEVS---ET--------------------------------------------
Q7MSM9_WOLSU/1-252VNS.-....EI--EG.PYALLIQPQYFGKLF---GV--------------------------------------------
Q835B4_ENTFA/4-243RAKI-TIIPGF--KGSSLKLMVAPEQYEELN---RR--------------------------------------------
Q972Z8_SULTO/108-304LSS.-....GY--S..DVNLIIPPYVHALLY---RV--------------------------------------------
Q97V86_SULSO/96-329TRE.-....GF--GK.DVYILMSSLNYSKTF---RV--------------------------------------------

PF11651

B7KXS0_METC4/1-419LNDK..LVGEAYRDGAV.GRIAQVDTYMSQNV--PVHVTGSRTNG.TVNGAGQNVT..YTQVLSNGVAVKDFGGQLLNVS
Q3RBQ2_XYLFA/1-408FHTS.DELRGEFSKNAV.GLFAGLEFYKQLSL--PTHTNGL.GAGYVVSGAGQIGS...................SISMD
A5VES4_SPHWW/1-413YIQG..AASDAYRKGDL.GTIGGIDTRMSQNV--QSITTGSRAGSILIDLSITGSTIDYAT.......VKDTMIQTIHMD
Q57SP8_SALCH/1-428DIFG.RVPEEAYRNGTIQRQIAGFDEILRSPK--LPAVTKSTATGVTVSGAQKFKPQAYTLDTDGNKENVDNRVATVTVS
B2U8F8_RALPJ/1-419LNPS.NEISEQFLTGQM.KRGLGFTWMMDQTV--LAHTTGAYGTPPTVSGANQSGSGLGTM..............TLNVS
Q1R947_ECOUT/1-416AYAQ.GATLTAYEKAQI.PPVASFDSYKTDIS--GRLPKGS.TESLTVSGQPEHKVEA....KDSNGMPVDNRQGTITVS
A4E782_9ACTN/1-291NASAVGDNGTALKEASL.GRKYGLDFYCDQNV--QKTTAET.......................................
A4JD31_BURVG/1-395LNPQ.RKISDQYETGMITTDTLGFDWMSDQTT--KVHTVGTFTAG.TVNGAGQTGN...................TLVTN
Q2G3Y7_NOVAD/1-418SEAT.ERSRTAFERAMIRSDVAGIEVFKNDQE--IRLAAAG.GGATTVNGANQRTVPAATVTSAGVTENKDNRYTDLVIT
Q3RHM5_XYLFA/1-409FHTS.DEIRGEFSKNAV.GMFAGLEFYKQLAL--PTHTNGP.GSGLVVTGTGNQGA...................TLAID
Q9AYZ7_BPHK6/1-421HASD.QLVRTAWENAQIPTNFGGIRALMSNGL--ASRTQGAFGGTLTVKTQPTVTYNA..........VKDSYQFTVTLT
Q5YSR9_NOCFA/1-303VPDG.VGSTAALRQGSIGRNLFGFDAYMTQNI--VQPATSP.......................................
B5NXL6_SALET/1-427DIFG.RIPEEAYRDGTIQRQVAGFDDVLRSPK--LPVLTKSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLS

PF06673

Q9MCB6_9VIRU/1-347ISDAIT-------------IVMSPQTF-AELR--KA--------------------------------------------
Q9MCB8_9VIRU/1-347ISDAIT-------------IVMSPQTF-AELR--KA--------------------------------------------

PF05065

A5IR70_STAA9/36-312EDDELE...A.--NA....FISKTQNR.SLLR..KI--------------------------------------------
E0THR4_PARBH/115-394LPQAYR...Q.--NG..R.FMMNRSTL.ASIR..KL--------------------------------------------
A5MBG7_STRPN/137-417TP.........--......ILVTSKTIARKLK..MV--------------------------------------------
B1J5N2_PSEPW/144-414YRASA......--......IALNPVDW.ADIE..LT--------------------------------------------
Q1GG15_SILST/131-399YPATG......--......HVMHPTDW.ARIE..LT--------------------------------------------
Q3HL14_9CAUD/114-381LDPAIS...P.--NA..I.LLTNQDGF.NYLD..KL--------------------------------------------
Q1DCZ9_MYXXD/94-361LTAHVR...M.--GN..AAWVLHPTRA.TALL..QL--------------------------------------------
Q3R2V6_XYLFA/355-623IALNNA...D.--VNAMS.YAFNAGIR.GYAK..TA--------------------------------------------
Q7Y4I4_9CAUD/8-297MEDAVGMIDGS--ERDITGAILDPIFT.TALS..KM--------------------------------------------
Q6GAL1_STAAS/126-378LHEDYR...DN--AT....IYMRYADYVKIIS....--------------------------------------------
B0K6S2_THEPX/124-397LKAPYR...K.--NA..V.FLMNDATV.KAIR..KL--------------------------------------------
Q1CQW9_STRPC/140-392LDPAYN...V.--SF.....IVSQSFY.QSMD..TL--------------------------------------------
Q0AAI8_ALHEH/83-374LKSDYL...G.--NA..R.FMMSRATM.NKIR..KL--------------------------------------------
A4WC36_ENT38/128-406IDPAYR...S.--GPKFR.WAFNDSTL.QVIE..EM--------------------------------------------
Q3EL79_BACTI/115-382LDPAFS...A.--VA..N.IITNQDGF.NYLD..QL--------------------------------------------
Q139N4_RHOPS/143-428LKPGYR...Q.--NA..S.FVMNRRTQ.AAIR..KF--------------------------------------------
A5F9J3_CLOK5/135-393LEDDYA...EN--AK....IVMKKADYFTMIK....--------------------------------------------
Q6G7X2_STAAS/129-401VKPNYEHNV..--......AIVSQTMF.AKLD..KM--------------------------------------------
A0AI11_LISW6/136-390LDPAYE...R.--TA.....VVSQSFL.QWVD..TL--------------------------------------------
Q3J4R6_RHOS4/160-429YPADG......--......MVLNEIDW.ALIE..TA--------------------------------------------
A5VKJ7_LACRD/107-373LDPAIM...S.--SS..S.FVTNQSGY.NVLS..KV--------------------------------------------
Q92CB8_LISIN/19-306IPAKYLRSPQD--FR....YYTSPSVETEWID..KL--------------------------------------------
A5KJS3_9FIRM/124-396LRAPYR...N.--KA..V.WLLNDSTV.KAIR..KL--------------------------------------------
A1VBS2_DESVV/113-404LKKGHR...A.--GA..T.FMMNGKTL.STLR..KW--------------------------------------------
A1T829_MYCVP/9-278FAAAQALSEDV--GGTITSFVANPETA.LTLA..QL--------------------------------------------
Q982R8_RHILO/176-465LKQGYR...N.--NA..S.YLSTDATM.AKIR..KF--------------------------------------------
Q5HTE1_CAMJR/118-386LDSAYR...K.--NA..T.WLVGDEFM.KAIY..KL--------------------------------------------
A1AYY2_PARDP/166-435YPADG......--......IVLHPTNW.AQIE..LT--------------------------------------------
Q7WLQ0_BORBR/118-390YEADG......--......LVLNPIDW.TSIE..LT--------------------------------------------
A3LM59_PSEAI/122-402KLSADG.....--......VVMTELDW.MNIE..LQ--------------------------------------------
Q8X755_ECO57/100-380LRKKYR...K.--NA..V.WVVNSTTA.AKLQ..KV--------------------------------------------
Q1ILS6_KORVE/495-776LEESSI...P.--LIAPG.IATTPGVK.KKLR..NT--------------------------------------------
B8FNY7_DESHD/107-369VKPSLL...K.--NT..I.ILTNQSGY.DYLD..NL--------------------------------------------
Q1GH34_SILST/388-661ISAANA...D.--VNSMA.YVQNAKMR.GHFK..ST--------------------------------------------
Q2GAM7_NOVAD/185-459LPANG......--......IVMHPSDW.ADIE..LT--------------------------------------------
Q8XYS4_RALSO/130-408VDPAYR...N.--APMYR.LAFNDQTL.KVLE..EL--------------------------------------------
Q3J3K4_RHOS4/110-395LGADYR...A.--NA..T.FVMNSKTA.GAVR..KM--------------------------------------------
Q1NB79_9SPHN/81-368LRAPYR...Q.--GA..C.FVMNSATL.SVIR..KM--------------------------------------------
Q5PB65_ANAMM/103-375LDEYFA...G.--RG..A.FIMHRSVL.QAIR..SL--------------------------------------------
Q1QLS4_NITHX/103-379LPAYYR...N.--RG..V.WLMNSKTI.AAVR..KL--------------------------------------------
Q65ES7_BACLD/133-400LDPAIN...A.--TT..K.VVTNQSGF.NVLD..KL--------------------------------------------
Q8ED08_SHEON/122-393YAADG......--......IVLNPIDW.AVIE..TL--------------------------------------------
Q813J9_BACCR/150-424VKEVRK...K.--AR....WVLNTAAL.TKIE..TM--------------------------------------------
Q3J5Z4_RHOS4/150-439VEDADV...G.--MVSPG.WIMRASTK.NWLA..SL--------------------------------------------
Q3F193_BACTI/24-317MSAGYT...P.--TT....IIMHPLCW.SLFA....--------------------------------------------
A1B638_PARDP/102-387LGAQYR...A.--NA..S.FVMNSKTA.AAVR..KM--------------------------------------------
A5WQQ4_MYCTF/196-475LPPRFQ...SN--SA....FAANLSTI.NVLR..QA--------------------------------------------
Q1R877_ECOUT/115-398LRKAHR...T.--GA..K.FMMNNNSL.FAIR..LL--------------------------------------------
A4IS66_GEOTN/24-302LPKKYLRDRSQ--WR....FYVHWDIEDAYRD..VL--------------------------------------------
Q17ZS7_CLOD6/178-435IGLIKK...A.--NGEATDILYNSNTE.TDLN..LL--------------------------------------------
Q854Z2_9CAUD/258-539LAARHR...RQ--GA....WLANNLIY.NKIR..QF--------------------------------------------
Q9AZS7_9CAUD/124-390VDPAII...A.--TS..S.LLTNQSGL.NKLA..LV--------------------------------------------
Q0AWY3_SYNWW/43-310VKPEYR...R.--NG..V.WLMNDETA.LALR..TL--------------------------------------------
A4YU30_BRASO/140-423MMARLF...EM--PGGNPIWLANRDTI.PQLG..TM--------------------------------------------
Q1B5C3_MYCSS/9-280LAEALSLIEDV--GGNPTAFVSNSSTV.LALS..KL--------------------------------------------
Q2NV28_SODGM/127-397IPATG......--......HVLHFTNW.AQIE..LI--------------------------------------------
Q1B7W7_MYCSS/9-278EVTPNR.....--......WFLNGADF.IALR..KL--------------------------------------------
A3T0Y2_9RHOB/165-433NAADG......--......VTINPVDW.AAIE..LL--------------------------------------------
Q1GHS2_SILST/113-395LDARYR...A.--GA..S.FVMNSKTA.GLIR..KL--------------------------------------------
Q2L2B0_BORA1/123-401VDPAYR...N.--APKFR.LAFNDATL.QILE..EM--------------------------------------------
A2SD63_METPP/97-385LKPQYR...T.--GA..S.WVMNRSTA.ATLR..KL--------------------------------------------
Q3J223_RHOS4/110-368DRNNGA.....--......YLMAGTTA.AALS..KA--------------------------------------------
A5TX36_FUSNP/106-365LDPAIS...A.--NA..I.ILTNQSGF.NFLD..NL--------------------------------------------
A1TML8_ACIAC/138-428IEMANV...D.--MSSCG.WVMAPRTI.RWLG..SL--------------------------------------------
Q3DFH6_STRAG/127-397LPAPYR...K.--NA..V.WILHDTTV.KAIR..KL--------------------------------------------
Q637B0_BACCZ/101-383EDVEDA.....--AV....LILNKLDL.KSFA..KL--------------------------------------------
Q14M91_SPICI/321-590LKLGYS...NG--AK....FVMNNETF.WTIQ..NI--------------------------------------------
Q1QKG8_NITHX/112-388LPAAYR...G.--RG..T.WLMNARTL.AAIR..KL--------------------------------------------
A3KA53_9RHOB/140-434LRNRNI...V.--VTGAQ.WVMSPRME.NFLM..NL--------------------------------------------
A5M4C8_STRPN/8-299IEDAVQQVIAR--GCEVTGIALSPTAG.HALG..KL--------------------------------------------
Q0S2A4_RHOSR/9-273VHDAKSEALAN--GAELTHIVLAPDVA.LALA..KA--------------------------------------------
A3X0R0_9BRAD/133-422LKSGYR...N.--GA..S.WLMSDATM.NTVR..KF--------------------------------------------
Q6LSF8_PHOPR/134-417VDPAYR...N.--SPGVG.YMFHDTTL.EALR..VI--------------------------------------------
A5N1H4_CLOK5/152-424DDGEDG...AP--IGEVI.AVMKRSFYYSQIAPQTF--------------------------------------------
Q859C1_9CAUD/118-386VPSAYR...A.--NA..K.YVVNDLRA.AQMR..KL--------------------------------------------
A3W815_9RHOB/115-386LPAMYR...N.--AG..T.WMMNGTTL.GVIR..TL--------------------------------------------
Q6J1Y2_9CAUD/119-381LDPAYS...R.--AL.....VVTQSLF.NTLD..TL--------------------------------------------
A7HRJ6_PARL1/148-433VKAGYR...A.--NG..R.FVMNRSTQ.SSIR..KF--------------------------------------------
A4WS92_RHOS5/111-382LPATYR...G.--RG..A.WAMNGTTL.GAVR..LL--------------------------------------------
Q9XJ79_9CAUD/117-382VDPAIK...Q.--TS..L.FLTNTSGF.TALK..KV--------------------------------------------
Q2YMS9_BRUA2/137-422LKAGYR...Q.--NA..N.FVMNRKTQ.SVLR..KL--------------------------------------------
A3SMP9_9RHOB/146-433VEDADV...S.--MMAPG.WAMRASTK.NFLA..GL--------------------------------------------
Q73HT5_WOLPM/107-395LDEYYS...K.--NA..S.FLMNRSTL.KDIR..LL--------------------------------------------
B1ZCX2_METPB/163-460LYMTLRFIPET--SRWA..WVMNPRTL.RYLA..DM--------------------------------------------
Q9A4P7_CAUCR/53-338TKTQYR...Q.--NG..R.FVMNRRTV.SAVR..KF--------------------------------------------
Q3Z7J9_DEHE1/124-397LRSVYR...N.--KA..I.WILNDTTI.KALR..KI--------------------------------------------
Q9B0A7_BPMB1/19-303.........TD--GKKWTHTLLDDTVE.PVLN..GS--------------------------------------------
Q6UAX6_9CAUD/134-425SMDGNS...N.--MISSG.WGMSNRTY.MKLF..GL--------------------------------------------
A6VBQ1_PSEA7/140-406AEIANV...D.--AVN...WLTNPAAK.TKLA..ST--------------------------------------------
A7B3D6_RUMGN/128-405MKKAYR...NG--S.....FVMNQSTFDTGID..GM--------------------------------------------
Q12EX8_POLSJ/63-302...........--AV....WVAHPRAG.AAIG..LM--------------------------------------------
Q830G6_ENTFA/163-444VTEVMK...K.--GR....FIINRAAL.TAIE..KM--------------------------------------------
A7MP72_CROS8/125-401VDPAYR...N.--SPKFR.FAFNDNTL.LKIS..SM--------------------------------------------
A0JQM6_LACS1/116-372IADEFQ...SD--IK....VYMTRPDYLKMIK....--------------------------------------------
A4EPK1_9RHOB/132-412MYARLQ...RI--PGDKPFWLINQDVL.PELM..FM--------------------------------------------
A3XTC6_9VIBR/12-299VPSRYH.....--ASDDFAIYMNRATWFDEFN..FV--------------------------------------------
Q3JTL8_BURP1/144-412FPATG......--......IVLNPIDW.ASIE..LT--------------------------------------------
A7ILP2_XANP2/167-448LKEAYL...A.--NG..S.WLMKRGTV.GSVA..LL--------------------------------------------
Q77WA0_BPHK0/112-381FSASG......--......IVLNPRDW.HNIA..LL--------------------------------------------
Q7Y5K8_9CAUD/121-389YPASG......--......IVINPIDW.AAIE..LA--------------------------------------------
B0T632_CAUSK/96-391LHTKYR...NS--AT....FVTGSDIE.LQLM..LV--------------------------------------------
Q6HR18_BACAN/82-358L........AG--SV....FVMGRPAF.NQVA..KL--------------------------------------------
Q855V6_9CAUD/7-307VEAAVGLVLGD--NLSPDGVALDNTFS.FMLA..TQ--------------------------------------------
Q11H37_MESSB/111-386LAPAYR...R.--NA..T.WALNSTTL.ALVR..KL--------------------------------------------
Q88G49_PSEPK/193-483LENANS...N.--MTSPG.FVMAPRTK.RWLA..AL--------------------------------------------
Q9MBJ9_9CAUD/128-407PFQADA.....--......LVINPLDY.QELR..LA--------------------------------------------
Q9ZXF6_BPPH1/131-394LDPMVA...P.--GS..I.VLTNQDGY.DWLD..TL--------------------------------------------
Q72BY4_DESVH/118-395VDPAYR...A.--LG.AR.WMFHDLTL.KAVK..KL--------------------------------------------
A5ZPL8_9FIRM/99-375LGQAFK...P.--TS..K.VITNDDGL.QWLD..TL--------------------------------------------
A5ZRV5_9FIRM/125-407LDPAIA...V.--SS..I.VLTNQDGF.NYMD..KL--------------------------------------------
A6NQ27_9FIRM/74-343MNT........--......MLVSGDVMLKMLKMSEF--------------------------------------------
Q9AZM2_9CAUD/164-424LKPQDS...A.--AA..S.IVMSQSAY.NLFD..MA--------------------------------------------
Q0FZ25_9RHIZ/128-413LKAGYR...Q.--NA..S.FMMNRRTQ.AMVR..KL--------------------------------------------
B2JU92_BURP8/137-421MISRLP...VG--SFGRSFWLINPDVL.PALD..NL--------------------------------------------
Q81Z09_BACAN/121-392LPLEYE...AS--AI....WTMTKKTF.MEFS..AM--------------------------------------------
Q3SS55_NITWN/107-382LPAAYR...N.--AG..T.WLMNSTTL.AAIR..KL--------------------------------------------
B8I8R8_CLOCE/60-320L.PSVK...A.--GL..T.TITNVSGY.VKLK..NW--------------------------------------------
Q2GDU5_NEOSM/81-367LQREFS...V.--NG..T.FLMHSTTI.QLIR..GL--------------------------------------------
Q8XLC0_CLOPE/109-375LDPSVL...Y.--GC..V.IVTNQDGF.AFLD..AI--------------------------------------------
A4L2R1_LACRE/100-373LKAPYR...Q.--NA..V.FLMNDDTV.KAIR..KM--------------------------------------------
Q8W6U5_9CAUD/140-430LENADA...N.--LTQPG.WIMAPRTF.RFLE..GL--------------------------------------------
Q3SSD8_NITWN/135-418IKQGYR...Q.--NA..R.FLMNRKTQ.AAIR..KF--------------------------------------------
A3WSQ9_9BRAD/101-392LRAPYR...P.--NA..R.WLMNLSTA.GVVR..KL--------------------------------------------
Q0H261_9CAUD/146-418DDS........--VGEIV.AVMKRSTYYNRLVEFSI--------------------------------------------
Q38K95_LACRE/117-373LDPAYN...K.--MI.....IASQSFY.QYLD..TL--------------------------------------------
Q0SPK4_9VIRU/118-397LLNVFK...A.--TS..S.WIVNQDGF.NYLD..SL--------------------------------------------
A7DYB2_9CAUD/103-361LGKGA......--......FFMNKSTYAELVG..VT--------------------------------------------
Q9AZY5_9CAUD/140-394IKKVYD...V.--KL.....FISASMY.SELD..KL--------------------------------------------
A6VNQ3_ACTSZ/129-407VDPAYR...N.--VGNSR.LAFNDNTF.KALK..EL--------------------------------------------
B1JZG6_BURCC/143-413LDLVNV...N.--GGR...WLSNPSVK.RVLA..TT--------------------------------------------
Q857K6_BPMB2/17-320VNNALSLLVNS--GKKWTGTLLDNVTE.PILN..TA--------------------------------------------
A5N291_CLOK5/33-297LKDEYR...N.--NA..V.FIMHDNTA.MLLR..TL--------------------------------------------
Q5WID4_BACSK/129-404IVQGYR...RN--AV....WVMNTEAF.ETLA..NI--------------------------------------------
A4EKP0_9RHOB/156-445VEDANV...M.--MVSPG.WIMRAGTK.NFLA..SL--------------------------------------------
A4XZF1_PSEMY/131-410VDPAYR...R.--SGNCS.LMFHDTTL.RELK..KL--------------------------------------------
Q5HBR1_EHRRW/126-404LDEYFA...A.--KA..V.FLMHRSVL.QEIR..SI--------------------------------------------
Q2N5Z6_ERYLH/94-380MKAGHR...Q.--GA..S.FVMNSATL.AEVR..KL--------------------------------------------
A1KTF7_NEIMF/343-623IAAANA...D.--IGDLA.YITNARVR.GLLK..TK--------------------------------------------
A7KUP9_9CAUD/79-375MANEYT...P.--SD....LMMHPLAW.TVFA....--------------------------------------------
Q9L8M6_HAEIF/114-400LHSKYR...K.--NA..V.WVMSSTIA.AALQ..KL--------------------------------------------
A8GXG9_RICB8/224-495LKEEYL...A.--NA..T.LLMNRATL.SEVQ..KL--------------------------------------------
Q8SBP8_9CAUD/122-380V.PNAR...K.--RA..I.IVTNSDGR.AYLD..GL--------------------------------------------
A7A701_BIFAD/6-292.........SD--EYDINGIALSKTMA.NELR..KI--------------------------------------------
Q81X81_BACAN/7-286ANKKNAF....--......WMISKSAKFSILD....--------------------------------------------
Q2GJL3_ANAPZ/114-389LNENFS...S.--RA..A.FLMNRSIL.QEIR..SL--------------------------------------------
A3XTC7_9VIBR/76-390INFEYQ...QN--AV....WYVSKKVL.KTLR..KM--------------------------------------------
A9W2M6_METEP/135-420LRAGYR...Q.--GA..S.FVMNRRVQ.SAIR..KF--------------------------------------------
A7GEE5_CLOBL/122-400LPSYYK...T.--SA..T.WVTNQDGY.NFLD..CL--------------------------------------------
A3UK25_9RHOB/114-399PKRSYR...A.--KG..R.FVMNRATV.SAVR..KF--------------------------------------------
A9BYD9_DELAS/120-394YWADG......--......IVISPLDW.AAIE..LT--------------------------------------------
Q892H0_CLOTE/99-365LDPAFR...Y.--TS..S.IVTNQDGY.NYLD..KL--------------------------------------------
Q5ZGF6_9CAUD/117-376F........PV--TA....IVLRPTDYYDILV..TQ--------------------------------------------
Q5Z3V6_NOCFA/148-434RVNPNG.....--......IVVNPADA.EAID..LA--------------------------------------------
Q6R4V3_9CAUD/365-630ISTFNA...D.--AGRLA.YLTSVTQR.GAAK..KA--------------------------------------------
A6XMJ6_9CAUD/157-445LSKARA...NY--SNGMKFWAMSSNTH.AVLMSKAI--------------------------------------------
A5CD71_ORITB/88-365LDDYYH...A.--NS..T.LLMHRTTL.AKIQ..TI--------------------------------------------
A8FGQ6_BACP2/20-302MPSKYLRVPQD--FR....FYTSPSLEVEWKD..QV--------------------------------------------
Q3Y1P7_ENTFC/243-499LDPALN...K.--MV.....ILNQSGY.YHLD..TL--------------------------------------------
A1EAE9_9CAUD/18-293YDADVE...P.--NA....FVSKIQNR.SALR..EA--------------------------------------------
A3PHD9_RHOS1/126-396LPASG......--......FVLHMMDW.AKIE..LT--------------------------------------------
Q3J3W7_RHOS4/148-418IPTVYA...Q.--NA..V.WVMNRTTL.AKLR..TY--------------------------------------------
Q857Z9_9CAUD/161-490FQTPNA.....--......VVMNPRDW.ELLR..LT--------------------------------------------
A6F0K0_9ALTE/127-405IDPAYR...R.--AANFR.LGLNDNTL.KMMT..EM--------------------------------------------
A1TD88_MYCVP/110-388LPQRYA...FN--AS....WLAHRKIY.SKIR..QF--------------------------------------------
B4SNH6_STRM5/129-412LPSAFT...A.--GA..K.FALNRKTQ.GVVR..KL--------------------------------------------
A6BER6_9FIRM/23-314DKVEKCGYLV.--NG....HMADVSMR.AKLR..GL--------------------------------------------
A5VJB3_LACRD/236-497LDPALQ...S.--TS..T.WLVNQSAF.QVLD..TL--------------------------------------------
Q5L2L4_GEOKA/120-373LHEDYR...EN--AK....IVMRYQDYSDMIE....--------------------------------------------
Q0AG17_NITEC/123-405VDPAYR...A.--ASGVR.FMMNDSVL.KSIR..KM--------------------------------------------
A9CJN8_AGRT5/134-419LKAGHR...Q.--NG..T.FLMNRKTQ.GALR..RF--------------------------------------------
A3DG61_CLOTH/127-416MPARLR...AN--AV....WYINQEIE.PQLY..TM--------------------------------------------
A4TCV1_MYCGI/152-412HAASA......--......FVMHANDW.EAIE..LA--------------------------------------------
A3WWM5_9BRAD/96-387LKGEYR...D.--KA..V.WMMNKRTA.GMVR..KF--------------------------------------------
Q2SDM1_HAHCH/110-393LKKAFR...R.--NA..N.WMMTGTTV.EKVR..KF--------------------------------------------
Q5J5U0_9CAUD/24-332LDGYDLVSANT--DVDFNGWAADPRYR.ARLL..RS--------------------------------------------
B3XQ47_LACRE/128-385LDDAFQ...DN--AK....VLMTRSDYYDMLD....--------------------------------------------
B3XLQ0_LACRE/117-374LDVAYN...K.--MI.....IASQSFY.NWLD..TL--------------------------------------------
A6C3V3_9PLAN/122-410MWSRLK...AS--SRMNSAWFINQDTE.PQLH..QM--------------------------------------------
A6XRQ5_VIBCL/392-657IAADNA...D.--VGSML.YMMNAVGR.GHCK..ST--------------------------------------------
A6U954_SINMW/144-422LKTAYT...R.--NA..V.WALNRTTL.GSVR..RL--------------------------------------------
A7GI70_CLOBL/117-372LEDDYA...EN--AT....ISMTRKDYYDIIE....--------------------------------------------
A3WZW4_9BRAD/137-425LKAKYR...Q.--NA..N.FMMSRATV.AALR..KL--------------------------------------------
Q8LTC0_9CAUD/142-396LDPAYS...R.--VI.....IASQSFY.NFLD..TV--------------------------------------------
Q9T1F6_9CAUD/115-380LDPAIE...S.--TS..S.FITNQSGY.NILS..KV--------------------------------------------
A5LFN8_STRPN/129-383LKTYYN...A.--TI.....VCTQSMF.AALD..KI--------------------------------------------
Q5Z394_NOCFA/119-388HTAGL......--......FVLSPADW.EALE..LA--------------------------------------------
A6FF94_9GAMM/101-399IDLMYQIKIQY--RSGAK.MYMHETTL.QRFK..KV--------------------------------------------
B2JL19_BURP8/113-379YNPTF......--......AVMNPLDW.ASIQ..LM--------------------------------------------
A6M951_9VIRU/99-368LDPVFR...S.--TS..S.VIVNQDAF.NWLD..TL--------------------------------------------

PF05125

VPN_BPP2/6-342IEPWYQ-------EDPDLVVIVGRQLLADKYF--PI--------------------------------------------
VPN_BPHP1/3-330LDFRHQ-------NRNDLVFLVGADLVSKETK--LI--------------------------------------------
O80304_BP186/6-342IDEIYQ-------DDPKLVAIVGRKLLADKYF--PL--------------------------------------------
Q48277_HAESO/6-337IAPQFQ-------DDTKLVAIMSRDLLADKYF--PL--------------------------------------------
Q9ZXM3_9CAUD/6-336IDPWHR-------RDPGLVVILGRELVHDKYF--PM--------------------------------------------

PF09950

A3M3U3_ACIBT/79-324-------------------------------------------------------V---ADSGGK----TFLKFIEENN-
A6UAP6_SINMW/63-317-------------------------------------------------------I---DAVNQT----TILEWIERNN-
Q9P9P2_XYLFA/83-327-------------------------------------------------------R---SDNSDK----TILHYVLENN-
Q0T6M7_SHIF8/67-313-------------------------------------------------------V---SSAGNQ----SLLTNLQTNT-
A7ILG8_XANP2/97-352-------------------------------------------------------A---SSAANA----TILTFLKENN-
A3L742_PSEAI/62-309-------------------------------------------------------V---NEQGLE----TILTYLQKNN-
A9ABK3_BURM1/97-345-------------------------------------------------------V---SDAGNI----SVLRYLQDNS-
Q7N327_PHOLL/60-317-------------------------------------------------------F---DTNSVI----VGVDLLPVSA-
A5PIZ3_9CAUD/86-326-------------------------------------------------------.---.PETTM----SYLDYFKQQN-
Q2G4R3_NOVAD/110-363-------------------------------------------------------V---GD.TNA----TILSFLLANN-
Q2NRY5_SODGM/71-317-------------------------------------------------------V---SSAGNR----SLLDYLNENT-
Q2NSP7_SODGM/16-248-------------------------------------------------------S---NPNTNL----TVLVALKQAN-
A4N6E6_HAEIF/55-278-------------------------------------------------------.---RNNTDT----TALEFLTKS.-
Q333F7_9CAUD/77-311-------------------------------------------------------.---.PQTNL----SYGELFTRNN-
A5UGK3_HAEIG/78-315-------------------------------------------------------M---NTADKV----DVLTFFKRKH-
Q0BRS5_GRABC/65-316-------------------------------------------------------I---.PATSE----TALSFLARTN-
B0UJ01_METS4/61-314-------------------------------------------------------I---DAVNPV----TILDWIRRHN-
Q6XQD3_BPT1/81-319-------------------------------------------------------.---.PETTM----SYLDYFKSQN-
A6TKD0_ALKMQ/59-304-------------------------------------------------------N---AENYNM----TIRKWLQEQK-
Q835B4_ENTFA/56-293-------------------------------------------------------Y---GEYDAR----SIMKVVQENG-
Q45PZ1_9CAUD/59-293-------------------------------------------------------.---.PGTSV----SYGEFFRQNN-
A2WAD9_9BURK/103-363-------------------------------------------------------I---SSAGNK----SILTYLLENN-
Q46YM7_CUPPJ/97-345-------------------------------------------------------V---SSAGNI----SVLEYLKQNT-
A9C0G0_DELAS/59-320-------------------------------------------------------Y---SATTME----TILSFVMRTN-
Q984H1_RHILO/85-339-------------------------------------------------------I---DTVNQT----TILEWVMQKN-
A8ATG6_9CAUD/56-301-------------------------------------------------------Y---SNEDSR----SVLKVLQDNA-

PF04454

C9RYB7_GEOSY/5-265-------------------------------------------------------H---EGTH.V----LEIEHIRELM-
D4H156_DENA2/1-251-------------------------------------------------------V---P..G.G----TLGDTVRRQI-
D2Z797_9BACT/1-250-------------------------------------------------------S---K..G.Y----PLRKRIESMV-
C8WPL7_EGGLE/1-257-------------------------------------------------------Q---PNTG.L----LEIDRIKKLI-
D0LZ74_HALO1/1-251-------------------------------------------------------T---QD.G.Y----PVAKQVQRLV-
D1B7I4_THEAS/1-249-------------------------------------------------------S---EP...Y----PMRKNLAELV-
A0KD92_BURCH/1-251-------------------------------------------------------R---DQ.G.Y----PVLGHIKRIV-
A0PLA3_MYCUA/1-251-------------------------------------------------------T---EH.G.Y----PIREHLNRLV-
A1B987_PARDP/1-251-------------------------------------------------------A---ED.G.Y----PVLKHLERLV-
A3DFK3_CLOTH/1-257-------------------------------------------------------Q---PGTG.T----TEYDRINKLL-
A4WHF5_PYRAR/156-358-------------------------------------------------------V---EKTG.V----MELTRVKSLV-
MARIT_THEP1/1-251-------------------------------------------------------E---A..GHY----PLEKRVEECL-
A6TWC5_ALKMQ/1-250-------------------------------------------------------M---Q..G.H----PLINRIQELT-
A7HIB4_ANADF/2-255-------------------------------------------------------Y---PGTA.L----TPHQQLQPAF-
A7I7A2_METB6/2-249-------------------------------------------------------Y---PQGD.G----TELDHVSSIV-
A8F8I8_THELT/3-247-------------------------------------------------------Y---ESGN.Q----TEYEHLSMII-
A8L1F1_FRASN/1-253-------------------------------------------------------T---EHGG.Y----LLLNHLKQIL-
A8UW07_9AQUI/3-269-------------------------------------------------------H---DNTG.L----LEIEQIKKVV-
A9BEM3_PETMO/1-251-------------------------------------------------------N---LS...Y----PLDLVVKEII-
A9FWS5_SORC5/3-254-------------------------------------------------------A---ED.G.Y----PLRKHIEGQL-
A9H5P1_GLUDA/1-251-------------------------------------------------------D---DE.G.Y----PVFRHIESLI-
B1CAJ4_9FIRM/1-257-------------------------------------------------------Q---PGIN.M----LELERISKLV-
B1L4G8_KORCO/136-346-------------------------------------------------------H---ERTG.I----MELQRLKALI-
B1VSP7_STRGG/1-251-------------------------------------------------------S---DH.G.Y----PVKTHLSRLV-
B2A6K6_NATTJ/8-259-------------------------------------------------------M---S..G.E----PLIERIHELT-
B2GID2_KOCRD/1-252-------------------------------------------------------T---DH.G.Y----PVHEHVSRIL-
B2JNZ6_BURP8/1-251-------------------------------------------------------S---DQ.G.Y----PVIEHIKRIV-
B2V6Y3_SULSY/1-265-------------------------------------------------------Y---GNSG.I----LEIDQIKKLF-
B4UA40_HYDS0/1-265-------------------------------------------------------Y---GNSG.V----LEITHIKELF-
B4UI59_ANASK/1-259-------------------------------------------------------F---PGSS.L----TPYQQLLPAF-
B8CYH7_HALOH/1-249-------------------------------------------------------N---DR.G.Y----PLEKRISDII-
B8D495_DESK1/120-343-------------------------------------------------------T---GRTG.L----TELDRVRQVV-
B8EQK3_METSB/1-251-------------------------------------------------------S---DH.G.F----PVLEHVKRLV-
B8GHL2_METPE/5-250-------------------------------------------------------Y---PQGS.T----TELEHLQQMI-
B9JHD1_AGRRK/1-251-------------------------------------------------------S---DD.G.Y----PVFHHIERVV-
B9MNM0_ANATD/1-251-------------------------------------------------------N---PMAG.V----LELERISKLV-
B9YCJ8_9FIRM/1-256-------------------------------------------------------Q---PGTG.L----LEVDRIARLI-
C0R0J8_BRAHW/1-256-------------------------------------------------------Q---QGTG.M----TEAQRISSMI-
C0ZHN4_BREBN/1-265-------------------------------------------------------H---KGTN.V----LEIEHVRNLV-
C0ZVK4_RHOE4/1-251-------------------------------------------------------S---DH.G.Y----PIREHLRRVL-
C1B1V8_RHOOB/4-254-------------------------------------------------------R---DE.G.H----PVFHHLRDLI-
C1DV98_SULAA/1-265-------------------------------------------------------Y---GNSG.V----LEIEHIKKLF-
D5UVK7_TSUPD/1-251-------------------------------------------------------S---DH.G.Y----PVREHLNRLV-
C3MM35_SULIL/96-329-------------------------------------------------------V---DRTG.T----YEIEMIKEI.-
C4XPM7_DESMR/1-251-------------------------------------------------------V---R..G.Y----PLSQYLETML-
C5B5H8_METEA/1-251-------------------------------------------------------N---EE.G.Y----PIFHHLERIV-
O67639_AQUAE/1-267-------------------------------------------------------H---DNTG.L----LELEQIKKVV-
Q08WR7_STIAD/2-266-------------------------------------------------------F---EKTG.V----LEIETIRQLA-
Q0RH88_FRAAA/1-253-------------------------------------------------------A---EHGG.Y----LLLTHLQHIL-
Q1K2C9_DESAC/1-251-------------------------------------------------------T---P..G.G----TLRSIIETQI-
Q2RVS0_RHORT/1-258-------------------------------------------------------T---TPGG.Y----PVLQHVRRLF-
Q401P1_9EURY/136-332-------------------------------------------------------Y---EKSG.K----MLVEVLKEIF-
LIN18_BRELN/1-252-------------------------------------------------------T---DH.G.Y----PIREHLSRQL-
Q4JC29_SULAC/153-340-------------------------------------------------------Y---DKSG.T----YEIKLVKHA.-
Q5YPL3_NOCFA/1-252-------------------------------------------------------S---DH.G.Y----PIRTHIERLI-
Q7MSM9_WOLSU/1-252-------------------------------------------------------A---GNSG.Y----PLTLKLAELL-
Q835B4_ENTFA/4-243-------------------------------------------------------Y---GEYDAR----SIMKVVQENG-
Q972Z8_SULTO/108-304-------------------------------------------------------V---DRTG.T----MEIELLRHL.-
Q97V86_SULSO/96-329-------------------------------------------------------V---DRSG.T----YEIEMIKEI.-

PF11651

B7KXS0_METC4/1-419GLGNGGV.......VAKGDVFTIAGVFAVNHVTKQVL...PYLRQFTVLAAAVADG---TGNATL----QISPAIIAPA-
Q3RBQ2_XYLFA/1-408GKAGKGD.......IMKGSIITFADVFEVHPITGATT...GRLRQFLVTDDY...A---AGGSTL----SIYPAIIPTS-
A5VES4_SPHWW/1-413SFTNATDT......VKAGEVFTIAGVYAVNPVTKARL...PWLKQFTVVADATC.A---SNETDV----VIYPAMIWTG-
Q57SP8_SALCH/1-428TTTG..........FKRGDKISFTGVKFLSQMAKNVL...TDDATFSITR.....V---IDGTHI----EITPKPIALD-
B2U8F8_RALPJ/1-419ALNGP.........VNAGDVFTIAGVFAVNRVTKQAY...PELQQFTVVQAA...A---AGATSL----SIYPSINPPV-
Q1R947_ECOUT/1-416ASG...........LQVGDAFTIAGVNSVHQITKDTT...GQPQVFRVL......A---VSGTTV----TISPKILPVE-
A4E782_9ACTN/1-291........................................................---......----..........-
A4JD31_BURVG/1-395AITGT.........LNAGDIIMIDGVEAINRLTGETY...GQLQQFVVTADV...A---SGATSI----PLYPAIVPAP-
Q2G3Y7_NOVAD/1-418ATTYAN........VKIGDAFTIAGVNEIHLITKQDT...GNLKTFRVVD.....K---PAANTI----RIWPAIIDAA-
Q3RHM5_XYLFA/1-409DT..KGDTRTALVVLSKGTIFTLAGVFETHPITGEAT...TRLRQFLVTTDY...R---RGEYGV----TIYPPIVLTS-
Q9AYZ7_BPHK6/1-421GATTSVTGF.....LKAGDQVKFTNTYWLQQQTKQALYNGATPISFTATVTADANS---DSSGDV----TVTLSGVPIY-
Q5YSR9_NOCFA/1-303.......................................................A---TGQPTT----EV........-
B5NXL6_SALET/1-427ATTG..........MKRGDKISFAGVKFLGQMAKNVL...AQDATFSVVR.....V---VDGTHV----EITPKPVALD-

PF06673

Q9MCB6_9VIRU/1-347-------------------------------------------------------K---G-TDGH----SRFNELATKEQ
Q9MCB8_9VIRU/1-347-------------------------------------------------------K---G-TDGH----SRFNELATKEQ

PF05065

A5IR70_STAA9/36-312-------------------------------------------------------V...DPETKE....RIY........
E0THR4_PARBH/115-394-------------------------------------------------------K...D.TEGN....YLWS...PGL.
A5MBG7_STRPN/137-417-------------------------------------------------------K...D.GEKR....YIDPQPFAPI.
B1J5N2_PSEPW/144-414-------------------------------------------------------K...D.ANGS....YIWVNVQEGGV
Q1GG15_SILST/131-399-------------------------------------------------------K...D.GNAN....YIIGKPQGTIA
Q3HL14_9CAUD/114-381-------------------------------------------------------K...D.KDGK....YILQ...SDP.
Q1DCZ9_MYXXD/94-361-------------------------------------------------------Q.....NSGV....WVFR...QEM.
Q3R2V6_XYLFA/355-623-------------------------------------------------------L...K.FPQT....AASG...TIW.
Q7Y4I4_9CAUD/8-297-------------------------------------------------------K...N.AEGG....KLYPELAW...
Q6GAL1_STAAS/126-378-------------------------------------------------------....VLSNGT....TNFF.......
B0K6S2_THEPX/124-397-------------------------------------------------------K...D.GQGQ....YLWQ...PSL.
Q1CQW9_STRPC/140-392-------------------------------------------------------K...D.ENGR....YLLQ...DSI.
Q0AAI8_ALHEH/83-374-------------------------------------------------------R...D.GDDR....ALLQ...MSL.
A4WC36_ENT38/128-406-------------------------------------------------------V...D.DQKR....PLWL...PDV.
Q3EL79_BACTI/115-382-------------------------------------------------------E...D.KDGR....PLLQ...PDP.
Q139N4_RHOPS/143-428-------------------------------------------------------K...D.NNGV....YLWQ...PPA.
A5F9J3_CLOK5/135-393-------------------------------------------------------....ELANNN....TALF.......
Q6G7X2_STAAS/129-401-------------------------------------------------------K...D.KLGN....YLIQPDVK...
A0AI11_LISW6/136-390-------------------------------------------------------K...D.SDGQ....YILH...RDI.
Q3J4R6_RHOS4/160-429-------------------------------------------------------K...D.SENR....YIFANPLQLAG
A5VKJ7_LACRD/107-373-------------------------------------------------------K...D.AQGR....YMLQ...RDV.
Q92CB8_LISIN/19-306-------------------------------------------------------GDRQT.SLGD....SAV........
A5KJS3_9FIRM/124-396-------------------------------------------------------K...D.GNGN....YIWQ...PSV.
A1VBS2_DESVV/113-404-------------------------------------------------------K...D.AEGN....YIWQ...PGI.
A1T829_MYCVP/9-278-------------------------------------------------------K..RSGDSNE....PLLQ...ASVD
Q982R8_RHILO/176-465-------------------------------------------------------K...D.GQGN....YVWA...PPS.
Q5HTE1_CAMJR/118-386-------------------------------------------------------T...D.NDNR....PLWL...PAL.
A1AYY2_PARDP/166-435-------------------------------------------------------K...D.GEFR....YIFANVMQLAG
Q7WLQ0_BORBR/118-390-------------------------------------------------------K...T.DDKQ....YLFATPRGLAV
A3LM59_PSEAI/122-402-------------------------------------------------------K...D.GENR....YLFANLQGLVT
Q8X755_ECO57/100-380-------------------------------------------------------K...N.ANGD....YIWR...DRL.
Q1ILS6_KORVE/495-776-------------------------------------------------------A...E.LSNT....ISL....PIW.
B8FNY7_DESHD/107-369-------------------------------------------------------T...D.AKGR....PLLN...DSL.
Q1GH34_SILST/388-661-------------------------------------------------------Q...K.FSGT....NGA....PIW.
Q2GAM7_NOVAD/185-459-------------------------------------------------------K...T.DDGA....YLFANPQGGSE
Q8XYS4_RALSO/130-408-------------------------------------------------------V...D.GNGR....PLWL...PGL.
Q3J3K4_RHOS4/110-395-------------------------------------------------------K...D.SDGR....FLWS...DGL.
Q1NB79_9SPHN/81-368-------------------------------------------------------K...T.SDGA....FLWQ...PGL.
Q5PB65_ANAMM/103-375-------------------------------------------------------K...S.GSGQ....YLLQ...PG..
Q1QLS4_NITHX/103-379-------------------------------------------------------K...DGSTGA....YLWQ...PGL.
Q65ES7_BACLD/133-400-------------------------------------------------------K...D.AFGR....YLLQ...PNP.
Q8ED08_SHEON/122-393-------------------------------------------------------K...D.SNKN....YLIGKPQGQTV
Q813J9_BACCR/150-424-------------------------------------------------------K...T.DDGF....PLLR...PFN.
Q3J5Z4_RHOS4/150-439-------------------------------------------------------K...D.ANGN....PLFP...SIG.
Q3F193_BACTI/24-317-------------------------------------------------------KNAALEGTSV....AAFGQGTSNFD
A1B638_PARDP/102-387-------------------------------------------------------R...D.ADGR....FLWA...DSL.
A5WQQ4_MYCTF/196-475-------------------------------------------------------....ETANGALKFPSL.........
Q1R877_ECOUT/115-398-------------------------------------------------------K...D.SEGN....YLWR...PGL.
A4IS66_GEOTN/24-302-------------------------------------------------------RARGT.GLGD....TAQT.......
Q17ZS7_CLOD6/178-435-------------------------------------------------------V...D.TTGQ....PLNE...PKV.
Q854Z2_9CAUD/258-539-------------------------------------------------------....DTQGGA....GLWT...TIG.
Q9AZS7_9CAUD/124-390-------------------------------------------------------K...T.AEGK....YLLE...PDP.
Q0AWY3_SYNWW/43-310-------------------------------------------------------K...D.DGGN....YIWN...HA..
A4YU30_BRASO/140-423-------------------------------------------------------T.....IGNN....AAFL...PVN.
Q1B5C3_MYCSS/9-280-------------------------------------------------------K..KTSDSNE....PLLS...PNL.
Q2NV28_SODGM/127-397-------------------------------------------------------K...D.TLGR....YLLSNPAALTT
Q1B7W7_MYCSS/9-278-------------------------------------------------------K...E.TTGS....AKYLIESDVT.
A3T0Y2_9RHOB/165-433-------------------------------------------------------K...D.TQGR....YIFGNPNELAT
Q1GHS2_SILST/113-395-------------------------------------------------------K...D.ADGR....FLWS...DGL.
Q2L2B0_BORA1/123-401-------------------------------------------------------E...D.GNGR....PLWI...PGL.
A2SD63_METPP/97-385-------------------------------------------------------K...T.TDGE....SLWA...AST.
Q3J223_RHOS4/110-368-------------------------------------------------------K.....ANSQ....FVLEIKEGVT.
A5TX36_FUSNP/106-365-------------------------------------------------------T...D.KQNR....PLLE...VNL.
A1TML8_ACIAC/138-428-------------------------------------------------------R...D.GNGN....KAFP...EI..
Q3DFH6_STRAG/127-397-------------------------------------------------------K...D.NNGN....YIWQ...PST.
Q637B0_BACCZ/101-383-------------------------------------------------------R...T.SDGK....KVYN...VVS.
Q14M91_SPICI/321-590-------------------------------------------------------K...D.KNDR....PIWNHNISS..
Q1QKG8_NITHX/112-388-------------------------------------------------------K...DGTTGV....YLWQ...PSY.
A3KA53_9RHOB/140-434-------------------------------------------------------R...D.GNGN....KVYP...EM..
A5M4C8_STRPN/8-299-------------------------------------------------------K...D.ADKR....AVYPEFRF...
Q0S2A4_RHOSR/9-273-------------------------------------------------------K..TATGSNQ....GLLETVDDGV.
A3X0R0_9BRAD/133-422-------------------------------------------------------K...D.AEGA....YIWA...PPS.
Q6LSF8_PHOPR/134-417-------------------------------------------------------K...D.KNDR....PIFV...PGY.
A5N1H4_CLOK5/152-424-------------------------------------------------------L...PTSDGR....LVIQ.......
Q859C1_9CAUD/118-386-------------------------------------------------------K...D.ANGQ....YLWQ...SGL.
A3W815_9RHOB/115-386-------------------------------------------------------K...D.GDGR....FLWQ...ASF.
Q6J1Y2_9CAUD/119-381-------------------------------------------------------K...D.KNGR....YLLHDASDSI.
A7HRJ6_PARL1/148-433-------------------------------------------------------K...D.TDGN....YLWQ...PAV.
A4WS92_RHOS5/111-382-------------------------------------------------------K...D.GDGR....FLWQ...PSY.
Q9XJ79_9CAUD/117-382-------------------------------------------------------K...N.AMGD....YLME...RDV.
Q2YMS9_BRUA2/137-422-------------------------------------------------------K...D.KDGN....YLWQ...PPA.
A3SMP9_9RHOB/146-433-------------------------------------------------------R...D.ANGY....PLYP...SID.
Q73HT5_WOLPM/107-395-------------------------------------------------------K...S.QTGQ....YLWQ...PSL.
B1ZCX2_METPB/163-460-------------------------------------------------------RVGAG.TDGE....YAFPEL.....
Q9A4P7_CAUCR/53-338-------------------------------------------------------K...D.AQGN....YIWN...AAL.
Q3Z7J9_DEHE1/124-397-------------------------------------------------------K...D.NNGN....YIWQ...PSV.
Q9B0A7_BPMB1/19-303-------------------------------------------------------V...D.ANGR....PLFVESTYESL
Q6UAX6_9CAUD/134-425-------------------------------------------------------R...D.GNGN....KVYP...EM..
A6VBQ1_PSEA7/140-406-------------------------------------------------------L...K.EAGL....PGY.....LL.
A7B3D6_RUMGN/128-405-------------------------------------------------------E...D.ENGQ....PIGR...TNYG
Q12EX8_POLSJ/63-302-------------------------------------------------------....NGSLGV....ACNV.......
Q830G6_ENTFA/163-444-------------------------------------------------------K...T.DDGF....PLLR...PFT.
A7MP72_CROS8/125-401-------------------------------------------------------K...D.AQGR....PLWL...PDV.
A0JQM6_LACS1/116-372-------------------------------------------------------....ELSNGA....VSLF.......
A4EPK1_9RHOB/132-412-------------------------------------------------------T.....VGDK....PIWM...PSGD
A3XTC6_9VIBR/12-299-------------------------------------------------------E...D.VTGN....VINY.......
Q3JTL8_BURP1/144-412-------------------------------------------------------K...D.SQGR....YIVGNPVNGTT
A7ILP2_XANP2/167-448-------------------------------------------------------K...D.AQGQ....YLWR...PGL.
Q77WA0_BPHK0/112-381-------------------------------------------------------K...D.NEGR....YIFGGPQAFTS
Q7Y5K8_9CAUD/121-389-------------------------------------------------------K...D.ANNQ....YLIGNARGTLT
B0T632_CAUSK/96-391-------------------------------------------------------K...D.STGN....YIWQPAVG...
Q6HR18_BACAN/82-358-------------------------------------------------------K...D.AQGNYHVVKDVVNGKPVY.
Q855V6_9CAUD/7-307-------------------------------------------------------R...D.SQGR....KLYPELGFGTD
Q11H37_MESSB/111-386-------------------------------------------------------K...D.SQGN....FLWQ...PGI.
Q88G49_PSEPK/193-483-------------------------------------------------------R...D.GNGN....KAYP...EL..
Q9MBJ9_9CAUD/128-407-------------------------------------------------------K...D.ANGQYYGGGVFQGQYGSGG
Q9ZXF6_BPPH1/131-394-------------------------------------------------------K...D.GTGR....YLLQ...PDP.
Q72BY4_DESVH/118-395-------------------------------------------------------K...D.GDGR....PLWM...PDV.
A5ZPL8_9FIRM/99-375-------------------------------------------------------K...N.DKGE....YLLQ...PSP.
A5ZRV5_9FIRM/125-407-------------------------------------------------------K...D.KDGK....YIMQ...PDP.
A6NQ27_9FIRM/74-343-------------------------------------------------------Q...NPLTGL....NFQG.......
Q9AZM2_9CAUD/164-424-------------------------------------------------------T...D.AMGR....PLLQ...PNV.
Q0FZ25_9RHIZ/128-413-------------------------------------------------------K...D.ADGN....YLWQ...PPS.
B2JU92_BURP8/137-421-------------------------------------------------------T.....LGNY....PIYM...PVGG
Q81Z09_BACAN/121-392-------------------------------------------------------T...D.ADGQ....PIAR...TNYG
Q3SS55_NITWN/107-382-------------------------------------------------------K...DGTTGT....YLWS...PGF.
B8I8R8_CLOCE/60-320-------------------------------------------------------K...D.AQKR....PLNL...ITV.
Q2GDU5_NEOSM/81-367-------------------------------------------------------K...YEQTGH....YMFQ...PGI.
Q8XLC0_CLOPE/109-375-------------------------------------------------------E...D.KNGR....PLLQ...PNP.
A4L2R1_LACRE/100-373-------------------------------------------------------K...D.KNDQ....YIWQ...PSV.
Q8W6U5_9CAUD/140-430-------------------------------------------------------R...D.GNGN....KVYP...EL..
Q3SSD8_NITWN/135-418-------------------------------------------------------K...SKTEEL....YLWQ...PSI.
A3WSQ9_9BRAD/101-392-------------------------------------------------------K...D.AEGR....FVWA...DA..
Q0H261_9CAUD/146-418-------------------------------------------------------Q..VD.SNGN.............V.
Q38K95_LACRE/117-373-------------------------------------------------------K...D.KNGQ....YLLH...EAI.
Q0SPK4_9VIRU/118-397-------------------------------------------------------E...D.KTGR....PYLQ...PDP.
A7DYB2_9CAUD/103-361-------------------------------------------------------K.....ADAK....MLVEEPLK...
Q9AZY5_9CAUD/140-394-------------------------------------------------------K...D.KNGR....YLLQ...DSI.
A6VNQ3_ACTSZ/129-407-------------------------------------------------------V...D.GQNR....PLWL...PDV.
B1JZG6_BURCC/143-413-------------------------------------------------------E...K.AANT....GIF.....LT.
Q857K6_BPMB2/17-320-------------------------------------------------------V...D.GNGR....PLFVESTYTEQ
A5N291_CLOK5/33-297-------------------------------------------------------K...D.TSGS....YLWN...SS..
Q5WID4_BACSK/129-404-------------------------------------------------------....EDKNGR....GILA.....AD
A4EKP0_9RHOB/156-445-------------------------------------------------------R...EPVHGS....YLFP...SIQ.
A4XZF1_PSEMY/131-410-------------------------------------------------------K...D.ADGR....PIWL...PGV.
Q5HBR1_EHRRW/126-404-------------------------------------------------------K...S.PSGQ....YLWY...PGL.
Q2N5Z6_ERYLH/94-380-------------------------------------------------------K...T.ADGA....FLWQ...PGM.
A1KTF7_NEIMF/343-623-------------------------------------------------------L...K.ADGV....SGY.....IW.
A7KUP9_9CAUD/79-375-------------------------------------------------------KNELMGSLQA....NPYG....NYP
Q9L8M6_HAEIF/114-400-------------------------------------------------------K...N.KNGD....FIWR...DGL.
A8GXG9_RICB8/224-495-------------------------------------------------------K...D.NQGR....FIWQ...QSL.
Q8SBP8_9CAUD/122-380-------------------------------------------------------M...D.KQGR....PLLK...E.L.
A7A701_BIFAD/6-292-------------------------------------------------------R...VPSTGQ....RFYPEIPI...
Q81X81_BACAN/7-286-------------------------------------------------------....ENENER....LSFENIP....
Q2GJL3_ANAPZ/114-389-------------------------------------------------------K...S.NTGQ....YLLQ...VG..
A3XTC7_9VIBR/76-390-------------------------------------------------------KVSTDGTDQR....PLITMDFGSFD
A9W2M6_METEP/135-420-------------------------------------------------------K...D.ADGN....YLWQ...PPL.
A7GEE5_CLOBL/122-400-------------------------------------------------------E...D.KQGN....SYLR...PDP.
A3UK25_9RHOB/114-399-------------------------------------------------------K...D.ADGQ....YIWQ...PAQ.
A9BYD9_DELAS/120-394-------------------------------------------------------K...T.ADNA....YLFTNPRTQEL
Q892H0_CLOTE/99-365-------------------------------------------------------K...D.TDGD....YLLQ...PSI.
Q5ZGF6_9CAUD/117-376-------------------------------------------------------K...SVGAGYGLPGVVTQ.......
Q5Z3V6_NOCFA/148-434-------------------------------------------------------K...D.ANER....YYFGGPQAITQ
Q6R4V3_9CAUD/365-630-------------------------------------------------------Q...V.FDNT....GER.....IW.
A6XMJ6_9CAUD/157-445-------------------------------------------------------T...FNSAGA....LVAS.......
A5CD71_ORITB/88-365-------------------------------------------------------Q...D.SSGR....FIWQ...PKL.
A8FGQ6_BACP2/20-302-------------------------------------------------------ANRQT.TLGD....AVI........
Q3Y1P7_ENTFC/243-499-------------------------------------------------------K...D.SDGR....YILQ...PDV.
A1EAE9_9CAUD/18-293-------------------------------------------------------R...D.GNKV....SIY........
A3PHD9_RHOS1/126-396-------------------------------------------------------K...N.TVGD....YVLANPLRLAG
Q3J3W7_RHOS4/148-418-------------------------------------------------------F...N.GMGE....PLLL...DSI.
Q857Z9_9CAUD/161-490-------------------------------------------------------K...D.ANGQ....YMGGNFFGNAY
A6F0K0_9ALTE/127-405-------------------------------------------------------E...D.LQGR....PLWL...PAV.
A1TD88_MYCVP/110-388-------------------------------------------------------....DTNGGA....SLWG...QLA.
B4SNH6_STRM5/129-412-------------------------------------------------------K...D.AQGN....YLWQ...PSL.
A6BER6_9FIRM/23-314-------------------------------------------------------K...N.ANGD....PLFK...SDM.
A5VJB3_LACRD/236-497-------------------------------------------------------K...D.NEGR....YLLQ...PDV.
Q5L2L4_GEOKA/120-373-------------------------------------------------------....TLANGN....ATLY.......
Q0AG17_NITEC/123-405-------------------------------------------------------K...D.TQGR....PVFL...PGY.
A9CJN8_AGRT5/134-419-------------------------------------------------------K...D.TSGA....YLWH...PPA.
A3DG61_CLOTH/127-416-------------------------------------------------------ALNIG.AGGA....PVFMPSGGAA.
A4TCV1_MYCGI/152-412-------------------------------------------------------L...SSANTI....EYRGLPYDASA
A3WWM5_9BRAD/96-387-------------------------------------------------------K...D.VDGA....YVWQ...NAI.
Q2SDM1_HAHCH/110-393-------------------------------------------------------K...D.ADGN....YMWR...PGI.
Q5J5U0_9CAUD/24-332-------------------------------------------------------QAYRD.ANGNVDPTRINL.......
B3XQ47_LACRE/128-385-------------------------------------------------------....GLANNS....ATLY.......
B3XLQ0_LACRE/117-374-------------------------------------------------------K...D.KNGR....YLLQ...DSI.
A6C3V3_9PLAN/122-410-------------------------------------------------------SLGVSTAGGQ....LVYM...PPAG
A6XRQ5_VIBCL/392-657-------------------------------------------------------Q...K.FANT....NGS....PIW.
A6U954_SINMW/144-422-------------------------------------------------------K...DADKG.....YVWQ...PGL.
A7GI70_CLOBL/117-372-------------------------------------------------------....TLANGN....ATLY.......
A3WZW4_9BRAD/137-425-------------------------------------------------------K...D.GQGN....YAWQ...PSL.
Q8LTC0_9CAUD/142-396-------------------------------------------------------K...D.GNGR....YLLQ...DSI.
Q9T1F6_9CAUD/115-380-------------------------------------------------------K...D.ADGR....YLMQ...PDV.
A5LFN8_STRPN/129-383-------------------------------------------------------K...D.KDGR....YMLQ...TDI.
Q5Z394_NOCFA/119-388-------------------------------------------------------R...TDTAGQ....LELGGPVDRAA
A6FF94_9GAMM/101-399-------------------------------------------------------R...D.AYQR....PIFM...DSF.
B2JL19_BURP8/113-379-------------------------------------------------------K...N.AQGE....YLFGSPLAPVT
A6M951_9VIRU/99-368-------------------------------------------------------K...D.QNGQ....YLLQ...PSI.

PF05125

VPN_BPP2/6-342-------------------------------------------------------V---N-KE.Q----DNSEMLAADV-
VPN_BPHP1/3-330-------------------------------------------------------Q---Q-KHGL----TPTEKAALGS-
O80304_BP186/6-342-------------------------------------------------------V---N-KQ.Q----ENTESLAADI-
Q48277_HAESO/6-337-------------------------------------------------------L---N-QS..----KASEQVAGDI-
Q9ZXM3_9CAUD/6-336-------------------------------------------------------V---N-KD.Q----PATEKIATDL-

PF09950

A3M3U3_ACIBT/79-324--I.........FA.SQ----GKPLTIRGL-------------GR.SNGKGTAGA.......DRSIIYRRDP----SCIQ
A6UAP6_SINMW/63-317--I.........YTRTT----GQPLTIRGV-------------FGFLDTAGAGST.......KRMVAYRRSP----EVLK
Q9P9P2_XYLFA/83-327--I.........AKAER----GLDLTVRTG-------------YG.LETAGEGGT.......TRAMVYTKNP----TKLV
Q0T6M7_SHIF8/67-313--I.........SYHQN----GVPLNIRAV-------------KW.LKGRGVGNK.......DRMVAYTNDK----KYVR
A7ILG8_XANP2/97-352--I.........LTAEK----GIPLDIVSV-------------KW.LDKANRSGAS.....YDRMVAYSQQP----EYVR
A3L742_PSEAI/62-309--V.........YTATT----GRPLTIRGL-------------NG.LDAAGAGGT.......ARMVSYRRDP----SVLK
A9ABK3_BURM1/97-345--L.........ANQLN----GRPLEIFPS-------------KW.LTGRGAAGK.......NRMVAYTKDK----NRVR
Q7N327_PHOLL/60-317--MDRIMAALRKASNND----SFSITFVKV-------------PSNFAKNIVKGK.......TRLAIYTYSE----DYIE
A5PIZ3_9CAUD/86-326--...............----.GGITIESI-------------SE.LEDIDGAGT.......KAALVYEKDP----MNMS
Q2G4R3_NOVAD/110-363--V.............A----GEALTILKS-------------RE.LETAGTGST.......TRMIAYDNNP----QVLK
Q2NRY5_SODGM/71-317--I.........AFKQN----GKPLDIQPV-------------KW.LEKGDEFTA.......NRAVLYSQDR----KYVQ
Q2NSP7_SODGM/16-248--...............----.PGIEFVKA-------------NE.LNAAGKSGK.......GSIVIGTIRN----DILC
A4N6E6_HAEIF/55-278--..........LSAAA----GREVAIKAL-------------PSNFGTRVTSGK.......TRAMVYVNSK----EYVI
Q333F7_9CAUD/77-311--...............----.PGLTIRFL-------------QF.LDNYDGAGG.......KAALAFEKSP----LNMS
A5UGK3_HAEIG/78-315--...............----.PNLTIQGL-------------WE.LEKAGTGNK