Sequence alignment for CL0373

PF09950

Q9P9P2_XYLFA/84-327--------------------------------GRG-.KRH--------.SGRGEDIPTVDVAY-----------------
E1VAC6_HALED/80-318--------------------------------GMA-.KFI--------.SNYADDLPRVDVTG-----------------
A9C0G0_DELAS/60-320--------------------------------GRA-.NWQ--------.SGYAKDIPLADVNQ-----------------
A6TKD0_ALKMQ/60-304--------------------------------GAA-.KIF--------AYGASDDIPLVDADV-----------------
H6NDU4_9BACL/55-298--------------------------------GVA-.KIL--------.ANNADDVPFVDVDT-----------------
Q7N327_PHOLL/62-316--------------------------------KD.-.GII--------.GNKTNSLKTIDSDI-----------------
Q6FAE7_ACIAD/80-324--------------------------------GIG-.KDY--------.SGTGGDLPLAEVEY-----------------
R6PG10_9CLOT/91-341--------------------------------GMA-.KII--------.HNYATDLPRADVKG-----------------
B4EG48_BURCJ/103-345--------------------------------...-.SWI--------.GKDASAIAGLSLDI-----------------
C5AFU5_BURGB/112-366--------------------------------...-.NWI--------.SNEGNAIAGPSVDI-----------------
R6AF56_9FIRM/26-279--------------------------------NDL-.SIV--------.GTASNTIPVMQVST-----------------
K8E4M7_CARML/57-293--------------------------------GAA-.KII--------.ANGADDLPLVDTDL-----------------
E3HGR1_ACHXA/80-315--------------------------------GMA-.TIV--------.ANYADNLPRADVKG-----------------
C9LU84_SELS3/82-338--------------------------------GQA-.DGV--------.GGIQNAVRRIQADL-----------------
R7JXV9_9CLOT/86-336--------------------------------GMA-.AII--------.NNYATDLPRVDVQG-----------------
B8IDG5_METNO/63-315--------------------------------GQA-.TWL--------.HGAADDVPKAEVLR-----------------
R6R1V3_9FIRM/101-351--------------------------------GFA-.AII--------.ANYASDLPRVDVKG-----------------
H8L668_FRAAD/90-334--------------------------------...-.AWV--------.GKDASAITGLGLDI-----------------
R6RQ09_9CLOT/93-346--------------------------------...-.GIV--------HAGGSNGIPMVQADF-----------------
Q0BRS5_GRABC/66-316--------------------------------GRA-.QWF--------.NGQAQDVPRADIVR-----------------
Q2NSP7_SODGM/17-247--------------------------------GEP-.KII--------.SDNADDLPTIDRGL-----------------
B8IIV0_METNO/63-315--------------------------------GRA-.KWI--------.TGQAHDVPRADVLR-----------------
Q6XQD3_BPT1/82-319--------------------------------GTA-.QII--------.ADYTDDLPLVDALG-----------------
A9I906_BORPD/80-320--------------------------------GMA-.KII--------.ANYADDLPRVDVYG-----------------
Q2G4R3_NOVAD/111-362--------------------------------GQA-.EFM--------.GGGAFDMPYASTQM-----------------
W8UFX7_YEREN/64-311--------------------------------GEL-.QIF--------.GPNSTDVPTVDIAM-----------------
A7ILG8_XANP2/103-352--------------------------------...-.SWA--------.SLEATARPRAVLDI-----------------
Q32EP9_SHIDS/73-313--------------------------------...-.NWV--------.GKDSTAIAGVNVDI-----------------
G2IHV9_9SPHN/64-315--------------------------------GRA-.EYI--------.SAKGFDIPNVSKQM-----------------
Q835B4_ENTFA/57-293--------------------------------GAA-.KII--------.ANGADDLPLVDIDM-----------------
D0UIJ0_AGGAD/58-304--------------------------------D..-.GLI--------.TVGTSTLDQVEVGF-----------------
Q984H1_RHILO/86-339--------------------------------GQA-.QWF--------.NGNAHDVPKVELTR-----------------
Q2NRY5_SODGM/73-317--------------------------------ADG-ESWI--------.SHSTNVIAGIDLDI-----------------

PF04454

D4H156_DENA2/1-251----------MN.LLRKDFAPIGSAAWDEI..NTI-AKET--------LKANLSARRFADVEGPYGINFAAVNLGRLKIS
C8WPL7_EGGLE/1-257----------MD.YLARESADLSDGLWNRI..DET-VIGT--------ARAQLTCRRFLKVFGPLGAGVTTVAVDGVNKE
D0LZ74_HALO1/1-251----------MD.LLKRHLAPIVPDAWSAI..DEE-AKEI--------FQGHLAGRKLVDFRGPFGWEYAAVNTGELRPI
D1B7I4_THEAS/1-249----------MD.VLKRGFAPISQEAWGVL..DQQ-ARVI--------LRENLSARRFVDVEGPKGWDFPGFGTGRLVLP
A1B987_PARDP/1-251----------MD.NLHRKLAPISDAAWAQI..EDE-AART--------LKRYLGARRVVDVHGPEGFGLSAVGTGHLRPA
A3DFK3_CLOTH/1-257----------MD.FLSREGSPISAELWEKI..DEA-VVSA--------AKKILTGRRFISIYGPLGAGIQAINVDNISEL
A6TWC5_ALKMQ/1-250----------MD.ILKRDMAPLTESVWEEI..DQR-AAEV--------LKTHLSARRVVNIVGPKGWDYTVVPEGRLKKI
A7HIB4_ANADF/2-255----------TT.WLDREGAPFAQEVWDRI..DAV-ARSA--------ADEVRAGRRLLEVVGPLGFGARAGVAEDLPLG
A7I7A2_METB6/2-249----------ANVYLGRDEAPIGAESWKLI..DDV-AVQA--------AKGQLAGRRLLAIEGPYGFGLKAIPLGDYALE
A8F8I8_PSELT/3-247----------NK.YLMQEDAPFDPKLWQLF..NET-MTDI--------AKAQLVGRRILSVKGPFGLGLKQISITDVQIE
A8L1F1_FRASN/1-253----------MN.HLLRGHAPLSEEAWKAV..DEE-ARSR--------LTTNLAARKLIDFAGPHGWAYSATPIGRVTAL
A9BEM3_PETMO/1-251----------MD.FLKRELAPITEEAWEEL..DER-AKEI--------FKNKLKIRPIIDVEGPYGWDYSSYNLGTNELI
A9FWS5_SORC5/3-254----------MD.LLKRELAPILPAAWDLI..DHE-ATRV--------LKLHLAGRKVVDFRGPFGWEVAAVNTGRLRAI
A9H5P1_GLUDA/1-251----------MN.NLHRELAPISEAAWAQI..EEE-ASRT--------LKRYLAARRVVDVPEAKGFGFSAVGTGHVERI
B1VSP7_STRGG/1-251----------MN.NLHRELAPVTPSAWEEI..EEE-ARRT--------FRRHVAGRRVVDVSDPAGPTLAAVGDGHLTDI
B2A6K6_NATTJ/8-259----------MN.LFKEQLAPLTNAAWNEI..NDR-AAQV--------IKSNLSTRKVFKINGPKGLDYPAVSEGRLSEI
B2GID2_KOCRD/1-252----------MN.NLHRDLAPISSAAWADM..GDE-ARRT--------FAARAAARRTVDMPEPAGAEFSALGTGHVSRV
B2JNZ6_BURP8/1-251----------MN.NLHRELAPISSEAWSQI..EEE-VART--------FKRSVAGRRVVDVKGPGGVDLSGVGTGHQSTI
B2V6Y3_SULSY/1-265----------ME.FLKRNEAPLSESDWEKI..DKV-VVET--------AKRVLVGRRFIEISGPYDPSVQFVPYDYIEDG
B4UA40_HYDS0/1-265----------MN.FLHREESPLTAQEWQTI..DNI-VVNT--------ARNHLVGRRFIELTQALDPAIQSVAYDTIPSL
B8CYH7_HALOH/1-249----------MV.NLKRSLAPITPDAWEFI..DKE-ARRV--------LKLKLSARKAVDFVGPKGIKYAAVNTGRRTAL
B8EQK3_METSB/1-251----------MN.NLHRELAPISDAAWAQI..EEE-TTRT--------LKRYLAGRRVVDMPQTGGVALSAVGTGHLLSI
B8GHL2_METPE/5-250----------S..YLGRSDAPITAETWTII..DTT-MVEA--------AKSMLTGRRLLHLEGPYGLGLKAIPLQDSVSE
B9JHD1_AGRRK/1-251----------MN.NLHRQLAPISDSAWAQI..EEE-ASRT--------LKRHLAARRVVDVQDPGGVELSAVGTGHLKPI
C0R0J8_BRAHW/1-256----------MD.YLARESSPFEESFWQNI..DKV-VVET--------ASRTLIGRRFLSIYGPLGAGAISVQYDKSDRE
C0ZHN4_BREBN/1-265----------MDKLRKYPDSPLTTEEWNQL..DAT-VVDM--------ARRQLVGRRFIDIYGPLGEGIQTITNDVYEES
C0ZVK4_RHOE4/1-251----------MT.NLHRDLAPISAAAWAEI..EEE-ASRT--------FKRHVAGRRVVDVEGPSGDDLAAIPLGHQVPI
D5UVK7_TSUPD/1-251----------MN.NLYRDLAPVTSAAWSEI..ETE-ATRT--------FKRNIAGRRVVDLGDPLGPTASAVGTGHLLEV
C4XPM7_DESMR/1-251----------MD.ILKRDLAPVTAAAWQAV..DSR-ARQT--------LTTMLSGRRVVDVAGPLGWEYAAVPLGRIEYA
C5B5H8_METEA/1-251----------MN.NLHRELAPISDAAWAQI..EDE-ASRT--------LKRYLAARRVVDVVGPKGPGYAAAGTGHTRPI
O67639_AQUAE/1-267----------ME.FLQRDQAPLTAEEWEQI..DKT-AYEV--------FKSTVVCRKFMPVVGPFGAGHQVVSYDVLYGV
Q08WR7_STIAD/2-266----------PD.FLGHAENPLREEEWARL..NET-VIQV--------ARRSLVGRRILDIYGPLGAGVQSVPHDEYQGV
Q0RH88_FRAAA/1-253----------MN.HLLRGHAPLTDAAWKAV..DDE-AKAR--------LTTNLAARKVVDFAGPHGWEYSATALGRVAAL
Q2RVS0_RHORT/1-258----------MN.DLMRDLAPISAKAWAEI..ETE-ARGT--------LTVTLAARKVVDFKGPLGWDASSVSLGRTEAL
Q5YPL3_NOCFA/1-252----------MN.NLHRELAPITSEAWAAI..EEE-AGRT--------FKRHIAGRRVVDVAGPHGVDFSAVGLGRTTGI
Q7MSM9_WOLSU/1-252----------MD.ILRRENAQFPASIWSAI..EKE-AGLV--------FGKHLTGRKVVDFKGGLGIGFSSLPTGRVISS
Q97V86_SULSO/96-329----------ET.....KDFPLIPTSSKEISKDHI-VSWI--------TEGIVSSRIMRNIGNTIKYEFTTIPLSEIKED
B2HH42_MYCMM/1-251----------MN.NLYRDLAPVTEAAWAEI..ELE-ATRT--------FKRHIAGRRVVDVSDPGGPVTAAVSTGRLIDV
Q0SE23_RHOJR/5-254----------.S.NLHRNLAPVTEVAWQQI..GEE-AART--------FKRHVAGRRVVDVAGPFGYSYSAHNLGRVTPI
Q2IH48_ANADE/1-259----------MS.WQDRDGAPFGQQVWDRI..DEA-IEAA--------AAEARAGRRLLRVIGPLGFEARAGVADDAPAG
Q5L1H9_GEOKA/8-264----------.......PEAPLTSSQWGEL..DEL-VIET--------ARRQLVGRRFIDLYGPLGEGVQSVANDIYMNP
MARIT_THEMA/1-251----------ME.FLKRSFAPLTEKQWQEI..DNR-AREI--------FKTQLYGRKFVDVEGPYGWEYAAHPLGEVEVL

PF05065

E0THR4_PARBH/115-394----------GAVLSPQET.S-----------DVI.DLKL--------RDASP.MRQLATVRR..IS.ANVFRK.PVPLT
Q1GG15_RUEST/131-399----------VGDGVAPTR.L-----------PGI.QGLP--------QRRLT.IRDLLAQGRMDGNTIEYVQE.TGFNN
Q1DCZ9_MYXXD/94-361----------AGVLVPIQQ.S-----------GEV.IEFL--------RPDAA.MLKLGVRTQ..TF.KGELHM.GKQTG
Q0AAI8_ALKEH/83-374----------QGVTVRSDW.A-----------DQI.FKKI--------RESSP.VRQVANNLS..TN.SNELEV.LVDRG
Q3J4R6_RHOS4/160-429----------AGPLIAPQR.E-----------TEI.VGLP--------RRQVF.VRDLLSRSTTNSNLVQYARM.KARTN
A1T829_MYCVP/9-278----------HGIVVPDEL.G-----------DLV.IAAA--------ARASVALRASVVVTT..ASREYRVPV.LSGLP
Q982R8_RHILO/176-465----------GGYLVPTET.E-----------KTI.DRIM--------GVTST.MRQLATILP..IG.TSEYKK.LVNMG
A1AYY2_PARDP/166-435----------GGGLIWSDR.E-----------TEI.VGLP--------RRQMT.IRNLLSQGRTGSNAIEYARQ.TTRTN
Q1ILS6_KORVE/495-776----------GTNFVQTTIRP-----------DEF.IDLL--------RNRLV.VMKMGARKL..GDLQGNLQL.PKQTA
Q1GH34_RUEST/388-661----------GGNTIANPLLT-----------QSF.IQML--------RNRTI.LLQL.ATPL..MGLVGNPDI.PTQEG
Q2GAM7_NOVAD/185-459----------AGDLIVPQR.Q-----------PGI.IGLP--------QRRMT.IRDLLTPGNTGSNAIQYVKE.TGFTN
Q8XYS4_RALSO/130-408----------GGYTVPRTF.L-----------AKV.VEQL--------VTYGG.MASVMQNLT..TDGGEPIDW.PVALG
Q3J3K4_RHOS4/110-395----------GGYLVDPQT.S-----------DAI.RSML--------LSTAS.IRQIAGVVH..VE.ATSFDV.LIDRT
Q1QLS4_NITHX/103-379----------GGYLAPAEF.S-----------AEV.VKGI--------VEMSP.IRQAARVGS..TS.SGEVLL.PKRTG
Q8ED08_SHEON/122-393----------GAGLVRPDR.M-----------AGI.VAGP--------ERRLT.IRDLIAPGETESNTIEYVKE.TGFTN
Q813J9_BACCR/150-424----------GSVTIPDFL.S-----------KEI.ITYA--------QEENF.LRRLGTGVK..TKENIKYPV.LVK..
Q3J5Z4_RHOS4/150-439----------GGVTIPRPQ.A-----------AEL.IEML--------RARVV.VRASGARTL..PMPAGEMRH.AKQVG
A1B638_PARDP/102-387----------GGFLAAPTV.A-----------MQV.QEAL--------NVTAS.LRRVANVVA..VE.SASYEV.LVDMG
Q0AWY3_SYNWW/43-310----------GALTLNPKG.Q-----------SRY.MAAL--------EKEGL.FRSLATDIR..AY.NYNYNI.KTANG
A4YU30_BRASO/140-423----------EGVLVPTEW.R-----------EQI.WSLV--------FADND.LLGFCNPEP...TQGNTVGI.VKDET
Q2NV28_SODGM/127-397----------TGTIVAPDR.Q-----------ADI.LTKP--------KQRLF.IRDLIASGKTQSNTIYYVKQ.KGFTN
Q1GHS2_RUEST/113-395----------GGFLVDPQT.A-----------DVV.RSVL--------HSTAS.IRAVASVVN..VE.ATSFDV.LIDHS
Q2L2B0_BORA1/123-401----------GGYTVPRTF.W-----------AKV.VESM--------KQYGG.IASVAQILT..TDGGGPIEW.PTSNG
A2SD63_METPP/97-385----------GGYMVLPQM.S-----------DEV.TRVM--------LETSP.LLSSVRLVD..LEPTDEFEE.IVDRD
A1TML8_ACIAC/138-428----------GGVLVPENF.A-----------TSV.IESL--------RPKSV.IRRLGAVSI..PLNNGNMTL.PRIMG
Q1QKG8_NITHX/112-388----------GGYLAPAEF.S-----------TEF.IRDL--------VQFSP.IRALAIVRD..TL.APSVSY.PRRTG
Q0S2A4_RHOJR/9-273----------ENAFTPEDY.G-----------KLI.DTEV--------DAKSV.AFQAATVVN.TDKHQIRVPI.LVSDP
Q6LSF8_PHOPR/134-417----------GGYTTAPEW.I-----------RQV.EQAM--------KAYGG.MYDVSTVMR..TATGNTINF.PTTDA
A5N1H4_CLOK5/152-424----------TDAIIPEAV.I-----------DMI.QARL--------GDYSA.LYSEVYVQPL....TGTARI.IMDGA
A7HRJ6_PARL1/148-433----------GGYLVPVET.E-----------KLI.DRII--------SEVSP.IRAIAGIRQ..IG.SASYKK.PFAAG
Q2YMS9_BRUA2/137-422----------GGYLVPAEL.E-----------TEI.GRRL--------AVLSP.IRGISGVRQ..VS.GAVLKK.PFSIS
Q73HT5_WOLPM/107-395----------GGYLVTPHI.V-----------KRI.NKRV--------TDSSP.MRQICSSQR..IS.TETLDY.IIEDF
Q9A4P7_CAUCR/53-338----------GGYVAPPEL.E-----------RLI.LRRL--------AATSP.MREICQVRT..IG.AGTFRK.PVSPT
Q3Z7J9_DEHM1/124-397----------GGYLVPDEY.E-----------KQL.IDAL--------QEENF.FRSLATVIQ..TQ.SGTHTI.PVVAS
Q830G6_ENTFA/163-444----------GSVTVPEVI.A-----------SEV.ISYA--------QEENL.LRKYGTVIR..TAGDVKYPI.LVK..
A7MP72_CROS8/125-401----------GGFTVPKQF.R-----------NRV.VEAM--------KAYGG.IAGVCQILS..TSNGQDIDW.TYSDG
A7ILP2_XANP2/167-448----------GGYLVPTAT.S-----------ARI.LTRI--------WETSP.LRQLSTVET..IG.TDKIEI.PIDDD
B0T632_CAUSK/96-391----------GGITVPTNI.H-----------TDV.VEKL--------RKSSP.LLGLSTVTSLKGLQKLLLKTSAAQAN
Q11H37_CHESB/111-386----------GGFLVPDNF.V-----------AEM.LRNV--------VQFSP.VRQYARVMN..VA.GANVRM.PKRTG
Q88G49_PSEPK/193-483----------GGVLVPQNF.S-----------SEV.IELL--------RPKSV.VRKLGAVSL..PLENGNLTV.PRIKG
Q72BY4_DESVH/118-395----------GGYTVPRET.A-----------TSI.IEAL--------KAFGG.MRDVATIIT..TASGAPLNY.PTSDG
B2JU92_BURP8/137-421----------GGFLVPPQF.A-----------SEI.FTLS--------LEEQA.LLPMTDSTP...ISGNSMVFPKDETT
Q81Z09_BACAN/121-392----------GS.VIPQTV.L-----------DKI.IEKI--------EAVGM.ILPLITRTA..IKGGVTVPT.SAVKP
Q3SS55_NITWN/107-382----------GGYLAPTEM.A-----------TEF.IRDL--------VQYSP.IRGLASVRS..TS.APAVSY.PKRIG
Q2GDU5_NEOSM/81-367----------NGFPLTDTL.I-----------NSI.HEQM--------KKLSP.IRKLASVNT..IS.TDCITY.ISNGD
Q3SSD8_NITWN/135-418----------GGFVVPDQM.E-----------AAI.DRVL--------GTVSA.MRAISRVMS..IS.SGTYKK.LVNQG
A6VNQ3_ACTSZ/129-407----------GGYTVPKEM.Q-----------ARI.VEQM--------KAYGG.IAQVAQILT..TSDGRTIEW.ITADG
A5N291_CLOK5/33-297----------GAYVAPDEF.R-----------EGF.NTAL--------AKENI.LRRFATVIN..LS.SAEGKI.QAVSS
Q5WID4_BACSK/129-404----------GGYTVPEDI.S-----------REI.LKSI--------HEMNT.VRNLVTVVP.KNTSYGNYTV.RKGVA
A4XZF1_PSEMY/131-410----------GGYLVPREF.S-----------ANL.LEAL--------KDFGG.MRAVAQVIR..TETGAAMDW.PTTDA
Q2N5Z6_ERYLH/94-380----------GGYAVPQQI.D-----------AMI.AREL--------VEISP.IRALAQVVQ..TG.SAGYRK.LVSTG
Q2GJL3_ANAPZ/114-389----------FSYLIPKKI.H-----------LHF.DKLL--------SQNSI.MRKLCSIEK..IS.SDSLEY.LISNN
A9BYD9_DELAS/120-394----------AGDLIVPDR.V-----------PGI.VAPG--------LRRLT.IRDLLNWGRTGSNAVDFARE.LVFTN
Q5Z3V6_NOCFA/148-434----------GAFVVPE...Q-----------TGI.VEML--------GRRPLTIRNLVSVRRTGSDAVEYVEQ.TSHTN
A5CD71_ORITB/88-365----------GCYLVQPTL.H-----------QKI.VGGI--------KHKSP.MRQLASLEL..IS.SSALDT.VIEDN
A8FGQ6_BACP2/20-302----------GG.LMNATQ.S-----------NTF.IRMM--------QNTPT.VLNDARIIPMESDSQKIEKIGFGQRI
A1TD88_MYCVP/110-388----------GGFLVPMQLDP-----------TII.LTAN--------GSFNQ.VRQISRVVQ...ATGKSWTGVTSAGV
A9CJN8_AGRFC/134-419----------GGFLLPSET.D-----------GEI.GRRM--------TAISP.IRALATVRQ..VS.AAVLKK.PFALG
A3DG61_CLOTH/127-416----------GGFLLENEF.I-----------NDL.FESM--------MAQSQ.VANRIRMIPIGANTNRLRALGIDENS
Q2SDM1_HAHCH/110-393----------GGFGVPEEL.D-----------RQI.LELE--------RELSP.MRALCRNIQ..VS.TDGYKR.LVNLG
B2JL19_BURP8/113-379----------NQYPVPSDR.R-----------TTI.IPPG--------MNDVW.IRDLLPGGTTTSNLIEYPRE.KAAQL
B7GIM9_ANOFW/146-418----------GELTIPEVV.V-----------NRI.MDIM--------GDYTT.LYPLVDKIR...V.KGTTRI.LVDTD
B9KI56_ANAMF/104-375----------.AYLMPREI.S-----------MHI.DKRL--------SQSSV.MRKLCSVEKVSGDSLEYFTT.NNKDT
C5AYR6_METEA/135-420----------GGYLVPPTI.E-----------REV.LRRL--------AEISP.IRAIATVRVV..S.GGQYKR.AVSVN
P71947_MYCTU/196-475----------GGFLIPAAL.D-----------PAILLSGD--------GSTNP.IRQVARVVQ..TT.SEVWRGVTSEG.
Q2FX56_STAA8/38-311----------...TLLNDF.T-----------TPI.LQEV--------MENSK.IMQLGKYEPMEGT.EKKFTF.WADKP
Q2G1W8_STAA8/130-399----------.FVVIPEEI.V-----------TDI.LKLK--------EVEFN.LDKYVTVKRVTNG.SGKYPV.VRQSE
Q3J3W7_RHOS4/239-509----------GGYLAPKEF.G-----------DEL.FKNL--------IEFSP.IRKYARVVQ..IS.APEITY.PKRVT
Q81X82_BACAN/69-344----------GAITVPTSL.S-----------NVI.VEKL--------VEEAA.LFGRAKSFT..PV.SGTLEV.LREKN
Q81XY0_BACAN/102-381----------GNVVLPKHS.A-----------TDI.RPTF--------NEVST.LIDRVSSKTLKGGESYQQPY.IKSYG
Q88MK4_PSEPK/141-410----------.GVAIQPTR.V-----------PGI.VVGP--------EREFT.IRDLIMPGRTGSNAVEFVQE.TGFQN
Q9CFS0_LACLA/124-389----------AGLTIPQDI.R-----------TMI.NTLV--------RQYDS.LQQYVRVESVSTS.NGSRVY.EKWTD
Q9P9R2_XYLFA/357-623----------GGNIIATELHA-----------SSF.IEIL--------RNKTW.VMQRATVMG..GL.VGNVDI.PRQKG
Q9ZWV6_BPPHC/121-387----------...VLSRTL.Y-----------GQL.IAQA--------VERSA.IMRGGASTFTTSD.ANPMDF.TVITG
W6SDV8_9CLOT/124-396----------GGYLVPDEF.E-----------RTL.VQTL--------EEENV.FRKLAKIIQ..TS.SGDRKI.PVVVT

PF06673

Q9MCB6_9VIRU/1-347----------MGVNETQEMMKQAIEAGVKVRELETKVEEL--------NKEREELKKEREANIPSEKPQDVERKFMRELG
Q9MCB8_9VIRU/1-347----------MGANETQEIMKQAIEAGVKVRELEAKVEEL--------NKEREELKKEREASIPSEKPEDAERKFMRELG

PF05125

D3UZQ7_XENBS/11-324.LQNYSVGLAKAYGVTDT....SRYFALSDPKETALRAAL--------LES.VEFLNMITCADVDHLSGQVVSVGNPGLF
A6TE73_KLEP7/8-340KFNAYLSRVAELNGIDPDDV..SKKFSVEPSVTQTMMNTV--------QMS.SAFLQKINIVPVDELKGEKIGVGVNGTI
M9X6X0_MANHA/8-336KYNAYLARQAELNNLPFNALATGIKFTVQPSVQQKLYEKV--------RES.SDFLKSISFVFVDEQTGETLGLDSAHTV
Q5E389_VIBF1/11-331...GYKKAVAASNNVSDV....TEKFNVTPNGAQKIIAQI--------RER.NWLLGKINIVPVSNQKGEAIGLGVTGMI
Q2S7I3_HAHCH/8-327LFNDMCAAMAATYGVGSV....AEQFNVEPTIAQELQDKI--------TES.SEFLQLINVVAVDELKGEKVIGSVTGFV
Q15Y13_PSEA6/12-335.FAVMLGLMAQTYGVDSV....AETFSATPEVHQMLMDKI--------VLQ.SSFLQQINVMPVTEIKGQKILGSASGLV
H2IY53_RAHAC/8-339LFDKYIQRQAELNHISPAHI..TKAYSIDPSVEQTLEDKV--------QQS.SEMLKLINIYGVNDQNGEKIGLGVSGPI
B8J319_DESDA/15-323......SALAQGYSVPSV....GEHFAIEPSVAQRLNDKI--------VEQ.STFLPRINIVPVDELVGENLLGYAKEPV
W8UNE7_YEREN/11-324.LANYSAGLASEYGVNDP....SRYFALTDPKETAMRSAL--------LER.ADFLSMITCADVDQLQGQVVSVGNPGIF
C1DBL5_LARHH/8-337QYTQFVTQLARLNSVPSAE....KSFTVAPSIQQTLESRI--------QQS.SEFLSRINVIGVPEMAGEKIGLGVTGTI
E6WE37_PANSA/8-338KFNAFLIQLAKINDVAVPDI..SAKFTVEPSVAQKLESKI--------QES.AAFLQMINIIPVDEQSGEVLGLGVGSTI
C5BH00_EDWI9/18-332KFSDTFNDCGRSG.........DMQFTLTEPRAIALRKAL--------LES.TEFLRLINLMDVPHPQGQVVTVGESTLR
B2FIZ5_STRMK/8-334LFDGFTQQIATLNNVSGVV....NTFAVEPTVQQALEARM--------QEN.STFLQAINMPGVAELKGEKIGVGINGTI
C1DS28_AZOVD/8-332LFDAYLGQIAQLNGVADVS....RKFTATPTVAQRLETRI--------QES.SEFLGRINMIGVAEQSGEKIGLGVSGPV
Q8XY26_RALSO/8-332LFTAYKDAIAKLNGVARVD....EKFSVAPSVQQKLETKV--------QES.SDFLTRINFYGVPEQEAEKIGLGVSGPV
D8MKI1_ERWBE/9-341.WDAYNLRQAQLNGAKPEHVANSKHFSITPSVAQKLEDKI--------QDS.SELLKKINVVPVSEQEGEKLGLGISGPI
F6IH75_9SPHN/8-355LFKSYVSQIALLNGIDVEDA..VTKFSVSPAVEQTLEEKI--------QES.SDFLSEINIVGVPQQTGQKVGVTVTRPM
J7TAL9_MORMO/8-339KFNDYLMRLSALYEVPVEEL..TSKVEITPSVAQTLEDNV--------QQS.AAFLGFVNIVPVPEKTGQVIGLGVGSSI
B2VH98_ERWT9/8-339KLNAYMSVLAEINKINLSAL..NSKFTVESSIAQTLETKI--------QES.SAFLQAINITPVDEQSGERLGLGIGQTI
F4HA06_GALAU/6-327EFYSFLRNVANYYGTDVDALIRGESFALEVPKAAELGENI--------QQR.SEFLKSINLDYVTDVSGYKLRGATEKSI
G0AIP5_COLFT/8-331AFEGYTSQIAQLNATSSVQ....HTFSVVPTVQQKLEDKI--------QES.SEFLKKINIIGVTEQEGEKLGLGVSGPI
F0LXI5_VIBFN/8-332KLSAYVQAVAQQNGVENA....TEMFNVSPNGTQRIIAAI--------RES.NWFLSRINIITVKNQIGEAIGLGVSGMI
B0UTP6_HISS2/8-335TLMNYIQGISNDNQEDFSRIARGAKFNVTPSVQQRLENAV--------QES.SDFLKLINIVPVDEQQGEILGLGVSGTI
CAPSD_BPP2/8-340KFNAYLSRVAELNGIDAGDV..SKKFTVEPSVTQTLMNTM--------QES.SDFLTRINIVPVSEMKGEKIGIGVTGSI
H2IRH6_RAHAC/8-340KFNAYLSRLAELNGVDVEDL..SKKFSVEPSVTQTLITTV--------QES.SEFLSRINMVPVDEQEGEKIGLGVTGSI
B4F0K8_PROMH/8-339KFNAYLTQLGKIYGVSAQAFS.DTKVQIEPSAAQTLETNI--------QQS.AEFLTHVNIVPVDEQVGEAIGLGIGSTI
B0UW33_HISS2/6-327IYNAFIQAIAQHYNVPFAEVRLGEEFSLEAPKAALLGSNI--------QQS.SDFLKEINMVQVTDLKGLKLWGATEKGI
E6VXL3_DESAO/8-324KFSELCAALAEGYGVETAKV..TQGFTVAPTVEQRLQDAI--------TEQ.SEFLPLINVITVSELVGQNVLGSASGPV
A6VSU1_MARMS/18-341....HFADTAEAFNVTPRDPSVGQHFSATPSVAQTIYEKI--------VEHGDDFLKLINVIGVRDIKGEKVGMSLSGRS
C5AGA6_BURGB/8-333ALTRYMDNIAKLNGVASVA....EKFAVAPSVQQTLEKRI--------QES.AAFLQRINVQGVTEQMGEKLGLLIGAPI
J7SK37_MORMO/10-341AYLSYLDNQARLNHAVRDGK..SLQFSVDPSVQQKIEKAV--------MES.SPFLKEINSFGVTEQEGSTILVASSQPI
W0L880_9ENTR/8-339KFDQYLSRQAELNHIPVSSV..TAKFSVDPSITQTLENRI--------QES.SEFLTRINISSVSEQEGEKLGLGIDAPI
Q1QXQ6_CHRSD/8-331LFNQFADQVAKLNGVPDAT....QKFAVDPTIQQRLEKRI--------QES.SDFLNRINMIGVDELKGEKLALGVSGPI
C5BAR3_EDWI9/8-332KYNAYVETIAGLSGIQSAA....VEFTVEPSVQQTLETKI--------QAS.VEFLTKINVHEVVDQEGEKIGIGVDRPT
F4HB41_GALAU/8-340LFTGYVDRIAQLNNVAAEDV..KEGFSVEPTAEQKLVDKI--------TLS.SDFLQRINVISVTNQIGERIGLSVANAI
Q63LE5_BURPS/8-332AYEKYAAQIAKLNDTGDVS....KKFAVEPTVQQRLETKM--------QES.SEFLKRINVLPVTELEGEKLGLSVSGPI
A7MN35_CROS8/15-328....YHKKLTKDTAYREGE...NRRFALAPPAENMLRAAI--------LES.GWMMNNITLRDVNAQSGNAINIGASELH
A1VSG1_POLNA/8-331AYNSFLQRQEQLNGVPSAR....ESFTVVPSVQQTLESKM--------QES.SALLAAINVIGVREMSGEKLGLGITGPI
F0LQ00_VIBFN/14-328...AYSSQVIANAGVQEG....SLMFNLTPPMETKLRQAI--------MQS.DSFLGQITLLPVQQITGQVVDVGQDGLS
Q6D3X2_PECAS/8-339LFDQYVARQAQLNGVSSAAI..AAKFAVDPTVQQRLESAA--------QES.DTFLRKINVFGVTQQIGQKVLIGSKGPM
CAPSD_BPHC1/5-328AYYALAAALAKHFNQPLDSVLRGESFALKAPEAALLGENI--------QQR.SDFLKQINMIQVAHTKGQKLFGATEKGV
D8J087_HERSS/8-337AYNAYTTRLASLNDVAGGAV..HSTFSVEPSVQQTLEDKM--------QES.SEFLGSINIIGVDELEGEKIGLGVSGPV
H2FUC0_OCESG/13-333.LDKYSARLAQAYGIDTSKL..EQQFSVTGPQETRLRAAL--------LES.ADFLRMITLADVDQIKGQVVDVGIGSIH
Q8P6J5_XANCP/8-334QFNQFAEQIAKLNGITSAF....HSFAVDPTVQQKLETRM--------QES.SEFLSKINIIPVDELSGQKVGIGVTGSI
E0SAM8_DICD3/25-338YLSAYSAGLAQEYGVADT....ARYFALTDPKETQLRAAL--------LER.VDFLSMINVLDVDQLSGQVVSVGSSALH
D3VKM6_XENNA/8-339KFNAYLTRLGEIHGVDAGAF..SGKVEVQPSVAQTLEDEI--------QRS.AEFLQKVNVVPVSEQSGQAIGLGIGSTV

PF11651

C4K6U8_HAMD5/1-421MANNLESN.ISQIVLKKFLPGFMSDIVLCKTVDRQLLSGE....INSNTGDSVSFKRPHQFKSERTETGDITGKDKNGLF
Q2G3Y7_NOVAD/1-418MATSFTK..QEQVMFDNVIEGFDDMLVIGKAAEV.YQPLD....AQEQVNAQDKFWLPAPMIGASYDGFDQSA.NFDGLT
C5B0T5_METEA/1-404MANSLLT...TQAITREAIRLFKNSNRFLQSIDRQYSDQFA..RTGGKIGNTLNIRLPNDYVVRRGPTA.....VPQDTV
K4L4N8_9FIRM/1-374MGNTILT...PSIIAKEALLQLRNNTVMANLVHRDYSQEF.....VAGVGNTVTIRKPATFEAQEFNRSTGI..QIQDAT
A5VES4_SPHWW/1-413MANSLLT...IDVIAKEALSVLENELVAAKAVHRGLESEFGNAKNGYSSGATVTIKRPTDFTVRSGANA.....SVQDVI
B2U8F8_RALPJ/1-419MANTILT...IDMITREALRLFKNSNAFLKSIDRQYDEDFA..KSGAKIGSALRVRLPNDFTVRRGAAA.....SVQGTN
CAPSD_BPP22/1-427MALNEGQ..IVTLAVDEIIETISAITPMAQKAKK.YTPPA....ASMQ.RSSNTIWMPVEQESPTQEGWDLTD.KATGLL
J7TW41_MORMO/1-425MALNEGQ..IITYMVDEVVNTIENNCPMAQRVSK.YTPPA....ADLQ.RSQNTIWMPVEQEAPTQPGWDLTN.KATGIV
I2B9R2_SHIBC/1-422MATNNLDSNVSQIVLKKFLPGFMSDLVLAKTVDRQLLAGE....INSSTGDSVSFKRPHQFASKRTETGDISGQAKNNLI

PF09950

Q9P9P2_XYLFA/84-327----------------------------------------------------AQKSVPVVL-------------------
E1VAC6_HALED/80-318----------------------------------------------------KEETLKLKS-------------------
A9C0G0_DELAS/60-320----------------------------------------------------DMQTKTFQL-------------------
A6TKD0_ALKMQ/60-304----------------------------------------------------ERHTQKVYG-------------------
H6NDU4_9BACL/55-298----------------------------------------------------RREFQRIYS-------------------
Q7N327_PHOLL/62-316----------------------------------------------------EWHKAPVGQ-------------------
Q6FAE7_ACIAD/80-324----------------------------------------------------DTVSLPIKV-------------------
R6PG10_9CLOT/91-341----------------------------------------------------EPETAHIKS-------------------
B4EG48_BURCJ/103-345----------------------------------------------------GKTPNPLTL-------------------
C5AFU5_BURGB/112-366----------------------------------------------------GKTPQPMRL-------------------
R6AF56_9FIRM/26-279----------------------------------------------------EKNLYKVFT-------------------
K8E4M7_CARML/57-293----------------------------------------------------QRFQQPIYT-------------------
E3HGR1_ACHXA/80-315----------------------------------------------------EEKVAQIKN-------------------
C9LU84_SELS3/82-338----------------------------------------------------SKDLYKVLP-------------------
R7JXV9_9CLOT/86-336----------------------------------------------------ESHTASIKS-------------------
B8IDG5_METNO/63-315----------------------------------------------------RQHETAVAM-------------------
R6R1V3_9FIRM/101-351----------------------------------------------------TPHRAEIVN-------------------
H8L668_FRAAD/90-334----------------------------------------------------GKTMHPLSL-------------------
R6RQ09_9CLOT/93-346----------------------------------------------------SKGTYKAHM-------------------
Q0BRS5_GRABC/66-316----------------------------------------------------DRLRVTVSM-------------------
Q2NSP7_SODGM/17-247----------------------------------------------------NAHATRAHL-------------------
B8IIV0_METNO/63-315----------------------------------------------------SQFESSVSM-------------------
Q6XQD3_BPT1/82-319----------------------------------------------------TSEFGKVFR-------------------
A9I906_BORPD/80-320----------------------------------------------------QEVTARIKD-------------------
Q2G4R3_NOVAD/111-362----------------------------------------------------NQATRNFHL-------------------
W8UFX7_YEREN/64-311----------------------------------------------------NQGFHEIKT-------------------
A7ILG8_XANP2/103-352----------------------------------------------------GKVVSPLHL-------------------
Q32EP9_SHIDS/73-313----------------------------------------------------GKSGNPLNL-------------------
G2IHV9_9SPHN/64-315----------------------------------------------------SQGVTNFFL-------------------
Q835B4_ENTFA/57-293----------------------------------------------------KRYQSPIFT-------------------
D0UIJ0_AGGAD/58-304----------------------------------------------------TPTRSYIVP-------------------
Q984H1_RHILO/86-339----------------------------------------------------EKFETTVSM-------------------
Q2NRY5_SODGM/73-317----------------------------------------------------NKTTLPLTP-------------------

PF04454

D4H156_DENA2/1-251----------DNKSPK......--------------------.....DVVYGVNTVLPLVE-------------------
C8WPL7_EGGLE/1-257----------EVLEDG......--------------------.....IGRIVGRTQLELPL-------------------
D0LZ74_HALO1/1-251----------DDTPED......--------------------......VDMKLRQVQPLAE-------------------
D1B7I4_THEAS/1-249----------EGQQKG......--------------------.....AVRFGVRQFQPMIE-------------------
A1B987_PARDP/1-251----------TALAEG......--------------------......VESHRREVNPLLE-------------------
A3DFK3_CLOTH/1-257----------DETEEN......--------------------.....ISVIRGRTYRHIPL-------------------
A6TWC5_ALKMQ/1-250----------EDNPGN......--------------------......VCTGMYQVKPLVE-------------------
A7HIB4_ANADF/2-255----------EEPEG.......--------------------......AHVHVPRVRPLPV-------------------
A7I7A2_METB6/2-249----------D...........--------------------.......GISASVSLPLSL-------------------
A8F8I8_PSELT/3-247----------P...........--------------------.......GVFSNKTLPLFY-------------------
A8L1F1_FRASN/1-253----------QAPPGE......--------------------.....GVRARLRRVLPVME-------------------
A9BEM3_PETMO/1-251----------ENPRDG......--------------------......LGWGIRQVLPIVE-------------------
A9FWS5_SORC5/3-254----------ERKEGP......--------------------.....AVSAGVRLVRPLVE-------------------
A9H5P1_GLUDA/1-251----------DAPGSD......--------------------......IRAVRRNVLPLVE-------------------
B1VSP7_STRGG/1-251----------DPPTPD......--------------------......VAARARTSTPVIE-------------------
B2A6K6_NATTJ/8-259----------FHGHQQG.....--------------------.....EVKAGLHQVKPLME-------------------
B2GID2_KOCRD/1-252----------AADTPG......--------------------......VEALQRHVVRVVE-------------------
B2JNZ6_BURP8/1-251----------AAPHHG......--------------------......VIAKLSEVKALVQ-------------------
B2V6Y3_SULSY/1-265----------NSGACGLFGE..--------------------.VDCGVVKVKERKILPLPI-------------------
B4UA40_HYDS0/1-265----------DNGACGLFGD..--------------------.KECGIAKIKSRKFLPIPQ-------------------
B8CYH7_HALOH/1-249----------EDKAEG......--------------------......ASIFQRQVLPLVE-------------------
B8EQK3_METSB/1-251----------AAPAEG......--------------------......VLARQREVKPLVE-------------------
B8GHL2_METPE/5-250----------G...........--------------------.......NLIRSGFAPVDL-------------------
B9JHD1_AGRRK/1-251----------PGPGDG......--------------------......VQTALREVKTLVE-------------------
C0R0J8_BRAHW/1-256----------EVFEDG......--------------------.....FVKTSGRKSVELPQ-------------------
C0ZHN4_BREBN/1-265----------RFGGLSLRGE..--------------------..SLEMTQPSRRVSMTIPI-------------------
C0ZVK4_RHOE4/1-251----------NPLADG......--------------------......VIAHARQSQPVIE-------------------
D5UVK7_TSUPD/1-251----------GGPAEG......--------------------......VQAHLRDSRPLVR-------------------
C4XPM7_DESMR/1-251----------KTQSVS......--------------------.....GITYGLHQVKPLVE-------------------
C5B5H8_METEA/1-251----------EAPGEG......--------------------......IRSLLREAQPLVE-------------------
O67639_AQUAE/1-267----------EPGVCEVKPGQE--------------------YKVCEPVRTGERKHVPVPT-------------------
Q08WR7_STIAD/2-266----------SSGAIDIVGE..--------------------.QETATVFTDVRKFKTIPI-------------------
Q0RH88_FRAAA/1-253----------SAPPAA......--------------------.....GVQARVRQVQPVIE-------------------
Q2RVS0_RHORT/1-258----------AEEPKAAGS...--------------------...AAVVTVRKRAVQPLIE-------------------
Q5YPL3_NOCFA/1-252----------AAPDEG......--------------------......VQARQRVVAPLVE-------------------
Q7MSM9_WOLSU/1-252----------KEKLGE......--------------------......ASVGVRMNTPVIE-------------------
Q97V86_SULSO/96-329----------SGDI........--------------------......IQSKSASLYEVPL-------------------
B2HH42_MYCMM/1-251----------KAPTDG......--------------------......VIAHLRASKPLVR-------------------
Q0SE23_RHOJR/5-254----------KTSDSR......--------------------......IRAQQRQVNPLVE-------------------
Q2IH48_ANADE/1-259----------GEDEPEAG....--------------------....DETHVHVPSVRALPV-------------------
Q5L1H9_GEOKA/8-264----------EQGDMSFHGK..--------------------..ELSLSEPARRVHLTIPL-------------------
MARIT_THEMA/1-251----------SDENEV......--------------------......VKWGLRKSLPLIE-------------------

PF05065

E0THR4_PARBH/115-394.PI.......GAGWVG.....E............T..AA...RPETTTP.TLVAIDFPAME-------------------
Q1GG15_RUEST/131-399..........NAAPVAE...GA.....................AKPSSDIKLDVKTTTAKV-------------------
Q1DCZ9_MYXXD/94-361.TS.......VFKWVG.....E............G..ET...VPKSAP..KYGKIVLKAHK-------------------
Q0AAI8_ALKEH/83-374.EP.......DSAWVA.....E............K..GD...RDPTAAS.FMSRHKIAVHE-------------------
Q3J4R6_RHOS4/160-429..........AAGVVAE...GA.....................LKPESGLEYEAADAPVRT-------------------
A1T829_MYCVP/9-278..........SSSFVA.....E...............GQ....ELALNDAVIEELTIVPAK-------------------
Q982R8_RHILO/176-465.GA.......GSGWVG.....E............E..EA...RPQTGTP.TLRELIFTVME-------------------
A1AYY2_PARDP/166-435..........NARPVTE...GA.....................QKPESDYVWAQESALVRT-------------------
Q1ILS6_KORVE/495-776.AA.......TLYWTG.....E............NPGSA...VTATDQ..TTGSVTLSPKQ-------------------
Q1GH34_RUEST/388-661.GA.......TGYWIG.....E............D..IE...ATEDLL..SLGQRQFSPKT-------------------
Q2GAM7_NOVAD/185-459..........NAATVTET.AGT.....................AKPQSEIKFDIVTSSVTT-------------------
Q8XYS4_RALSO/130-408VAE.......EGELLG.....E............G..EA...TGEDDI..DFGIGTLGAHK-------------------
Q3J3K4_RHOS4/110-395.EV.......GSGWAT.....E............A..AT...ISESASP.TIERISIKLHE-------------------
Q1QLS4_NITHX/103-379.RP.......TGSWVG.....E............T..DA...RPGTES..SYGQIEVPIHE-------------------
Q8ED08_SHEON/122-393..........NAAPVAE...GA.....................AKPYSEITFGLVSAGVRT-------------------
Q813J9_BACCR/150-424.KA.......EAQGHK.....N............E..RTNNEMPETDI..EFDEIELSPTE-------------------
Q3J5Z4_RHOS4/150-439.SA.......VAAYAA.....E............N..AA...IAPSQP..SFDKIDQSFKK-------------------
A1B638_PARDP/102-387.DI.......AHGWAS.....E............A..AA...QAETGTP.SVQRVVIPVHE-------------------
Q0AWY3_SYNWW/43-310.ND.......VAAWVE.....E............G..GT...IPIADGMGDFNDIALKIHK-------------------
A4YU30_BRASO/140-423.TPWGA.AGVQAAWRS.....E...............GT....QMIASKAALTPEILQLHE-------------------
Q2NV28_SODGM/127-397..........NAKTVAE...NT.....................AKPYSTIEFEEATVPVRT-------------------
Q1GHS2_RUEST/113-395.DV.......GAGWAT.....E............T..GS...VTETGTP.SIDRIVIPLHE-------------------
Q2L2B0_BORA1/123-401TED.......EGELIG.....E............N..TD...AGEKDV..EFGHDALGAHK-------------------
A2SD63_METPP/97-385.EV.......GVTWVG.....E............L..DS...RSETTAP.ALGKFIVPLHE-------------------
A1TML8_ACIAC/138-428.NT.......TVSYVG.....T............E..QD...IPVTDM..TFGDMKLSAKK-------------------
Q1QKG8_NITHX/112-388.IT.......NAKWKG.....E............T..QS...QEGSEP..AFGQTEITVRE-------------------
Q0S2A4_RHOJR/9-273..........STGWFA.....E...............NT....EITLVDPETDELVIVPTK-------------------
Q6LSF8_PHOPR/134-417TAE.......EGEIVG.....Q............N..ES...AGTKDT..TFGNKTIGSYM-------------------
A5N1H4_CLOK5/152-424.IP.......EGIWTE.....M...............TD....AVQELSAGFSQTELDGFK-------------------
A7HRJ6_PARL1/148-433.GM.......QTGWVG.....E............T..EA...RPQTATP.SLAEIEFPAME-------------------
Q2YMS9_BRUA2/137-422.GP.......ATGWVG.....E............T..DA...RPQTASS.KLAELQFPTME-------------------
Q73HT5_WOLPM/107-395DRA.......GAGWSS.....ETVDDEDGGNKSKY..DF...AKDTDTP.KIQKISVTTYE-------------------
Q9A4P7_CAUCR/53-338.GL.......AAAWVA.....E............T..AA...RPETTAP.TLDVIDFPAGE-------------------
Q3Z7J9_DEHM1/124-397.HG.......TAAWMD.....E............N..GL...YPESDD..TFDQISLSAYK-------------------
Q830G6_ENTFA/163-444.KA.......EANVNK.....K............E..RTT.DITETAI..QFDEILLDPAE-------------------
A7MP72_CROS8/125-401TAD.......MGVMLG.....E............N..EE...ASEGDV..TFEPITIGAKK-------------------
A7ILP2_XANP2/167-448.EA.......SAGWVG.....E............T..EG...RPETGTP.AIGVQTIPVFE-------------------
B0T632_CAUSK/96-391..........TRSERG.....A.....................FTDNTVEGFAGITLGSKD-------------------
Q11H37_CHESB/111-386.TM.......TAAWVA.....E............T..GD...RASTQP..AYGEVELTPFE-------------------
Q88G49_PSEPK/193-483.GA.......VVGYIG.....T............E..ED...MPATDM..QFDDLKLSSKK-------------------
Q72BY4_DESVH/118-395TSE.......EGEIVD.....Q............N..AA...ASDADA..SFGTVGLPVYK-------------------
B2JU92_BURP8/137-421...PWGTDGIRAYWQA.....E...............AS....VATATKPKLGVSTNRLHK-------------------
Q81Z09_BACAN/121-392..........VATWVA.....E...............SS....GSDKQKKTTGSITFNYHK-------------------
Q3SS55_NITWN/107-382.RT.......NAQWRG.....E............T..QA...QTTGEP..TFGQLEIPVRE-------------------
Q2GDU5_NEOSM/81-367.AL.......EAQWVS.....E...............DE...ITNSDAKEHIITTEINTYE-------------------
Q3SSD8_NITWN/135-418.GA.......VGGWVG.....E............R..QA...RPATATP.TLVELAFQAME-------------------
A6VNQ3_ACTSZ/129-407TTE.......EGELIG.....E............N..TA...ATESDT..AFGVGSLGAKK-------------------
A5N291_CLOK5/33-297.TG.......TADWVE.....D............G..DP...IPESADT..FTQFLVKSYK-------------------
Q5WID4_BACSK/129-404..........QKLYNTA..EKE...............QI....KELKNM.EFDQITWNIKK-------------------
A4XZF1_PSEMY/131-410TSE.......EGEIVG.....E............N..AE...VDSQDA..TFGTLAHVVYK-------------------
Q2N5Z6_ERYLH/94-380.GT.......ASGWVS.....E............T..AG...RPETDTP.SFEEIAPPTGE-------------------
Q2GJL3_ANAPZ/114-389QET.......FVGWSG.....D...........HN..TI...VSKSLTP.KLSHINIRLFE-------------------
A9BYD9_DELAS/120-394..........NAGPVGEN.PSG.....................GKPESNITFEAAQVPVVT-------------------
Q5Z3V6_NOCFA/148-434..........AAAVVPEATSAAAPTAPGTAGALVLNPNG...GYKPEGSWAFVRKTAVVKT-------------------
A5CD71_ORITB/88-365.EF.......ITGWVA.....E............Q..DE...RAETKSP.TLLRRKIAVHE-------------------
A8FGQ6_BACP2/20-302..........LRPAEEGQALDA......................KDRVVPATSTVHLNAKE-------------------
A1TD88_MYCVP/110-388..........SGSWDGE..AVE.....................VSDDSP.ELQQPEIPVHK-------------------
A9CJN8_AGRFC/134-419.GM.......TTGWVS.....E............T..AA...RPQTATP.QLAELSFPTME-------------------
A3DG61_CLOTH/127-416RANGSRWGGVQAYWVA.....E...............AE....TAAQSKPKFREIEMSLQK-------------------
Q2SDM1_HAHCH/110-393.GA.......GSGWVG.....E............T..DA...RPETNTP.KLAQIEAFMGE-------------------
B2JL19_BURP8/113-379..........NADYQTE...GQ.....................LKAQSDLSFEMAQAPIVT-------------------
B7GIM9_ANOFW/146-418.TS.......PAVWIE.....Q............A..GA...LPTGDVG.TIASVDFDGFK-------------------
B9KI56_ANAMF/104-375..........FVGWGG.....E...............VQ....SDTAAP.KMSKTTIYLHE-------------------
C5AYR6_METEA/135-420.GP.......AAGWVA.....E............T..AP...RPQTDAP.NLSELSFPAME-------------------
P71947_MYCTU/196-475..A.......EAHWYS.....E............A..QE....VSDDSP.TLAQPAVPSYR-------------------
Q2FX56_STAA8/38-311..........GAYWVG.....E............G..QK....IETSKA.TWVNATMRAFK-------------------
Q2G1W8_STAA8/130-399.VA.......ALEKVE.....E............L..EE...NPELAVK.PFFQLAYDINT-------------------
Q3J3W7_RHOS4/239-509.GT.......SATWVS.....E............V..GD...RTGSEP..SFDQVTLTPHE-------------------
Q81X82_BACAN/69-344.IG.......DATFIG.....E............M..ED.....ASMSDFTFDKVTLEQRR-------------------
Q81XY0_BACAN/102-381..........EGDYTT.....E............G..ND...YNTSET..TFGYADITKAK-------------------
Q88MK4_PSEPK/141-410..........MAAPQA....GE...............GA....AKAQSDLSFGLKTTNVIT-------------------
Q9CFS0_LACLA/124-389VTP.......LTVMDA.....E............D..GK...IPDLDNP.QLTIIKYLIKR-------------------
Q9P9R2_XYLFA/357-623.TT.......QAYWVG.....E............G..DS....PEKSKP.ALDQIHFTPKS-------------------
Q9ZWV6_BPPHC/121-387.RA.......TAGIVG.....E............T..AE...IPESYP..ATTQRSMGGFK-------------------
W6SDV8_9CLOT/124-396.KG.......TAAWLD.....E............G..EE...FDESDS..VFGQTSIGAYK-------------------

PF06673

Q9MCB6_9VIRU/1-347DKM-------TEMPEQ------------------GFLREFANASALNVVNSLGSITSKYAR-------------KSGIYD
Q9MCB8_9VIRU/1-347SKM-------AEMPEQ------------------GFLREFANGADLNVVNSLGSITSKYAR-------------KSGIYD

PF05125

D3UZQ7_XENBS/11-324----------TGRKKD.....G--------------------RFMRATGI..DGNEYKLVE-------------------
A6TE73_KLEP7/8-340----------ASTTDTN.SGKE--------------------RKTADFTAL.ESKKYECDQ-------------------
M9X6X0_MANHA/8-336----------ASTTDTS.GDGE--------------------RKTTSIAKL.VKQTYHCQQ-------------------
Q5E389_VIBF1/11-331----------ASRTNTK.AGKE--------------------RQTKAVYNM.KPMPYLCEK-------------------
Q2S7I3_HAHCH/8-327----------PKRTDTD..SAD--------------------RQTSDVLAL.GSKGYELHP-------------------
Q15Y13_PSEA6/12-335----------TTRTNTT.GAGE--------------------RKGRHLLDL.DAQGYELHQ-------------------
H2IY53_RAHAC/8-339----------SSTNNST..TDR--------------------RQPTNLAAL.DSNKYTCNK-------------------
B8J319_DESDA/15-323----------TSRTDTS.GSGE--------------------RKPKDVLGL.GKYDYQLHK-------------------
W8UNE7_YEREN/11-324----------TGRKEG.....G--------------------RFIRETNV..DGNEYKLVK-------------------
C1DBL5_LARHH/8-337----------AGRTRTG.PGKP--------------------RVARSVADL.DSHKYQCAK-------------------
E6WE37_PANSA/8-338----------AGTTDTS..SQE--------------------RQPTDPTYI.DGTGYKCTQ-------------------
C5BH00_EDWI9/18-332----------TGRVKD.....G--------------------RFTKGSGI..SGNEFRLVE-------------------
B2FIZ5_STRMK/8-334----------AGRTDTS.GNGE--------------------RNPSDPTAL.DAQGYECQK-------------------
C1DS28_AZOVD/8-332----------ASTTNTA..TTD--------------------RATTDLSTL.DDRGYTCSQ-------------------
Q8XY26_RALSO/8-332----------ASNTDTT..QQD--------------------RQTSDIATL.DGRRYRCEQ-------------------
D8MKI1_ERWBE/9-341----------ASSNTSS..TER--------------------RTPRSVHTL.DDDKYRCEQ-------------------
F6IH75_9SPHN/8-355----------ASRTDTA.GGNR--------------------RTPTDPTDTGDNGSYFCRQ-------------------
J7TAL9_MORMO/8-339----------AGTTDTT..KTD--------------------REATDPSEM.TDIKYECQQ-------------------
B2VH98_ERWT9/8-339----------AGTTDTT..QKE--------------------REPTDPTYI.DGDGYKCTQ-------------------
F4HA06_GALAU/6-327----------TGRKKD.....G--------------------RYLARLDH..TQGKYQLTE-------------------
G0AIP5_COLFT/8-331----------ASRTDTS..KAE--------------------RQTRDVSTM.DGHRYRCEK-------------------
F0LXI5_VIBFN/8-332----------ASRTDTS.GDGE--------------------RKPKDYHGM.KAMPYACVQ-------------------
B0UTP6_HISS2/8-335----------AGTTDTN..ATG--------------------RKTQAIHAL.NKIPYHCQQ-------------------
CAPSD_BPP2/8-340----------ASTTDTA.GGTE--------------------RQPKDFSKL.ASNKYECDQ-------------------
H2IRH6_RAHAC/8-340----------ASTTDTD.GGSE--------------------RKTADFQAL.ASRKYKCEQ-------------------
B4F0K8_PROMH/8-339----------AGTTDTT..AKE--------------------RETSDPIKL.TKNSYHCQK-------------------
B0UW33_HISS2/6-327----------TGRKPT.....E--------------------RHIATLNH..TQTGYELAR-------------------
E6VXL3_DESAO/8-324----------SGRTDTKVDGNE--------------------RTPRDVLGL.GSFPYQLYQ-------------------
A6VSU1_MARMS/18-341----------AGRTNTD.GGIE--------------------RKPKHLVKT.DSKGYELHH-------------------
C5AGA6_BURGB/8-333----------ASTTDTT..KAD--------------------RTTVDLTDM.DPNAYVCAQ-------------------
J7SK37_MORMO/10-341----------ASRNTST..TDR--------------------REPAQAFGM.EENTFKCAQ-------------------
W0L880_9ENTR/8-339----------ASTTDTT..VER--------------------RQPASVDNL.DSGKYRCEQ-------------------
Q1QXQ6_CHRSD/8-331----------AGRTNVS..NQD--------------------RQTRDLSTL.DPQGYECRM-------------------
C5BAR3_EDWI9/8-332----------ASRTDTS..QRE--------------------REPVDPIRL.TANRYRCEK-------------------
F4HB41_GALAU/8-340----------ASTTDTD..GKE--------------------RETKSISQL.DSRKYHCES-------------------
Q63LE5_BURPS/8-332----------ASRTDTT..KAA--------------------RQPIDPTAL.DSNRYRCEK-------------------
A7MN35_CROS8/15-328----------TGRTAG.....G--------------------RFRKKVTI..NGSEFWLSE-------------------
A1VSG1_POLNA/8-331----------ASRTNTA..TTD--------------------RSPRSVETL.DNTTYACKQ-------------------
F0LQ00_VIBFN/14-328----------TGRAA......E--------------------RFSVEVGQ..EGNTYTLVK-------------------
Q6D3X2_PECAS/8-339----------AGVNNGT..TVR--------------------RNPGMNHTM.EPFNYTCRK-------------------
CAPSD_BPHC1/5-328----------TGRKQT.....G--------------------RNLANLDH..TQNGFELAE-------------------
D8J087_HERSS/8-337----------ASRTDTS.GDKR--------------------RSTRDASAM.SNRRYRCEK-------------------
H2FUC0_OCESG/13-333----------SGRKAS.....G--------------------RFIKAVGV..GGHNYELTE-------------------
Q8P6J5_XANCP/8-334----------ASRTDTG.AGKT--------------------RTPRNVAAL.DKNEYVAKK-------------------
E0SAM8_DICD3/25-338----------TGRKEG.....G--------------------RFIRQVGV..EGNDYKLVE-------------------
D3VKM6_XENNA/8-339----------AGTTDTD..SQD--------------------RITTDPTRL.TAVEYKCEQ-------------------

PF11651

C4K6U8_HAMD5/1-421S---------AKATGKVGKYITVAVEWTQIEEALKLNQL.DQILSPIHERMVTDLETELAH.............FMMNNG
Q2G3Y7_NOVAD/1-418Q---------LNVPASVGYHKSVPKTLSSKN..LRNAFAMGQYGKAAKQKLSSDVNLALFN.............TVALYG
C5B0T5_METEA/1-404E---------KQTPVAIANQTGVDIAFSTADRALSLDDYSRRVLAPAINVLAGAIASDVM..............GLAENI
K4L4N8_9FIRM/1-374E---------GSESVVLDKLLDVSFEVTAEQLTMDIRDFSEQLLIPAMQGFANKIDLYLL..............GLYNDI
A5VES4_SPHWW/1-413E---------GSTTITVDQQKGVDFAFTSAELTLSIKDLSERVIKPAMVQLANKIDSDVL..............SLAAKV
B2U8F8_RALPJ/1-419E---------QKTSLVMANQIGVDIQFSSAERALSLDDYSERILKPAINDIAGQIAADIMGGMDGLVPAGTLYPDTQLPA
CAPSD_BPP22/1-427E---------LNVAVNMGEPDNDFFQLRADD..LRDETAYRRRIQSAARKLANNVELKVAN.............MAAEMG
J7TW41_MORMO/1-425E---------LSVKCNMGVPDNDFFTLRADD..TRDETSIRRRMKASGLKLANNIETSIAK.............QAADTA
I2B9R2_SHIBC/1-422S---------GKATGRVGNYITVAVEYGQLEEAIKLNQL.DEILQPVRERIVTDLETELAQ.............FMMSNG

PF09950

Q9P9P2_XYLFA/84-327--GTIGY-DYTTEE--LRQSAF---L.R.....KP-LN-TA---RADAAMDAYERHINDVALF.....G-----ED...E
E1VAC6_HALED/80-318--LGDAY-GYSLDE--MRLANA---M.G.....TN-LP-ER---KGRTARRAIDQLINKVAMV.....G-----DA.KHG
A9C0G0_DELAS/60-320--AAIGY-QWNLEE--VNTTMA---FPG.....AS-LS-DR---RARAARLAYMKFMFDLTLK.....G-----SP.EKG
A6TKD0_ALKMQ/60-304--VVVGF-TIGIQE--KRAAQM---A.N.....RT-ID-IT---KAIAARRAVAEKENRFFYV.....G-----SE.AHQ
H6NDU4_9BACL/55-298--IVAGF-AYTVQE--QRAAQM---T.G.....QT-ID-ST---KAGVARRAVAEKENRLAWI.....G-----DP.DFN
Q7N327_PHOLL/62-316--WGKSA-TWTQQE--LEKIAR---L.N.....IN-LQ-TK---KQDDLYANATATIQYAGYV.....G-----HEGVKG
Q6FAE7_ACIAD/80-324--GVISY-QYSIME--VAAAQQ---M.G.....IQ-LE-GD---KVQAARLAAEKHLSQIAWY.....G-----NS.LTG
R6PG10_9CLOT/91-341--IGGSY-GYSVQE--MRASRK---S.G.....KG-LD-HR---KAEAARYAVDVALNKIAWA.....G-----DP.ENR
B4EG48_BURCJ/103-345--WGMQI-GWTIPE--LESAQK---L.G.....RP-VD-QQ---KFEGMQLKHNMDVDEQVYI.....G-----DP.VLG
C5AFU5_BURGB/112-366--WGAEV-KYTVPE--LVKSQK---L.G.....MP-ID-AQ---KVDAMNLKRNMDIDQIVYF.....G-----DP.QIG
R6AF56_9FIRM/26-279--WMHMM-RINFVD--MAKAKQ---I.G.....RS-LE-DM---LNKGIRLNYNKSLDMNVYK.....G-----FE.KLG
K8E4M7_CARML/57-293--IAAGI-RISVQE--LRQAQL---V.G.....QS-VD-AT---KTETARRAIAEKENSIIFT.....G-----DP.KVN
E3HGR1_ACHXA/80-315--IGDSY-GYSVME--LRAAAA---N.R.....TD-LP-TR---KSMAARKAVEIKLNQMALI.....G-----DT.KFG
C9LU84_SELS3/82-338--YEVSM-SIKIQD--QLRGAV---T.G.....RS-IE-DI---YNDGIRLDYDKYMDINTYL.....G-----QE.AYG
R7JXV9_9CLOT/86-336--VGDSY-GYNVQE--MRASRM---A.G.....KS-LD-AR---KGAAARRASDYMVNKIAFA.....G-----DK.KHN
B8IDG5_METNO/63-315--AGIGY-GYDLEE--LGKAQL---M.G.....MN-LG-TD---KAEAARLASEEFIDQVALF.....G-----DP.AKG
R6R1V3_9FIRM/101-351--IGDSY-GYNVQE--LRACRR---N.AVLGIMKS-LD-AV---RAEAARRVYDVKVNHLIWS.....G-----DE.KAK
H8L668_FRAAD/90-334--WAMQI-GWTIPE--LASAQQ---L.G.....RP-VD-QQ---KFAGMNLKHQMDIDEQVYI.....G-----DT.VLG
R6RQ09_9CLOT/93-346--IAAGT-RVMWVD--MQRGNM---T.G.....RN-LD-SL---LRDGLRMAYDKHLEENTYV.....G-----FK.RYG
Q0BRS5_GRABC/66-316--AAIGY-GYDLAE--LEHARQ---Y.G.....ID-LG-PE---KAEAARRAYEEFVDDIVLR.....G-----DA.ARG
Q2NSP7_SODGM/17-247--LGASY-CYSVPE--LEKVRA---N.G.....LE-LP-TD---KAIYVRQEMDRKIATIGVY.....G-----DA.DYA
B8IIV0_METNO/63-315--AGIGY-GYDLEE--IGKAQL---M.G.....LN-LS-AD---KADAARRASEEFIDQVALF.....G-----DP.AKG
Q6XQD3_BPT1/82-319--LGNAY-LISIDE--IKAGQA---T.G.....RP-LS-TR---KASACQLAHDQLVNRLVFK.....G-----SA.PHK
A9I906_BORPD/80-320--IGDSY-GYNVGE--LRASTA---M.R.....TS-LP-QR---RAAAARRAIEVKQNQIAMV.....G-----DA.QHK
Q2G4R3_NOVAD/111-362--AAIGY-EWNTQE--MQRAAK---L.G.....RS-LS-SD---KAQGAVLAADRFIYGIAMTGKTPRG-----ES.EKG
W8UFX7_YEREN/64-311--AALGY-TYSIEE--IGFAML---N.N.....VN-LD-AE---RGQAVRDVVEQGLNKIYLL.....G-----HS.DIG
A7ILG8_XANP2/103-352--WSMDV-AYTLPE--LESARL---T.G.....RP-ID-TQ---MLSALNRKNQMDTDQVVYI.....G-----DS.SIG
Q32EP9_SHIDS/73-313--WGMEL-GWTVIE--LQAAQQ---V.G.....RP-ID-TQ---KYDGMQLKWQMDNDEQVYV.....G-----DS.ALN
G2IHV9_9SPHN/64-315--AGCGY-ELSLQE--VNRASK---M.G.....VD-LA-SR---DASDARKIAEKFIFDRGMT.....G-----ST.EKG
Q835B4_ENTFA/57-293--IAAGI-RYSRQE--IRQAQM---M.G.....TS-ID-AT---KAEVARRTIAEKENSFIFV.....G-----DP.KVN
D0UIJ0_AGGAD/58-304--WAKSV-TWTKPE--LEQGKL---L.G.....LA-LN-TA---KIMALNKNAQQTLQKVAFL.....G-----HAKDSR
Q984H1_RHILO/86-339--AAIGY-GYNLEE--LGTAQL---L.G.....MN-LN-PD---KATTARRAAEERIDSTAFI.....G-----DA.AKG
Q2NRY5_SODGM/73-317--WSRQL-SWTVFE--LASAMQ---L.G.....RP-VD-SQ---KLDAMNQVYQLNVDRQVYV.....G-----SK.LLS

PF04454

D4H156_DENA2/1-251--ARINF-SLDIWE--LDNIDR---G-A-----KD-IA-LD---DLAEAARKMADFEENAVYN-----G-----FK-DSG
C8WPL7_EGGLE/1-257--FYEDF-TLLSRD--MEYAAQ---T-G-----YP-LD-LS---VAIAAAKKASRREDDLILN-----G-----SK-ALG
D0LZ74_HALO1/1-251--VRVPF-TLDVTE--LDSVAR---G-A-----TN-PD-LD---DVARAAERMVEAEDSAIFH-----G-----WA-QAG
D1B7I4_THEAS/1-249--TRVSF-EISIWD--LDDISR---G-A-----VD-VD-LS---SLEDAARKMAEFEERAIYH-----G-----LD-EGC
A1B987_PARDP/1-251--LRVPF-TLTRAA--IDDVAR---G-S-----ND-SD-WQ---PLKDAARKIALAEDRLVFL-----G-----HG-DAG
A3DFK3_CLOTH/1-257--INEDF-SLLWRD--LEFSEQ---M-G-----LP-VD-LS---SASRAATQCALREDKLIFY-----G-----ND-ELG
A6TWC5_ALKMQ/1-250--ARISF-KLDRWE--MDNLIR---G-A-----KD-IK-LD---ALEEAAEKMAIFEENMLYN-----G-----YK-PGD
A7HIB4_ANADF/2-255--IHRTF-ALGARA--LEADAA---C-G-----EP-LV-LS---EASEAARQIARAEDRIVFE-----G-----LP-RAG
A7I7A2_METB6/2-249--IRTEF-SLGKRD--LAAYER---D-H-----LI-LD-TA---PVACAAMDAAAKEDRIIFN-----G-----LA-..G
A8F8I8_PSELT/3-247--IHKTF-NISKRD--IASYER---E-G-----VT-LD-LK---NLITAVRECATIEDRLIFE-----G-----IN-...
A8L1F1_FRASN/1-253--LRAAF-SIDRGE--LDAIDR---G-A-----DD-ID-LS---ALEEAARRVATTENSVVFH-----G-----YA-EAG
A9BEM3_PETMO/1-251--IRNPF-VLKQWE--LDNIER---G-L-----KT-PD-LE---GLETAAKQLASFENKLILK-----G-----IE-KAN
A9FWS5_SORC5/3-254--FRAPI-RLELAE--LDAVGR---G-A-----QE-PN-IE---DVVRAAEHAARFEDGAIFN-----G-----LA-AAG
A9H5P1_GLUDA/1-251--LRVPF-TLARDA--IDDVER---G-A-----GD-SD-WQ---PLKDAAKKIAFAEDRAVFD-----G-----YA-AAG
B1VSP7_STRGG/1-251--WRVPF-TVTRQA--VDDVER---G-S-----AD-SD-WQ---PVKDAARTCAFAEDMAIID-----G-----YG-AAG
B2A6K6_NATTJ/8-259--TRITF-KLDRWE--LDNIER---G-A-----QD-ID-LE---PLEDAARKIALFEENAIYN-----G-----HN-DGQ
B2GID2_KOCRD/1-252--LRAPF-TLKRSD--IDDVER---G-A-----AD-PD-WQ---PVKDAAVALASAEDRTVFY-----G-----SD-SAG
B2JNZ6_BURP8/1-251--LTVPF-ELSRDA--IDAVER---G-A-----ND-SD-WQ---AAKDAAKELAYAEDRAIFD-----G-----YK-AAG
B2V6Y3_SULSY/1-265--IYKDF-KIHWRD--VESSKK---F-N-----IP-ID-FS---VAAAAASQVAIAEDRLIFH-----G-----DI-ETG
B4UA40_HYDS0/1-265--IYKDF-KIHWRD--IETSRK---L-N-----IP-LD-VS---VVALATREVALAEDRFIFH-----G-----DS-EIG
B8CYH7_HALOH/1-249--VEIPF-RLHLEE--LEAFVR---G-A-----ED-VN-ID---NLLESANELARIENKAIFF-----G-----MD-SAG
B8EQK3_METSB/1-251--LRVPF-ELSRAA--IDDVER---G-A-----DD-SD-WQ---PAKDAAKTIAFAEDRAIFD-----G-----YA-DAA
B8GHL2_METPE/5-250--IQTSF-SLSKRD--LAAYER---D-G-----ML-PN-TS---AVAVAAIEAARQEDAVIFT-----G-----TD-..Q
B9JHD1_AGRRK/1-251--LRVPF-KLTRQA--IDDVER---G-A-----ED-SD-WS---PVKDAARKIAFAEDRSVFD-----G-----YA-AAG
C0R0J8_BRAHW/1-256--IYQDF-TLLWRD--LENNIS---N-K-----LP-LD-LS---IVSQAAQTLANKEDNLIFN-----G-----ND-FLE
C0ZHN4_BREBN/1-265--LYKDF-MLYWRD--VAQART---L-G-----MP-LD-MS---AAANAAAGGALMEDDLIFN-----G-----AA-EFD
C0ZVK4_RHOE4/1-251--LRVPF-TVSRQA--IDDVER---G-A-----KD-SD-WQ---PVKDAAKQIAFAEDRAIFE-----G-----YP-AAS
D5UVK7_TSUPD/1-251--LRVPF-TLSRKA--IDSVER---G-A-----QD-AD-WD---PVKDAARSLAYAEDRAIFE-----G-----YP-DAS
C4XPM7_DESMR/1-251--VKVPF-TLDIAE--IDNAAR---G-G-----KD-ID-LA---ALDEAAEKLARFEEEALYH-----G-----FA-PAG
C5B5H8_METEA/1-251--LRVPF-TLTRQA--IDDVER---G-S-----ED-SD-WQ---PLKDAARMLAFAEDRAVFE-----G-----YA-AAG
O67639_AQUAE/1-267--LYKDF-VISWRD--LEHWRQ---F-N-----LP-VD-TT---GVAAAASSLAVAEDKLILF-----G-----NQ-EMG
Q08WR7_STIAD/2-266--IYKDF-LLHWRD--IEAARI---H-N-----MP-LD-VS---AAAGAAALCAQQEDELIFY-----G-----DP-KLG
Q0RH88_FRAAA/1-253--LRVGF-TLDRAE--LADADR---G-A-----DD-LD-LA---PLEEAVRRIAVTENSVVFH-----G-----YQ-EAG
Q2RVS0_RHORT/1-258--LCVPF-TLKRAE--LEAIAR---G-A-----SD-AD-LD---PVIEAARAIAIAEDRAVFH-----G-----FA-AGG
Q5YPL3_NOCFA/1-252--LRVPF-TLSREE--LDNVER---G-A-----KD-TD-LD---AVKEAARRIAFAEDRAIFE-----G-----YP-AAG
Q7MSM9_WOLSU/1-252--LKIPF-SFPESE--VEAILR---E-A-----NA-FD-IS---SIEKAAKKVCVAENELVFY-----G-----LK-KEG
Q97V86_SULSO/96-329--INSQV-KFYLGQ--KSDSRR---.-.-----..-..-..---TAVLAGKSFAKMENYLLLK-----N-----HP-...
B2HH42_MYCMM/1-251--LRVPF-TLSRNE--IDDVER---G-S-----QD-SD-WD---PVKAAAKQLAFVEDRTIFE-----G-----YG-AAS
Q0SE23_RHOJR/5-254--LRFPF-TLSRAE--VDDVAR---G-S-----LD-SD-WQ---PVKDAAKAVAFAEDQSIFQ-----G-----FD-EAG
Q2IH48_ANADE/1-259--LHRTF-RLGARA--VEALER---R-G-----EP-LT-LT---EAAEAARRIARAEDRLLFE-----G-----HA-GAG
Q5L1H9_GEOKA/8-264--LYKDF-ILYWRD--IEQAKQ---L-G-----SP-ID-FS---AAANAAQQCALLEDDLIFN-----G-----ST-EFD
MARIT_THEMA/1-251--LRATF-TLDLWE--LDNLER---G-K-----PN-VD-LS---SLEETVRKVAEFEDEVIFR-----G-----CE-KSG

PF05065

E0THR4_PARBH/115-394--LYAMP.AATQAL..LDDTVV---D-------..-LS.AW...LAEEIQAEFAAQESAAFVS-----G.DG..VN...K
Q1GG15_RUEST/131-399--IAHWM.KASRQA..LDDVSA---.-------..-LR.SM...IDQRLLFGLALAEENQLLN-----G.....DGTGQN
Q1DCZ9_MYXXD/94-361--GMVLT.DISNDL..LRTPGV---G-------..-.D.AG...VGEDIRATVADGLDDAGFN-----G.DG..TGA..A
Q0AAI8_ALKEH/83-374--HYSYP.SVTQQF..LEDSRL---D-------..-LE.QW...LQDKIGTRFGRQEAESFIK-----G.DG..NG...K
Q3J4R6_RHOS4/160-429--IAHWI.PVSRQA..LEDADQ---.-------..-LQ.GE...IDGELRYGLDLTEEAEILS-----G.....DGEGQH
A1T829_MYCVP/9-278--IGHVA.PLSREL..VRDSFN---E-------..-GAPEI...VATAQGIDIARKVDEAFFG-----......ADNPVA
Q982R8_RHILO/176-465--LYANP.ATTRTM..LDDGII---D-------..-IG.AW...LADEVNITFAEQEGAAFVT-----G.NG..LK...R
A1AYY2_PARDP/166-435--IAHFV.HVSRQA..MEDAQQ---.-------..-LQ.TE...IDTELRYGLMLAEEGQLLK-----G.....DGVGQN
Q1ILS6_KORVE/495-776--AMAQT.AYSRQF..IIQSSI---D-------..-AE.QF...VREDLANIFALGVDLAALV-----G.SG..TSN..Q
Q1GH34_RUEST/388-661--VAAYS.EITRRT..LKQSSL---D-------..-IE.AL...VRSDLALALATSLDFAGFY-----G.TG..AND..Q
Q2GAM7_NOVAD/185-459--IAHWV.LATKQI..LDDVPQ---.-------..-LR.SY...IDGRLRYGLEYVEEGQLLN-----G.....GGTGTD
Q8XYS4_RALSO/130-408--LSSKVVRVSEEL..LSDSSV---D-------..-IE.AF...LAGRIAARIGRAESRLVVQ-----G.TG..DGKPQQ
Q3J3K4_RHOS4/110-395--LSAMP.KASQRL..LDDSAF---D-------..-VE.SW...LAGKIATRFMRAESAAFVS-----G.DG..ID...K
Q1QLS4_NITHX/103-379--MACYV.DVSQRL..LEDAAV---N-------..-VE.SE...VASDLSEEFGRLEGLGFSQ-----G.DG..VK...K
Q8ED08_SHEON/122-393--IAHLF.KASRQI..LDDSKQ---.-------..-LQ.SF...INARARYGLMLKEEVQLLY-----G.....NNTGAN
Q813J9_BACCR/150-424--FDALA.TVTKKL..LARTGL---P-------..-IE.QI...VMDELKKAYVRKETQYMVN-----G.DE..AN....
Q3J5Z4_RHOS4/150-439--LVGMV.PIGNSL..LRHSGV---A-------..-MA.QL...VRDDLLKVMALREDLAFLR-----G.DG..SAD..T
A1B638_PARDP/102-387--LSAMP.KASQRL..LDDAAF---D-------..-VE.TW...LAGRIAEKFARAEATAFIS-----G.DG..VN...K
Q0AWY3_SYNWW/43-310--LVVFL.KLEEAF..VKDATF---K-------..-IE.DY...LVSRLAKNFGRAEDNGFIN-----G.TG..EN...M
A4YU30_BRASO/140-423--LYAFV.LATNEV..LDDAPR---.-------..-LQ.NR...ITVQAARAIRWKLFEAVCF-----G.....DGNG.K
Q2NV28_SODGM/127-397--IAHMF.KASKQI..LDDFSQ---.-------..-LA.SL...IDMELRYGLKYVEEQQILF-----G.....DGTGSN
Q1GHS2_RUEST/113-395--LSALP.KASQRL..LDDSAF---D-------..-IE.GW...LAGRIADKFARAEAQSFIS-----G.DG..VD...K
Q2L2B0_BORA1/123-401--LTSKVIRISNEL..LADTGI---D-------..-ME.SF...LAGRVASRIGRAESRLIVM-----G.TG..TGSPAQ
A2SD63_METPP/97-385--VYAMP.AVSQKL..IDTASF---N-------..-VM.DW...LNTKIGEKFGFSFGASIIA-----G.DG..AA...R
A1TML8_ACIAC/138-428--AAAIV.PIANDL..LAYAGV---N-------PR-VD.AI...VVGDLQTSMALSEDQHFLR-----S.DG..AGN..K
Q1QKG8_NITHX/112-388--VNTYV.DISNQL..LADSAG---S-------..-AQ.AE...VQLALSEDFGAKEGLAFVS-----G.VG..PL...A
Q0S2A4_RHOJR/9-273--VAGRT.QISNEA..ADDTDP---A-------..-AA.SI...IGKALARDIANKTDAAFFG-----......NTVTNG
Q6LSF8_PHOPR/134-417--YSSKSIAIPWEL..LQDSFF---D-------..-ID.GY...IQDLLGMRIGRITNRHFTV-----G.TG..IN...E
A5N1H4_CLOK5/152-424--VGGFI.PVANAI..LEDSMI---N-------..-LA.NY...IETRLSMAIAKALDKAILT-----G.....AAASKQ
A7HRJ6_PARL1/148-433--LYAMP.AATPTL..LDDAAV---N-------..-ID.QW...LAEEVQTAFAEQEGAAFVI-----G.DG..VK...K
Q2YMS9_BRUA2/137-422--IYAMP.AATSSL..LDDSAV---N-------..-VE.QW...IAEEVEAAFAEQEGAAFVS-----G.DG..VN...K
Q73HT5_WOLPM/107-395--LYAQP.QISQKL..LDDAFV---D-------..-VE.SW...LVEKIAETFSKEESEAFIK-----G.EG..TF...Q
Q9A4P7_CAUCR/53-338--LYASP.AATQAL..LDDAYV---S-------..-ID.EW...LAEEVQDAFAAQETTAFVT-----G.DG..VN...K
Q3Z7J9_DEHM1/124-397--LGTAI.KVSEEL..MNDSVF---D-------..-LE.KY...ISTEFARRIGAAEEEAFLI-----G.DG..NK...K
Q830G6_ENTFA/163-444--FDALA.TVTKKL..LKMSGV---P-------..-VE.DI...VVEELKKAYVRKEINYMFN-----G.DD..AG....
A7MP72_CROS8/125-401--MTSKIIRVSNEL..LLDSGI---D-------..-MN.GY...LAARIAQRLGRGEAAQIVN-----G.DG..TGK..N
A7ILP2_XANP2/167-448--IYAKP.RATQSM..LEDASI---N-------..-IE.GW...LATKISDKFARIEASAFIV-----G.NG..VK...K
B0T632_CAUSK/96-391--VYDRQAHTVESV..EGDSVL---D-------..-FQQVLLASMNAGIAEKMASELLNSTVT-----NAVENVAGTTTI
Q11H37_CHESB/111-386--AACYV.DISNQL..LEDSAF---N-------..-LE.SE...LAFDAAEEFGRLESVAFVA-----G.DG..TG...K
Q88G49_PSEPK/193-483--LAALV.PISNDL..LGYSGT---N-------PN-VD.RL...VVNDLTASVALAEDLSFLR-----G.AG..TGN..L
Q72BY4_DESVH/118-395--FSSKTIAVPIEL..LQDSGV---D-------..-IE.AF...IRSRIATRVARIQNRMFTL-----G.TG..TG...Q
B2JU92_BURP8/137-421--LMALV.PVTDEL..LDDASA---.-------..-LA.SY...LPGKTAASIRWKTDESILF-----G.....TGAG.Q
Q81Z09_BACAN/121-392--LRCAV.AVSLEVETMSLAVF---E-------..-...TT...LINNIVEAMTKAIEQAIVS-----G.....DGSG.K
Q3SS55_NITWN/107-382--INTYV.DISNQL..LADSAG---A-------..-AE.SE...VRMALAEDFGLKEGLSFLK-----G.TG..PL...Q
Q2GDU5_NEOSM/81-367--LYTQP.KTTQKV..LDDPSI---N-------..-VE.KW...LIEQAALAFTQLENETFIT-----G.DG..KN...K
Q3SSD8_NITWN/135-418--LYANP.AATQTL..LDDSRV---N-------..-IE.QW...LADEVSITFAEMEGASFII-----G.DG..VG...K
A6VNQ3_ACTSZ/129-407--LSSKIIRVSNEL..LQDSAI---N-------..-IE.AY...LADRIAQRIGRAEAKYLIQ-----G.TG..AGTPAQ
A5N291_CLOK5/33-297--LASLV.KLNRSF..VTDMNF---N-------..-LE.KY...LMGDFAKRFGKAEENALLN-----G.NG..TT...Q
Q5WID4_BACSK/129-404--FAGFL.PISSEL..LDDSFL---N-------..-FT.RE...IIDWLSESALTTENDEIFY-----G.....KGDE.N
A4XZF1_PSEMY/131-410--FSSKDIAVPFEL..LQDSAI---D-------..-LE.AH...INQRLTERLGRITNRMFTT-----G.TG..TN...Q
Q2N5Z6_ERYLH/94-380--LYANP.AASQAM..LDDAGF---D-------..-LE.AW...LASEIAMEFARAEGAAFVN-----G.SG..ID...Q
Q2GJL3_ANAPZ/114-389--LYAQP.QLAKNL..LEDTCI---D-------..-LE.RW...LMNNLVDAFSRKENQAFIS-----G.SG..AS...Q
A9BYD9_DELAS/120-394--IAHWV.PASKQV..LSDVPM---.-------..-LQ.SY...IDGRLRYGLKLKEELQLLK-----G.....SGVGLN
Q5Z3V6_NOCFA/148-434--IAEWV.PATKRA..LADVAA---.-------..-LE.GL...INDELRADVAEAEEGQILN-----G.....DGSGEN
A5CD71_ORITB/88-365--LYAQP.KATQKL..LDDSNI---N-------..-IE.NW...LIERLEDSFANAENKSFIL-----G.NG..IS...Q
A8FGQ6_BACP2/20-302--VIAEI.HMTYDS..IENNIE---K-------DG-IQ.QT...IMQMLAERAAVDIEELIVN-----GDTTSSDPFLAQ
A1TD88_MYCVP/110-388--LQIWV.EFSHEL..QHDAAG---.-------..-LA.DD...IAKMIAFEKDVKESIAFAT-----G.....SGVG.Q
A9CJN8_AGRFC/134-419--LYAMP.AATQGL..LDDAAV---D-------..-IE.AW...IASEVDIAFAEQEAAAFIA-----G.DG..VN...K
A3DG61_CLOTH/127-416--LLALC.YVTDDL..LQDTTA---.-------..-LE.AI...VRQAYADEMSFKIDDAIIN-----G.....TGVG.M
Q2SDM1_HAHCH/110-393--IYANP.ATTQKA..LDDVYF---N-------..-VE.QW...IADEVAQEFVDREADAFLN-----G.DG..VG...K
B2JL19_BURP8/113-379--LAHWL.LASRQV..LDDVAQ---.-------..-LQ.SY...INMRMTYGLRMKEDKELLT-----G.....DGATGH
B7GIM9_ANOFW/146-418--VGKVT.FVDNYL..LQDSII---N-------..-LD.EY...VTKKIARAIAKALDLGIVK-----G.TG..ATNK.Q
B9KI56_ANAMF/104-375--LYAQP.QIAKKL..LDDSLV---D-------..-LE.GW...LIDNLVDAFSRKENEAFIS-----G.DG..DK...K
C5AYR6_METEA/135-420--LYAMP.AATQTL..LDDAVL---D-------..-ID.AW...LAEEVETAFAEQESVAFVT-----G.NG..VG...R
P71947_MYCTU/196-475--GSCWI.PFSLEI..EGDAAG---.-------..-FV.AE...VGRVLADSVEQLQAAAFVS-----G.SG..NG...E
Q2FX56_STAA8/38-311--LGVIL.PVTKEF..LNYTYS---Q-------..-FF.EE...MKPMIAEAFYKKFDEAGIL-----N.....QGN..N
Q2G1W8_STAA8/130-399--HRGYF.RISREA..IEDAKV---N-------..-VL.QE...LKLWMARTIAATRNKAIID-----VITK..GSTGST
Q3J3W7_RHOS4/239-509--LATFT.DISNAL..LEDNAY---N-------..-LE.GE...LMADFAESFGRAESAAFVN-----G.DG..VG...K
Q81X82_BACAN/69-344--AATAI.ELSQQL..VNDSGI---D-------..-VV.NY...AVGVMTRRLARKLDETVLN-----G.....DKTKKQ
Q81XY0_BACAN/102-381--VTAYS.EDTEEL..QKLPAA---D-------..-YD.AE...VMKGITVATRKKLTREILI-----G.....TGATNR
Q88MK4_PSEPK/141-410--IAHWF.RASKQV..LSDIPL---.-------..-LQ.SY...INGRAIYGLKYKEEEQLLA-----G.....DGTGQN
Q9CFS0_LACLA/124-389--YAGII.TATNTL..LKDTAE---N-------..-IL.AW...LSSWIAKKVVVTRNQAII.-----............
Q9P9R2_XYLFA/357-623--LAAYT.DITRRL..LLQSTP---D-------..-AE.QI...VRSDLLNVMALEVDRAAIY-----G.....SGSDMQ
Q9ZWV6_BPPHC/121-387--YGFAS.VVSYEF..ATDQVL---D-------..-LV.GF...LVSDAGPAIGDAMGRHFLT-----G.TG..TG...Q
W6SDV8_9CLOT/124-396--LGTMI.KVSDEL..LNDSVF---D-------..-LE.NY...ISTEFARRIGAKEEEAFLV-----G.DG..DG...K

PF06673

Q9MCB6_9VIRU/1-347GAMKARFQGLTLAEDGVDDTFI---E-------GT-FKAGTDKNKAQTASKRSLRPQMAEAYL-----------QMDKAT
Q9MCB8_9VIRU/1-347GAMKARFQGLTLAEDGVDDTFI---S-------GT-FKAGTDKNKSQTATKRSLRPQMAEAYL-----------QMDKAT

PF05125

D3UZQ7_XENBS/11-324--TDSGA-ALKWDL--LSIWANSG.S-------EEEFF-LR---MQAFTNESFALDMLRVGFN-----GQRIA.ETTNPD
A6TE73_KLEP7/8-340--VNFDF-HFKYKK--LDLWAR...F-------QD.FQ-RR---IRDAIIQRQALDFIMAGFN-----GVERA.ETSDRA
M9X6X0_MANHA/8-336--INFDT-HINYKQ--LDMWAK...F-------PD.FQ-QK---VANVAAKQRKRDLIMIGFN-----GTSRA.ATSDRN
Q5E389_VIBF1/11-331--VDFDS-HIRYEQ--LDAFAH...L-------PN.FN-QL---INSQTREQIDMNKVTIGWY-----GKSCA.EDTDAS
Q2S7I3_HAHCH/8-327--VEYDT-HIKYKT--IDSWAK...F-------PD.FQ-AR---YGGWVRKAISLSKLRVGWL-----GTSCALPATKPG
Q15Y13_PSEA6/12-335--TDMDT-ALLYSM--IDSWAK...F-------PD.LA-DR---YANYINRAIATNKAMIGWH-----GTSVA.ATTDPT
H2IY53_RAHAC/8-339--VNADT-FTPYTQ--LDAWAK...F-------QD.FQ-KR---LSNQIIKRIALDRIMIGFN-----GTSYA.EKSDRA
B8J319_DESDA/15-323--TDSDV-AIRYNT--IDVWAK...F-------PD.LA-DH---YARYVQERIAADRELIGWY-----GERAV.ATTDLV
W8UNE7_YEREN/11-324--TDSGA-ALTWDL--LSIWANAG.D-------ENEFF-QR---MQDFTNESFALDMIRIGWN-----GKTAE.KSTDPI
C1DBL5_LARHH/8-337--TNFDT-AIPYQQ--LDVWAK...F-------PD.FQ-TR---LRDAILKQQALDRIMIGFN-----GTSVA.EDTDRD
E6WE37_PANSA/8-338--TNFDT-ALPYAK--LDLWAK...F-------QD.FQ-TR---IRDAIIQRQALDRIMIGFN-----GVKRE.KTSNRL
C5BH00_EDWI9/18-332--TDSCC-VITWAQ--LAIWANAG.T-------PGEFF-NL---MNSTAVINFALDMLRIGFN-----GTHAA.ENSNPT
B2FIZ5_STRMK/8-334--TDFDT-ALPYAR--LDAWAH...R-------PE.FQ-TL---IRDAIIQRQALDRIMIGWN-----GTSIA.KNTDRV
C1DS28_AZOVD/8-332--TNFDT-HLTYAR--LDAWAK...F-------PD.FQ-AR---VRDAIVKRQALDRIMIGWN-----GISRA.ATSNPA
Q8XY26_RALSO/8-332--TNSDT-HITYQR--LDAWAK...F-------PD.FQ-TR---IRDAIIKRQALDRIMIGFN-----GVSRA.ATSNRV
D8MKI1_ERWBE/9-341--TNYDT-FISYPQ--LDMWAK...F-------PD.FQ-QR---ITNQIIKRRALDRIMIGFN-----GTSRA.GKSDLA
F6IH75_9SPHN/8-355--TNYDH-AIKYAK--LDAWRH...K-------PQ.FQ-TL---LRDVILKQQGRDRIMIGFN-----GTSAA.ASTDVV
J7TAL9_MORMO/8-339--TNYDT-ALTYQK--LDLWAK...F-------KD.FQ-LR---IRNAIIRRQALDRIMIGFN-----GTHRA.KTSDRA
B2VH98_ERWT9/8-339--TNFDT-ALPYSK--LDMWAK...F-------SD.FQ-VR---IRDVIVKRQALDRIMIGFN-----GLKRE.KTSNRV
F4HA06_GALAU/6-327--TDSGI-IVPWAM--FDNFAR...F-------GDRLA-AL---YAEFVQTQIALDQLKVGWY-----GKSVA.ENTSAA
G0AIP5_COLFT/8-331--TNFDT-HIGYAK--LDAWAK...F-------QD.FQ-SR---IANQILIRQGLDRMVIGFN-----GTKIA.SDTDIA
F0LXI5_VIBFN/8-332--TNFDT-AIRYAK--LDAWAH...M-------KS.FN-QI---VSKHTREQIDANKITVGWF-----GQTAA.ANTDAA
B0UTP6_HISS2/8-335--INYDT-HLKYAI--LDMWAK...F-------PD.FA-KR---IGTLKAERMALDRIMIGFN-----GTSRA.ATSNRK
CAPSD_BPP2/8-340--INFDF-YIRYKT--LDLWAR...Y-------QD.FQ-LR---IRNAIIKRQSLDFIMAGFN-----GVKRA.ETSDRS
H2IRH6_RAHAC/8-340--VNFDF-HIRYNT--LDLWAR...Y-------QD.FQ-TR---LRDAIAKRQALDYIMAGFN-----GVSRA.ETSDRS
B4F0K8_PROMH/8-339--TNYDT-HLDYAK--IDMWAK...F-------TD.FQ-TR---IRDAIIRRQALDRIMIGFN-----GTHRA.DNSDRT
B0UW33_HISS2/6-327--TDSGI-LVPWDM--FDQFAR...F-------GDKLP-AL---YAEFFNKQVALDMLQVGWH-----GKSVA.PTTSQS
E6VXL3_DESAO/8-324--TNSDV-YIRYDT--LDAWAK...F-------KD.FA-ER---YTRYVQERIANDREMAGWY-----GVDAA.ADTDMT
A6VSU1_MARMS/18-341--TEFDV-ALKYSK--IDAWSK...F-------KD.FA-NR---YMKMVRASIGDDMLQTGWT-----GISAE.TFTDLE
C5AGA6_BURGB/8-333--TNYDT-HLKYSK--LDAWAQ...F-------PN.FQ-TT---VRDVNATQQALDRIRIGFN-----GVGRA.ATSDRT
J7SK37_MORMO/10-341--TNFDT-MIPYTQ--LDAWAG...H-------PQ.FQ-SL---INQQIIQREGLDRLMIGFN-----GVKCA.AKSDRQ
W0L880_9ENTR/8-339--TNSDT-FIRYAR--LDAFAK...F-------KD.FQ-AR---VTNQIIKRRGLDRIMIGLN-----GVSRA.AKSNKA
Q1QXQ6_CHRSD/8-331--TEFDT-HLGYNK--IDAWAK...F-------PN.FQ-AL---IRDAVIRQQALDRMTIGFN-----GTSAA.TQTDRA
C5BAR3_EDWI9/8-332--TNYDT-ALPYAR--LDAWAA...H-------PD.FQ-IR---VRDSITRRQGLDRILIGFN-----GTHVA.VQTNFQ
F4HB41_GALAU/8-340--VNFDT-HISYQL--LDQWAK...F-------PD.FQ-TR---LAKQTQKTIGLNLIMMGFN-----GTSRS.ENSDLS
Q63LE5_BURPS/8-332--TDYDT-AIPYRK--LDMWAK...F-------AD.FQ-QR---IRDVILNQGALDRIMIGWN-----GVKAA.ATTDRQ
A7MN35_CROS8/15-328--TDTCA-SISYGE--MADIYNIGAA-------GD.FD-KA---MDAFFAEALALDMLRTGFN-----GMAIA.DTTDPE
A1VSG1_POLNA/8-331--TNYDT-AIKYAV--LDAWAK...F-------PD.FQ-TR---LRDLIIKRQALDRIVIGLN-----GVSAA.VATNLA
F0LQ00_VIBFN/14-328--TDSGS-HIKWET--MTQWANSG.S-------KDEWM-KM---MKAAISRRFALDMLRIGFN-----GTSVA.AITNPV
Q6D3X2_PECAS/8-339--VNYDY-GISYEQ--LDAWAH...Q-------PN.FQ-PL---ISSAMARQMSLDRIMIGFN-----GTSYA.DPSDRA
CAPSD_BPHC1/5-328--TDSGI-IVPWAL--FDSFAI...F-------KDRLV-EL---YSEYFQNQVALDILQIGWN-----GQSVA.DNTTKA
D8J087_HERSS/8-337--TNFDT-HITYAK--LDAWAK...F-------KD.FQ-TR---VATAILKRQALDRIMIGFN-----GVKVA.ADTNLA
H2FUC0_OCESG/13-333--TDSGA-LLSWAT--LAVWANAG.N-------EGEFL-RL---VNEFINRSFALDMIRVGFN-----GTSIA.TNTDPE
Q8P6J5_XANCP/8-334--TDFDT-AIPYAL--LDAWAK...F-------PD.FQ-AR---LRDAIVKRQALDRLQIGFN-----GTHAA.ADTDRA
E0SAM8_DICD3/25-338--TDSCA-ALPWDL--LSVWANAG.G-------EDEFF-QL---VQAFSNEAFALDMLRIGFN-----GNSVA.KSTNPD
D3VKM6_XENNA/8-339--TNFDT-SLSYAK--LDLWAK...F-------RD.FQ-LR---IRNAIIRRQALDRIMIGFN-----GTQRA.KTSNRA

PF11651

C4K6U8_HAMD5/1-421ALSLG....SPNTA--IKKWAD---V----------AQTAS---FIKDIGIKTG..ENYAIMDPWSAQRLADAQSGLHAA
Q2G3Y7_NOVAD/1-418SVFSKRTGAATG..--...YDD---V----------ADIDS---RLTRIGVPTD..GRMAFYSPTNMNAMAGNLAGRSEA
C5B0T5_METEA/1-404PHVARNADGSNNTI--SPNMST---F----------LTAGA---ILDRYGVSRAPGQRVVTFDPITQARTVSSFSTLFND
K4L4N8_9FIRM/1-374PFNFGTAGSTPS..--..EISD---V----------TGARK---VLNDNKVPFA..NRNLVIDTAAEDKFLQLATFHEAD
A5VES4_SPHWW/1-413PNWVG....TPGQI--VNSFQD---F----------APAPQ---RLDEQGVMSD..GRTAILSPADQWGMLGSQTNLYIQ
B2U8F8_RALPJ/1-419SNLVGKFDGSNNLL--NADLNT---F----------LSANA---RLNKLSAPG...NRKIVLDPITEARMVGSLAGLLNP
CAPSD_BPP22/1-427SLVITSPDAIGTNT--ADAWNF---V----------ADAEE---IMFSRELNRD.MGTSYFFNPQDYKKAGYDLTKRDIF
J7TW41_MORMO/1-425SLIVTDVDHVAVE.--NKAWDM---M----------SDAEA---LIFQRELNRS.QGLSYFFNADDYKKAGMSLAGKDMY
I2B9R2_SHIBC/1-422ALSLG....SPNTP--INKWSD---V----------AQTGS---FMKDLGIKTG..ENYAVMDPWSAQRLADAQSGLHGS

PF09950

Q9P9P2_XYLFA/84-327LTG.LYTH.-----------------PGVPVL---LN....------------....TAGPWIG......QSPAQVL.AL
E1VAC6_HALED/80-318FYG.FTNH.-----------------PNLGET---A.....------------....VNGDWTNSA....TTGQQIL.DD
A9C0G0_DELAS/60-320MGG.LINY.-----------------NGVVVA---NAPADG------------TG..GSTLWVNAAGVGQKTPAQIV.RD
A6TKD0_ALKMQ/60-304AEG.LLNF.-----------------TGIQTM---PVALNA------------GE..TSTKWKD......KTSEEII.ED
H6NDU4_9BACL/55-298IPG.LINA.-----------------TGIQTT---NVPPRA------------DG..TSTKWKD......KTGEEIV.ED
Q7N327_PHOLL/62-316QEG.LLTG.-----------------SKVQLI---AEVTGK------------.................SIKDMSAEEF
Q6FAE7_ACIAD/80-324VKG.FLNQ.-----------------TGVTVV---T.....------------....AQHDWAT......ATIEQIL.SD
R6PG10_9CLOT/91-341LMGVLTTS.-----------------NNIPVT---TATAGK------------G...GSAKWKD......KTADEIL.AD
B4EG48_BURCJ/103-345VTG.LVNA.-----------------ASVTNT---SNA...------------....IAGNWGS......ATPAQML.AD
C5AFU5_BURGB/112-366FTG.LVNSN-----------------SAVASV---TNVANG------------AS..GTPQWTT......KTPDEIL.RD
R6AF56_9FIRM/26-279TTG.LVND.-----------------PNVVVA---TADNGA------------S...GKATWKD......KTPDEIL.DD
K8E4M7_CARML/57-293VKG.IANA.-----------------DGIQVV---N.....------------....VSKTWKT......ATSDEIV.EQ
E3HGR1_ACHXA/80-315LYG.LVNH.-----------------PNVPLV---VG....------------....LHGDWLNPT....TTADQIL.AD
C9LU84_SELS3/82-338TTG.LLND.-----------------KQITAT---AVTAGA------------S...GQTDWAH......KTPTEIL.ND
R7JXV9_9CLOT/86-336LVGIFSDG.-----------------TDIPLY---TLSEVE------------VDGKKYTDWAH......KTADQIL.ED
B8IDG5_METNO/63-315FSG.LLNH.-----------------PAVTTG---TAAATG------------EG..GSPAWAR......KTAEQIL.AD
R6R1V3_9FIRM/101-351IVGILSSD.-----------------NNIPVY---TLQNGA------------G...GKADWAS......KTADEIA.AD
H8L668_FRAAD/90-334LEG.LVNS.-----------------SAVTTT---NVVNGA------------S...GSPLWSS......KTPKEIL.AD
R6RQ09_9CLOT/93-346TTG.LLNN.-----------------PDVVVL---DAASNG------------ADS.ASTKFKD......KTPDMIL.KD
Q0BRS5_GRABC/66-316FSG.LLSH.-----------------PAVTAG---TVANGA------------S...GNPDWAH......KTVDEII.DD
Q2NSP7_SODGM/17-247MQG.LLTY.-----------------PFTTIE---DSVGT.------------.................KTALAKITSF
B8IIV0_METNO/63-315YSG.LINN.-----------------PGVTQG---SAAATG------------TG..SSTRWVD......KTADQVL.AD
Q6XQD3_BPT1/82-319IVS.VFNH.-----------------PNITKI---......------------....TSGKWIDVSTMKPETAE....AE
A9I906_BORPD/80-320LYG.LTNH.-----------------PNIGMT---TG....------------....LNGDWANPA....TTADQIL.DD
Q2G4R3_NOVAD/111-362WTG.FINN.-----------------GSAPSA---QVAADG------------TG..SSRLWAD......KTPDLIL.RD
W8UFX7_YEREN/64-311.EG.LYTS.-----------------SNVGVE---AAPATL------------ADLVAAIPT........KGTQPII.DF
A7ILG8_XANP2/103-352TTG.LLNS.-----------------ASVTNV---SNVAAG------------AS..SSMAWTS......KTADEIR.KD
Q32EP9_SHIDS/73-313LKG.LVTL.-----------------DGVPVN---N.....------------....AAKTWAT......STPDEIR.AS
G2IHV9_9SPHN/64-315FTG.LINN.-----------------GGVPTA---NVPADG------------TG..SATAWST......KDADKKV.RD
Q835B4_ENTFA/57-293HKG.VANA.-----------------EGIQVI---N.....------------....SPKKWKE......MTSEEIV.EQ
D0UIJ0_AGGAD/58-304LTG.LLNN.-----------------KSVEVY---AIKGAA------------Q................NTKVQAM..D
Q984H1_RHILO/86-339FSG.LVNS.-----------------STPTAT---QAPADG------------TG..SARTFAS......KTADQVL.RD
Q2NRY5_SODGM/73-317VQG.LLNQ.-----------------ASVKRS---K.....------------....AGKPWKQ......STADEIR.AA

PF04454

D4H156_DENA2/1-251IVG-LNQV------------------AAKNRI---NMT..------------------------------LDKDNLV-DA
C8WPL7_EGGLE/1-257TDG-LLTV------------------KGSSKI---KKSDW------------------------------SQGENSF-AD
D0LZ74_HALO1/1-251IKG-IVDS------------------TPHEAL---AVA..------------------------------.SVSDFP-RA
D1B7I4_THEAS/1-249IEG-IVKS------------------AGYTAE---LSV..------------------------------SKSKDMI-MG
A1B987_PARDP/1-251IRG-ILPE------------------TSNPIV---ALP..------------------------------ANVADYP-EA
A3DFK3_CLOTH/1-257YKG-LLTE------------------DGIVKF---PISNW------------------------------SEGENPF-KD
A6TWC5_ALKMQ/1-250IEG-LIEA------------------SSHKLS---QFG..------------------------------NNGEEIM-EN
A7HIB4_ANADF/2-255VSG-LLGH------------------EGAVEL---PAGDW------------------------------SDPARVA-DD
A7I7A2_METB6/2-249TPG-LLNA------------------EGAGSL---TLSKW------------------------------DKVGAAA-DQ
A8F8I8_PSELT/3-247SHG-LVSA------------------PGTISM---ELSDW------------------------------KNVGQAA-SD
A8L1F1_FRASN/1-253IIG-ITEA------------------SSHPVL---ELG..------------------------------ADTDSYP-RT
A9BEM3_PETMO/1-251IIG-LQTL------------------AKQNSV---ESSK.------------------------------ESLKDFV-KS
A9FWS5_SORC5/3-254IEG-ILEV------------------APHKPV---VIP..------------------------------.APEAWP-RA
A9H5P1_GLUDA/1-251ILG-LREG------------------TSNPKL---ALP..------------------------------SSASDYP-AA
B1VSP7_STRGG/1-251ITG-LRDG------------------SSHDPL---PLP..------------------------------ADARDYP-VA
B2A6K6_NATTJ/8-259IPG-LKTV------------------LTQDLI---PLG..------------------------------NTGSEIM-ES
B2GID2_KOCRD/1-252IQG-IAPA------------------SDNERL---SLP..------------------------------QDVREFP-NA
B2JNZ6_BURP8/1-251IVG-IREG------------------SSNTSL---ALP..------------------------------ADVADYP-NA
B2V6Y3_SULSY/1-265FPG-LLNV------------------EGKNSI---SISDW------------------------------NQTGEAF-KD
B4UA40_HYDS0/1-265YPG-LLNV------------------EGRSII---KNKNF------------------------------DEEGGIF-KT
B8CYH7_HALOH/1-249ISG-LVNS------------------SGQTLD---.....------------------------------TPATGLI-SS
B8EQK3_METSB/1-251ITG-VRQG------------------TSNPIM---TLP..------------------------------ADVRDYP-DA
B8GHL2_METPE/5-250VKG-LMNT------------------GGSQSV---KLASW------------------------------EKIGAAA-DD
B9JHD1_AGRRK/1-251IQG-IREG------------------SSNPIL---PLP..------------------------------SNVRGYP-DA
C0R0J8_BRAHW/1-256LKG-ILNA------------------EGAQKL---QISDW------------------------------GQGENPY-TD
C0ZHN4_BREBN/1-265LPG-LMNV------------------KGRLTH---LKSDW------------------------------MESGNAF-AD
C0ZVK4_RHOE4/1-251ITG-VRAS------------------GSNPEL---KLP..------------------------------IDAKDYP-EA
D5UVK7_TSUPD/1-251IPG-IRTT------------------AAGSDL---KLP..------------------------------DDPRDIP-DV
C4XPM7_DESMR/1-251IKG-LSEV------------------SSQTRL---QVS..------------------------------SNPEDIA-EK
C5B5H8_METEA/1-251IGG-IGKG------------------SSNAAV---PLP..------------------------------ATLDDYP-EA
O67639_AQUAE/1-267IEG-FLTA------------------KGTLRE---ELSDW------------------------------EKVGNAF-QD
Q08WR7_STIAD/2-266HEG-LMTA------------------TDRLTV---PLGDW------------------------------ATPGAGY-VA
Q0RH88_FRAAA/1-253LVG-ITQA------------------SSHPQL---TLE..------------------------------AGTDTYP-RT
Q2RVS0_RHORT/1-258ITG-IGEA------------------SAEHAL---DLP..------------------------------ADLADFP-GV
Q5YPL3_NOCFA/1-252ITG-IRAA------------------GSNAPI---TVP..------------------------------DDARLVP-EA
Q7MSM9_WOLSU/1-252IEG-LIPS------------------IPHKPI---K....------------------------------AKGDEIL-PA
Q97V86_SULSO/96-329...-LSPL------------------KIGLKI---TGSDW------------------------------NVAGNIL-LD
B2HH42_MYCMM/1-251IEG-IRSS------------------SSNPPL---TLP..------------------------------EDPREIP-DV
Q0SE23_RHOJR/5-254IRG-LGPS------------------SDNPVL---SLP..------------------------------EDPLLIP-DA
Q2IH48_ANADE/1-259VRG-LLEH------------------PGLVEV---PAGDW------------------------------ADPGRAG-DA
Q5L1H9_GEOKA/8-264VPG-IMNV------------------KGKIAH---IRSDW------------------------------MKSGNAF-TD
MARIT_THEMA/1-251VKG-LLSF------------------EE.RKI---ECG..------------------------------STPKDLL-EA

PF05065

E0THR4_PARBH/115-394PRG-ILDYSTAPDD......TRAADELGTTPS...SGATID------------...........------..ADDLI...
Q1GG15_RUEST/131-399LSG-LI....................TNATAY...SAAFAP------------A...SETAI..------...DKMRLAM
Q1DCZ9_MYXXD/94-361PKG-LFAQ......................LD...AAHTFA------------....STGTTAA------AYLSDVD...
Q0AAI8_ALKEH/83-374PRG-ILDYDTVPDGDFEWGADPADYTIGAIYT...GESGDF------------........PSN------NPDNVLY...
Q3J4R6_RHOS4/160-429LSG-LI....................TNASAY...SGVYEP------------A...GATAI..------...DKLRFAL
A1T829_MYCVP/9-278NDG-LQAL..................TGVQEV...DAGSV.------------...........------...LNLD...
Q982R8_RHILO/176-465PRG-ILAYPTVANA......NYSWGNVGYVVT...GAASDF------------....LAPTSTV------SPADALL...
A1AYY2_PARDP/166-435LEG-LV....................TAATAF...VPAFAV------------A...GETMI..------...DTLRLAL
Q1ILS6_KORVE/495-776PKG-IVNQ..................SGVGTE...AIATDG------------....GA.....------ITYSIIT...
Q1GH34_RUEST/388-661PLG-IANT..................SGVNVV...DFGGAA------------....SGGGSAL------PTWAEVI...
Q2GAM7_NOVAD/185-459LNG-IY....................TQATAF...AAPITP------------TAAGMMTKI..------...DIIRLAI
Q8XYS4_RALSO/130-408PQG-LAAS.................VTLTKST...ANAAKL------------...........------.TWQEVN...
Q3J3K4_RHOS4/110-395PRG-FLAPAKVANA......SWSWGSIGYVPS...GAASDF------------........LAT------NPADCII...
Q1QLS4_NITHX/103-379PIG-IMEAA................GVAYTAT...GNASTL------------.........GT------APADTLI...
Q8ED08_SHEON/122-393LHG-IM....................LQASAY...VKPTGA------------TV.DTEQHI..------...DRIRLAL
Q813J9_BACCR/150-424...-....NIND..........GALAKKAVEF...KTD...------------.........EK------NLYDALV...
Q3J5Z4_RHOS4/150-439PKG-LRHWMLP...........ANWSAAPVAA...TPA...------------...........------AAEAAIR...
A1B638_PARDP/102-387PRG-ILTHAKAPNG......SATNVQIGTIPS...GGTGDF------------........AAT------NPANALI...
Q0AWY3_SYNWW/43-310PTG-ILAA......................SG...GAEVGV------------....TT...NA------ITYEDVV...
A4YU30_BRASO/140-423PLG-FM.....................ASPAL...VTAPAE------------....GGQSAGT------IVTANIL...
Q2NV28_SODGM/127-397LNG-IF....................TQATAF...KAELKP------------A...HRTAI..------...DDLRLAM
Q1GHS2_RUEST/113-395PTG-ILTHPTVDNG......SWSWGNIGYVAT...GSDGGI------------...........------GSADAIV...
Q2L2B0_BORA1/123-401PKG-LAAS.................AVVGKQT...ASAATF------------...........------.TWKEVN...
A2SD63_METPP/97-385PSG-FTNYPIAATAD....ATRPWGTLQYLPT...GTDGAF------------........NST------TKTDVLV...
A1TML8_ACIAC/138-428PKG-LLYWALA...........ANKVAAPAAP...TLA...------------...........------QADAFLS...
Q1QKG8_NITHX/112-388PEG-IMSNA................DVAATTT...GNAATL------------.........GT------NPADLLI...
Q0S2A4_RHOJR/9-273PSG-LLSV..................SGVQVV...DTGAGW------------...........------...TTLD...
Q6LSF8_PHOPR/134-417PAG-IVPGA...............ALGKKGKT...GQTALV------------...........------.TYEDLV...
A5N1H4_CLOK5/152-424PTG-II....................TALGGTGLEAHNVTS------------...........------...DGTLKNI
A7HRJ6_PARL1/148-433PRG-FLDYDMVAEN......AWEWGKLGFIAT...GNAGGF------------........PTS------NPADKLI...
Q2YMS9_BRUA2/137-422PRG-FLSYETVADD......AWAWGKIGHVAT...GVAGAL------------........PPE------DPSDKLI...
Q73HT5_WOLPM/107-395PKG-ILAYENGN..........SYNKIEQVKT....E..KL------------...........------D.SDSIM...
Q9A4P7_CAUCR/53-338PKG-LLAYTAAPDA......SYTWGQVGYLAT...GVAGGW------------........TAS------NPTDRLI...
Q3Z7J9_DEHM1/124-397PEG-VFTK......................VA...ATTGAT------------....TEINNAT------VSFDDIM...
Q830G6_ENTFA/163-444...-....NENP..........GALAKKAVAF...EKPVDL------------....TAAGAGQ------KLYDALI...
A7MP72_CROS8/125-401VKG-LAKW.................VTKTTSA...AAADAF------------...........------.TWEELL...
A7ILP2_XANP2/167-448PRG-ILTYPAAPAG......TYARGKILQVNS...GHATNI------------...........------.TADGLV...
B0T632_CAUSK/96-391PAG-ILNR..................VTEVAADRFTGSIGK------------TPCLTTAGINL------VTFEDMI...
Q11H37_CHESB/111-386PKG-ILADT................GIATVVS...GNASTL------------.........GT------APADKLI...
Q88G49_PSEPK/193-483PKG-LRFWAPA...........FNVFAAPAAV...TLE...------------...........------AVEFALS...
Q72BY4_DESVH/118-395PSG-ILKDI...............SAGKVGAT...GQAATV------------...........------.TYDDLV...
B2JU92_BURP8/137-421PWG-VM.....................KSGAL...IVVAKD------------....SGQATNT------LTPTNIS...
Q81Z09_BACAN/121-392PKG-ILAETP..............FE.........GQALDV------------...........------...AKINYKT
Q3SS55_NITWN/107-382PEG-LLINA................DISIVAT...GNASTL------------.........GS------GPADMLI...
Q2GDU5_NEOSM/81-367PHG-ILQHNTDS..........TGKQICKITS...KEKDKI------------...........------.TPADIL...
Q3SSD8_NITWN/135-418PRG-LLSYDTVADT......SYAWGKLGYVVS...GVAAAM------------......TDSSH------NGADALT...
A6VNQ3_ACTSZ/129-407PKG-LAAS.................VTGTTTS...KTTGKV------------...........------.DWLDIN...
A5N291_CLOK5/33-297PTG-ILT.............................ADADV------------....TTADNST------ISFDEII...
Q5WID4_BACSK/129-404VEG-LLT..................................------------....NDKFKKI------DAPDEVTIKF
A4XZF1_PSEMY/131-410PHG-VVTGA...............AAGKVGAT...GKATSV------------...........------.GWEDLV...
Q2N5Z6_ERYLH/94-380PDG-FLTVPHSTSDD....QARSFGTLQYVGT...GDDAGF------------.........GS------NPDAKLI...
Q2GJL3_ANAPZ/114-389PTG-ILSYDEGT..........GPGQIERVKV....E..TL------------...........------N.TDAII...
A9BYD9_DELAS/120-394MDG-IY....................TQATPY...VNPGVV------------V..QAETRI..------...DRLRLAL
Q5Z3V6_NOCFA/148-434FTG-INNWS................GVQTQAF...DTDLF.------------...........------...TSVRKAI
A5CD71_ORITB/88-365PHG-ILYNPE.............EYGIEIIPC...HKIDL.------------...........------...EALL...
A8FGQ6_BACP2/20-302MDG-VR....................KQAVTH...IVDANG------------...........------...AEISRQM
A1TD88_MYCVP/110-388PRG-VITA.................LMGSDSV...VNSAVT------------...........------...DTFAAGD
A9CJN8_AGRFC/134-419PKG-FLSYTAIAND......GWNWGNIGYVAT...GVSAGF------------........ASA------GPMDVLL...
A3DG61_CLOTH/127-416PLG-IL.....................NSDAL...VTVPKE------------....KDQGAGT------IKYENIL...
Q2SDM1_HAHCH/110-393PKG-ILAYAMDTAPD....ASREFGKLQRVIS...GKAGDF------------...........------.NADNLL...
B2JL19_BURP8/113-379IAG-LI....................TQAAPF...APTDPA------------.....LNGV..------...DNIRLAM
B7GIM9_ANOFW/146-418PLG-IIPSL................PA.QNQV.........------------.....TIEADN------NLLKNLV...
B9KI56_ANAMF/104-375PSG-ILSS.................ED........GKDEGQ------------I...ERVSAKQ------LNSDAII...
C5AYR6_METEA/135-420PKG-FLSYDTVANA......NWASGRLGFIAT...GAAGAF------------........PAS------NPSDVLF...
P71947_MYCTU/196-475PTG-FVSA.................LTGTADY...TVTGAG------------........TEA------VVAADVY...
Q2FX56_STAA8/38-311PFG-KS....................IA.QSI...EKTN..------------.....KVIKGD------FTQDNII...
Q2G1W8_STAA8/130-399SSG-FEKE..................GKKLEV...KKAK..------------...........------.SLDDIK...
Q3J3W7_RHOS4/239-509PKG-IMAA..................AGIATL...SGGAGT------------...........------ITVASLI...
Q81X82_BACAN/69-344FEG-ILTS..................TVAEVV...GTHE..------------........AGK------ISLDNLL...
Q81XY0_BACAN/102-381LVG-IFS...................AAATAI...DSETDL------------....EISAIDA------STLDEII...
Q88MK4_PSEPK/141-410LLG-LI....................PQATAF...NNALRK------------........AGD------TKIDTLR...
Q9CFS0_LACLA/124-389...-......................EVMKAA...PKKPTI------------...........------AKFDDVI...
Q9P9R2_XYLFA/357-623PTG-VKHH..................SGINAV...SFAQK.------------.........GQ------PTFAELV...
Q9ZWV6_BPPHC/121-387PRG-ILTD......................AT...GANAAF------------....GEADADS------KVSDALI...
W6SDV8_9CLOT/124-396PTG-IFNA..................TGGAQL...GVTAGS------------........ATA------ITADEII...

PF06673

Q9MCB6_9VIRU/1-347VRG-VNDSGALSEYVMSEMVNRVIQKVEHNMI---LGSADG------------SNGFYGLKTATDGWTKQIEYTDLFDGI
Q9MCB8_9VIRU/1-347VRG-VNDSGALSEYVMSEMVNRVIQKVEYNMI---LGSVDG------------SNGFYGLKTATDGWTKQIEYTDLFEGI

PF05125

D3UZQ7_XENBS/11-324ENP-NGEDVNKGWHQIAKEWNGG....KQVIT---T.................PVTL.DQ..HG.......DHKSLDSMA
A6TE73_KLEP7/8-340THP-MLQDVAVGWLQKYRN.EAP....TRVMS---KIVDEEGNVVSA......VIRV.GK..NG.......DYVNLDALV
M9X6X0_MANHA/8-336SNP-LLQDVAKGWLQKMRE.DAK....ERVMN---GESTDN............QVLV.GK..GQ.......EYANLDALV
Q5E389_VIBF1/11-331ANP-NGEDVCKGWFQAIRD.NNP....DAMLT---QGETAN............EIRI.GE..GG.......DFINLDLAV
Q2S7I3_HAHCH/8-327DHP-NGEDVNKGWLQQLREFKSG....SQWFV---EGATAG............QIRI.GE..GG.......DFANLDAAV
Q15Y13_PSEA6/12-335ANP-MGQDVNKGWLQILRE.QAA....AQVLT---EGDTAG............KVIL.GA..SG.......DFENLNSIV
H2IY53_RAHAC/8-339ANP-LLQDCGVGWLQQYRT.NAA....QRVMK---DVTVTSRDDTN.......QVVA.....KG.......DYGNYDSIV
B8J319_DESDA/15-323ANP-LMQDVNKGWLQYMRD.NLP....ANILT---EGEHAG............EIRI.GK..GG.......DYSCLDVAI
W8UNE7_YEREN/11-324KFP-NGEDVNIGWHEIVRKYNKG....NQIIS---T.................PVTL.DE..KG.......DYKSLDAMA
C1DBL5_LARHH/8-337SNP-LLQDVNKGWLQQYRE.HAP....ERVMS---EVAESSG...........KVKI.GPAVTG.....AEGYRNLDALV
E6WE37_PANSA/8-338ENP-LLQDVNIGWLEKIRQ.ESP....VHVIK---GIPQDDGSLSS.......SIRV.GK..NG.......DFANLDALV
C5BH00_EDWI9/18-332DYP-SGEDINIGWHQIARNWGDNEGRVSRILT---T.................PVTV.GE..GG.......DYISLDAMA
B2FIZ5_STRMK/8-334ANP-LLQDVNKGWLQKYRE.HAP....ERVMK---EGAAGSG...........KIKVGGT..DA.......DYGNIDALV
C1DS28_AZOVD/8-332TNQ-LRQDVNIGWLQKMRT.ENA....ARVLA---EVVADSD...........EITI.GA..TG.......DYKNIDALV
Q8XY26_RALSO/8-332VNP-MLQDVNKGWLQNLRE.QAP....QRVME---EGKKAAG...........KIIV.GA..GG.......DYGNLDALV
D8MKI1_ERWBE/9-341ANP-LLQDVNIGWMQKYRA.NAP....QRVMT---GAKLTSRDDSN.......KVIA.....KG.......DYGSLDSLV
F6IH75_9SPHN/8-355ANP-LLQDVNEGWLHKIRT.HAG....SRVLN---DGDLSVDPTKAIYVAAGVEVVD.GD..ATNTASAEADYANLDALA
J7TAL9_MORMO/8-339ANK-MLEDVNIGWLQKVRT.DAE....AHVIS---DVRDDAGNVISA......VIRV.GK..DG.......DFNNLDALV
B2VH98_ERWT9/8-339QNP-LLQDVNIGWLEKIRQ.EKP....SQVIS---QRIDNSGKVVAG......NITI.GK..GG.......VFNNLDAVV
F4HA06_GALAU/6-327D..-.MSDVNKGWMQLERE.EKP....ENVMK---DGATVG............KIKIFGE..GA.......DFENLDHLA
G0AIP5_COLFT/8-331AYP-MLQDVNKGWLQHFRE.DAP....QRVMS---QGEAKPG...........KLLI.GT..GG.......DYLNLDAAV
F0LXI5_VIBFN/8-332ANP-NGEDVNKGWFQAMRE.HNA....ERLIT---EGVEGSG...........VIQI.GE..GG.......DFANLDLAV
B0UTP6_HISS2/8-335TNP-LLQDVAVGWLKKIED.NAP....ERVMT---EDKKSSG...........KIEV.GE..GK.......TYKNLDALV
CAPSD_BPP2/8-340SNP-MLQDVAVGWLQKYRN.EAP....ARVMS---KVTDEEGRTTSE......VIRV.GK..GG.......DYASLDALV
H2IRH6_RAHAC/8-340KFQ-MLQDVAVGWLQKLRN.EAA....ERVMD---KITDDTGAVVSD......TVRI.GV..KG.......DFENIDAAV
B4F0K8_PROMH/8-339KYP-LLQDVNSGWLQKVRE.RAP....EHVMG---SETKDGATTAQ.......PILV.GK..GQ.......AYQNLDALV
B0UW33_HISS2/6-327D..-.LSDVNKGWLALLKE.QKS....ANVYT---GNSSH.............KINLYGT..DA.......EFANLDELA
E6VXL3_DESAO/8-324ANP-LLQDVNKGWLQYMRA.HLP....ANILI---EGATTG............EIRI.GT..TG.......DFANLDHAV
A6VSU1_MARMS/18-341ANP-LLQDLNKGWLQIMREFKDG....QQYLK---ATAEV.............PIVLGSD...........SIKNLDVLV
C5AGA6_BURGB/8-333KNP-NLEDVNKGWLQTYRD.QAK....DRVIS---EGKKGSG...........KLVIGGA..DG.......DYKNLDALV
J7SK37_MORMO/10-341KNP-LLQDVNIGWLQLVRE.RAP....QRVMK---NISLTSRDEDG.......KIIK.....KG.......SYANIDAVV
W0L880_9ENTR/8-339QNP-LLQDVNIGWLQKYRL.YSP....QRVLA---EITVTSRDEDN.......VIIA.....KG.......DYGNLDSLA
Q1QXQ6_CHRSD/8-331ANP-MLEDVNIGWLQQYRN.NAP....ARVMT---GGATAD............TVQV.GK..GG.......DYVNLDALV
C5BAR3_EDWI9/8-332QYP-LLQDVNKGWLQQYRD.HAP....ERVMR---EGVEDSG...........KIII.GR..GG.......DYENLDAMV
F4HB41_GALAU/8-340RNK-LLQDVKKGFLQKIRE.EAP....LKVMD---GKNSEN............KIKV.GK..GQGTGEDAKGYENLDALV
Q63LE5_BURPS/8-332ANP-LLQDVNIGWLQQYRE.RAA....QRVLH---EGAKQAG...........KVLI.GK..AG.......DYENLDALV
A7MN35_CROS8/15-328TCK-KGEDVNIGWHALAKQYENG....KQIMA---E.................PLTL.GE..TG.......EWKNIDLLA
A1VSG1_POLNA/8-331TYP-LLQDVNIGWLQHIRT.DAP....TRVMD---EGAVPG............AVSV.GA..SG.......DYKNLDALV
F0LQ00_VIBFN/14-328ENP-LGQDVNKGWLTLVKE.KKA....AQVLA---..................TAVL.DP..TGTTED...SYKNLDSLA
Q6D3X2_PECAS/8-339ANP-LLQDCGVGWLQKIRT.EAS....HRRIS---DVTITARDEDN.......KVIA.....KG.......TYGNLSAAV
CAPSD_BPHC1/5-328D..-.LSDVNKGWLKLLQE.QRA....ANFMT---ESTKSSG...........KITIFGD..NA.......DYANLDDLA
D8J087_HERSS/8-337QYP-LLQDVNKGWLQQIRE.HSP....QRVMG---LVGPELPG..........KVVI.GSGEGA.......DYANLDAAV
H2FUC0_OCESG/13-333ANP-LGQDVNKGWQQLVREWNGG....SQIIG---SAQS..............KVYF.DPDGNG.......DYNTLDAMA
Q8P6J5_XANCP/8-334AFP-LLEDVNIGWMQQYRT.NAA....QRVLA---SGKTAG............KMVI.GAGDGA.......DYRNLDALV
E0SAM8_DICD3/25-338KNP-NGEDVNIGWHQRMKDFKDG....QQIIT---D.................RVVL.DE..NG.......DYKSLDAMA
D3VKM6_XENNA/8-339QYP-MLEDVNIGWLEKVRK.DAP....DHVIS---SITDDQGKVISA......VIRI.GK..GG.......DFHNLDALV

PF11651

C4K6U8_HAMD5/1-421D.QLVRTAWENAQISGNFGGIRALMSNGLASR---EQGDFG...GTLTVKTAPNVDYLS..........VKDSYQFTVAL
Q2G3Y7_NOVAD/1-418T.ERSRTAFERAMIRSDVAGIEVFKNDQEIRL---AAAG.G...GATTVNGANQRTVPAATVTSAGVTENKDNRYTDLVI
C5B0T5_METEA/1-404Q.NKVSQQYREGVLRSDVLGFDWQMDQTVILH---TTGAYG...ALPTVAGANQSGS...................AITV
K4L4N8_9FIRM/1-374KVGDNGTALREASL.GRKFGFNIFMDQNVKKH---TKGTLAGDAGTIKVKGAVSAGS..................TQLVI
A5VES4_SPHWW/1-413G..AASDAYRKGDL.GTIGGIDTRMSQNVQSI---TTGSRA...GSILIDLSITGSTIDY.......ATVKDTMIQTIHM
B2U8F8_RALPJ/1-419S.NEISEQFLTGQM.KRGLGFTWMMDQTVLAH---TTGAYG...TPPTVSGANQSGSGL..............GTMTLNV
CAPSD_BPP22/1-427G.RIPEEAYRDGTIQRQVAGFDDVLRSPKLPV---LTKSTA...TGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTL
J7TW41_MORMO/1-425G.RIPEEAYKSGTIQKQVAGFNDVLRSPKLPT---LTAGTA...TGVTVDGAQKFKPEAWKEDVDGNRENVDNRTAVVKV
I2B9R2_SHIBC/1-422D.QLIRSAWEDAQISGNFGGIRALMSNGLASR---TQGAFG...GTLTVQTAPTVTYNA..........VKDTYQFTVTL

PF09950

Q9P9P2_XYLFA/84-327FNQLIS...SAWMN..THY..V-EMIDTVLLPGRVM-NYLV--STP-----------RSDNS...DKTIL......HYVL
E1VAC6_HALED/80-318LLAMYD...AVQIQ..SYD..Y-HTPNTLALAPTRR-SALM--RKN-----------VNEGG..NWESVW......SRFK
A9C0G0_DELAS/60-320INIALQ...GISLA..TFE..T-ELADTILLPVEAF-NYIA--ATP-----------YSATT...METIL......SFVM
A6TKD0_ALKMQ/60-304IRLARK...KVNAL..PGL...-.TVDTLLLPPNQY-EDLD--KPV-----------NAENY...NMTIR......KWLQ
H6NDU4_9BACL/55-298VRIVRS...LVSVL..PGH..M-TAPLALALPPNQF-EILN--SRY-----------NEYDS....RTVL......QVIQ
Q7N327_PHOLL/62-316INMVLNAYNVAWAK..SGY..R-IQPTHVAIDASDF-M.LA--MQK-----------FDTNSVIVGVDLLPVSAMDRIMA
Q6FAE7_ACIAD/80-324FNASLSDSEDLFDG.....DIS-VQPDTYLMASNQY-SSLS--NRV-----------VPDSG...GKTFL......KFIE
R6PG10_9CLOT/91-341INGYMA...TVSRN..TKN..V-ERPDTLALPTDVF-IDIA--TRR-----------IDHTN....TTVK......DFVL
B4EG48_BURCJ/103-345VNELLN...SVWAA..SAY..A-VCPERLLIDPLNF-SRLN--SEI-----------VSSAG...NISIL......QFLK
C5AFU5_BURGB/112-366VNEILT...SAWQA..SGW..K-VKPNRLMLPPAQL-GWVA--SQV-----------ISSAG...NKSIL......TYLL
R6AF56_9FIRM/26-279INQAIT...AAWVA..SEYDLD-GMPNHILIPPQQY-TLLV--TRK-----------VSEAG...NCSLL......EYLM
K8E4M7_CARML/57-293VRTTRA...KITVI..PGY..R-TASLKMLVSSTQY-EELN--RRY-----------SDFDS....RTIL......KVIE
E3HGR1_ACHXA/80-315LDMIYD...AVVNQ..SKN..V-HTPTRIVMPTEQR-SKIF--SRR-----------VPDAN...GKTVG......QFFQ
C9LU84_SELS3/82-338IDEAII...AGWTG..AQYDNS-AIPNHILIDPANF-AYIN--RTM-----------VSVNGYPTPVSIM......QYLV
R7JXV9_9CLOT/86-336INGMQK...FVDKI..TMS..I-EKPDTLALPSYIY-MDLS--TRR-----------IPDTE....TTVL......SFIK
B8IDG5_METNO/63-315VNTELT...GLFTA..SST..V-EMADTLLLPYEQM-LGIG--LRR-----------IDSLS...PITIL......DWIR
R6R1V3_9FIRM/101-351IAGILN...YIDTL..TQS..V-EHPDSWVMPNDLY-TALN--LRR-----------IDGTG....ESVL......SYIK
H8L668_FRAAD/90-334FNAILN...LAWEA..SAY..A-VCPTKVLIAPAKY-SIL.--TQP-----------VSEAG...NISIL......EYVR
R6RQ09_9CLOT/93-346INDAIL...YAWSQ..CEYDRD-AVPNHIIMPYEQF-NYLA--TTK-----------VTDLA...EKTIL......TFLL
Q0BRS5_GRABC/66-316VNAALT...GIQTA..SLR..V-EMADTVLLPVDRW-LKLS--QTR-----------IPATS....ETAL......SFLA
Q2NSP7_SODGM/17-247INQHWNLKGGVFPV........-...THIVLPQALY-DDIS--ITL-----------SNPNT...NLTVL..........
B8IIV0_METNO/63-315VNGQLT...GIYTG..SST..V-ELADTVLLPYDQM-IALS--LRR-----------IDPTS...QMTLL......DWIQ
Q6XQD3_BPT1/82-319LTQAIE...TIETI..TRG..Q-HRATNILIPPSMR-KVLA--IRM-----------PETTM.....SYL......DYFK
A9I906_BORPD/80-320LNALYN...AVRLQ..SKG..V-HTPNVLAIPSTQH-AALY--SKR-----------LSDSG...GLTVG......EFFV
Q2G4R3_NOVAD/111-362INAALT...AVETG..TGE..T-HIANTLALPTSRY-NYIA--TTR-----------VGDTN....ATIL......SFLL
W8UFX7_YEREN/64-311FGAAYN...QVYLK...NTVTV-HRPNGFVLPSEQH-QLLM--RTL-----------LSTHN.ASNVTLL......EFLR
A7ILG8_XANP2/103-352VNELLI...SVWAA..SGY..V-APPTKLALSPTAF-GYIS--TTI-----------ASSAA...NATIL......TFLK
Q32EP9_SHIDS/73-313INQVLS...DAWAA..SGY..S-VVPRDLLILPEQF-ALLS--SII-----------VSSAG...NQSLL......TYLQ
G2IHV9_9SPHN/64-315VNLAIT...DVFTN..TKE..T-EMADTLLLPTSSF-LDAS--TAR-----------VGDTG....MTVL......AYIQ
Q835B4_ENTFA/57-293LRTSRA...KITII..PGF..K-GSSLKLMVAPEQY-EELN--RRY-----------GEYDA....RSIM......KVVQ
D0UIJ0_AGGAD/58-304FDKAVAFFKEIFLKGMEKTKRI-EAPNTFAIDSLDL-AHLA--LVQ-----------RANTD....TTAL......EFLT
Q984H1_RHILO/86-339VNTQIT...GIATD..TLG..N-ELADTILLPYSIM-LDLS--QRR-----------IDTVN...QTTIL......EWVM
Q2NRY5_SODGM/73-317IDAGLT...TAWKQ..TGR..A-VVPDKMLVSPDEY-ALLV--STI-----------VSSAG...NRSLL......DYLN

PF04454

D4H156_DENA2/1-251ISEAQG---RMRKE------GI-ASGANLVVNPALW-QFLA--HVV-----------P..GG---------------TLG
C8WPL7_EGGLE/1-257ITAGVA---QLAKT------GY-LGRYALVVSPDLF-LDLQ--RLQ-----------PNTGL---------------LEI
D0LZ74_HALO1/1-251VLSAAD---TLRKA------GV-TGPYALVLGPKAY-DDLF--AAT-----------QD.GY---------------PVA
D1B7I4_THEAS/1-249IAKGVR---TMGAS------.V-EGPFALVGGDKLF-AAID--GFS-----------EP..Y---------------PMR
A1B987_PARDP/1-251VASAVS---ELRLA------GV-NGPYALILGTTAF-TAAN--GGA-----------ED.GY---------------PVL
A3DFK3_CLOTH/1-257ISIGLA---KFIEN------GI-VGRKALVVSPNLF-VQLQ--RIQ-----------PGTGT---------------TEY
A6TWC5_ALKMQ/1-250LAQGMI---LLKEA------YV-DQPVTLVVGIDAW-KRIN--REM-----------Q..GH---------------PLI
A7HIB4_ANADF/2-255LLGALA---KLDEA------GR-HGPYALAVSPGRF-YQLL--RPY-----------PGTAL---------------TPH
A7I7A2_METB6/2-249IIDAVT---KLDAA------GF-HGPYSLALAPAQY-NLLL--RRY-----------PQGDG---------------TEL
A8F8I8_PSELT/3-247VIEAVT---KLDEA------GF-HGPYLLALSPDRY-NLLF--RRY-----------ESGNQ---------------TEY
A8L1F1_FRASN/1-253VAKAVA---LLRRA------GI-GGPYGLAIDPDGY-TAIL--EAT-----------EHGGY---------------LLL
A9BEM3_PETMO/1-251LFEVKK---RFMEQ------GI-EGPYTLVINKELW-QDLF--TMN-----------LS..Y---------------PLD
A9FWS5_SORC5/3-254VAEARE---VLRAA------GV-DGPYALALGPKAY-DELA--AAA-----------ED.GY---------------PLR
A9H5P1_GLUDA/1-251IAAALN---QLRLA------GV-NGPYAVVLGAGVY-TALS--GGD-----------DE.GY---------------PVF
B1VSP7_STRGG/1-251VSQAVT---RLRLA------GV-DGPYRLLLGADAF-TEAA--ETS-----------DH.GY---------------PVK
B2A6K6_NATTJ/8-259ITRGII---TLRKA------YI-SQNMTLIVGEEAW-RKIN--KEM-----------S..GE---------------PLI
B2GID2_KOCRD/1-252VAKAKT---ELRLA------GV-AGPYNLLLPAELY-TEVT--ETT-----------DH.GY---------------PVH
B2JNZ6_BURP8/1-251IGGALQ---QLRLA------GV-DGPYSVLLGADAY-TALG--EAS-----------DQ.GY---------------PVI
B2V6Y3_SULSY/1-265ILNAIV---KLNEN------GF-YNNFALVLNPQDY-AMLN--RLY-----------GNSGI---------------LEI
B4UA40_HYDS0/1-265ALACVE---TLVEK------GF-SKNLAYILNPKDY-TKAF--RIY-----------GNSGV---------------LEI
B8CYH7_HALOH/1-249VAEGIN---NLVKA------GV-NGPYTLLLGPELY-HSLY--TRN-----------DR.GY---------------PLE
B8EQK3_METSB/1-251IAHALS---QLRLV------GV-NGPYAVLFGAEAY-TALA--ETS-----------DH.GF---------------PVL
B8GHL2_METPE/5-250LIKAVT---ALDLA------GF-HGPYALALSPARY-NLLF--RRY-----------PQGST---------------TEL
B9JHD1_AGRRK/1-251IAKAVS---QLRLA------GV-NGPYALVLGTEAY-TAAS--GGS-----------DD.GY---------------PVF
C0R0J8_BRAHW/1-256IVKAIN---MIREK------GI-VGRFVLCLSQSLY-FDLQ--RIQ-----------QGTGM---------------TEA
C0ZHN4_BREBN/1-265IVEARN---KLLKM------GH-SGPYALVVSPELY-SLLH--RVH-----------KGTNV---------------LEI
C0ZVK4_RHOE4/1-251ISQAIT---SLRLA------GV-NGPYSLLLNADAF-TAIN--ETS-----------DH.GY---------------PIR
D5UVK7_TSUPD/1-251VSQALS---DLRLA------GV-DGPYSVLLSADVY-TRVS--ETS-----------DH.GY---------------PVR
C4XPM7_DESMR/1-251VSKALT---ALRKT------SV-EGPYALVVGPELW-VALS--GHV-----------R..GY---------------PLS
C5B5H8_METEA/1-251VARALN---DLKLA------GC-NGPYVLVLGGDVY-RAAS--GGN-----------EE.GY---------------PIF
O67639_AQUAE/1-267VVKGIS---RLVEK------GF-YTNYYLIVNPKRY-FLLN--RIH-----------DNTGL---------------LEL
Q08WR7_STIAD/2-266IVEATR---KLNEH------GH-YGPYAVVLSPRLY-SLLH--RIF-----------EKTGV---------------LEI
Q0RH88_FRAAA/1-253VAKAVA---LLRRA------GI-AGPYALALEPDSY-TAVI--ETA-----------EHGGY---------------LLL
Q2RVS0_RHORT/1-258LVRALA---VLRDR------GV-DGPYALVLGRTVY-QQLM--ETT-----------TPGGY---------------PVL
Q5YPL3_NOCFA/1-252ITQALT---ALRLA------GV-DGPYSVLLSAELY-TEVS--ETS-----------DH.GY---------------PIR
Q7MSM9_WOLSU/1-252VAEGIK---ELVNS------EI-EGPYALLIQPQYF-GKLF--GVA-----------GNSGY---------------PLT
Q97V86_SULSO/96-329VLRAYE---NLTRE------GF-GKDVYILMSSLNY-SKTF--RVV-----------DRSGT---------------YEI
B2HH42_MYCMM/1-251ITQALS---ELRLA------GV-DGPYSVLLAADVY-TKVS--ETT-----------EH.GY---------------PIR
Q0SE23_RHOJR/5-254VASALS---ALRLA------GV-EGPYSVVLDADAY-TAVS--ETR-----------DE.GH---------------PVF
Q2IH48_ANADE/1-259LLAALT---ALDDA------GR-HGPYAAAVSPARF-YQLF--RPF-----------AGTAL---------------TPY
Q5L1H9_GEOKA/8-264VVEARN---KLLQL------GH-TGPYALVLSPELY-ALIH--RVH-----------EGTHV---------------LEI
MARIT_THEMA/1-251IVRALS---IFSKD------GI-EGPYTLVINTDRW-INFL--KEE-----------AG.HY---------------PLE

PF05065

E0THR4_PARBH/115-394.DLIY.---TLPQAYR...Q.N-G..R.FMMNRSTL.ASIR..KLK..--------.D.TEG--------------NYLW
Q1GG15_RUEST/131-399LQAALA---EYPATG.......-.....HVMHPTDW.ARIE..LTK..--------.D.GNA--------------NYII
Q1DCZ9_MYXXD/94-361.KAVEL---PLTAHVR...M.G-N..AAWVLHPTRA.TALL..QLQ..--------...NSG--------------VWVF
Q0AAI8_ALKEH/83-374.DVVD.---ALKSDYL...G.N-A..R.FMMSRATM.NKIR..KLR..--------.D.GDD--------------RALL
Q3J4R6_RHOS4/160-429LEASLA---LYPADG.......-.....MVLNEIDW.ALIE..TAK..--------.D.SEN--------------RYIF
A1T829_MYCVP/9-278......---SFAAAQALSEDVG-GTITSFVANPETA.LTLA..QLK..--------RSGDSN--------------EPLL
Q982R8_RHILO/176-465.DLLY.---GLKQGYR...N.N-A..S.YLSTDATM.AKIR..KFK..--------.D.GQG--------------NYVW
A1AYY2_PARDP/166-435LQASLA---EYPADG.......-.....IVLHPTNW.AQIE..LTK..--------.D.GEF--------------RYIF
Q1ILS6_KORVE/495-776.KAQE.---DLEESSI...P.L-IAPG.IATTPGVK.KKLR..NTA..--------.E.LSN--------------TISL
Q1GH34_RUEST/388-661.QMES.---EISAANA...D.V-NSMA.YVQNAKMR.GHFK..STQ..--------.K.FSG--------------TNGA
Q2GAM7_NOVAD/185-459LQAALA---ELPANG.......-.....IVMHPSDW.ADIE..LTK..--------.T.DDG--------------AYLF
Q8XYS4_RALSO/130-408.TLIH.---AVDPAYR...N.A-PMYR.LAFNDQTL.KVLE..ELV..--------.D.GNG--------------RPLW
Q3J3K4_RHOS4/110-395.TLIY.---SLGADYR...A.N-A..T.FVMNSKTA.GAVR..KMK..--------.D.SDG--------------RFLW
Q1QLS4_NITHX/103-379.DVFY.---SLPAYYR...N.R-G..V.WLMNSKTI.AAVR..KLK..--------.DGSTG--------------AYLW
Q8ED08_SHEON/122-393LQAALA---EYAADG.......-.....IVLNPIDW.AVIE..TLK..--------.D.SNK--------------NYLI
Q813J9_BACCR/150-424.KMKNT---PVKEVRK...K.A-R....WVLNTAAL.TKIE..TMK..--------.T.DDG--------------FPLL
Q3J5Z4_RHOS4/150-439.RAVS.---LVEDADV...G.M-VSPG.WIMRASTK.NWLA..SLK..--------.D.ANG--------------NPLF
A1B638_PARDP/102-387.DLVY.---ALGAQYR...A.N-A..S.FVMNSKTA.AAVR..KMR..--------.D.ADG--------------RFLW
Q0AWY3_SYNWW/43-310.KLFF.---SVKPEYR...R.N-G..V.WLMNDETA.LALR..TLK..--------.D.DGG--------------NYIW
A4YU30_BRASO/140-423......---KMMARLF...EMP-GGNPIWLANRDTI.PQLG..TMT..--------...IGN--------------NAAF
Q2NV28_SODGM/127-397LQAQLA---RIPATG.......-.....HVLHFTNW.AQIE..LIK..--------.D.TLG--------------RYLL
Q1GHS2_RUEST/113-395.DLVY.---ALDARYR...A.G-A..S.FVMNSKTA.GLIR..KLK..--------.D.ADG--------------RFLW
Q2L2B0_BORA1/123-401.GLIH.---SVDPAYR...N.A-PKFR.LAFNDATL.QILE..EME..--------.D.GNG--------------RPLW
A2SD63_METPP/97-385.DTVA.---ALKPQYR...T.G-A..S.WVMNRSTA.ATLR..KLK..--------.T.TDG--------------ESLW
A1TML8_ACIAC/138-428.GLML.---RIEMANV...D.M-SSCG.WVMAPRTI.RWLG..SLR..--------.D.GNG--------------NKAF
Q1QKG8_NITHX/112-388.DHMY.---SLPAAYR...G.R-G..T.WLMNARTL.AAIR..KLK..--------.DGTTG--------------VYLW
Q0S2A4_RHOJR/9-273......---YVHDAKSEALANG-AELTHIVLAPDVA.LALA..KAK..--------TATGSN--------------QGLL
Q6LSF8_PHOPR/134-417.SLEH.---SVDPAYR...N.S-PGVG.YMFHDTTL.EALR..VIK..--------.D.KND--------------RPIF
A5N1H4_CLOK5/152-424VSHMSV---IDDGEDG...API-GEVI.AVMKRSFYYSQIAPQTFL..--------.PTSDG--------------RLVI
A7HRJ6_PARL1/148-433.DLVY.---AVKAGYR...A.N-G..R.FVMNRSTQ.SSIR..KFK..--------.D.TDG--------------NYLW
Q2YMS9_BRUA2/137-422.ELIY.---TLKAGYR...Q.N-A..N.FVMNRKTQ.SVLR..KLK..--------.D.KDG--------------NYLW
Q73HT5_WOLPM/107-395.MLYY.---SLDEYYS...K.N-A..S.FLMNRSTL.KDIR..LLK..--------.S.QTG--------------QYLW
Q9A4P7_CAUCR/53-338.DLIY.---ATKTQYR...Q.N-G..R.FVMNRRTV.SAVR..KFK..--------.D.AQG--------------NYIW
Q3Z7J9_DEHM1/124-397.DVFH.---SLRSVYR...N.K-A..I.WILNDTTI.KALR..KIK..--------.D.NNG--------------NYIW
Q830G6_ENTFA/163-444.EFKNT---PVTEVMK...K.G-R....FIINRAAL.TAIE..KMK..--------.T.DDG--------------FPLL
A7MP72_CROS8/125-401.ALKH.---SVDPAYR...N.S-PKFR.FAFNDNTL.LKIS..SMK..--------.D.AQG--------------RPLW
A7ILP2_XANP2/167-448.NMTF.---SLKEAYL...A.N-G..S.WLMKRGTV.GSVA..LLK..--------.D.AQG--------------QYLW
B0T632_CAUSK/96-391..KLYN---SLHTKYR...NSA-T....FVTGSDIE.LQLM..LVK..--------.D.STG--------------NYIW
Q11H37_CHESB/111-386.DLLY.---KLAPAYR...R.N-A..T.WALNSTTL.ALVR..KLK..--------.D.SQG--------------NFLW
Q88G49_PSEPK/193-483.ALIL.---RLENANS...N.M-TSPG.FVMAPRTK.RWLA..ALR..--------.D.GNG--------------NKAY
Q72BY4_DESVH/118-395.DLEH.---SVDPAYR...A.L-G.AR.WMFHDLTL.KAVK..KLK..--------.D.GDG--------------RPLW
B2JU92_BURP8/137-421......---NMISRLP...VGS-FGRSFWLINPDVL.PALD..NLT..--------...LGN--------------YPIY
Q81Z09_BACAN/121-392LTDAEA---ALPLEYE...ASA-I....WTMTKKTF.MEFS..AMT..--------.D.ADG--------------QPIA
Q3SS55_NITWN/107-382.DTFY.---SLPAAYR...N.A-G..T.WLMNSTTL.AAIR..KLK..--------.DGTTG--------------TYLW
Q2GDU5_NEOSM/81-367.SLYY.---GLQREFS...V.N-G..T.FLMHSTTI.QLIR..GLK..--------.YEQTG--------------HYMF
Q3SSD8_NITWN/135-418.DLVY.---SIKQGYR...Q.N-A..R.FLMNRKTQ.AAIR..KFK..--------.SKTEE--------------LYLW
A6VNQ3_ACTSZ/129-407.ALLH.---SVDPAYR...N.V-GNSR.LAFNDNTF.KALK..ELV..--------.D.GQN--------------RPLW
A5N291_CLOK5/33-297.SLYF.---SLKDEYR...N.N-A..V.FIMHDNTA.MLLR..TLK..--------.D.TSG--------------SYLW
Q5WID4_BACSK/129-404LRRVKN---SIVQGYR...RNA-V....WVMNTEAF.ETLA..NI...--------.EDKNG--------------RGIL
A4XZF1_PSEMY/131-410.DLEH.---SVDPAYR...R.S-GNCS.LMFHDTTL.RELK..KLK..--------.D.ADG--------------RPIW
Q2N5Z6_ERYLH/94-380.DLVH.---TMKAGHR...Q.G-A..S.FVMNSATL.AEVR..KLK..--------.T.ADG--------------AFLW
Q2GJL3_ANAPZ/114-389.KLFY.---SLNENFS...S.R-A..A.FLMNRSIL.QEIR..SLK..--------.S.NTG--------------QYLL
A9BYD9_DELAS/120-394LQVELA---DYWADG.......-.....IVISPLDW.AAIE..LTK..--------.T.ADN--------------AYLF
Q5Z3V6_NOCFA/148-434TKARTV---GRVNPNG......-.....IVVNPADA.EAID..LAK..--------.D.ANE--------------RYYF
A5CD71_ORITB/88-365.SLIN.---SLDDYYH...A.N-S..T.LLMHRTTL.AKIQ..TIQ..--------.D.SSG--------------RFIW
A8FGQ6_BACP2/20-302LKQAYK---AMPSKYLRVPQDF-R....FYTSPSLEVEWKD..QVANR--------QT.TLG--------------DAVI
A1TD88_MYCVP/110-388VHNLDG---DLPQRYA...FNA-S....WLAHRKIY.SKIR..QF...--------.DTNGG--------------ASLW
A9CJN8_AGRFC/134-419.DAVY.---ALKAGHR...Q.N-G..T.FLMNRKTQ.GALR..RFK..--------.D.TSG--------------AYLW
A3DG61_CLOTH/127-416..KMWS---SMPARLR...ANA-V....WYINQEIE.PQLY..TMALN--------IG.AGG--------------APVF
Q2SDM1_HAHCH/110-393.SVIY.---RLKKAFR...R.N-A..N.WMMTGTTV.EKVR..KFK..--------.D.ADG--------------NYMW
B2JL19_BURP8/113-379AQVQAA---FYNPTF.......-.....AVMNPLDW.ASIQ..LMK..--------.N.AQG--------------EYLF
B7GIM9_ANOFW/146-418.KQIG.---LIDTGTD...S.V-GEIV.AVMKRSTYYNRLV..EFSIQ--------VD.SNG--------------NVVG
B9KI56_ANAMF/104-375.SLYY.---SLDEYFA...GRG-A....FIMHRSVL.QAIR..SLK..--------.S.GSG--------------QYLL
C5AYR6_METEA/135-420.DLIY.---ALRAGYR...Q.G-A..S.FVMNRRVQ.SAIR..KFK..--------.D.ADG--------------NYLW
P71947_MYCTU/196-475.ALQS.---ALPPRFQ...S.N-S..A.FAANLSTI.NVLR..QAE..--------.T.ANG--------------ALKF
Q2FX56_STAA8/38-311.DLEAL---LEDDELE...A.N-A....FISKTQNR.SLLR..KIV..--------.DPETK--------------ERIY
Q2G1W8_STAA8/130-399.DAINL---NVKPNYE...H.N-V....AIVSQTMF.AKLD..KMK..--------.D.KLG--------------NYLI
Q3J3W7_RHOS4/239-509.EAYH.---AIPTVYA...Q.N-A..V.WVMNRTTL.AKLR..TYF..--------.N.GMG--------------EPLL
Q81X82_BACAN/69-344.DMTL.---AVHPDHL...A.G-S..V.FVMGRPAF.NQVA..KLK..--------.D.AQG--------------NYHV
Q81XY0_BACAN/102-381.YSYG.---.GDEDVE...D.A-A..V.LILNKLDL.KSFA..KLR..--------.T.SDG--------------KKVY
Q88MK4_PSEPK/141-410.RAILQ---VRIAEYR...A.S-A....IALNPVDW.ADIE..LTK..--------.D.ANG--------------SYIW
Q9CFS0_LACLA/124-389.TMINT---AVDPAII...A.T-S..S.LLTNQSGL.NKLA..LVK..--------.T.AEG--------------KYLL
Q9P9R2_XYLFA/357-623.QMET.---QIALNNA...DVN-A.MS.YAFNAGIR.GYAK..TAL..--------.K.FPQ--------------TAAS
Q9ZWV6_BPPHC/121-387.DLFH.---EVPSAYR...K.N-A..K.FVVNDLRA.AQMR..KLK..--------.D.ANG--------------QYLW
W6SDV8_9CLOT/124-396.DLVY.---SLKAPYR...K.N-A..V.FLMNDATV.KAIR..KLK..--------.D.GQG--------------QYLW

PF06673

Q9MCB6_9VIRU/1-347TDAVAE-------------CSI-SDAITIVMSPQTF-AELR--KAK------------GTDG--------------HSRF
Q9MCB8_9VIRU/1-347TDAVAE-------------CSI-SDAITIVMSPQTF-AELR--KAK------------GTDG--------------HSRF

PF05125

D3UZQ7_XENBS/11-324SDLINT---CIPQQFIHDPRLV-VLVGADLVAAEQY-RLYQ...SA-----------DRPTE--------------KIAA
A6TE73_KLEP7/8-340MDATDN---LIDEIYQEDAELV-AIVGRKLLADKYF-PIVN...KD-----------QPNSE--------------ALAA
M9X6X0_MANHA/8-336MDATEE---LIDEWHRDDTDLV-VITGRKLLADKYF-PIVN...QQ-----------NAPTE--------------ELAA
Q5E389_VIBF1/11-331MNVK.G---LLADECANANDLV-ALIGSDLLAYDKA-KFYTAHGNT-----------PSEKS--------------LIED
Q2S7I3_HAHCH/8-327HACL.Q---MVDELHRDGGDLV-VIMGRDLLAEDKA-QLYAAQGHK-----------PTEKE--------------RLEN
Q15Y13_PSEA6/12-335HGAL.S---MIPEEHADSGDLV-AIVGRDLITRDKG-RRYAQHGEL-----------PSEKQ--------------RIEM
H2IY53_RAHAC/8-339FDAVNS---LMDEWYKDSPDLV-VITGRNLTVNRSF-PIINAVSTN-----------NPNSE--------------ALAG
B8J319_DESDA/15-323NDMV.E---GIPYYLQK..DLV-ALIGRDLIVRERA-MLFEAVQGT-----------PTEKA--------------AMD.
W8UNE7_YEREN/11-324SDLIND---KIPQQFRNDPRLV-VLVGADLVAAEQY-RLYQ...KA-----------DRPTE--------------KIAA
C1DBL5_LARHH/8-337FDAVEN---LIDEAFAEHPDLV-VIVGRSLLADKYF-PIIN...KD-----------NPPTE--------------QLAA
E6WE37_PANSA/8-338MDAVNR---KIGVQYQDDTDLV-VVCGRGLLADKYF-PLVN...QQ-----------QPNTE--------------ALAA
C5BH00_EDWI9/18-332SDLIHA---SIPPQYHNDPRLV-VLVGADLIAAESL-RLFN...KE-----------DKPSE--------------QVAA
B2FIZ5_STRMK/8-334MDLVAN---LIDPWHQDDTSLV-VICGRSLVHDKYF-PIVN...GN-----------NTPTE--------------KVAA
C1DS28_AZOVD/8-332FDLVAD---MLEPWYQEDTDLV-VICGRQLLADKYF-PIIN...QN-----------HAPTE--------------QLAA
Q8XY26_RALSO/8-332FDVVNQ---LVEPWYAEDPELV-VLCGRNLLADKYF-PLVN...KD-----------RDPVQ--------------QIAA
D8MKI1_ERWBE/9-341FDATSS---LLDEWFKSSDELV-VLCGRNIVTAREF-PLINGISES-----------NPNSE--------------ALAG
F6IH75_9SPHN/8-355FDAL.D---LLDPWHRSDTDLV-VIVGWKLVKDKYL-NLLQ..AAG-----------ETATE--------------REAA
J7TAL9_MORMO/8-339MSAVDE---VIDEEYRDDTELV-VICGRKLLSDKYF-PLVN...KE-----------QENSE--------------KLAA
B2VH98_ERWT9/8-339MGAVSE---KIAVQYQDDTELV-VICGRQLLADKYF-PIVN...KD-----------QPNTE--------------ALAA
F4HA06_GALAU/6-327AELK.S---GIDLRHRDRNDLV-FLVGADLIGKEAE-LINKAHGLT-----------PTEKA--------------VLGS
G0AIP5_COLFT/8-331ADGI.N---LLDPWYQEDTGLV-AFVGRKLLNDKYF-PLIN...TK-----------QAPTE--------------TLAA
F0LXI5_VIBFN/8-332LNLK.N---LLHPACENDSDLI-AIIGSDLLAYEKA-KFYDAHGNT-----------PTEKS--------------KIQE
B0UTP6_HISS2/8-335FSAVSD---LIAPQFQDDTKLV-AIMSRDLLADKYF-PLLN....Q-----------SKASE--------------QVAG
CAPSD_BPP2/8-340MDATNN---LIEPWYQEDPDLV-VIVGRQLLADKYF-PIVN...KE-----------QDNSE--------------MLAA
H2IRH6_RAHAC/8-340MNATDF---LLDAWHSEDPGLV-VICGRKMLSDKYF-PLIN...KS-----------QENSE--------------KLAG
B4F0K8_PROMH/8-339QDTVDT---AIDPEYQDDTGLV-VICGRKLLADKYF-PLVN...KD-----------QDNSE--------------KLAA
B0UW33_HISS2/6-327LDLK.Q---GLDLRHQNRTDLV-FLVGADLVNVESK-YISKASKLT-----------ATERA--------------ALGS
E6VXL3_DESAO/8-324SDLL.Q---GIPRYLRK..GLI-TLVGDELISHEHA-GLYKAIGNT-----------PSEK.--------------VLAT
A6VSU1_MARMS/18-341HQAK.Q---MLPIYHRKRKDLV-VIVGDDILSSQEE-TYFEVNGNT-----------PTEKA--------------VLAN
C5AGA6_BURGB/8-333YEATNS---LIEPWYAESPELV-VLCGRDTLLDKYF-PILD...RD-----------NPPTE--------------SLAA
J7SK37_MORMO/10-341YDAVNN---LIDPWHRNAAGLV-AIVGRQLVTQKNF-KIINQHSQQ-----------NPNME--------------LMAG
W0L880_9ENTR/8-339YDAVNS---LIEPWFQDDTGLI-VICGRNLLSDKYF-PILNTLSKT-----------NPNSE--------------ALAG
Q1QXQ6_CHRSD/8-331YDAVNS---LLEPWYRRVPGLV-VIVGRDLLSDKYF-PLLN...TE-----------QPPTE--------------QMAA
C5BAR3_EDWI9/8-332NDGEEN---LIDEWHVDGADLV-AICGRGVLHDKYF-PILN...QH-----------NENSE--------------KLAG
F4HB41_GALAU/8-340FDATNK---IIAEEYADDTELV-VICGRNILADKYF-QMIN...KT-----------NQPTE--------------ELAG
Q63LE5_BURPS/8-332MDIVSS---MIDPWFQEDTGLV-VICGRELLHDKYF-PIVN...AT-----------QAPTE--------------RLAA
A7MN35_CROS8/15-328NHLITN---FIAEPFREDPRLV-VLVGAELAAQQRL-KLFN...AA-----------DRAAD--------------ISAA
A1VSG1_POLNA/8-331FDAAQT---LLDPWYQNDGGLV-AIVGRTLMHDKLF-PLVS...DP-----------TAPTE--------------MLAA
F0LQ00_VIBFN/14-328QDLINT---TIAPEHREDPDLV-VMVGHNLVSAEQH-RLLE...SA-----------NTPTE--------------HKAA
Q6D3X2_PECAS/8-339YDAKNS---LMDEWHKRNPDNV-VILAGDLLTTSNF-PAINAMSQT-----------NPNSE--------------MLAG
CAPSD_BPHC1/5-328FDLK.Q---GLDFRHQNRNDLV-FLVGADLVSKETK-LIQQKHGLT-----------PTEKA--------------ALGS
D8J087_HERSS/8-337YDAVTN---L.DPWYQDDTSLV-VIVGRELLHDKYF-PMIN...KD-----------NKPTE--------------ALAT
H2FUC0_OCESG/13-333SDLINS---TIDPAFRNDPRLT-VMVGADLVAAAQG-RLYQ...QA-----------DKPTE--------------QIAA
Q8P6J5_XANCP/8-334FDVVSN---LLDPWHRKDPSLV-VVLGRDLMHDKYF-PMVN...KD-----------QAASE--------------KIAT
E0SAM8_DICD3/25-338SDLINA---KIPQQYRNDPRLV-VLVGADLVAAEQY-RLFQ...KA-----------DRPTE--------------KIAA
D3VKM6_XENNA/8-339MDSVNN---AIDAEYQDDTELV-VICGRELLADKYF-PLVN...QA-----------QPNTE--------------QMAA

PF11651

C4K6U8_HAMD5/1-421TGATPSKTGFLKAGDQLKFTST.HWLNQQSKQTLYNGSTAM--IFTAT..VLEETNSTASGD--------------VTVK
Q2G3Y7_NOVAD/1-418TATTYA...NVKIGDAFTIAGV.NEIHLITKQDT...GNLK--TFRVV..D.....KPAANT--------------IRIW
C5B0T5_METEA/1-404SALAGP....LKKGDFVSFAGV.NSVNRITKQND...GVLA--RFVVT..ADV...AAGATA--------------IPIY
K4L4N8_9FIRM/1-374DGTNMTG..TLLKGDLLSIDGKPYAIIENT...........--........TA...VTNEIA--------------VKLY
A5VES4_SPHWW/1-413DSFTNAT.DTVKAGEVFTIAGV.YAVNPVTKARL...PWLK--QFTVV..ADAT.CASNETD--------------VVIY
B2U8F8_RALPJ/1-419SALNGP....VNAGDVFTIAGV.FAVNRVTKQAY...PELQ--QFTVV..QAA...AAGATS--------------LSIY
CAPSD_BPP22/1-427SATTG.....MKRGDKISFAGV.KFLGQMAKNVL...AQDA--TFSVV..R.....VVDGTH--------------VEIT
J7TW41_MORMO/1-425SDGS.A....FKRGDKISFAGV.KFISQMAKDLL...TQDA--TFAVV........GVDGNN--------------ITIM
I2B9R2_SHIBC/1-422TGATASVTGFLKAGDQIKFTNT.YWLQQQSKQVLYNGSAPI--SFTATVLSDA..NSTAGGA--------------VTVT

PF09950

Q9P9P2_XYLFA/84-327E---NNI----------------AKAERGLDLTVRTGYG.LETAGE....GGT.......TRAMVYTKNP----TKLVLH
E1VAC6_HALED/80-318A---LYP----------------NV.......SLIASTE.LEPSDA....NGQQ......SSAVMYERDV----DNLSIE
A9C0G0_DELAS/60-320R---TNL----------------YTMQTGRPLTIRTVRELGTGAAN....GTT.......GRMVAYKNDG----EYVKLH
A6TKD0_ALKMQ/60-304E---QKW----------------FT.......NIIRVAD.LEGAGD....SST.......DCLAVFDSSK----DVVEMA
H6NDU4_9BACL/55-298S---YNW----------------FR.......SIDRAPE.LRGAGT....GGT.......DSMLIFDASS----EVMELL
Q7N327_PHOLL/62-316A---LRK----------------ASNNDSFSITFVKVPSNFAKNIV....KGK.......TRLAIYTYSE----DYIEMK
Q6FAE7_ACIAD/80-324E---NNI----------------F.ATQSKPLTIRGLGR.SNGKGT....AGA.......DRSIIYRRDP----SCIQMK
R6PG10_9CLOT/91-341E---HAP----------------YLK......EIVAAAE.LNSDSVETNPYAKSSDGQ..NVAFFFTKDP----DKLAVE
B4EG48_BURCJ/103-345N---NSL----------------SNAINGRPLEIYPSKW.LTNRGA....SNT.......NRMVAYTKDK----NRVRFP
C5AFU5_BURGB/112-366E---NNI----------------C.TQQGVKLEILPLKW.LIGAGT....GGTPGTLGTVDRMVAYNNDK----KYVQYP
R6AF56_9FIRM/26-279N---NNI----------------A.KNQGRSISIYPSRW.CIKAGA....GQT.......DRMVAYVNDE----DKVNFD
K8E4M7_CARML/57-293E---NQW----------------FE.......SIIPVSD.LDKAGT....NKT.......DCFIIMDTRS----STCEIL
E3HGR1_ACHXA/80-315D---KHP----------------GL.......QIMGAAE.FKGAGA....GGK.......DLILAYEYSE----ENLAME
C9LU84_SELS3/82-338D---HNI----------------A.KAKGVDLVIAECRF.CIGAGI....GKK.......NRMVAYVNQR----RFVGMD
R7JXV9_9CLOT/86-336D---HAP----------------YLK......NFESMAE.LQDSATDINPTGK.......NVAFMYTKDP----EKFSLE
B8IDG5_METNO/63-315R---HNI----------------YTLETGQDLTVIGVRA.LETAGA....GGS.......ARMVAYRRDP----SVLKLW
R6R1V3_9FIRM/101-351E---HTP----------------QIK......NWETAGE.LSKSNKDYNTTGK.......NIGLLYTKDA----DKMYHD
H8L668_FRAAD/90-334T---NCI----------------SHNVNGRPLDIQPVKW.LAGRGT....SGT.......DRMVAYTQEM----DRVRFP
R6RQ09_9CLOT/93-346E---NNV----------------A.KQNGADLFIGATSW.CKGAGD....ESE.......DRMVVYCNRE----KYLAMD
Q0BRS5_GRABC/66-316R---TNI----------------YTLTTGLPLTVRGIPG.LESAGA....SGV.......GRMIVYRRAP----DVMKLH
Q2NSP7_SODGM/17-247.---..V----------------ALKQANPGIEFVKANE.LNAAGK....SGK.......GSIVIGTIRN----DILCNR
B8IIV0_METNO/63-315Q---KNV----------------YTIETQRPLNVFGVRG.LETAGA....GGT.......TRMVAYRRDP----AVVKLW
Q6XQD3_BPT1/82-319S---QNS----------------GIEID....SIAELED.IDGAGT..............KGVLVYEKNP----MNMSIE
A9I906_BORPD/80-320K---QHP----------------GL.......RIEEVPE.LSDAGT....GGV.......SLAIMYERSE----ENLSME
Q2G4R3_NOVAD/111-362A---NNV----------------A....GEALTILKSRE.LETAGT....GST.......TRMIAYDNNP----QVLKFM
W8UFX7_YEREN/64-311T---NFK----------------DMDFDDDVL........LAGAGA....AKK.......DRLVVYKKDM----RVVKGH
A7ILG8_XANP2/103-352E---NNI----------------LTAEKGIPLDIVSVKW.LDKANR....SGASY.....DRMVAYSQQP----EYVRFP
Q32EP9_SHIDS/73-313T---NTI----------------SYHQNGVPLNIRAVKW.LKGRGV....GNK.......DRMVAYTNDK----KYVRYP
G2IHV9_9SPHN/64-315A---NNA----------------YTAISRQPLNILPMQW.LETAGA....SST.......KRMIAYARNP----GVLEFF
Q835B4_ENTFA/57-293E---NGW----------------FS.......SIEQVYD.LKGVGT....DNS.......DSFIIMDTKP----STCEIL
D0UIJ0_AGGAD/58-304K---HLS----------------AAA..GRQVAIKALPSNYGTRVT....DGK.......TRAMVYVNSK----EHVIFD
Q984H1_RHILO/86-339Q---KNV----------------YTLTTGAPLTVRGLFGYLETAGT....GSS.......KRMVAYRRSP----EVLKMH
Q2NRY5_SODGM/73-317E---NTI----------------AFKQNGKPLDIQPVKW.LEKGDE....FTA.......NRAVLYSQDR----KYVQFP

PF04454

D4H156_DENA2/1-251D---TVR----------------RQI.KGDIIYSETVDG---------------------..ALLVADRE----GDVELT
C8WPL7_EGGLE/1-257D---RIK----------------KLI.GDNVYMTSVMGP---------------------GKAVLVCAEP----EYLDLA
D0LZ74_HALO1/1-251K---QVQ----------------RLVVDGPLVRANALAG---------------------..ALVMSMRG----GDYELT
D1B7I4_THEAS/1-249K---NLA----------------ELV..DKVIYAPALDG---------------------..ALLVSLAG----GHLQLT
A1B987_PARDP/1-251K---HLE----------------RLV.DVPVVWSQALEG---------------------..GAVVTTRG----GDFDLW
A3DFK3_CLOTH/1-257D---RIN----------------KLL.DGNIFSTPVLKD---------------------DKAVLVCSEP----QNIDLV
A6TWC5_ALKMQ/1-250N---RIQ----------------ELT.GSKVIYSPVVEG---------------------..ALLLPYDH----EDLELT
A7HIB4_ANADF/2-255Q---QLQ----------------PAF.AGGIVKAPAIQD---------------------G.AVIVMRTP----SGPRIL
A7I7A2_METB6/2-249D---HVS----------------SIV.GDGVIKAPVLKK---------------------G.GVLVASGS----QYASVA
A8F8I8_PSELT/3-247E---HLS----------------MII..KGIYKAPVLKN---------------------S.GVLMSDSE----AYASII
A8L1F1_FRASN/1-253N---HLK----------------QIL.DGPVVRAPGVRG---------------------..AVVLSQRG----GDFILE
A9BEM3_PETMO/1-251L---VVK----------------EII.DAKVKPMHEVDE---------------------..SFVVSNRG----GDFKLI
A9FWS5_SORC5/3-254K---HIE----------------GQLIDGPIVWAPALEG---------------------..GVLLSTRG----GDFELT
A9H5P1_GLUDA/1-251R---HIE----------------SLI.DGKIVWAPAIEG---------------------..GFVLSTRG----GDFELD
B1VSP7_STRGG/1-251T---HLS----------------RLV.DDEILWAPAVKG---------------------..GVLLSTRG----GDFELC
B2A6K6_NATTJ/8-259E---RIH----------------ELT.GSKVVISPIVDG---------------------..AYLVPYDH----DDLELT
B2GID2_KOCRD/1-252E---HVS----------------RILGEGSIIWAPALDD---------------------..ALLVSARG----GDYELH
B2JNZ6_BURP8/1-251E---HIK----------------RIV.NGEIIWAPALEG---------------------..GSVLSMRG----GDYELH
B2V6Y3_SULSY/1-265D---QIK----------------KLF.DVGVFTTPVIPQ---------------------FTAVVVSTGI----ENLDLF
B4UA40_HYDS0/1-265T---HIK----------------ELF.DVGVFTSHAVDE---------------------GKTIAVATGV----ENMDIF
B8CYH7_HALOH/1-249K---RIS----------------DII.GGDILFTPDLEG---------------------Y.GLLLSKRG----GDFELI
B8EQK3_METSB/1-251E---HVK----------------RLV.EDQIFWAPAIAG---------------------..AFVLTTRG----GDFELT
B8GHL2_METPE/5-250E---HLQ----------------QMI.TDGIFKAPVLKD---------------------G.GVLIATGQ----QYAAIV
B9JHD1_AGRRK/1-251H---HIE----------------RVV.DGGIIWAPAIEG---------------------..GFVLTTRG----GDFELD
C0R0J8_BRAHW/1-256Q---RIS----------------SMI..GNLYNVPVIKG---------------------KKAALICAEP----QYMDLA
C0ZHN4_BREBN/1-265E---HVR----------------NLV.TDGVFQSPTIKG---------------------RSGVLVATGR----HNLDLA
C0ZVK4_RHOE4/1-251E---HLR----------------RVL.DGEIIWAPAIDG---------------------..AFLLSTRG----GDYELH
D5UVK7_TSUPD/1-251E---HLN----------------RLV.DGDIIWAPAIDG---------------------..AFVLTTRG----GDFDLR
C4XPM7_DESMR/1-251Q---YLE----------------TML.GGQVIVSPFIEE---------------------..AYLLSTRG----GDLEMT
C5B5H8_METEA/1-251H---HLE----------------RIV.DGGVIWAPAIAG---------------------..GFVLTTRG----GDFELD
O67639_AQUAE/1-267E---QIK----------------KVV..KEVYQTPIIPE---------------------DIVLLVSASP----ANFDLA
Q08WR7_STIAD/2-266E---TIR----------------QLA.SDGVFQSNRLRG---------------------DSGVVVSTGR----ENMDLT
Q0RH88_FRAAA/1-253T---HLQ----------------HIL.DGPVVQAPGVTG---------------------..AVVLSLRG----GDFVLE
Q2RVS0_RHORT/1-258Q---HVR----------------RLF.EGPLIWAPGVDG---------------------..AMLISQRG----GDFELT
Q5YPL3_NOCFA/1-252T---HIE----------------RLIPDGEIIWAPAIDG---------------------..AFVLTTRG----GDYELT
Q7MSM9_WOLSU/1-252L---KLA----------------ELLQGNNIIVAPALKS---------------------G.ALLVSLRG----GDYELY
Q97V86_SULSO/96-329E---MIK----------------EI...GNVVPTDIVSN---------------------DEIYVISKQG----..FDIL
B2HH42_MYCMM/1-251E---HLN----------------RLV.DGDIIWAPAIDG---------------------..AFVLTTRG----GDFDLQ
Q0SE23_RHOJR/5-254H---HLR----------------DLV.AGDIIWAPAISG---------------------..GYVLSTRG----GDNQLT
Q2IH48_ANADE/1-259Q---QLL----------------PAF.EGGIVKAPGLRD---------------------G.AVVVVRSA----SGPQAV
Q5L1H9_GEOKA/8-264E---HIR----------------ELM.TAGIYQTPVIKG---------------------KRGVVIDTGR----QNIDLA
MARIT_THEMA/1-251K---RVE----------------ECLRGGKIITTPRIED---------------------..ALVVSERG----GDFKLI

PF05065

E0THR4_PARBH/115-394S...PGL....GG----QT....ASLLGFSITESEHMPDV........ANGETP..----...IAFG.DF...QRGYLIV
Q1GG15_RUEST/131-399GKPQGTIA.P...----.......TLWGLPVVATQAI.................T.----VDKFLTG.AFN..MGAQIFD
Q1DCZ9_MYXXD/94-361R...QEM...LDR----G......TIRGFPFVMTTRVPV..........SRI....----...TFSA.DW...RQFIYGI
Q0AAI8_ALKEH/83-374Q...MSL...AEG----RP....NTLLGFPVVIAEDMPDP........AADSES..----...ILFG.DF...GQAYTIV
Q3J4R6_RHOS4/160-429ANPLQLAG.P...----.......VLWGRPVVPTTEI.................D.----EDKFLVG.AFR..AAATIYD
A1T829_MYCVP/9-278Q...ASVDPTQPT----AR.....MILGSQLLVSPAV...................----DADVIWAIPQ....LHSLVV
Q982R8_RHILO/176-465A...PPS...ANE----KV....PTIFGKPAYTDDNMNEI........GTNTFP..----...VAVG.DF...KRAYLIV
A1AYY2_PARDP/166-435ANVMQLAG.P...----.......QLWGHPVVQTQSM.................D.----LDEFLTG.AFK..AAATIYD
Q1ILS6_KORVE/495-776....PIW...HSD----DT......VAGYPAMSSNQLPSNTS.....KGSGTNL..----.HTMIVG.DW....AQLILG
Q1GH34_RUEST/388-661....PIW...ESD----NT......VNGYRGEVTNQIK.............D....----.GDVFHG.DF....ANVLVG
Q2GAM7_NOVAD/185-459ANPQGGSE.A...----.......RLWRLPVVETQAM.................T.----VDKFLTG.AFQ..MGAQVFD
Q8XYS4_RALSO/130-408L...PGL...ESS----AP....PTILKRQYVIDQAIDDI........GAGKKF..----...MYGG.DF....NQFILR
Q3J3K4_RHOS4/110-395S...DGL...AAA----EP....ARLMGYPVLLCEDMPDI........AAGAFA..----...IAFG.DF...AAGYTIA
Q1QLS4_NITHX/103-379Q...PGL...AQG----DP....ATILGRPLIEDPTMDDI........GSAAEP..----...ILFG.SV...SDAYRIY
Q8ED08_SHEON/122-393GKPQGQTV.P...----.......TLWNRPVVETQSI.................V.----QNEFLVG.AFQ..MGAQIYD
Q813J9_BACCR/150-424R...PFN...QAE----GGI..GYTLLGFPVEEEDAIDI..........PDSPD..----TPVFYFG.DF....SKFYIQ
Q3J5Z4_RHOS4/150-439P...SIG...ASA----Q.......LMGFPIRTSSQIPDNLG.....AGGDE....----.TEIYFG.DF....DEAMIG
A1B638_PARDP/102-387A...DSL...AMG----QP....AQLLGYPVLVCEDMPDI........AQGSHS..----...IAFG.DF...RSAYTIV
Q0AWY3_SYNWW/43-310N...HA.......----.N....DTILGKKVCISEFMPSA........GTGAKP..----...IAFG.DF....SYYWIV
A4YU30_BRASO/140-423L...PVN...QAL----TGSPFKNTLAGDPLLFNEHCQ............TVGT..----TGDIVLA.DL....SGYALA
Q2NV28_SODGM/127-397SNPAALTT.P...----.......TLWGLPVVVTEAA.................EF----KDKFLVG.AFN..LGAQLFD
Q1GHS2_RUEST/113-395S...DGL...QAG----EP....ARLMGYPVLVAEDMPDV........ASDSLS..----...IAFG.DF...AAGYTIA
Q2L2B0_BORA1/123-401I...PGL...DAG----AP....ARLLKYQYVVDQAIPAL........AAGAKF..----...MFAG.DF....DQFILR
A2SD63_METPP/97-385A...AST...TAG----LP....STLLGYPVIEDDQMASI........ATNSLS..----...IAFG.NF...RRGYTFV
A1TML8_ACIAC/138-428P...EI....ESG----R.......LKGYPVALTTQIPVNLG.....AGGDA....----.SEIYFG.NF....ADMFIG
Q1QKG8_NITHX/112-388Q...PSY...VSG----QP....ETILGRPVIEIPDMADI........GAGAEP..----...ILFG.DI...ATAFRIV
Q0S2A4_RHOJR/9-273ETVDDGV......----.......KLAGLIALVSPYV...................----TAGNAWALDS....SQVLTV
Q6LSF8_PHOPR/134-417V...PGY...ETG----NPGGAPDRILNRPITINQHMAEM........AADAKS..----...ILFG.AL....NKYRIR
A5N1H4_CLOK5/152-424Q.........TAQ----SP....RLPDGTRIVFSQYM.................P.----ANTILLG.DF....KKYLLG
A7HRJ6_PARL1/148-433Q...PAV...AAG----QP....PTLLNYAVTEAEDMPSM........EAGAPA..----...VAFG.DF...RRGYLIV
Q2YMS9_BRUA2/137-422Q...PPA...AIG----EK....ASFMGVGLVEAEHMPDI........AADAAA..----...IAFG.DF...GRGYLVV
Q73HT5_WOLPM/107-395Q...PSL...SLE----AP....DTLMGIPVYQSADMPPA........PNNQLP..----..VIAMA.DF...KQAYKIV
Q9A4P7_CAUCR/53-338N...AAL...QPG----QS....ASLLGFPVTEIEAMPDM........AANSLS..----...VAFG.DF...EKGYLIV
Q3Z7J9_DEHM1/124-397Q...PSV...VAG----QP....DTILNRPYKTSIYAPEL........AAGNTA..----...ILFG.DF....SFYWIA
Q830G6_ENTFA/163-444R...PFT...QAE----GGI..GYQLVGYPVDWTDAADK..........KGEPD..----TPVLYFG.DF....SAFKIQ
A7MP72_CROS8/125-401L...PDV...VGM----AP....ATVLNVPYVIDQAIADI........GAGKQF..----...VYCG.DF....DRFILR
A7ILP2_XANP2/167-448R...PGL...EAG----KP....SILLGYPVRQADDMPVV........GAGALP..----...IAFG.DF...RAGYTVV
B0T632_CAUSK/96-391QPAVG.....QTY----QA.....VIQGRPVVIDDFMPG...........VTGSAG----VPRVLFA.DF....SENYVN
Q11H37_CHESB/111-386Q...PGI...ANG----QP....ETILGRPVAEMPDMPDV........TADALP..----...ILIG.DF...QQGYRIV
Q88G49_PSEPK/193-483P...EL....DQN----M.......LKGFPVGSTTQIPINLG.....AEGDA....----.SEIHFA.DF....ADCFIG
Q72BY4_DESVH/118-395M...PDV...AGS----AP....ATILGYGYAINQNMAVM........AANAKS..----...ILFG.HL....KAYTIR
B2JU92_BURP8/137-421M...PVGGGDRAA----GGSP.YGMLKGRPIVLSEHAS............PFSS..----QSDISLL.DL....SYYRSI
Q81Z09_BACAN/121-392R...TNYGISGKP----ER.....ILLGRPVVLCNYVDS..........FATATEG----TAFAFLF.NY....KDYILN
Q3SS55_NITWN/107-382S...PGF....QG----QA....DTILGRPVIDCPDMDDV........GSGTTP..----...IAFG.DI...AATYRIL
Q2GDU5_NEOSM/81-367Q...PGI...LVG----QP....DTLMGIPVIECSEMPIIPISDKSTSSTKKYP..----...IIFG.DF...KRGYQIV
Q3SSD8_NITWN/135-418Q...PSI...QAG----QP....ATILGYPVTDDDNMPDAT.......AGGNFP..----...IAFG.DF...QRGYLIV
A6VNQ3_ACTSZ/129-407L...PDV...AGV----AP....STILGKQYVIDQGIADI........GVGNKF..----...AYFG.DF....NRFVVR
A5N291_CLOK5/33-297N...SS.......----.D....NTIFGKPVVTSPYMPTV........SAGAKS..----...IVFG.DL....SYYWLI
Q5WID4_BACSK/129-404A.....ADPRNED----AF.....NLFGRPVHVYDEIVT..........DDETK..----TTQILFG.DI...KRCYRMF
A4XZF1_PSEMY/131-410L...PGV...DVA----EP....ATLIGMRYTINQDMPVM........AANAKS..----...ILFG.DF....SRYIIR
Q2N5Z6_ERYLH/94-380Q...PGM...VEG----QP....DRLLGYPVVEAEDMPDI........ANGECP..----...VAFG.NF...RHGYLIA
Q2GJL3_ANAPZ/114-389Q...VG....NSG----D.....EMLLGIPVYQTSDMPMY........SDGSNS..----..IIAIA.DF...KSAYKIV
A9BYD9_DELAS/120-394TNPRTQEL.P...----.......SLWGRNVVPTQAM.................D.----PAEFLVG.AFGGGLAAQGWD
Q5Z3V6_NOCFA/148-434GGPQAITQ.R...----.......TLWGLPVIESESQ.................A.----AGEALVG.DF...AKAVLWD
A5CD71_ORITB/88-365Q...PKL...SRN----LP....QTILGIPVICASDMPTTQ......LTNDSIP..----CYPIILA.DF...KLAYKIV
A8FGQ6_BACP2/20-302..........QGG----LS.....SAFGVPVKGLANMQT..........YDEAGTD----VSDILLT.HP....KNIIVG
A1TD88_MYCVP/110-388G...QLA...EGR----KS.....ELLGRPDYVAEAMDSS........ITNGQD..----NHVLAFG.DF....QNFVIA
A9CJN8_AGRFC/134-419H...PPA...AAG----QP....ASLMGFPVTEAEDMPGV........AANSFA..----...IAFG.DF...RAGYLVV
A3DG61_CLOTH/127-416MPSGGAA...ASQ----YS.....TLLNRPIIPIEQCS............PLGK..----KGDIILA.DP....TQYIGI
Q2SDM1_HAHCH/110-393R...PGI...EAG----QP....SLLLGYGIEENEDMPEV........AADANA..----...ILFG.DF...MRGYSIV
B2JL19_BURP8/113-379GSPLAPVT.P...----.......RLWNINIDATYAM.................A.----QGQFLVG.D.A..RQAMVWD
B7GIM9_ANOFW/146-418K..LPNL...RIP----.......DLLGLRVVFNNFL................D..----DDTVLFG.EF....QQYTLV
B9KI56_ANAMF/104-375Q...PGP....SG----EE.....TLLGAPVYQTSDMPA..........IANAK..----LPIIAFG.DF...KNAYKIV
C5AYR6_METEA/135-420Q...PPL...AAD----RA....ATLMGFPLVEAEAMPD...........IAAG..----SHAIAFG.DF...KRGYLVV
P71947_MYCTU/196-475....PSL...HAS----PP.....MLAGKHIWEVSNMDTVDA....AVTATNY...----..PLVLG.DW....KQFIIT
Q2FX56_STAA8/38-311..........DRN----SD.....SLDGLPVVNLKSS..............NLK..----RGELITG.DF....DKLIYG
Q2G1W8_STAA8/130-399Q...PDV...KEK----TQ....QRLLGAKIEILPDEVL...........GQKG..----NNTLIIG.NL...KDAIVLF
Q3J3W7_RHOS4/239-509L...DSI...SEK----AP....TTLLGRPVVEAPDMPNM........TAGATP..----...ILFG.DL....SGYRIV
Q81X82_BACAN/69-344V...KDV...VNG----KPV...YKIFGHEILIQDKMPS...........AAAG..----SITVVFI.NF...AEAYATM
Q81XY0_BACAN/102-381N...VVS...QGN----SG.....TIDGVPFIINSACKAVSD....AKTTAGQ...----.YSMAYG.PL....SNYQLT
Q88MK4_PSEPK/141-410V....NV...QEG----GV....QRLWKLPVVDSNAV................P..----EGEFLVG.AMN..IAAQVFD
Q9CFS0_LACLA/124-389E...PDP...TKP----NS....YLIKGKQVIVVADRWLPN......TGSTVYP..----...LYYG.DM...SQAITLF
Q9P9R2_XYLFA/357-623G...TIW...ESG----N......TVNGYPASVSNQI................K..----AGDVFFG.NW....ADLIIA
Q9ZWV6_BPPHC/121-387Q...SAL...TVG----AP....DTFNGKVVETDDGM................P..----ADKVLFA.DL....SKYRVR
W6SDV8_9CLOT/124-396Q...PSL...TAG----TP....DTLLNRPVYTSAYAPTI.........EAGA...----.KTIAFG.DF....GYYWIA

PF06673

Q9MCB6_9VIRU/1-347NELATKE----------------QIAQSFGAVNLETRVWMPK------------------DEVAVYNHDEYVLIGDLNVE
Q9MCB8_9VIRU/1-347NELATKE----------------QIAQSFGAVNLETRVWMPK------------------DEVAVYNHDEYVLIGDLNVE

PF05125

D3UZQ7_XENBS/11-324QMLGS..----------------.SIAGRPAMVPPFMPG-----------------------KRMVVTML----PNLQIL
A6TE73_KLEP7/8-340DIIIS.Q----------------KRIGNLPAVRVPYFPA-----------------------NAIMVTRL----DNLSIY
M9X6X0_MANHA/8-336DIVIS.Q----------------KRIGGLKAVRVPFFPA-----------------------NAILITKL----ENLAIY
Q5E389_VIBF1/11-331KQVIG..----------------.TYGGLPAFCPPSFPP-----------------------TGIFVTSF----KNLSLY
Q2S7I3_HAHCH/8-327QAIIR..----------------.TYGGLPAITAPFFPA-----------------------RGLLVTSL----DNLSLY
Q15Y13_PSEA6/12-335AQTID..----------------.TYGGLNAFTVPHFPA-----------------------RGVLVTSM----SNLSLY
H2IY53_RAHAC/8-339QLIAS.R----------------KTIGNLPSFIAPFFPD-----------------------GSMFITSW----ENLSIY
B8J319_DESDA/15-323....SFS----------------QKYGGLPWETPSFFPA-----------------------RGLVITPL----ANLSLY
W8UNE7_YEREN/11-324QMLSD..----------------.SIAGRPAMVPPFMPG-----------------------KRMVVTML----SNLHIY
C1DBL5_LARHH/8-337DMVIS.Q----------------KRIGNLPAVRAPFMKA-----------------------GSMLVTPL----SNLSIY
E6WE37_PANSA/8-338DLIIS.Q----------------KRMGGLQAVRAPYFPA-----------------------DALLITRL----DNLSIY
C5BH00_EDWI9/18-332RQLGK..----------------.DIAGRRAIVPPFMPG-----------------------KRMVITML----PNLQIL
B2FIZ5_STRMK/8-334ELILG.T----------------KRIGGLQPVIVPFFPA-----------------------KSLMVTSL----SNLSLY
C1DS28_AZOVD/8-332DVVTS.Q----------------KRIGNLPAVRVPYFPP-----------------------KALLVTRL----DNLSIY
Q8XY26_RALSO/8-332DLIIS.Q----------------KRIGNLQAVRVPYFPA-----------------------NGLLVTRL----DNLSIY
D8MKI1_ERWBE/9-341QLIAS.R----------------KTIGNIPSLIAPSFPD-----------------------GTLFITSL----SNLSIY
F6IH75_9SPHN/8-355HRILTLP----------------KQLAGKRAVIVPFFPE-----------------------TSMLITSL----DNLSIY
J7TAL9_MORMO/8-339DMIIS.Q----------------KRIGGLQAVRAPYFPE-----------------------NALFITRL----DNLSIY
B2VH98_ERWT9/8-339DLIIS.Q----------------KRIGGLPAVRASFFPA-----------------------DALLITRL----DNLSIY
F4HA06_GALAU/6-327QNLLG..----------------.SFGGMRGIVPPNFPA-----------------------RGAVVTTL----SNLSIY
G0AIP5_COLFT/8-331DIIIS.Q----------------KRIGGLPAVRVPFFPD-----------------------NAILITRF----DNLSVY
F0LXI5_VIBFN/8-332RQVIG..----------------.TYGGLPAVSVPGFPS-----------------------TGIMVTSY----DNLSIY
B0UTP6_HISS2/8-335DIIMS.T----------------KRVGGLQAVQAPFVPK-----------------------GTILITRL----DNLSIY
CAPSD_BPP2/8-340DVIIS.Q----------------KRIGNLPAVRVPYFPA-----------------------DAMLITKL----ENLSIY
H2IRH6_RAHAC/8-340DIIVS.Q----------------KRIGNLPAVRVPYFPD-----------------------NALLITRL----DNLSIY
B4F0K8_PROMH/8-339DTIIS.Q----------------KRIGGLPAVRAPFFPG-----------------------NAFFITRL----DNLSIY
B0UW33_HISS2/6-327HNLVN..----------------.TFAGMRAIIPPNFPA-----------------------KGAAVTTL----NNLSIY
E6VXL3_DESAO/8-324QSLSL..----------------..LGGLPWMTPSNFPG-----------------------RGLVITPL----KNLSIY
A6VSU1_MARMS/18-341RITKA..----------------..YGNLPIVYAPFFPD-----------------------GSLLVTPL----DNLSIY
C5AGA6_BURGB/8-333SMVIS.Q----------------KRIGNLQAMRVPFMPR-----------------------GKLFITIP----KNLSIY
J7SK37_MORMO/10-341NELMK.L----------------SSVGGIPSVQVPYFPD-----------------------GAVLITTM----KNLSIY
W0L880_9ENTR/8-339QVLLS.Q----------------QQIGAMPTYRVPYFPP-----------------------NAMLITRF----DNLSIY
Q1QXQ6_CHRSD/8-331DLVIS.Q----------------KRIGGLQGMDVPFFPD-----------------------NALMVTTL----DNLSIY
C5BAR3_EDWI9/8-332QILVS.Q----------------KTIGGRPAVRVPGFPR-----------------------NTILVTAF----SNLSIY
F4HB41_GALAU/8-340QVILS.Q----------------KQIGGLKAIRVPYFPA-----------------------NSMLITRL----DNLSIY
Q63LE5_BURPS/8-332DLIVS.Q----------------KRIGNLPAVRVPFFPK-----------------------RALMVTKL----SNLSIY
A7MN35_CROS8/15-328QLAGS..----------------.SVAGRFAFIPPFMPG-----------------------RRLAVTTL----SNLHIY
A1VSG1_POLNA/8-331DIVRS.Q----------------RRLGGLQAITVPYFPA-----------------------NTVLITRL----DNLSIY
F0LQ00_VIBFN/14-328QTLAK..----------------.TIAGRTAITPPFFPA-----------------------NGIWVTNT----KNLQIL
Q6D3X2_PECAS/8-339QLIVA.Q----------------ERVGNMPTFIAPYFPV-----------------------SGVLITPF----KNLSVY
CAPSD_BPHC1/5-328HNLMG..----------------.SFGGMNAITPPNFPA-----------------------RAAAVTTL----KNLSVY
D8J087_HERSS/8-337DIIVS.Q----------------KRIGGLPAVRVPSFPA-----------------------NAMLITRL----DNLSIY
H2FUC0_OCESG/13-333QQLAT..----------------.SVAGRRAITPPFFPG-----------------------KRMVVTIP----ANLHLY
Q8P6J5_XANCP/8-334DLILS.Q----------------RRVGGLQVAEVPYLPD-----------------------GALMVTSL----ANLSIY
E0SAM8_DICD3/25-338QMLDS..----------------.TIAGRPAIVPPFMPG-----------------------KRMTVTTL----SNLHIY
D3VKM6_XENNA/8-339DIIIS.Q----------------KRIGHLPAVRVPYFPP-----------------------KALFITRL----DNLSIY

PF11651

C4K6U8_HAMD5/1-421LSGVPIYDEKNSQ....YNAVDAKVKAGDAVSIIGTAKQQM-------------------KPNLFYNKFFCGLGTIPL..
Q2G3Y7_NOVAD/1-418PAIIDAAEGSIGSK..EYANVSATPANGANITWLNTTAAPL-------------------..NPFFRKESLLLIPGSFTV
C5B0T5_METEA/1-404PALIPPVGGVAVP....YQTVSASPANGAQVTSPFPAGETY-------------------RKNVVLSTSALTMVTADLEV
K4L4N8_9FIRM/1-374PA...................TADIADDTEVTIVSTHTA..-------------------..NLAFHKNAFALVSRPLAL
A5VES4_SPHWW/1-413PAMIWTGAFQNVS......VVGVTDLNNQAVTFLGSAATTY-------------------AQNLVFHKNAFALAIVPMVS
B2U8F8_RALPJ/1-419PSINPPVGGNPVQ....YQTVTASPANGAQITFLTNASAQY-------------------RMNLAYVPEAITMVTADLEL
CAPSD_BPP22/1-427PKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNVKDART-------------------..NVFWADDAIRIVSQPIPA
J7TW41_MORMO/1-425PKPIALDDAALKPEERAYANVNTSLAAGAAISVINVKTAKT-------------------..NIFWADDSITLLSQPIPL
I2B9R2_SHIBC/1-422LSGVPIYDTTNSQ....YNAVSHQVDAGDEVTVIGTAGQTM-------------------KPNLFYNKFFCGLGTIPL..

PF09950

Q9P9P2_XYLFA/84-327L-PMP-IRF.LPPQ.---------------PKGLRFDIPGEYKYSGVEFRYPKSALYADGI
E1VAC6_HALED/80-318I-PRP-FEQ.LPAE.---------------KRNLEMVIDCIAKCSGVAVYRPLSLTKA...
A9C0G0_DELAS/60-320L-PMP-HRF.LPVYQ---------------DGPLNYAVPGIFRTGGVELLTTVAMRYIDQI
A6TKD0_ALKMQ/60-304L-PLD-ITR.HPEVM---------------LANMSSQINLEERTGGAIVRFPMGICRADGI
H6NDU4_9BACL/55-298L-PMD-MMR.HDPE.---------------WEFPKWKFVVEERCGGVVIRYPMAIARGDGI
Q7N327_PHOLL/62-316V-HMP-ELL.AVRQ.---------------RDLLTFECGYRSAFGGAMWKQPKSAVYVDY.
Q6FAE7_ACIAD/80-324C-D.D-VSF.LAAQ.---------------PDGLDVKVPGHYKYQGVWLKRVDSLRYLDHV
R6PG10_9CLOT/91-341D-PMP-YYQ.YPVQ.---------------ERNLEMIVPCEARTAGVIIYYPLSALIA...
B4EG48_BURCJ/103-345L-.VP-LQR.TPLE.---------------YRDIRQLTTYFGRLGVVEVVYPETIGYRDGV
C5AFU5_BURGB/112-366M-.TD-LQR.TPLE.---------------YRSLFQITTYWSRLGQIEWRYGTTGAYRDGI
R6AF56_9FIRM/26-279I-TVP-ITRAMSSPN---------------LSAAAYDTLYAAQIGQVKFNYYQPVRYIDGI
K8E4M7_CARML/57-293L-PMD-VVR.FEQE.---------------WAYPNWKVPFEERCGGALIRTPYAIVRADGI
E3HGR1_ACHXA/80-315L-PMP-FNQ.LAAQ.---------------ARGLELVVPCLARAGGVVVYYPLSLA.....
C9LU84_SELS3/82-338V-PVP-MSRVMTQPN---------------VNTASYDSLYMANVGQVKIHYFEPFIYRDGI
R7JXV9_9CLOT/86-336I-PLP-FYQ.YPLQ.---------------VQKLETEIPCETRTAGLIIYYPLSMLLAYG.
B8IDG5_METNO/63-315L-PMP-FRF.FPAWQ---------------TGPWRFEVPGAFRLGGLDIRRPGAFRYLDGI
R6R1V3_9FIRM/101-351V-PMA-FLQ.HAPQ.---------------DRNLEIVINCEGRDAGMVIPYPLSACLV...
H8L668_FRAAD/90-334Y-.VP-LQR.TPLE.---------------YRDLRQLVTYFGRLGAVEFVYPETLAYADG.
R6RQ09_9CLOT/93-346E-LVP-LTRAMTGPN---------------TAEFCYDTAYAGNLSEVEVFYDQTMVYVDGI
Q0BRS5_GRABC/66-316I-PMP-LQF.LAPWQ---------------SGPMRFEVPGIFRLGGVDIRKPGAIRYLDGV
Q2NSP7_SODGM/17-247V-PVA-FTA.LPAQ.---------------ARNINVYVPCYCKVVELEVLQKDALLRVD.L
B8IIV0_METNO/63-315M-PMP-FRF.FPAWQ---------------TGPFKFDVPGAFRLGGVDIRRPGAFRYLDGI
Q6XQD3_BPT1/82-319I-PEA-FNM.LPAQ.---------------PKDLHFKVPCTSKCTGLTIYRPMTIVLITGV
A9I906_BORPD/80-320N-PMP-FNQ.LAAQ.---------------ARNLELVVPCLARTGGVAVYYPLALTKAEGI
Q2G4R3_NOVAD/111-362L-PGA-HQF.LPAFQ---------------KSSLVYEVGGIMNVGGCDVRLPKAIVYRDS.
W8UFX7_YEREN/64-311D-VMP-LRF.LAPAT---------------PDNVNFKVPAVLRTGGTEWRIPKAAHYVDGV
A7ILG8_XANP2/103-352F-.VP-LIP.ATTQ.---------------YEGIWVKVPYYGKLGQVEVVYPEVIGYRDGI
Q32EP9_SHIDS/73-313L-.VP-LQS.VPVQ.---------------YRGLYQIVTYYGKLGAVEPVYKETISYVDGI
G2IHV9_9SPHN/64-315L-PGA-FTF.MPMHP---------------ISSLAWRVDGIMNVGQLEIYRPKAVSYRDGI
Q835B4_ENTFA/57-293L-PED-IVR.LEVE.---------------WSFPNWKVPFVERCGGALIRTPYAIVRVDGI
D0UIJ0_AGGAD/58-304V-PMS-PTV.LDAQP---------------KGLLAFESGLRMAFGGVTFMEPDSALYVDY.
Q984H1_RHILO/86-339V-PMP-FRF.LPAWQ---------------TGPIKFDVPGIFRVGGVDIRRPKAVRYLDGI
Q2NRY5_SODGM/73-317L-.VP-LQR.TPME.---------------YRDLRQIVTYYSKVGAVELRYSDTMHYVDGI

PF04454

D4H156_DENA2/1-251T-GQD-FAIGYHSHD---------------ASKVNLFLTESFT------------------
C8WPL7_EGGLE/1-257I-GLD-LSVGYLELA---------------DFNHTFRIMETAA------------------
D0LZ74_HALO1/1-251V-GQD-LSIGYAFHD---------------RSKVELFVAESFT------------------
D1B7I4_THEAS/1-249L-GQD-MSLGYEAHD---------------STTVRLFFTETFA------------------
A1B987_PARDP/1-251L-GQD-ISIGYLSHD---------------AASVTLYLQESLT------------------
A3DFK3_CLOTH/1-257I-GQD-MITSYLETK---------------NLNHYFRIMETIL------------------
A6TWC5_ALKMQ/1-250I-GRD-FSIGYEYHD---------------AKTVQLFITESLT------------------
A7HIB4_ANADF/2-255V-GQE-LAAAYDGRE---------------GIFHQISLVESVT------------------
A7I7A2_METB6/2-249L-GQD-LAVGYNGPV---------------GDLLEFQIYESLA------------------
A8F8I8_PSELT/3-247L-GQD-LSIGFIGPA---------------EERFEFSISESLA------------------
A8L1F1_FRASN/1-253S-GQD-LSVGYSSHT---------------AEEVELYLEQSFS------------------
A9BEM3_PETMO/1-251L-GQD-ISLGYESKF---------------DEQLKFFFTESLT------------------
A9FWS5_SORC5/3-254V-GED-LSIGYDGHD---------------RQVVELFLTESFT------------------
A9H5P1_GLUDA/1-251I-GQD-FSIGYSSHS---------------ADSVELYLQESFT------------------
B1VSP7_STRGG/1-251L-GQD-LSIGYADHD---------------ATSVHLYFQQAFT------------------
B2A6K6_NATTJ/8-259I-GLD-FSIGYEHHD---------------EHHVQLFITESFT------------------
B2GID2_KOCRD/1-252L-GQD-AAIGYTSHT---------------AETVELYLRETLT------------------
B2JNZ6_BURP8/1-251L-GQD-VSIGYQSHT---------------DSTVRLYLRETLT------------------
B2V6Y3_SULSY/1-265I-SQD-MITSYLNYD---------------NMDHYFRVFEILA------------------
B4UA40_HYDS0/1-265L-VQD-MISAFIDYE---------------NMDYYFRVFEILA------------------
B8CYH7_HALOH/1-249V-GQD-IAIGFSGQF---------------GDELEFFLLESFT------------------
B8EQK3_METSB/1-251L-GQD-VSIGYLSHT---------------AETVQLYLQESFT------------------
B8GHL2_METPE/5-250L-GQD-MTIGFTGPS---------------KESLDFTISESLA------------------
B9JHD1_AGRRK/1-251I-GQD-ISIGYLSHS---------------STVVELYLQETFT------------------
C0R0J8_BRAHW/1-256V-GID-MSTAYLEQK---------------DLNHSFRIMETII------------------
C0ZHN4_BREBN/1-265I-AED-FDSAFLGDE---------------QMNSLFRVYECVV------------------
C0ZVK4_RHOE4/1-251L-GQD-LSIGYLSHD---------------ANSVELYFQESMT------------------
D5UVK7_TSUPD/1-251L-GTD-VEIGYLSHT---------------ADTVDLYLQETFT------------------
C4XPM7_DESMR/1-251L-GGD-IAIGYASHD---------------TEKVALFFLESFT------------------
C5B5H8_METEA/1-251I-GQD-ISIGYLSHS---------------ATTVELYLQESFT------------------
O67639_AQUAE/1-267I-ALD-VNVAFVETS---------------NMNHTFRVMEMVV------------------
Q08WR7_STIAD/2-266V-AMD-MVTAYLGAS---------------RMNHPFRVLEALI------------------
Q0RH88_FRAAA/1-253S-GQD-LSIGYASHT---------------ADTVDLYLEESFT------------------
Q2RVS0_RHORT/1-258V-GRD-FSIGYHDHD---------------AQSVHLYLQESMT------------------
Q5YPL3_NOCFA/1-252L-GQD-VSIGYLSHD---------------ADTVRLYFQQTMQ------------------
Q7MSM9_WOLSU/1-252S-GMD-IGVGYSEKK---------------STNHELFFFETLT------------------
Q97V86_SULSO/96-329V-FSD-LNVEYLSKE---------------KDYEVYLITEQIA------------------
B2HH42_MYCMM/1-251L-GTD-VAIGYTSHD---------------ADTVQLYLQETLT------------------
Q0SE23_RHOJR/5-254L-GTD-LSIGYDSHT---------------ATDVTLYLEETFT------------------
Q2IH48_ANADE/1-259V-GQE-LTAAYDGRE---------------GIFHLVSLAESVT------------------
Q5L1H9_GEOKA/8-264V-AVD-VQTAFLDTE---------------NMNYLFRVYESV.------------------
MARIT_THEMA/1-251L-GQD-LSIGYEDRE---------------KDAVRLFITETFT------------------

PF05065

E0THR4_PARBH/115-394D.RAG.VGV..LRDP............YS..AKPYVLFYTTKRVGGGIQDY.AALKLLQM-
Q1GG15_RUEST/131-399R.WDATVETGYEN...............DDFTKNLVTILAEERLALAIFRP.EAFIYGDL-
Q1DCZ9_MYXXD/94-361D.EDLILSEHDVRA.................EYDETTVRAIVKGDFKVRQP.KAFSSITY-
Q0AAI8_ALKEH/83-374D.RIG.VSV..LRDP............YT..LPGWVRWYVRKRIGGALTNP.EALKAVVF-
Q3J4R6_RHOS4/160-429R.MDTEVLISSEDR..............DNFVKNMLTVRAEKRLALAIKRA.AALIYGDF-
A1T829_MYCVP/9-278V.RED.VETEVSTD..............VFFTSDRVAVKTTARLGWDWPHP.SSIVKINL-
Q982R8_RHILO/176-465D.RQG.VRV..LRDE............LT..NKPYVHFYTTKRVGGGISNF.EAIKLLKC-
A1AYY2_PARDP/166-435R.MDPEVIASSEDR..............DNFIKNMITVRAEERLALAIKRP.AALITGEF-
Q1ILS6_KORVE/495-776E.WGA.LEI..IADPY..........TQAG..KGNVVLTGSMLVDIAVRYA.QAFVVIND-
Q1GH34_RUEST/388-661M.WGG.LDI..TVDPY..........THSR..RGRLRIVTMQDADYVLRHP.AGLCFGTD-
Q2GAM7_NOVAD/185-459R.EEANVEISTEDS..............DNFRKNLVTIRAEERLALAVYRP.EAFIKGDF-
Q8XYS4_RALSO/130-408R.VRS.MAIKRLVER............YA..EYGQVGFLAFHRFGCVLQDT.SAIAALVG-
Q3J3K4_RHOS4/110-395E.RPE.VRV..LRDP............FS..AKPHVLFYATKRVGGDVSDY.AAIKLLKI-
Q1QLS4_NITHX/103-379D.RLN.LSI..MRDP............YSQATSGVVRFHARRRTGGALVLA.DALRKIKC-
Q8ED08_SHEON/122-393R.MDIEVLISTEND..............KDFENNMVSIRAEERLALAVYRP.EAFVKGNF-
Q813J9_BACCR/150-424D.VIGSLEVQKLVE..............LFSRTNRVGFRIWNLLDAQLIH..SPFEVPVY-
Q3J5Z4_RHOS4/150-439D.SMA.LVV..GSSTDASFV.DGNGATVSAFQNDLTLMRAISEHDFAPAHD.EAFAGFNA-
A1B638_PARDP/102-387E.RPD.LRV..LRDP............FS..AKPHVLFYASKRVGGGVTDA.RAVKLMVF-
Q0AWY3_SYNWW/43-310D.RRP.LSIRTLTEQ............YA..LEDCIGYLAYEFLDGKLVRP.EAIKVMEM-
A4YU30_BRASO/140-423TKQGGGIDFAASIH..............LFFDQNLTAFRWIIRAGGQPYLS.KPVQPAKG-
Q2NV28_SODGM/127-397R.EEASVVISTENT..............DDFEKNMISIRCEERLALAVYRP.EAFIKGDL-
Q1GHS2_RUEST/113-395E.RPD.LRV..LRDP............FS..AKPHVLFYASKRVGGDVSDF.AAIKLMKF-
Q2L2B0_BORA1/123-401R.VRY.MVLKRLVER............YA..EYDQTGFLAFHRFGCVLQDT.AAIKALQG-
A2SD63_METPP/97-385R.RLG.TRF..LVDP............YT..NKPKVNLYAYQRVGGAVANF.EAIKLVRF-
A1TML8_ACIAC/138-428E.DMQ.LTV..AYSTEASYK.DGAGNVISSFQRDQTLVRVIAKHDFAPRHV.ESIVVATG-
Q1QKG8_NITHX/112-388D.RLA.LSL..LVNP............YIRATDGMTRIHATRRTGSAVVQP.AAIKKIRC-
Q0S2A4_RHOJR/9-273R.RKG.TTLATSKD..............AAFGSDATQIRAVSRVGFGFANP.AGIVRLHD-
Q6LSF8_PHOPR/134-417L.VMD.LRLFRMTDS...........KYT..EKAQTGFIGYQRADGALIDVGGAVKYYQN-
A5N1H4_CLOK5/152-424E.RKG.VQLAVSDQ..............VRFIEDQTVFKGTARYDGKPVYP.SYFVKITV-
A7HRJ6_PARL1/148-433D.RLG.VRV..LRDP............YS..AKPYVLFYTTKRVGGGVQNF.EAIKLLKF-
Q2YMS9_BRUA2/137-422D.RIG.VRV..LRDP............YS..AKPYVLFYTTKRVGGGVQDF.EAIKLLKF-
Q73HT5_WOLPM/107-395D.NRG.MRI..LRDP............YT..NKPYVRFFVTKRVGGEVVNT.SAIKLLKI-
Q9A4P7_CAUCR/53-338D.RAG.VRV..LRDP............YS..AKPHVLFYTTKRVGGGVQNF.DAIKLLKF-
Q3Z7J9_DEHM1/124-397D.RQG.RSFKRLSEL............YA..ANGQIGFLASERVDGKLILP.EAVKGLSV-
Q830G6_ENTFA/163-444E.VIGALEIQKLVE..............KFSGKNQVGFQIYNLLDGQLVY..SPFEPAVY-
A7MP72_CROS8/125-401R.VAY.MTLMRLTER............YA..EYDQVGFLAFHRFDCALEDA.AAVKALVG-
A7ILP2_XANP2/167-448D.RLG.ITT..LRDP............YS..AKPFVEFYSRRRVGGDVTNF.EAFALMVV-
B0T632_CAUSK/96-391F..SGPMQWVVDPY................TAPGYVKYTARQRFGSVFRDS.QAIRGLLL-
Q11H37_CHESB/111-386D.RVS.LAV..LRDP............YTMASKGQTRFHMRRRVGGGVVKA.EAFKALKI-
Q88G49_PSEPK/193-483E.DDA.MVI..DFSKEATYK.DGSGNVISAFQRDQTLVRVIAKHDFGPRHV.ESVAVMTD-
Q72BY4_DESVH/118-395D.AMS.VEMYRFTDS...........AFM..KKGQIGFLAFCRSGGVNTDT.NAIKFYQN-
B2JU92_BURP8/137-421T.SRGGIQTATSMH..............VYFDADATAFRTTFRVDGGPKIE.NAITPPKS-
Q81Z09_BACAN/121-392T.NYQ.MGVKKYED................NETDDQVTKAIMIVDGKVVDK.NSLVVLKK-
Q3SS55_NITWN/107-382D.RIG.LSI..LANP............YLLATTGTTRIHATRRVGGAVVQP.AAMKKIVC-
Q2GDU5_NEOSM/81-367D.RSE.MRV..LRDP............YS..AKPYVSFYITKRVGAKVINP.KAFVFLEM-
Q3SSD8_NITWN/135-418D.RMG.VRV..LRDP............FT..NKPYVHFYTT......CPSS.DNLRLIRH-
A6VNQ3_ACTSZ/129-407R.VAY.MTLKRLVER............YA..EFDQTAFLAFHRFDCVLEDT.SAIKALVG-
A5N291_CLOK5/33-297E.RQP.ITIKKLSEL............YA..LQGQIGFSAYERLDGKLIQP.DALKILQI-
Q5WID4_BACSK/129-404D.RKR.FEIKSTDVG............ADAFLTDQTYFRGIERFDGRIVDP.EGVVIVEG-
A4XZF1_PSEMY/131-410D.VMQ.VLLFRMTDS...........AYT..RKGQVGFLAFMRSGGRLMDVGGALKYYQN-
Q2N5Z6_ERYLH/94-380E.RTA.TQI..LRDP............FT..NKPFVHFYATKRVGGQVLDS.NAIKLLKI-
Q2GJL3_ANAPZ/114-389E.NKD.MRI..LRDP............YT..EKSFVKFYTTKRIGGAAVNC.NAIKLLTV-
A9BYD9_DELAS/120-394R.EDVSVSISFEDR..............DNFVKNMATVLCEERIALTVFRP.ASFVKGAF-
Q5Z3V6_NOCFA/148-434R.EETTVTITDSHA..............DFFIRNLVAILAEERLAFAVTRP.AAFVKTDI-
A5CD71_ORITB/88-365D.HAANIKM..TRDP............YT..EKPFVKFYAVKRVGGDIVVS.KAIKILQF-
A8FGQ6_BACP2/20-302F.SRH.IRIEVEKD................IRSRKFIIVLTAKLDSKFEEE.DAV..AKV-
A1TD88_MYCVP/110-388D.RLG.TTLSYIPNLM..........GPNGRPVGKAGWHAWIRVGSDVVNP.GAFRLLNV-
A9CJN8_AGRFC/134-419D.RTG.VRI..LRDP............YS..AKPYVLFYTTKRVGGGVQNF.EAIKLVKF-
A3DG61_CLOTH/127-416D.KKG.LTSDVSIH..............VRFLYDEQVFRFIYKFNGMPYKN.KPIMPYKG-
Q2SDM1_HAHCH/110-393D.RIG.ARM..LRDP............YT..HKPFVHFYTTKRVGGMLVDS.NAIKVLTL-
B2JL19_BURP8/113-379R.QAINIEVSREDV..............DNFRRNMVTILVEERLGLSVFAQ.AAFATGSL-
B7GIM9_ANOFW/146-418E.RES.ITIDSSTH..............VKFTEDQTAFRGKGRFDGKPVKP.EAFVLVTI-
B9KI56_ANAMF/104-375E.NRN.MKI..LRDP............FT..SKAFVAFYTTKRVGGSIING.SAIKLLKI-
C5AYR6_METEA/135-420D.RAG.LRT..LRDP............YS..AKPYVLFYTTKRVGGGVQDF.SAIKLLRF-
P71947_MYCTU/196-475D.RVG.STVELVPHVF..........GGNRRPTGQRGFFCWFRVGSDVLVD.NAFRVLKV-
Q2FX56_STAA8/38-311I.PQL.IEYKIDETAQLSTVKNEDGTPVNLFEQDMVALRATMHVALHIADD.KAFAKLV.-
Q2G1W8_STAA8/130-399D.RSQ.YQASWTDY.................MHFGECLMIAVRQDCRILDY.KSAIVI..-
Q3J3W7_RHOS4/239-509D.RVG.LAIMRDPF..............SLATKGQVRFHARKRVGADLTHP.DRFVKLKV-
Q81X82_BACAN/69-344I.KKG.AQMKRISDD............TKQALRGSHMLMLDMYCDGKILNE.DAIKFLK.-
Q81XY0_BACAN/102-381I.FSD.MDVQRSTD..............FKFKQGMIAHRGSVFAGGNVISK.NGFLRV..-
Q88MK4_PSEPK/141-410R.EEAAVEV..STED............GDNFRTNMVTIRAEERLALAVYRP.ESFVHGEF-
Q9CFS0_LACLA/124-389D.REN.MSLLPTNIG............AGAFETDTTKIRVIDRFDVKATDS.EALVAGS.-
Q9P9R2_XYLFA/357-623M.WGG.LDITVDPY..............SLSTSGGTRIVVFQDVDFNIRRT.ESFCYG..-
Q9ZWV6_BPPHC/121-387F.AGS.LRVDRSVD..............AKFSTDQIVYRFLQRADGLLVDA.RGAKVLT.-
W6SDV8_9CLOT/124-396D.RQG.RSFKRLNE..............LFATTGQVGFLASQRVDGKLILP.EAIKVLQ.-

PF06673

Q9MCB6_9VIRU/1-347N-YND-FDLRYNVEQ---------------------WLSETLVGGSIRGKNRSAYLTKKAS
Q9MCB8_9VIRU/1-347N-YND-FDLRYNVEQ---------------------WLSETLVGGSIRGKNRSAYLKKKGS

PF05125

D3UZQ7_XENBS/11-324T-QRNTRQRKA.EFV---------------DDRKQFENKYLRNEGYALETP-ELYAAYD..
A6TE73_KLEP7/8-340F-MDESHRRSI.IEN---------------PKLDQVENYESMNIDYVVETY-SAGCFIENI
M9X6X0_MANHA/8-336V-QEGTTRKHI.ENV---------------PKKDRIETYESENIDYVVEDY-GCAALIENI
Q5E389_VIBF1/11-331I-QKDSIRRSVAVKN---------------DKRDQIENFESMNMAYVVEQL-AKAAALE..
Q2S7I3_HAHCH/8-327Y-QADSLRRQV.IDN---------------PKRNRVEDFNSLNEGYVIEDE-TKA......
Q15Y13_PSEA6/12-335Y-QESSIRRQI.VDE---------------PKKNQYADYRSQNEGYVVETL-EKAAYIEGA
H2IY53_RAHAC/8-339W-QEGGHRRRI.VEE---------------PEYNRVSTYSSSNDAYVIEDY-GYGCLIEGI
B8J319_DESDA/15-323H-QDTSWRRKI.EDN---------------AKKDQYEDYLSRNEGYVVETP-EQL......
W8UNE7_YEREN/11-324T-QRNTRQRKA.EFV---------------EDRTQYENKYLRNEGYAIEFP-EMYAAFD..
C1DBL5_LARHH/8-337W-QEGGRRRHV.REE---------------PDYDRIANYESSNDAYVVERY-EAGCLIENI
E6WE37_PANSA/8-338W-QDESRRRAV.IDN---------------PKRDRVENFESVNEAYVVEDY-ECVCLVENI
C5BH00_EDWI9/18-332T-LKGSRRRKA.EDA---------------GERKQFENSYWRYEGYALGDP-DLYAAVDE.
B2FIZ5_STRMK/8-334W-QIGGRRRHI.MEQ---------------PNKNRVANFESSNDDYVIEDY-GLGAIAENI
C1DS28_AZOVD/8-332W-QEGTRRRQV.VDN---------------AKRDRIENYESVNDAYVIEDL-GGAALAENI
Q8XY26_RALSO/8-332Y-QENARRRTI.LDN---------------AKRDRIENYESSNDAYVIEDL-ACAAMAENI
D8MKI1_ERWBE/9-341W-MEEKQRRLL.KDE---------------PEYNRVATYESSNDAYVIEDY-GFGCLIEGI
F6IH75_9SPHN/8-355W-QEETRRRQI.RDE---------------PALDQIENYESVNEDYVVEDY-GRTALVENV
J7TAL9_MORMO/8-339W-QSETRRRHI.IDN---------------PKRDRIENYESVNEAYVVEDY-RGTALIENI
B2VH98_ERWT9/8-339W-QEETRRRSI.IDN---------------PKRDRIENFESVNEAYVVEDY-DCTCLIENI
F4HA06_GALAU/6-327V-QDASVRRSY.RND---------------EDRKGIIDSYYRNEGYVVEDA-GLFTAIEF.
G0AIP5_COLFT/8-331F-QDGARRRRV.EDV---------------AKRDRIENYESSNDAYVVEDF-GLGALLENI
F0LXI5_VIBFN/8-332I-QEDSVRRTVGKKN---------------DAKDQMENFESMNMAYVIEQL-EKVAAVE..
B0UTP6_HISS2/8-335Y-QEGAMRRTL.KDN---------------AEYDRYEDYTSSNDDFVVENY-ESVALLKNI
CAPSD_BPP2/8-340Y-MDDSHRRVI.EEN---------------PKLDRVENYESMNIDYVVEDY-AAGCLVEKI
H2IRH6_RAHAC/8-340I-MDSSHRRHI.EEV---------------ARRDRIENYESLKIDFVIEDY-GCAAMIENI
B4F0K8_PROMH/8-339F-LADSRRRQV.LDN---------------PKRDRIENYESVNEDFVVEDF-RGVALVENI
B0UW33_HISS2/6-327T-QSSSVRRRF.ESN---------------QDKMGIITSYYRNEGYVVEDT-GLMTAIEAE
E6VXL3_DESAO/8-324V-QEESWRRKV.EDN---------------PKKDRIEDYNSRNEGYVVEVP-EQ.......
A6VSU1_MARMS/18-341F-QDTSVRRLQ.KDK---------------PELNEVQDFNSANQGYVVEDE-EMAAFIEGI
C5AGA6_BURGB/8-333W-QIGGRRRTV.IDN---------------PKRDQVEFFESSNEAYVVEDF-GAGCLIENV
J7SK37_MORMO/10-341W-QKGKLNRFI.KNE---------------PEYNRIATYAQSNDGYAVEDY-GLACLIEGI
W0L880_9ENTR/8-339W-QEDTHRRMI.RDE---------------PEWDRIATYESSNDAYVVEDY-GCGCLIEGI
Q1QXQ6_CHRSD/8-331W-QTGARRRYV.TEN---------------PKRNRIENYESSNDAYVIEDF-GAGCLIENI
C5BAR3_EDWI9/8-332V-QKGSRRRAI.IDN---------------PKRDRVENFESSNDAFVVEDF-GCGCLFENI
F4HB41_GALAU/8-340L-QEGSLRRAI.INN---------------PKRNRIEDFISKNIDFIVENY-DCAALIENI
Q63LE5_BURPS/8-332Y-QEGARRRTL.KEV---------------PERDRIENYESSNDAYVVEDF-GCGCVAENI
A7MN35_CROS8/15-328T-QANTRYFRV.EFD---------------EENAEYVRSCLRNEGYALGNP-ELYAAVDES
A1VSG1_POLNA/8-331Y-QSSSRRRSI.IDN---------------PKRDQIENLESSNDAFVVEDY-GLCALVENI
F0LQ00_VIBFN/14-328T-QEGTQWRRQ.QNN---------------EDKLRFENNHIRMEGYAVGNM-KKFAAIENV
Q6D3X2_PECAS/8-339Y-QRGGLRRTI.KEE---------------SEYNRIATYQSSNDDFVIEDY-GNVAFIDGI
CAPSD_BPHC1/5-328T-EAESVRRSL.RND---------------EDKKGLVTSYYRQEGYVVEDL-GLMTAIDHT
D8J087_HERSS/8-337F-QNGGRRRRV.VDE---------------PKADRIENYESSNDAYVIEDE-GLAALVENV
H2FUC0_OCESG/13-333T-QRGTRQRSA.AHN---------------QDRKGFESQYWRMEGYAVGEY-RAYASFD..
Q8P6J5_XANCP/8-334Y-QTGGRRRYI.QEV---------------PARDRIENYESSNDAYVVEDY-GLGCVVEHI
E0SAM8_DICD3/25-338T-QRNTRQRKA.EFV---------------EDRKQFENKYLRNEGYAVEYP-ELYASF...
D3VKM6_XENNA/8-339Y-QDGTRRRTV.LDN---------------PRRDRIENFESVNEAYVVEDY-RGVALIEHI

PF11651

C4K6U8_HAMD5/1-421PKLHS.IDSAVATY....EGFSIRVHKYADGDANKQMMRFDLLPAYVCFNPHM.GGQFFG-
Q2G3Y7_NOVAD/1-418NPDDG.WQVMTATT...DLGISITYTRQGAINDLSVKARWDIDFGTALLSPEMAGVQMFG-
C5B0T5_METEA/1-404P.GGV.HEAHRETF....DGVSMRLVTAYNVMSDQMVTRLDVLYGFAPVRPEF.GAIVAD-
K4L4N8_9FIRM/1-374PRGLSSEQKAIVNY....DGLGLRVIYDYNSQYKKDVISIDMLCGVKTLSSEL.ACRLLG-
A5VES4_SPHWW/1-413P.PGA.KDVARQSY....SGTSVRLIPFYNGSNDVSTMRLDVLYGFKALDPRL.ATRISG-
B2U8F8_RALPJ/1-419P.KGV.HEAYRETY....DNTSMRIVTAYNVQTDQFITRLDILYGFKALRPEW.IVRVAD-
CAPSD_BPP22/1-427NHELF.AGMKTTSFSIPDVGLNGIFATQGDISTLSGLCRIALWYGVNATRPEAIGVGLPG-
J7TW41_MORMO/1-425NHALF.SGMKTEAFNIPSVGLNGVVAYQGDISTLEGKCRIAVWYSACTKRPEAVGIGLTG-
I2B9R2_SHIBC/1-422PKLNS.IDSAVATY....EGFSIRVHKYSDGDANVQKMRFDLLPAYVCFNPHM.GGQFFG-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window