Sequence alignment for CL0375

PF00822

CLD7_HUMAN/4-182SG--------------------LQLLGFSMA---LLGWVG--------LVACTAI.P.Q--W--QM---S----------
CCG2_MOUSE/6-197RG--------------------VQMLLTTVG---AFAAFS--------LMTIAVG.TDY--W--LY---S----------
EMP3_HUMAN/1-156MS--------------------LLLLVVSAL---HILILI--------LLFVATLDKSW--W--TL---P----------
EMP1_MOUSE/1-154ML--------------------VLLAGLFVV---HIATAI--------MLFVSTI.ANV--W--MV---A----------
CLD1_MOUSE/4-182AG--------------------LQLLGFILA---SLGWIG--------SIVSTALP..Q--W--KI---Y----------
CLD10_HUMAN/4-179TA--------------------SEIIAFMVS---ISGWV.--------.LVSSTLPTDY--W--KV---S----------
PMP22_HUMAN/1-153ML--------------------LLLLSIIVL---HVAVLV--------LLFVSTI.VSQ--W--IV---G----------
EMP1_RABIT/1-154ML--------------------VLLAAIFVV---HIATCV--------MLFVSTI.ANV--W--VV---S----------
LMIP_BOVIN/1-157MY--------------------SFMGGGLFC---AWVGTI--------LLVVATA.TDH--W--MQ---Y----------
EMP2_MOUSE/1-165ML--------------------VILAFIIVF---HIVSTA--------LLFISTI.DNA--W--WV---G----------
CLD7B_DANRE/4-182KG--------------------LQLLGFTLS---LLGLIG--------LIIGTIMP..Q--W--KM---S----------
EMP1_HUMAN/1-151ML--------------------VLLAGIFVV---HIATVI--------MLFVSTI.ANV--W--LV---S----------
EMP2_HUMAN/1-160ML--------------------VLLAFIIAF---HITSAA--------LLFIATV.DNA--W--WV---G----------

PF13903

TM235_HUMAN/16-197-----------------------------------LLSFA--------LLAAAVA-SDY--W..YI...L----------
TM235_MOUSE/16-192-----------------------------------LLSFA--------LLAAAVA-SDY--W..YI...L----------
B4Q2K5_DROYA/16-232-----------------------------------IIATA--------LLAIAFS-TDN--W..LH...Y----------
TM182_XENTR/15-225-----------------------------------ALGIL--------IYLVAFG-SDY--W..LLAKEI----------
Q16RP0_AEDAE/16-235-----------------------------------IIAVA--------LLAIAFS-TDN--W..LS...Y----------
TM182_MOUSE/15-220-----------------------------------ALGVL--------LFLVAFG-SDY--W..LL..AT----------
D2HQ99_AILME/17-198-----------------------------------LVGVV--------LALVAVV-TDH--W..AV...L----------
A7SGP9_NEMVE/19-204-----------------------------------LAALV--------LIIVAII-TEY--W..VM...A----------
B4NZC2_DROYA/16-190-----------------------------------VFSLI--------CFIIAFS-TPY--W..LV...T----------
Q1L8R4_DANRE/69-258-----------------------------------ITGIM--------LTVLGVG-TEF--W..VE...L----------
B0WVP8_CULQU/16-190-----------------------------------AVAFL--------FILIAFV-SPY--W..LQ...T----------
B4H3C9_DROPE/44-223-----------------------------------IFAFA--------FIAIAFA-TPS--W..LV...S----------
B4KVB2_DROMO/40-219-----------------------------------IFAFA--------FIAIAFA-TPS--W..LV...S----------
Q17AR2_AEDAE/35-214-----------------------------------VIALV--------TVLVAFA-TPS--W..LV...S----------
Q6E5P4_TAKRU/18-198-----------------------------------CLAWI--------FVMITTG-LNE--WRLWY...L----------
Q5DCP0_SCHJA/66-231-----------------------------------FLSLL--------LFIVGSV-STS--W..IT...I----------
B0WVM7_CULQU/17-198-----------------------------------CLIVG--------LLVAALT-TDN--W..VQ...S----------
C1BSD7_9MAXI/17-200-----------------------------------CLAIS--------LLGASLG-TDN--W..VE...S----------
B4NIE2_DROWI/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------
B4HC72_DROPE/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------
A9VEC0_MONBE/368-521-----------------------------------VLCVV--------FYGVGLG-TRR--W..SV...A----------
B3LY06_DROAN/17-198-----------------------------------CLAIG--------LLLVSLT-TNH--W..VR...A----------
TMM47_XENTR/28-170-----------------------------------FLALC--------LDIGAVL-SPA--W..VT...A----------
TM225_HUMAN/18-160-----------------------------------SWAVV--------LMVMGIT-LDK--W..VE...L----------
A8Q053_BRUMA/17-199-----------------------------------IAVLS--------LIAAALF-TDY--W..SE...S----------
B4K6W4_DROMO/17-198-----------------------------------CLAIG--------LLLTSMT-TNH--W..VR...A----------
A6H7D9_BOVIN/18-203-----------------------------------LGAFI--------VLCFVLA-TQQ--W..IR...S----------
B4MC21_DROVI/17-198-----------------------------------CLAIG--------LLLASMT-TNH--W..VR...A----------
B7QNM3_IXOSC/25-197-----------------------------------YCSTV--------LLLISFA-SPY--W..LE..SY----------
B5X0V8_SALSA/21-162-----------------------------------FLALC--------LDIVALL-SPA--W..VT...A----------
A7SYX5_NEMVE/51-211-----------------------------------LASAV--------LLAIAEA-EPK--W..IK...I----------
B3P1Z4_DROER/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------
A9V5F7_MONBE/26-226-----------------------------------LLALI--------LYIVGVA-TPA--W..IE...H----------
B4I3M6_DROSE/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------
Q16T28_AEDAE/17-198-----------------------------------CLIVG--------LLVAALT-TDN--W..VQ...A----------
B4QV06_DROSI/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------
B4PTR2_DROYA/17-198-----------------------------------CLAIG--------LLLVSMT-TNH--W..VR...A----------

PF07062

O45670_CAEEL/8-219-K--------------------LLLALSIVL---ILVGIC--------LTSAGCF-SPA--W--QV---V----------
A8XPM2_CAEBR/9-213-Q--------------------KYQLATLIS---SVVSNF--------LLFFATI-TPA--W--QV---A----------
A8XPM1_CAEBR/5-202-L--------------------ILSYTILVL---TIIAFL--------LTAAALC-TPS--W--QV---V----------
A8XPW0_CAEBR/10-221-K--------------------GSLFLSILF---SFIGAG--------LSIAAIL-TPS--W--QI---V----------
Q18135_CAEEL/11-221-T--------------------IVIISSLIL---LIVALG--------LQAGGVM-SPS--W--QV---V----------

PF10242

Q7PMA1_ANOGA/11-202-----------------------RSLLWFLV---TLIACM--------TLFGAIV-LPK--W--LI---GPEVIQIRNEE
LHPL4_RAT/22-200-----------------------IGVLWAIF---TICFAI--------INVVVFI-QPY--W--VG---D.......SVS
LHPL3_XENLA/22-199-----------------------IGVLWAIF---TICFAI--------VNIVCFI-QPY--W--IG---D.......GVD
TMHS_RAT/25-202-----------------------VGVMWGTL---TICFSV--------LVMALFI-QPY--W--IG---D.......SVS
TMHS_CHICK/25-202-----------------------MGVLWALF---TLCFSI--------LMVVTFI-QPY--W--IG---D.......SID
Q4STB3_TETNG/22-199-----------------------VGVLWTVF---TITFAV--------ITVVVFI-QPY--W--IG---D.......SVS
Q4TFH6_TETNG/25-207-----------------------VGVLWAVC---TLCFAI--------IQVVVLV-QPS--W--VG---T.......TGT
Q178A0_AEDAE/25-199-----------------------IAVLWAIF---SICYAI--------ISVVAFV-TPE--W--VG---D.......SD.
Q2M056_DROPS/25-199-----------------------IGVLWAIF---TICYAI--------IGIVAFV-TPE--W--IG---D.......PD.
Q9XVU1_CAEEL/19-183-----------------------VGAIWVLC---GLCTTV--------LQTLALI-HPT--W--IG---...........
LHPL2_HUMAN/9-204-----------------------RSMLWTLL---SIVVAF--------AELIAFM-SAD--W--LI---GK....ARSRG
Q4S279_TETNG/9-201-----------------------RSMLWTLL---SIVAAF--------GELIAFM-STD--W--LV---GY....PRTPD
Q568B9_DANRE/9-197-----------------------RSMLWTLM---SIVVAF--------AELVAFM-SAE--W--LV---G.......YSE
Q4RUW4_TETNG/9-195-----------------------RSMLWTLL---SIIVAF--------AELITFM-SPD--W--LM---G.......FPR
Q9W0X9_DROME/9-195-----------------------ASLVWFLC---SLVADM--------LFAVALV-TPR--W--LV---GP....AQGTD
Q292M2_DROPS/9-197-----------------------GSLVWFLC---TLVADM--------LIAAALV-TPR--W--LI---G.......PVQ
LHFP_MOUSE/8-193-----------------------TGVIWALL---SFLSAA--------TSCVGFF-MPY--W--LW---G.......SQ.
LHPL1_RAT/8-192-----------------------VGTFWAFL---SLVTAV--------ASSTSYF-LPY--W--LF---G.......SQ.

PF06653

Q8ITZ9_CAEEL/47-208V..............................---......--------.......-...--.--ET--------------
Q9TZ35_CAEEL/1-155MRK...................VGAIGVL..---ILLGFI--------FNAVSVF-TDS--W--LV--------------
A8WY95_CAEBR/1-161MTHRK.................VYGLGIL..---IALASI--------ANFVGVF-TPC--W--LS--------------
A8XQE4_CAEBR/1-163MDWK..................LYALGLM..---LIISWA--------AQGVGLF-TPH--W--MT--------------
A8WYV7_CAEBR/1-134MSRVQ.................VSILGVL..---ILISFV--------LTTISTF-TKY--W--IV--------------
A8WK96_CAEBR/1-140MVR...................KSHCGYGFF---LIIALL--------LTLASVF-TPG--W--RS--------------
A8XRC8_CAEBR/1-182MCLSG.................LTQILYGLI---MTGSAI--------LTAVALF-TPG--W--NT--------------
A8XQE5_CAEBR/1-150MNAS..................LFLLGFL..---IVICSI--------LDIVGTY-TPG--W--IV--------------
Q9XUZ7_CAEEL/1-168MATAK.................RLFFTVV..---TIAAMA--------CNFFGVL-SNA--W--VT--------------
Q2WF57_CAEEL/1-166MRK...................IAAIGGI..---VFISFI--------LTIVAMF-TKL--W--IS--------------
O45515_CAEEL/1-161MTAVK.................RLFFSAL..---NLLGGI--------CILIGVG-TPA--W--LT--------------
A8XR11_CAEBR/1-188ML....................LPYACVTAL---VFLSII--------FSGISLF-TYG--W--AT--------------
B6IEW4_CAEBR/1-156MTDVK.................IAFLGFL..---VFNSLI--------FNILGIF-TPN--W--TS--------------
Q95YB5_CAEEL/1-123M..............................---......--------.......-...--.--..--------------
A8WK67_CAEBR/1-167MSRPK.................VGAIGAL..---IVVSFI--------LCAVATF-TKN--W--IN--------------
Q95XC2_CAEEL/1-191MAD...................LKFLILGIF---ISIGFV--------LNIVGVV-APC--F--MV--------------
B6IFT2_CAEBR/1-179MLYFLIPIPNS.....QSRGAPIIIIGYF.F---VVGGWL--------LEIAALL-LPD--W--IV--------------
A8XQE6_CAEBR/1-167MDGS..................LVALGFL..---VGICAT--------LNGVGVF-TQA--W--IV--------------
B6IEW3_CAEBR/1-114M..............................---......--------.......-...--.--..--------------
A8XWG5_CAEBR/1-169MKWVT.................VETICLLFS---VLIGFV--------LNVLAVF-LPY--W--IV--------------
O45334_CAEEL/1-161MSAVK.................RLFLNIV..---VCIGIV--------CNFFGVF-SQA--W--IT--------------
A8WY98_CAEBR/1-166MGDPK.................LPALIAL..---VVLAFV--------ANAVAVF-TPA--W--VC--------------
B6IKT5_CAEBR/1-215MIILRTNTLQRSDEIPFLLIGEIKTLGVL..---ISLCFL--------FHTYGLF-SDC--W--IE--------------
B6IKT4_CAEBR/1-120M..............................---......--------.......-...--.--..--------------

PF07344

A4I9X4_LEIIN/377-531-----------------------------------FFAFL........FVLVGT.PSDM..F------------------
A4HBJ2_LEIBR/15-170-----------------------------------FIAFF........LVLVGT.PLDM..F------------------
A4H6C8_LEIBR/15-170-----------------------------------FIAFI........FVLVAT.PLDM..F------------------
Q4Q3F7_LEIMA/15-171-----------------------------------FIAFF........FVLVGT.PLDM..F------------------
A4H5H1_LEIBR/15-170-----------------------------------FIAFL........CVLMGT.PIDM..F------------------
A4HBJ0_LEIBR/15-171-----------------------------------FIAFL........LVLVGT.PIDM..Y------------------
Q7KPY0_LEIBR/5-180-----------------------------------CIVFM........FLVTSA.PISQ..F------------------
A4HB47_LEIBR/18-199-----------------------------------LIAFL........FLLVGT.PTGQ..F------------------
A4I9X2_LEIIN/15-169-----------------------------------FVAFF........FVLVGT.PSDM..F------------------
Q4Q339_LEIMA/15-170-----------------------------------FVAFL........LVLVGT.PLEI..F------------------
Q27227_TRYCR/14-171-----------------------------------FLAFL........FVLVGT.PIDQ..F------------------
Q4E0S1_TRYCC/20-182-----------------------------------CISFV........FATVST.PTSQ..F------------------
Q4Q3A7_LEIMA/14-189-----------------------------------FVAIL........FVAVGT.PLAM..Y------------------
A4HAZ8_LEIBR/15-170-----------------------------------FIAFV........FVVVGT.PIDM..F------------------
Q4QIA0_LEIMA/15-170-----------------------------------LIAFV........AVMVGT.GVDM..F------------------
Q4Q8C7_LEIMA/145-338-----------------------------------WVHLL........FVILSS.ALSQ..I------------------
Q585K0_TRYB2/9-167-----------------------------------LVTLF........AVASAVCALVFPVF------------------
A4H5D1_LEIBR/15-173-----------------------------------FVAFL........LVLVAT.PIDMYWF------------------
Q9GU51_LEIIN/15-171-----------------------------------FIAFF........FVLVGT.PIDM..F------------------
A4HB02_LEIBR/15-170-----------------------------------FFAFL........FVLVAT.PIDM..F------------------
A4H5G6_LEIBR/15-171-----------------------------------LIAFF........FVLLAT.PIDM..Y------------------
A4I9W9_LEIIN/15-171-----------------------------------LVAFI........LLLAGT.PSDI..F------------------
A4HDL4_LEIBR/18-168-----------------------------------FLVLL........FVVIAT.PISQ..I------------------
Q4QHJ3_LEIMA/241-414-----------------------------------FISGC........VLTIATVGTAQNMW------------------
A4HAJ6_LEIBR/28-184-----------------------------------FIAFL........LVLVAT.PIDM..Y------------------
E9AG83_LEIIN/15-171-----------------------------------FIAFL........FVLVGT.PIDM..F------------------
A4H7D7_LEIBR/15-172-----------------------------------FVAFM........FVLVAT.PIDM..F------------------
A4I4J2_LEIIN/15-171-----------------------------------FLALL........CLVVAT.PFDM..F------------------
Q4QAK7_LEIMA/19-166-----------------------------------FFAWA........FALVAT.PTAQ..F------------------
Q4QI88_LEIMA/15-171-----------------------------------LLAFL........FVLVGT.PIDM..F------------------
A4HBJ1_LEIBR/15-170-----------------------------------FIAFL........LVLVAT.PLDV..F------------------
A4HGJ1_LEIBR/143-338-----------------------------------WVHLL........FVILSA.TLSQ..I------------------
Q4Q3A8_LEIMA/18-199-----------------------------------LIAFI........FILVGT.LIDQ..F------------------
A4HI41_LEIBR/20-195-----------------------------------CTVFM........FLVTSA.PISQ..F------------------
A4HDI3_LEIBR/87-236-----------------------------------FLVFL........FVLVAT.PISQ..I------------------
A4I4J3_LEIIN/81-236-----------------------------------FLAFF........SLLVGI.PLDM..F------------------
E9AHT2_LEIIN/15-171-----------------------------------FIAFL........LVLVGT.PLDV..F------------------
E9AG85_LEIIN/15-170-----------------------------------FIAFF........SVLIGT.GVDM..F------------------
Q4Q327_LEIMA/15-169-----------------------------------FVALL........LVLVGT.PVDM..F------------------
A4HTM4_LEIIN/15-171-----------------------------------FFAFL........FVLVGT.PIDM..F------------------
Q4Q8C6_LEIMA/374-525-----------------------------------FVSVA........LALVSI.PTSQ..L------------------
Q4Q397_LEIMA/79-235-----------------------------------FIAFF........FVLVGT.PLDM..F------------------
A4IAL7_LEIIN/15-170-----------------------------------FIAFL........FVLVAT.PLSM..F------------------
A4H5G0_LEIBR/15-170-----------------------------------LIAFL........FVLVGT.PIDM..F------------------
A4H606_LEIBR/64-214-----------------------------------MIAWIIFSLGSFGFMLVASCPVPW..L------------------
Q4Q317_LEIMA/15-172-----------------------------------FVAFL........LVLVGT.PLDI..F------------------
A4I0W5_LEIIN/18-168-----------------------------------FLVLL........FVVIAT.PISQ..I------------------
A4I9W8_LEIIN/77-234-----------------------------------FIAFL........LVLVAT.PIDM..F------------------
A4H5D2_LEIBR/15-171-----------------------------------FIAFM........FLLSGS.LVDM..F------------------
A4H5G5_LEIBR/226-381-----------------------------------IIAFL........LVLVAT.PLEM..F------------------
A4I9X1_LEIIN/15-170-----------------------------------FVAFF........FVLVGT.PIDM..F------------------
Q384H4_TRYB2/118-295-----------------------------------LLNIF........FAILGT.SLSQ..L------------------
Q4CVL1_TRYCC/26-174-----------------------------------MVSFI........FFVIGT.PIAM..L------------------
A4I5B9_LEIIN/26-190-----------------------------------FVTAT........FTVCGT.PLGMLMI------------------
A4I0W4_LEIIN/18-166-----------------------------------LAVFL........FVIVAT.PISQ..L------------------
A4I9X0_LEIIN/31-188-----------------------------------FVAFI........LLLVGT.PLDI..F------------------
A4IAM2_LEIIN/15-170-----------------------------------LIAFL........SVLIGT.PLDM..F------------------
A4I9R7_LEIIN/15-171-----------------------------------LIAFF........FVLVGT.PIDM..F------------------
A4HAL2_LEIBR/14-189-----------------------------------FVAVL........FITVGT.PLAM..Y------------------
Q4DU87_TRYCC/14-171-----------------------------------FTALL........LMLTGT.PLDQ..F------------------
Q4Q309_LEIMA/15-169-----------------------------------FVAFL........LVLAGT.PLDM..F------------------
A4H9E8_LEIBR/48-205-----------------------------------FFAFF........FVLFGT.PIDM..F------------------
A4HI43_LEIBR/25-189-----------------------------------FVALV........FSTCGT.PLGMLMI------------------
Q4Q6L8_LEIMA/15-171-----------------------------------FIALL........CVMIGT.GVDM..F------------------
A4HB00_LEIBR/15-170-----------------------------------FFAFL........FVLVAT.PLDM..F------------------
A4I6E5_LEIIN/15-171-----------------------------------FIALL........CVMIGT.GVDM..F------------------
A4H605_LEIBR/152-298-----------------------------------TVAFI........FHLTSSCPIPW..M------------------
A4H9E9_LEIBR/15-171-----------------------------------FFAFF........FVLVAT.PLDV..F------------------
A4HAJ4_LEIBR/51-207-----------------------------------FFAFL........FVLFGT.PIDM..F------------------
A4H5G7_LEIBR/15-171-----------------------------------VIAFV........LVLFGT.PIDM..Y------------------
Q4QHJ4_LEIMA/134-280-----------------------------------AAAFV........CHLTSSCPIPW..M------------------
A4HGF8_LEIBR/158-312-----------------------------------SIAFV........FTLAAACPIPW..Y------------------
Q4Q1U9_LEIMA/15-169-----------------------------------FVAFL........LVLAGT.SADM..F------------------
A4IAM1_LEIIN/15-170-----------------------------------LIAFL........SVLIGT.PLDM..F------------------
Q4QI87_LEIMA/15-171-----------------------------------FLAFL........FVLVGT.PIDM..F------------------
Q384H3_TRYB2/301-450-----------------------------------FLAFL........LTLVAH.PLSL..M------------------

PF07803

GSG1_HUMAN/8-118-----------------KAFSGQRTLLSAIL---SMLSLS--------FSTTSLL-SNY--W------------------
GSG1L_HUMAN/2-133-----------------KTSRRGRALLAVAL---NLLALL--------FATTAFL-TTH--W------------------
Q4SN53_TETNG/4-143-----------------HMSRRSRSLLSLTL---TTLALA--------LSILALC-TSY--W------------------
Q4SCG5_TETNG/5-121-----------------QQMRSPR..ISFLQ---TLASLF--------LGGVALL-SSY--W------------------
GSG1L_DANRE/2-113-----------------KTTRKCRALLSVGL---NLLALL--------FSTTAFI-TTY--W------------------
Q4S7Q6_TETNG/2-112-----------------KTNRRCRTLLSVSL---NFFALF--------FSITAFI-TTY--W------------------
GSG1L_XENTR/2-125-----------------ELSRRNRSLLSVVL---NLLALS--------FSVAAFF-TSY--W------------------
Q4SAX5_TETNG/2-120-----------------RRERGWRASLALTL---NFVAFA--------FAVSAVS-TSY--W------------------

PF11381

Q0A7S1_ALHEH/5-63----------------------------------RILGIA--------LLAGGII-ALY--L------------------
A3WLM6_9GAMM/3-61----------------------------------KIVGLI--------LLVVGAI-LLY--F------------------
Q08WE2_STIAD/3-61----------------------------------RLVGVV--------LAVVGAV-LLW--T------------------
Q1PY89_9BACT/3-61----------------------------------KVVSLA--------ILAVGIL-FII--L------------------
B2T1Q0_BURPP/3-61----------------------------------KAISIA--------LIVGGIV-LLY--F------------------
C0A3E3_9BACT/3-61----------------------------------KIISVA--------LLAGGIV-LII--Y------------------
A3NQ77_BURP0/3-61----------------------------------RAISVA--------LIVGGVV-LLY--F------------------
Q1D4N9_MYXXD/46-104----------------------------------RLLGVM--------LAIAGAV-LLW--S------------------
Q0F2S1_9PROT/25-83----------------------------------KMIGLA--------LTVTGIG-LAI--W------------------
A6TU20_ALKMQ/37-94----------------------------------KIFGGI--------LLFLGVI-LSF--F------------------
Q11TD1_CYTH3/5-54----------------------------------RIFGAA--------LTVLGVG-FLI--Y------------------
Q30SB9_SULDN/10-68----------------------------------KIIGLI--------LTVVGIG-FAV--W------------------
A1WU28_HALHL/18-76----------------------------------QIIGIV--------LLITGAV-LLY--F------------------
A1SWI4_PSYIN/2-60----------------------------------KIISIV--------LIVLGIG-LAV--W------------------
A6VWJ5_MARMS/4-62----------------------------------KIIGII--------LVIAGAA-LAV--W------------------
Q0AB85_ALHEH/5-63----------------------------------RLLGLV--------ILIAGAV-LLY--F------------------
Q07X17_SHEFN/4-62----------------------------------KIIGIV--------LVIAGIF-LAL--W------------------
Q3IDA6_PSEHT/4-62----------------------------------KVIGIV--------LIIIGVA-LAI--W------------------
A3QG33_SHELP/25-83----------------------------------KYLGIV--------LLVIGVA-LAW--W------------------

PF12351

Q75CU4_ASHGO/65-257-----------------------SLHERTNT......TGF--------EQLR----------------------------
A1DMY3_NEOFI/52-247-----------------------IVEKVYNV....SHGNS--------TIRE----------------------------
A3LV03_PICST/62-245-----------------------AYKSTNSS......TEL--------AEMS----------------------------
A5E535_LODEL/80-252-----------------------FYNSNATL.........--------SDVQ----------------------------
A7EL23_SCLS1/52-241-----------------------IGQISKVG...T..DGS--------KIGG----------------------------
A7TJZ8_VANPO/66-260-----------------------FATESAET......KGL--------EKIV----------------------------
B5VE06_YEAS6/60-260-----------------------SYEKSNTT...L..GLE--------E.VI----------------------------
B6HGM8_PENCW/52-252-----------------------IAHAVHNV...SQAGQG--------TTLE----------------------------
B8MZW1_ASPFN/73-257-----------------------VVQATANI...V..GGA--------E.ME----------------------------
B8NY21_ASPFN/72-267-----------------------IAEKVYNLSQPR..NTT--------I.QE----------------------------
B9WIK5_CANDC/65-244-----------------------NSSSSTNS...T..AID--------ELLS----------------------------
C0NA65_AJECG/81-270-----------------------FANLTTGA...R..NNA--------DSFE----------------------------
C0SH54_PARBP/74-258-----------------------INTAMTNI...V..GGA--------Q.LE----------------------------
C1G9K9_PARBD/72-262-----------------------IFANLSAG...I.NRNA--------TSLE----------------------------
C4JX23_UNCRE/51-235-----------------------VTTAIENI...V..GRA--------R.LE----------------------------
C4QXD3_PICPG/65-260-----------------------AYKNQDAK......GLS--------L.MS----------------------------
C4YC02_CLAL4/51-224-----------------------IANSVSSN......SSI--------TELS----------------------------
C5DEC8_LACTC/64-258-----------------------SSFSSNNS...T..SDL--------QNVA----------------------------
C5DPI4_ZYGRC/66-266-----------------------SFNQSNGTTQMS..GLE--------Q.VS----------------------------
C5G079_ARTOC/74-258-----------------------LVPTIANI...V..GGA--------H.LE----------------------------
C5M8V3_CANTT/127-303-----------------------LSTKSLNS......TSL--------DALS----------------------------
YEJ7_SCHPO/33-201-----------------------STTSKFQLF.SL..ATN--------V.AQ----------------------------
Q0CSC3_ASPTN/220-409-----------------------FYSVVANI......SST--------GNLA----------------------------
Q0U808_PHANO/74-259-----------------------VTQAIANI...V..GNA--------Q.LG----------------------------
Q0V1Y2_PHANO/45-209-----------------------VKLYLAAI......SPS--------TGTI----------------------------
Q59WR6_CANAL/68-244-----------------------TTTTNNNS...T..AID--------E.LS----------------------------
Q6BL79_DEBHA/62-241-----------------------AYKGSNIS...T..KLA--------E.MT----------------------------
Q6CH13_YARLI/62-243-----------------------SSFKQSNA......TDL--------AYLK----------------------------
Q6CW51_KLULA/66-265-----------------------QFSSQEYT......DGL--------ENVQ----------------------------
Q6FQP2_CANGA/65-266-----------------------SFTHNAKT......TGF--------ENVV----------------------------
Q870W5_NEUCS/62-268-----------------------VVALTSSS...N..GTL--------APMQ----------------------------
YNB1_SCHPO/52-216-----------------------IFARLLRV......KNE--------T.TT----------------------------

PF06687

Q4WWY3_ASPFU/5-166-----------------------PATPLTIL...LLAAFV--------LLLLSVLSTP....------------------
Q75E26_ASHGO/7-202-----------------------ITSLSFLL...LLGSCL--------LGFFTILSGAK.HT------------------
Q757N9_ASHGO/7-167-----------------------LSGLIWLA...QTAALA--------FLVVSCITAP....------------------
A5DJU1_PICGU/4-217-----------------------SLLVLWVF...TSICFV--------LQLLPIMSVPLTGK------------------
PALI_DEBHA/4-238-----------------------GLLILDLF...VSICLT--------IQLLPIISVPITGK------------------
Q0V6X2_PHANO/4-166-----------------------PATPLSIL...FFIAFC--------LLLLSTLSTP....------------------
Q6BIN6_DEBHA/7-162-----------------------FNSISFIL...MLVTVV--------FLILSCITSP....------------------
A5DHH0_PICGU/5-162-----------------------FHTASAVL...MIICLV--------FLILATISAP....------------------
Q6C1Y6_YARLI/7-199-----------------------IGAFTILL...IAGATL--------LSFFVLLAGAR.DS------------------
Q6BLL9_DEBHA/5-198-----------------------STILNIFL...LAGTCL--------LLLLVILSGAS.DN------------------
A5DC91_PICGU/5-198-----------------------TGIFNLFF...LAGSTL--------LLVFIVLSGST.NH------------------
Q6BME8_DEBHA/24-312-----------------------LQIIRLFT...CIAALT--------FIIATLIGSL....------------------
A5DG26_PICGU/5-318-----------------------FRFLLIIF...SIAAAI--------LSVFALIGSYK.NE------------------
MAC1_SCHPO/6-177-----------------------LAFLAILF...LLIPTA--------LLIIGSVSVPS...------------------
PALI2_KLULA/3-167-----------------------VKIVLVVL...LTLALV--------FECFSTISVP....------------------
PALI1_KLULA/4-168-----------------------FKIVFLTS...LSLALV--------FELFNTISVP....------------------
PALI_ASHGO/5-170-----------------------MSVVEWLLLGSTTLALL--------FQSFATFSVP....------------------
PALI_CANGA/6-170-----------------------LRTLLAIL...VSICVV--------FQAFPLATVP....------------------
A7TPS6_VANPO/6-170-----------------------LMMSVAIL...MTISLV--------FHIIPNITTP....------------------
PALI_YARLI/7-167-----------------------SATGLLVI...LLIAFA--------LQLVAVLSVP....------------------
A6ZMC2_YEAS7/4-169-----------------------MIHIVVFL...LAITTI--------FEILPLITVP....------------------
PALI_CANAL/4-232-----------------------AFIALLIL...LIVCWV--------IQLLPVIAVPFTT.------------------
A5E4Z6_LODEL/4-205-----------------------SLLALLVL...CLICWI--------IQLLPVISVPLTP.------------------
A3LUV8_PICST/4-233-----------------------TLLILWGV...CCICLV--------IQLLPVISVPITS.------------------
A6SN30_BOTFB/4-166-----------------------PATPLSLL...LLAAFA--------CLLVSILSTP....------------------
PALI_MAGO7/4-169-----------------------PATPLAVL...LAAAFG--------LLLISVLSTP....------------------
Q2H463_CHAGB/4-183-----------------------PATPLSVL...LFAAFV--------LILLSVLSTP....------------------
PALI_NEUCR/4-175-----------------------PATPLAVL...LFAAFG--------LLTLATISTP....------------------
Q0CX64_ASPTN/5-167-----------------------PATPLTIL...LLIAFV--------LLLLSVISTP....------------------
A2QF35_ASPNC/5-165-----------------------PATPLTIL...LLIAFA--------LLLISVISTP....------------------
A6R830_AJECN/5-168-----------------------PATPLTVL...LLTAFV--------LLLLSVLSTP....------------------
MUG33_SCHPO/5-166-----------------------SATPSLIL...LVIAIV--------FFVLAICTPP....------------------
Q4P8U5_USTMA/5-204-----------------------YLVPALVL...SFVSMI--------LLVLVTISTPTTLS------------------
A3LTF9_PICST/7-165-----------------------FHSVAFVL...ILVSFV--------FLLLATISPP....------------------
A5DUT6_LODEL/7-165-----------------------FNTISFVL...ILVSFV--------FLLLATISSP....------------------
Q5ALR6_CANAL/7-166-----------------------YHTISFLF...ILVSFV--------FLLFATISYP....------------------
A6ZNI8_YEAS7/5-176-----------------------SSVVFFLVGLSQFVTMA--------FLIIGSITAP....------------------
A7TT16_VANPO/7-179-----------------------STLWFSIISTMQFTSMA--------FLIICCVTAP....------------------
Q6CX71_KLULA/9-171-----------------------FATLLFFL...QCVALA--------FLILACVSAP....------------------
Q6FSP2_CANGA/9-169-----------------------MFLVVGLL...AFISMA--------FFIIASVTAP....------------------
A7A250_YEAS7/7-175-----------------------ILLFSSFL...QLISFS--------GFMICCLTSP....------------------
A1CFA3_ASPCL/8-205-----------------------LGLLGLFF...TASALL--------LMFLAFLGGAR.NS------------------
A2QNP6_ASPNC/8-205-----------------------MGFLGLFF...TAGALL--------LMFLTLLGGAR.NS------------------
A6R6X6_AJECN/8-204-----------------------IALLGLLF...TAGAFI--------LMMLTLIGGSR.NT------------------
Q0V6H1_PHANO/8-203-----------------------LAILSLIL...VGGAVL--------LQFFTILTGGV.NS------------------
Q5AH49_CANAL/4-201-----------------------LNIIPVFF...LVGSVL--------LLILTIINGAG.TS------------------
A5E7B2_LODEL/4-201-----------------------LTIVPIFF...LLGSTL--------LLILTAINGAG.TS------------------
A5DAF8_PICGU/6-205-----------------------FTIVPLIL...LLGSTL--------LLVFMNIVGAN.NS------------------
Q5A4M8_CANAL/5-199-----------------------FTFFNLFF...LAGTVL--------LLIFTVLSGSS.KH------------------
A3LV33_PICST/5-198-----------------------HTIANLFF...LAGTIL--------LLIFVVLSGSS.DH------------------
SUR7_YEAST/9-206-----------------------LRLVVLLF...LAGNTL--------LLILMIISGAT.DH------------------
A7TH74_VANPO/9-205-----------------------ARLLTLLF...LAGNTL--------CLILIIISGST.NS------------------
Q753Q0_ASHGO/8-202-----------------------GKLLTAIL...LAGNTL--------LLLFIVFSGSI.ES------------------
Q6CXH5_KLULA/9-205-----------------------TKFVSLLF...LMGSTM--------LLIFIVLSGSI.EH------------------
Q2H574_CHAGB/3-201-----------------------RTPVALIL...IAGSLV--------LLWFVILSGVT.HT------------------
Q7SI65_NEUCR/8-206-----------------------LALLSLFF...IAISLI--------LLWFVILSGIT.RT------------------
A6SND7_BOTFB/8-206-----------------------MGIVSLIL...LGASIM--------FMFFVILGGIT.GT------------------
A7EBS7_SCLS1/8-206-----------------------TGIISLVL...IGASIM--------FMFFVILGGIT.QT------------------
Q6FT41_CANGA/7-205-----------------------VNAIVCLF...IVGAGL--------LSFFLILSGAR.DS------------------
A7TIB3_VANPO/11-209-----------------------VHLLTFFF...LLGAGL--------LTFIVVLSGAR.ST------------------
Q6CJ71_KLULA/7-204-----------------------VSSLSLLF...LLGSGL--------LTFFVILSGAR.TT------------------
FMP45_YEAST/7-205-----------------------VNLLVFLF...LLGAGL--------LTFFLILSGGR.ES------------------
YNT4_YEAST/7-206-----------------------VYFINLFF...LLGATL--------LTFFLILAGGR.TT------------------
A7TTI2_VANPO/7-207-----------------------VTIISHVS...SSGAGL--------LMSFVALSGST.TS------------------
Q55HH6_CRYNB/6-242-----------------------CVAGATIL...SVISVI--------LLIFAHIGQVSSGA------------------
Q4PHQ4_USTMA/26-258-----------------------MIHVGEFL...TFAAVV--------LCVFANIGQLTNNI------------------
PUN1_YEAST/6-240-----------------------TLFFAAIF...SLGALI--------LAIVACAGSTK.NY------------------
Q6FPE4_CANGA/6-240-----------------------ALILALFF...ALASLV--------LACIACAGSTK.NY------------------
A7TGC8_VANPO/6-240-----------------------RLFVAALI...SFTTFI--------IAIIGCAGSTS.NY------------------
Q6CWP2_KLULA/5-243-----------------------TVLASFVI...TAASLI--------LAIFACFGSTQ.NS------------------
Q59US7_CANAL/25-311-----------------------IQLCRLFT...CLIAIV--------CCLACIVAPR....------------------
A5E006_LODEL/6-375-----------------------FRAIIIFF...SLACLI--------LSCFAIAGSYK.NA------------------
A5E421_LODEL/6-397-----------------------FRVILIFF...SVACLI--------LSCFAITGSYK.NE------------------
Q6BMS1_DEBHA/5-319-----------------------VRLIIILL...SIATTV--------LSIFALVGSYK.NE------------------
A3LZK7_PICST/5-323-----------------------FRIILIFF...SIACTV--------LTAFAVTGSFK.NE------------------
Q5ADV0_CANAL/6-394-----------------------FRVILIIL...SLMCCI--------LEIFAVTGSYD.NK------------------
Q2UBQ3_ASPOR/26-275-----------------------HRLLRSFL...YLIAWI--------FLVLVVIGDVS.NK------------------
A2QQ39_ASPNC/26-275-----------------------HRILRSFC...YLIAWI--------FLILVCIGNVA.DK------------------
Q5BDP9_EMENI/26-276-----------------------HRILRSFL...HLIAWI--------FLLLVVIGNTS.DK------------------
Q0CQ07_ASPTN/27-276-----------------------HRLLRTLL...YLIAWI--------FLLLVCIGNLS.NK------------------
YDO9_SCHPO/12-275-----------------------FTGIGTVC...VGVGAL--------LSILCIINQTQHNI------------------
Q0TZ73_PHANO/4-276-----------------------TALVPVLC...CIVALI--------LSFLCLFAGHKQSF------------------
Q7SFF9_NEUCR/5-286-----------------------STLVPIIA...SIAAFV--------LVLLALVAGSSKGF------------------
A1DME7_NEOFI/9-255-----------------------CIFTPYAL...TIASLV--------CIIMVGLGCTKSSS------------------
Q2UPQ3_ASPOR/9-255-----------------------CIITPYAL...TIASLV--------CIIIVGLGCTNSGS------------------
Q0CRK6_ASPTN/9-256-----------------------CILTPYAL...TIASLV--------CIIMVGLGCTNANS------------------
A2QPC4_ASPNC/9-256-----------------------CIFTPYVL...TIASLI--------CIIMVGLGCTKSSS------------------
Q5B2L7_EMENI/9-256-----------------------CIFTPYVL...TIAALI--------CLIVVGLGSTDNGT------------------
A6RDR9_AJECN/9-246-----------------------CIFTPYLL...TIGALV--------CLIFVGLGVTSPNA------------------
Q0V4X3_PHANO/9-258-----------------------CIITPMAL...TLASLI--------CIVIVMLGQMSAGS------------------
Q2UF28_ASPOR/9-224-----------------------WRGFPCAL...TIGSLI--------CLVIVGLGCTRAHK------------------
Q2TX92_ASPOR/9-279-----------------------CVVLPYVF...SVASLI--------CLIFANLTGFG.ST------------------
Q7SG51_NEUCR/8-271-----------------------CVALPFLL...TVASLV--------ALLVGGLAGVAD..------------------
Q2HFG4_CHAGB/9-276-----------------------CVLVPFLL...TLASLI--------AMLVAGLSGLAD..------------------
A6RLC7_BOTFB/8-271-----------------------CVGVPFGL...TLASLV--------CLLIASLAGVTD..------------------
A2R5N4_ASPNC/9-229-----------------------LVSTSCLL...NIGTLL--------CLIVIGLACTKMGS------------------
Q5K881_CRYNJ/4-176-----------------------PAFPGLFF...AFAAAV--------LLLFASISPP....------------------
Q4PH32_USTMA/4-186-----------------------PATPGTLL...TLAAAV--------LLGLVTISTP....------------------
Q5KGB3_CRYNJ/7-189-----------------------NATPGTIL...CLAATI--------LLAIVSFNTP....------------------

PF00822

CLD7_HUMAN/4-182------------S--YAG-----------------------------------------DNI..........ITA---QA
CCG2_MOUSE/6-197------------R--GVC-----------------------------------------KTKSVSENETSKKNEE---VM
EMP3_HUMAN/1-156------------G--KE.-----------------------------------------................---..
EMP1_MOUSE/1-154------------D--YAN-----------------------------------------................---..
CLD1_MOUSE/4-182------------S--YAG-----------------------------------------DNI..........VTA---QA
CLD10_HUMAN/4-179------------T--IDG-----------------------------------------TV...........ITT---AT
PMP22_HUMAN/1-153------------N--GH.-----------------------------------------................---..
EMP1_RABIT/1-154------------D--SIN-----------------------------------------................---..
LMIP_BOVIN/1-157------------R--LSG-----------------------------------------................---AF
EMP2_MOUSE/1-165------------D--SF.-----------------------------------------................---..
CLD7B_DANRE/4-182------------A--YVG-----------------------------------------DNI..........ITA---IA
EMP1_HUMAN/1-151------------N--TVD-----------------------------------------................---..
EMP2_HUMAN/1-160------------D--EF.-----------------------------------------................---..

PF13903

TM235_HUMAN/16-197------------E..VAD..............AGN.............................GSAWPGR.AEL...LS
TM235_MOUSE/16-192------------E..VAD..............AGG............................LG.......GVQ...LF
B4Q2K5_DROYA/16-232------------D..VWR..............NQIQSFAAKH...............SDAESLLH.NMNVK.YYY...YT
TM182_XENTR/15-225------------E..KCS..............ENQ.............................ETGDNAT.HSV...LL
Q16RP0_AEDAE/16-235------------E..VKR..............NNIQTFIAK................HPDGASLT...ESF.NNRLVYYT
TM182_MOUSE/15-220------------E..VGR..............C.S.............................GE..QNI.ENI...TF
D2HQ99_AILME/17-198------------S..PEL..............D...................................HHN.ATC...EA
A7SGP9_NEMVE/19-204------------D..LQR..............TVL.............................TNGTAVS.QTG...GS
B4NZC2_DROYA/16-190------------D..GSL..............Q........................................NP...RF
Q1L8R4_DANRE/69-258------------A..PSK..............SFY..................................NN.QTC...LV
B0WVP8_CULQU/16-190------------D..GRL..............E........................................NP...KF
B4H3C9_DROPE/44-223------------D..YRI..............TGAKLDRLGLWV..........HCFRSLPDVND...............
B4KVB2_DROMO/40-219------------D..YRI..............TG........................................A...KL
Q17AR2_AEDAE/35-214------------D..YRI..............T........................................GA...KL
Q6E5P4_TAKRU/18-198------------D..VGN..............TSV.....................................ITS...GV
Q5DCP0_SCHJA/66-231------------H..FKTIGLFQQCDNLIKQMN.NI...........................QLSFNVEH.NNQ...NN
B0WVM7_CULQU/17-198------------G..ARR..............YNS.............................TESQGRV.HFG...LF
C1BSD7_9MAXI/17-200------------K..VYR..............EANVKAYGYVHFGL.......FKGARQLNHGFG...ERN.YPM...DI
B4NIE2_DROWI/17-198------------N..PRR..............GNS.............................TEANGDV.NFG...LF
B4HC72_DROPE/17-198------------N..PRR..............HTS.............................SEAKGDV.NFG...LF
A9VEC0_MONBE/368-521------------D..PDE..............TQIRGYEL..................GLFEYCSRRCQPY.LDN...QF
B3LY06_DROAN/17-198------------N..PRR..............KSSSEAAGEVNFGLFY...GSQQLNPGFGVRTNPVDVYT.FVR..TEN
TMM47_XENTR/28-170------------D..NQY..............YLS.............................LWESCKK.AE......
TM225_HUMAN/18-160------------I..SED..............E........................................RA...KM
A8Q053_BRUMA/17-199------------R..PIN..............RKFNSVNNYVNLGL.......FKGSRQLDWGLG....PR.HKS...FS
B4K6W4_DROMO/17-198------------Y..PRR..............TNTTEAKGDVNFGLF.....YGNQNLNPGFGVR..NNQV.DVY...SF
A6H7D9_BOVIN/18-203------------T..IAI..............SDSSSNGSVIITYG......LLRGKSIQELNHGLAESDK.NFE...VL
B4MC21_DROVI/17-198------------Y..PRR..............SNS.............................TEAKGDV.NLG...LF
B7QNM3_IXOSC/25-197------------Q..EAN..............AEFVRLGL...................WDVCFRNYRHPS.YQY...DE
B5X0V8_SALSA/21-162------------E..RFS..............L................................SLWESC.TET...EA
A7SYX5_NEMVE/51-211------------IGGKCN..............GDYIGL.......................YKVIAYKSSS.DLE...QF
B3P1Z4_DROER/17-198------------T..PRR..............KNSADAKGEFNFGLF.....FGSYHLNPGFGVRTNSVNV.YNF...VR
A9V5F7_MONBE/26-226------------D..IKNNGDHVI.VGRGFFQT.YEDDPNGLITLYTY..AIKDQNGYKQDPFCG.SNNATLQSS...YL
B4I3M6_DROSE/17-198------------T..PRR..............KNSADAKGEFNFGLFF...GNYHLNPGFGIRTN....SV.DVY...TF
Q16T28_AEDAE/17-198------------S..PKR..............YNS.............................SESQGRI.HFG...LF
B4QV06_DROSI/17-198------------T..PRR..............KNSADAKGEFNFGLFF...GNYHLNPGFGIRTNSVDVYT.FVR..TEN
B4PTR2_DROYA/17-198------------T..PRR..............KNSLDAKGEFNFGLFYGSYHLNPGFGFRTNSVDVYTYVR.TEN...GD

PF07062

O45670_CAEEL/8-219------------D--IRE------------------------------------------------------------FR
A8XPM2_CAEBR/9-213------------D--DLD------------------------------------------------------------AD
A8XPM1_CAEBR/5-202------------Y--ARE------------------------------------------------------------IR
A8XPW0_CAEBR/10-221------------N--LRE------------------------------------------------------------YG
Q18135_CAEEL/11-221------------D--IRE------------------------------------------------------------FR

PF10242

Q7PMA1_ANOGA/11-202GNFT........V--LRH--------------------------------------------------------------
LHPL4_RAT/22-200............T--PKP--------------------------------------------------------------
LHPL3_XENLA/22-199............T--PQA--------------------------------------------------------------
TMHS_RAT/25-202............T--PQA--------------------------------------------------------------
TMHS_CHICK/25-202............T--PQA--------------------------------------------------------------
Q4STB3_TETNG/22-199............T--PQA--------------------------------------------------------------
Q4TFH6_TETNG/25-207QRHLPPGA....A--PPS--------------------------------------------------------------
Q178A0_AEDAE/25-199............S--DAG--------------------------------------------------------------
Q2M056_DROPS/25-199............N--DGA--------------------------------------------------------------
Q9XVU1_CAEEL/19-183............S--DEG--------------------------------------------------------------
LHPL2_HUMAN/9-204GVEPAGPGGGSPE--PYH--------------------------------------------------------------
Q4S279_TETNG/9-201AVFGRHGATAAGE--AYR--------------------------------------------------------------
Q568B9_DANRE/9-197GSELNFTVTASHR--SDQ--------------------------------------------------------------
Q4RUW4_TETNG/9-195SDSNAGEDS...R--EYR--------------------------------------------------------------
Q9W0X9_DROME/9-195STAS........S--HHQ--------------------------------------------------------------
Q292M2_DROPS/9-197PVDELSSVS...S--QRQ--------------------------------------------------------------
LHFP_MOUSE/8-193............L--GKP--------------------------------------------------------------
LHPL1_RAT/8-192............L--GKP--------------------------------------------------------------

PF06653

Q8ITZ9_CAEEL/47-208------------NRST..------------------------------------------------------........
Q9TZ35_CAEEL/1-155------------WSYA..------------------------------------------------------........
A8WY95_CAEBR/1-161------------GTTE..------------------------------------------------------........
A8XQE4_CAEBR/1-163------------NDGE..------------------------------------------------------........
A8WYV7_CAEBR/1-134------------WHNG..------------------------------------------------------........
A8WK96_CAEBR/1-140------------YKGN..------------------------------------------------------........
A8XRC8_CAEBR/1-182------------IENNVK------------------------------------------------------D......V
A8XQE5_CAEBR/1-150------------GN....------------------------------------------------------........
Q9XUZ7_CAEEL/1-168------------DWSG..------------------------------------------------------........
Q2WF57_CAEEL/1-166------------WSIG..------------------------------------------------------........
O45515_CAEEL/1-161------------DDGG..------------------------------------------------------........
A8XR11_CAEBR/1-188------------IRPFNP------------------------------------------------------LY.....P
B6IEW4_CAEBR/1-156------------NRTY..------------------------------------------------------........
Q95YB5_CAEEL/1-123------------......------------------------------------------------------........
A8WK67_CAEBR/1-167------------FTIL..------------------------------------------------------........
Q95XC2_CAEEL/1-191------------EKATA.------------------------------------------------------........
B6IFT2_CAEBR/1-179------------FSDG..------------------------------------------------------........
A8XQE6_CAEBR/1-167------------DTVTER------------------------------------------------------........
B6IEW3_CAEBR/1-114------------......------------------------------------------------------........
A8XWG5_CAEBR/1-169------------ETNYN.------------------------------------------------------........
O45334_CAEEL/1-161------------DYGG..------------------------------------------------------........
A8WY98_CAEBR/1-166------------MNDYQ.------------------------------------------------------........
B6IKT5_CAEBR/1-215------------SESFIL------------------------------------------------------HGWYDEHG
B6IKT4_CAEBR/1-120------------......------------------------------------------------------........

PF07344

A4I9X4_LEIIN/377-531------------.RERFR------------------------------------------------------.....GGD
A4HBJ2_LEIBR/15-170------------.RFNSL------------------------------------------------------....TRSV
A4H6C8_LEIBR/15-170------------.RVKDL------------------------------------------------------...GRFGS
Q4Q3F7_LEIMA/15-171------------.RGNDP------------------------------------------------------...VAAYR
A4H5H1_LEIBR/15-170------------.HLRIG------------------------------------------------------...GRFGN
A4HBJ0_LEIBR/15-171------------.RFRPR------------------------------------------------------...YITQN
Q7KPY0_LEIBR/5-180------------.RGRGI------------------------------------------------------NASATGGA
A4HB47_LEIBR/18-199------------.RVPNK------------------------------------------------------...VAFSG
A4I9X2_LEIIN/15-169------------.RIPNT------------------------------------------------------.......T
Q4Q339_LEIMA/15-170------------.RAHNR------------------------------------------------------.......P
Q27227_TRYCR/14-171------------.RTKEK------------------------------------------------------.....KAT
Q4E0S1_TRYCC/20-182------------.RGKGY------------------------------------------------------..LDGGKE
Q4Q3A7_LEIMA/14-189------------.MPLND------------------------------------------------------...SVLHV
A4HAZ8_LEIBR/15-170------------.RVKPM------------------------------------------------------...FREGT
Q4QIA0_LEIMA/15-170------------.YNKPE------------------------------------------------------...HSSGA
Q4Q8C7_LEIMA/145-338------------.DVVGG------------------------------------------------------........
Q585K0_TRYB2/9-167------------.RMKNE------------------------------------------------------........
A4H5D1_LEIBR/15-173------------.RIGSV------------------------------------------------------...RSFFP
Q9GU51_LEIIN/15-171------------.RDDTE------------------------------------------------------...GMYGN
A4HB02_LEIBR/15-170------------....LQ------------------------------------------------------...FPDPP
A4H5G6_LEIBR/15-171------------.RFRRE------------------------------------------------------...YITPN
A4I9W9_LEIIN/15-171------------IRTDHG------------------------------------------------------......PG
A4HDL4_LEIBR/18-168------------.DSMTS------------------------------------------------------........
Q4QHJ3_LEIMA/241-414------------......------------------------------------------------------...EHYDR
A4HAJ6_LEIBR/28-184------------.RFRPQ------------------------------------------------------...YITPN
E9AG83_LEIIN/15-171------------.RGTTK------------------------------------------------------...DLFNI
A4H7D7_LEIBR/15-172------------.RIRSR------------------------------------------------------...DSQVL
A4I4J2_LEIIN/15-171------------.REVKG------------------------------------------------------...GVFGG
Q4QAK7_LEIMA/19-166------------.QTPGH------------------------------------------------------........
Q4QI88_LEIMA/15-171------------.RPHNT------------------------------------------------------...SRIGN
A4HBJ1_LEIBR/15-170------------.RFKPQ------------------------------------------------------......NP
A4HGJ1_LEIBR/143-338------------.DLVGG------------------------------------------------------........
Q4Q3A8_LEIMA/18-199------------.RVQNV------------------------------------------------------...DALSN
A4HI41_LEIBR/20-195------------.RGSGI------------------------------------------------------RADGSGGA
A4HDI3_LEIBR/87-236------------.ESVFG------------------------------------------------------........
A4I4J3_LEIIN/81-236------------.RIDPS------------------------------------------------------...IRFGG
E9AHT2_LEIIN/15-171------------.RGNDP------------------------------------------------------...PFFER
E9AG85_LEIIN/15-170------------.YIKPE------------------------------------------------------...HSFGA
Q4Q327_LEIMA/15-169------------.RMPST------------------------------------------------------.......G
A4HTM4_LEIIN/15-171------------.RPHGT------------------------------------------------------...SRFCS
Q4Q8C6_LEIMA/374-525------------.DVVGA------------------------------------------------------........
Q4Q397_LEIMA/79-235------------.RAAVE------------------------------------------------------...EFNFS
A4IAL7_LEIIN/15-170------------.SMAVK------------------------------------------------------...GLPNE
A4H5G0_LEIBR/15-170------------.RLRDE------------------------------------------------------...PPFGN
A4H606_LEIBR/64-214------------.RDRQG------------------------------------------------------........
Q4Q317_LEIMA/15-172------------.RGVNP------------------------------------------------------...QVLGN
A4I0W5_LEIIN/18-168------------.DSKTS------------------------------------------------------........
A4I9W8_LEIIN/77-234------------.RLKKL------------------------------------------------------...YQYPH
A4H5D2_LEIBR/15-171------------.HVNEY------------------------------------------------------...FSANS
A4H5G5_LEIBR/226-381------------.RITDN------------------------------------------------------......LS
A4I9X1_LEIIN/15-170------------.RSSNS------------------------------------------------------......SV
Q384H4_TRYB2/118-295------------.DEVGG------------------------------------------------------........
Q4CVL1_TRYCC/26-174------------.QPKLS------------------------------------------------------........
A4I5B9_LEIIN/26-190------------RSWGED------------------------------------------------------LSGSSAEL
A4I0W4_LEIIN/18-166------------.DVKNG------------------------------------------------------........
A4I9X0_LEIIN/31-188------------.RSNPA------------------------------------------------------...GMSKT
A4IAM2_LEIIN/15-170------------.RGDVN------------------------------------------------------...I.FDK
A4I9R7_LEIIN/15-171------------.RGTIA------------------------------------------------------...EIAFS
A4HAL2_LEIBR/14-189------------.VPRSE------------------------------------------------------...NAKRV
Q4DU87_TRYCC/14-171------------.RPRTN------------------------------------------------------.....PFF
Q4Q309_LEIMA/15-169------------.HIRTR------------------------------------------------------.......G
A4H9E8_LEIBR/48-205------------.RLTGT------------------------------------------------------...SSSPS
A4HI43_LEIBR/25-189------------RSWEEN------------------------------------------------------SSDSGSDL
Q4Q6L8_LEIMA/15-171------------.HVTPE------------------------------------------------------...YSFGV
A4HB00_LEIBR/15-170------------.RFRMN------------------------------------------------------......FF
A4I6E5_LEIIN/15-171------------.YLKHG------------------------------------------------------...PGSSA
A4H605_LEIBR/152-298------------.RSSSG------------------------------------------------------........
A4H9E9_LEIBR/15-171------------.HFKDI------------------------------------------------------...RNFTR
A4HAJ4_LEIBR/51-207------------.RLDQP------------------------------------------------------.....LDS
A4H5G7_LEIBR/15-171------------.RFRPR------------------------------------------------------...YIRPN
Q4QHJ4_LEIMA/134-280------------.RGESG------------------------------------------------------........
A4HGF8_LEIBR/158-312------------.RGKNV------------------------------------------------------..EESGVN
Q4Q1U9_LEIMA/15-169------------.RIPRG------------------------------------------------------.......S
A4IAM1_LEIIN/15-170------------.RGDLN------------------------------------------------------...D.FGE
Q4QI87_LEIMA/15-171------------.RVKGL------------------------------------------------------...GRFAN
Q384H3_TRYB2/301-450------------.DVVGG------------------------------------------------------........

PF07803

GSG1_HUMAN/8-118--------------------------------------------------------------------------------
GSG1L_HUMAN/2-133--------------------------------------------------------------------------------
Q4SN53_TETNG/4-143--------------------------------------------------------------------------------
Q4SCG5_TETNG/5-121--------------------------------------------------------------------------------
GSG1L_DANRE/2-113--------------------------------------------------------------------------------
Q4S7Q6_TETNG/2-112--------------------------------------------------------------------------------
GSG1L_XENTR/2-125--------------------------------------------------------------------------------
Q4SAX5_TETNG/2-120--------------------------------------------------------------------------------

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257--------------------------------------------------------------------------------
A1DMY3_NEOFI/52-247--------------------------------------------------------------------------------
A3LV03_PICST/62-245--------------------------------------------------------------------------------
A5E535_LODEL/80-252--------------------------------------------------------------------------------
A7EL23_SCLS1/52-241--------------------------------------------------------------------------------
A7TJZ8_VANPO/66-260--------------------------------------------------------------------------------
B5VE06_YEAS6/60-260--------------------------------------------------------------------------------
B6HGM8_PENCW/52-252--------------------------------------------------------------------------------
B8MZW1_ASPFN/73-257--------------------------------------------------------------------------------
B8NY21_ASPFN/72-267--------------------------------------------------------------------------------
B9WIK5_CANDC/65-244--------------------------------------------------------------------------------
C0NA65_AJECG/81-270--------------------------------------------------------------------------------
C0SH54_PARBP/74-258--------------------------------------------------------------------------------
C1G9K9_PARBD/72-262--------------------------------------------------------------------------------
C4JX23_UNCRE/51-235--------------------------------------------------------------------------------
C4QXD3_PICPG/65-260--------------------------------------------------------------------------------
C4YC02_CLAL4/51-224--------------------------------------------------------------------------------
C5DEC8_LACTC/64-258--------------------------------------------------------------------------------
C5DPI4_ZYGRC/66-266--------------------------------------------------------------------------------
C5G079_ARTOC/74-258--------------------------------------------------------------------------------
C5M8V3_CANTT/127-303--------------------------------------------------------------------------------
YEJ7_SCHPO/33-201--------------------------------------------------------------------------------
Q0CSC3_ASPTN/220-409--------------------------------------------------------------------------------
Q0U808_PHANO/74-259--------------------------------------------------------------------------------
Q0V1Y2_PHANO/45-209--------------------------------------------------------------------------------
Q59WR6_CANAL/68-244--------------------------------------------------------------------------------
Q6BL79_DEBHA/62-241--------------------------------------------------------------------------------
Q6CH13_YARLI/62-243--------------------------------------------------------------------------------
Q6CW51_KLULA/66-265--------------------------------------------------------------------------------
Q6FQP2_CANGA/65-266--------------------------------------------------------------------------------
Q870W5_NEUCS/62-268--------------------------------------------------------------------------------
YNB1_SCHPO/52-216--------------------------------------------------------------------------------

PF06687

Q4WWY3_ASPFU/5-166---------------------------------------------------------------------.I......IQG
Q75E26_ASHGO/7-202---------------------------------------------------------------------GV......LKN
Q757N9_ASHGO/7-167---------------------------------------------------------------------.V......VSD
A5DJU1_PICGU/4-217---------------------------------------------------------------------AV......GYN
PALI_DEBHA/4-238---------------------------------------------------------------------GI......GYN
Q0V6X2_PHANO/4-166---------------------------------------------------------------------.V......IPA
Q6BIN6_DEBHA/7-162---------------------------------------------------------------------.V.......SS
A5DHH0_PICGU/5-162---------------------------------------------------------------------.V......VPS
Q6C1Y6_YARLI/7-199---------------------------------------------------------------------AP......LNN
Q6BLL9_DEBHA/5-198---------------------------------------------------------------------FP......LND
A5DC91_PICGU/5-198---------------------------------------------------------------------FP......FNR
Q6BME8_DEBHA/24-312---------------------------------------------------------------------.A......NRN
A5DG26_PICGU/5-318---------------------------------------------------------------------SY......LTD
MAC1_SCHPO/6-177---------------------------------------------------------------------.........TR
PALI2_KLULA/3-167---------------------------------------------------------------------.......ITIG
PALI1_KLULA/4-168---------------------------------------------------------------------.......ITSH
PALI_ASHGO/5-170---------------------------------------------------------------------.......LSNG
PALI_CANGA/6-170---------------------------------------------------------------------.......LNKN
A7TPS6_VANPO/6-170---------------------------------------------------------------------.......VIDH
PALI_YARLI/7-167---------------------------------------------------------------------.......VTKT
A6ZMC2_YEAS7/4-169---------------------------------------------------------------------.......VTKY
PALI_CANAL/4-232---------------------------------------------------------------------.......PDAN
A5E4Z6_LODEL/4-205---------------------------------------------------------------------.......LSSK
A3LUV8_PICST/4-233---------------------------------------------------------------------.......PSTN
A6SN30_BOTFB/4-166---------------------------------------------------------------------.......IIKS
PALI_MAGO7/4-169---------------------------------------------------------------------.......IIKA
Q2H463_CHAGB/4-183---------------------------------------------------------------------.......IISA
PALI_NEUCR/4-175---------------------------------------------------------------------.......IIKQ
Q0CX64_ASPTN/5-167---------------------------------------------------------------------.......IVKG
A2QF35_ASPNC/5-165---------------------------------------------------------------------.......IVKS
A6R830_AJECN/5-168---------------------------------------------------------------------.......VVKS
MUG33_SCHPO/5-166---------------------------------------------------------------------.......LANN
Q4P8U5_USTMA/5-204---------------------------------------------------------------------DSTP.FDFVRS
A3LTF9_PICST/7-165---------------------------------------------------------------------.......VVST
A5DUT6_LODEL/7-165---------------------------------------------------------------------.......VVTT
Q5ALR6_CANAL/7-166---------------------------------------------------------------------.......VVDI
A6ZNI8_YEAS7/5-176---------------------------------------------------------------------.......IFKQ
A7TT16_VANPO/7-179---------------------------------------------------------------------.......VFKQ
Q6CX71_KLULA/9-171---------------------------------------------------------------------.......VFDN
Q6FSP2_CANGA/9-169---------------------------------------------------------------------.......AFHQ
A7A250_YEAS7/7-175---------------------------------------------------------------------.......IIRN
A1CFA3_ASPCL/8-205---------------------------------------------------------------------NP......LNR
A2QNP6_ASPNC/8-205---------------------------------------------------------------------RP......LNE
A6R6X6_AJECN/8-204---------------------------------------------------------------------NP......LNR
Q0V6H1_PHANO/8-203---------------------------------------------------------------------AP......LNK
Q5AH49_CANAL/4-201---------------------------------------------------------------------SV......LGK
A5E7B2_LODEL/4-201---------------------------------------------------------------------SV......LGK
A5DAF8_PICGU/6-205---------------------------------------------------------------------SI......LGD
Q5A4M8_CANAL/5-199---------------------------------------------------------------------FP......LNK
A3LV33_PICST/5-198---------------------------------------------------------------------FP......LDE
SUR7_YEAST/9-206---------------------------------------------------------------------YP......VNR
A7TH74_VANPO/9-205---------------------------------------------------------------------FP......IDK
Q753Q0_ASHGO/8-202---------------------------------------------------------------------SP......IDR
Q6CXH5_KLULA/9-205---------------------------------------------------------------------SP......VNE
Q2H574_CHAGB/3-201---------------------------------------------------------------------SP......LRQ
Q7SI65_NEUCR/8-206---------------------------------------------------------------------SP......LRQ
A6SND7_BOTFB/8-206---------------------------------------------------------------------SP......LDK
A7EBS7_SCLS1/8-206---------------------------------------------------------------------TP......LDK
Q6FT41_CANGA/7-205---------------------------------------------------------------------GT......LKN
A7TIB3_VANPO/11-209---------------------------------------------------------------------GT......LTR
Q6CJ71_KLULA/7-204---------------------------------------------------------------------GV......LDK
FMP45_YEAST/7-205---------------------------------------------------------------------GT......LKN
YNT4_YEAST/7-206---------------------------------------------------------------------GV......LKN
A7TTI2_VANPO/7-207---------------------------------------------------------------------GT......LKD
Q55HH6_CRYNB/6-242---------------------------------------------------------------------.......LVRS
Q4PHQ4_USTMA/26-258---------------------------------------------------------------------VT.......RN
PUN1_YEAST/6-240---------------------------------------------------------------------SP......INK
Q6FPE4_CANGA/6-240---------------------------------------------------------------------YP......INQ
A7TGC8_VANPO/6-240---------------------------------------------------------------------NP......INK
Q6CWP2_KLULA/5-243---------------------------------------------------------------------TP......LNQ
Q59US7_CANAL/25-311---------------------------------------------------------------------.......VTNT
A5E006_LODEL/6-375---------------------------------------------------------------------NY......LTS
A5E421_LODEL/6-397---------------------------------------------------------------------NY......LTS
Q6BMS1_DEBHA/5-319---------------------------------------------------------------------AY......LTK
A3LZK7_PICST/5-323---------------------------------------------------------------------RF......LTN
Q5ADV0_CANAL/6-394---------------------------------------------------------------------KY......LTD
Q2UBQ3_ASPOR/26-275---------------------------------------------------------------------PV......LRQ
A2QQ39_ASPNC/26-275---------------------------------------------------------------------PV......LRQ
Q5BDP9_EMENI/26-276---------------------------------------------------------------------PV......LRQ
Q0CQ07_ASPTN/27-276---------------------------------------------------------------------PV......LRE
YDO9_SCHPO/12-275---------------------------------------------------------------------AF.......QN
Q0TZ73_PHANO/4-276---------------------------------------------------------------------M........ED
Q7SFF9_NEUCR/5-286---------------------------------------------------------------------MESY..DVVTN
A1DME7_NEOFI/9-255---------------------------------------------------------------------ST......LND
Q2UPQ3_ASPOR/9-255---------------------------------------------------------------------ST......LND
Q0CRK6_ASPTN/9-256---------------------------------------------------------------------GT......LND
A2QPC4_ASPNC/9-256---------------------------------------------------------------------ST......LND
Q5B2L7_EMENI/9-256---------------------------------------------------------------------DS......LRD
A6RDR9_AJECN/9-246---------------------------------------------------------------------PL.......ND
Q0V4X3_PHANO/9-258---------------------------------------------------------------------NKAPATSLGRD
Q2UF28_ASPOR/9-224---------------------------------------------------------------------A........EN
Q2TX92_ASPOR/9-279---------------------------------------------------------------------LEKKLTGLISQ
Q7SG51_NEUCR/8-271---------------------------------------------------------------------.........KS
Q2HFG4_CHAGB/9-276---------------------------------------------------------------------.........KS
A6RLC7_BOTFB/8-271---------------------------------------------------------------------.........KS
A2R5N4_ASPNC/9-229---------------------------------------------------------------------HE......LER
Q5K881_CRYNJ/4-176---------------------------------------------------------------------.......AWDQ
Q4PH32_USTMA/4-186---------------------------------------------------------------------.......IIKS
Q5KGB3_CRYNJ/7-189---------------------------------------------------------------------.......LLKS

PF00822

CLD7_HUMAN/4-182----MY--------------------------------------------------------------------------
CCG2_MOUSE/6-197----TH--------------------------------------------------------------------------
EMP3_HUMAN/1-156----.S--------------------------------------------------------------------------
EMP1_MOUSE/1-154----AS--------------------------------------------------------------------------
CLD1_MOUSE/4-182----IY--------------------------------------------------------------------------
CLD10_HUMAN/4-179----YW--------------------------------------------------------------------------
PMP22_HUMAN/1-153----.A--------------------------------------------------------------------------
EMP1_RABIT/1-154----AS--------------------------------------------------------------------------
LMIP_BOVIN/1-157----AH--------------------------------------------------------------------------
EMP2_MOUSE/1-165----.S--------------------------------------------------------------------------
CLD7B_DANRE/4-182----MY--------------------------------------------------------------------------
EMP1_HUMAN/1-151----AS--------------------------------------------------------------------------
EMP2_HUMAN/1-160----.F--------------------------------------------------------------------------

PF13903

TM235_HUMAN/16-197....SH--------------------------------------------------------------------------
TM235_MOUSE/16-192....SH--------------------------------------------------------------------------
B4Q2K5_DROYA/16-232....RT--------------------------------------------------------------------------
TM182_XENTR/15-225....HH--------------------------------------------------------------------------
Q16RP0_AEDAE/16-235....RT--------------------------------------------------------------------------
TM182_MOUSE/15-220....HH--------------------------------------------------------------------------
D2HQ99_AILME/17-198....AH--------------------------------------------------------------------------
A7SGP9_NEMVE/19-204....KT--------------------------------------------------------------------------
B4NZC2_DROYA/16-190....TN--------------------------------------------------------------------------
Q1L8R4_DANRE/69-258....AH--------------------------------------------------------------------------
B0WVP8_CULQU/16-190....HN--------------------------------------------------------------------------
B4H3C9_DROPE/44-223......--------------------------------------------------------------------------
B4KVB2_DROMO/40-219....DK--------------------------------------------------------------------------
Q17AR2_AEDAE/35-214....DR--------------------------------------------------------------------------
Q6E5P4_TAKRU/18-198....AW--------------------------------------------------------------------------
Q5DCP0_SCHJA/66-231....QI--------------------------------------------------------------------------
B0WVM7_CULQU/17-198....SG--------------------------------------------------------------------------
C1BSD7_9MAXI/17-200....SD--------------------------------------------------------------------------
B4NIE2_DROWI/17-198Y.GNQH--------------------------------------------------------------------------
B4HC72_DROPE/17-198Y.GNQH--------------------------------------------------------------------------
A9VEC0_MONBE/368-521....EP--------------------------------------------------------------------------
B3LY06_DROAN/17-198....TE--------------------------------------------------------------------------
TMM47_XENTR/28-170......--------------------------------------------------------------------------
TM225_HUMAN/18-160....NH--------------------------------------------------------------------------
A8Q053_BRUMA/17-199....VY--------------------------------------------------------------------------
B4K6W4_DROMO/17-198......--------------------------------------------------------------------------
A6H7D9_BOVIN/18-203....GT--------------------------------------------------------------------------
B4MC21_DROVI/17-198Y.GQHH--------------------------------------------------------------------------
B7QNM3_IXOSC/25-197....TF--------------------------------------------------------------------------
B5X0V8_SALSA/21-162......--------------------------------------------------------------------------
A7SYX5_NEMVE/51-211....CY--------------------------------------------------------------------------
B3P1Z4_DROER/17-198....TE--------------------------------------------------------------------------
A9V5F7_MONBE/26-226....SR--------------------------------------------------------------------------
B4I3M6_DROSE/17-198....VR--------------------------------------------------------------------------
Q16T28_AEDAE/17-198GGQKH.--------------------------------------------------------------------------
B4QV06_DROSI/17-198....DD--------------------------------------------------------------------------
B4PTR2_DROYA/17-198....TS--------------------------------------------------------------------------

PF07062

O45670_CAEEL/8-219----AE--------------------------------------------------------------------------
A8XPM2_CAEBR/9-213----RY--------------------------------------------------------------------------
A8XPM1_CAEBR/5-202----QW--------------------------------------------------------------------------
A8XPW0_CAEBR/10-221----SI--------------------------------------------------------------------------
Q18135_CAEEL/11-221----AT--------------------------------------------------------------------------

PF10242

Q7PMA1_ANOGA/11-202----PS--------------------------------------------------------------------------
LHPL4_RAT/22-200----GY--------------------------------------------------------------------------
LHPL3_XENLA/22-199----GY--------------------------------------------------------------------------
TMHS_RAT/25-202----GY--------------------------------------------------------------------------
TMHS_CHICK/25-202----GY--------------------------------------------------------------------------
Q4STB3_TETNG/22-199----GY--------------------------------------------------------------------------
Q4TFH6_TETNG/25-207----GR--------------------------------------------------------------------------
Q178A0_AEDAE/25-199----GR--------------------------------------------------------------------------
Q2M056_DROPS/25-199----GR--------------------------------------------------------------------------
Q9XVU1_CAEEL/19-183----GY--------------------------------------------------------------------------
LHPL2_HUMAN/9-204----PT--------------------------------------------------------------------------
Q4S279_TETNG/9-201----PT--------------------------------------------------------------------------
Q568B9_DANRE/9-197----RT--------------------------------------------------------------------------
Q4RUW4_TETNG/9-195----PS--------------------------------------------------------------------------
Q9W0X9_DROME/9-195----SS--------------------------------------------------------------------------
Q292M2_DROPS/9-197----SS--------------------------------------------------------------------------
LHFP_MOUSE/8-193----VS--------------------------------------------------------------------------
LHPL1_RAT/8-192----VS--------------------------------------------------------------------------

PF06653

Q8ITZ9_CAEEL/47-208...KKE--------------------------------------------------------------------------
Q9TZ35_CAEEL/1-155...KIQ--------------------------------------------------------------------------
A8WY95_CAEBR/1-161...RLQ--------------------------------------------------------------------------
A8XQE4_CAEBR/1-163......--------------------------------------------------------------------------
A8WYV7_CAEBR/1-134...LFK--------------------------------------------------------------------------
A8WK96_CAEBR/1-140....GA--------------------------------------------------------------------------
A8XRC8_CAEBR/1-182TNGGKP--------------------------------------------------------------------------
A8XQE5_CAEBR/1-150......--------------------------------------------------------------------------
Q9XUZ7_CAEEL/1-168......--------------------------------------------------------------------------
Q2WF57_CAEEL/1-166...KFS--------------------------------------------------------------------------
O45515_CAEEL/1-161......--------------------------------------------------------------------------
A8XR11_CAEBR/1-188LIDDDE--------------------------------------------------------------------------
B6IEW4_CAEBR/1-156....LE--------------------------------------------------------------------------
Q95YB5_CAEEL/1-123......--------------------------------------------------------------------------
A8WK67_CAEBR/1-167...YQS--------------------------------------------------------------------------
Q95XC2_CAEEL/1-191.DSKQH--------------------------------------------------------------------------
B6IFT2_CAEBR/1-179.....G--------------------------------------------------------------------------
A8XQE6_CAEBR/1-167.GYSIS--------------------------------------------------------------------------
B6IEW3_CAEBR/1-114......--------------------------------------------------------------------------
A8XWG5_CAEBR/1-169.IRALT--------------------------------------------------------------------------
O45334_CAEEL/1-161......--------------------------------------------------------------------------
A8WY98_CAEBR/1-166.YDGNY--------------------------------------------------------------------------
B6IKT5_CAEBR/1-215ELYFIR--------------------------------------------------------------------------
B6IKT4_CAEBR/1-120......--------------------------------------------------------------------------

PF07344

A4I9X4_LEIIN/377-531..PLCI--------------------------------------------------------------------------
A4HBJ2_LEIBR/15-170..TRCL--------------------------------------------------------------------------
A4H6C8_LEIBR/15-170..TPCL--------------------------------------------------------------------------
Q4Q3F7_LEIMA/15-171..SVCI--------------------------------------------------------------------------
A4H5H1_LEIBR/15-170..TPCI--------------------------------------------------------------------------
A4HBJ0_LEIBR/15-171..TTVT--------------------------------------------------------------------------
Q7KPY0_LEIBR/5-180SKLSCV--------------------------------------------------------------------------
A4HB47_LEIBR/18-199..GSCL--------------------------------------------------------------------------
A4I9X2_LEIIN/15-169EGTLCF--------------------------------------------------------------------------
Q4Q339_LEIMA/15-170GVAQCL--------------------------------------------------------------------------
Q27227_TRYCR/14-171GNTPCI--------------------------------------------------------------------------
Q4E0S1_TRYCC/20-182SKLSCV--------------------------------------------------------------------------
Q4Q3A7_LEIMA/14-189YNGYCV--------------------------------------------------------------------------
A4HAZ8_LEIBR/15-170..VPCL--------------------------------------------------------------------------
Q4QIA0_LEIMA/15-170..RVCI--------------------------------------------------------------------------
Q4Q8C7_LEIMA/145-338...GCY--------------------------------------------------------------------------
Q585K0_TRYB2/9-167TKEAIQ--------------------------------------------------------------------------
A4H5D1_LEIBR/15-173..NHCI--------------------------------------------------------------------------
Q9GU51_LEIIN/15-171..TPCI--------------------------------------------------------------------------
A4HB02_LEIBR/15-170IFRACF--------------------------------------------------------------------------
A4H5G6_LEIBR/15-171..TTVT--------------------------------------------------------------------------
A4I9W9_LEIIN/15-171YPTICL--------------------------------------------------------------------------
A4HDL4_LEIBR/18-168..KMCY--------------------------------------------------------------------------
Q4QHJ3_LEIMA/241-414TTSLKI--------------------------------------------------------------------------
A4HAJ6_LEIBR/28-184..TTVV--------------------------------------------------------------------------
E9AG83_LEIIN/15-171..SLCI--------------------------------------------------------------------------
A4H7D7_LEIBR/15-172.PDRCY--------------------------------------------------------------------------
A4I4J2_LEIIN/15-171..SACV--------------------------------------------------------------------------
Q4QAK7_LEIMA/19-166...GCY--------------------------------------------------------------------------
Q4QI88_LEIMA/15-171..TPCL--------------------------------------------------------------------------
A4HBJ1_LEIBR/15-170NFPGCL--------------------------------------------------------------------------
A4HGJ1_LEIBR/143-338...SCY--------------------------------------------------------------------------
Q4Q3A8_LEIMA/18-199..DPCL--------------------------------------------------------------------------
A4HI41_LEIBR/20-195SKLACV--------------------------------------------------------------------------
A4HDI3_LEIBR/87-236..PGCF--------------------------------------------------------------------------
A4I4J3_LEIIN/81-236..RVCV--------------------------------------------------------------------------
E9AHT2_LEIIN/15-171..HFCI--------------------------------------------------------------------------
E9AG85_LEIIN/15-170..RVCI--------------------------------------------------------------------------
Q4Q327_LEIMA/15-169FDTSCI--------------------------------------------------------------------------
A4HTM4_LEIIN/15-171..TPCL--------------------------------------------------------------------------
Q4Q8C6_LEIMA/374-525...ACF--------------------------------------------------------------------------
Q4Q397_LEIMA/79-235..HVCV--------------------------------------------------------------------------
A4IAL7_LEIIN/15-170...GCY--------------------------------------------------------------------------
A4H5G0_LEIBR/15-170..TPCI--------------------------------------------------------------------------
A4H606_LEIBR/64-214...GKW--------------------------------------------------------------------------
Q4Q317_LEIMA/15-172.LMVCI--------------------------------------------------------------------------
A4I0W5_LEIIN/18-168..RTCY--------------------------------------------------------------------------
A4I9W8_LEIIN/77-234.PNPCY--------------------------------------------------------------------------
A4H5D2_LEIBR/15-171..DYCL--------------------------------------------------------------------------
A4H5G5_LEIBR/226-381VVNGYY--------------------------------------------------------------------------
A4I9X1_LEIIN/15-170FVGQCI--------------------------------------------------------------------------
Q384H4_TRYB2/118-295...ACF--------------------------------------------------------------------------
Q4CVL1_TRYCC/26-174.PGTCY--------------------------------------------------------------------------
A4I5B9_LEIIN/26-190ELNPCF--------------------------------------------------------------------------
A4I0W4_LEIIN/18-166..SGCY--------------------------------------------------------------------------
A4I9X0_LEIIN/31-188..LICI--------------------------------------------------------------------------
A4IAM2_LEIIN/15-170..RPCV--------------------------------------------------------------------------
A4I9R7_LEIIN/15-171..HFCL--------------------------------------------------------------------------
A4HAL2_LEIBR/14-189TNGYCI--------------------------------------------------------------------------
Q4DU87_TRYCC/14-171LTDPCV--------------------------------------------------------------------------
Q4Q309_LEIMA/15-169VNTSCI--------------------------------------------------------------------------
A4H9E8_LEIBR/48-205.EVVVT--------------------------------------------------------------------------
A4HI43_LEIBR/25-189VINPCY--------------------------------------------------------------------------
Q4Q6L8_LEIMA/15-171..RLCL--------------------------------------------------------------------------
A4HB00_LEIBR/15-170NITGCM--------------------------------------------------------------------------
A4I6E5_LEIIN/15-171..RVCV--------------------------------------------------------------------------
A4H605_LEIBR/152-298...RKY--------------------------------------------------------------------------
A4H9E9_LEIBR/15-171..RMCV--------------------------------------------------------------------------
A4HAJ4_LEIBR/51-207DVAVVT--------------------------------------------------------------------------
A4H5G7_LEIBR/15-171..ATVT--------------------------------------------------------------------------
Q4QHJ4_LEIMA/134-280...RKY--------------------------------------------------------------------------
A4HGF8_LEIBR/158-312YNERTF--------------------------------------------------------------------------
Q4Q1U9_LEIMA/15-169LPTLCI--------------------------------------------------------------------------
A4IAM1_LEIIN/15-170..RPCV--------------------------------------------------------------------------
Q4QI87_LEIMA/15-171..TPCL--------------------------------------------------------------------------
Q384H3_TRYB2/301-450...GCY--------------------------------------------------------------------------

PF07803

GSG1_HUMAN/8-118----FV--------------------------------------------------------------------------
GSG1L_HUMAN/2-133----CQ--------------------------------------------------------------------------
Q4SN53_TETNG/4-143----CE--------------------------------------------------------------------------
Q4SCG5_TETNG/5-121----CV--------------------------------------------------------------------------
GSG1L_DANRE/2-113----CE--------------------------------------------------------------------------
Q4S7Q6_TETNG/2-112----CV--------------------------------------------------------------------------
GSG1L_XENTR/2-125----CE--------------------------------------------------------------------------
Q4SAX5_TETNG/2-120----CE--------------------------------------------------------------------------

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257--------------------------------------------------------------------------------
A1DMY3_NEOFI/52-247--------------------------------------------------------------------------------
A3LV03_PICST/62-245--------------------------------------------------------------------------------
A5E535_LODEL/80-252--------------------------------------------------------------------------------
A7EL23_SCLS1/52-241--------------------------------------------------------------------------------
A7TJZ8_VANPO/66-260--------------------------------------------------------------------------------
B5VE06_YEAS6/60-260--------------------------------------------------------------------------------
B6HGM8_PENCW/52-252--------------------------------------------------------------------------------
B8MZW1_ASPFN/73-257--------------------------------------------------------------------------------
B8NY21_ASPFN/72-267--------------------------------------------------------------------------------
B9WIK5_CANDC/65-244--------------------------------------------------------------------------------
C0NA65_AJECG/81-270--------------------------------------------------------------------------------
C0SH54_PARBP/74-258--------------------------------------------------------------------------------
C1G9K9_PARBD/72-262--------------------------------------------------------------------------------
C4JX23_UNCRE/51-235--------------------------------------------------------------------------------
C4QXD3_PICPG/65-260--------------------------------------------------------------------------------
C4YC02_CLAL4/51-224--------------------------------------------------------------------------------
C5DEC8_LACTC/64-258--------------------------------------------------------------------------------
C5DPI4_ZYGRC/66-266--------------------------------------------------------------------------------
C5G079_ARTOC/74-258--------------------------------------------------------------------------------
C5M8V3_CANTT/127-303--------------------------------------------------------------------------------
YEJ7_SCHPO/33-201--------------------------------------------------------------------------------
Q0CSC3_ASPTN/220-409--------------------------------------------------------------------------------
Q0U808_PHANO/74-259--------------------------------------------------------------------------------
Q0V1Y2_PHANO/45-209--------------------------------------------------------------------------------
Q59WR6_CANAL/68-244--------------------------------------------------------------------------------
Q6BL79_DEBHA/62-241--------------------------------------------------------------------------------
Q6CH13_YARLI/62-243--------------------------------------------------------------------------------
Q6CW51_KLULA/66-265--------------------------------------------------------------------------------
Q6FQP2_CANGA/65-266--------------------------------------------------------------------------------
Q870W5_NEUCS/62-268--------------------------------------------------------------------------------
YNB1_SCHPO/52-216--------------------------------------------------------------------------------

PF06687

Q4WWY3_ASPFU/5-166IPLATF.NH.......................................................................
Q75E26_ASHGO/7-202FYWLEA.NTSNFN...................................................................
Q757N9_ASHGO/7-167LGLADA.DG.......................................................................
A5DJU1_PICGU/4-217LFLSEF.ND.......................................................................
PALI_DEBHA/4-238LHLSKY.GN.......................................................................
Q0V6X2_PHANO/4-166IPIATY.RG.......................................................................
Q6BIN6_DEBHA/7-162FGLGST.SS.......................................................................
A5DHH0_PICGU/5-162FALGQT.TS.......................................................................
Q6C1Y6_YARLI/7-199FYWLEA.ETSNIP...................................................................
Q6BLL9_DEBHA/5-198FYWIKA.DTSSIS...................................................................
A5DC91_PICGU/5-198FYWLKA.DTSSIS...................................................................
Q6BME8_DEBHA/24-312IYIARI.NCARLDVARGLYNSLRSSVSLSSSILGDSED..........................................
A5DG26_PICGU/5-318IYLIDV.HLSGLKLSKLFDVNNFKRELPPLVNEALILE..........................................
MAC1_SCHPO/6-177MTLAKV.EG.......................................................................
PALI2_KLULA/3-167LYISEY.NG.......................................................................
PALI1_KLULA/4-168LFISEY.NG.......................................................................
PALI_ASHGO/5-170VTLSHF.NG.......................................................................
PALI_CANGA/6-170LILGQY.MG.......................................................................
A7TPS6_VANPO/6-170LMLSQL.DG.......................................................................
PALI_YARLI/7-167ISLGSY.QD.......................................................................
A6ZMC2_YEAS7/4-169LSLSSF.RN.......................................................................
PALI_CANAL/4-232IYLSYY.NN.......................................................................
A5E4Z6_LODEL/4-205IYLSCF.EN.......................................................................
A3LUV8_PICST/4-233IYLSSY.RN.......................................................................
A6SN30_BOTFB/4-166IPLASF.DG.......................................................................
PALI_MAGO7/4-169IPLGEY.VG.......................................................................
Q2H463_CHAGB/4-183IPLGSWLKE.......................................................................
PALI_NEUCR/4-175IPLSSF.EIKDVG...................................................................
Q0CX64_ASPTN/5-167IPLATF.KN.......................................................................
A2QF35_ASPNC/5-165IALARH.DN.......................................................................
A6R830_AJECN/5-168IPIATV.DD.......................................................................
MUG33_SCHPO/5-166LTLGKYGD........................................................................
Q4P8U5_USTMA/5-204TRLDGVVDLSPNSNRDR...............................................................
A3LTF9_PICST/7-165FALSKT.SD.......................................................................
A5DUT6_LODEL/7-165FNLGKT.AT.......................................................................
Q5ALR6_CANAL/7-166FALSKT.SD.......................................................................
A6ZNI8_YEAS7/5-176IGYSKY.DE.......................................................................
A7TT16_VANPO/7-179IGLSKY.NN.......................................................................
Q6CX71_KLULA/9-171VRLASF.DG.......................................................................
Q6FSP2_CANGA/9-169IGLAKS.NG.......................................................................
A7A250_YEAS7/7-175WGLAQA.AG.......................................................................
A1CFA3_ASPCL/8-205IYWLQA.DTSNIP...................................................................
A2QNP6_ASPNC/8-205IFFLQV.DTSNIP...................................................................
A6R6X6_AJECN/8-204TWFLEA.DTSNIP...................................................................
Q0V6H1_PHANO/8-203FYFLEA.STNGIP...................................................................
Q5AH49_CANAL/4-201FYWSET.DTSGLT...................................................................
A5E7B2_LODEL/4-201FYWSET.DTSGIQ...................................................................
A5DAF8_PICGU/6-205FYWSEA.ETSSIS...................................................................
Q5A4M8_CANAL/5-199FYWLEA.DTSGIK...................................................................
A3LV33_PICST/5-198FYWVSA.DTSNIS...................................................................
SUR7_YEAST/9-206FYWVQG.NTTGIP...................................................................
A7TH74_VANPO/9-205FYWVEG.NTSGIP...................................................................
Q753Q0_ASHGO/8-202LYWLRA.QTDGFN...................................................................
Q6CXH5_KLULA/9-205FYWLQA.DTSNIT...................................................................
Q2H574_CHAGB/3-201TYFLRA.DTSGIE...................................................................
Q7SI65_NEUCR/8-206TYFLRA.DTSGIS...................................................................
A6SND7_BOTFB/8-206TQFLSA.DTSSIA...................................................................
A7EBS7_SCLS1/8-206THFLRA.DTSSIA...................................................................
Q6FT41_CANGA/7-205FYWFEA.DTSGFN...................................................................
A7TIB3_VANPO/11-209FYWLEA.DTSGFN...................................................................
Q6CJ71_KLULA/7-204FYWFEA.DTSGLP...................................................................
FMP45_YEAST/7-205FYWLQA.DTNGFN...................................................................
YNT4_YEAST/7-206FYWFQA.STSGFN...................................................................
A7TTI2_VANPO/7-207FYWFDA.NTSGIG...................................................................
Q55HH6_CRYNB/6-242IYMAEV.NVAAYGNGFQGGTNTSASG......................................................
Q4PHQ4_USTMA/26-258IRYVSV.DTSGLGDALSRSGRSVSN.......................................................
PUN1_YEAST/6-240IYCAEL.DLSQMKVSTVLPSL...........................................................
Q6FPE4_CANGA/6-240IFCAQL.DLSNLDIATVIPAA...........................................................
A7TGC8_VANPO/6-240IYVAQL.NLRKIKQDTVFDK............................................................
Q6CWP2_KLULA/5-243IYVAQI.DISNISFSTVLGADLP.........................................................
Q59US7_CANAL/25-311TYAARI.NCSHLDVANGLYESLRNSVTQVFTPAIFNDQ..........................................
A5E006_LODEL/6-375TYLINF.HLDGLDLRQIISTSIGSGSRKIKRADTTATATATVSTGTTFSTSSNTGLA.......................
A5E421_LODEL/6-397TYLINF.HLDGLDLRQIISTSVGSGSNKIKKRAQDTEATATATATPTTTTGGLQLPSQVNSWIGVATSYINQPGF.....
Q6BMS1_DEBHA/5-319IYLLDF.HLTDLDVSQLIDFNGFSKRDTIHPDSKRDTILPGRT.....................................
A3LZK7_PICST/5-323TYLVNV.HLTSLNTSALINMAASGANIQKRATSTIPQVAAVWQ.....................................
Q5ADV0_CANAL/6-394TYLINF.HIDSLDLTKLIDSSRITKRDGVGSKMVSINPRQGTPTKRAPAESGWYYVPGGSNTQSGPSATASSGGNAVASG
Q2UBQ3_ASPOR/26-275TWFLKI.DLSNI.IPLSVPNAV..........................................................
A2QQ39_ASPNC/26-275TYFLEI.NLANI.IPLSTPNAV..........................................................
Q5BDP9_EMENI/26-276TYFLKI.DLSDI.IPLSVPNAV..........................................................
Q0CQ07_ASPTN/27-276TYFLKI.DLSNI.IPLSVPNAV..........................................................
YDO9_SCHPO/12-275IYFIQL.NTTSIFSVANQTAVVNNTSNLLNELTGTLV...........................................
Q0TZ73_PHANO/4-276YHLLTL.NTSLLGETLLSESRPTDTSNPLTNLL...............................................
Q7SFF9_NEUCR/5-286LVYNQL.SDNQPGSEADGVCEKLGFLSKA...................................................
A1DME7_NEOFI/9-255LYFFRA.NLQNLTTSSSVTSAVNSALESAGV.................................................
Q2UPQ3_ASPOR/9-255LYFFRA.DLQNMTTTATNQSTISQALSDAGV.................................................
Q0CRK6_ASPTN/9-256LYFFRA.NLQNITSNSSSVTSEVTNALEDAGV................................................
A2QPC4_ASPNC/9-256LYFFRA.NLKNITSEASSTASTVSSVVSDLT.................................................
Q5B2L7_EMENI/9-256LYFFRA.DLQDLNSSAPIQNSVSSVLDDLNI.................................................
A6RDR9_AJECN/9-246IYFVKA.DLKDLNLNSKGFPQELLP.......................................................
Q0V4X3_PHANO/9-258LYFFKA.DTSAFQADSDSLLDNIADSVNI...................................................
Q2UF28_ASPOR/9-224LYFLRF.......IQALDE.............................................................
Q2TX92_ASPOR/9-279RSVFDD.SLAAVAETTSDVSSTLQDTSNTAQNE...............................................
Q7SG51_NEUCR/8-271MYMFDV.NLSNFSISLADAGELLNLNESSILKAGAQQIFGR.......................................
Q2HFG4_CHAGB/9-276LYMFRV.NVTDLSLSPASVSRILEGTGFNAPSFDDIDLPDVDL.....................................
A6RLC7_BOTFB/8-271LDIFAV.NTTNLSISSSALLSLENSFRKRGLADLTVAALTPST.....................................
A2R5N4_ASPNC/9-229LNFFQL.DVQNSRNISTSNALV..........................................................
Q5K881_CRYNJ/4-176VGFLTT.TAGTTK...................................................................
Q4PH32_USTMA/4-186IYFLEA.TIGGNGPQS................................................................
Q5KGB3_CRYNJ/7-189LYFLSA.TFSSGSYE.................................................................

PF00822

CLD7_HUMAN/4-182--------------------------------------------------------------------------------
CCG2_MOUSE/6-197--------------------------------------------------------------------------------
EMP3_HUMAN/1-156--------------------------------------------------------------------------------
EMP1_MOUSE/1-154--------------------------------------------------------------------------------
CLD1_MOUSE/4-182--------------------------------------------------------------------------------
CLD10_HUMAN/4-179--------------------------------------------------------------------------------
PMP22_HUMAN/1-153--------------------------------------------------------------------------------
EMP1_RABIT/1-154--------------------------------------------------------------------------------
LMIP_BOVIN/1-157--------------------------------------------------------------------------------
EMP2_MOUSE/1-165--------------------------------------------------------------------------------
CLD7B_DANRE/4-182--------------------------------------------------------------------------------
EMP1_HUMAN/1-151--------------------------------------------------------------------------------
EMP2_HUMAN/1-160--------------------------------------------------------------------------------

PF13903

TM235_HUMAN/16-197--------------------------------------------------------------------------------
TM235_MOUSE/16-192--------------------------------------------------------------------------------
B4Q2K5_DROYA/16-232--------------------------------------------------------------------------------
TM182_XENTR/15-225--------------------------------------------------------------------------------
Q16RP0_AEDAE/16-235--------------------------------------------------------------------------------
TM182_MOUSE/15-220--------------------------------------------------------------------------------
D2HQ99_AILME/17-198--------------------------------------------------------------------------------
A7SGP9_NEMVE/19-204--------------------------------------------------------------------------------
B4NZC2_DROYA/16-190--------------------------------------------------------------------------------
Q1L8R4_DANRE/69-258--------------------------------------------------------------------------------
B0WVP8_CULQU/16-190--------------------------------------------------------------------------------
B4H3C9_DROPE/44-223--------------------------------------------------------------------------------
B4KVB2_DROMO/40-219--------------------------------------------------------------------------------
Q17AR2_AEDAE/35-214--------------------------------------------------------------------------------
Q6E5P4_TAKRU/18-198--------------------------------------------------------------------------------
Q5DCP0_SCHJA/66-231--------------------------------------------------------------------------------
B0WVM7_CULQU/17-198--------------------------------------------------------------------------------
C1BSD7_9MAXI/17-200--------------------------------------------------------------------------------
B4NIE2_DROWI/17-198--------------------------------------------------------------------------------
B4HC72_DROPE/17-198--------------------------------------------------------------------------------
A9VEC0_MONBE/368-521--------------------------------------------------------------------------------
B3LY06_DROAN/17-198--------------------------------------------------------------------------------
TMM47_XENTR/28-170--------------------------------------------------------------------------------
TM225_HUMAN/18-160--------------------------------------------------------------------------------
A8Q053_BRUMA/17-199--------------------------------------------------------------------------------
B4K6W4_DROMO/17-198--------------------------------------------------------------------------------
A6H7D9_BOVIN/18-203--------------------------------------------------------------------------------
B4MC21_DROVI/17-198--------------------------------------------------------------------------------
B7QNM3_IXOSC/25-197--------------------------------------------------------------------------------
B5X0V8_SALSA/21-162--------------------------------------------------------------------------------
A7SYX5_NEMVE/51-211--------------------------------------------------------------------------------
B3P1Z4_DROER/17-198--------------------------------------------------------------------------------
A9V5F7_MONBE/26-226--------------------------------------------------------------------------------
B4I3M6_DROSE/17-198--------------------------------------------------------------------------------
Q16T28_AEDAE/17-198--------------------------------------------------------------------------------
B4QV06_DROSI/17-198--------------------------------------------------------------------------------
B4PTR2_DROYA/17-198--------------------------------------------------------------------------------

PF07062

O45670_CAEEL/8-219--------------------------------------------------------------------------------
A8XPM2_CAEBR/9-213--------------------------------------------------------------------------------
A8XPM1_CAEBR/5-202--------------------------------------------------------------------------------
A8XPW0_CAEBR/10-221--------------------------------------------------------------------------------
Q18135_CAEEL/11-221--------------------------------------------------------------------------------

PF10242

Q7PMA1_ANOGA/11-202--------------------------------------------------------------------------------
LHPL4_RAT/22-200--------------------------------------------------------------------------------
LHPL3_XENLA/22-199--------------------------------------------------------------------------------
TMHS_RAT/25-202--------------------------------------------------------------------------------
TMHS_CHICK/25-202--------------------------------------------------------------------------------
Q4STB3_TETNG/22-199--------------------------------------------------------------------------------
Q4TFH6_TETNG/25-207--------------------------------------------------------------------------------
Q178A0_AEDAE/25-199--------------------------------------------------------------------------------
Q2M056_DROPS/25-199--------------------------------------------------------------------------------
Q9XVU1_CAEEL/19-183--------------------------------------------------------------------------------
LHPL2_HUMAN/9-204--------------------------------------------------------------------------------
Q4S279_TETNG/9-201--------------------------------------------------------------------------------
Q568B9_DANRE/9-197--------------------------------------------------------------------------------
Q4RUW4_TETNG/9-195--------------------------------------------------------------------------------
Q9W0X9_DROME/9-195--------------------------------------------------------------------------------
Q292M2_DROPS/9-197--------------------------------------------------------------------------------
LHFP_MOUSE/8-193--------------------------------------------------------------------------------
LHPL1_RAT/8-192--------------------------------------------------------------------------------

PF06653

Q8ITZ9_CAEEL/47-208--------------------------------------------------------------------------------
Q9TZ35_CAEEL/1-155--------------------------------------------------------------------------------
A8WY95_CAEBR/1-161--------------------------------------------------------------------------------
A8XQE4_CAEBR/1-163--------------------------------------------------------------------------------
A8WYV7_CAEBR/1-134--------------------------------------------------------------------------------
A8WK96_CAEBR/1-140--------------------------------------------------------------------------------
A8XRC8_CAEBR/1-182--------------------------------------------------------------------------------
A8XQE5_CAEBR/1-150--------------------------------------------------------------------------------
Q9XUZ7_CAEEL/1-168--------------------------------------------------------------------------------
Q2WF57_CAEEL/1-166--------------------------------------------------------------------------------
O45515_CAEEL/1-161--------------------------------------------------------------------------------
A8XR11_CAEBR/1-188--------------------------------------------------------------------------------
B6IEW4_CAEBR/1-156--------------------------------------------------------------------------------
Q95YB5_CAEEL/1-123--------------------------------------------------------------------------------
A8WK67_CAEBR/1-167--------------------------------------------------------------------------------
Q95XC2_CAEEL/1-191--------------------------------------------------------------------------------
B6IFT2_CAEBR/1-179--------------------------------------------------------------------------------
A8XQE6_CAEBR/1-167--------------------------------------------------------------------------------
B6IEW3_CAEBR/1-114--------------------------------------------------------------------------------
A8XWG5_CAEBR/1-169--------------------------------------------------------------------------------
O45334_CAEEL/1-161--------------------------------------------------------------------------------
A8WY98_CAEBR/1-166--------------------------------------------------------------------------------
B6IKT5_CAEBR/1-215--------------------------------------------------------------------------------
B6IKT4_CAEBR/1-120--------------------------------------------------------------------------------

PF07344

A4I9X4_LEIIN/377-531--------------------------------------------------------------------------------
A4HBJ2_LEIBR/15-170--------------------------------------------------------------------------------
A4H6C8_LEIBR/15-170--------------------------------------------------------------------------------
Q4Q3F7_LEIMA/15-171--------------------------------------------------------------------------------
A4H5H1_LEIBR/15-170--------------------------------------------------------------------------------
A4HBJ0_LEIBR/15-171--------------------------------------------------------------------------------
Q7KPY0_LEIBR/5-180--------------------------------------------------------------------------------
A4HB47_LEIBR/18-199--------------------------------------------------------------------------------
A4I9X2_LEIIN/15-169--------------------------------------------------------------------------------
Q4Q339_LEIMA/15-170--------------------------------------------------------------------------------
Q27227_TRYCR/14-171--------------------------------------------------------------------------------
Q4E0S1_TRYCC/20-182--------------------------------------------------------------------------------
Q4Q3A7_LEIMA/14-189--------------------------------------------------------------------------------
A4HAZ8_LEIBR/15-170--------------------------------------------------------------------------------
Q4QIA0_LEIMA/15-170--------------------------------------------------------------------------------
Q4Q8C7_LEIMA/145-338--------------------------------------------------------------------------------
Q585K0_TRYB2/9-167--------------------------------------------------------------------------------
A4H5D1_LEIBR/15-173--------------------------------------------------------------------------------
Q9GU51_LEIIN/15-171--------------------------------------------------------------------------------
A4HB02_LEIBR/15-170--------------------------------------------------------------------------------
A4H5G6_LEIBR/15-171--------------------------------------------------------------------------------
A4I9W9_LEIIN/15-171--------------------------------------------------------------------------------
A4HDL4_LEIBR/18-168--------------------------------------------------------------------------------
Q4QHJ3_LEIMA/241-414--------------------------------------------------------------------------------
A4HAJ6_LEIBR/28-184--------------------------------------------------------------------------------
E9AG83_LEIIN/15-171--------------------------------------------------------------------------------
A4H7D7_LEIBR/15-172--------------------------------------------------------------------------------
A4I4J2_LEIIN/15-171--------------------------------------------------------------------------------
Q4QAK7_LEIMA/19-166--------------------------------------------------------------------------------
Q4QI88_LEIMA/15-171--------------------------------------------------------------------------------
A4HBJ1_LEIBR/15-170--------------------------------------------------------------------------------
A4HGJ1_LEIBR/143-338--------------------------------------------------------------------------------
Q4Q3A8_LEIMA/18-199--------------------------------------------------------------------------------
A4HI41_LEIBR/20-195--------------------------------------------------------------------------------
A4HDI3_LEIBR/87-236--------------------------------------------------------------------------------
A4I4J3_LEIIN/81-236--------------------------------------------------------------------------------
E9AHT2_LEIIN/15-171--------------------------------------------------------------------------------
E9AG85_LEIIN/15-170--------------------------------------------------------------------------------
Q4Q327_LEIMA/15-169--------------------------------------------------------------------------------
A4HTM4_LEIIN/15-171--------------------------------------------------------------------------------
Q4Q8C6_LEIMA/374-525--------------------------------------------------------------------------------
Q4Q397_LEIMA/79-235--------------------------------------------------------------------------------
A4IAL7_LEIIN/15-170--------------------------------------------------------------------------------
A4H5G0_LEIBR/15-170--------------------------------------------------------------------------------
A4H606_LEIBR/64-214--------------------------------------------------------------------------------
Q4Q317_LEIMA/15-172--------------------------------------------------------------------------------
A4I0W5_LEIIN/18-168--------------------------------------------------------------------------------
A4I9W8_LEIIN/77-234--------------------------------------------------------------------------------
A4H5D2_LEIBR/15-171--------------------------------------------------------------------------------
A4H5G5_LEIBR/226-381--------------------------------------------------------------------------------
A4I9X1_LEIIN/15-170--------------------------------------------------------------------------------
Q384H4_TRYB2/118-295--------------------------------------------------------------------------------
Q4CVL1_TRYCC/26-174--------------------------------------------------------------------------------
A4I5B9_LEIIN/26-190--------------------------------------------------------------------------------
A4I0W4_LEIIN/18-166--------------------------------------------------------------------------------
A4I9X0_LEIIN/31-188--------------------------------------------------------------------------------
A4IAM2_LEIIN/15-170--------------------------------------------------------------------------------
A4I9R7_LEIIN/15-171--------------------------------------------------------------------------------
A4HAL2_LEIBR/14-189--------------------------------------------------------------------------------
Q4DU87_TRYCC/14-171--------------------------------------------------------------------------------
Q4Q309_LEIMA/15-169--------------------------------------------------------------------------------
A4H9E8_LEIBR/48-205--------------------------------------------------------------------------------
A4HI43_LEIBR/25-189--------------------------------------------------------------------------------
Q4Q6L8_LEIMA/15-171--------------------------------------------------------------------------------
A4HB00_LEIBR/15-170--------------------------------------------------------------------------------
A4I6E5_LEIIN/15-171--------------------------------------------------------------------------------
A4H605_LEIBR/152-298--------------------------------------------------------------------------------
A4H9E9_LEIBR/15-171--------------------------------------------------------------------------------
A4HAJ4_LEIBR/51-207--------------------------------------------------------------------------------
A4H5G7_LEIBR/15-171--------------------------------------------------------------------------------
Q4QHJ4_LEIMA/134-280--------------------------------------------------------------------------------
A4HGF8_LEIBR/158-312--------------------------------------------------------------------------------
Q4Q1U9_LEIMA/15-169--------------------------------------------------------------------------------
A4IAM1_LEIIN/15-170--------------------------------------------------------------------------------
Q4QI87_LEIMA/15-171--------------------------------------------------------------------------------
Q384H3_TRYB2/301-450--------------------------------------------------------------------------------

PF07803

GSG1_HUMAN/8-118--------------------------------------------------------------------------------
GSG1L_HUMAN/2-133--------------------------------------------------------------------------------
Q4SN53_TETNG/4-143--------------------------------------------------------------------------------
Q4SCG5_TETNG/5-121--------------------------------------------------------------------------------
GSG1L_DANRE/2-113--------------------------------------------------------------------------------
Q4S7Q6_TETNG/2-112--------------------------------------------------------------------------------
GSG1L_XENTR/2-125--------------------------------------------------------------------------------
Q4SAX5_TETNG/2-120--------------------------------------------------------------------------------

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257--------------------------------------------------------------------------------
A1DMY3_NEOFI/52-247--------------------------------------------------------------------------------
A3LV03_PICST/62-245--------------------------------------------------------------------------------
A5E535_LODEL/80-252--------------------------------------------------------------------------------
A7EL23_SCLS1/52-241--------------------------------------------------------------------------------
A7TJZ8_VANPO/66-260--------------------------------------------------------------------------------
B5VE06_YEAS6/60-260--------------------------------------------------------------------------------
B6HGM8_PENCW/52-252--------------------------------------------------------------------------------
B8MZW1_ASPFN/73-257--------------------------------------------------------------------------------
B8NY21_ASPFN/72-267--------------------------------------------------------------------------------
B9WIK5_CANDC/65-244--------------------------------------------------------------------------------
C0NA65_AJECG/81-270--------------------------------------------------------------------------------
C0SH54_PARBP/74-258--------------------------------------------------------------------------------
C1G9K9_PARBD/72-262--------------------------------------------------------------------------------
C4JX23_UNCRE/51-235--------------------------------------------------------------------------------
C4QXD3_PICPG/65-260--------------------------------------------------------------------------------
C4YC02_CLAL4/51-224--------------------------------------------------------------------------------
C5DEC8_LACTC/64-258--------------------------------------------------------------------------------
C5DPI4_ZYGRC/66-266--------------------------------------------------------------------------------
C5G079_ARTOC/74-258--------------------------------------------------------------------------------
C5M8V3_CANTT/127-303--------------------------------------------------------------------------------
YEJ7_SCHPO/33-201--------------------------------------------------------------------------------
Q0CSC3_ASPTN/220-409--------------------------------------------------------------------------------
Q0U808_PHANO/74-259--------------------------------------------------------------------------------
Q0V1Y2_PHANO/45-209--------------------------------------------------------------------------------
Q59WR6_CANAL/68-244--------------------------------------------------------------------------------
Q6BL79_DEBHA/62-241--------------------------------------------------------------------------------
Q6CH13_YARLI/62-243--------------------------------------------------------------------------------
Q6CW51_KLULA/66-265--------------------------------------------------------------------------------
Q6FQP2_CANGA/65-266--------------------------------------------------------------------------------
Q870W5_NEUCS/62-268--------------------------------------------------------------------------------
YNB1_SCHPO/52-216--------------------------------------------------------------------------------

PF06687

Q4WWY3_ASPFU/5-166................................................................................
Q75E26_ASHGO/7-202...............................................................Q..AP.PN.........
Q757N9_ASHGO/7-167................................................................................
A5DJU1_PICGU/4-217................................................................................
PALI_DEBHA/4-238................................................................................
Q0V6X2_PHANO/4-166................................................................................
Q6BIN6_DEBHA/7-162................................................................................
A5DHH0_PICGU/5-162................................................................................
Q6C1Y6_YARLI/7-199.................................................................GAH.DF.........
Q6BLL9_DEBHA/5-198.................................................................GAP.KM.........
A5DC91_PICGU/5-198.................................................................HAY.ST.........
Q6BME8_DEBHA/24-312......................................NVLPVDSSLTNSEIAVLTSYAENQVA.DAP.QY.........
A5DG26_PICGU/5-318......................................ERADVSSSEITTAINNIVDSLTYQEL.GLA.DV.........
MAC1_SCHPO/6-177................................................................................
PALI2_KLULA/3-167................................................................................
PALI1_KLULA/4-168................................................................................
PALI_ASHGO/5-170................................................................................
PALI_CANGA/6-170................................................................................
A7TPS6_VANPO/6-170................................................................................
PALI_YARLI/7-167................................................................................
A6ZMC2_YEAS7/4-169................................................................................
PALI_CANAL/4-232................................................................................
A5E4Z6_LODEL/4-205................................................................................
A3LUV8_PICST/4-233................................................................................
A6SN30_BOTFB/4-166................................................................................
PALI_MAGO7/4-169................................................................................
Q2H463_CHAGB/4-183................................................................................
PALI_NEUCR/4-175...............................................................D................
Q0CX64_ASPTN/5-167................................................................................
A2QF35_ASPNC/5-165................................................................................
A6R830_AJECN/5-168................................................................................
MUG33_SCHPO/5-166................................................................................
Q4P8U5_USTMA/5-204............................................................PIGA................
A3LTF9_PICST/7-165................................................................................
A5DUT6_LODEL/7-165................................................................................
Q5ALR6_CANAL/7-166................................................................................
A6ZNI8_YEAS7/5-176................................................................................
A7TT16_VANPO/7-179................................................................................
Q6CX71_KLULA/9-171................................................................................
Q6FSP2_CANGA/9-169................................................................................
A7A250_YEAS7/7-175................................................................................
A1CFA3_ASPCL/8-205...............................................................G..AP.AL.........
A2QNP6_ASPNC/8-205...............................................................G..AP.SL.........
A6R6X6_AJECN/8-204...............................................................G..AP.ET.........
Q0V6H1_PHANO/8-203...............................................................N..AR.NP.........
Q5AH49_CANAL/4-201...............................................................G..VPYNK.........
A5E7B2_LODEL/4-201...............................................................G..APQDT.........
A5DAF8_PICGU/6-205...............................................................K..ANFPK.........
Q5A4M8_CANAL/5-199...............................................................N..APANR.........
A3LV33_PICST/5-198...............................................................G..APS.R.........
SUR7_YEAST/9-206...............................................................N..AGD.E.........
A7TH74_VANPO/9-205...............................................................N..APD.I.........
Q753Q0_ASHGO/8-202...............................................................G..AFG.W.........
Q6CXH5_KLULA/9-205...............................................................G..APA.L.........
Q2H574_CHAGB/3-201...............................................................G..AR.SI.........
Q7SI65_NEUCR/8-206...............................................................G..AR.DV.........
A6SND7_BOTFB/8-206...............................................................G..AR.PV.........
A7EBS7_SCLS1/8-206...............................................................G..AR.PV.........
Q6FT41_CANGA/7-205...............................................................D..AP.DV.........
A7TIB3_VANPO/11-209...............................................................S..AP.NT.........
Q6CJ71_KLULA/7-204...............................................................G..AP.DT.........
FMP45_YEAST/7-205...............................................................S..AP.ST.........
YNT4_YEAST/7-206...............................................................S..AP.SV.........
A7TTI2_VANPO/7-207...............................................................G..IAPNK.........
Q55HH6_CRYNB/6-242..................................................LYDTNNTDHMGAFK..GLRQY.........
Q4PHQ4_USTMA/26-258....................................................LYASSASSPVGQGNGLKQD.........
PUN1_YEAST/6-240.......................................................SSATLSSLG..LP.SY.........
Q6FPE4_CANGA/6-240.......................................................SSFSISDLG..LP.KF.........
A7TGC8_VANPO/6-240.........................................................ISQDIGTDILP.GY.........
Q6CWP2_KLULA/5-243.....................................................QSTVISLDALG..VP.SY.........
Q59US7_CANAL/25-311.......................................MSGTGNSLTTSEIKLITEYAETQVA..GSPQY.........
A5E006_LODEL/6-375...................TTVASQVEAWANAASGLTSSSTTDASDIISAIADVLDNLSALELG..LA.DV.........
A5E421_LODEL/6-397.SSEVAGLATSLGTSIPSSISIPASISLPSGISLPSDLSIPTDASDLTAAIADVLNNVSPQELG..IA.DV.........
Q6BMS1_DEBHA/5-319..................................VVEKDLASSLSDIGSTISGIVNSITYEDMG..LA.QV.........
A3LZK7_PICST/5-323.................................SAQNGDISGAESSIIQTIDAAIPDISYRELG..LP.DV.........
Q5ADV0_CANAL/6-394SAINWWSPVESGSATSSGSGSGSTSSGSSGSDSSNSGSTSGGYYTTVSQAVHSLLSNVNPQVLG..MA.QV.........
Q2UBQ3_ASPOR/26-275......................................................LINSIARSIG..LH.DF.........
A2QQ39_ASPNC/26-275......................................................LIDTIARTIG..LH.DF.........
Q5BDP9_EMENI/26-276......................................................FINSIARSIG..LH.DF.........
Q0CQ07_ASPTN/27-276......................................................LINSIARSIG..LH.DF.........
YDO9_SCHPO/12-275........................................DTLETYIDQGATDLIEQVEQEMKDVSELPDW.........
Q0TZ73_PHANO/4-276...........................................NSIPNEISSAINDRIGEITARLGIE.DF.........
Q7SFF9_NEUCR/5-286...............................................CEDATGAVGDAKDDLVN..ALGDIENDIADQLA
A1DME7_NEOFI/9-255.............................................DISSSDLAKALDEAQKQLK..IK.DF.........
Q2UPQ3_ASPOR/9-255.............................................TVSDGDISAALEQVQKQFD..LK.DF.........
Q0CRK6_ASPTN/9-256.............................................SVSDGDIQSALQEVEKSFD..LK.DF.........
A2QPC4_ASPNC/9-256.............................................GVSDGDLSAALEEIEEQYN..IE.DF.........
Q5B2L7_EMENI/9-256.............................................SVDDGDLGSALEEVEQYFN..IP.DF.........
A6RDR9_AJECN/9-246...................................................FTNSLQQADGSGK..LH.DF.........
Q0V4X3_PHANO/9-258................................................DNNLLNALQGGAKSGE..LK.AF.........
Q2UF28_ASPOR/9-224..........................................................VNNTTG..LN.DF.........
Q2TX92_ASPOR/9-279...........................................GNDAIDGVMEAVGNAVDEAKN..QAQDVSDKLAKI..
Q7SG51_NEUCR/8-271...................................DVEATTIDDLTKRDDSNGGLTNLTASLLG..FY.DI.........
Q2HFG4_CHAGB/9-276.................................PDLSKIDIPDINIDVGKRQSQTENITAADLG..LY.DL.........
A6RLC7_BOTFB/8-271..................................TTSEKSTIESAIASITGTDSATNITAKDLD..LA.DS.........
A2R5N4_ASPNC/9-229.......................................................TTWDESQFN.....KT.........
Q5K881_CRYNJ/4-176................................................................................
Q4PH32_USTMA/4-186.............................................................GQV................
Q5KGB3_CRYNJ/7-189..............................................................GT................

PF00822

CLD7_HUMAN/4-182--------K--G--L-WMDCVT-----------------------------------------------QS.--------
CCG2_MOUSE/6-197--------S--G--L-WRTCCL-----------------------------------------------EG.--------
EMP3_HUMAN/1-156--------L--N--L-WYDCTW-----------------------------------------------NND--------
EMP1_MOUSE/1-154--------V--G--L-WKNCTG-----------------------------------------------GNC--------
CLD1_MOUSE/4-182--------E--G--L-WMSCVS-----------------------------------------------QS.--------
CLD10_HUMAN/4-179--------A--N--L-WKACVT-----------------------------------------------DS.--------
PMP22_HUMAN/1-153--------T--D--L-WQNCST-----------------------------------------------SSS--------
EMP1_RABIT/1-154--------V--G--L-WRNCTS-----------------------------------------------GDC--------
LMIP_BOVIN/1-157--------Q--G--L-WRYCLG-----------------------------------------------TKC--------
EMP2_MOUSE/1-165--------A--D--L-WRVCTN-----------------------------------------------STN--------
CLD7B_DANRE/4-182--------Q--G--L-WMSCAY-----------------------------------------------QS.--------
EMP1_HUMAN/1-151--------V--G--L-WKNCTN-----------------------------------------------ISC--------
EMP2_HUMAN/1-160--------A--D--V-WRICTN-----------------------------------------------NTN--------

PF13903

TM235_HUMAN/16-197--------S..G--L.WRIC..-----------------------------------------------.EG--------
TM235_MOUSE/16-192--------S..G--L.WRTCEG-----------------------------------------------QNS--------
B4Q2K5_DROYA/16-232--------R..G--L.FRICYP-----------------------------------------------KER--------
TM182_XENTR/15-225--------E..G--F.FWRCWF-----------------------------------------------NHA--------
Q16RP0_AEDAE/16-235--------R..G--L.FRYCYP-----------------------------------------------KEK--------
TM182_MOUSE/15-220--------E..G--F.FWRCWF-----------------------------------------------SGV--------
D2HQ99_AILME/17-198--------F..G--L.WRICTK-----------------------------------------------RIV--------
A7SGP9_NEMVE/19-204--------F..G--L.FKGTSS-----------------------------------------------KDY--------
B4NZC2_DROYA/16-190--------L..G--L.WEVCFN-----------------------------------------------NFQ--------
Q1L8R4_DANRE/69-258--------Y..G--L.WKCCTK-----------------------------------------------TIE--------
B0WVP8_CULQU/16-190--------L..G--L.WELCLN-----------------------------------------------DFQ--------
B4H3C9_DROPE/44-223--------....--........-----------------------------------------------.DS--------
B4KVB2_DROMO/40-219--------L..G--L.WVHCFR-----------------------------------------------SLP--------
Q17AR2_AEDAE/35-214--------L..G--L.WTHCFR-----------------------------------------------SLP--------
Q6E5P4_TAKRU/18-198--------V..G--I.WRACFY-----------------------------------------------SHV--------
Q5DCP0_SCHJA/66-231--------N..E--I.ERICHL-----------------------------------------------RDL--------
B0WVM7_CULQU/17-198--------Q...--......KH-----------------------------------------------LNV--------
C1BSD7_9MAXI/17-200--------I..M--F.HEQKFM-----------------------------------------------NR.--------
B4NIE2_DROWI/17-198--------LNPG--FGVRTYQV-----------------------------------------------DVY--------
B4HC72_DROPE/17-198--------LNLG--FGVRTY..-----------------------------------------------.PV--------
A9VEC0_MONBE/368-521--------T..G--QTDLNMVT-----------------------------------------------RT.--------
B3LY06_DROAN/17-198--------T..S--F.WLWL..-----------------------------------------------LT.--------
TMM47_XENTR/28-170--------...N--L.WICDST-----------------------------------------------LES--------
TM225_HUMAN/18-160--------S..P--W.MMCCPA-----------------------------------------------LWP--------
A8Q053_BRUMA/17-199--------E..E--L.HDRVGF-----------------------------------------------VP.--------
B4K6W4_DROMO/17-198--------....--.....IRT-----------------------------------------------EHG--------
A6H7D9_BOVIN/18-203--------L...--T.NSSPKT-----------------------------------------------LH.--------
B4MC21_DROVI/17-198--------LNLG--F.GVRTN.-----------------------------------------------.QI--------
B7QNM3_IXOSC/25-197--------N..G--CHWVHSYA-----------------------------------------------YQN--------
B5X0V8_SALSA/21-162--------....--G.WRCLST-----------------------------------------------LTS--------
A7SYX5_NEMVE/51-211--------S..G--K....MVL-----------------------------------------------IL.--------
B3P1Z4_DROER/17-198--------N..G--D...TSFW-----------------------------------------------LW.--------
A9V5F7_MONBE/26-226--------L..G--V.TR....-----------------------------------------------.SR--------
B4I3M6_DROSE/17-198--------T..E--N.DDTSFW-----------------------------------------------LW.--------
Q16T28_AEDAE/17-198--------LNVA--YGWRRHDV-----------------------------------------------DVL--------
B4QV06_DROSI/17-198--------T..S--F.WLWL..-----------------------------------------------LT.--------
B4PTR2_DROYA/17-198--------F..G--L.WLLTTV-----------------------------------------------...--------

PF07062

O45670_CAEEL/8-219--------HQHG--L-WWDCIR-----------------------------------------------AEK..-.HVVS
A8XPM2_CAEBR/9-213--------VQSG--L-WLYCP.-----------------------------------------------.....-.....
A8XPM1_CAEBR/5-202--------VQSG--L-WLSCQT-----------------------------------------------RPN..-.....
A8XPW0_CAEBR/10-221--------HEHG--L-WLDCTR-----------------------------------------------HSRDG-NHILQ
Q18135_CAEEL/11-221--------HHHG--L-WLDCTR-----------------------------------------------PQL..-.HLVK

PF10242

Q7PMA1_ANOGA/11-202--------V--G--I-YNRCK.-----------------------------------------------.....-..RMG
LHPL4_RAT/22-200--------F--G--L-FHYCV.-----------------------------------------------....G-SGLA.
LHPL3_XENLA/22-199--------F--G--L-FHFCI.-----------------------------------------------....G-SGFS.
TMHS_RAT/25-202--------F--G--L-FSYCV.-----------------------------------------------....G-NVLS.
TMHS_CHICK/25-202--------F--G--L-FSYCI.-----------------------------------------------....G-NALT.
Q4STB3_TETNG/22-199--------F--G--L-FHYCI.-----------------------------------------------....G-NALT.
Q4TFH6_TETNG/25-207--------L--G--L-FEVCV.-----------------------------------------------.....-..ESD
Q178A0_AEDAE/25-199--------L--G--L-WQICQ.-----------------------------------------------.....-...KD
Q2M056_DROPS/25-199--------L--G--L-WQQCQ.-----------------------------------------------.....-...RD
Q9XVU1_CAEEL/19-183--------F--G--L-YDYCG.-----------------------------------------------.....-.....
LHPL2_HUMAN/9-204--------L--G--I-YARCI.-----------------------------------------------..RNP-GVQHF
Q4S279_TETNG/9-201--------L--G--I-YGRCI.-----------------------------------------------.....-KLPHL
Q568B9_DANRE/9-197--------L--G--I-YNRCL.-----------------------------------------------.....-.KVAQ
Q4RUW4_TETNG/9-195--------L--G--L-YSRCL.-----------------------------------------------.....-RIGSQ
Q9W0X9_DROME/9-195--------V--G--I-YTRCK.-----------------------------------------------.....-..VMQ
Q292M2_DROPS/9-197--------V--G--I-YTRCK.-----------------------------------------------.....-..VMH
LHFP_MOUSE/8-193--------F--G--T-FRRCSY-----------------------------------------------PVHDE-SRQMM
LHPL1_RAT/8-192--------F--S--T-FRRCNY-----------------------------------------------PVR.G-DGHNL

PF06653

Q8ITZ9_CAEEL/47-208--------TCHW--VNPFST..-----------------------------------------------.LG--------
Q9TZ35_CAEEL/1-155--------VTRG--IVPYSS..-----------------------------------------------SEP--------
A8WY95_CAEBR/1-161--------ECAG--IVPYYS..-----------------------------------------------TEK--------
A8XQE4_CAEBR/1-163--------.SRG--ILPWHS..-----------------------------------------------GDT--------
A8WYV7_CAEBR/1-134--------GHFG--IVPFQS..-----------------------------------------------...--------
A8WK96_CAEBR/1-140--------PDIG--LISRYC..-----------------------------------------------...--------
A8XRC8_CAEBR/1-182--------DWNG--LMPWSCIS-----------------------------------------------HSQ--------
A8XQE5_CAEBR/1-150--------...G--NLPVLT..-----------------------------------------------...--------
Q9XUZ7_CAEEL/1-168--------.SIG--LFPLWV..-----------------------------------------------VTI--------
Q2WF57_CAEEL/1-166--------YGIG--IVPYHS..-----------------------------------------------NSA--------
O45515_CAEEL/1-161--------.SVG--IVPFYS..-----------------------------------------------TEV--------
A8XR11_CAEBR/1-188--------ILLG--LVPFDP.D-----------------------------------------------TPF--------
B6IEW4_CAEBR/1-156--------LGSG--LR......-----------------------------------------------...--------
Q95YB5_CAEEL/1-123--------....--........-----------------------------------------------...--------
A8WK67_CAEBR/1-167--------RGIG--IVPYDS..-----------------------------------------------GIG--------
Q95XC2_CAEEL/1-191--------KCHA--VNPFSS..-----------------------------------------------.MG--------
B6IFT2_CAEBR/1-179--------PSYG--ILPYPSVF-----------------------------------------------SNF--------
A8XQE6_CAEBR/1-167--------ASIG--IVPYYQ..-----------------------------------------------DDP--------
B6IEW3_CAEBR/1-114--------....--.VPYPS..-----------------------------------------------QLT--------
A8XWG5_CAEBR/1-169--------YSVG--IIPFHF.A-----------------------------------------------YEA--------
O45334_CAEEL/1-161--------.SIG--IVPFYS..-----------------------------------------------TEV--------
A8WY98_CAEBR/1-166--------GCTG--IVPYYA.N-----------------------------------------------LDP--------
B6IKT5_CAEBR/1-215--------FFDG--IRPDNM..-----------------------------------------------...--------
B6IKT4_CAEBR/1-120--------....--........-----------------------------------------------...--------

PF07344

A4I9X4_LEIIN/377-531--------TLWG..L-RVTCSS-----------------------------------------------SDY--------
A4HBJ2_LEIBR/15-170--------TLWG..Y-KERCSS-----------------------------------------------SSI--------
A4H6C8_LEIBR/15-170--------TLWG..G-KENCND-----------------------------------------------LKS--------
Q4Q3F7_LEIMA/15-171--------TLWG..W-KSRCTS-----------------------------------------------SVY--------
A4H5H1_LEIBR/15-170--------TLWG..L-NEQCYT-----------------------------------------------SRN--------
A4HBJ0_LEIBR/15-171--------TLWG..V-KMGGFN-----------------------------------------------LTN--------
Q7KPY0_LEIBR/5-180--------TAWG..L-KNDCNS-----------------------------------------------NNY--------
A4HB47_LEIBR/18-199--------TVWG..L-KNKCTS-----------------------------------------------TKW--------
A4I9X2_LEIIN/15-169--------TLWG..D-KVSCSS-----------------------------------------------SGY--------
Q4Q339_LEIMA/15-170--------TLFG..F-KLDCKG-----------------------------------------------LQY--------
Q27227_TRYCR/14-171--------TLWG..V-KEDCQS-----------------------------------------------MKY--------
Q4E0S1_TRYCC/20-182--------TAWG..V-KNECTS-----------------------------------------------NKY--------
Q4Q3A7_LEIMA/14-189--------SLWG..I-RDRCLI-----------------------------------------------LLY--------
A4HAZ8_LEIBR/15-170--------TLWG..G-KFHCFD-----------------------------------------------LSY--------
Q4QIA0_LEIMA/15-170--------TLWG..A-KTDCRK-----------------------------------------------PKI--------
Q4Q8C7_LEIMA/145-338--------TFWG..Y-KANCDT-----------------------------------------------VSY--------
Q585K0_TRYB2/9-167--------TLWY..Y-MEKVDD-----------------------------------------------VVK--------
A4H5D1_LEIBR/15-173--------TLWG..V-KVVCSN-----------------------------------------------LAY--------
Q9GU51_LEIIN/15-171--------TLWG..F-QFDCYS-----------------------------------------------VSY--------
A4HB02_LEIBR/15-170--------TLWG..F-KDHCNS-----------------------------------------------VSL--------
A4H5G6_LEIBR/15-171--------TLWG..V-KMGPLN-----------------------------------------------TTN--------
A4I9W9_LEIIN/15-171--------TLWG..F-KTDCSS-----------------------------------------------RHH--------
A4HDL4_LEIBR/18-168--------TLWG..S-KSDCSK-----------------------------------------------VGY--------
Q4QHJ3_LEIMA/241-414--------TYWGVEI-YHRNES-----------------------------------------------LSE--------
A4HAJ6_LEIBR/28-184--------TLWG..V-KLGVLN-----------------------------------------------TTN--------
E9AG83_LEIIN/15-171--------TLWG..S-KFECNT-----------------------------------------------IMY--------
A4H7D7_LEIBR/15-172--------TLWG..L-KTNCDS-----------------------------------------------FSY--------
A4I4J2_LEIIN/15-171--------TLWG..L-QKVCLG-----------------------------------------------TEY--------
Q4QAK7_LEIMA/19-166--------TMWG..Y-RKFCGD-----------------------------------------------VPY--------
Q4QI88_LEIMA/15-171--------TLWG..Y-KSECYS-----------------------------------------------TKY--------
A4HBJ1_LEIBR/15-170--------TLWG..F-TNSCGS-----------------------------------------------VLY--------
A4HGJ1_LEIBR/143-338--------TFWG..Y-KENCDT-----------------------------------------------VSY--------
Q4Q3A8_LEIMA/18-199--------TIWG..F-KDKCIS-----------------------------------------------LKW--------
A4HI41_LEIBR/20-195--------TSWG..L-KNDCNS-----------------------------------------------NHY--------
A4HDI3_LEIBR/87-236--------TFFG..F-KSHCSS-----------------------------------------------LSV--------
A4I4J3_LEIIN/81-236--------TLWG..A-KPDCRN-----------------------------------------------VKV--------
E9AHT2_LEIIN/15-171--------TLWG..G-KINCSD-----------------------------------------------TSY--------
E9AG85_LEIIN/15-170--------TLWG..G-KTDCRK-----------------------------------------------AKV--------
Q4Q327_LEIMA/15-169--------TLWG..E-RFTCTS-----------------------------------------------SGY--------
A4HTM4_LEIIN/15-171--------TLWG..Y-KNECFN-----------------------------------------------TAY--------
Q4Q8C6_LEIMA/374-525--------TYWG..Y-KDNCDN-----------------------------------------------STY--------
Q4Q397_LEIMA/79-235--------TLWG..A-KLGCYN-----------------------------------------------SSY--------
A4IAL7_LEIIN/15-170--------TLWG..F-KSTCNR-----------------------------------------------GME--------
A4H5G0_LEIBR/15-170--------TLWG..S-KVECYG-----------------------------------------------LTF--------
A4H606_LEIBR/64-214--------TLWR...-......-----------------------------------------------...--------
Q4Q317_LEIMA/15-172--------TLFG..V-KVDCYN-----------------------------------------------TTY--------
A4I0W5_LEIIN/18-168--------TFWG..M-KSDCRK-----------------------------------------------VHY--------
A4I9W8_LEIIN/77-234--------TLWG..A-KFDCSS-----------------------------------------------STY--------
A4H5D2_LEIBR/15-171--------TYWG..L-KERCTD-----------------------------------------------MKN--------
A4H5G5_LEIBR/226-381--------SLWG..S-HQSVGN-----------------------------------------------LSF--------
A4I9X1_LEIIN/15-170--------TLWG..F-KRDCFS-----------------------------------------------LNY--------
Q384H4_TRYB2/118-295--------TFWG..Y-KTDCDS-----------------------------------------------VSY--------
Q4CVL1_TRYCC/26-174--------TLWG...-TRACNS-----------------------------------------------PNY--------
A4I5B9_LEIIN/26-190--------TLWG..L-HSDCSK-----------------------------------------------PDY--------
A4I0W4_LEIIN/18-166--------TFVG..Y-KKECSL-----------------------------------------------SAL--------
A4I9X0_LEIIN/31-188--------TLWG..F-KNDCSS-----------------------------------------------LHS--------
A4IAM2_LEIIN/15-170--------TLWG..Y-KVMCDS-----------------------------------------------IVY--------
A4I9R7_LEIIN/15-171--------TLWG..A-KWGCSN-----------------------------------------------SSY--------
A4HAL2_LEIBR/14-189--------TMWG..I-RDKCLT-----------------------------------------------LTY--------
Q4DU87_TRYCC/14-171--------TLWG..G-KMHCSS-----------------------------------------------TEY--------
Q4Q309_LEIMA/15-169--------TLWG..D-KLACNS-----------------------------------------------SGY--------
A4H9E8_LEIBR/48-205--------TLWG..L-KKGVFT-----------------------------------------------TDY--------
A4HI43_LEIBR/25-189--------TLWG..L-QNRCGR-----------------------------------------------PYF--------
Q4Q6L8_LEIMA/15-171--------TLWG..E-KLDCRK-----------------------------------------------PKV--------
A4HB00_LEIBR/15-170--------TLWG..L-KNTCNS-----------------------------------------------ISH--------
A4I6E5_LEIIN/15-171--------TLWG..A-KSDCRA-----------------------------------------------PKV--------
A4H605_LEIBR/152-298--------GVWR...-..ATGG-----------------------------------------------GEP--------
A4H9E9_LEIBR/15-171--------TLWG..F-QLNCTS-----------------------------------------------TRY--------
A4HAJ4_LEIBR/51-207--------TLWG..L-KAGVFS-----------------------------------------------VEY--------
A4H5G7_LEIBR/15-171--------TLWG..V-KKGAFN-----------------------------------------------GTN--------
Q4QHJ4_LEIMA/134-280--------GVWR...-..ATGG-----------------------------------------------GQP--------
A4HGF8_LEIBR/158-312--------NLWK...-...AEG-----------------------------------------------GNY--------
Q4Q1U9_LEIMA/15-169--------TLWG..L-RLTCNS-----------------------------------------------SGY--------
A4IAM1_LEIIN/15-170--------TLWG..F-KRMCYS-----------------------------------------------IVY--------
Q4QI87_LEIMA/15-171--------TLWG..G-KEECYS-----------------------------------------------TKY--------
Q384H3_TRYB2/301-450--------TFWG..Y-KNDCDK-----------------------------------------------STY--------

PF07803

GSG1_HUMAN/8-118--------GTQK--VPKPLC.E----------------------------------------------------------
GSG1L_HUMAN/2-133--------GTQR--VPKPGC.G----------------------------------------------------------
Q4SN53_TETNG/4-143--------GTHK--VVKPLCLS----------------------------------------------------------
Q4SCG5_TETNG/5-121--------GKQK--VPKPLC.T----------------------------------------------------------
GSG1L_DANRE/2-113--------GTQR--VPKPNC.S----------------------------------------------------------
Q4S7Q6_TETNG/2-112--------GTQR--VPKPKC.S----------------------------------------------------------
GSG1L_XENTR/2-125--------GTHK--VVKPPCLS----------------------------------------------------------
Q4SAX5_TETNG/2-120--------GTRK--VAKPFCTG----------------------------------------------------------

PF11381

Q0A7S1_ALHEH/5-63-----------G--------------------------------------------------------------------
A3WLM6_9GAMM/3-61-----------S--------------------------------------------------------------------
Q08WE2_STIAD/3-61-----------G--------------------------------------------------------------------
Q1PY89_9BACT/3-61-----------G--------------------------------------------------------------------
B2T1Q0_BURPP/3-61-----------G--------------------------------------------------------------------
C0A3E3_9BACT/3-61-----------G--------------------------------------------------------------------
A3NQ77_BURP0/3-61-----------G--------------------------------------------------------------------
Q1D4N9_MYXXD/46-104-----------G--------------------------------------------------------------------
Q0F2S1_9PROT/25-83-----------G--------------------------------------------------------------------
A6TU20_ALKMQ/37-94-----------G--------------------------------------------------------------------
Q11TD1_CYTH3/5-54-----------T--------------------------------------------------------------------
Q30SB9_SULDN/10-68-----------G--------------------------------------------------------------------
A1WU28_HALHL/18-76-----------G--------------------------------------------------------------------
A1SWI4_PSYIN/2-60-----------G--------------------------------------------------------------------
A6VWJ5_MARMS/4-62-----------G--------------------------------------------------------------------
Q0AB85_ALHEH/5-63-----------G--------------------------------------------------------------------
Q07X17_SHEFN/4-62-----------G--------------------------------------------------------------------
Q3IDA6_PSEHT/4-62-----------G--------------------------------------------------------------------
A3QG33_SHELP/25-83-----------G--------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257--------IKVG--Y-LGVCLS------------------------NLPAA.........YPGGP....VQCF.-GRKNI
A1DMY3_NEOFI/52-247--------VRAG--Y-MGLCLT------------------------LSN..............RA....QLC..-...SG
A3LV03_PICST/62-245--------IRVG--Y-LGVCVN------------------------IQ...............QN....MTC..-.TSFS
A5E535_LODEL/80-252--------VRVG--Y-LASCLI------------------------IGD.............D......KSCSY-YTSMP
A7EL23_SCLS1/52-241--------LRFG--Y-MGLCAY------------------------VGVEGNNG...DTFKNTNG....FQCIG-KQYEQ
A7TJZ8_VANPO/66-260--------VKSG--Y-MGICID------------------------KIPSNF........NSTSK....TICY.-SRSAI
B5VE06_YEAS6/60-260--------IRSG--Y-MGVCID------------------------NIPSQYSSY..NNMTTFSN....SICY.-ARKNL
B6HGM8_PENCW/52-252--------VRAG--Y-MGMCVT------------------------QRH..............TG....RIC..-...SS
B8MZW1_ASPFN/73-257--------VRVG--Y-FGICVS------------------------PSG..............GA....YIC..-...NS
B8NY21_ASPFN/72-267--------VRAG--Y-MGLCLT------------------------RSD..............GA....QFC..-...SS
B9WIK5_CANDC/65-244--------VKIG--Y-MGVCLS------------------------SSQ..............KD....ISC..-.TTYT
C0NA65_AJECG/81-270--------IRTG--Y-LSHCLK------------------------QAS..............GL....WVC..-...AR
C0SH54_PARBP/74-258--------VRVG--Y-FGICIQ------------------------PTG..............GA....FMC..-...NQ
C1G9K9_PARBD/72-262--------IRTG--Y-LGHCMK------------------------QNS..............GL....WIC..-...AR
C4JX23_UNCRE/51-235--------VRVG--F-FGICIQ------------------------KDG..............GS....FLC..-...NA
C4QXD3_PICPG/65-260--------VKAG--Y-MGICVD------------------------TPKLLQGNSTDEMKELGSQ....ITC..-.TSRD
C4YC02_CLAL4/51-224--------LATG--Y-LGMCVS------------------------AD...............GS....KMC..-.STAK
C5DEC8_LACTC/64-258--------VRAG--Y-MGICVT------------------------GIPST.........YSEKS....TLCY.-SRKNI
C5DPI4_ZYGRC/66-266--------IASG--Y-MGVCIT------------------------NIPKDY........DKGVK....SVCY.-PRKDL
C5G079_ARTOC/74-258--------VRVG--Y-FGICIQ------------------------RNG..............GG....FLC..-...NQ
C5M8V3_CANTT/127-303--------IRVG--Y-LGVCLS------------------------QDN.............D......LTC..-.TTYA
YEJ7_SCHPO/33-201--------INVG--Y-FNMCVL------------------------SAN..............AT....LIC..-...KP
Q0CSC3_ASPTN/220-409--------VRVG--Y-FGLCMA------------------------TNT..............GGDPVSWIC..-...RG
Q0U808_PHANO/74-259--------VRVG--Y-FGICIN------------------------RDG..............GG....YIC..-...SN
Q0V1Y2_PHANO/45-209--------IRIG--Y-FGICIS------------------------TPT.............VAN....WTC..-.....
Q59WR6_CANAL/68-244--------VKVG--Y-MGVCLS------------------------SSS..............KD....ISC..-....T
Q6BL79_DEBHA/62-241--------LSVG--Y-LGVCVD------------------------I.D..............KS....LQC..-.TSFN
Q6CH13_YARLI/62-243--------ARSG--F-FGACAT------------------------VS...............NA....TEC..-.VSRG
Q6CW51_KLULA/66-265--------IFSG--Y-MGICIN------------------------NIPSNYDR....NSSSKSS....KVCF.-NRKKV
Q6FQP2_CANGA/65-266--------VKVG--Y-LRTCID------------------------KVPRV.........YNMDNNSIATKCY.-SGKTI
Q870W5_NEUCS/62-268--------VRLG--Y-FGMCGD------------------------DG...............DT....RTCLS-AAGHY
YNB1_SCHPO/52-216--------VDVG--F-FGVCDQ------------------------AIN.............STS....RVC..-.....

PF06687

Q4WWY3_ASPFU/5-166........VDYG--V-FGFCKA...........................................----GQCTN.IHIGY
Q75E26_ASHGO/7-202........TRWY--N-YNWCEY......................................GDDHT----GVCSN.NKV.M
Q757N9_ASHGO/7-167........VQYG--V-FGYCIQ..........................................D----RGCSP.VSASY
A5DJU1_PICGU/4-217........LKFG--V-FGVCNI.........................................TT----DICSS.PRIGY
PALI_DEBHA/4-238........YTFG--V-LGLCTS..........................................N----NICSK.PKVGY
Q0V6X2_PHANO/4-166........INFG--V-LGYCVD...........................................----GKCDG.PMIGY
Q6BIN6_DEBHA/7-162........YNYG--I-FGYCQS..........................................S----GSCSS.SSYPY
A5DHH0_PICGU/5-162........HRFG--V-FGSCEI.........................................KS----GSCTK.AAYPY
Q6C1Y6_YARLI/7-199........TRWT--T-YNFCGV.....................................STDNKN----FECSK.NQADF
Q6BLL9_DEBHA/5-198........AAWT--F-WGVCEE........................................NDY----SKCTS..GPAY
A5DC91_PICGU/5-198........SSWT--F-WGVCQS........................................DDF----SKC.K.SGPAY
Q6BME8_DEBHA/24-312........IVTS--L-WSWCYGNYNITQHM.....................DRHGVVHISKHNDV----LTCSK.STKRY
A5DG26_PICGU/5-318........YSIS--F-WGYCRGTATNDKIAN..................PLKKVTNNFDNNKVNF----TYCSK.PTPGY
MAC1_SCHPO/6-177........TEFG--I-FGTCTG.........................................NG----TDCTE.TSFGY
PALI2_KLULA/3-167........YRFG--V-FGWCKV.........................................DR----SVCSP.IRIGY
PALI1_KLULA/4-168........YKFG--V-FGWCKV.........................................DG----SICSP.IRMGY
PALI_ASHGO/5-170........YKFG--V-FGWCDT.........................................TH----THCTP.LKLGY
PALI_CANGA/6-170........YHFG--V-FGWCFV......................................DKGVT----IACHC....KF
A7TPS6_VANPO/6-170........IQFG--V-FGWCNT.......................................KGHS----MGCSG.LSIGY
PALI_YARLI/7-167........HKFG--V-FGYCNV.........................................KD----GTCSP.AGVGY
A6ZMC2_YEAS7/4-169........HYYG--L-FGWCVR......................................GQNQE----LMCTK.MKIGY
PALI_CANAL/4-232........YRFG--V-FGICNV.........................................ER----HICSK.PSIGY
A5E4Z6_LODEL/4-205........FTFG--V-FGICDE.........................................RS----GKCSD.ARIGY
A3LUV8_PICST/4-233........FTFG--V-FGICDA.........................................TK----GICSE.PRIGY
A6SN30_BOTFB/4-166........VQFG--V-FGFCK...........................................G----STCSN.VEIGY
PALI_MAGO7/4-169........VTFG--V-FGYCIN.........................................NN----ARCSP.IEIGY
Q2H463_CHAGB/4-183........STLA--S-LGFAPRMA.................................VPQLRLAT----MSVSV.DPIRY
PALI_NEUCR/4-175........LSFG--V-FGYCT...........................................S----SGCSP.IEIGY
Q0CX64_ASPTN/5-167........VDYG--V-FGYCK...........................................N----DKCTN.IHVGY
A2QF35_ASPNC/5-165........IDYG--V-FGYCK...........................................G----DVCTS.IHVGY
A6R830_AJECN/5-168........IKFG--I-FGYCV...........................................G----SNCSP.IRVGY
MUG33_SCHPO/5-166........VRFG--V-FGYCLN...........................................----SNCSK.PLVGY
Q4P8U5_USTMA/5-204........LKFG--T-WGYCSA.....................................LNGTSN----FACFK.HSHGY
A3LTF9_PICST/7-165........YVYG--I-FGFCTN.........................................SG----SKCST.ATFPY
A5DUT6_LODEL/7-165........YSYG--L-FGYCLE.........................................NN----SKCSS.ATYPI
Q5ALR6_CANAL/7-166........NKYG--I-FGSCST........................................SNS----DNCIV....GY
A6ZNI8_YEAS7/5-176........ITYG--T-FGYCKE...........................................----GSCSK.ASYNY
A7TT16_VANPO/7-179........ITYG--V-FGYCDT.........................................SA----DTCSK.ASASY
Q6CX71_KLULA/9-171........IHYG--V-FGYCED.........................................DG----GSCSS.AQANY
Q6FSP2_CANGA/9-169........FTYG--T-LGYCQD...........................................----.GCSR.ASASY
A7A250_YEAS7/7-175........VSYG--T-FGYCKT........................................LNS----FSCSR.VRLIY
A1CFA3_ASPCL/8-205........SRWT--Y-WNLCAV.....................................NDKGHN----.ACGK.SYADY
A2QNP6_ASPNC/8-205........SRWT--F-WEICAV.....................................TANGKN----.LCGS.SYPDF
A6R6X6_AJECN/8-204........SRWT--F-WGVCGV.....................................SD.GKN----.DCHG.TTAAF
Q0V6H1_PHANO/8-203........SRWT--F-FAICGE.....................................ENGLNA----.NCGA.SVPAL
Q5AH49_CANAL/4-201........TRWT--F-YRMCGV.....................................DHNKNA----.HCGK.SQAAF
A5E7B2_LODEL/4-201........TRWT--F-YRTCGV.....................................SNGRNS----.DCTK.SSAAY
A5DAF8_PICGU/6-205........TRWT--S-YNMCGV.....................................KDGRNS----.NCLS.AAPAY
Q5A4M8_CANAL/5-199........SAWT--F-WGVC.......................................DKADYS----.NC.L.LGPAY
A3LV33_PICST/5-198........AAWT--F-WGVC.......................................EKNNYT----.EC.Q.SGPAF
SUR7_YEAST/9-206........TRWT--F-WGACLQ.....................................DKDGSD----.TCTSNLAPAY
A7TH74_VANPO/9-205........TRWT--F-WGVCSK.....................................IDDRTY----..CQDYLSPAS
Q753Q0_ASHGO/8-202........SKWT--F-WGLCNG.....................................EGAHNR----.ECGR.MSPAY
Q6CXH5_KLULA/9-205........SRWT--F-WGLCGV.....................................SGNKNV----.NCSS.LEPAY
Q2H574_CHAGB/3-201........SQWT--F-FKVCGD.....................................GNT...----.DCGP.SRPGL
Q7SI65_NEUCR/8-206........SQWT--Y-FKVCGL.....................................NNL...----.DCGP.ARPAL
A6SND7_BOTFB/8-206........SQWN--F-FRVCGA.....................................GNT...----.DCGS.SVPAL
A7EBS7_SCLS1/8-206........SQWN--Y-FRVCGE.....................................GNT...----.DCGS.SVPDL
Q6FT41_CANGA/7-205........TRWY--N-YMYCGY.....................................ADHETY----.DCSD.KGADK
A7TIB3_VANPO/11-209........TRWY--N-YEFCGW......................................DGHRT----SNCSS.KGAAK
Q6CJ71_KLULA/7-204........TRWF--N-YHWCAY.....................................ENGEIG----.SCSG.KQADL
FMP45_YEAST/7-205........TRWY--N-YNWCGY.....................................EDGQLA----.NCSS.RAPAK
YNT4_YEAST/7-206........TRWY--N-YNWCGW.....................................ESRGIA----VNCSS.KMAAQ
A7TTI2_VANPO/7-207........TRWF--N-YRWCSI.....................................SSAGDI----ISCTY.SEAAT
Q55HH6_CRYNB/6-242........YRYG--M-YNACGY......................................QKDGS----GVCNS.STFAY
Q4PHQ4_USTMA/26-258........YQWG--L-YSYCAG.....................................QESGSQ----RACSE.RSFGF
PUN1_YEAST/6-240........INIG--L-WSYCTV.....................................DSSHNI----QSCSS.PHGIQ
Q6FPE4_CANGA/6-240........INIG--L-WSYCVA.....................................SSSTDV----TSCTS.PNGIQ
A7TGC8_VANPO/6-240........INIG--L-WSYCTS....................................STDSKHV----EKCTS.PHGIQ
Q6CWP2_KLULA/5-243........FNLG--V-WSYCLA.....................................NSEKQI----TSCTK.PAGIE
Q59US7_CANAL/25-311........CISS--L-WTWCYGNYETYTVV.....................GKDGEIYTKKKNEV----LTCTD..KSSY
A5E006_LODEL/6-375........YSTS--F-WGYCRGEKTGNSTTATTSSSSSSSSTSSSSNSSVLKWMDNNFDNSDVNY----TWCSA.PKVGF
A5E421_LODEL/6-397........YSTS--F-WGYCRGEKVGNGSEPFN..............NSLGHWIDKNFDNSNVNY----TWCSP.PKAGF
Q6BMS1_DEBHA/5-319........YSIS--L-WGYCKGEVKGSS........................KTEKGFDNSDIDF----KWCSD.PKPAY
A3LZK7_PICST/5-323........YSFS--Y-WGYCRGYIIGDIT......................ASNNHPFDNNKVNY----TWCSP.AQVGF
Q5ADV0_CANAL/6-394........YSVG--F-WGYCRGYVIQDDS.......................KKTKKFDNSNVNY----TWCSE.PKVSF
Q2UBQ3_ASPOR/26-275........YTVG--L-WNFCEG.....................................YNDSGI----TKCSK.PETLY
A2QQ39_ASPNC/26-275........YQVG--L-WNFCEG.....................................YLDQGI----THCSS.PKPLY
Q5BDP9_EMENI/26-276........YQVG--L-WNFCEG.....................................YNNEGI----THCSK.PKTLY
Q0CQ07_ASPTN/27-276........YQVG--L-WNFCEG.....................................YNDQGI----THCSK.HKTLY
YDO9_SCHPO/12-275........YSIG--L-WNYCQGN...................................SSDYTNP----TYCST.PSPSY
Q0TZ73_PHANO/4-276........YSAH--M-LDYCYGQYTPLEV......................ANATISDDDISKNV----TGCSQ.SQAMY
Q7SFF9_NEUCR/5-286EKLGIHEFYSLH--A-RTVCEGEYSP............................SPTAKGAGRTV----ANCIKTFPSGF
A1DME7_NEOFI/9-255........YDIG--L-WGYCDGD..................................VTNGNYKT----QNCSK.PKAEF
Q2UPQ3_ASPOR/9-255........YNIG--L-WGYCDGN..................................VTNDKFEV----SECSK.PKGEF
Q0CRK6_ASPTN/9-256........YTIG--L-WGYCDGN..................................INDHKYNV----SNCSK.PESMF
A2QPC4_ASPNC/9-256........YAIG--L-WGYCEGNI.................................TSNNSYQT----NNCSK.PEAEF
Q5B2L7_EMENI/9-256........YNIG--L-FGYCQGNV.................................TNNNDYRV----TNCSS.PEAQF
A6RDR9_AJECN/9-246........YLIG--L-WNHCYGE..................................YENGQYKI----IRCTD.RKAKY
Q0V4X3_PHANO/9-258........YQVG--L-WSYCSGTK................................DASTGEETI----DFCSK.SSTSF
Q2UF28_ASPOR/9-224........YSIG--L-WSYCTGNI.................................TDNGTYKT----TYCSK.PRGGF
Q2TX92_ASPOR/9-279.ESNIERFYIIG--L-WGYCQGS..................................FNGTGSTV----RKCTP.PSSSF
Q7SG51_NEUCR/8-271........YDIS--L-WGYCTT......................................AHNGT----RECTK.AKFNW
Q2HFG4_CHAGB/9-276........YDVN--I-WNYCYT......................................TQNGT----RECTK.GKFDW
A6RLC7_BOTFB/8-271........YKVS--L-WGYCAV.......................................TGKN----TTCTK.AKFNW
A2R5N4_ASPNC/9-229........YLVG--I-MGYCET.....................................DNRDTT----MDCLS.PQAGS
Q5K881_CRYNJ/4-176........TVFG--V-FGECVK..........................................G----GSCSS.KSVGY
Q4PH32_USTMA/4-186........ARLG--T-LGYCLG...........................................----NTCND.PTLGY
Q5KGB3_CRYNJ/7-189........MQLG--T-LGFCVT.......................................LNDA----TNCTG.PTVGY

PF00822

CLD7_HUMAN/4-182----TGMMSCKMY------------------------------DSV---------LALSAA-----------------LQ
CCG2_MOUSE/6-197----NFKGLCKQI------------------------------DHF---------PEDADY-----------------EA
EMP3_HUMAN/1-156----TKTWACSN.------------------------------...---------VSENGW-----------------LK
EMP1_MOUSE/1-154----DGSLSYGN.------------------------------...---------...EDA-----------------IK
CLD1_MOUSE/4-182----TGQIQCKVF------------------------------DSL---------LNLNST-----------------LQ
CLD10_HUMAN/4-179----TGVSNCKDF------------------------------PSM---------LALDGY-----------------IQ
PMP22_HUMAN/1-153----GNVHHCFS.------------------------------...---------SSPNEW-----------------LQ
EMP1_RABIT/1-154----SGGLSYGH.------------------------------...---------...EDA-----------------LK
LMIP_BOVIN/1-157----YLQTESIA.------------------------------...---------..YWNA-----------------TR
EMP2_MOUSE/1-165----CTEINELTG------------------------------PEA---------FEGYSV-----------------MQ
CLD7B_DANRE/4-182----TGQQQCKVY------------------------------DSV---------LQLDSA-----------------LQ
EMP1_HUMAN/1-151----SDSLSYAS.------------------------------...---------...EDA-----------------LK
EMP2_HUMAN/1-160----CTVINDS..------------------------------...---------FQEYST-----------------LQ

PF13903

TM235_HUMAN/16-197----QNGCIPLVDPFAS....................ESLDVSTSV---------QHLILL-----------------HR
TM235_MOUSE/16-192----CVPLIDPFASAG.......................LEVSPSV---------QHLLSL-----------------HR
B4Q2K5_DROYA/16-232----PPVSAVPTYLSPIETHCSNI......DYFPQAEDEKIANEDA---------TSRLHL-----------------AR
TM182_XENTR/15-225----EEENSNTMENFWFTNQAPTKNCTHAYLSPFPQNRDNSNSTSY---------HSALVY-----------------RG
Q16RP0_AEDAE/16-235----PPASSVQIYLSPVETHCSNIDY...FPQTEEDKSSPGFNEDI---------MARLHL-----------------AR
TM182_MOUSE/15-220----VEENNSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSY---------DSAIIY-----------------RG
D2HQ99_AILME/17-198----MTDSKDKTCGPITLPGEKNCS.....YFRHFNPGETSEIFHV---------TTQKEY-----------------SI
A7SGP9_NEMVE/19-204----GLGNRQRNFDV.........................KEEFEE---------VANNKV-----------------VW
B4NZC2_DROYA/16-190----DIHRFFDNPFNGCLW................VFEEEYYIIHD---------FLLPGF-----------------YI
Q1L8R4_DANRE/69-258----VSDVDPKLEVCGPLHLQGESNC...TFFKFYTTGENIVLFQK---------TPEKDL-----------------TV
B0WVP8_CULQU/16-190----DIHRFYDTRFSGCMW................IFEEEYYILHD---------YILPGF-----------------FI
B4H3C9_DROPE/44-223----QRRFFVGCRWVYDPFT...............TGYDEIRGFLL---------PAFMIA-----------------TQ
B4KVB2_DROMO/40-219----DVNDDSQRRFFVGCRWVYD.........PFTKGYDEIRGFLL---------PAFMIT-----------------TQ
Q17AR2_AEDAE/35-214----DVNDDYQRRFFVGCRWVYD.........PFTTGYDEIRGFLI---------PPFMIA-----------------TQ
Q6E5P4_TAKRU/18-198----LAKVENCQS............................ISIAA---------PFAPAE-----------------IP
Q5DCP0_SCHJA/66-231----S.........................................---------.....N-----------------NL
B0WVM7_CULQU/17-198----AYGWRQHD..............................IDVL---------AVIRDE-----------------PD
C1BSD7_9MAXI/17-200----..........................................---------......-----------------.D
B4NIE2_DROWI/17-198----DFIRTENG...............................DTS---------FWLWLL-----------------TT
B4HC72_DROPE/17-198----DVYTFIRTE............................NGDTS---------FWLWLL-----------------TT
A9VEC0_MONBE/368-521----..........................................---------......-----------------.E
B3LY06_DROAN/17-198----..........................................---------......-----------------.T
TMM47_XENTR/28-170----D.........................................---------.....W-----------------QI
TM225_HUMAN/18-160----E.........................................---------....DD-----------------LK
A8Q053_BRUMA/17-199----..........................................---------......-----------------.K
B4K6W4_DROMO/17-198----DTS.......................................---------...FWL-----------------WL
A6H7D9_BOVIN/18-203----..........................................---------......-----------------.S
B4MC21_DROVI/17-198----EVYNFI...................................R---------TEHGET-----------------SF
B7QNM3_IXOSC/25-197----IRDW......................................---------.LLPGW-----------------FM
B5X0V8_SALSA/21-162----D.........................................---------.....W-----------------QI
A7SYX5_NEMVE/51-211----..........................................---------......-----------------.Q
B3P1Z4_DROER/17-198----..........................................---------......-----------------.L
A9V5F7_MONBE/26-226----DNN.......................................---------..GRNW-----------------CR
B4I3M6_DROSE/17-198----..........................................---------......-----------------.L
Q16T28_AEDAE/17-198----AVLQDEPD...............................VMS---------YWLWLG-----------------TA
B4QV06_DROSI/17-198----..........................................---------......-----------------.T
B4PTR2_DROYA/17-198----..........................................---------......-----------------..

PF07062

O45670_CAEEL/8-219VGDFYDETPLHCMYKFDNSAELVIQNTLNNID....EDGAAGESEH---------HRFWAW-----------------HK
A8XPM2_CAEBR/9-213.......GQAQCWYIFS.DSLINYYEKVDVCRFFLIGDCRKKLLRT---------PYFFGW-----------------HY
A8XPM1_CAEBR/5-202.......GMYSCTYTFSHDDFNTYF............SDEVSGFRT---------PSFYPW-----------------QR
A8XPW0_CAEBR/10-221RYATVTE.PLHCVYKFDYDK...YSGTFELED....DNSPVGEVNR---------HKFYGW-----------------HT
Q18135_CAEEL/11-221SQN.KDDLPLHCTYKFDISATQIIDENIEDID....QNSAAGESEH---------HQFFGW-----------------HK

PF10242

Q7PMA1_ANOGA/11-202RIEYNCGNFDLNG---------------------------LLTDST---------VFPVPW-----------------.K
LHPL4_RAT/22-200GRELTCRGSFTDF---------------------------STIPSS---------A....F-----------------.K
LHPL3_XENLA/22-199.KELTCTGSFTEF---------------------------SSIPSG---------A....F-----------------.K
TMHS_RAT/25-202.SELICKGGPLDF---------------------------SSIPSR---------A....F-----------------.K
TMHS_CHICK/25-202.GELICKGSPLDF---------------------------GTIPSS---------A....F-----------------.K
Q4STB3_TETNG/22-199.SELTCKGSALDF---------------------------GSIPSG---------A....F-----------------.K
Q4TFH6_TETNG/25-207WPVPDCRGGLSSL---------------------------SPLPS.---------.....F-----------------.Q
Q178A0_AEDAE/25-199DLNDSCSGKLEDL---------------------------LAMQSI---------A....F-----------------.Q
Q2M056_DROPS/25-199EIFDNCRRRWENV---------------------------LAVPTF---------S....F-----------------.Q
Q9XVU1_CAEEL/19-183....TSECPWSPF---------------------------RVRPLS---------M....W-----------------FE
LHPL2_HUMAN/9-204QRDTLCGPYAESF---------------------------GEIASG---------F....W-----------------.Q
Q4S279_TETNG/9-201QRGILCGPYAIHF---------------------------GEIASG---------F....W-----------------.Q
Q568B9_DANRE/9-197QKVVQCGPYATDF---------------------------MEIASG---------F....W-----------------.Q
Q4RUW4_TETNG/9-195GVGVSCGPYAGTF---------------------------GEVASG---------F....W-----------------.Q
Q9W0X9_DROME/9-195EGGFQCGRFDLDG---------------------------LATDSS---------VYPNEW-----------------.K
Q292M2_DROPS/9-197QVGYHCGRFDLDG---------------------------LATDSS---------VYPSEW-----------------.K
LHFP_MOUSE/8-193VMVEECGRYA.SF---------------------------QGIPST---------E....W-----------------.R
LHPL1_RAT/8-192IMVEECGRYA.SF---------------------------AAIPSL---------A....W-----------------.Q

PF06653

Q8ITZ9_CAEEL/47-208--------------------------------------Y......S---------YDLASF-----------------FL
Q9TZ35_CAEEL/1-155--------------------------------------T......W---------LAAASW-----------------MM
A8WY95_CAEBR/1-161--------------------------------------A......W---------LAISSW-----------------LM
A8XQE4_CAEBR/1-163--------------------------------------G......W---------IKAATV-----------------EL
A8WYV7_CAEBR/1-134--------------------------------------........---------......-----------------..
A8WK96_CAEBR/1-140--------------------------------------........---------......-----------------..
A8XRC8_CAEBR/1-182--------------------------------------GSTCSDWW---------AELPGW-----------------MR
A8XQE5_CAEBR/1-150--------------------------------------.......W---------IDVAGI-----------------LI
Q9XUZ7_CAEEL/1-168--------------------------------------G......W---------YVAASL-----------------VM
Q2WF57_CAEEL/1-166--------------------------------------G......W---------FTAASW-----------------MV
O45515_CAEEL/1-161--------------------------------------G......W---------FAAASW-----------------MM
A8XR11_CAEBR/1-188--------------------------------------G......W---------LVATCI-----------------FM
B6IEW4_CAEBR/1-156--------------------------------------........---------LTLASS-----------------FM
Q95YB5_CAEEL/1-123--------------------------------------........---------......-----------------..
A8WK67_CAEBR/1-167--------------------------------------G......W---------FSAASW-----------------MM
Q95XC2_CAEEL/1-191--------------------------------------S......S---------YDFASF-----------------AL
B6IFT2_CAEBR/1-179--------------------------------------G......W---------AVAACW-----------------LM
A8XQE6_CAEBR/1-167--------------------------------------G......W---------LKAGSV-----------------LI
B6IEW3_CAEBR/1-114--------------------------------------S......M---------FPTLCI-----------------LM
A8XWG5_CAEBR/1-169--------------------------------------P......F---------HIATSV-----------------MM
O45334_CAEEL/1-161--------------------------------------G......W---------YALASW-----------------MM
A8WY98_CAEBR/1-166--------------------------------------A......W---------FAAASW-----------------LM
B6IKT5_CAEBR/1-215--------------------------------------........---------...VCI-----------------MM
B6IKT4_CAEBR/1-120--------------------------------------........---------......-----------------..

PF07344

A4I9X4_LEIIN/377-531---------------------------------------LLFIEMY.WSDC....RGRVAR-----------------FR
A4HBJ2_LEIBR/15-170---------------------------------------DSPLNVV.WEEC....PVRLRR-----------------FY
A4H6C8_LEIBR/15-170---------------------------------------DTSYHEL.WSFC....PGRLAR-----------------FR
Q4Q3F7_LEIMA/15-171---------------------------------------EAGVDEL.WRDC....GGRRKR-----------------FR
A4H5H1_LEIBR/15-170---------------------------------------DISLEQL.WMDC....PIRRDR-----------------FR
A4HBJ0_LEIBR/15-171---------------------------------------VITSDYL.WRRC....TNRRDR-----------------FR
Q7KPY0_LEIBR/5-180---------------------------------------DYRPTSI...GC....ARAKQL-----------------FQ
A4HB47_LEIBR/18-199---------------------------------------DVRTSNL.WAGC....PERLKR-----------------FH
A4I9X2_LEIIN/15-169---------------------------------------LHYVELL.WRDC....PLRIPR-----------------FR
Q4Q339_LEIMA/15-170---------------------------------------DQTVDMQ.WIEC....PARITL-----------------FR
Q27227_TRYCR/14-171---------------------------------------EFTFWED.FREC....PSVLRL-----------------FR
Q4E0S1_TRYCC/20-182---------------------------------------DLRSSEI...KCEGNDKRLHQL-----------------FQ
Q4Q3A7_LEIMA/14-189---------------------------------------SVSPNDV.WSEC....HGRVGR-----------------FK
A4HAZ8_LEIBR/15-170---------------------------------------DFRPEYV.FVNC....TNRLMR-----------------FR
Q4QIA0_LEIMA/15-170---------------------------------------TNPSSVR.WALC....PIRLNN-----------------FR
Q4Q8C7_LEIMA/145-338---------------------------------------TRRTVLL..QSC....RRVRSA-----------------LQ
Q585K0_TRYB2/9-167---------------------------------------QTKVHES...PC....KEYSVY-----------------FQ
A4H5D1_LEIBR/15-173---------------------------------------ESSSDAE.WALC....PTRRDR-----------------FR
Q9GU51_LEIIN/15-171---------------------------------------DNRSDHF.WGGC....HGRRDR-----------------FR
A4HB02_LEIBR/15-170---------------------------------------NASLNDL.WEFC....PRRLRL-----------------FR
A4H5G6_LEIBR/15-171---------------------------------------VIPTYIL.WRQC....PARLNR-----------------FL
A4I9W9_LEIIN/15-171---------------------------------------TLTIDRT.FGAC....PPRVHR-----------------FR
A4HDL4_LEIBR/18-168---------------------------------------TGRGKMA.FGGC....GQRVNN-----------------MN
Q4QHJ3_LEIMA/241-414---------------------------------------NWPLSSY...HC....PQLTLH-----------------MR
A4HAJ6_LEIBR/28-184---------------------------------------TISSDFL.WRRC....IPRRDR-----------------FR
E9AG83_LEIIN/15-171---------------------------------------AMPTDDQ.WKFC....PTRLQH-----------------FR
A4H7D7_LEIBR/15-172---------------------------------------QFLSDDL.WESC....PPRRDR-----------------FR
A4I4J2_LEIIN/15-171---------------------------------------IMKTRVL.WKNC....PSRRDR-----------------FL
Q4QAK7_LEIMA/19-166---------------------------------------DLTGDAA..FGC....ARRTST-----------------MR
Q4QI88_LEIMA/15-171---------------------------------------DVRSDDL.WANC....TDRLLQ-----------------FR
A4HBJ1_LEIBR/15-170---------------------------------------DSTLFEV.WEGC....PHHLSG-----------------FH
A4HGJ1_LEIBR/143-338---------------------------------------TRRTALL..MNC....TRLRSN-----------------MH
Q4Q3A8_LEIMA/18-199---------------------------------------SVRTKDL.WKGC....PQRLQR-----------------FN
A4HI41_LEIBR/20-195---------------------------------------DYRSTSI...TC....ARPRQL-----------------FQ
A4HDI3_LEIBR/87-236---------------------------------------DTTGTAA.FG.C....AQRRNN-----------------MN
A4I4J3_LEIIN/81-236---------------------------------------GIDVDTR.WRYC....PTRVKR-----------------FH
E9AHT2_LEIIN/15-171---------------------------------------LFTSDEI.WDDC....PGRRDR-----------------FR
E9AG85_LEIIN/15-170---------------------------------------TITPGVR.WKFC....PIRLRN-----------------FR
Q4Q327_LEIMA/15-169---------------------------------------FSYIDET.FHNC....PQRLTH-----------------FR
A4HTM4_LEIIN/15-171---------------------------------------DSWADDL.WAKC....PDRRLQ-----------------FR
Q4Q8C6_LEIMA/374-525---------------------------------------TIPRPLY...PT....PYIRRH-----------------LG
Q4Q397_LEIMA/79-235---------------------------------------LVTSDEL.WVNC....TARRDR-----------------FR
A4IAL7_LEIIN/15-170---------------------------------------VTKSDEL.WANC....MGRRNR-----------------FR
A4H5G0_LEIBR/15-170---------------------------------------ELKSDDL.WSPC....PRRRDS-----------------VR
A4H606_LEIBR/64-214---------------------------------------DVNGTPWRMIEC....DHRRQM-----------------FQ
Q4Q317_LEIMA/15-172---------------------------------------AESAEVL.WADC....LNRLNR-----------------FH
A4I0W5_LEIIN/18-168---------------------------------------TAKGKGA.FGNC....RQRLNN-----------------MS
A4I9W8_LEIIN/77-234---------------------------------------SVKLSMM.WSPC....PSRRNL-----------------FR
A4H5D2_LEIBR/15-171---------------------------------------VKSLDEF.FKHC....SFARDH-----------------FH
A4H5G5_LEIBR/226-381---------------------------------------FSSSATL.WADC....PGRLML-----------------FR
A4I9X1_LEIIN/15-170---------------------------------------VRTVDVS.FEKC....PSRITR-----------------FR
Q384H4_TRYB2/118-295---------------------------------------TIRTQLL...PC....APIRGR-----------------LQ
Q4CVL1_TRYCC/26-174---------------------------------------DWRVN...WDTC....KARRLR-----------------FQ
A4I5B9_LEIIN/26-190---------------------------------------SLRITDSPIVNC....SDMHVR-----------------FE
A4I0W4_LEIIN/18-166---------------------------------------SATGTAA.FG.C....KQRRDS-----------------MS
A4I9X0_LEIIN/31-188---------------------------------------DLTLDDI.FHYC....PDRLRR-----------------FR
A4IAM2_LEIIN/15-170---------------------------------------VDSTDTK.WNRC....HNRRNR-----------------FR
A4I9R7_LEIIN/15-171---------------------------------------FLTSDQL.WANC....TGRRNR-----------------FR
A4HAL2_LEIBR/14-189---------------------------------------SERTAYV.WSEC....PGRVSR-----------------FK
Q4DU87_TRYCC/14-171---------------------------------------VISGNDV.IHEC....YAVLEL-----------------FR
Q4Q309_LEIMA/15-169---------------------------------------FVYIDKM.FINC....PPRLPR-----------------FR
A4H9E8_LEIBR/48-205---------------------------------------GLNASRQ.WRFC....PNRLNR-----------------FR
A4HI43_LEIBR/25-189---------------------------------------ARRITDPPIINC....SDIHTR-----------------FE
Q4Q6L8_LEIMA/15-171---------------------------------------NNPSDTR.WALC....PNHRNN-----------------FR
A4HB00_LEIBR/15-170---------------------------------------NITVYTV.WADC....PVRLRL-----------------FR
A4I6E5_LEIIN/15-171---------------------------------------TNPSDKR.WANC....PIRRRN-----------------FR
A4H605_LEIBR/152-298---------------------------------------DLKVSDI..HDC....SYEMQY-----------------WQ
A4H9E9_LEIBR/15-171---------------------------------------DNSNDGL.WRNC....HNRRDR-----------------FR
A4HAJ4_LEIBR/51-207---------------------------------------GLSAAEQ.WKDC....PDRLHR-----------------FR
A4H5G7_LEIBR/15-171---------------------------------------LMTSDYL.WRRC....TGRRDR-----------------FR
Q4QHJ4_LEIMA/134-280---------------------------------------DLEVSDI..HDC....SYEMQS-----------------WK
A4HGF8_LEIBR/158-312---------------------------------------SAVSVRT.MKDC....PVEKQF-----------------YQ
Q4Q1U9_LEIMA/15-169---------------------------------------AAYIDAT.FRPC....PHRIAR-----------------FR
A4IAM1_LEIIN/15-170---------------------------------------ALDTDEK.WATC....HKRRSR-----------------FR
Q4QI87_LEIMA/15-171---------------------------------------DVSYDEL.WANC....NDRLLQ-----------------FR
Q384H3_TRYB2/301-450---------------------------------------TYRTGLL...KC....VGLRRV-----------------LS

PF07803

GSG1_HUMAN/8-118-------------------------------------------------------K...GL-----------------AA
GSG1L_HUMAN/2-133-------------------------------------------------------Q...GG-----------------RA
Q4SN53_TETNG/4-143-------------------------------------------------------P...VK-----------------MK
Q4SCG5_TETNG/5-121-------------------------------------------------------P...TK-----------------HT
GSG1L_DANRE/2-113-------------------------------------------------------K...DR-----------------RH
Q4S7Q6_TETNG/2-112-------------------------------------------------------K...LR-----------------TH
GSG1L_XENTR/2-125-------------------------------------------------------A...VK-----------------SK
Q4SAX5_TETNG/2-120-------------------------------------------------------PPVRVK-----------------QS

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257TGTPLYDALDLRV.---------------......FNIPAAANSSSHTDLNILGLAHAAAA-----------------DI
A1DMY3_NEOFI/52-247SAAALASMVKAE..---------------.......GIQGNDAGAAD.PLNLIWIAQNFKE-----------------KI
A3LV03_PICST/62-245TLNTLANVSGIS..---------------........IIPTSTKSTQPQLDLVGLAKVFS.-----------------NI
A5E535_LODEL/80-252QLPQLSLDLT....---------------................NNVVFNLLDIAKSFSD-----------------.L
A7EL23_SCLS1/52-241SPDEIASTLH....---------------.........V.........DANIVQLGQKLQN-----------------DI
A7TJZ8_VANPO/66-260EKTKLYNDVSLTLL---------------......NIQSTNSTSTPS.KINILELAKLTSD-----------------NV
B5VE06_YEAS6/60-260SSVPLYRDLEIQLS---------------......NIASSSSKTQSSVVLNILKLAQLTSV-----------------NV
B6HGM8_PENCW/52-252NVQVLANLIQAQKP---------------.....VNNGNASTRFIPD.PLNLIMMADEFKE-----------------KI
B8MZW1_ASPFN/73-257NATALAEVVT....---------------..............VDQD.PLNLIWVASTFKD-----------------AV
B8NY21_ASPFN/72-267NAAALASMVKDQ..---------------........GLQGSNDTAD.PLNLIWIAKNFKE-----------------TI
B9WIK5_CANDC/65-244QLDSFPKFSI....---------------..............SILSGHLDLIQLAQSFSS-----------------NI
C0NA65_AJECG/81-270DIQPLAKVIS....---------------..........DQKKSNID.PLNLIYMSKAFKD-----------------RM
C0SH54_PARBP/74-258NATALADMLQ....---------------..............SEDD.PLNLVWVAATFKD-----------------AV
C1G9K9_PARBD/72-262NAEALANAIR....---------------..........EQKASDAD.PLNLLYMSKAFKD-----------------QT
C4JX23_UNCRE/51-235NATALAGYTQ....---------------..............PEDD.PLNLIWVASTFKD-----------------AV
C4QXD3_PICPG/65-260SIGKFNKDFMGV..---------------.......SLYSSGTNTTAAFIDLVSIVDAFSN-----------------RM
C4YC02_CLAL4/51-224NASDLAPYAT....---------------.............ISVGESSLSLVEVSKALR.-----------------NV
C5DEC8_LACTC/64-258SNAPLYDDLDVKVF---------------......NIRSSNSSSTQATQLNILQLAEDSSV-----------------RL
C5DPI4_ZYGRC/66-266ANNPLYNDLSIELF---------------NV..PSSDKKSTQKQLPI.NLNILELAETTSR-----------------YV
C5G079_ARTOC/74-258NATILAESLG....---------------..............VESD.PLNLIWVASTFKD-----------------AV
C5M8V3_CANTT/127-303QLESFPTYSI....---------------..............SILDGTLDLVKLAQSFS.-----------------SI
YEJ7_SCHPO/33-201QFTGCPGLTS....---------------....................ISLTDVRSKFLI-----------------NE
Q0CSC3_ASPTN/220-409KAKKLVALVE....---------------..............GVQD.PLNILAIADNFRD-----------------EV
Q0U808_PHANO/74-259NATALVDNLN....---------------..............VDQD.PLNLVWVAATFKD-----------------AV
Q0V1Y2_PHANO/45-209.....SRFIK....---------------..........GDHGLDDS.HVKLIKAVKKMQY-----------------GA
Q59WR6_CANAL/68-244TYTGLDSFPK....---------------..........FSISMLSG.DLDLVQLAQSF.S-----------------NI
Q6BL79_DEBHA/62-241DLDSI.SDYTGI..---------------.......SIIPTTKNGTD.QLNLVTLAKTFR.-----------------KV
Q6CH13_YARLI/62-243NLTALEDMFPSL..---------------........SITQSGTNSS.ALGLIQLATQFTG-----------------DI
Q6CW51_KLULA/66-265DDMDIFDDLTIKIF---------------.....SFKNSNSTEESESSNLNILELAHQNSD-----------------EL
Q6FQP2_CANGA/65-266ENESIYSDITLQLF---------------NV.PKSSQSSNTTTSTPV.TLNLLELAQITAA-----------------KV
Q870W5_NEUCS/62-268DPDEPQDIIHLTEL---------------LFPQVMNNSNARGAIPE..LQNMVLTGLDLQD-----------------Q.
YNB1_SCHPO/52-216.....HELRN....---------------..............WDQT.TGGLAYETSRFAW-----------------LQ

PF06687

Q4WWY3_ASPFU/5-166TTDEI..SNTDNSE......................................FDLPSSTRR.............S...LS
Q75E26_ASHGO/7-202GFAPR..DHWGDSS.......................................EMPENFIS......KRATYFYL...SR
Q757N9_ASHGO/7-167GPERV..F........................................SGTQWAMGQDMRR.............V...LG
A5DJU1_PICGU/4-217PARFNNLENAPSSSV.................................DTGFIQLPSRTRY.............T...VS
PALI_DEBHA/4-238PPETDAFYSFMDDENGE.............................YPDFAAAELPSRARY.............V...IS
Q0V6X2_PHANO/4-166DTEQL..FRNQPTP.....................................DFSLPAASRH.............A...LS
Q6BIN6_DEBHA/7-162VLSKI..DK........................................SAGWLLAPSTRD.............T...LA
A5DHH0_PICGU/5-162TLGDI..DK........................................GSGWTLAPSTRN.............S...LS
Q6C1Y6_YARLI/7-199PFDPV..RNFGTEE.......................................GIPQEFIG.......THKWYYL...TR
Q6BLL9_DEBHA/5-198PISPK..DNFDTTS.......................................NVPKDFVD......NRGTYYYL...SR
A5DC91_PICGU/5-198PLSPV..DNFETSS.......................................SVPQDFVD......NRDTYYYL...TR
Q6BME8_DEBHA/24-312IFDYK..DELELIG....................................LQSILAYAYQSSDLNDKKYEETIAK...RN
A5DG26_PICGU/5-318KFDPL..TVLKHEINDTINDTVDGNGVVSNA.IGSTVKQQLTQLVDNLSYENLNLPGNLKK......DLTLLNNL...TR
MAC1_SCHPO/6-177NASSS...........................................LIDDFYYKGDKRL.............V...LS
PALI2_KLULA/3-167SKDDILLFNE.......................................QEYLHLPNHAKY.............A...LS
PALI1_KLULA/4-168SLDDILLFND.......................................NEYLHLPNHAKY.............A...LS
PALI_ASHGO/5-170SAEDGFLFAG.......................................QDELSLPTQAKY.............S...LS
PALI_CANGA/6-170RPDSIETYKY.......................................TDQLLFPSLYKV.............T...IS
A7TPS6_VANPO/6-170RYPQSSLL.........................................ALKFRLPSGIRY.............S...VT
PALI_YARLI/7-167NLVDS.D..........................................NAGFSLPSNARH.............T...LS
A6ZMC2_YEAS7/4-169DSTDVDSS.........................................GHVLTLPSNSKV.............V...VS
PALI_CANAL/4-232PSTNSTFYAYDNDES................................FGTGGIVLPSDVRY.............T...IS
A5E4Z6_LODEL/4-205PSSNSSNFVLQDNY....................................DGVVLPSDVKY.............T...IS
A3LUV8_PICST/4-233PSVNSTFYLMANDND................................FDNNGVRLPSSVTY.............T...IS
A6SN30_BOTFB/4-166STESLYDETQ.......................................SATFDLSTKTRS.............T...LS
PALI_MAGO7/4-169DEGLAAALADK......................................NANFDLPSQARR.............T...LS
Q2H463_CHAGB/4-183SHLSTQDLSTYPGPL.................................HAEGFSLNASTRS.............T...LS
PALI_NEUCR/4-175DTLLILTAAFSDKI...................................NSDFDIPRATRS.............T...LS
Q0CX64_ASPTN/5-167TNDDMTSTGS.......................................SSDFNLPSTTRV.............S...LS
A2QF35_ASPNC/5-165ADDDITSE.........................................DGTFSIAPGTRR.............S...LS
A6R830_AJECN/5-168TSNGLFNDASR......................................DEDFSLPSSVRH.............S...LS
MUG33_SCHPO/5-166NSD..................................................YLDEHAKD......GFRTSVIVRQRAS
Q4P8U5_USTMA/5-204SATFGINSNNTATA..................................ARESVTIGSS....................WT
A3LTF9_PICST/7-165SLSDVDDK.........................................TDNWLLANSSRD.............N...LA
A5DUT6_LODEL/7-165DLASVDDS.........................................STNWVMSSSTRN.............T...LA
Q5ALR6_CANAL/7-166PLDFTGSIKDN......................................SSGYLFMNDTRT.............T...LA
A6ZNI8_YEAS7/5-176HPDELSDS.........................................DSNWKLNSNARS.............I...LG
A7TT16_VANPO/7-179DPYTLQNDSD.......................................NTNWKLSSKARD.............S...LG
Q6CX71_KLULA/9-171HPENLDDD.........................................DSNWKMNNDSRK.............A...LG
Q6FSP2_CANGA/9-169HPETLDDDE........................................NTKWFLPQSSRA.............K...LS
A7A250_YEAS7/7-175NTSKE.........TLP.............................GPSLERWWLSPKARH.............T...IG
A1CFA3_ASPCL/8-205PFDPPSHRNFGTTT.......................................NIPSAFIG......TNH.YFLT...SR
A2QNP6_ASPNC/8-205PFDPPSHRNFDTTQ.......................................NIPSAFIG......TNH.YFLT...SR
A6R6X6_AJECN/8-204PLDPPSSWNFDTTD.......................................GVPPQFIG......TSR.YFYI...TR
Q0V6H1_PHANO/8-203PFDPP..RNFGTQT.......................................GIPEQFIG......THQ.YYYL...SR
Q5AH49_CANAL/4-201PYSPE..DNFGRNS.......................................GIPQNFID......DRDTYYYL...SR
A5E7B2_LODEL/4-201PYSPK..DNFGSES.......................................GLPESFIS......NRNTYYYL...SR
A5DAF8_PICGU/6-205PFSPQ..DNFSTKQ.......................................GIPKSFVS......HRDTYYYL...TR
Q5A4M8_CANAL/5-199PISPE..DNFGTTA.......................................DIPKDFVD......NENTYYYL...SR
A3LV33_PICST/5-198PISPV..DNWDTNV.......................................NVPQKFID......NRDTFYYL...SR
SUR7_YEAST/9-206PISPV..DNFNTHI.......................................NVPHQFIS......KRDAFYYL...TR
A7TH74_VANPO/9-205PISPV..DNFHTRE.......................................NVPERFIS......NRNAYYYL...PR
Q753Q0_ASHGO/8-202PLSPA..DNFGGV.........................................LPARFVE......DQDTFFYL...SR
Q6CXH5_KLULA/9-205PLSPV..DDFGTTE.......................................GFPSDFVN......NRDTYYYL...TR
Q2H574_CHAGB/3-201PLGD...AWASNAR.......................................NAPSELIGSHGNDTTSYFYWYM...WR
Q7SI65_NEUCR/8-206PLGD...AWDSNPA.......................................GAPAGLTGKYGGHTTSHYFWYM...WR
A6SND7_BOTFB/8-206PLGY...AWVGGGS.......................................GAPSSIRGSYGKSTTSFTYFYM...WR
A7EBS7_SCLS1/8-206PFGY...AWVGGGD.......................................GAPSSLLGSHAKNTTSSSYYYM...WR
Q6FT41_CANGA/7-205PFSPK..DNFGESP.......................................NMPRTFID......HRKTYYYL...SK
A7TIB3_VANPO/11-209PFSPK..DNFGPSD.......................................NMPRTFLD......NRNAYYYL...SR
Q6CJ71_KLULA/7-204PFSPR..DNFGNSP.......................................DLPASFRD......NRNTYYYL...SR
FMP45_YEAST/7-205PFSPR..DNFGNSV.......................................NLPSSFRN......NRDTYYYL...SR
YNT4_YEAST/7-206PFSPR..DNFGSSP.......................................LMPSTFLN......NRNAYYYL...SR
A7TTI2_VANPO/7-207PFSPV..DNFLTTV.......................................GVPKSFIK......NRNTYFYL...SR
Q55HH6_CRYNB/6-242PMEPLAGMIGDVPSKF...............................RIQTVNIIPSSTFK......DNSYNHGM...SK
Q4PHQ4_USTMA/26-258EFVPV..EAILADAPQD.............................ARQPIRELLPEGTFS......NSKYLGDY...SK
PUN1_YEAST/6-240NFNLS..SLVYDNINNNEA........................LELMDSVASVVLPEKLKS......KMTYYNNL...VK
Q6FPE4_CANGA/6-240TFNLK..NLLKDNIENNQV........................LQLVDDVAKIVLPQQLQD......KLVYYNNL...VK
A7TGC8_VANPO/6-240QFDLQ..TLLGDSVNNNQA........................TKLIESIEDIIIPDKLED......KKGYYNNL...AK
Q6CWP2_KLULA/5-243QFDLE..KLLKDNVENNQV........................TELIDQVISLALPDELDD......KMSYYNAL...IK
Q59US7_CANAL/25-311VFDYI.........NQL.............................ESIGLEIILAYAYQSSTFTTTSYEKQVSS...RN
A5E006_LODEL/6-375FFDPV..EILKEELNRTIDGKSVDSQSDDISQLSQTYKSELKQLIDNLSLLDLNLPGNLQN......DLKTLNNL...TK
A5E421_LODEL/6-397FFDPL..EIFKQEMNRTIDDISVDTQSQQINQLSQQYKTELKLLIDNLSALDLNLPGNLQN......DLTLLNNL...TT
Q6BMS1_DEBHA/5-319FFDPL..EIIKQELNNTINDKITGASGSID..ISSDVRTVLEQIVDNITYETLNLPGNLNK......QLTLLNNL...TK
A3LZK7_PICST/5-323QLKPI..DLFKTELNNTLNNRVNGLPAGIQT.AASTYSNQLQLLLNSIGDDNLQLPGNLNE......NIDRLNTV...TV
Q5ADV0_CANAL/6-394FFNPV..EIFKKEMNNTLYGIQVDSQAAGIGQLSYTQKSELKVLIDHLDIDELNLPGNING......KLQQLHNL...TN
Q2UBQ3_ASPOR/26-275WFNPV..EIIMSELL.................................SGATIALPGDITD......ALKIARIA...SH
A2QQ39_ASPNC/26-275WFNPV..EIILSELL.................................SGATIALPADITS......ALHIARIA...SH
Q5BDP9_EMENI/26-276WFNPV..QIILSELL.................................SGASIALPSDITD......ALDLARAA...SH
Q0CQ07_ASPTN/27-276WFNPV..EIILSELL.................................SGATIALPADITD......ALKIARLA...SH
YDO9_SCHPO/12-275YFNPL..TMLETSINNA.............................TGSQINITLPSEVDL......GLKVLKGA...CY
Q0TZ73_PHANO/4-276KFDPT..RIVEEALNRTT..........................GQRVTLQDLKWPQDIED......GVKALNAL...MA
Q7SFF9_NEUCR/5-286NVSDILDKELRVGPFK...............................LTLEDIGFNDEVQS......ALDTLNRV...IR
A1DME7_NEOFI/9-255YFNPI..TIWQLND..................................TGVEDVLPNDLSK......ALNVYKNV...SK
Q2UPQ3_ASPOR/9-255WFNPI..EVWNLEE..................................TGVENGLPSGLRK......SLNLYKNV...SK
Q0CRK6_ASPTN/9-256WFNPL..DVWNLEE..................................SGLENALPDGLEK......TLNIYKNV...SK
A2QPC4_ASPNC/9-256WFNPL..EVWNLEE..................................SGLENALPSKVKS......SLNTYKAV...SK
Q5B2L7_EMENI/9-256WFDPV..EVWNLKT..................................LGLQNAIPDDLQD......ALNVYKNV...SK
A6RDR9_AJECN/9-246WFDPV..KEWDLEDLV..............................KDKDGHKFLPSSLDK......GLSAYRKV...AG
Q0V4X3_PHANO/9-258WFDPF..SVWKLED..................................TSLQKAVGEDLQK......GLNTYKKV...AG
Q2UF28_ASPOR/9-224WFDPI..DTWGLNG..................................TNTNDFLPGKLKK......SLNMYRNV...SL
Q2TX92_ASPOR/9-279WFNFT..EVLGLES..................................SWAEKIFPSEVEK......VVGVYKVA...SK
Q7SG51_NEUCR/8-271AEDAL..NGTQHDINSL............................LTLTGQNVTLPKEVTD......AFKTYVTA...SK
Q2HFG4_CHAGB/9-276AATAL..NTTTGDFNSM............................LTATGLNVTLPKEITD......AVRAFGTV...SK
A6RLC7_BOTFB/8-271AATSL..NTTSIDTLA..............................SATGVNATLPSEVKH......ALKTFTVV...SK
A2R5N4_ASPNC/9-229YFNVL..KATGEEG....................................KETDLSSALRR......SLRAYKTT...ST
Q5K881_CRYNJ/4-176DLVIN...........................................GATDVNINQTVLH.............N...LT
Q4PH32_USTMA/4-186SFDPNQLLGIQ......................................VVGSRYTSAVIK.............G...LT
Q5KGB3_CRYNJ/7-189EFDPNTVFG........................................ISSFDIPEAITK.............Y...LT

PF00822

CLD7_HUMAN/4-182ATRALMVVSL....V--LG-FL--------------------------AMFVA-T----------------------M--
CCG2_MOUSE/6-197DTAEYFLRAVRASSI--FP-IL--------------------------SVILL-F----------------------M--
EMP3_HUMAN/1-156AVQVLMVLSL....I--LC-CL--------------------------SFILF-M----------------------F--
EMP1_MOUSE/1-154AVQAFMILSI....I--FS-II--------------------------SLVVF-V----------------------F--
CLD1_MOUSE/4-182ATRALMVIGI....L--LG-LI--------------------------AIFVS-T----------------------I--
CLD10_HUMAN/4-179ACRGLMIAAV....S--LG-FF--------------------------GSIFA-L----------------------F--
PMP22_HUMAN/1-153SVQATMILSI....I--FS-IL--------------------------SLFLF-F----------------------C--
EMP1_RABIT/1-154AVQAFMILSI....I--FS-VI--------------------------SLIIF-V----------------------F--
LMIP_BOVIN/1-157AFMILSSLCA....T--SG-II--------------------------MGIVA-F----------------------A--
EMP2_MOUSE/1-165AVQATMILST....I--LS-CI--------------------------SFLIF-L----------------------L--
CLD7B_DANRE/4-182ATRALMVVAI....L--LT-VA--------------------------GLGVA-S----------------------M--
EMP1_HUMAN/1-151TVQAFMILSI....I--FC-VI--------------------------ALLVF-V----------------------F--
EMP2_HUMAN/1-160AVQATMILST....I--LC-CI--------------------------AFFIF-V----------------------L--

PF13903

TM235_HUMAN/16-197AVIVVLPLSL....V--LL.VC--------------------------GWICG.L.---------------------L--
TM235_MOUSE/16-192TVMVVLPLSL....V--LI.VC--------------------------GWVCG.L.---------------------L--
B4Q2K5_DROYA/16-232SCIALFIISF....V--TI.FC--------------------------AFWTG.L.---------------------S--
TM182_XENTR/15-225FWNIFMLLGV....V--TA.VI--------------------------GGFLI.I.---------------------C--
Q16RP0_AEDAE/16-235SVIAAFILSF....V--AI.FC--------------------------AFWTG.L.---------------------S--
TM182_MOUSE/15-220FWAVLLLLGV....V--AA.LT--------------------------ASFLI.I.---------------------C--
D2HQ99_AILME/17-198SAAAIAIFSL....G--FI.IM--------------------------GTTCA.L.---------------------L--
A7SGP9_NEMVE/19-204ATVGFCALSL....P--FI.CF--------------------------GLGMA.C.---------------------Y--
B4NZC2_DROYA/16-190SVQLFATLC.....F--VM.CL--------------------------VVIPL.T.---------------------A--
Q1L8R4_DANRE/69-258ASAMFAIISL....F--LM.VM--------------------------GAICI.I.---------------------M--
B0WVP8_CULQU/16-190AVQFFFTLCF....T--LL.LL--------------------------GILMT.L.---------------------L--
B4H3C9_DROPE/44-223FFYTLAFIGM....L--LS.AI--------------------------GVLVFFL.---------------------C--
B4KVB2_DROMO/40-219FFYTLTFIGM....L--VS.AI--------------------------GVLVF.FL---------------------C--
Q17AR2_AEDAE/35-214FFYTLCTIGV....I--LSMIM--------------------------VLFFF.L.---------------------C--
Q6E5P4_TAKRU/18-198VAQ...........V--LM.ML--------------------------AVVAG.L.---------------------V--
Q5DCP0_SCHJA/66-231SALFFTILGS....S--FL.LS--------------------------GIF.....---------------------S--
B0WVM7_CULQU/17-198VMSYWLWLGTAIGAG--LG.AL--------------------------GGAVG.A.---------------------I--
C1BSD7_9MAXI/17-200LYVTTVAMLI....G--GI.FF--------------------------GGLTV.I.---------------------L--
B4NIE2_DROWI/17-198LGTGFGLLAC....A--VA.AI--------------------------ASVLK.A.---------------------A--
B4HC72_DROPE/17-198LGTGFGL.......L--AC.AV--------------------------AAIAA.V.---------------------L--
A9VEC0_MONBE/368-521ATAAFLVLAI....L--AT.FA--------------------------AIVLI.I.---------------------F--
B3LY06_DROAN/17-198LGTGFGLLAC....A--VA.AI--------------------------AAVLK.S.---------------------A--
TMM47_XENTR/28-170ATLALLLGGA....A--II.LI--------------------------AFLVG.L.---------------------I--
TM225_HUMAN/18-160VVRIMMTSSL....G--LS.FL--------------------------LNLIL.G.---------------------M--
A8Q053_BRUMA/17-199VSWVFILFSLAIGIL--WN.VV--------------------------GAVVA.L.---------------------L--
B4K6W4_DROMO/17-198LTTLGTGFGL....L--AC.TI--------------------------AAIAA.V.---------------------L--
A6H7D9_BOVIN/18-203VVIVFLALGL....F--SS.LL--------------------------SAGFT.F.---------------------C--
B4MC21_DROVI/17-198WLWLLTTLGT....G--FG.LL--------------------------SCAIA.A.---------------------I--
B7QNM3_IXOSC/25-197FVQSMMTLAL....M--FA.FT--------------------------ALVLV.S.---------------------I--
B5X0V8_SALSA/21-162ATLVLLLAGA....A--VT.LV--------------------------TFLVT.L.---------------------I--
A7SYX5_NEMVE/51-211FVVSICCIGI....V--AS.MF--------------------------ACLLD.L.---------------------C--
B3P1Z4_DROER/17-198LTTLGTGFGL....L--AC.AV--------------------------AAIAA.V.---------------------L--
A9V5F7_MONBE/26-226TRDAAAAIAI....I--TV.LA--------------------------AAFAL.T.---------------------L--
B4I3M6_DROSE/17-198LTTLGTGFGL....L--AC.AV--------------------------AAIAA.V.---------------------L--
Q16T28_AEDAE/17-198IGTGLGALGG....A--VS.AV--------------------------ASVLK.S.---------------------S--
B4QV06_DROSI/17-198LGTGFGLLAC....A--VA.AI--------------------------AAVLK.S.---------------------A--
B4PTR2_DROYA/17-198.GTGFALLAC....A--VA.AI--------------------------AAVFK.S.---------------------A--

PF07062

O45670_CAEEL/8-219AILFFIITSE----F--LA-FI--------------------------SICSG-V----------------------C--
A8XPM2_CAEBR/9-213AVLILNVISM----I--FM-SL--------------------------SIASI-I----------------------F--
A8XPM1_CAEBR/5-202TLFHIYLISQ----A--FA-ML--------------------------SLIS.-F----------------------C--
A8XPW0_CAEBR/10-221STMILLGFAL----L--TT-GL--------------------------STFIG-A----------------------C--
Q18135_CAEEL/11-221FTLGFMLCAI----V--LA-AL--------------------------SLLCG-I----------------------C--

PF10242

Q7PMA1_ANOGA/11-202FTMTLMCVGT----M--L.-LG--------------------------LTLVSTL----------------------V--
LHPL4_RAT/22-200AAAFFVLLSM----V--LI-LG--------------------------CITCFAL----------------------F--
LHPL3_XENLA/22-199AASFFIGLSM----T--LI-IG--------------------------CIVSFGL----------------------F--
TMHS_RAT/25-202TAMFFVALAM----F--LI-IG--------------------------SIICFSL----------------------F--
TMHS_CHICK/25-202TAMFFVGIST----F--LI-IG--------------------------SILCFSL----------------------F--
Q4STB3_TETNG/22-199TAMFFVGISM----L--LV-VG--------------------------SIVCFSL----------------------F--
Q4TFH6_TETNG/25-207SVAVLVGVSL----W--AV-WT--------------------------SVLCLCL----------------------F--
Q178A0_AEDAE/25-199VATVFCGLAV----A--TS-VL--------------------------AICCLLL----------------------M--
Q2M056_DROPS/25-199LATFFMMGAI----G--LA-LL--------------------------TIFFLVC----------------------L--
Q9XVU1_CAEEL/19-183ISAFLVLAAT----V--LS-FL--------------------------AIFSILL----------------------L--
LHPL2_HUMAN/9-204ATAIFLAVGI----F--I.-LC--------------------------MVALVSV----------------------F--
Q4S279_TETNG/9-201ATSIFLAAGI----L--L.-LC--------------------------AVAFISV----------------------F--
Q568B9_DANRE/9-197ATVIFLVIGI----F--L.-LS--------------------------VVGILSV----------------------F--
Q4RUW4_TETNG/9-195AAILFLAAGT----L--L.-LG--------------------------GVACISI----------------------F--
Q9W0X9_DROME/9-195AAMFFVMLGF----S--L.-LS--------------------------VTVILTL----------------------I--
Q292M2_DROPS/9-197AAMFFISLGF----A--L.-LS--------------------------VTVLLTL----------------------L--
LHFP_MOUSE/8-193ICTIVTGLGC----G--L.-LL--------------------------LVALTAL----------------------M--
LHPL1_RAT/8-192MCTVVTGAGC----A--L.-LL--------------------------LVALAAV----------------------L--

PF06653

Q8ITZ9_CAEEL/47-208YATIFCQCII----GWLIG-SI--------------------------VNKTKIKK---------------------S--
Q9TZ35_CAEEL/1-155FISFGLFFPV----I..LI-YL--------------------------HASHKVYH---------------------H--
A8WY95_CAEBR/1-161FITVAFTLTA----I..FA-YF--------------------------IVQARVLH---------------------S--
A8XQE4_CAEBR/1-163YIAFLAFIPA----I..GC-YM--------------------------IAVREDFK---------------------T--
A8WYV7_CAEBR/1-134..........----.....-..--------------------------...FKVYR---------------------Q--
A8WK96_CAEBR/1-140..........----.....-.G--------------------------NGVREVNQ---------------------Y--
A8XRC8_CAEBR/1-182CVVICMILSL----I..VQ-IV--------------------------AIIYNLLT---------------------C--
A8XQE5_CAEBR/1-150NLPVGCYIGM----L..II-FG--------------------------VNTRLICN---------------------Q--
Q9XUZ7_CAEEL/1-168EVSLFCTVLV----L..IQ-LI--------------------------VTSNNIRR---------------------N--
Q2WF57_CAEEL/1-166FISFGLFIPL----I..LV-VL--------------------------FTAYKVHH---------------------D--
O45515_CAEEL/1-161FISLSLAVVV----S..LF-TA--------------------------MLFRDVRR---------------------H--
A8XR11_CAEBR/1-188YLNFACSILT----F..LF-CV--------------------------IGAIIFIL---------------------R--
B6IEW4_CAEBR/1-156LGTLALSSIT----V..VI-FF--------------------------YVYYQVKN---------------------N--
Q95YB5_CAEEL/1-123FASIAFFVVL----K..II-FG--------------------------LAQSLTTK---------------------S--
A8WK67_CAEBR/1-167FISFGLFFPL----I..LI-YL--------------------------HAAYKVHH---------------------H--
Q95XC2_CAEEL/1-191YTTVVCQFMV----ALMYG-FI--------------------------VYETKIKK---------------------R--
B6IFT2_CAEBR/1-179YIASALCFVI----F..FF-YI--------------------------AFLHILKK---------------------H--
A8XQE6_CAEBR/1-167CSSFCFFITL----S..IW-YI--------------------------VNLIIINR---------------------F--
B6IEW3_CAEBR/1-114YIALGLSMVS----L..LC-FM--------------------------VAFLLVRK---------------------D--
A8XWG5_CAEBR/1-169LTAFVLYVFL----VGFLV-FA--------------------------LISCLVQK---------------------Y--
O45334_CAEEL/1-161YISVACHLLV----T..IL-LT--------------------------LVFRDVRR---------------------N--
A8WY98_CAEBR/1-166FISFATFLLM----F..FF-VY--------------------------NARSKIHH---------------------H--
B6IKT5_CAEBR/1-215YVSLALLLVV----I..LS-YC--------------------------LIVNQIRK---------------------N--
B6IKT4_CAEBR/1-120YFSFLQFAFT----F..LI-YL--------------------------YTVFVVYR---------------------N--

PF07344

A4I9X4_LEIIN/377-531AAQGCAIISV-------FV-FA--------------------------AALIAGLT...-----------------.L--
A4HBJ2_LEIBR/15-170VAQALAIVSI-------LV-YG--------------------------AAFVLGVI...-----------------.M--
A4H6C8_LEIBR/15-170MAEVFAVISI-------FV-YG--------------------------LAALFGFI...-----------------.V--
Q4Q3F7_LEIMA/15-171AAQVLAVISI-------FV-YG--------------------------AAFVLGVL...-----------------.L--
A4H5H1_LEIBR/15-170RAQVFAIISI-------CV-YG--------------------------LAALLGFI...-----------------.A--
A4HBJ0_LEIBR/15-171VAQVFAVISI-------FV-YG--------------------------AAAALGFM...-----------------.M--
Q7KPY0_LEIBR/5-180VSEAFYIVAV-------IV-SF--------------------------LSCLMSGL...-----------------.Y--
A4HB47_LEIBR/18-199AAEALSVASV-------VV-SA--------------------------LAFLFGVV...-----------------.M--
A4I9X2_LEIIN/15-169LAQGCAIISI-------VV-YF--------------------------AALVLGFL...-----------------.L--
Q4Q339_LEIMA/15-170LAQGCAIISI-------LV-YG--------------------------AAFVLGLV...-----------------.L--
Q27227_TRYCR/14-171MAGAFSIISI-------LL-LL--------------------------AATILGVA...-----------------.A--
Q4E0S1_TRYCC/20-182TTQAFSIISI-------FL-TF--------------------------ASIITVGM...-----------------.L--
Q4Q3A7_LEIMA/14-189IAQVCAIAGA-------VI-LA--------------------------ASLLGSFL...-----------------.D--
A4HAZ8_LEIBR/15-170VAEAFAIISI-------FL-YG--------------------------AAFVLGVL...-----------------.M--
Q4QIA0_LEIMA/15-170LCQVFAIISI-------LV-YG--------------------------AAFLFGFL...-----------------.L--
Q4Q8C7_LEIMA/145-338AGSAFSIISV-------LA-SA--------------------------ATLVSSWV...-----------------.L--
Q585K0_TRYB2/9-167VIEAGVLISV-------LT-GF--------------------------AALVFIILSNC-----------------KI--
A4H5D1_LEIBR/15-173AAQAFAVISI-------FV-YL--------------------------AAFLLGVI...-----------------.M--
Q9GU51_LEIIN/15-171AAQAFAILSV-------VV-YG--------------------------TAFVLGLF...-----------------.A--
A4HB02_LEIBR/15-170AAGVLAIISI-------FI-FA--------------------------AAFVLGVS...-----------------.M--
A4H5G6_LEIBR/15-171LAQAFAVISI-------LI-YG--------------------------AATVLGFI...-----------------.K--
A4I9W9_LEIIN/15-171AAQAFTIISI-------LV-YG--------------------------AAFIAGLT...-----------------.L--
A4HDL4_LEIBR/18-168GGAAFAIISI-------LT-TL--------------------------VALFFGIM...-----------------.M--
Q4QHJ3_LEIMA/241-414AAAVLSIISD-------AF-LF--------------------------PTFLFSVA...-----------------.A--
A4HAJ6_LEIBR/28-184LAQACAVLSI-------FV-YG--------------------------AAAALGFI...-----------------.M--
E9AG83_LEIIN/15-171IGQILSIISV-------FV-YA--------------------------LAALLGFI...-----------------.M--
A4H7D7_LEIBR/15-172VAQAFAVMSI-------FV-YL--------------------------AAVVLGVI...-----------------.M--
A4I4J2_LEIIN/15-171LAQAFDVISL-------AV-YL--------------------------SAFVLGLI...-----------------.L--
Q4QAK7_LEIMA/19-166CGAAFGVMAS-------AC-GF--------------------------AGLISAIV...-----------------.L--
Q4QI88_LEIMA/15-171VAEALAVISI-------FV-YG--------------------------LAFIFGVL...-----------------.M--
A4HBJ1_LEIBR/15-170AAEAFAIISI-------LV-YG--------------------------AAFVLGVL...-----------------.M--
A4HGJ1_LEIBR/143-338TGSAFAILSI-------LA-ST--------------------------VTVVTSWL...-----------------.L--
Q4Q3A8_LEIMA/18-199AAEALSIAAV-------LI-SA--------------------------LACLIGFV...-----------------.M--
A4HI41_LEIBR/20-195VAQAFYIIAV-------IV-SF--------------------------LSSLLSGL...-----------------.Y--
A4HDI3_LEIBR/87-236GGAVFAIISL-------FT-TL--------------------------AALVLAVM...-----------------.L--
A4I4J3_LEIIN/81-236VAQAFAVISV-------FV-YG--------------------------AAFLFGLF...-----------------.L--
E9AHT2_LEIIN/15-171AAQALAVISI-------FL-YG--------------------------AAFVLGVL...-----------------.L--
E9AG85_LEIIN/15-170IGEAFAVISI-------FV-YG--------------------------AAFLFGFL...-----------------.L--
Q4Q327_LEIMA/15-169IAQAFAIISI-------FV-YF--------------------------AAFVMGLV...-----------------.L--
A4HTM4_LEIIN/15-171VAQALAVISI-------VV-YG--------------------------LAFILGFI...-----------------.M--
Q4Q8C6_LEIMA/374-525VGAAFSIVTL-------IV-LL--------------------------VNFAAAVI...-----------------.A--
Q4Q397_LEIMA/79-235AAQALAVISI-------FV-YG--------------------------AAFVLGVL...-----------------.L--
A4IAL7_LEIIN/15-170AAQAFVVISI-------FV-YG--------------------------TAFVLGLI...-----------------.A--
A4H5G0_LEIBR/15-170AAQAFAVISI-------FV-YG--------------------------LAALFGFI...-----------------.M--
A4H606_LEIBR/64-214AMEAFTILGC-------LL-SL--------------------------ASLLAGIL...-----------------.Q--
Q4Q317_LEIMA/15-172VAQAFAIISI-------LV-YF--------------------------AAFFFGLL...-----------------.L--
A4I0W5_LEIIN/18-168GGAAFAIVSV-------FT-TL--------------------------AALVFGIL...-----------------.M--
A4I9W8_LEIIN/77-234LAQVFAVISI-------FL-YG--------------------------AAFILGLI...-----------------.V--
A4H5D2_LEIBR/15-171TARVLALVSI-------VV-FG--------------------------LASLLGFM...-----------------.T--
A4H5G5_LEIBR/226-381LAQALAVLSI-------FI-FG--------------------------AAAALGVV...-----------------.M--
A4I9X1_LEIIN/15-170LAQGCAIISI-------FV-YG--------------------------AAFMLGFI...-----------------.L--
Q384H4_TRYB2/118-295TGAAFSIISI-------CL-LA--------------------------SIIYLYIR...-----------------.S--
Q4CVL1_TRYCC/26-174FGEAFSICAL-------YF-AV--------------------------VAGIGSWY...-----------------.V--
A4I5B9_LEIIN/26-190AAEAFSILAI-------FS-LV--------------------------GLFGASWY...-----------------.M--
A4I0W4_LEIIN/18-166TGAAFAIISI-------LT-TL--------------------------AALVFIAL...-----------------.M--
A4I9X0_LEIIN/31-188ALQIFVIVSI-------VV-YG--------------------------AAFIAGFT...-----------------.L--
A4IAM2_LEIIN/15-170ASEALAVISI-------MV-YC--------------------------AAFVLGFI...-----------------.M--
A4I9R7_LEIIN/15-171AAQASAVISI-------FL-YG--------------------------AAFVLGVL...-----------------.L--
A4HAL2_LEIBR/14-189TAQVFAIGAA-------II-LI--------------------------ASILANLL...-----------------.N--
Q4DU87_TRYCC/14-171VAEASSIVSI-------AL-LL--------------------------AATILGVL...-----------------.S--
Q4Q309_LEIMA/15-169VAQAFALISV-------LV-YG--------------------------AAFIAGLT...-----------------.L--
A4H9E8_LEIBR/48-205LAQAFALISI-------FV-YG--------------------------LAFVLGVI...-----------------.Q--
A4HI43_LEIBR/25-189AAEAFSVLAI-------FS-LF--------------------------GVLGGSWY...-----------------.K--
Q4Q6L8_LEIMA/15-171VGQVFAIITI-------FV-YA--------------------------ASVVFGVL...-----------------.W--
A4HB00_LEIBR/15-170AAGALAIISI-------FI-YG--------------------------AAFVLGVV...-----------------.M--
A4I6E5_LEIIN/15-171IGQAFAVITI-------FV-YG--------------------------LAFLFGFL...-----------------.L--
A4H605_LEIBR/152-298AVAATSVLAT-------FA-SC--------------------------GAMISGVL...-----------------.L--
A4H9E9_LEIBR/15-171ALQAFALISI-------FV-YG--------------------------AAFVMGVI...-----------------.M--
A4HAJ4_LEIBR/51-207LAQVLAIISI-------FV-YG--------------------------TAFVLGFI...-----------------.M--
A4H5G7_LEIBR/15-171LAQAFAVISI-------FV-YG--------------------------AAAALGFI...-----------------.M--
Q4QHJ4_LEIMA/134-280AAAAMSVLAT-------VT-SF--------------------------GAMISGVL...-----------------.L--
A4HGF8_LEIBR/158-312TIAVCTIVGC-------AL-SL--------------------------VSLLITGA...-----------------.R--
Q4Q1U9_LEIMA/15-169LAQAFALISI-------LV-YG--------------------------AAFVLGLV...-----------------.L--
A4IAM1_LEIIN/15-170MAEALAAISI-------MV-YC--------------------------AAFVLGVI...-----------------.M--
Q4QI87_LEIMA/15-171VAEALAVISI-------FV-YG--------------------------LAFILGFI...-----------------.A--
Q384H3_TRYB2/301-450AGVVFNILAI-------IL-LA--------------------------AALGCCILFLK-----------------RD--

PF07803

GSG1_HUMAN/8-118KCFDMPVSLDG.DTNTS..-...........TQ...............EVVQYNWE---------------------T--
GSG1L_HUMAN/2-133NCPNSGANATANGTAAPAA-AAAAATASGNGPP...............GGALYSWE---------------------T--
Q4SN53_TETNG/4-143NCGQNNSEPYTTESPTQNP-Y......NRTLSPARRDELAKIRQRQLANAVHYIWE---------------------T--
Q4SCG5_TETNG/5-121NCIPVPGVSNS........-............................SNIQFFWE---------------------T--
GSG1L_DANRE/2-113NCIDYGVNET.........-...........DP...............SKVHYSWE---------------------T--
Q4S7Q6_TETNG/2-112QCIDYGVNET.........-...........DP...............NKVVYSWE---------------------T--
GSG1L_XENTR/2-125NCQALALNSSSTGSDATDT-N.......GTLNP...............NVVHYNWE---------------------T--
Q4SAX5_TETNG/2-120FCIRFNSSNVN........-...........DS...............RLVQYIFE---------------------T--

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257DHPYIFMISI-------I---L--------------------------AILMFCILLYVT.............VP.ML--
A1DMY3_NEOFI/52-247VFDGLIFITV-------V---L--------------------------TFLCFILLATFPGWHEE.IDENGSERE.VK--
A3LV03_PICST/62-245CHPHILMTVI-------I---L--------------------------VLVMLLLITYSS................IP--
A5E535_LODEL/80-252CHPHMLMTTV-------I---L--------------------------TLITLVTLCYL.................IL--
A7EL23_SCLS1/52-241SI.FMPMVAL-------A---L--------------------------FLLGFLVDTF..A.........W.....LF--
A7TJZ8_VANPO/66-260IHPYVLMATI-------V---L--------------------------TILMFILLVYVT.............VPYEL--
B5VE06_YEAS6/60-260IHPYVLMATV-------I---L--------------------------TILMFLFILYVT.............VP.KL--
B6HGM8_PENCW/52-252VFNGLIYIVV-------A---L--------------------------MFICFLLLSTFPGWHEE.VGDDGDERQ.VK--
B8MZW1_ASPFN/73-257VFPYLLIVAV-------I---L--------------------------AFFCFILLATFPGWHEE.IDSTGSERE.VK--
B8NY21_ASPFN/72-267VFDGLIFIAV-------A---V--------------------------AFICFLALATFPGWHEE.VDEDGSERE.VK--
B9WIK5_CANDC/65-244CHPRILLTTI-------I---L--------------------------TLINLLLLCYCV.............IP.IV--
C0NA65_AJECG/81-270VFSGLIFASI-------P---F--------------------------LFVCFLLLATFPTWQDE.VDSNGSEVQ.VK--
C0SH54_PARBP/74-258VFPYLIIVAI-------I---L--------------------------AFICFILLATFPGWHEE.ITEDGSDRE.VK--
C1G9K9_PARBD/72-262VFSGLIFASI-------P---F--------------------------VFICFLLLSTFPGWHED.LNSSGSEQE.VR--
C4JX23_UNCRE/51-235VFPYLIIVAL-------I---F--------------------------AFICFLILGTFPGWHEE.LNDDGSERE.VL--
C4QXD3_PICPG/65-260VKPYLLMAIL-------V---L--------------------------SICLFCNLLY.............SALP.FM--
C4YC02_CLAL4/51-224CHPRLLATSL-------A---L--------------------------CLVLLLVM....SW.......LA..LP.LV--
C5DEC8_LACTC/64-258IHPYVLMAVI-------V---L--------------------------TIVMFCCTLF.............ATIP.KL--
C5DPI4_ZYGRC/66-266VHPYILMVTV-------I---L--------------------------ATLMFLMLIYST.............IP.AL--
C5G079_ARTOC/74-258VFPYLIIVAL-------I---F--------------------------AFLSFLLLATFPGWHEE.LNQQGSDIE.VK--
C5M8V3_CANTT/127-303CHPRILFATI-------V---L--------------------------TLVSLLLLCYM.................LI--
YEJ7_SCHPO/33-201VHPWMIVFSF-------C---V--------------------------CGVSFLMGVVSS.................L--
Q0CSC3_ASPTN/220-409IVSVVIIIAI-------V---M--------------------------TLVGVYGMSTFPRWQDNMDDDTGSEME.GT--
Q0U808_PHANO/74-259VFPYLLIVAI-------I---L--------------------------AFFTFVLLATFPGWHEERDEQTGSDVD.VK--
Q0V1Y2_PHANO/45-209MYPLPAGAAI-------L---L--------------------------FIIFVS......................FL--
Q59WR6_CANAL/68-244CHPRILLATI-------I---L--------------------------TLIGLIIL....C.........YCVIP.IV--
Q6BL79_DEBHA/62-241CYSNVLLAAI-------V---L--------------------------TLLSLVVM....F.........WNVIP.LV--
Q6CH13_YARLI/62-243VHPSLPVVTL-------V---L--------------------------DVLVFVFV....L.........WSIFA.FI--
Q6CW51_KLULA/66-265VHPYLLMVVT-------I---F--------------------------TILLFGITVY.............AIIP.KL--
Q6FQP2_CANGA/65-266VHPHLLIATV-------A---F--------------------------TVLEFIGMTYYL.............IP.LL--
Q870W5_NEUCS/62-268IFGKVLLTGS-------A---L--------------------------FALGLVLM..FPLKLV..KKKLAKLAP.GT--
YNB1_SCHPO/52-216VHPVLLAIVV-------V---F--------------------------STLSIVLT....IL.......KY.....LA--

PF06687

Q4WWY3_ASPFU/5-166SILIVHPVAA-------F...L--------------------------TLVCLCLA--------------------AA..
Q75E26_ASHGO/7-202VGWAMLVIGL-------F...F--------------------------MVLAILP.--------------------YI.V
Q757N9_ASHGO/7-167RILVVAPVAA-------G...L--------------------------TLLAVVSN--------------------FV..
A5DJU1_PICGU/4-217KLLIVHVVGF-------G...F--------------------------SVILFLIS--------------------GG.L
PALI_DEBHA/4-238KLLVVHIVGF-------C...F--------------------------TTLLFLLS--------------------LA.L
Q0V6X2_PHANO/4-166SILIVHPVAA-------F...M--------------------------TLICFALA--------------------VA..
Q6BIN6_DEBHA/7-162KVFIVCPIAA-------G...I--------------------------SFICLVF.--------------------IL.L
A5DHH0_PICGU/5-162KIFILCPIGA-------G...L--------------------------SLITLLAI--------------------LV..
Q6C1Y6_YARLI/7-199FAFPFYLISL-------F...F--------------------------TVITLFVS--------------------LF..
Q6BLL9_DEBHA/5-198FSFAFTLVAV-------G...F--------------------------TGIALII.--------------------DV.L
A5DC91_PICGU/5-198FAFAFEIISL-------C...F--------------------------AGVSLII.--------------------DI.L
Q6BME8_DEBHA/24-312NKYKLVPSGL-------I...F--------------------------GASSQLVI--------------------LIFG
A5DG26_PICGU/5-318AAFALTIVGV-------V...L--------------------------SFLSVII.--------------------QL.L
MAC1_SCHPO/6-177KVLITHIISA-------F...L--------------------------SFLSAIFV--------------------FF..
PALI2_KLULA/3-167NLLLVHVLAF-------V...C--------------------------VTILWVFG--------------------ML..
PALI1_KLULA/4-168KLLLVHVLSF-------V...C--------------------------VLVFWLFA--------------------IL..
PALI_ASHGO/5-170KLLVVHPLAL-------C...S--------------------------MVVLWLMV--------------------VL..
PALI_CANGA/6-170TLLVVHPVSF-------A...F--------------------------TCILWIMA--------------------LI..
A7TPS6_VANPO/6-170RLLVVHPIAL-------V...F--------------------------VFVLWLMS--------------------LC..
PALI_YARLI/7-167NLLIVHPIAT-------G...F--------------------------TLILTVLA--------------------ML..
A6ZMC2_YEAS7/4-169NLLVVHPISL-------A...F--------------------------TGTLLILA--------------------VI..
PALI_CANAL/4-232KLLVVHVVAF-------C...F--------------------------SSLLLIVI--------------------FGLI
A5E4Z6_LODEL/4-205KLLVVHVVAF-------C...F--------------------------SSLLMTVI--------------------CLLF
A3LUV8_PICST/4-233KLLIVHVIAF-------C...F--------------------------SCILTLIV--------------------LVLI
A6SN30_BOTFB/4-166AILIIHPVAA-------L...F--------------------------TLIMLILA--------------------IA..
PALI_MAGO7/4-169TILIIHPVAA-------L...V--------------------------TLIMFAMS--------------------IA..
Q2H463_CHAGB/4-183SLLIVHPVAG-------L...L--------------------------TLIMFVLA--------------------VI..
PALI_NEUCR/4-175SILIVHPVAA-------L...I--------------------------TLINFVLA--------------------IV..
Q0CX64_ASPTN/5-167SILIVHPVAA-------L...L--------------------------TLICLCMA--------------------IA..
A2QF35_ASPNC/5-165AILIVHPVAA-------F...L--------------------------TLVCLCMA--------------------AA..
A6R830_AJECN/5-168SLLIVHPVAA-------F...L--------------------------TLTCFGLA--------------------AA..
MUG33_SCHPO/5-166YGLVIVPVSA-------CICLI--------------------------STIMTIFA--------------------HI..
Q4P8U5_USTMA/5-204RGLAVHVVAF-------V...A--------------------------ALIALVLT--------------------AIPK
A3LTF9_PICST/7-165KVFIIAPISL-------G...V--------------------------NFILLALI--------------------VA..
A5DUT6_LODEL/7-165KIFIVTPIAL-------G...F--------------------------NFITLIII--------------------AI..
Q5ALR6_CANAL/7-166KIFVLAPIAL-------G...F--------------------------DLILLIVI--------------------FV..
A6ZNI8_YEAS7/5-176KIIFITPIAA-------GLNFL--------------------------GFLCTIMS--------------------VLLI
A7TT16_VANPO/7-179KILIVTPIAA-------GLNFF--------------------------SFLFSLFM--------------------VI..
Q6CX71_KLULA/9-171SILIVTPIAA-------G...L--------------------------TFLALVTS--------------------FL..
Q6FSP2_CANGA/9-169RILIVAPVAA-------GLNFF--------------------------TFASALVL--------------------FALP
A7A250_YEAS7/7-175GLLISIPVAT-------C...L--------------------------TFISFALL--------------------LVII
A1CFA3_ASPCL/8-205FMFPFHIIAL-------F...F--------------------------ATCSLFT.--------------------GF.L
A2QNP6_ASPNC/8-205FSFPFLIIAL-------F...F--------------------------GVVSLFT.--------------------GF.L
A6R6X6_AJECN/8-204FMFAFMLIGV-------F...W--------------------------VVLSLFT.--------------------GL.L
Q0V6H1_PHANO/8-203FMFAFYLIAL-------F...F--------------------------GAVALLT.--------------------GL.L
Q5AH49_CANAL/4-201VGWAFILVGL-------F...F--------------------------GVTAMVA.--------------------AP.L
A5E7B2_LODEL/4-201IGWSFIIVGL-------F...F--------------------------AVIALII.--------------------VP.L
A5DAF8_PICGU/6-205FSYVFFLIGI-------F...F--------------------------TVVALIP.--------------------VA.L
Q5A4M8_CANAL/5-199FAFAFCLIAL-------A...F--------------------------SGLAFII.--------------------DI.L
A3LV33_PICST/5-198FSFAFALIAL-------G...F--------------------------SGLAFII.--------------------DI.L
SUR7_YEAST/9-206FSFCFFWIAL-------A...F--------------------------VGVSFIL.--------------------YV.L
A7TH74_VANPO/9-205FAFCFFWVSL-------A...F--------------------------IGVAFIL.--------------------YI.I
Q753Q0_ASHGO/8-202FAFCFFWIAL-------S...F--------------------------IAIAFLF.--------------------CV.F
Q6CXH5_KLULA/9-205FSFCFFLIAL-------V...F--------------------------IGVGLIF.--------------------YV.L
Q2H574_CHAGB/3-201FGWVFFLIAL-------F...F--------------------------EVLAFFS.--------------------GF.L
Q7SI65_NEUCR/8-206FGWVFFLLAL-------F...F--------------------------ETLAFFS.--------------------GF.L
A6SND7_BOTFB/8-206FGWVFYLMGL-------F...F--------------------------TVFAFFA.--------------------SL.F
A7EBS7_SCLS1/8-206FGWVFYLMGL-------F...F--------------------------TVFAFFT.--------------------SI.L
Q6FT41_CANGA/7-205VGWAMLLISL-------F...F--------------------------TVLAIVP.--------------------IF.L
A7TIB3_VANPO/11-209IGWSFLLVSL-------F...F--------------------------IVTAIIPQ--------------------II..
Q6CJ71_KLULA/7-204VGWAMLLIGL-------F...F--------------------------VVLALIP.--------------------VL.L
FMP45_YEAST/7-205VGWAMLLISL-------F...F--------------------------IVLALVP.--------------------GF.L
YNT4_YEAST/7-206VGWAMLLIGL-------F...F--------------------------LLITLVS.--------------------VI.A
A7TTI2_VANPO/7-207TAWGLWLVGL-------I...F--------------------------NILSFAG.--------------------TI.H
Q55HH6_CRYNB/6-242AGSGLIFVGS-------C...A--------------------------AALALIFG--------------------VI..
Q4PHQ4_USTMA/26-258PAMYLIFIGS-------CLAAL--------------------------AWISGLVS--------------------HR..
PUN1_YEAST/6-240CMFITILIGI-------V...L--------------------------TFVNLVFN--------------------VLRW
Q6FPE4_CANGA/6-240CMFITLIIGI-------V...L--------------------------TFLNLVIN--------------------VLRW
A7TGC8_VANPO/6-240CMFITLIIGI-------C...L--------------------------MFINFVVI--------------------IFRF
Q6CWP2_KLULA/5-243CMSITLVIGI-------A...L--------------------------LGLNIIVN--------------------ILRW
Q59US7_CANAL/25-311AKFQLAFNGI-------I...F--------------------------TCCAQFVI--------------------LICI
A5E006_LODEL/6-375AGFALMIITS-------V...L--------------------------SFISIVV.--------------------QL.M
A5E421_LODEL/6-397ASFALMLITA-------A...L--------------------------SFISIVV.--------------------QL.M
Q6BMS1_DEBHA/5-319AAFALILIMA-------I...L--------------------------SAIGVFV.--------------------QL.I
A3LZK7_PICST/5-323VSFGFLLTAC-------V...L--------------------------SAISVII.--------------------QL.L
Q5ADV0_CANAL/6-394ASFGLLMAVA-------V...L--------------------------SFVSVLI.--------------------QM.L
Q2UBQ3_ASPOR/26-275WMFALFILST-------I...L--------------------------TFVMIFL.--------------------SP.L
A2QQ39_ASPNC/26-275WMFGLFITAT-------V...L--------------------------TFILIFL.--------------------SP.L
Q5BDP9_EMENI/26-276WMFGLFITST-------V...L--------------------------TFVLIFA.--------------------SP.L
Q0CQ07_ASPTN/27-276WMFGLFLAAT-------V...L--------------------------TFVMIFL.--------------------SP.L
YDO9_SCHPO/12-275AMRAMYILGF-------IFFAL--------------------------TIVSIVIS--------------------CLPF
Q0TZ73_PHANO/4-276AMFVLYVIAI-------C...L--------------------------IFVAFVAA--------------------LF..
Q7SFF9_NEUCR/5-286AFAIILIVDV-------ILTGL--------------------------SMLASLLA--------------------IF..
A1DME7_NEOFI/9-255WMFIAYIVAF-------I...A--------------------------TIVELVV.--------------------GL.F
Q2UPQ3_ASPOR/9-255WMFIAYIVAF-------V...A--------------------------TVVELVV.--------------------GV.F
Q0CRK6_ASPTN/9-256WMFVAYIIAF-------I...A--------------------------TVVELVV.--------------------GV.F
A2QPC4_ASPNC/9-256WMFIAYIIAF-------A...L--------------------------TVAELVV.--------------------GV.F
Q5B2L7_EMENI/9-256WMCIAYIIAF-------A...A--------------------------TGLEILL.--------------------GI.T
A6RDR9_AJECN/9-246WMFIAFIVAL-------V...A--------------------------TCVELLV.--------------------GI.A
Q0V4X3_PHANO/9-258WMVWSFIIAL-------V...L--------------------------SVAEFII.--------------------GF.F
Q2UF28_ASPOR/9-224WMAIIYLIAV-------I...A--------------------------TVLEIMT.--------------------GL.M
Q2TX92_ASPOR/9-279GISATYITAL-------T...T--------------------------TVLTLIT.--------------------GL.T
Q7SG51_NEUCR/8-271WAQIVFIIAL-------V...A--------------------------LVVEIVF.--------------------GI.F
Q2HFG4_CHAGB/9-276WTQVVFIIAY-------V...T--------------------------LGIELFF.--------------------GL.F
A6RLC7_BOTFB/8-271WTQVVYIIAL-------I...A--------------------------TALELFL.--------------------GI.F
A2R5N4_ASPNC/9-229WMQITYVLAT-------L...L--------------------------TAVQLLAA--------------------LI..
Q5K881_CRYNJ/4-176YAMILHPIAG-------F...L--------------------------ALLALVFG--------------------LL..
Q4PH32_USTMA/4-186YTLILHPIAL-------A...F--------------------------AVVSVLLG--------------------LI..
Q5KGB3_CRYNJ/7-189YVLILHVVAL-------G...F--------------------------AAIAMIVA--------------------IF..

PF00822

CLD7_HUMAN/4-182-------------------------------------------GMKC---------------------------------
CCG2_MOUSE/6-197-------------------------------------------GGLC---------------------------------
EMP3_HUMAN/1-156-------------------------------------------QLYT---------------------------------
EMP1_MOUSE/1-154-------------------------------------------QLFT---------------------------------
CLD1_MOUSE/4-182-------------------------------------------GMKC---------------------------------
CLD10_HUMAN/4-179-------------------------------------------GMKC---------------------------------
PMP22_HUMAN/1-153-------------------------------------------QLFT---------------------------------
EMP1_RABIT/1-154-------------------------------------------QLFT---------------------------------
LMIP_BOVIN/1-157-------------------------------------------QQPT---------------------------------
EMP2_MOUSE/1-165-------------------------------------------QLFR---------------------------------
CLD7B_DANRE/4-182-------------------------------------------GMKC---------------------------------
EMP1_HUMAN/1-151-------------------------------------------QLFT---------------------------------
EMP2_HUMAN/1-160-------------------------------------------QLFR---------------------------------

PF13903

TM235_HUMAN/16-197-------------------------------------------SSLA---------------------------------
TM235_MOUSE/16-192-------------------------------------------SSLS---------------------------------
B4Q2K5_DROYA/16-232-------------------------------------------GCWK---------------------------------
TM182_XENTR/15-225-------------------------------------------AAPF---------------------------------
Q16RP0_AEDAE/16-235-------------------------------------------GCWK---------------------------------
TM182_MOUSE/15-220-------------------------------------------AAPF---------------------------------
D2HQ99_AILME/17-198-------------------------------------------SFPK---------------------------------
A7SGP9_NEMVE/19-204-------------------------------------------NEFS---------------------------------
B4NZC2_DROYA/16-190-------------------------------------------AFLR---------------------------------
Q1L8R4_DANRE/69-258-------------------------------------------AVSK---------------------------------
B0WVP8_CULQU/16-190-------------------------------------------FLVC---------------------------------
B4H3C9_DROPE/44-223-------------------------------------------AGPD---------------------------------
B4KVB2_DROMO/40-219-------------------------------------------AGPD---------------------------------
Q17AR2_AEDAE/35-214-------------------------------------------AGPD---------------------------------
Q6E5P4_TAKRU/18-198-------------------------------------------ANIC---------------------------------
Q5DCP0_SCHJA/66-231-------------------------------------------LNIK---------------------------------
B0WVM7_CULQU/17-198-------------------------------------------ASVL---------------------------------
C1BSD7_9MAXI/17-200-------------------------------------------SLLN---------------------------------
B4NIE2_DROWI/17-198-------------------------------------------SAAK---------------------------------
B4HC72_DROPE/17-198-------------------------------------------KSAS---------------------------------
A9VEC0_MONBE/368-521-------------------------------------------GLGR---------------------------------
B3LY06_DROAN/17-198-------------------------------------------SGAK---------------------------------
TMM47_XENTR/28-170-------------------------------------------SICV---------------------------------
TM225_HUMAN/18-160-------------------------------------------KFTY---------------------------------
A8Q053_BRUMA/17-199-------------------------------------------NTVA---------------------------------
B4K6W4_DROMO/17-198-------------------------------------------KSAS---------------------------------
A6H7D9_BOVIN/18-203-------------------------------------------NSVS---------------------------------
B4MC21_DROVI/17-198-------------------------------------------AAVF---------------------------------
B7QNM3_IXOSC/25-197-------------------------------------------LLMR---------------------------------
B5X0V8_SALSA/21-162-------------------------------------------SLCR---------------------------------
A7SYX5_NEMVE/51-211-------------------------------------------GTLN---------------------------------
B3P1Z4_DROER/17-198-------------------------------------------KSAS---------------------------------
A9V5F7_MONBE/26-226-------------------------------------------SFCL---------------------------------
B4I3M6_DROSE/17-198-------------------------------------------KSAS---------------------------------
Q16T28_AEDAE/17-198-------------------------------------------SASK---------------------------------
B4QV06_DROSI/17-198-------------------------------------------SAA.---------------------------------
B4PTR2_DROYA/17-198-------------------------------------------SAAK---------------------------------

PF07062

O45670_CAEEL/8-219-------------------------------------------APCV---------------------------------
A8XPM2_CAEBR/9-213-------------------------------------------AYVK---------------------------------
A8XPM1_CAEBR/5-202-------------------------------------------VSVS---------------------------------
A8XPW0_CAEBR/10-221-------------------------------------------ACCH---------------------------------
Q18135_CAEEL/11-221-------------------------------------------APCS---------------------------------

PF10242

Q7PMA1_ANOGA/11-202-------------------------------------------TCCR---------------------------------
LHPL4_RAT/22-200-------------------------------------------FFCN---------------------------------
LHPL3_XENLA/22-199-------------------------------------------FFCN---------------------------------
TMHS_RAT/25-202-------------------------------------------FVCN---------------------------------
TMHS_CHICK/25-202-------------------------------------------FFCN---------------------------------
Q4STB3_TETNG/22-199-------------------------------------------FFCN---------------------------------
Q4TFH6_TETNG/25-207-------------------------------------------RFCS---------------------------------
Q178A0_AEDAE/25-199-------------------------------------------VFMK---------------------------------
Q2M056_DROPS/25-199-------------------------------------------LFMK---------------------------------
Q9XVU1_CAEEL/19-183-------------------------------------------VLLR---------------------------------
LHPL2_HUMAN/9-204-------------------------------------------TMCV---------------------------------
Q4S279_TETNG/9-201-------------------------------------------TMCF---------------------------------
Q568B9_DANRE/9-197-------------------------------------------SMCF---------------------------------
Q4RUW4_TETNG/9-195-------------------------------------------SLCF---------------------------------
Q9W0X9_DROME/9-195-------------------------------------------TCCR---------------------------------
Q292M2_DROPS/9-197-------------------------------------------TCCR---------------------------------
LHFP_MOUSE/8-193-------------------------------------------GCCV---------------------------------
LHPL1_RAT/8-192-------------------------------------------GCCM---------------------------------

PF06653

Q8ITZ9_CAEEL/47-208-------------------------------------------KYSK---------------------------------
Q9TZ35_CAEEL/1-155-------------------------------------------GCCH---------------------------------
A8WY95_CAEBR/1-161-------------------------------------------GFCC---------------------------------
A8XQE4_CAEBR/1-163-------------------------------------------GYTI---------------------------------
A8WYV7_CAEBR/1-134-------------------------------------------GCSH---------------------------------
A8WK96_CAEBR/1-140-------------------------------------------DCKA---------------------------------
A8XRC8_CAEBR/1-182-------------------------------------------LACC---------------------------------
A8XQE5_CAEBR/1-150-------------------------------------------GFTN---------------------------------
Q9XUZ7_CAEEL/1-168-------------------------------------------GYSP---------------------------------
Q2WF57_CAEEL/1-166-------------------------------------------GCCH---------------------------------
O45515_CAEEL/1-161-------------------------------------------GYSY---------------------------------
A8XR11_CAEBR/1-188-------------------------------------------GDSR---------------------------------
B6IEW4_CAEBR/1-156-------------------------------------------DYSS---------------------------------
Q95YB5_CAEEL/1-123-------------------------------------------GFSF---------------------------------
A8WK67_CAEBR/1-167-------------------------------------------GCCH---------------------------------
Q95XC2_CAEEL/1-191-------------------------------------------QYSK---------------------------------
B6IFT2_CAEBR/1-179-------------------------------------------GFSL---------------------------------
A8XQE6_CAEBR/1-167-------------------------------------------GYTP---------------------------------
B6IEW3_CAEBR/1-114-------------------------------------------DYSG---------------------------------
A8XWG5_CAEBR/1-169-------------------------------------------KLC.---------------------------------
O45334_CAEEL/1-161-------------------------------------------GYCH---------------------------------
A8WY98_CAEBR/1-166-------------------------------------------GYGS---------------------------------
B6IKT5_CAEBR/1-215-------------------------------------------YTLV---------------------------------
B6IKT4_CAEBR/1-120-------------------------------------------GYSR---------------------------------

PF07344

A4I9X4_LEIIN/377-531-------------------------------------------LFCC.................................
A4HBJ2_LEIBR/15-170-------------------------------------------LFCC.................................
A4H6C8_LEIBR/15-170-------------------------------------------LFCC.................................
Q4Q3F7_LEIMA/15-171-------------------------------------------LCCC.................................
A4H5H1_LEIBR/15-170-------------------------------------------LCCC.................................
A4HBJ0_LEIBR/15-171-------------------------------------------LYCC.................................
Q7KPY0_LEIBR/5-180-------------------------------------------FIG..................................
A4HB47_LEIBR/18-199-------------------------------------------LCCC.................................
A4I9X2_LEIIN/15-169-------------------------------------------LYGV.................................
Q4Q339_LEIMA/15-170-------------------------------------------LYGC.................................
Q27227_TRYCR/14-171-------------------------------------------HFYL.................................
Q4E0S1_TRYCC/20-182-------------------------------------------FNG..................................
Q4Q3A7_LEIMA/14-189-------------------------------------------ACCC.................................
A4HAZ8_LEIBR/15-170-------------------------------------------LLCC.................................
Q4QIA0_LEIMA/15-170-------------------------------------------LYCC.................................
Q4Q8C7_LEIMA/145-338-------------------------------------------CCRLREADRHVRSPSRYANMGEVALA..QEPDCNDGI
Q585K0_TRYB2/9-167-------------------------------------------PLCC.................................
A4H5D1_LEIBR/15-173-------------------------------------------LFCC.................................
Q9GU51_LEIIN/15-171-------------------------------------------VCWC.................................
A4HB02_LEIBR/15-170-------------------------------------------LFCC.................................
A4H5G6_LEIBR/15-171-------------------------------------------LYCC.................................
A4I9W9_LEIIN/15-171-------------------------------------------LFCC.................................
A4HDL4_LEIBR/18-168-------------------------------------------LIRV.................................
Q4QHJ3_LEIMA/241-414-------------------------------------------VYS..................................
A4HAJ6_LEIBR/28-184-------------------------------------------LYCC.................................
E9AG83_LEIIN/15-171-------------------------------------------LCCC.................................
A4H7D7_LEIBR/15-172-------------------------------------------LFCC.................................
A4I4J2_LEIIN/15-171-------------------------------------------LWCC.................................
Q4QAK7_LEIMA/19-166-------------------------------------------NTQI.................................
Q4QI88_LEIMA/15-171-------------------------------------------LCCC.................................
A4HBJ1_LEIBR/15-170-------------------------------------------LFCC.................................
A4HGJ1_LEIBR/143-338-------------------------------------------CIRFREADREARHQCRYVNVDDAESIAGEANFNNGGA
Q4Q3A8_LEIMA/18-199-------------------------------------------LCCC.................................
A4HI41_LEIBR/20-195-------------------------------------------FMG..................................
A4HDI3_LEIBR/87-236-------------------------------------------LLRI.................................
A4I4J3_LEIIN/81-236-------------------------------------------LWCC.................................
E9AHT2_LEIIN/15-171-------------------------------------------LFCC.................................
E9AG85_LEIIN/15-170-------------------------------------------LYCC.................................
Q4Q327_LEIMA/15-169-------------------------------------------LYGC.................................
A4HTM4_LEIIN/15-171-------------------------------------------LFCC.................................
Q4Q8C6_LEIMA/374-525-------------------------------------------VCCLTQAP.............................
Q4Q397_LEIMA/79-235-------------------------------------------LCCC.................................
A4IAL7_LEIIN/15-170-------------------------------------------LCCC.................................
A4H5G0_LEIBR/15-170-------------------------------------------LCCC.................................
A4H606_LEIBR/64-214-------------------------------------------IKG..................................
Q4Q317_LEIMA/15-172-------------------------------------------IFCC.................................
A4I0W5_LEIIN/18-168-------------------------------------------LIRV.................................
A4I9W8_LEIIN/77-234-------------------------------------------LRCC.................................
A4H5D2_LEIBR/15-171-------------------------------------------MCCY.................................
A4H5G5_LEIBR/226-381-------------------------------------------LFCC.................................
A4I9X1_LEIIN/15-170-------------------------------------------LFCC.................................
Q384H4_TRYB2/118-295-------------------------------------------ALAKYMSQYNAEGQTPARR................ME
Q4CVL1_TRYCC/26-174-------------------------------------------LSG..................................
A4I5B9_LEIIN/26-190-------------------------------------------ICG..................................
A4I0W4_LEIIN/18-166-------------------------------------------LLRI.................................
A4I9X0_LEIIN/31-188-------------------------------------------LFCF.................................
A4IAM2_LEIIN/15-170-------------------------------------------LFCC.................................
A4I9R7_LEIIN/15-171-------------------------------------------LFCC.................................
A4HAL2_LEIBR/14-189-------------------------------------------ACCC.................................
Q4DU87_TRYCC/14-171-------------------------------------------HIYN.................................
Q4Q309_LEIMA/15-169-------------------------------------------LFYC.................................
A4H9E8_LEIBR/48-205-------------------------------------------LFCC.................................
A4HI43_LEIBR/25-189-------------------------------------------ICG..................................
Q4Q6L8_LEIMA/15-171-------------------------------------------LYYC.................................
A4HB00_LEIBR/15-170-------------------------------------------LFYR.................................
A4I6E5_LEIIN/15-171-------------------------------------------LYCC.................................
A4H605_LEIBR/152-298-------------------------------------------CVN..................................
A4H9E9_LEIBR/15-171-------------------------------------------LFCC.................................
A4HAJ4_LEIBR/51-207-------------------------------------------LYCC.................................
A4H5G7_LEIBR/15-171-------------------------------------------LYCC.................................
Q4QHJ4_LEIMA/134-280-------------------------------------------CVN..................................
A4HGF8_LEIBR/158-312-------------------------------------------LVG..................................
Q4Q1U9_LEIMA/15-169-------------------------------------------LFYC.................................
A4IAM1_LEIIN/15-170-------------------------------------------LFCC.................................
Q4QI87_LEIMA/15-171-------------------------------------------LFCC.................................
Q384H3_TRYB2/301-450-------------------------------------------VF...................................

PF07803

GSG1_HUMAN/8-118-------------------------------------------GDDR---------------------------------
GSG1L_HUMAN/2-133-------------------------------------------GDDR---------------------------------
Q4SN53_TETNG/4-143-------------------------------------------GEDK---------------------------------
Q4SCG5_TETNG/5-121-------------------------------------------GDDR---------------------------------
GSG1L_DANRE/2-113-------------------------------------------GDDR---------------------------------
Q4S7Q6_TETNG/2-112-------------------------------------------GDDR---------------------------------
GSG1L_XENTR/2-125-------------------------------------------GDDK---------------------------------
Q4SAX5_TETNG/2-120-------------------------------------------GEEK---------------------------------

PF11381

Q0A7S1_ALHEH/5-63--------------------------------------------------------------------------------
A3WLM6_9GAMM/3-61--------------------------------------------------------------------------------
Q08WE2_STIAD/3-61--------------------------------------------------------------------------------
Q1PY89_9BACT/3-61--------------------------------------------------------------------------------
B2T1Q0_BURPP/3-61--------------------------------------------------------------------------------
C0A3E3_9BACT/3-61--------------------------------------------------------------------------------
A3NQ77_BURP0/3-61--------------------------------------------------------------------------------
Q1D4N9_MYXXD/46-104--------------------------------------------------------------------------------
Q0F2S1_9PROT/25-83--------------------------------------------------------------------------------
A6TU20_ALKMQ/37-94--------------------------------------------------------------------------------
Q11TD1_CYTH3/5-54--------------------------------------------------------------------------------
Q30SB9_SULDN/10-68--------------------------------------------------------------------------------
A1WU28_HALHL/18-76--------------------------------------------------------------------------------
A1SWI4_PSYIN/2-60--------------------------------------------------------------------------------
A6VWJ5_MARMS/4-62--------------------------------------------------------------------------------
Q0AB85_ALHEH/5-63--------------------------------------------------------------------------------
Q07X17_SHEFN/4-62--------------------------------------------------------------------------------
Q3IDA6_PSEHT/4-62--------------------------------------------------------------------------------
A3QG33_SHELP/25-83--------------------------------------------------------------------------------

PF12351

Q75CU4_ASHGO/65-257-------------------------------------------PYKRP..------------------------------
A1DMY3_NEOFI/52-247-------------------------------------------PFPSWP.------------------------------
A3LV03_PICST/62-245-------------------------------------------GFPGRQ.------------------------------
A5E535_LODEL/80-252-------------------------------------------PLPFHA.------------------------------
A7EL23_SCLS1/52-241-------------------------------------------AGLGKP.------------------------------
A7TJZ8_VANPO/66-260-------------------------------------------PFKLY..------------------------------
B5VE06_YEAS6/60-260-------------------------------------------PFKLA..------------------------------
B6HGM8_PENCW/52-252-------------------------------------------PFPSEA.------------------------------
B8MZW1_ASPFN/73-257-------------------------------------------PFPSRP.------------------------------
B8NY21_ASPFN/72-267-------------------------------------------PFPSRR.------------------------------
B9WIK5_CANDC/65-244-------------------------------------------PGKSF..------------------------------
C0NA65_AJECG/81-270-------------------------------------------PFPSKV.------------------------------
C0SH54_PARBP/74-258-------------------------------------------PFPSRF.------------------------------
C1G9K9_PARBD/72-262-------------------------------------------PFPSRI.------------------------------
C4JX23_UNCRE/51-235-------------------------------------------PFPSRP.------------------------------
C4QXD3_PICPG/65-260-------------------------------------------PCKPI..------------------------------
C4YC02_CLAL4/51-224-------------------------------------------PGKVV..------------------------------
C5DEC8_LACTC/64-258-------------------------------------------PGKTY..------------------------------
C5DPI4_ZYGRC/66-266-------------------------------------------PFKYW..------------------------------
C5G079_ARTOC/74-258-------------------------------------------PFPSRP.------------------------------
C5M8V3_CANTT/127-303-------------------------------------------PLVPGKF------------------------------
YEJ7_SCHPO/33-201-------------------------------------------PLIGRLE------------------------------
Q0CSC3_ASPTN/220-409-------------------------------------------PVPSTA.------------------------------
Q0U808_PHANO/74-259-------------------------------------------PFPSRP.------------------------------
Q0V1Y2_PHANO/45-209-------------------------------------------VFRNRPG------------------------------
Q59WR6_CANAL/68-244-------------------------------------------PGKSI..------------------------------
Q6BL79_DEBHA/62-241-------------------------------------------PGKSM..------------------------------
Q6CH13_YARLI/62-243-------------------------------------------PGATQ..------------------------------
Q6CW51_KLULA/66-265-------------------------------------------PFKNY..------------------------------
Q6FQP2_CANGA/65-266-------------------------------------------PFKNW..------------------------------
Q870W5_NEUCS/62-268-------------------------------------------PLTKKQQ------------------------------
YNB1_SCHPO/52-216-------------------------------------------PAYIRQ.------------------------------

PF06687

Q4WWY3_ASPFU/5-166...........................................AHLHAPSH.............................
Q75E26_ASHGO/7-202...........................................SIFTE................................
Q757N9_ASHGO/7-167...........................................SQFSGVHR.............................
A5DJU1_PICGU/4-217VINSLWNDRQRRQLKQSRQLTSPDASVHSKKSIPRARPPKKYDGCLV.................................
PALI_DEBHA/4-238...........................................TVILWLEESETKVPFKDAVRKKVKIRQNSRNNSSTEL
Q0V6X2_PHANO/4-166...........................................AHFHSPAH.............................
Q6BIN6_DEBHA/7-162...........................................SHFLST...............................
A5DHH0_PICGU/5-162...........................................GHCVGS...............................
Q6C1Y6_YARLI/7-199...........................................SLCSR................................
Q6BLL9_DEBHA/5-198...........................................AFCFS................................
A5DC91_PICGU/5-198...........................................GLCFN................................
Q6BME8_DEBHA/24-312...........................................YILYSNRGPEQS.........................
A5DG26_PICGU/5-318...........................................GCFMSPDN.............................
MAC1_SCHPO/6-177...........................................SIFLVNQ..............................
PALI2_KLULA/3-167...........................................TCFRCIKT.............................
PALI1_KLULA/4-168...........................................ICIKWLNT.............................
PALI_ASHGO/5-170...........................................SQCYKHS..............................
PALI_CANGA/6-170...........................................IRLSRFGR.............................
A7TPS6_VANPO/6-170...........................................LFIEKLGT.............................
PALI_YARLI/7-167...........................................AHIQGPAS.............................
A6ZMC2_YEAS7/4-169...........................................IMVTPLGD.............................
PALI_CANAL/4-232IILFFKYIKTKKDLEDI.........QLNDSSHEITIHSDEEDNNNNNIDNTNHNNKRAS....................
A5E4Z6_LODEL/4-205ALESVDRWRYQMKPR.............QEIESEEEREEREQREENEKRDL.............................
A3LUV8_PICST/4-233FLQWLDDDIPIMSRIKR.........GFHIKSVEDEHVTQSFLKPPSRSDSEPTENAHQES...................
A6SN30_BOTFB/4-166...........................................AHFHAPSH.............................
PALI_MAGO7/4-169...........................................AHFHSPSH.............................
Q2H463_CHAGB/4-183...........................................AHFHSPSH.............................
PALI_NEUCR/4-175...........................................AHFHSPSH.............................
Q0CX64_ASPTN/5-167...........................................AHFHGPSH.............................
A2QF35_ASPNC/5-165...........................................AHFHSPSH.............................
A6R830_AJECN/5-168...........................................AHFHSPSH.............................
MUG33_SCHPO/5-166...........................................GAIARSP..............................
Q4P8U5_USTMA/5-204..........................................Q.....................................
A3LTF9_PICST/7-165...........................................AHFTAK...............................
A5DUT6_LODEL/7-165...........................................SHFIGR...............................
Q5ALR6_CANAL/7-166...........................................IHFGSR...............................
A6ZNI8_YEAS7/5-176...........................................NVLSSDRVGS...........................
A7TT16_VANPO/7-179...........................................MSFMSSELA............................
Q6CX71_KLULA/9-171...........................................CQFRFFDS.............................
Q6FSP2_CANGA/9-169DI......................................NIG.....................................
A7A250_YEAS7/7-175...........................................FLFQTGGT.............................
A1CFA3_ASPCL/8-205...........................................AMCT..R..............................
A2QNP6_ASPNC/8-205...........................................AMCT..R..............................
A6R6X6_AJECN/8-204...........................................ALCT..R..............................
Q0V6H1_PHANO/8-203...........................................ALVS..R..............................
Q5AH49_CANAL/4-201...........................................NFCYF................................
A5E7B2_LODEL/4-201...........................................NFCFA................................
A5DAF8_PICGU/6-205...........................................SICLSGF..............................
Q5A4M8_CANAL/5-199...........................................GFCF..E..............................
A3LV33_PICST/5-198...........................................AFCL..L..............................
SUR7_YEAST/9-206...........................................TWCS..K..............................
A7TH74_VANPO/9-205...........................................SWFS..N..............................
Q753Q0_ASHGO/8-202...........................................TWCS..Y..............................
Q6CXH5_KLULA/9-205...........................................SWCS..Y..............................
Q2H574_CHAGB/3-201...........................................ALCS..R..............................
Q7SI65_NEUCR/8-206...........................................ACLG..R..............................
A6SND7_BOTFB/8-206...........................................AMTS..R..............................
A7EBS7_SCLS1/8-206...........................................ALCS..T..............................
Q6FT41_CANGA/7-205...........................................SIFKLAR..............................
A7TIB3_VANPO/11-209...........................................NIFKVIP..............................
Q6CJ71_KLULA/7-204...........................................SFFKVG...............................
FMP45_YEAST/7-205...........................................ATFLPFK..............................
YNT4_YEAST/7-206...........................................SLIRYNR..............................
A7TTI2_VANPO/7-207...........................................TNFYQTP..............................
Q55HH6_CRYNB/6-242................................................................................
Q4PHQ4_USTMA/26-258................................................................................
PUN1_YEAST/6-240...........................................IIHIR................................
Q6FPE4_CANGA/6-240...........................................FLHFS................................
A7TGC8_VANPO/6-240...........................................LVDSV................................
Q6CWP2_KLULA/5-243...........................................ILHFT................................
Q59US7_CANAL/25-311...........................................FVIYSNRGSSRD.........................
A5E006_LODEL/6-375...........................................GCCVSPDN.............................
A5E421_LODEL/6-397...........................................ACCISPDN.............................
Q6BMS1_DEBHA/5-319...........................................GCCVDPSN.............................
A3LZK7_PICST/5-323...........................................AFFFSPNS.............................
Q5ADV0_CANAL/6-394...........................................AFCFSPEK.............................
Q2UBQ3_ASPOR/26-275...........................................ATSSRPPQSIAPDPNVNA...................
A2QQ39_ASPNC/26-275...........................................AVSSRPPQALSSDPVVNQ...................
Q5BDP9_EMENI/26-276...........................................AVSSRPPQTISSDPGVNR...................
Q0CQ07_ASPTN/27-276...........................................AVSSRPPQTISSDPAEND...................
YDO9_SCHPO/12-275................................................................................
Q0TZ73_PHANO/4-276...........................................AVIASGR..............................
Q7SFF9_NEUCR/5-286...........................................FLGNKER..............................
A1DME7_NEOFI/9-255...........................................AICSR................................
Q2UPQ3_ASPOR/9-255...........................................AICSR................................
Q0CRK6_ASPTN/9-256...........................................AICSR................................
A2QPC4_ASPNC/9-256...........................................AICSR................................
Q5B2L7_EMENI/9-256...........................................AIFSR................................
A6RDR9_AJECN/9-246...........................................AVFSR................................
Q0V4X3_PHANO/9-258...........................................AIFSR................................
Q2UF28_ASPOR/9-224...........................................AVGGNR...............................
Q2TX92_ASPOR/9-279...........................................AIVSG................................
Q7SG51_NEUCR/8-271...........................................ANCSR................................
Q2HFG4_CHAGB/9-276...........................................ANCSR................................
A6RLC7_BOTFB/8-271...........................................AMCSR................................
A2R5N4_ASPNC/9-229...........................................VVNKA................................
Q5K881_CRYNJ/4-176...........................................GACAASR..............................
Q4PH32_USTMA/4-186...........................................SHCREF...............................
Q5KGB3_CRYNJ/7-189...........................................AHSPTF...............................

PF00822

CLD7_HUMAN/4-182-------------T--------------RCGG------------------DDKVKKARIAMGG----GI--I-FI-----
CCG2_MOUSE/6-197-------------I--------------AASE------------------FYKTRHN.IILSA----GI--F-FV-----
EMP3_HUMAN/1-156-------------M--------------RRGG------------------LFYA........T----GL--C-QL-----
EMP1_MOUSE/1-154-------------M--------------EKGN------------------RFFL........S----GS--T-ML-----
CLD1_MOUSE/4-182-------------M--------------RCLE------------------DDEVQKMWMAVIG----GI--I-FL-----
CLD10_HUMAN/4-179-------------T--------------KVGG------------------SDKAKAK.IACLA----GI--V-FI-----
PMP22_HUMAN/1-153-------------L--------------TKGG------------------RFYI........T----GI--F-QI-----
EMP1_RABIT/1-154-------------M--------------EKGN------------------RFFL........S----GA--T-ML-----
LMIP_BOVIN/1-157-------------F--------------TRLS------------------RPFS........A----GI--M-FF-----
EMP2_MOUSE/1-165-------------L--------------KQGE------------------RFVL........T----SI--I-QL-----
CLD7B_DANRE/4-182-------------T--------------NCGG------------------DDKVKKSRIAMTG----GI--I-LS-----
EMP1_HUMAN/1-151-------------M--------------EKGN------------------RFFL........S----GA--T-TL-----
EMP2_HUMAN/1-160-------------L--------------KQGE------------------RFVL........T----SI--I-QL-----

PF13903

TM235_HUMAN/16-197-------------.--------------..QS.V................SLLL--------F..T.GC..Y.FL.....
TM235_MOUSE/16-192-------------.--------------..QS.V................PLLL--------A..T.GC..Y.FL.....
B4Q2K5_DROYA/16-232-------------.--------------..RS.S................GAIT--------A..T.SI..L.LLVTCLL
TM182_XENTR/15-225-------------.--------------..TN.H................RIYK--------A..G.GG..L.FI.....
Q16RP0_AEDAE/16-235-------------.--------------..RS.A................GAIT--------A..T.AI..L.MLTACLL
TM182_MOUSE/15-220-------------.--------------..SS.H................FLYK--------A..G.GG..S.YI.....
D2HQ99_AILME/17-198-------------.--------------..KR.D................YLXP--------A..R..............
A7SGP9_NEMVE/19-204-------------.--------------..KP.N................LMVL--------G..TLGVFVM.HI.....
B4NZC2_DROYA/16-190-------------.--------------..TS.RDDD..........RYMVLLL--------A..I.GS..C.QV.....
Q1L8R4_DANRE/69-258-------------.--------------..GV.Q................FFLK--------P..A.AV..C.FI.....
B0WVP8_CULQU/16-190-------------.--------------..SK.DND...........RYIMLLL--------T..N.GT..T.MV.....
B4H3C9_DROPE/44-223-------------.--------------..QK.H................FITL--------IRSV.GY..V.LL.....
B4KVB2_DROMO/40-219-------------.--------------..QK.YF..............ITLIR--------S..V.GY..V.LL.....
Q17AR2_AEDAE/35-214-------------.--------------..QK.FF..............LKLIR--------T..M.GF..L.TL.....
Q6E5P4_TAKRU/18-198-------------.--------------..GA.VAMRLVYFSVADRRNMRLVFV--------L..A.GM..L.YL.....
Q5DCP0_SCHJA/66-231-------------.--------------..RK.R................AFYY--------T..S.VV..L.HI.....
B0WVM7_CULQU/17-198-------------.--------------..KS.SSASKKT...GTLMVLFVSNF--------L..S.GI..S.QV.....
C1BSD7_9MAXI/17-200-------------.--------------..TA.SDP............REAVCH--------F..P.GL..I.ALN...S
B4NIE2_DROWI/17-198-------------.--------------..RG.G................TMVL--------L..L.AS..N.IA.....
B4HC72_DROPE/17-198-------------.--------------..AA.KR.............GGTMVL--------L..L.TA..N.IS.....
A9VEC0_MONBE/368-521-------------.--------------..KG.Y................HVTM--------N.HA.AM..L.TL.....
B3LY06_DROAN/17-198-------------.--------------..KG.G................TMVL--------L..L.AA..N.IS.....
TMM47_XENTR/28-170-------------.--------------..GS.R...............RRFYR--------P..V.AV..M.LF.....
TM225_HUMAN/18-160-------------L--------------IPQN.K................YIQL--------F..T.TI..L.SF.....
A8Q053_BRUMA/17-199-------------.--------------..RE.TDTI..........VGPKGIY--------L..W.SI..L.TA.....
B4K6W4_DROMO/17-198-------------.--------------..AA.KK.............GGTMLL--------L..L.AS..N.IS.....
A6H7D9_BOVIN/18-203-------------.--------------..NP.Y................QTFL--------G.PT.GV..Y.TWS...G
B4MC21_DROVI/17-198-------------.--------------..KS.ASAAKKG...GTMVILLASNV--------S..A.AC..A.QV.....
B7QNM3_IXOSC/25-197-------------.--------------..FL.LRF............EIIVLM--------V..A.FI..L.EA.....
B5X0V8_SALSA/21-162-------------.--------------..GT.H...............RRHYR--------M..V.AV..F.LF.....
A7SYX5_NEMVE/51-211-------------.--------------..KI.L................RWLK--------N..N.SV..ANIL.....
B3P1Z4_DROER/17-198-------------.--------------..AA.KRGGA.......MMLLLT...--------......S..N.IF.....
A9V5F7_MONBE/26-226-------------.--------------..QRGC................CSVL--------F..F.VI..A.LC.....
B4I3M6_DROSE/17-198-------------.--------------..AS.KR.............GGTMIL--------L..L.TS..N.IC.....
Q16T28_AEDAE/17-198-------------.--------------..KS.GTMV..........VLFAANI--------L..S.GL..S.QI.....
B4QV06_DROSI/17-198-------------.--------------.....KR.............GGTMML--------L..L.TS..N.IC.....
B4PTR2_DROYA/17-198-------------.--------------..RG.GA..............MMLLL--------T..S.NI..C.AA.....

PF07062

O45670_CAEEL/8-219-------------P--------------STA...----------------.FAF-------------SI--S-LF-----
A8XPM2_CAEBR/9-213-------------P--------------ARSRIA----------------IIML-------------DA--F-CG-----
A8XPM1_CAEBR/5-202-------------R--------------KESKLP----------------NILR-------------TV--F-LV-----
A8XPW0_CAEBR/10-221-------------S--------------SLA...----------------.LFF-------------TI--I-TL-----
Q18135_CAEEL/11-221-------------S--------------GFA...----------------.VLY-------------AI--L-VA-----

PF10242

Q7PMA1_ANOGA/11-202-------------L--------------HSVYGF----------------SMHK-----------LLCI--F-QG-----
LHPL4_RAT/22-200-------------.--------------....TA----------------TVYK-----------ICAW--M-QL-----
LHPL3_XENLA/22-199-------------.--------------....TA----------------TVYK-----------ICAW--M-QL-----
TMHS_RAT/25-202-------------.--------------....TA----------------TVYK-----------ICAW--M-QL-----
TMHS_CHICK/25-202-------------.--------------....AA----------------TVYK-----------VCAW--M-QL-----
Q4STB3_TETNG/22-199-------------.--------------....AG----------------SVYK-----------ICAW--M-QL-----
Q4TFH6_TETNG/25-207-------------.--------------....AA----------------TVYK-----------ICAW--L-QL-----
Q178A0_AEDAE/25-199-------------.--------------....ST----------------TVFH-----------ICGW--M-QM-----
Q2M056_DROPS/25-199-------------.--------------....ST----------------RVFH-----------ICGW--M-QI-----
Q9XVU1_CAEEL/19-183-------------.--------------....DR----------------HAFI-----------LCSW--L-HF-----
LHPL2_HUMAN/9-204-------------.--------------QSIMKK----------------SIFN-----------VCGL--L-QG-----
Q4S279_TETNG/9-201-------------.--------------QSIMKK----------------SIFN-----------VCGL--L-QG-----
Q568B9_DANRE/9-197-------------.--------------QSILKK----------------SIFN-----------VCGL--L-QG-----
Q4RUW4_TETNG/9-195-------------.--------------QSILKK----------------SLFN-----------ICGL--L-QA-----
Q9W0X9_DROME/9-195-------------.--------------QSACGK----------------SIHN-----------MTAC--A-QV-----
Q292M2_DROPS/9-197-------------.--------------QSAFGK----------------SIHN-----------MTAC--A-QV-----
LHFP_MOUSE/8-193-------------.--------------SELISR----------------TVGR-----------VAGG--I-QF-----
LHPL1_RAT/8-192-------------.--------------EELISR----------------MMGR-----------CMGA--A-QF-----

PF06653

Q8ITZ9_CAEEL/47-208-------------E--------------ILSR------------------FDYI-------------KW--L-FM-----
Q9TZ35_CAEEL/1-155-------------S--------------IRHN------------------FNGI-------------SL--L-CS-----
A8WY95_CAEBR/1-161-------------G--------------CRKW------------------FILI-------------SI--I-AL-----
A8XQE4_CAEBR/1-163-------------R--------------ACKY------------------LLIL-------------AL--M-VF-----
A8WYV7_CAEBR/1-134-------------G--------------VRIN------------------FFGI-------------LI--F-CL-----
A8WK96_CAEBR/1-140-------------Y--------------GRFQ------------------LPFE-------------KA--T-LA-----
A8XRC8_CAEBR/1-182-------------C--------------KKYI------------------IHPL-------------TL--F-AV-----
A8XQE5_CAEBR/1-150-------------S--------------NRTP------------------FLVI-------------AG--L-AL-----
Q9XUZ7_CAEEL/1-168-------------T--------------QRGK------------------FISI-------------AV--L-SL-----
Q2WF57_CAEEL/1-166-------------S--------------IRHC------------------FNSI-------------CL--I-CS-----
O45515_CAEEL/1-161-------------T--------------QRSR------------------FFLL-------------AM--F-AL-----
A8XR11_CAEBR/1-188-------------Y--------------QKYI------------------YVIL-------------CG--S-TF-----
B6IEW4_CAEBR/1-156-------------N--------------LRKW------------------FRII-------------DL--A-SI-----
Q95YB5_CAEEL/1-123-------------L--------------TRIL------------------FFVI-------------AG--F-SA-----
A8WK67_CAEBR/1-167-------------S--------------IRHN------------------FHGI-------------SL--L-CS-----
Q95XC2_CAEEL/1-191-------------E--------------ILSL------------------FYYF-------------KW--F-FL-----
B6IFT2_CAEBR/1-179-------------Q--------------LRKF------------------YYTL-------------SI--L-SL-----
A8XQE6_CAEBR/1-167-------------R--------------VRRL------------------FYSI-------------AF--A-AI-----
B6IEW3_CAEBR/1-114-------------K--------------VKFL------------------LHLI-------------AG--S-SL-----
A8XWG5_CAEBR/1-169-------------.--------------.KTG------------------YLLV-------------GI--L-SA-----
O45334_CAEEL/1-161-------------Y--------------QRSQ------------------FFLI-------------AF--F-SL-----
A8WY98_CAEBR/1-166-------------H--------------TRKW------------------FHFI-------------AL--A-AF-----
B6IKT5_CAEBR/1-215-------------R--------------TRRL------------------LFGI-------------SL--G-TI-----
B6IKT4_CAEBR/1-120-------------S--------------VRKW------------------FKLM-------------TN--N-SG-----

PF07344

A4I9X4_LEIIN/377-531.............S--------------SLRL------------------VCLA-----------------L-NI-----
A4HBJ2_LEIBR/15-170.............S--------------FLRF------------------VCLT-----------------L-NI-----
A4H6C8_LEIBR/15-170.............S--------------FFHW------------------ICLA-----------------L-NI-----
Q4Q3F7_LEIMA/15-171.............S--------------IFRL------------------LCLA-----------------L-NI-----
A4H5H1_LEIBR/15-170.............S--------------CLRW------------------VCLA-----------------L-NI-----
A4HBJ0_LEIBR/15-171.............S--------------VFRL------------------FCLA-----------------L-NI-----
Q7KPY0_LEIBR/5-180.............M--------------KAKV------------------LLVL-----------------L-AV-----
A4HB47_LEIBR/18-199.............R--------------CLRG------------------LCLV-----------------L-NI-----
A4I9X2_LEIIN/15-169.............S--------------LLRW------------------VCLA-----------------L-NI-----
Q4Q339_LEIMA/15-170.............T--------------IHRW------------------VCLA-----------------L-NI-----
Q27227_TRYCR/14-171.............K--------------SLKI------------------FATL-----------------L-LV-----
Q4E0S1_TRYCC/20-182.............K--------------STRR------------------LTLL-----------------L-AV-----
Q4Q3A7_LEIMA/14-189.............C--------------CIKW------------------VCIL-----------------L-NL-----
A4HAZ8_LEIBR/15-170.............P--------------LLRW------------------ICLG-----------------L-NI-----
Q4QIA0_LEIMA/15-170.............S--------------GFRW------------------LCLA-----------------L-NI-----
Q4Q8C7_LEIMA/145-338ENGRQADAPVYDAG--------------NLKK------------------VIMI-----------------V-VA-----
Q585K0_TRYB2/9-167..............--------------.LRI------------------ISTP-----------------L-SI-----
A4H5D1_LEIBR/15-173.............R--------------RLRW------------------VCLA-----------------L-NS-----
Q9GU51_LEIIN/15-171.............P--------------FFRW------------------VCLV-----------------L-NI-----
A4HB02_LEIBR/15-170.............F--------------WLRY------------------VCLG-----------------L-NI-----
A4H5G6_LEIBR/15-171.............D--------------RLRM------------------VCVV-----------------L-NS-----
A4I9W9_LEIIN/15-171.............S--------------FLRL------------------VCLA-----------------L-NI-----
A4HDL4_LEIBR/18-168.............S--------------CPVI------------------LPLF-----------------F-TS-----
Q4QHJ3_LEIMA/241-414.............R--------------PCKW------------------VTVG-----------------F-GA-----
A4HAJ6_LEIBR/28-184.............S--------------FFRM------------------VCVA-----------------L-NI-----
E9AG83_LEIIN/15-171.............S--------------LLRW------------------LCLV-----------------F-NI-----
A4H7D7_LEIBR/15-172.............R--------------YLRW------------------VCLA-----------------L-NC-----
A4I4J2_LEIIN/15-171.............P--------------VLRR------------------VCVA-----------------L-NI-----
Q4QAK7_LEIMA/19-166.............Q--------------IPVI------------------VPFV-----------------L-AA-----
Q4QI88_LEIMA/15-171.............F--------------CLRW------------------VCLT-----------------L-NI-----
A4HBJ1_LEIBR/15-170.............S--------------ILRW------------------VCLG-----------------L-NI-----
A4HGJ1_LEIBR/143-338HNTKQANEAVYDAG--------------NLKK------------------LMMI-----------------V-VA-----
Q4Q3A8_LEIMA/18-199.............R--------------CLRW------------------LCLI-----------------L-NI-----
A4HI41_LEIBR/20-195.............I--------------KAKV------------------ALIV-----------------L-GF-----
A4HDI3_LEIBR/87-236.............P--------------CMVP------------------FALL-----------------F-AG-----
A4I4J3_LEIIN/81-236.............S--------------AFRW------------------VCLA-----------------L-NI-----
E9AHT2_LEIIN/15-171.............S--------------IFRW------------------VCLV-----------------L-NI-----
E9AG85_LEIIN/15-170.............A--------------GFRW------------------LCLA-----------------L-NI-----
Q4Q327_LEIMA/15-169.............T--------------IHRW------------------VCLA-----------------L-NI-----
A4HTM4_LEIIN/15-171.............F--------------FFRW------------------VCLT-----------------L-NI-----
Q4Q8C6_LEIMA/374-525.........HTISL--------------NSRI------------------VLGT-----------------L-GC-----
Q4Q397_LEIMA/79-235.............S--------------ILRW------------------VCLA-----------------V-NI-----
A4IAL7_LEIIN/15-170.............A--------------CLRW------------------ACLA-----------------L-NV-----
A4H5G0_LEIBR/15-170.............P--------------WLRV------------------VCLV-----------------L-NV-----
A4H606_LEIBR/64-214.............R--------------GHLG------------------VTIL-----------------L-GS-----
Q4Q317_LEIMA/15-172.............P--------------CLRW------------------LCLA-----------------L-NI-----
A4I0W5_LEIIN/18-168.............S--------------CAVV------------------FPLI-----------------F-TC-----
A4I9W8_LEIIN/77-234.............P--------------WLRW------------------VCLV-----------------L-NI-----
A4H5D2_LEIBR/15-171.............N--------------SLGW------------------GCLL-----------------L-NI-----
A4H5G5_LEIBR/226-381.............P--------------LLRW------------------ICVM-----------------L-NI-----
A4I9X1_LEIIN/15-170.............S--------------LLRW------------------VCLV-----------------L-NV-----
Q384H4_TRYB2/118-295SRSGILPAEDSIVA--------------SNKW------------------TIVA-----------------V-GG-----
Q4CVL1_TRYCC/26-174.............S--------------KKKW------------------LTVI-----------------A-SA-----
A4I5B9_LEIIN/26-190.............S--------------KIKK------------------AVML-----------------L-AV-----
A4I0W4_LEIIN/18-166.............P--------------CAMF------------------PPLL-----------------F-TC-----
A4I9X0_LEIIN/31-188.............A--------------VLRL------------------TCMA-----------------L-NI-----
A4IAM2_LEIIN/15-170.............S--------------LLRW------------------VCLA-----------------L-NV-----
A4I9R7_LEIIN/15-171.............S--------------IFRW------------------VCLV-----------------L-NI-----
A4HAL2_LEIBR/14-189.............Y--------------CVKY------------------LCIV-----------------L-NL-----
Q4DU87_TRYCC/14-171.............K--------------SLRT------------------LTNV-----------------L-LV-----
Q4Q309_LEIMA/15-169.............S--------------LLRV------------------VCLT-----------------L-NI-----
A4H9E8_LEIBR/48-205.............S--------------YLRW------------------VCLA-----------------L-NI-----
A4HI43_LEIBR/25-189.............S--------------NIKT------------------TVMM-----------------L-SV-----
Q4Q6L8_LEIMA/15-171.............S--------------GFRW------------------LCLA-----------------L-NI-----
A4HB00_LEIBR/15-170.............L--------------ILRW------------------ICLG-----------------L-NI-----
A4I6E5_LEIIN/15-171.............S--------------GFRW------------------LCLA-----------------L-NI-----
A4H605_LEIBR/152-298.............K--------------GHMA------------------ASFI-----------------L-SF-----
A4H9E9_LEIBR/15-171.............R--------------WLRW------------------VCLA-----------------L-NI-----
A4HAJ4_LEIBR/51-207.............S--------------FFRW------------------ICVT-----------------L-NI-----
A4H5G7_LEIBR/15-171.............S--------------FFRM------------------VCLA-----------------L-NI-----
Q4QHJ4_LEIMA/134-280.............K--------------GHMG------------------ASFI-----------------L-SF-----
A4HGF8_LEIBR/158-312.............R--------------SSYG------------------WILL-----------------F-SF-----
Q4Q1U9_LEIMA/15-169.............S--------------LLRL------------------VCLV-----------------L-NI-----
A4IAM1_LEIIN/15-170.............S--------------LLRW------------------VCLT-----------------L-NV-----
Q4QI87_LEIMA/15-171.............L--------------CFRW------------------VCLT-----------------L-NI-----
Q384H3_TRYB2/301-450.............H--------------KWNL------------------VVFV-----------------L-LC-----

PF07803

GSG1_HUMAN/8-118--------------------------------------------------FSFR-------------------SF-----
GSG1L_HUMAN/2-133--------------------------------------------------FLFR-------------------NF-----
Q4SN53_TETNG/4-143--------------------------------------------------FAFR-------------------YF-----
Q4SCG5_TETNG/5-121--------------------------------------------------FVFP-------------------TF-----
GSG1L_DANRE/2-113--------------------------------------------------FLFR-------------------HF-----
Q4S7Q6_TETNG/2-112--------------------------------------------------FLFR-------------------QF-----
GSG1L_XENTR/2-125--------------------------------------------------YAFK-------------------YF-----
Q4SAX5_TETNG/2-120--------------------------------------------------FLLR-------------------KF-----

PF11381

Q0A7S1_ALHEH/5-63-----------------------------------------------------------------------W-QA-----
A3WLM6_9GAMM/3-61-----------------------------------------------------------------------Y-EA-----
Q08WE2_STIAD/3-61-----------------------------------------------------------------------L-KA-----
Q1PY89_9BACT/3-61-----------------------------------------------------------------------V-SA-----
B2T1Q0_BURPP/3-61-----------------------------------------------------------------------G-QA-----
C0A3E3_9BACT/3-61-----------------------------------------------------------------------V-SA-----
A3NQ77_BURP0/3-61-----------------------------------------------------------------------G-QS-----
Q1D4N9_MYXXD/46-104-----------------------------------------------------------------------L-KA-----
Q0F2S1_9PROT/25-83-----------------------------------------------------------------------Y-QL-----
A6TU20_ALKMQ/37-94-----------------------------------------------------------------------Y-NQ-----
Q11TD1_CYTH3/5-54-----------------------------------------------------------------------A-IL-----
Q30SB9_SULDN/10-68-----------------------------------------------------------------------Y-QL-----
A1WU28_HALHL/18-76-----------------------------------------------------------------------Y-QA-----
A1SWI4_PSYIN/2-60-----------------------------------------------------------------------Y-QL-----
A6VWJ5_MARMS/4-62-----------------------------------------------------------------------Y-NI-----
Q0AB85_ALHEH/5-63-----------------------------------------------------------------------W-GL-----
Q07X17_SHEFN/4-62-----------------------------------------------------------------------Y-NI-----
Q3IDA6_PSEHT/4-62-----------------------------------------------------------------------Y-DV-----
A3QG33_SHELP/25-83-----------------------------------------------------------------------Y-NI-----

PF12351

Q75CU4_ASHGO/65-257----------------------------.LNL------------------ALLG-----------------L-SP-----
A1DMY3_NEOFI/52-247----------------------------.VMQ------------------VAMG-----------------L-SA-----
A3LV03_PICST/62-245----------------------------RTTM------------------ITTG-----------------F-AL-----
A5E535_LODEL/80-252----------------------------VVEK------------------FGLG-----------------V-GF-----
A7EL23_SCLS1/52-241----------------------------.VGK------------------VGMV-----------------A-MP-----
A7TJZ8_VANPO/66-260----------------------------.INQ------------------LLLV-----------------W-SS-----
B5VE06_YEAS6/60-260----------------------------.VNK------------------FLLL-----------------L-SS-----
B6HGM8_PENCW/52-252----------------------------.ALL------------------ASLL-----------------A-AS-----
B8MZW1_ASPFN/73-257----------------------------.VSQ------------------AALA-----------------L-IF-----
B8NY21_ASPFN/72-267----------------------------.VSQ------------------AALG-----------------M-ST-----
B9WIK5_CANDC/65-244----------------------------.MKK------------------INTG-----------------L-SF-----
C0NA65_AJECG/81-270----------------------------.VSR------------------VTTV-----------------L-VV-----
C0SH54_PARBP/74-258----------------------------.VSQ------------------IALA-----------------L-IF-----
C1G9K9_PARBD/72-262----------------------------.VSQ------------------LATV-----------------L-AG-----
C4JX23_UNCRE/51-235----------------------------.VSQ------------------VALA-----------------L-IF-----
C4QXD3_PICPG/65-260----------------------------.AER------------------SALV-----------------L-ST-----
C4YC02_CLAL4/51-224----------------------------.VRR------------------VGCG-----------------L-AA-----
C5DEC8_LACTC/64-258----------------------------.LNR------------------FLLA-----------------L-CP-----
C5DPI4_ZYGRC/66-266----------------------------.VLR------------------ATLC-----------------V-SA-----
C5G079_ARTOC/74-258----------------------------.VSQ------------------VALA-----------------L-IF-----
C5M8V3_CANTT/127-303----------------------------IVIK------------------VNTL-----------------F-TF-----
YEJ7_SCHPO/33-201----------------------------FLRN------------------IRIS-----------------L-SF-----
Q0CSC3_ASPTN/220-409----------------------------.ASS------------------LIMA-----------------F-ES-----
Q0U808_PHANO/74-259----------------------------.VSQ------------------VALA-----------------L-IF-----
Q0V1Y2_PHANO/45-209----------------------------KKAG------------------YAIV-----------------A-AW-----
Q59WR6_CANAL/68-244----------------------------.MKK------------------LNAG-----------------L-SF-----
Q6BL79_DEBHA/62-241----------------------------.AKK------------------IACV-----------------L-SA-----
Q6CH13_YARLI/62-243----------------------------.AGI------------------MMMW-----------------T-SI-----
Q6CW51_KLULA/66-265----------------------------.VQF------------------IIMG-----------------L-SA-----
Q6FQP2_CANGA/65-266----------------------------.INI------------------YNIV-----------------L-AS-----
Q870W5_NEUCS/62-268----------------------------FIRR------------------ACYS-----------------T-IW-----
YNB1_SCHPO/52-216----------------------------.WSI------------------SCLT-----------------T-ST-----

PF06687

Q4WWY3_ASPFU/5-166..........................SPRYLL------------------ALLI-----------------L-LL-----
Q75E26_ASHGO/7-202............................KAAY------------------VSTP-----------------A-LW-----
Q757N9_ASHGO/7-167..........................HAGIFV------------------SNLL-----------------W-TI-----
A5DJU1_PICGU/4-217............................PYLT------------------INLM-----------------L-SL-----
PALI_DEBHA/4-238TESTSATKMNSLSDEGTVDNERKSKDITPYLN------------------FMLM-----------------L-SL-----
Q0V6X2_PHANO/4-166..........................SPRYLL------------------ALLI-----------------F-TF-----
Q6BIN6_DEBHA/7-162............................GMII------------------LTLV-----------------L-NI-----
A5DHH0_PICGU/5-162............................VALI------------------LAIV-----------------F-NA-----
Q6C1Y6_YARLI/7-199............................LGSA------------------LAIS-----------------A-NA-----
Q6BLL9_DEBHA/5-198............................IIDK------------------VVIA-----------------F-VS-----
A5DC91_PICGU/5-198............................VIDR------------------IVIA-----------------F-IS-----
Q6BME8_DEBHA/24-312......................LNKIPVFVMN------------------IIAL-----------------I-SV-----
A5DG26_PICGU/5-318...........................CCLSF------------------LNFI-----------------F-EA-----
MAC1_SCHPO/6-177............................AVNI------------------INII-----------------V-VF-----
PALI2_KLULA/3-167..........................SRRMLI------------------IAVL-----------------W-SM-----
PALI1_KLULA/4-168..........................SKSVLL------------------FAVG-----------------W-SM-----
PALI_ASHGO/5-170...........................DRRLT------------------IIIL-----------------W-SF-----
PALI_CANGA/6-170..........................CPIFIL------------------SAAT-----------------W-SL-----
A7TPS6_VANPO/6-170..........................STSYTL------------------GVAL-----------------L-SL-----
PALI_YARLI/7-167..........................SSRYLL------------------FCLV-----------------F-SL-----
A6ZMC2_YEAS7/4-169..........................SPEMLL------------------FTAL-----------------F-SL-----
PALI_CANAL/4-232.................VTINKTIFDLTPFLN------------------LMLV-----------------F-TF-----
A5E4Z6_LODEL/4-205...........................TPYLN------------------MMLI-----------------L-TI-----
A3LUV8_PICST/4-233.................ASSRKKNRDITPWLD------------------LMQA-----------------A-AI-----
A6SN30_BOTFB/4-166..........................SPRYLL------------------GIFI-----------------L-SI-----
PALI_MAGO7/4-169..........................SARYLL------------------IVFI-----------------V-GL-----
Q2H463_CHAGB/4-183..........................SPRYLL------------------VLFI-----------------V-GI-----
PALI_NEUCR/4-175..........................SARYLL------------------ILFI-----------------V-SF-----
Q0CX64_ASPTN/5-167..........................SPRYLL------------------ALLI-----------------L-LL-----
A2QF35_ASPNC/5-165..........................SPRYLL------------------ALLI-----------------L-LL-----
A6R830_AJECN/5-168..........................SPRYLL------------------GLLI-----------------L-LL-----
MUG33_SCHPO/5-166............................GFFN------------------VIGT-----------------I-TF-----
Q4P8U5_USTMA/5-204............................VVRL------------------AAIV-----------------V-NA-----
A3LTF9_PICST/7-165............................TVTI------------------FAII-----------------L-NF-----
A5DUT6_LODEL/7-165............................KAIL------------------FAIV-----------------I-NV-----
Q5ALR6_CANAL/7-166............................VTVL------------------IGIF-----------------V-NV-----
A6ZNI8_YEAS7/5-176.........................ASAIMFF------------------VNLT-----------------F-ST-----
A7TT16_VANPO/7-179.........................SASVIFI------------------LHLF-----------------V-AG-----
Q6CX71_KLULA/9-171..........................STFWFV------------------MNFL-----------------F-SI-----
Q6FSP2_CANGA/9-169............................ALFF------------------VNLT-----------------L-SV-----
A7A250_YEAS7/7-175..........................NVPLIT------------------SNAI-----------------L-HI-----
A1CFA3_ASPCL/8-205............................IGSF------------------VSAL-----------------S-AY-----
A2QNP6_ASPNC/8-205............................IGSY------------------VSSL-----------------M-AW-----
A6R6X6_AJECN/8-204............................IGAW------------------VSAF-----------------F-AV-----
Q0V6H1_PHANO/8-203............................LGGY------------------ISSM-----------------T-TF-----
Q5AH49_CANAL/4-201............................VAGI------------------VGST-----------------T-AF-----
A5E7B2_LODEL/4-201............................IGGT------------------IASV-----------------A-TG-----
A5DAF8_PICGU/6-205............................VSGI------------------LSSL-----------------A-VG-----
Q5A4M8_CANAL/5-199............................IIDK------------------VVIF-----------------L-IT-----
A3LV33_PICST/5-198............................VVDK------------------VVIF-----------------L-VT-----
SUR7_YEAST/9-206............................MLSE------------------MVLI-----------------L-MS-----
A7TH74_VANPO/9-205............................EFTK------------------VLFI-----------------L-MS-----
Q753Q0_ASHGO/8-202............................SFTK------------------VVFT-----------------M-VL-----
Q6CXH5_KLULA/9-205............................SFTK------------------TVFV-----------------T-IV-----
Q2H574_CHAGB/3-201............................LGSM------------------FTGL-----------------I-SL-----
Q7SI65_NEUCR/8-206............................VGAA------------------VSGM-----------------I-AS-----
A6SND7_BOTFB/8-206............................VGSF------------------SGSV-----------------L-SM-----
A7EBS7_SCLS1/8-206............................LGSF------------------IGAW-----------------L-TM-----
Q6FT41_CANGA/7-205............................PLSI------------------TTCV-----------------L-CW-----
A7TIB3_VANPO/11-209............................GIAI------------------WSTV-----------------S-CW-----
Q6CJ71_KLULA/7-204............................VGAV------------------LSTV-----------------S-IW-----
FMP45_YEAST/7-205............................AVPV------------------LYCV-----------------L-SW-----
YNT4_YEAST/7-206............................RTAA------------------LATA-----------------M-SW-----
A7TTI2_VANPO/7-207............................RLFK------------------SYSV-----------------L-RW-----
Q55HH6_CRYNB/6-242............................KLRL------------------TFFI-----------------A-SI-----
Q4PHQ4_USTMA/26-258............................FAFL------------------GAAF-----------------L-SL-----
PUN1_YEAST/6-240............................PLTW------------------FGAF-----------------F-SF-----
Q6FPE4_CANGA/6-240............................FVNF------------------VGGF-----------------V-CF-----
A7TGC8_VANPO/6-240............................FFTV------------------LGIF-----------------F-SA-----
Q6CWP2_KLULA/5-243............................FVNV------------------IGRI-----------------L-SI-----
Q59US7_CANAL/25-311......................LSKIPSLVLH------------------VVTL-----------------I-SL-----
A5E006_LODEL/6-375...........................CCLSF------------------LNFM-----------------L-QV-----
A5E421_LODEL/6-397