Sequence alignment for CL0375

PF00822

CLD7_HUMAN/4-182SG--------------------LQLLGFSMALLG----WV--GLV---ACT----AI-----------------------
CCG2_MOUSE/6-197RG--------------------VQMLLTTVGAFA----AF--SLM---TIA----VG-----------------------
EMP3_HUMAN/1-156MS--------------------LLLLVVSALHIL----IL--ILL---FVA----TL-----------------------
EMP1_MOUSE/1-154ML--------------------VLLAGLFVVHIA----TA--IML---FVS----TI-----------------------
CLD1_MOUSE/4-182AG--------------------LQLLGFILASLG----WI--GSI---VST----AL-----------------------
CLD10_HUMAN/4-179TA--------------------SEIIAFMVSISG----WV--..L---VSS----TL-----------------------
PMP22_HUMAN/1-153ML--------------------LLLLSIIVLHVA----VL--VLL---FVS----TI-----------------------
EMP1_RABIT/1-154ML--------------------VLLAAIFVVHIA----TC--VML---FVS----TI-----------------------
LMIP_BOVIN/1-157MY--------------------SFMGGGLFCAWV----GT--ILL---VVA----TA-----------------------
EMP2_MOUSE/1-165ML--------------------VILAFIIVFHIV----ST--ALL---FIS----TI-----------------------
CLD7B_DANRE/4-182KG--------------------LQLLGFTLSLLG----LI--GLI---IGT----IM-----------------------
EMP1_HUMAN/1-151ML--------------------VLLAGIFVVHIA----TV--IML---FVS----TI-----------------------
EMP2_HUMAN/1-160ML--------------------VLLAFIIAFHIT----SA--ALL---FIA----TV-----------------------

PF13903

TM235_HUMAN/16-197--------------------------------LL----SF--ALL---AAA----VA-----------------------
TM235_MOUSE/16-192--------------------------------LL----SF--ALL---AAA----VA-----------------------
B4Q2K5_DROYA/16-232--------------------------------II----AT--ALL---AIA----FS-----------------------
TM182_XENTR/15-225--------------------------------AL----GI--LIY---LVA----FG-----------------------
A0A023EMM6_AEDAL/16-235--------------------------------II----AV--ALL---AIA----FS-----------------------
TM182_MOUSE/15-220--------------------------------AL----GV--LLF---LVA----FG-----------------------
D2HQ99_AILME/17-198--------------------------------LV----GV--VLA---LVA----VV-----------------------
B4NZC2_DROYA/16-190--------------------------------VF----SL--ICF---IIA----FS-----------------------
Q1L8R4_DANRE/69-258--------------------------------IT----GI--MLT---VLG----VG-----------------------
B0WVP8_CULQU/16-190--------------------------------AV----AF--LFI---LIA----FV-----------------------
B4KVB2_DROMO/40-219--------------------------------IF----AF--AFI---AIA----FA-----------------------
Q17AR2_AEDAE/35-214--------------------------------VI----AL--VTV---LVA----FA-----------------------
Q6E5P4_TAKRU/18-198--------------------------------CL----AW--IFV---MIT----TG-----------------------
B7QNM3_IXOSC/25-197--------------------------------YC----ST--VLL---LIS----FA-----------------------

PF07062

O45670_CAEEL/8-219-K--------------------LLLALSIVLILV----GI--CLT---SAG----CF-----------------------
A8XPM2_CAEBR/9-213-Q--------------------KYQLATLISSVV----SN--FLL---FFA----TI-----------------------
A8XPM1_CAEBR/5-202-L--------------------ILSYTILVLTII----AF--LLT---AAA----LC-----------------------
A8XPW0_CAEBR/10-221-K--------------------GSLFLSILFSFI----GA--GLS---IAA----IL-----------------------
Q18135_CAEEL/11-221-T--------------------IVIISSLILLIV----AL--GLQ---AGG----VM-----------------------

PF10242

Q7PMA1_ANOGA/11-202-----------------------RSLLWFLVTLI----AC--MTL---FGA----IV-----------------------
LHPL4_RAT/22-200-----------------------IGVLWAIFTIC----FA--IIN---VVV----FI-----------------------
TMHS_RAT/25-202-----------------------VGVMWGTLTIC----FS--VLV---MAL----FI-----------------------
TMHS_CHICK/25-202-----------------------MGVLWALFTLC----FS--ILM---VVT----FI-----------------------
Q178A0_AEDAE/25-199-----------------------IAVLWAIFSIC----YA--IIS---VVA----FV-----------------------
Q2M056_DROPS/25-199-----------------------IGVLWAIFTIC----YA--IIG---IVA----FV-----------------------
Q9XVU1_CAEEL/19-183-----------------------VGAIWVLCGLC----TT--VLQ---TLA----LI-----------------------
LHPL2_HUMAN/9-204-----------------------RSMLWTLLSIV----VA--FAE---LIA----FM-----------------------
Q4S279_TETNG/9-201-----------------------RSMLWTLLSIV----AA--FGE---LIA----FM-----------------------
Q568B9_DANRE/9-197-----------------------RSMLWTLMSIV----VA--FAE---LVA----FM-----------------------
Q4RUW4_TETNG/9-195-----------------------RSMLWTLLSII----VA--FAE---LIT----FM-----------------------
Q9W0X9_DROME/9-195-----------------------ASLVWFLCSLV----AD--MLF---AVA----LV-----------------------
Q292M2_DROPS/9-197-----------------------GSLVWFLCTLV----AD--MLI---AAA----LV-----------------------
LHFP_MOUSE/8-193-----------------------TGVIWALLSFL----SA--ATS---CVG----FF-----------------------
LHPL1_RAT/8-192-----------------------VGTFWAFLSLV----TA--VAS---STS----YF-----------------------
B1H157_XENTR/22-199-----------------------IGVLWAIFTIC----FA--IVN---IVC----FI-----------------------
H2SCC7_TAKRU/19-197-----------------------VGVLWAVCTLC----FA--IIQ---VVV----LV-----------------------
H3CMV1_TETNG/22-199-----------------------VGVLWTVFTIT----FA--VIT---VVV----FI-----------------------

PF06653

Q8ITZ9_CAEEL/47-208V.................................----..--...---...----..-----------------------
Q9TZ35_CAEEL/1-155MRK...................VGAIGVL..ILL----GF--IFN---AVS----VF-----------------------
A8WY95_CAEBR/1-161MTHRK.................VYGLGIL..IAL----AS--IAN---FVG----VF-----------------------
A8XQE4_CAEBR/1-163MDWK..................LYALGLM..LII----SW--AAQ---GVG----LF-----------------------
A8WYV7_CAEBR/1-134MSRVQ.................VSILGVL..ILI----SF--VLT---TIS----TF-----------------------
A8WK96_CAEBR/1-140MVR...................KSHCGYGFFLII----AL--LLT---LAS----VF-----------------------
A8XRC8_CAEBR/1-182MCLSG.................LTQILYGLIMTG----SA--ILT---AVA----LF-----------------------
A8XQE5_CAEBR/1-150MNAS..................LFLLGFL..IVI----CS--ILD---IVG----TY-----------------------
Q9XUZ7_CAEEL/1-168MATAK.................RLFFTVV..TIA----AM--ACN---FFG----VL-----------------------
Q2WF57_CAEEL/1-166MRK...................IAAIGGI..VFI----SF--ILT---IVA----MF-----------------------
O45515_CAEEL/1-161MTAVK.................RLFFSAL..NLL----GG--ICI---LIG----VG-----------------------
A8XR11_CAEBR/1-188ML....................LPYACVTALVFL----SI--IFS---GIS----LF-----------------------
B6IEW4_CAEBR/1-156MTDVK.................IAFLGFL..VFN----SL--IFN---ILG----IF-----------------------
Q95YB5_CAEEL/1-123M.................................----..--...---...----..-----------------------
A8WK67_CAEBR/1-167MSRPK.................VGAIGAL..IVV----SF--ILC---AVA----TF-----------------------
Q95XC2_CAEEL/1-191MAD...................LKFLILGIFISI----GF--VLN---IVG----VV-----------------------
B6IFT2_CAEBR/1-179MLYFLIPIPNS.....QSRGAPIIIIGYF.FVVG----GW--LLE---IAA----LL-----------------------
A8XQE6_CAEBR/1-167MDGS..................LVALGFL..VGI----CA--TLN---GVG----VF-----------------------
B6IEW3_CAEBR/1-114M.................................----..--...---...----..-----------------------
A8XWG5_CAEBR/1-169MKWVT.................VETICLLFSVLI----GF--VLN---VLA----VF-----------------------
O45334_CAEEL/1-161MSAVK.................RLFLNIV..VCI----GI--VCN---FFG----VF-----------------------
A8WY98_CAEBR/1-166MGDPK.................LPALIAL..VVL----AF--VAN---AVA----VF-----------------------
B6IKT5_CAEBR/1-215MIILRTNTLQRSDEIPFLLIGEIKTLGVL..ISL----CF--LFH---TYG----LF-----------------------
B6IKT4_CAEBR/1-120M.................................----..--...---...----..-----------------------

PF07344

A4I9X4_LEIIN/377-531--------------------------------FF----AF--LFV---LVG----T.-----------------------
A4HBJ2_LEIBR/15-170--------------------------------FI----AF--FLV---LVG----T.-----------------------
A4H6C8_LEIBR/15-170--------------------------------FI----AF--IFV---LVA----T.-----------------------
Q4Q3F7_LEIMA/15-171--------------------------------FI----AF--FFV---LVG----T.-----------------------
A4H5H1_LEIBR/15-170--------------------------------FI----AF--LCV---LMG----T.-----------------------
A4HBJ0_LEIBR/15-171--------------------------------FI----AF--LLV---LVG----T.-----------------------
A4HB47_LEIBR/18-199--------------------------------LI----AF--LFL---LVG----T.-----------------------
A4I9X2_LEIIN/15-169--------------------------------FV----AF--FFV---LVG----T.-----------------------
Q4Q339_LEIMA/15-170--------------------------------FV----AF--LLV---LVG----T.-----------------------
Q4E0S1_TRYCC/20-182--------------------------------CI----SF--VFA---TVS----T.-----------------------
Q4Q3A7_LEIMA/14-189--------------------------------FV----AI--LFV---AVG----T.-----------------------
A4HAZ8_LEIBR/15-170--------------------------------FI----AF--VFV---VVG----T.-----------------------
Q4QIA0_LEIMA/15-170--------------------------------LI----AF--VAV---MVG----T.-----------------------
Q4Q8C7_LEIMA/145-338--------------------------------WV----HL--LFV---ILS----S.-----------------------
Q585K0_TRYB2/9-167--------------------------------LV----TL--FAV---ASA----VC-----------------------
A4H5D1_LEIBR/15-173--------------------------------FV----AF--LLV---LVA----T.-----------------------
A4HB02_LEIBR/15-170--------------------------------FF----AF--LFV---LVA----T.-----------------------
A4H5G6_LEIBR/15-171--------------------------------LI----AF--FFV---LLA----T.-----------------------
A4I9W9_LEIIN/15-171--------------------------------LV----AF--ILL---LAG----T.-----------------------
A4HDL4_LEIBR/18-168--------------------------------FL----VL--LFV---VIA----T.-----------------------
Q4QHJ3_LEIMA/241-414--------------------------------FI----SG--CVL---TIA----TV-----------------------
A4HAJ6_LEIBR/28-184--------------------------------FI----AF--LLV---LVA----T.-----------------------
E9AG83_LEIIN/15-171--------------------------------FI----AF--LFV---LVG----T.-----------------------
A4H7D7_LEIBR/15-172--------------------------------FV----AF--MFV---LVA----T.-----------------------
A4I4J2_LEIIN/15-171--------------------------------FL----AL--LCL---VVA----T.-----------------------
Q4QAK7_LEIMA/19-166--------------------------------FF----AW--AFA---LVA----T.-----------------------
Q4QI88_LEIMA/15-171--------------------------------LL----AF--LFV---LVG----T.-----------------------
A4HBJ1_LEIBR/15-170--------------------------------FI----AF--LLV---LVA----T.-----------------------
A4HGJ1_LEIBR/143-338--------------------------------WV----HL--LFV---ILS----A.-----------------------
Q4Q3A8_LEIMA/18-199--------------------------------LI----AF--IFI---LVG----T.-----------------------
A4HI41_LEIBR/20-195--------------------------------CT----VF--MFL---VTS----A.-----------------------
A4HDI3_LEIBR/87-236--------------------------------FL----VF--LFV---LVA----T.-----------------------
A4I4J3_LEIIN/81-236--------------------------------FL----AF--FSL---LVG----I.-----------------------
E9AHT2_LEIIN/15-171--------------------------------FI----AF--LLV---LVG----T.-----------------------
Q4Q327_LEIMA/15-169--------------------------------FV----AL--LLV---LVG----T.-----------------------
A4HTM4_LEIIN/15-171--------------------------------FF----AF--LFV---LVG----T.-----------------------
Q4Q8C6_LEIMA/374-525--------------------------------FV----SV--ALA---LVS----I.-----------------------
Q4Q397_LEIMA/79-235--------------------------------FI----AF--FFV---LVG----T.-----------------------
A4IAL7_LEIIN/15-170--------------------------------FI----AF--LFV---LVA----T.-----------------------
A4H5G0_LEIBR/15-170--------------------------------LI----AF--LFV---LVG----T.-----------------------
Q4Q317_LEIMA/15-172--------------------------------FV----AF--LLV---LVG----T.-----------------------
A4I0W5_LEIIN/18-168--------------------------------FL----VL--LFV---VIA----T.-----------------------
A4I9W8_LEIIN/77-234--------------------------------FI----AF--LLV---LVA----T.-----------------------
A4H5D2_LEIBR/15-171--------------------------------FI----AF--MFL---LSG----S.-----------------------
A4H5G5_LEIBR/226-381--------------------------------II----AF--LLV---LVA----T.-----------------------
A4I9X1_LEIIN/15-170--------------------------------FV----AF--FFV---LVG----T.-----------------------
Q384H4_TRYB2/118-295--------------------------------LL----NI--FFA---ILG----T.-----------------------
Q4CVL1_TRYCC/26-174--------------------------------MV----SF--IFF---VIG----T.-----------------------
A4I5B9_LEIIN/26-190--------------------------------FV----TA--TFT---VCG----T.-----------------------
A4I0W4_LEIIN/18-166--------------------------------LA----VF--LFV---IVA----T.-----------------------
A4I9X0_LEIIN/31-188--------------------------------FV----AF--ILL---LVG----T.-----------------------
A4IAM2_LEIIN/15-170--------------------------------LI----AF--LSV---LIG----T.-----------------------
A4I9R7_LEIIN/15-171--------------------------------LI----AF--FFV---LVG----T.-----------------------
A4HAL2_LEIBR/14-189--------------------------------FV----AV--LFI---TVG----T.-----------------------
Q4DU87_TRYCC/14-171--------------------------------FT----AL--LLM---LTG----T.-----------------------
Q4Q309_LEIMA/15-169--------------------------------FV----AF--LLV---LAG----T.-----------------------
A4H9E8_LEIBR/48-205--------------------------------FF----AF--FFV---LFG----T.-----------------------
A4HI43_LEIBR/25-189--------------------------------FV----AL--VFS---TCG----T.-----------------------
Q4Q6L8_LEIMA/15-171--------------------------------FI----AL--LCV---MIG----T.-----------------------
A4HB00_LEIBR/15-170--------------------------------FF----AF--LFV---LVA----T.-----------------------
A4I6E5_LEIIN/15-171--------------------------------FI----AL--LCV---MIG----T.-----------------------
A4H605_LEIBR/152-298--------------------------------TV----AF--IFH---LTS----SC-----------------------
A4H9E9_LEIBR/15-171--------------------------------FF----AF--FFV---LVA----T.-----------------------
A4HAJ4_LEIBR/51-207--------------------------------FF----AF--LFV---LFG----T.-----------------------
A4H5G7_LEIBR/15-171--------------------------------VI----AF--VLV---LFG----T.-----------------------
Q4QHJ4_LEIMA/134-280--------------------------------AA----AF--VCH---LTS----SC-----------------------
A4HGF8_LEIBR/158-312--------------------------------SI----AF--VFT---LAA----AC-----------------------
Q4Q1U9_LEIMA/15-169--------------------------------FV----AF--LLV---LAG----T.-----------------------
A4IAM1_LEIIN/15-170--------------------------------LI----AF--LSV---LIG----T.-----------------------
Q4QI87_LEIMA/15-171--------------------------------FL----AF--LFV---LVG----T.-----------------------
Q384H3_TRYB2/301-450--------------------------------FL----AF--LLT---LVA----H.-----------------------
A4I5B8_LEIIN/20-195--------------------------------CI----VF--MFL---VTS----A.-----------------------
Q4DDC5_TRYCC/14-171--------------------------------FL----AF--LFV---LVG----T.-----------------------

PF07803

F1RBI8_DANRE/5-124--------------------RRSRSLLSLILTSL----AL--ALS---VLA----FC-----------------------
H9GN86_ANOCA/23-152--------------------RRGRALLAVGLNLL----AL--LFS---ATA----FG-----------------------
F1QA75_DANRE/4-115--------------------RRRRASLALLLNLL----AL--LLA---VSA----LS-----------------------
H3CZU3_TETNG/7-115--------------------QMRSPRISFLQTLA----SL--FLG---GVA----LL-----------------------
GSG1L_XENTR/5-124--------------------RRNRSLLSVVLNLL----AL--SFS---VAA----FF-----------------------
G1RGF7_NOMLE/4-119--------------------AKQQRALLLLPICL----AL--IFS---LTA----VV-----------------------
H2SQP8_TAKRU/10-121--------------------RRSRSLLSLTLTTL----AL--ALS---ILA----LC-----------------------
GSG1_BOVIN/8-121--------------------SSQRKRLSAVLNML----SL--SLS---TAS----LL-----------------------
I3KRK1_ORENI/5-112--------------------RRSRTLLSLSLNFF----AL--FFS---ITA----FI-----------------------
G1PJM9_MYOLU/8-122--------------------SGQWTFLSAILNLL----SL--GLS---SAF----LL-----------------------
M4ANQ0_XIPMA/5-117--------------------RGRRASLAITLNFV----AL--AFA---VSA----VT-----------------------
E1BQK0_CHICK/10-122--------------------..RRAFLAVILNLL----AL--SLS---TTA----LL-----------------------
F6XCN0_XENTR/6-117--------------------RRHRALFAVCLNLV----AL--LFS---TTA----FI-----------------------
H3A9A9_LATCH/14-126--------------------..RRTTLALVLNLV----AL--TLS---STA----LV-----------------------
X1WCY0_DANRE/5-116--------------------RAQRASLALTLNYV----AF--VMA---VSA----VT-----------------------
H2T2C4_TAKRU/9-124--------------------RRNRSLLSLSLTSL----AL--TLS---VLA----FC-----------------------
G1LVZ0_AILME/8-122--------------------SGQRIFLSAVLNML----SL--SLS---TTS----LL-----------------------
W5N1L9_LEPOC/5-116--------------------RRQRASLALTLNFI----AL--IFA---ISA----LS-----------------------
F6QYE6_XENTR/5-114--------------------RRRRATVALTLNFL----SL--LFS---ITA----FS-----------------------
M0QWL6_MOUSE/5-119--------------------.RWQRMLTLLPICL----AL--AFS---LTA----MG-----------------------
G5BYE9_HETGA/8-122--------------------SGQRTFVSAVLSVL----SL--SLS---TIS----LL-----------------------
H2ZT70_LATCH/6-119--------------------RKNRALLSVVLNSL----AL--LFS---VSA----FC-----------------------
F5H0V9_HUMAN/24-137--------------------SGQRTLLSAILSML----SL--SFS---TTS----LL-----------------------
H3A6Q3_LATCH/5-111--------------------RRCRALLAVSLNFV----AL--LFS---TTA----FI-----------------------
H3CN24_TETNG/5-116--------------------RRRRASLALTLNFV----AL--FLA---VSA----LT-----------------------
F6TBZ7_ORNAN/10-124--------------------..RRAILAVILNLL----AL--GLS---TAA----LL-----------------------
W5MNB3_LEPOC/10-148--------------------RRARSLLSLTLTSL----AL--ATS---ILA----FS-----------------------
I3JSS8_ORENI/21-128--------------------RKCRALLSVGLNLV----AL--FFS---TTA----FI-----------------------
H9GMT0_ANOCA/6-119--------------------RKSRSMLSLGLNSL----AL--CFS---VSA----FC-----------------------
G3HB44_CRIGR/10-121--------------------..QRTFISAILNML----SL--GLS---ATS----LL-----------------------
W5NZF8_SHEEP/5-115--------------------TRQQRALALLPVCL----AL--AFS---LTA----VG-----------------------
W5L9X5_ASTMX/6-118--------------------RRRRASLALALNLA----AM--LLA---VSA----LT-----------------------
G1M092_AILME/8-119--------------------....PALTVLPVCL----AL--AFS---LTA----LG-----------------------
V8PHH2_OPHHA/85-194--------------------RRQRASAALSLSFL----SL--IFS---ITA----FS-----------------------
H2NQH5_PONAB/15-140--------------------RRVRALLAVALNML----AL--LFA---TTA----FL-----------------------
G1TTX9_RABIT/4-118--------------------ARRQRALTLLPIGL----AL--TLS---LIA----VS-----------------------
H0XHA4_OTOGA/4-117--------------------ARRQRALTLLPVCL----AL--AFS---LTA----LG-----------------------
F7BNL6_XENTR/10-120--------------------..RRAILAVCLNLL----AL--ALS---ITA----LL-----------------------
F1NVB9_CHICK/11-120--------------------RRQRASVAFFLSFL----SL--VFS---ITA----FS-----------------------
F6WEP2_MONDO/5-117--------------------RRCRALLAVCLNLL----AL--LFS---TTA----FL-----------------------
F7FP57_MONDO/12-123--------------------...HTIVAVILNIM----AL--CLS---TTS----FL-----------------------

PF06687

Q7SFF9_NEUCR/5-294-------------STLVPIIA------SIAA-FV----LV--LLA...LVA----GS...--------------------
MAC1_SCHPO/6-177-------------LAFLAILF------LLIP-TA----..--.LL...IIG----SV...--------------------
Q5K881_CRYNJ/4-176-------------PAFPGLFF------AFAA-AV----LL--LFA......----.....--------------------
A0A0D1D1B0_USTMA/4-186-------------PATPGTLL------TLAA-AV----LL--GLV......----.....--------------------
Q5KGB3_CRYNJ/7-189-------------NATPGTIL------CLAA-TI----LL--AIV...SFN----.....--------------------
A7A250_YEAS7/7-175-------------ILLFSSFL------QLIS-FS----GF--MIC...CL.----.....--------------------
Q6FSP2_CANGA/9-169-------------...MFLVV------GLLA-FI----SM--AFF...IIA----SV...--------------------
A6ZNI8_YEAS7/5-176-------------SSVVFFLV------GLSQ-FV----TM--AFL...IIG----SI...--------------------
A7TT16_VANPO/7-179-------------STLWFSII------STMQ-FT----SM--AFL...IIC----CV...--------------------
Q6CX71_KLULA/9-171-------------...FATLL------FFLQ-CV----AL--AFL...ILA----CV...--------------------
Q757N9_ASHGO/7-167-------------...LSGLI------WLAQ-TA----AL--AFL...VVS----CI...--------------------
Q5ALR6_CANAL/7-166-------------YHTISFLF------ILVS-FV----..--.FL...LFA----TI...--------------------
A3LTF9_PICST/7-165-------------FHSVAFVL------ILVS-FV----..--.FL...LLA----TI...--------------------
A5DUT6_LODEL/7-165-------------FNTISFVL------ILVS-FV----FL--......LLA----TI...--------------------
Q6BIN6_DEBHA/7-162-------------FNSISFIL------MLVT-VV----..--.FL...ILS----CI...--------------------
A5DHH0_PICGU/5-162-------------FHTASAVL------MI..-.I----CL--VFL...ILA----TI...--------------------
A0A0D1DVQ9_USTMA/5-204-------------YLVPALVL------SFVS-MI----LL--VLV...TIS----TPTTL--------------------
MUG33_SCHPO/5-166-------------SATPSLIL------LVIA-IV----..--.FF...VLA----IC...--------------------
PALI_ASHGO/5-170-------------MSVVEWLL------LGST-TL----AL--LFQ...SFA----TF...--------------------
PALI2_KLULA/3-167-------------...VKIVL------VVLL-TL----AL--VFE...CFS----TI...--------------------
PALI1_KLULA/4-168-------------...FKIVF------LTSL-SL----AL--VFE...LFN----TI...--------------------
A7TPS6_VANPO/6-170-------------...LMMSV------AILM-TI----SL--VFH...IIP----NI...--------------------
PALI_CANGA/6-170-------------...LRTLL------AILV-SI----CV--VFQ...AFP----LA...--------------------
A3LUV8_PICST/4-233-------------...TLLIL------WGVC-CI----CL--VIQ...LLP----VI...--------------------
PALI_CANAL/4-232-------------AFIALLIL------LIVC-WV----IQ--LLP...VIA----VP...--------------------
A5E4Z6_LODEL/4-205-------------SLLALLVL------CLIC-WI----IQ--LLP...VIS----VP...--------------------
A5DJU1_PICGU/4-217-------------...SLLVL------WVFT-SI----CF--VLQ...LLP----IM...--------------------
PALI_DEBHA/4-238-------------...GLLIL------DLFV-SI----CL--TIQ...LLP----II...--------------------
A6ZMC2_YEAS7/5-169-------------IHIVVFLL------AITT-I.----..--.FE...ILP----LI...--------------------
Q2H463_CHAGB/5-183-------------ATPLSVLL------FAAF-VL----IL--LSV...LST----PI...--------------------
PALI_NEUCR/5-170-------------ATPLAVLL------FAAF-GL----LT--LAT...IST----PI...--------------------
PALI_MAGO7/5-169-------------ATPLAVLL------AAAF-GL----L.--......LIS----VL...--------------------
PALI_YARLI/7-167-------------...SATGL------LVIL-LI----AF--ALQ...LVA----VL...--------------------
Q0V6X2_PHANO/5-166-------------ATPLSILF------FIAF-CL----L.--......LLS----TL...--------------------
A6R830_AJECN/6-168-------------ATPLTVLL------LTAF-VL----L.--......LLS----VL...--------------------
A2QF35_ASPNC/6-165-------------ATPLTILL------LIAF-AL----L.--......LIS----VI...--------------------
Q0CX64_ASPTN/6-167-------------ATPLTILL------LIAF-VL----L.--......LLS----VI...--------------------
Q4WWY3_ASPFU/6-166-------------ATPLTILL------LAAF-VL----L.--......LLS----VL...--------------------
Q55HH6_CRYNB/6-242-------------CVAGATIL------SVIS-VI----LL--IFA...HIG----QV...--------------------
Q6BME8_DEBHA/24-312-------------LQIIRLFT------CIAA-LT----FI--IAT...LIG----SL..A--------------------
Q59US7_CANAL/25-311-------------IQLCRLFT------CLIA-IV----CC--LAC...IVA----PRV..--------------------
Q7SG51_NEUCR/8-271-------------CVALPFLL------TVAS-LV----AL--LVG...GLA----GV..A--------------------
Q2HFG4_CHAGB/9-276-------------CVLVPFLL------TLAS-LI----AM--LVA...GLS----GL...--------------------
Q0TZ73_PHANO/4-276-------------TALVPVLC------CIVA-LI----LS--FLC...LFA----GH...--------------------
Q6C1Y6_YARLI/7-199-------------IGAFTILL------IAGA-TL----LS--FFV...LLA----GA...--------------------
A6R6X6_AJECN/8-204-------------IALLGLLF------TAGA-FI----LM--MLT...LIG----GS...--------------------
A1CFA3_ASPCL/8-205-------------LGLLGLFF------TASA-LL----LM--FLA...FLG----GA...--------------------
A2QNP6_ASPNC/8-205-------------MGFLGLFF------TAGA-LL----LM--FLT...LLG----GA...--------------------
Q0V6H1_PHANO/8-203-------------LAILSLIL------VGGA-VL----LQ--FFT...ILT----GG...--------------------
A7EBS7_SCLS1/8-206-------------TGIISLVL------IGAS-IM----FM--FFV...ILG----GI...--------------------
Q2H574_CHAGB/3-201-------------RTPVALIL------IAGS-LV----LL--WFV...ILS----GV...--------------------
V5IRF3_NEUCR/8-206-------------LALLSLFF------IAIS-LI----LL--WFV...ILS----GI...--------------------
A7TTI2_VANPO/7-207-------------VTIISHVS------SSGA-GL----LM--SFV...ALS----GS...--------------------
SUR7_YEAST/9-206-------------LRLVVLLF------LAGN-TL----LL--ILM...IIS----GA...--------------------
A7TH74_VANPO/9-205-------------ARLLTLLF------LAGN-TL----CL--ILI...IIS----GS...--------------------
Q753Q0_ASHGO/8-202-------------GKLLTAIL------LAGN-TL----LL--LFI...VFS----GS...--------------------
Q6CXH5_KLULA/9-205-------------TKFVSLLF------LMGS-TM----LL--IFI...VLS----GS...--------------------
A5DC91_PICGU/5-198-------------TGIFNLFF------LAGS-TL----LL--VFI...VLS----GS...--------------------
Q6BLL9_DEBHA/5-198-------------STILNIFL------LAGT-CL----LL--LLV...ILS----GA...--------------------
SUR7_CANAL/5-199-------------FTFFNLFF------LAGT-VL----LL--IFT...VLS----GS...--------------------
A3LV33_PICST/5-198-------------HTIANLFF------LAGT-IL----LL--IFV...VLS----GS...--------------------
Q75E26_ASHGO/7-202-------------ITSLSFLL------LLGS-CL----LG--FFT...ILS----GA...--------------------
A7TIB3_VANPO/11-209-------------VHLLTFFF------LLGA-GL----LT--FIV...VLS----GA...--------------------
Q6FT41_CANGA/7-205-------------VNAIVCLF------IVGA-GL----LS--FFL...ILS----GA...--------------------
Q6CJ71_KLULA/7-204-------------VSSLSLLF------LLGS-GL----LT--FFV...ILS----GA...--------------------
E7KHH6_YEASA/7-206-------------VYFINLFF------LLGA-TL----LT--FFL...ILA----GG...--------------------
FMP45_YEAST/7-205-------------VNLLVFLF------LLGA-GL----LT--FFL...ILS----GG...--------------------
A5DAF8_PICGU/6-205-------------FTIVPLIL------LLGS-TL----LL--VFM...NIV----GA...--------------------
Q5AH49_CANAL/4-201-------------LNIIPVFF------LVGS-VL----LL--ILT...IIN----GA...--------------------
A5E7B2_LODEL/4-201-------------LTIVPIFF------LLGS-TL----LL--ILT...AIN----GA...--------------------
A7TGC8_VANPO/6-240-------------RLFVAALI------SFTT-FI----IA--IIG...CAG----ST...--------------------
Q6CWP2_KLULA/5-243-------------TVLASFVI------TAAS-LI----LA--IFA...CFG----ST...--------------------
E7Q7C4_YEASB/6-240-------------TLFFAAIF------SLGA-LI----LA--IVA...CAG----ST...--------------------
Q6FPE4_CANGA/6-240-------------ALILALFF------ALAS-LV----LA--CIA...CAG----ST...--------------------
A3LZK7_PICST/5-323-------------FRIILIFF------SIAC-TV----LT--AFA...VTG----SF...--------------------
Q5ADV0_CANAL/6-394-------------FRVILIIL------SLMC-CI----LE--IFA...VTG----SY...--------------------
Q6BMS1_DEBHA/5-319-------------VRLIIILL------SIAT-TV----LS--IFA...LVG----SY...--------------------
A5DG26_PICGU/5-318-------------FRFLLIIF------SIAA-AI----LS--VFA...LIG----SY...--------------------
A5E006_LODEL/6-375-------------FRAIIIFF------SLAC-LI----LS--CFA...IAG----SY...--------------------
A5E421_LODEL/6-397-------------FRVILIFF------SVAC-LI----LS--CFA...ITG----SY...--------------------
PUN1_SCHPO/12-275-------------FTGIGTVC------VGVG-AL----LS--ILC...IIN----QT...--------------------
Q2TX92_ASPOR/9-279-------------CVVLPYVF------SVAS-LI----CL--IFANLTGFG----STLEK--------------------
Q5BDP9_EMENI/26-276-------------HRILRSFL------HLIA-WI----FL--LLV...VIG----NT...--------------------
A2QQ39_ASPNC/26-275-------------HRILRSFC------YLIA-WI----FL--ILV...CIG----NV...--------------------
Q2UBQ3_ASPOR/26-275-------------HRLLRSFL------YLIA-WI----FL--VLV...VIG----DV...--------------------
Q0CQ07_ASPTN/27-276-------------HRLLRTLL------YLIA-WI----FL--LLV...CIG----NL...--------------------
A2R5N4_ASPNC/9-229-------------LVSTSCLL------NIGT-LL----CL--IVI...GLA----CT..K--------------------
Q2UF28_ASPOR/9-224-------------WRGFPCAL------TIGS-LI----CL--VIV...GLG----CT...--------------------
Q5B2L7_EMENI/9-256-------------CIFTPYVL------TIAA-LI----CL--IVV...GLG----ST..D--------------------
A1DME7_NEOFI/9-255-------------CIFTPYAL------TIAS-LV----CI--IMV...GLG----CT..K--------------------
A2QPC4_ASPNC/9-256-------------CIFTPYVL------TIAS-LI----CI--IMV...GLG----CT..K--------------------
B8MW98_ASPFN/9-255-------------CIITPYAL------TIAS-LV----CI--IIV...GLG----CT..N--------------------
Q0CRK6_ASPTN/9-256-------------CILTPYAL------TIAS-LV----CI--IMV...GLG----CT..N--------------------
A6RDR9_AJECN/9-246-------------CIFTPYLL------TIGA-LV----CL--IFV...GLG----VT...--------------------
Q0V4X3_PHANO/9-258-------------CIITPMAL------TLAS-LI----CI--VIV...MLG----QMSAG--------------------

PF12351

C1G9K9_PARBD/59-248-------------FANLSAGI...N..RNAT-SL----EI--RTG---YLG----HC-----------------------
Q75CU4_ASHGO/65-257-------------SLHERTNT......TGFE-QL----RI--KVG---YLG----VC-----------------------
A3LV03_PICST/62-245-------------AYKSTNSS......TELA-EM----SI--RVG---YLG----VC-----------------------
A7EL23_SCLS1/52-241-------------IGQISKVG...T..DGSK-IG----GL--RFG---YMG----LC-----------------------
A7TJZ8_VANPO/66-260-------------FATESAET......KGLE-KI----VV--KSG---YMG----IC-----------------------
B6HGM8_PENCW/52-252-------------IAHAVHNV...SQAGQGT-TL----EV--RAG---YMG----MC-----------------------
B8MZW1_ASPFN/73-257-------------VVQATANI...V..GGAE-.M----EV--RVG---YFG----IC-----------------------
B8NY21_ASPFN/72-267-------------IAEKVYNLSQPR..NTTI-.Q----EV--RAG---YMG----LC-----------------------
C0NA65_AJECG/81-270-------------FANLTTGA...R..NNAD-SF----EI--RTG---YLS----HC-----------------------
C1GWT8_PARBA/74-258-------------INTAMTNI...V..GGAQ-.L----EV--RVG---YFG----IC-----------------------
C4JX23_UNCRE/51-235-------------VTTAIENI...V..GRAR-.L----EV--RVG---FFG----IC-----------------------
C4QXD3_PICPG/65-260-------------AYKNQDAK......GLSL-.M----SV--KAG---YMG----IC-----------------------
C4YC02_CLAL4/51-224-------------IANSVSSN......SSIT-EL----SL--ATG---YLG----MC-----------------------
C5DEC8_LACTC/64-258-------------SSFSSNNS...T..SDLQ-NV----AV--RAG---YMG----IC-----------------------
C5DPI4_ZYGRC/66-266-------------SFNQSNGTTQMS..GLEQ-.V----SI--ASG---YMG----VC-----------------------
C5G079_ARTOC/74-258-------------LVPTIANI...V..GGAH-.L----EV--RVG---YFG----IC-----------------------
C5M8V3_CANTT/127-303-------------LSTKSLNS......TSLD-AL----SI--RVG---YLG----VC-----------------------
DNI1_SCHPO/33-201-------------STTSKFQLF.SL..ATNV-.A----QI--NVG---YFN----MC-----------------------
Q0CSC3_ASPTN/220-409-------------FYSVVANI......SSTG-NL----AV--RVG---YFG----LC-----------------------
Q0U808_PHANO/74-259-------------VTQAIANI...V..GNAQ-.L----GV--RVG---YFG----IC-----------------------
Q59WR6_CANAL/68-244-------------TTTTNNNS...T..AIDE-.L----SV--KVG---YMG----VC-----------------------
Q6BL79_DEBHA/62-241-------------AYKGSNIS...T..KLAE-.M----TL--SVG---YLG----VC-----------------------
Q6CH13_YARLI/62-243-------------SSFKQSNA......TDLA-YL----KA--RSG---FFG----AC-----------------------
Q6CW51_KLULA/66-265-------------QFSSQEYT......DGLE-NV----QI--FSG---YMG----IC-----------------------
Q6FQP2_CANGA/65-266-------------SFTHNAKT......TGFE-NV----VV--KVG---YLR----TC-----------------------
A7UX97_NEUCR/65-265-------------...LTSSS...N..GTLA-PM----QV--RLG---YFG----MC-----------------------
FIG1_YEAST/66-265-------------.YEKSNTT......LGLE-EV----II--RSG---YMG----VC-----------------------

PF12534

V8P1J9_OPHHA/785-1120MIPVTEFRQF-S.EQQPAFRVLKPWWDVFTD-YL----SV--AMLMVGVFG----CTLQV....................
M3ZMK4_XIPMA/1-325MIPITELRYF-V.DTQPAYRILKPWWDVFTD-YI----SI--VMLMISVFG----GTLQI....................
H2LAB2_ORYLA/1-327MIPVMEFRQF-S.EQQPAFRVLKPWWDVFTD-YL----SV--IMLMIGVFG----CTLQV....................
F7HZE8_CALJA/1-331MIPVAEFKQF-T.EQQPAFKVLKPWWDVLAE-YL----TV--AMLMIGVFG----CTLQV....................
I3KSZ5_ORENI/1-328MIPVMEFRQF-S.EQQTAFRVLKPWWDVFTD-YL----SV--MMLMIGVFG----CTLQV....................
W5KVQ3_ASTMX/1-344MIPVNEFRNI-ASEHNPKFRVLKPWWDVLSE-YL----CI--AMLMMGVFG----CTVQL....................
H3AVZ2_LATCH/1-372MFTLTEIASL-N.DIQPTYRILKPWWDVFMD-YL----AV--VMLMVAIFA----GTMQL....................
B1H2G3_XENTR/1-381MFTLSEVASL-N.DIQPTYRILKPWWDVFMD-YL----AV--VMLMVAIFA----GTMQI....................
E7FB32_DANRE/1-334MIPVNEFRNI-TSEQNPQFRVLKPWWDVLSE-YL----GI--AMLMIGVFG----CTLQL....................
G3NS96_GASAC/1-347MFSLSELAPL-N.QHQGRCKLLKPWWEVFMD-YL----VV--LMLMVSVLA----CTEQL....................
G3TTR1_LOXAF/1-384MFTLAEVASL-N.DIQPTYRILKPWWDVFMD-YL----AV--VMLMVAIFA----GTMQL....................
W5L768_ASTMX/1-377MFTLSELWSI-S.ERQGRYKLLKPWWEVFMD-YL----VL--LMLMVSILA----GTLLL....................
W5LUY8_ASTMX/1-363MFTLTEVASL-N.DIQPTYRILKPWWDVFMD-YL----GI--VMLMVAIFA----GTMQL....................
H3AKF0_LATCH/1-388MITFTELKYF-G.DQDPALKILKPWWDVFLE-YL----NF--LMILISVFG----GALQLYKTMSVCIGVGSKAFLCYLG
H3AX97_LATCH/1-334MLPVSDISFL-G.ESQITHRIFKPWWDILMD-YI----IY--SLMILSVIG----GADLL....................
I3JWS5_ORENI/1-362MFTLTEIASL-N.DIQPTYRILKPWWDVFMD-YL----GL--IMLMLAVFA----MTMQI....................
H3AY71_LATCH/1-328MIPVTEFKQF-T.EEQPAFRVIKPWWDVFHD-YI----CV--IMLMIGVFG----CTLQV....................
V8PI59_OPHHA/1-329MIPVAEFKHF-T.DQQPAFKVLKPWWDVLAE-YI----TI--VMLMIGVFG----CTLQV....................
A2BIH6_DANRE/1-360MFSLTEVASL-N.DIQPTYRILKPWWDVFMD-YI----GV--IMLMLAIFS----GTMQL....................
G3Q7A0_GASAC/1-345MIPVGEFRNF-GAEQNSKYRVLKPWWDVFSE-YL----CV--AMLMIGVFG----CTLQL....................
H3ARV9_LATCH/48-378MFTVTELKHF-S.DTQAAYHILKPWWDVLCH-YI----SM--VMLLIAVLG----GALQF....................
H2MNR6_ORYLA/1-346MFSLSELAPP-N.QHESRCKLLKPWWEVFMD-YL----VV--LMLMTSVLA----CTEQL....................
D4A758_RAT/1-334MITLTELKCL-A.DAQSSYHILKPWWDVFWY-YL----TL--IMLLVAVLA----GALQL....................
M4B034_XIPMA/1-370MFTLTEVASL-N.DIQPTYRILKPWWDVFMD-YL----GI--VMLMLAIFS----GTMQL....................
H2S8U7_TAKRU/1-339MIPVGEFRNF-STEQNTKLRVLKPWWDVFTE-YL----CV--AMVMIGVFG----CTLQL....................
R0K7Z6_ANAPL/1-340MIPVTELRYF-A.DTQPAYRILKPWWDVFTD-YI----SI--VMLMIAVFG----GTLQV....................
H0Z736_TAEGU/1-380MFTLAEVASL-S.DIQPTYRILKPWWDVFMD-YL----AV--VMLMVAIFA----GTMQL....................
H2S199_TAKRU/1-376MFTLAEVASL-N.DVQPTYRILKPWWDVLMD-YL----GL--VMLMLAIFG----MTMQI....................
G3PSX6_GASAC/1-374MFTLTEVASL-N.DIQPTYRILKPWWDVFMD-YL----GV--VMLMLAIFA----MTMQI....................
LRC8E_XENTR/1-341MIPVAEFKQF-T.EQQPAFKVLKPWWDVLAE-YI----TY--AMLMIGVFG----CTLQV....................
I3KNR5_ORENI/1-344MIPVGEFRSL-GTEPNSKYRVLKPWWDVFTE-YL----CI--AMLMIGVFG----CTLQL....................
F6SMM9_XENTR/1-324MIPIGEFRQF-S.ELQPAYRVLKPWWDVLMD-YL----SV--AMLMIGVFG----CTLQI....................
H0Z746_TAEGU/1-332MITLTELKCL-A.DAQSSYHILKPWWDVFWY-YL----TM--IMLLVAVLA----GALQL....................
F7CMN6_XENTR/1-328MITVTELRFL-A.DAQTSYHILKPWWDVFWY-YI----TM--VMLMIAVLA----GALQL....................
M4A3B2_XIPMA/1-344MFSLSELAPV-E.PQQNTWKLLKPWWEIFMD-YL----VV--LMLMTSVLA----CTVQL....................
G3X2F3_SARHA/1-331MLSLSELKYI-A.DSQSSCHILKPWWDVFWY-YL----TL--IMLLVAVLS----GALQL....................
W5KZ87_ASTMX/1-332MIPVTEFRQF-T.EQQPAFRVLKPWWDVFAE-YL----SV--VMLMIGVFG----CTLQV....................
E7FFH7_DANRE/1-330MFALSELWSG-G.ERQGSYKLLKPWWEVFMD-YL----LV--LMLMVSILA----GTLLL....................
M4AYR0_XIPMA/1-374MFTLTEVASL-N.DIQPTYRILKPWWDVLMD-YL----GL--VMLMLAIFA----MTMQI....................
M3ZY99_XIPMA/1-333MIPVGEFKSL-GIEQNSQFRVLKPWWDVLSE-YL----CI--AMLMIGVFG----CTLQL....................
H3AZN8_LATCH/1-348MFTVTDVAFI-G.ESQASNKILKPWWDVLMD-YL----VF--SMLMLSIFS----GTLLL....................
I3JMY0_ORENI/1-352MFSLSELAPL-N.QHQNRSKLLKPWWEVFMD-YL----VV--LMLMTSVLA----CTEQL....................
B3DLX1_XENTR/1-330MIPVTEFRQF-S.EQQPAFRVLKPWWDVFMD-YL----SA--AMLMIGGFG----CTLQI....................
A7SYJ2_NEMVE/1-332MFPIGQLTRF-E.VNNSNYRLLKPWWDVFTD-YL----SA--AMLVVAVLA----GLMQA....................
E7F333_DANRE/1-326MIPVTEFRQF-T.EQQPAFRVLKPWWDVFTD-YL----SV--VMLMIGVFG----CTLQV....................
W5LU14_ASTMX/1-373MFTLTEVASL-N.DVQPTYRILKPWWDVFMD-YL----GL--VMLMLAIFA----GTMQI....................
W5MLZ0_LEPOC/1-351MIPVNELRHF-AVDQNPRLRVLKPWWDVFAE-YL----CV--AMLMIGVFG----CTLQL....................
V8P1J9_OPHHA/1-333MITLTELRCL-A.DAQASFHILKPWWDVFCY-YL----TM--IMLLVAVLA----GALQL....................

PF00876

D6WYF3_TRICA/20-351-------------DNNVFRLH------YKLT-VI----ML--IVF---SIL....LT-----------------------
B4M9Z6_DROVI/21-389-------------.DPIFTLH------SKCT-IV----IL--LTC---TFL....LS-----------------------
B7PM37_IXOSC/22-351-------------..NVFRLY------TNAT-VA----LL--LSF---CML....LT-----------------------
H2W3J0_CAEJA/23-398-------------.EFYDRLH------.LFT-VY----LL--GFF---VVL....TG-----------------------
G4VIL2_SCHMA/22-395-------------DDFADRCS------YMLS-FI----IL--VMC---FTI....VT-----------------------
K1PTR0_CRAGI/36-398-------------DDWVDRVN------HIYT-VV----LL--CIF---AVF....TG-----------------------
T1J195_STRMM/20-353-------------DNSVFRLH------YKGT-VI----LL--IAF---SLL....VT-----------------------
T1FN93_HELRO/20-384-------------DDFADRLS------SRYT-VV----FL--ILF---AIL....VS-----------------------
A0A068XA01_HYMMI/23-373-------------.DFIDQLN------YQYT-GG----LM--VIF---IAI....IG-----------------------
B4JXM9_DROGR/128-462-------------DSIVFRLH------YSIT-VM----IL--MSF---SLI....IT-----------------------
Q16YE3_AEDAE/22-378-------------DNVAFKFH------YRAT-FT----IL--LVC---TLL....VT-----------------------
J9EMK4_WUCBA/21-384-------------.DVIASLH------SYFT-CN----LL--IAF---SVI....IS-----------------------
Q8JV09_CSIVT/20-354-------------DNDFFRLH------YKLT-AV----IL--LAF---SMV....VT-----------------------
A8XEP7_CAEBR/22-362-------------..ATEKLL------HNTT-IS----IL--IFL---FFL....LA-----------------------
H2VGJ4_CAEJA/19-337-------------.DAIDRLR------YFAT-VL----IL--CSC---ALF....IM-----------------------
K1RGD8_CRAGI/8-352-------------.SWVDGLN------GRWT-PL----LF--LVL---GVF....SF-----------------------
T1J195_STRMM/1266-1599-------------..AIFRLH------YNVT-VM----IL--IAF---SVI....VT-----------------------
B7P7W9_IXOSC/20-348-------------DNLMCRLH------HKAS-VG----IL--LAF---SIL....VT-----------------------
A0A068XZR8_ECHMU/21-417-------------EDFGDQLN------RIYT-PL----LI--LLL---AAA....AM-----------------------
G0P5C9_CAEBE/23-398-------------.EFYDRLH------.LFT-VY----LL--GFF---VLL....TG-----------------------
G7YGP3_CLOSI/23-373-------------.DFVDQLN------YQFT-SG----MI--IVF---IVM....IG-----------------------
Q16QK9_AEDAE/26-359-------------DNMVFRCH------YRLT-SA----VL--FLC---CVL....VT-----------------------
F1L798_ASCSU/18-385-------------EDFVDRLN------FQTT-SL----VF--FIA---TSV....IF-----------------------
T1KCG9_TETUR/13-350-------------DNYIFKLH------STVT-IV----IL--SIC---IVF....VG-----------------------
A0A068XBQ8_HYMMI/22-391-------------EDFADKFN------FIFT-VI----VL--LVA---TSV....VT-----------------------
E9HBX3_DAPPU/3-382-------------.......H------RRCT-IV----FL--LLL---SLP....LF-----------------------
T1ELD9_HELRO/20-382-------------DDFSDRLS------YRFT-TS----FL--IVF---AIL....VT-----------------------
B4NCN0_DROWI/21-406-------------.DPIFTLH------SKCT-IV----IL--LTC---TFL....LS-----------------------
A0A087W1T2_ECHMU/23-384-------------EDFGDRFN------YFGC-GV----VL--LVC---VFV....VS-----------------------
B4R5W3_DROSI/22-374-------------DNIVFKLH------YRWT-FV----IL--LVA---TLL....IT-----------------------
H3DSX6_PRIPA/33-350-------------..QADRLN------TRFT-VM----LL--AVT---SAL....LG-----------------------
J9K934_ACYPI/20-353-------------DNNIFRLH------YKVT-VI----IL--VSF---SLL....VT-----------------------
A0A068XY87_ECHMU/25-463-------------DDFVDRVN------HTYT-LN----LL--MFF---TAI....VL-----------------------
G6CUL7_DANPL/23-376-------------DNVVFKLH------YKLT-VT----FL--LAF---VIL....VC-----------------------
B7PZQ6_IXOSC/22-356-------------DNCVFRLH------WLVT-SS----VL--VVF---SLV....VT-----------------------
J9K6I2_ACYPI/23-369-------------DNPAFRVH------YRLT-FA----IL--LAC---TTL....VC-----------------------
E3MG81_CAERE/18-377-------------.DFVDKLN------YCAT-TI----GL--VLS---SAF....IT-----------------------
B7QK18_IXOSC/21-355-------------DNQIFRLH------YKAT-SL----LL--LMF---SIL....VT-----------------------
F1L5G5_ASCSU/25-358-------------.DLADRLN------SRIT-VC----VL--ALT---SAF....LV-----------------------
T1KCG2_TETUR/41-381-------------DNYIFKLH------STVT-IL----IL--SIS---IVF....VG-----------------------
J9JUV0_ACYPI/22-352-------------..TVFRVH------VTFT-TV----VL--LAC---SIM....VT-----------------------
G0P1Q9_CAEBE/46-404-------------DDIFDRLH------YYYT-TT----FL--LLT---AVL....IS-----------------------
T1KEY2_TETUR/40-390-------------.NFVIVIN------SSMM-PK----IL--LFE---AIL....LT-----------------------
T1ED09_HELRO/21-401-------------DDRVDRLN------RNVT-VV----ML--IFF---AII....VT-----------------------
O61786_CAEEL/18-377-------------DDFIDRLN------FQYS-AY----VF--ALS---ALV....IG-----------------------
K1PIY5_CRAGI/20-383-------------DDLIDRLN------HFYT-TG----IL--IIF---TVV....VS-----------------------
T1FHL5_HELRO/20-384-------------DDYIDRLS------RQYT-VV----LM--VLF---AFL....VS-----------------------
T1JJS6_STRMM/20-348-------------DNTIFKLH------YVFT-SI----AL--VAF---SLM....IT-----------------------
A8XEP6_CAEBR/20-382-------------DNGAERIV------HTTT-IQ----IL--LCF---GFL....VT-----------------------
E1FZD3_LOALO/21-449-------------DDLPDRCN------YFYT-VL----AL--LFF---SLL....IG-----------------------
G7YU10_CLOSI/46-435-------------EDFADRLN------HFFS-CG----LI--LML---AGV....TM-----------------------
E3MU80_CAERE/20-379-------------.DIVDRFS------YQYT-ST----IL--GFS---AIM....MA-----------------------
A8XER5_CAEBR/20-386-------------...TDRLN------YYYS-TL----II--MGM---SLT....IT-----------------------
Q6SA04_BOMMO/20-353-------------DNNVFRLH------YKAT-VI----IL--IAF---SLL....VT-----------------------
Q7Q5R9_ANOGA/21-353-------------.DLVWRLH------CRVT-VF----LL--LLA---SLL....LS-----------------------
E1FJE3_LOALO/20-378-------------.DFVDRLH------SYFT-TN----IL--IAF---SIL....VS-----------------------
E3M7W5_CAERE/20-359-------------DDASDSLS------CLIS-AF----LF--IIA---SIL....TS-----------------------
G4V7R0_SCHMA/22-401-------------EDFADRLN------.LFT-VI----LL--LIT---CII....VS-----------------------
E9HSG3_DAPPU/20-354-------------DNVVFRLH------YIFT-TV----LL--IAF---SLL....VT-----------------------
W5J902_ANODA/22-378-------------DNLAFKFH------YRAT-FI----ML--LVC---TLL....VT-----------------------
E0VDS2_PEDHC/20-352-------------DNAIFRIH------NVFT-TV----LL--MAF---SVI....IT-----------------------
E2AUZ7_CAMFO/26-358-------------DNMVFRMH------YRIT-SA----IL--FLC---CII....VT-----------------------
J9K6R4_ACYPI/20-351-------------DNLVFKLH------YKVT-FL----IL--LGF---SAF....LT-----------------------
J0XFG5_LOALO/19-380-------------DDATDRLH------YLYS-SN----IL--LAF---AVL....IS-----------------------
Q8MXG8_CAEEL/25-374-------------DDFVDRLH------YLYT-ST----MV--LMF---AVL....VS-----------------------
E3LDS0_CAERE/21-371-------------DDAVDRLS------YVTT-AT----LL--TFF---SIM....VS-----------------------
INX8_CAEEL/20-359-------------DDASDTLS------CLIT-AF----LF--ITA---AIL....TS-----------------------
G0M6M8_CAEBE/25-358-------------YDTIDRIN------AWFT-PF----VL--VAM---TLA....IS-----------------------
G7YTE6_CLOSI/24-379-------------DDFADRLN------YQLT-GL----LL--FVF---VGI....IG-----------------------
A8Y214_CAEBR/25-362-------------.DLADRLN------SRIT-VV----IL--AVS---SGL....LL-----------------------
A8XEF9_CAEBR/18-379-------------DDFIDRLN------FQYT-SY----VF--ALS---ALV....IG-----------------------
A0A068Y5E6_ECHMU/23-391-------------.DFADRCA------YLLS-FI----IL--LMC---FTI....VT-----------------------
T1IXN4_STRMM/24-349-------------DNLIFHLH------YRIT-AV----IL--TAA---AIL....VT-----------------------
E1JJF3_DROME/20-353-------------DNNVFRMH------YKAT-VI----IL--IAF---SLL....VT-----------------------
K1QY06_CRAGI/32-418-------------DNYVDRMS------YYYT-NM----FL--LFY---IMF....SV-----------------------
A0A088AID2_APIME/26-358-------------DNMVFRAH------YRIT-SA----IL--FAC---CIL....VC-----------------------
J9JSD1_ACYPI/20-354-------------DSPVFRLH------YSLT-VM----LL--SAF---SLI....VT-----------------------
Q16FA3_AEDAE/20-353-------------DSAVFRLH------NSFT-TA----LL--LAC---SLI....IT-----------------------
T1G942_HELRO/20-384-------------DDIVDRLN------HRYT-SL----LL--VIF---TIV....IS-----------------------
A0A068X0D8_HYMMI/25-462-------------DDFVDRVN------HTYT-MN----LI--MFF---TAV....VL-----------------------
Q7PXM2_ANOGA/20-353-------------DNIVFRLH------NTFT-TA----LL--LAC---SLI....IT-----------------------
A8QBS0_BRUMA/4-385-------------DDIVDRCN------YLLT-NM----MI--LIC---AIT....VA-----------------------
G7YNX9_CLOSI/22-427-------------EDFSDRIN------.LFT-VV----LF--LIA---CII....VS-----------------------
G4V9H2_SCHMA/22-390-------------EDFADKFN------FLIT-VM----VL--MLC---TTI....VT-----------------------
D6X4I9_TRICA/22-374-------------DNWIFRMH------YRVT-TL----IF--LVA---TLL....VT-----------------------
E0VDS1_PEDHC/24-362-------------DNLIFKCH------YRAT-VL----LL--LIG---VAL....LS-----------------------
G0MH94_CAEBE/20-359-------------DDASDSLS------CLIS-AF----LF--IIA---SIL....IS-----------------------
D6X4I8_TRICA/22-359-------------DNWAFKLH------YRVT-TL----LF--FIA---TIL....VT-----------------------
T1ICS8_RHOPR/21-357-------------DNFVFRLH------YRIT-FW----FL--LAC---AVL....VG-----------------------
E2BMI3_HARSA/21-353-------------.SMLFRMH------NKLT-AV----ML--LAC---SAI....LT-----------------------
E1ZXE9_CAMFO/20-352-------------DNNVFRLH------YKAT-VI----GL--IIF---SLL....VT-----------------------
T1HVH6_RHOPR/40-373-------------DSPVFRLH------YSIT-VM----IL--VAF---SLI....IT-----------------------
T1JXB6_TETUR/29-420-------------DDGVDKLN------RKYT-LL----VF--LFL---ALP....IF-----------------------
D6X4J0_TRICA/20-353-------------DNNVFRLH------YKAT-VI----IL--IAF---SLL....VT-----------------------
U1NYM9_ASCSU/445-793-------------DDAIDRLN------YYYT-PM----LL--VIF---ALT....LS-----------------------
U1M0X1_ASCSU/20-367-------------.DFVDRLH------SYFT-TN----IL--IAF---AIL....VS-----------------------
F4W7D6_ACREC/26-357-------------DNMVFRMH------YRIT-SA----IL--FLC---CII....VT-----------------------
T1G4P9_HELRO/16-378-------------DDLVDRMN------HQYS-VI----FL--FIF---MVI....IS-----------------------
T1J6W8_STRMM/21-346-------------DNFVFHLH------YRVT-AV----IL--AAA---AIL....VT-----------------------
C9IY29_CAEEL/84-449-------------DDWSDRLN------YLMT-PN----IL--LAF---SVL....IS-----------------------
K1PRS3_CRAGI/35-396-------------DDWIDRLN------HLYT-TI----IF--IIF---TIV....VS-----------------------
K7J6Q9_NASVI/27-365-------------DNIIFKLH------YRAT-FL----IL--LVS---TLL....VS-----------------------
G7YWN9_CLOSI/22-427-------------EDFADRLH------.LVT-VV----LF--SLA---ASI....VG-----------------------
E9HJ63_DAPPU/20-357-------------DSNIFRCH------YKLT-VI----VL--TIS---AML....IS-----------------------
E9HSG1_DAPPU/20-353-------------DNNIFRLH------YKAT-VI----VL--IAF---SLV....VT-----------------------
A0A087W211_ECHMU/22-417-------------EDFADKFN------FIFT-VI----VL--SLC---TVI....IT-----------------------
U1M8T6_ASCSU/413-766-------------DDVIDRCN------YLVT-NS----IL--FLC---AIT....VA-----------------------
A0A068XT33_HYMMI/22-423-------------DDFADRLN------.LFT-VV----LL--LFC---TVL....IS-----------------------
E5SKQ0_TRISP/420-774-------------DDLVDRVN------YYYT-PI----II--AFF---SLT....LS-----------------------
A0A068X0V5_HYMMI/31-381-------------.DFIDQLN------YQFT-GG----LI--LIF---III....IS-----------------------
E1GFD2_LOALO/19-366-------------DDFVDKLN------YHYT-SA----II--FAF---AII....VS-----------------------
U1NSW4_ASCSU/21-445-------------DDFTDRCN------YYYT-VL----AL--IFF---SLL....VG-----------------------
T1FAN8_HELRO/34-392-------------.....RLT------RTYT-VA----LL--LTF---SCL....IT-----------------------
E9G961_DAPPU/20-354-------------DSSVFRLH------YSIT-VM----IL--LAF---SLI....VT-----------------------
A0NH37_ANOGA/20-352-------------DNNIFRLH------YKAT-VI----IL--IAF---SLL....VT-----------------------
E5SB89_TRISP/314-669-------------DDVVDRAN------YFYT-PS----LL--LLF---ALI....IS-----------------------
E2BKJ4_HARSA/20-355-------------DNVIFRLH------SRVT-VL----LL--VVC---TIL....VT-----------------------
Q6AHN7_CAEEL/20-380-------------.DFVDRLH------SYFT-CN----LL--IGL---AVL....VS-----------------------
INX19_CAEBR/21-398-------------DDAVDRLN------YYYT-PL----IL--AVC---CLV....IS-----------------------
B4M9W3_DROVI/22-375-------------DNIVFKLH------YRWT-FV----LL--LVA---TLL....IT-----------------------
A8XEL3_CAEBR/23-389-------------.EFYDRLH------.LFT-VY----LL--GFF---VLL....TG-----------------------
U1NL47_ASCSU/159-526-------------.DMIDRLN------YHYT-AV----IL--MIT---GLS....IA-----------------------
A0A068X9B8_HYMMI/21-407-------------EDFSDRLN------RKYT-SS----LL--LLL---GAI....TM-----------------------
J9K206_ACYPI/24-352-------------DDYIFQCH------YKLT-TN----IL--LTF---CIL....VT-----------------------
U1NF34_ASCSU/22-362-------------.DFVDRLS------YDYT-VR----LL--VFF---AVL....VG-----------------------
J9EPQ3_WUCBA/20-374-------------.DIIDRLN------YQYT-AL----VI--ALT---AFT....LA-----------------------
J0M383_LOALO/18-371-------------EDSIDRLN------YHVT-TL----IL--LVA---AFT....II-----------------------
E5SKQ0_TRISP/18-378-------------.DFIDRLN------SFYT-VI----GT--VCF---AVL....VS-----------------------
K1QFN4_CRAGI/25-386-------------DDWIDRLN------HRYT-VL----LL--VIF---AVV....VS-----------------------
A0A068XF99_HYMMI/23-391-------------.DFADRCA------YLLS-FV----VL--VIC---FTI....VT-----------------------
T1KQD2_TETUR/20-352-------------DNPIFRLH------YKFS-VC----IL--VAF---SIM....VT-----------------------
G6D2Y2_DANPL/26-354-------------DNMVFRMH------YRIT-SA----IM--FLA---CIL....VT-----------------------
H2WEX7_CAEJA/18-379-------------DDFVDRLN------FQYT-SY----VF--AVS---ALV....IG-----------------------
K1Q160_CRAGI/48-414-------------DDLADRLS------CVFT-MV----LL--GAF---AVY....TA-----------------------
G0NI48_CAEBE/22-370-------------.DLVGNIS------SIVT-SI----LM--FFA---AVCFYGSIN-----------------------
Q174Z8_AEDAE/21-354-------------.NTVWRLH------SRIT-VY----ML--VFF---TIL....LS-----------------------
D6X4I6_TRICA/22-372-------------DNWVFKLH------YRAT-TV----IF--FVA---TIL....VT-----------------------
T1ITF1_STRMM/2-331-------------...LFVLH------YKVT-VG----VL--IAF---VIL....AT-----------------------
T1HXJ9_RHOPR/21-354-------------DNLVFKLH------YRIT-AL----LL--FIF---SVL....VT-----------------------
K7J6Q8_NASVI/20-354-------------DSMVFRMH------NLFT-AV----LL--LTC---SMI....IT-----------------------
K1PJW3_CRAGI/57-423-------------DDFIDRLN------HYYT-VI----LL--IVF---TVI....VS-----------------------
B7QN22_IXOSC/20-353-------------DNHVFRLH------YKVT-CA----VL--IAF---SIL....VT-----------------------
T1L390_TETUR/20-355-------------DDIVFRLH------RQLT-VL----IL--FAF---SII....VT-----------------------
F1L4F5_ASCSU/21-387-------------DDIVDRLH------FVGT-VT----VL--VLC---AMF....VG-----------------------
T1J195_STRMM/918-1253-------------DNVVFKLH------YMFT-TI----IL--VAF---SVL....IT-----------------------
J9FAW5_WUCBA/102-549-------------DDFPDRCN------YFYT-VL----TL--LFF---SLL....IG-----------------------
D6X0D3_TRICA/26-358-------------DNMVFRAH------YRVT-SA----IL--FVC---CII....VT-----------------------
U1MHH5_ASCSU/93-454-------------DDAVDRLH------YLYT-PN----IL--LAF---AVL....IS-----------------------
A0A068X744_HYMMI/28-419-------------EDFGDRLN------RFYT-ST----VL--LIL---VGV....TV-----------------------
H2W7D4_CAEJA/20-363-------------DDASDSLS------CLFT-AA----IF--IVS---AIL....IS-----------------------
T1I6M9_RHOPR/26-360-------------DNQVFRLH------YRTT-SA----FL--FVS---CVL....VT-----------------------
H2KP32_CLOSI/22-393-------------EDLADRAN------FQWN-VI----II--LIC---MIL....VT-----------------------
B7PZQ9_IXOSC/20-357-------------DNEVFRLH------YTAT-VI----IL--LAF---CIV....VS-----------------------
A8PUQ6_BRUMA/208-570-------------DDFVDKLN------YYYT-TT----IL--ASF---ALL....VS-----------------------
Q29DR1_DROPS/20-356-------------YDAVFTIH------SKCT-VA----LL--LAC---TFL....LS-----------------------
T1EHZ6_HELRO/2-360-------------DDTCDRIN------RLIS-AV----LI--LLL---GLV....VS-----------------------
H2KV18_CLOSI/22-415-------------DDWVDRLS------YVYS-VI----IL--LGF---TIL....VT-----------------------
J9B6M7_WUCBA/21-372-------------DDRIDRLN------YFVT-SS----LL--TFF---AIL....VS-----------------------
T1KKV8_TETUR/27-356-------------DNTIFKLH------YRWT-TN----ML--LVA---SIV....VT-----------------------
T1KKV7_TETUR/27-357-------------DNTAFKLH------YKYT-FN----AL--IIA---CAV....VT-----------------------
B4R7B1_DROSI/20-385-------------YDSVFTIH------SRCT-VV----IL--LTC---SLL....LS-----------------------
W5JJF8_ANODA/21-353-------------.DLVWRLH------CRVT-VY----LL--LFA---ALL....LS-----------------------
T1KDH8_TETUR/79-412-------------DNSLLRLH------YSLT-VT----LL--LAF---CVV....VT-----------------------
E0V9G4_PEDHC/20-367-------------DNNVFRLH------YKAT-AF----LL--AIC---SII....IT-----------------------
T1G9C5_HELRO/20-382-------------DDYVDRLS------HRVT-VI----IL--VGF---AFI....AS-----------------------
A0A088A2D0_APIME/27-384-------------DNLVFKMH------YRFT-FL----ML--LIA---TLL....VT-----------------------
T1JY39_TETUR/20-359-------------DNAIFRLH------WLFT-SV----IL--IAF---SIL....LS-----------------------
T1K2R1_TETUR/42-415-------------DSFLFTFH------SKIT-VL----ML--TFF---MCF....LM-----------------------
H3FJV0_PRIPA/15-362-------------.DGIDRLS------YLTT-AL----ML--LIF---CVI....VS-----------------------
E1ZXF1_CAMFO/20-353-------------DSMVFRMH------NHFT-TV----LL--FTC---SIL....LT-----------------------
G0NJM8_CAEBE/20-352-------------DSSIDRLN------YVIT-TS----IL--IGF---SLL....LF-----------------------
Q9N3R4_CAEEL/22-389-------------..GTEKLL------HNTT-IA----IL--VFL---FIL....LA-----------------------
G4V7R4_SCHMA/123-528-------------EDFSDRLS------.LFT-VV----LF--LIA---CII....VS-----------------------
D6X4I5_TRICA/20-353-------------DSAVFRMH------NLFT-TA----LL--MAC---SLI....IT-----------------------
A0A087W248_ECHMU/22-392-------------EDFADRFN------FIFT-VI----VL--LIC---TAV....VT-----------------------
Q29GY9_DROPS/22-375-------------DNIVFKLH------YRWT-FV----IL--LVA---TLL....IT-----------------------
K1Q539_CRAGI/458-821-------------DTGVHRLN------RLYC-MA----FF--IVL---TLF....AS-----------------------
E5S9V0_TRISP/19-379-------------DDFVDKLH------YFYT-TT----IL--LSF---SIL....VS-----------------------
O44887_CAEEL/17-366-------------DDSIDRLN------YYWT-PM----LL--VIF---ALT....LS-----------------------
Q7PKP9_ANOGA/22-378-------------DNLAFKFH------YRAT-FI----IL--LVC---TLL....VT-----------------------
B7PLS3_IXOSC/49-405-------------DDGVDKLN------RKYT-LV----VF--LFL---ALP....IF-----------------------
U1LVB7_ASCSU/48-414-------------EDFIDRLN------YRVT-SY----IL--LAA---AFT....II-----------------------
F1L3K8_ASCSU/22-368-------------.DSVDHLN------YYCT-SL----LL--AFA---ALA....IS-----------------------
Q9N3R5_CAEEL/20-377-------------DNGAERIV------HTTT-IQ----IL--ICF---GFL....VS-----------------------
E1ZXF0_CAMFO/28-380-------------DNLVFRLH------YRVT-FM----LL--LIG---TIL....VS-----------------------
F5HMP1_ANOGA/8-343-------------DSSIFRLH------TNAT-VI----LL--VTF---SIA....VT-----------------------
INX17_CAEEL/19-357-------------.DAIDRLR------YYFT-VF----LL--TSS---AFF....IM-----------------------
E0VDS4_PEDHC/20-354-------------DSSIFRLH------YSIT-VM----ML--IAF---SLI....VT-----------------------
E5SC05_TRISP/19-373-------------DDFTDRLN------YYYT-TL----FL--LFM---SIL....VS-----------------------
A8PTF8_BRUMA/22-367-------------.DKVDFLN------YYAT-SL----LL--ALV---ALA....IS-----------------------
J9JWH0_ACYPI/26-360-------------DNAVFRAH------YRLT-TA----IL--FGC---CIL....VT-----------------------
A0A068YJC6_ECHMU/46-414-------------EDLADRAN------FQWN-VI----VL--LIS---MIL....VT-----------------------
T1FMB3_HELRO/20-382-------------DDFSDRLL------YRHT-SA----LF--VLF---AIV....VS-----------------------
F1KWR8_ASCSU/21-373-------------DDRIDRLN------YFVT-SS----LL--TFF---AIL....VS-----------------------
E5SJ06_TRISP/21-380-------------DDATDQLH------YRFT-SC----LL--IVL---AMI....VS-----------------------
E9H086_DAPPU/26-366-------------DNAIFRLH------YRFT-SA----FF--FAA---CVI....IT-----------------------
H3EMZ6_PRIPA/18-385-------------EDKVDRLN------FQYT-SY----AY--VFS---AVL....IM-----------------------
H2KV19_CLOSI/22-392-------------EDFADKLS------FLYS-VL----VL--MLC---TTI....VT-----------------------
T1EFQ7_HELRO/20-385-------------DDFADRLS------SRYT-VV----LL--VLF---AVL....VG-----------------------
T1HJJ5_RHOPR/20-353-------------DNAIFRLH------YLFT-TV----ML--LAC---SLI....VT-----------------------
T1G065_HELRO/20-402-------------DDYIDRLT------RQYT-VI----IL--ICF---GFL....VS-----------------------
E3LLZ0_CAERE/22-389-------------..GTEQLL------HSTT-IS----IL--AFL---CVL....LA-----------------------
A0A068YEL0_ECHMU/22-423-------------DDFADRLN------.LFT-VI----LL--LLC---TLL....IS-----------------------
A0A068X4X8_HYMMI/22-417-------------EDFADKFN------FIFT-VV----VL--SLC---TVI....IT-----------------------
U1M8T6_ASCSU/18-361-------------EDAVDRIN------YMYT-NI----LL--LSF---SIL....LT-----------------------
K7J6Q6_NASVI/20-355-------------DTAVFRLH------YSLT-VI----LL--IAF---SLI....VT-----------------------
B7PF54_IXOSC/22-357-------------..FVFRLH------HRLT-VL----IL--IAF---AVL....IT-----------------------
E9HJ62_DAPPU/20-357-------------DNNIFRCH------YKLT-VI----FL--AVS---ATL....VS-----------------------
A0A068Y4Z1_ECHMU/24-412-------------QDWADRMS------YVHS-TI----IF--MLC---TAI....VS-----------------------
B4I656_DROSE/21-389-------------.DPIFTLH------SKCT-IV----IL--LTC---TFL....LS-----------------------
J9EZB8_WUCBA/21-364-------------DDLVDRLN------HVYT-VG----LF--MFL---ATL....TG-----------------------
E9H085_DAPPU/26-359-------------DNPIFRLH------YRLT-SA----IF--FAF---CVL....TT-----------------------
E0VNL8_PEDHC/26-361-------------DNMIFRFH------YRIT-SA----LL--FAS---CII....LT-----------------------
M9PGW0_DROME/20-353-------------DNAVFRLH------NSFT-TV----LL--LTC---SLI....IT-----------------------
H2KP29_CLOSI/22-395-------------DDFADRCS------YLLS-FV----LL--VLC---FTI....VT-----------------------
G4LX80_SCHMA/26-424-------------DDFIDRIN------HSHT-TT----VL--MIC---TLI....IM-----------------------
E1FV40_LOALO/19-382-------------DDFVDRLS------YFYT-PS----FL--IMM---AIL....VS-----------------------
T1EHZ5_HELRO/4-356-------------DDGIDRLN------RYYT-CC----IL--LAA---TTI....VS-----------------------
A8X0X1_CAEBR/20-359-------------DDASDSLS------CLIS-AF----LF--IIA---AIL....TS-----------------------
H3FKT7_PRIPA/38-405-------------DDFIDRLN------YYYT-PI----ML--SVA---CLI....IS-----------------------
A0A068Y3L2_ECHMU/21-416-------------EDFSDRLN------SFYT-TI----IL--LIL---VSI....TM-----------------------
E9HSG2_DAPPU/24-357-------------..PVFALH------YRLT-FL----VL--LTC---SIL....VT-----------------------
K1PRW3_CRAGI/26-393-------------DNYVDRLS------HYYT-VI----FL--LFM---QIT....VV-----------------------
A0A068YAQ8_ECHMU/95-570-------------DDFADRLN------YQFS-GV----LM--FLF---IGV....IG-----------------------
K1P371_CRAGI/31-392-------------DDWIDRLN------HLWT-VV----LM--TLF---AVV....TS-----------------------
G4VSX3_SCHMA/25-419-------------EDLADRLN------HFFS-CA----II--LML---SGV....TM-----------------------
T1G1G0_HELRO/20-382-------------DDFSDRLL------YRHT-SA----IF--VVF---AII....VS-----------------------
T1F3K5_HELRO/20-382-------------DDYVDRLS------RQYS-VI----IL--ICF---GFL....VS-----------------------
A0A068Y4N3_ECHMU/22-392-------------EDFADKMS------FMYS-VL----IL--LLC---TTI....IA-----------------------
T1EE00_HELRO/20-448-------------DDVIDRLS------SRYT-VV----ML--ICF---SLL....VS-----------------------
T1G9L4_HELRO/20-374-------------DSFSDRLS------CQYT-VT----IL--IIF---AIM....TT-----------------------
K1Q8H1_CRAGI/20-381-------------DDGLDRMS------HVVT-VV----LL--IIF---TVA....IS-----------------------
T1JVL3_TETUR/20-350-------------DNSVLVLH------YPVS-VI----LL--LAF---CVI....VT-----------------------
T1FF42_HELRO/20-382-------------DSFSDKLS------SKYT-VS----LL--SLF---ALL....SS-----------------------
F4WK99_ACREC/29-382-------------DNIVFRLH------YRVT-FL----LL--LVA---SIL....VT-----------------------
B4JMT0_DROGR/22-375-------------DNIVFKLH------YRWT-FV----LL--LVA---TLL....IT-----------------------
D6X4I2_TRICA/20-352-------------DSPVFRLH------YSIT-VL----IL--VAF---SLI....VT-----------------------
U1MEL2_ASCSU/21-373-------------DDFVDRLN------YYYT-PI----ML--AVA---CVI....IS-----------------------
T1KQA9_TETUR/21-353-------------DNNAFRLH------YKAT-VI----LL--VAS---SIL....VT-----------------------
B4JN21_DROGR/20-380-------------YDAVFTIH------SKCT-VV----IL--LTC---SLL....LS-----------------------
A8PZ15_BRUMA/19-373-------------DDIIDKLN------YYYT-TS----II--TVF---AIL....VS-----------------------
G7YJJ0_CLOSI/22-391-------------EDFADKFN------FLVT-VM----IL--LLC---TTV....VT-----------------------
T1KKN2_TETUR/42-372-------------DNIVFKLH------STVT-VL----IL--LVG---TMF....VS-----------------------
E5SRT1_TRISP/18-357-------------EDFIDRMH------FLFT-VK----VV--VTY---LVV....MS-----------------------
B4NKS4_DROWI/26-356-------------DNMVFRCH------YRIT-TA----IL--FTC---CII....VT-----------------------
A8X921_CAEBR/20-406-------------.DLVASVH------SFLT-SN----LL--VGL---AVL....IS-----------------------
Q29GC9_DROPS/20-393-------------YDAVFTIH------SKCT-VV----IL--ITC---SLL....LS-----------------------
B7QK16_IXOSC/22-357-------------DNNIFRLH------YRFT-GV----FL--FAS---SVL....VS-----------------------
Q29GW8_DROPS/21-382-------------.DPIFTLH------SKCT-IV----IL--LTC---TIL....LS-----------------------
G0NJM8_CAEBE/372-710-------------.DAIDRLR------YFAT-VV----IL--TSC---AFF....IM-----------------------

PF00029

H3AWH1_LATCH/3-247DWSILGRLLT.EVQNHSTVIG....KIWLTM.LL....IF..RIL---LVT----LV-----------------------
H2SPA6_TAKRU/4-236DWNLLGSILE.EVHIHSTIVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
F7EJU4_XENTR/1-220DWSILGRLLT.EVQNHSTVIG....KIWLTM.LL....IF..RIL---LVT----LV-----------------------
I3KXW0_ORENI/2-217SWGALYAQLG.GVNKHSTSLG....KIWLSV.LF....IF..RIT---ILV----LA-----------------------
A7VKB2_DANRE/3-235EWTLLKRLLD.AVHQHSTMIG....RLWLTI.MV....IF..RLL---IVA----VA-----------------------
F6QD10_XENTR/3-234DWSFLGQFLE.EVQKHSTVVG....KVWLTI.LF....IF..RML---VLG----TA-----------------------
W5LSW7_ASTMX/5-245DWGFLERLLI.EGQEYSTNVG....RVWLTV.LF....LF..RML---VLG----TA-----------------------
I3KZJ5_ORENI/3-218DWGFLSTLLE.KVQSHSTVIG....KIWMVV.LF....LF..RIM---VLG----AG-----------------------
H2U506_TAKRU/3-235NWAFLEGLLS.GVNKYSTAFG....RIWLAI.VF....IF..RLL---VFL----VA-----------------------
H0YRM3_TAEGU/4-209.WDSLGFLIV.TLNYNVTIVG....KIWLML.II....LL..RMA---VVV----LA-----------------------
I3KDI4_ORENI/5-225..GFLSSVLC.KWHAQATVIG....KSLLPV.LL....LI..RFV---ILG----AA-----------------------
W5NMQ0_LEPOC/2-215SWGQLYALLG.GVNKHSTSLG....KVWLSV.VF....VF..RIM---ILV----VA-----------------------
M4AZZ1_XIPMA/2-209DWKTFQALLS.GVNKYSTAFG....RVWLSV.VF....VF..RVM---VYV----VA-----------------------
M3WS82_FELCA/3-231DWGSLGQLLG.KVQTYSNPGG....KVWLSI.LF....VF..RIL---LLG----TA-----------------------
E7FEN2_DANRE/3-235DWNLLGSILE.EVHIHSTIVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
H0XEF8_OTOGA/3-277EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVA----IV-----------------------
F7AWX4_CIOIN/3-233SWKYLDDVLL.RLSKNSTLLG....KYWIAT.VL....LL..RLV---VLT----VF-----------------------
I3J6V1_ORENI/7-223...LCSVLER.VINHSITLMG....KVWLIV.MI....FL..RVL---ILL----FA-----------------------
W5NNA4_LEPOC/2-203NWGFLENVLS.GVNKYSTAIG....RIWLSI.VF....VF..RIL---IYV----AA-----------------------
H3CIE9_TETNG/2-271SWSFLTRLLE.EIHNHSTFVG....KLWLTV.LI....VF..RIV---LTA----VG-----------------------
Q1LWG0_DANRE/5-240DWGFLEHLLE.EGQEYSTGVG....RVWLTV.LF....LF..RML---VLG----TA-----------------------
W5LK97_ASTMX/3-236EWTLLKRLLD.AVHQHSTMIG....RLWLTV.MV....IF..RLL---VVA----VA-----------------------
W5LT82_ASTMX/3-260DWSILGRFLA.EVQNHSTVIG....KIWLTV.LL....IF..RIL---LVT----LV-----------------------
Q6NYU5_DANRE/3-235DWNFLGGILE.EVHIHSTMVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
G3PF51_GASAC/2-203NWGFLENILS.GVNKYSTVIG....RIWLSV.VF....LF..RIL---VYV----AA-----------------------
H3AVR6_LATCH/2-252SWSFLTRLLE.EIHNHSTFVG....KIWMTV.LI....VF..RIV---LTA----VG-----------------------
I3KPL9_ORENI/3-219EWGFLSSLLN.KVQSHSTVIG....KVWLSV.LF....IF..RIM---ILG----AG-----------------------
I3KDJ0_ORENI/24-241..SVLSRLLA.LWHSHAGFLG....KTVLPV.LQ....LV..RIV---LVG----AA-----------------------
H2YD27_CIOSA/3-225.WHIVQKLVE.GTGAHSTIVG....KYWITA.FF....VL..RFL---LVI----SI-----------------------
W5LS74_ASTMX/3-226EWDVLGRLLD.KVQKHSTVIG....KIWLTV.LF....VF..RIL---VLG----AG-----------------------
I3JLG4_ORENI/2-209DWKVLQGFLS.GVNKYSTAFG....RIWLSV.VF....VF..RVL---VFV----VA-----------------------
G1LUU1_AILME/1-212NWNFLGGVLE.EVHIHSTVFG....KIWLTI.LF....IF..RKL---VLG----VA-----------------------
W5NL33_LEPOC/3-225DWTFLGRLLD.KVQSHSTVVG....KIWLTV.LF....VF..RIL---VLG----AG-----------------------
W5K246_ASTMX/3-256EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVG----IV-----------------------
E4XFG0_OIKDI/3-274.WHIIEKLLE.EVAKHSTFVG....KVWITA.IF....LF..RIV---VVT----RI-----------------------
I3KZG9_ORENI/3-222DWSYLLTLLH.KVQSHSTIVG....KIWMSV.LF....LF..RIF---VLG----AA-----------------------
G1TBS7_RABIT/4-233.WSLLGRILE.EVHIHSTMVS....KLWLTI.LF....IF..RML---VLG----IA-----------------------
H2U507_TAKRU/2-210NWAFLEGLLS.GVNKYSTAFG....RIWLAI.VF....IF..RLL---VFL----VA-----------------------
Q28ED4_XENTR/2-214DWGTLYEVIG.GVNRHSTSIG....KIWLSV.LF....IF..RIM---ILV----VA-----------------------
H2LYS6_ORYLA/3-266EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVG----IV-----------------------
H3AJ15_LATCH/3-212EWSFLSSFLE.YLQNHSPMVG....RIWLVV.ML....IF..RIL---ILA----TV-----------------------
F7ETX8_ORNAN/2-215DWSTLHTFIG.GVNKYSTSIG....KIWITV.IF....IF..RVM---ILV----VA-----------------------
H2ZVD7_LATCH/5-257SWSFLTRLLE.EIHNHSTFVG....KVWLSM.LI....IF..RIV---LTA----VG-----------------------
H2S6C1_TAKRU/3-218DWGFLSSLLD.KVQSHSTVIG....KIWMSV.LF....LF..RIM---VLG----AG-----------------------
H3ALN1_LATCH/3-235DWNFLGGVLE.EVHIHSTIVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
CX32_DANRE/3-215DWGFLSALLD.KVQSHSTVIG....KIWMSV.LF....IF..RIL---VLG----AG-----------------------
I3J613_ORENI/3-235EWTLLKRLLD.AVHQHSTMIG....RLWLTV.MV....IF..RLL---IVA----VA-----------------------
U3KL92_FICAL/2-214NWAGLYTVLS.GVNRHSTAIG....RIWLSV.IF....IF..RIM---VLV----VA-----------------------
G3NQK0_GASAC/2-213NWSGLESLLS.GVNKYSTAFG....RIWLSM.VF....VF..RVM---VFV----VA-----------------------
H3C889_TETNG/2-252SWSFLTRLLD.EISNHSTFVG....KIWLTI.LI....IF..RIV---LTA----VG-----------------------
M4AHN8_XIPMA/3-229EWDLLGRLLE.KVQSHSTVIG....KVWLMV.LF....IF..RIM---VLQ----TA-----------------------
I3IYX3_ORENI/3-244DWSLLGNFLE.EVQEHSTSVG....KVWLTI.LF....IF..RIL---VLG----TA-----------------------
M3XKA4_LATCH/4-217.WIFWGRLLD.KIESHSTVVG....NIWLTV.LF....VF..RIL---VLG----.A-----------------------
H2T4Y3_TAKRU/239-451..NFLGRLLE.NAQEHSTVIG....KVWLTV.LF....IF..RIL---VLG----AA-----------------------
H3C2U7_TETNG/2-212SWAELYKRLG.GVNKHSTSLG....KVWLSV.LF....IF..RVS---ILV----LA-----------------------
R0L8V9_ANAPL/2-256SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LI....VF..RIV---LTA----VG-----------------------
V8NXQ1_OPHHA/3-236DWSFLGNILE.EVNEHSTVIG....RVWLTV.LF....IF..RIL---ILG----TA-----------------------
F7A3G7_MONDO/2-215SWAFLTRLLE.AVTQHSTLVG....KLWLSV.LV....VF..RLV---LLA----VG-----------------------
H2TXC6_TAKRU/12-223.........I.SVNHSITLMG....KVWLIV.MI....FL..RVL---TLL----FA-----------------------
F7EJS7_MONDO/2-210NWGIFEDLLS.GVNKYSTAFG....RIWLSL.VF....IF..RVL---VYL----VT-----------------------
H2T4Y3_TAKRU/2-222SWTTLYAQLA.GVNRHSTSLG....KVWLSV.LF....IF..RVM---VLV----VA-----------------------
I3KZV2_ORENI/5-248DWSFLEHLLE.EGQEYSTAIG....RVWLTV.LF....LF..RML---VLG----TA-----------------------
W5LRY9_ASTMX/2-208NWGNLESLLS.GVNKYSTVFG....RVWLSM.VF....IF..RVL---VFV----VA-----------------------
B3DID2_DANRE/3-226DWSLLGNFLE.EVQEHSTSVG....KVWLTI.LF....IF..RIL---VLG----TA-----------------------
W5LRJ3_ASTMX/2-218SWGTLYTQLV.GVNRHSTSLG....KIWLSV.LF....IF..RVT---ILV----VA-----------------------
H3DPE1_TETNG/2-203NWSFLENILS.GVNKYSTVIG....RVWLFV.VF....LF..RIL---VYV----VA-----------------------
G1P848_MYOLU/5-284SWSFLTRLLE.EIHHHSTFVG....KVWLTV.LV....VF..RIV---LTA----VG-----------------------
H0VZC3_CAVPO/5-270SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LV....VF..RIV---LTA----VG-----------------------
H2QV11_PANTR/5-214...FLRRLLA.EESRRSTPVG....RLLLPV.LL....GF..RLV---LLA----AS-----------------------
H9GHG0_ANOCA/3-256EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVA----IV-----------------------
V8NGI0_OPHHA/2-210DWKTLQGLLS.GVNKYSTAFG....RIWLSV.VF....VF..RVL---VYV----VA-----------------------
F6Z9W1_HORSE/5-215...FLRWLVA.EESRHSTHVG....RLLLPV.LL....GF..RLV---LLA----AS-----------------------
L5MG71_MYODS/92-305.......LII.TLNCNVTIVG....KIWLIF.MI....LL..RMV---VII----VA-----------------------
L5JSY3_PTEAL/60-308DWSFLGRLLT.QVQNHSTVVG....KVWLTV.LL....VF..RIL---LVT----LV-----------------------
R0LQP0_ANAPL/3-236DWSFLGEFLE.EVHKHSTVVG....KVWLTV.LF....IF..RML---VLG----TA-----------------------
F6XTB3_MONDO/3-229DWSFLGRLLN.EVQNHSTVIG....KIWLTA.LL....IF..RIL---LVT----LV-----------------------
W5LSK7_ASTMX/12-228.......LLSAAVETSTTYKG...RTVWFGL.LC....V...RLV---TLF----VA-----------------------
H2ML18_ORYLA/1-218DWSALGRLLD.KVQAYSTAGG....KVWLSV.LF....IF..RIL---VLG----TA-----------------------
F6S9P0_CIOIN/2-251SWHFLERWVE.KANQHSTLVG....KFWITF.LI....VC..RMV---IVA----SV-----------------------
H2SUJ4_TAKRU/2-210NWAFLQGLLS.GVNKYSTAFG....RVWLSI.VF....LF..RVM---VFV----VA-----------------------
F7BMQ9_MONDO/3-212EWAFLGSLLD.SVQLQSPLVG....RLWLVV.ML....IF..RIL---VLA----TV-----------------------
V8P2C7_OPHHA/3-221EWGFLSSLLD.AVQEHSPMVG....RFWLVV.ML....IF..RIL---ILA----TV-----------------------
L9JDB3_TUPCH/201-431DWGFLEKLLD.QVQEHSTVVG....KIWLTV.LF....IF..RIL---ILG----LA-----------------------
W5L1W8_ASTMX/2-257SWSFLTRLLD.EISDHSTFVG....KIWLTL.LI....IF..RIV---LTV----VG-----------------------
Q8JFD6_DANRE/3-260EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVA----IV-----------------------
G3GSS7_CRIGR/3-235DWNLLGGILE.EVHSHSTIVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
H2ZYS4_LATCH/3-236DWSLLGNILE.EVQEHSTVVG....KVWLTV.LF....VF..RIL---VLG----TA-----------------------
CXG1_PIG/2-255SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LI....VF..RIV---LTA----VG-----------------------
G1PYG2_MYOLU/3-223DWSLLGRLLD.TAQGHSTVIG....KVWLTV.LF....IF..RIL---LLG----AG-----------------------
Q6NVT8_XENTR/2-214NWAGLYAILS.GVNRHSTSIG....RIWLSV.VF....IF..RIM---VLV----VA-----------------------
W5NP42_LEPOC/3-225DWTFLLKVLE.QVHEHSTMVG....KVWLTV.LF....IF..RML---VLG----AA-----------------------
G3TTM6_LOXAF/5-249SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....VF..RIV---LTA----VG-----------------------
H3B5X0_LATCH/2-253SWAFLTRLLE.EINNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
I3N3J2_SPETR/5-215...FLRQLLA.EESQHSTPVG....RLLLPV.LL....GV..RLV---LLA----AS-----------------------
G3QAJ1_GASAC/3-273EWTILERLLEAAVQQHSTMIGSFFEKVCMSV.LA....VE..RMR---FQR----AV-----------------------
W5NMN4_LEPOC/3-227DWSLLGNILE.EVQEHSTSVG....KVWLTV.LF....IF..RIL---VLG----TA-----------------------
F6VRX7_CIOIN/3-218.WHIVEKLLE.QVAEHSTLVG....KFWVTF.FF....VL..RFL---MVV----SI-----------------------
W5NQJ6_SHEEP/2-210NWAFLRDVLS.GVNKYSTALG....RIWLSV.VF....IF..RVL---VYV----VA-----------------------
X1WDX8_DANRE/3-220DWGFLSKLLD.KVQSHSTSIG....KVWLTV.LL....IF..RIM---VLG----AG-----------------------
F7E5W8_XENTR/2-210NWAIFQGLLS.GVSTYSTAFG....RIWLSV.VF....IF..RLM---VYV----VA-----------------------
G1NQF9_MELGA/2-215DWGALQTILG.GVNKHSTSIG....KIWLTV.LF....IF..RIM---ILV----VA-----------------------
I3KVE7_ORENI/1-203EWGFIGGFFK.DFQTHLPMLG....RCWLIL.VL....VF..RIL---ILG----TV-----------------------
E4X0Y2_OIKDI/2-275SWHFLERWLE.RANQHSTLIG....KFWITY.LI....VC..RMV---IIG----SI-----------------------
G1KPR6_ANOCA/2-243SWSFLTRLLE.EINQHSTFVG....KVWLSV.LI....VF..RIV---LTA----VG-----------------------
H0YV03_TAEGU/2-256SWSFLTRLLE.EIQNHSTFVG....KIWLTV.LI....VF..RIV---LIA----VG-----------------------
H3C492_TETNG/2-256SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LV....VF..RIV---LTA----VG-----------------------
F1STM7_PIG/2-210NWGVFEGLLS.GVNKYSTAFG....RVWLSL.VF....IF..RLL---VYL----VT-----------------------
F6QCF2_XENTR/3-233DWSFLGNILE.EVNEHSTVIG....RVWLTV.LF....IF..RIL---ILG----TA-----------------------
I3MGG4_SPETR/8-224.....GFLII.TLNCNVTIVG....KIWLIF.MI....LL..RMV---VLI----LA-----------------------
W5LSW6_ASTMX/2-208NWTSLEVLLG.GVSQYSTVFG....RVWLSM.VF....IF..RFL---VFA----VA-----------------------
Q5TYN9_DANRE/3-219EWGFLSKLLD.KVQSHSTVVG....KVWLTV.LF....VF..RIM---VLG----AG-----------------------
U3JNY0_FICAL/2-256SWSFLTRLLE.EINNHSTFVG....KIWLTV.LI....VF..RIV---LTA----VG-----------------------
F1QYI2_DANRE/2-260SWSFLTRLLD.EISNHSTFVG....KIWLTL.LI....IF..RIV---LTV----VG-----------------------
CXG3_MOUSE/16-226...FLRQLLA.QESQHSTPVG....RFLLPM.LM....GF..RLL---ILV----SS-----------------------
CXA6_RAT/3-234DWSALHQLLE.KVQPYSTAGG....KVWIKV.LF....IF..RIL---LLG----TA-----------------------
H2Y3H1_CIOIN/3-269.WHIIHSLLE.QVRLHSTFPG....KLWIIM.MF....IF..RIV---VVA----RI-----------------------
G7NUB7_MACFA/3-235DWNLLGDTLE.EVHIHSTMIG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
R0LA62_ANAPL/1-208.WGVFEGLLS.GVNKYSTAFG....RIWLSV.VF....VF..RVL---VYV----VA-----------------------
E1BQP7_CHICK/5-259SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....VF..RIV---LTA----VG-----------------------
W5LTI3_ASTMX/3-258DWSILGRFLT.EVQNHSTVIG....KIWLTM.LL....IF..RIL---LVA----LV-----------------------
F6WJC3_XENTR/17-225NWGVYEALIT.GVNKYSTEFG....RLWLSI.VF....IF..RFL---VYA----LT-----------------------
I3JAN6_ORENI/2-208NWNWLQALLS.GVSNYSTVFG....RVWLSV.VF....IF..RVM---VFV----VA-----------------------
H0VLP6_CAVPO/5-215...FLRQLLA.QESQCSTPVG....RLLLPV.LL....GF..RLA---LLA----AS-----------------------
F7BI06_MONDO/3-235DWSFLGNILE.EVNEHSTVIG....RVWLTV.LF....IF..RIL---ILG----TA-----------------------
CXA4_XENTR/3-232DWEFLEKLLD.QVQEHSTSIG....KIWLMV.LF....IF..RIL---ILG----LA-----------------------
H2S6B7_TAKRU/5-280EWDLLGRLLD.KVQSHSTVLG....KVWLTV.LF....VF..RIL---VLQ----TA-----------------------
H3ASF8_LATCH/3-233DWGFLEKLLD.KVQEHSTPIG....KVWLTI.LF....IF..RIL---ILG----VA-----------------------
I3KHF0_ORENI/2-267SWSFLTRLLE.EIHNHSTFVG....KIWLTA.LI....VF..RIV---LTA----VG-----------------------
F6VXA2_MONDO/2-249SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....VF..RIV---LTA----VG-----------------------
W5JZ19_ASTMX/2-270SWSFLTRLLE.EIQNHSTPVG....KLWLTT.LV....VF..RIV---LTV----VG-----------------------
H2LHM2_ORYLA/1-203EWDFVGKHFE.TLAKELPMLG....RLWLFF.ML....VF..RIV---ILG----TV-----------------------
H2T1Y9_TAKRU/3-225DWNLLGKLLE.KAQEHSTVVG....KVWLTV.LF....IF..RIL---ILS----AA-----------------------
I3KF01_ORENI/2-208NWNWLQALIS.GVNKYSTVFS....RAWLAV.VF....IF..RVM---VFV----VA-----------------------
G1N2B3_MELGA/4-211.WDSLGFLVV.TLNYNVTIIG....KIWLML.VV....LL..RMA---VVV----LA-----------------------
E7FBZ4_DANRE/3-233DWSALGKLLD.KVQAYSTAGG....KVWLSV.LF....IF..RIL---VLG----TA-----------------------
H2LI61_ORYLA/2-265SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LI....VF..RIV---LTA----VG-----------------------
W5KYU2_ASTMX/9-217......ALFI.SLNQNITFIG....KLWLTV.FL....LF..RVF---ILL----FA-----------------------
E4WSZ4_OIKDI/3-276.WRYIDPLLE.KAARHSTIFG....KYWATI.IV....IF..RLT---ML.----TF-----------------------
W5LUZ9_ASTMX/2-214NWASFYAVVS.GVNRHSTGIG....RIWLSV.IF....IF..RIL---VLV----VA-----------------------
H2YWV0_CIOSA/3-255SWHFVERWLQ.KVNQHSTLIG....KFWITF.LI....IF..RIV---VVS----SV-----------------------
G1U794_RABIT/5-221SWGFLTRLLE.EIHNHSTFVG....KVWLTV.LV....VF..RIV---LTA----VG-----------------------
H2ZV48_LATCH/2-203SWNFFLDVLS.GVNKYSTGIG....RIWLSV.VF....IF..RLF---IYV----AA-----------------------
H3API8_LATCH/2-210SWAFLHGIVS.GVNKYSTAFG....RVWLSV.VF....IF..RLL---VYV----VA-----------------------
H2XJX2_CIOIN/3-260.WNILEKVSE.QVSLYATLTG....QVWYLL.VY....LF..RLI---VVV----TI-----------------------
CXG1_DANRE/2-250SWSFLTRLLD.EISNHSTFVG....KIWLTL.FI....IF..RIV---LTV----VG-----------------------
G1QTG3_NOMLE/2-211DWKTLQALLS.GVNKYSTAFG....RIWLSV.VF....VF..RVL---VYV----VA-----------------------
H3AJZ7_LATCH/3-233DWSALGKLLD.KVQAYSTAGG....KVWLSV.LF....IF..RIL---ILG----TA-----------------------
H0XZ54_OTOGA/6-222...FLGFLLV.TLNCNVTIVG....KVWLIL.TV....LL..RVA---VIV----LA-----------------------
Q8K4M6_CAVPO/2-215DWGALHAILG.GVNKYSTSIG....KIWLTV.LF....IF..RVM---ILV----VA-----------------------
E4XZI0_OIKDI/4-257..EVLAGISE.KLLKYSTPFG....HMWNAL.TF....LC..RLL---PAT----TI-----------------------
H2MKZ2_ORYLA/3-221EWSFLSQLLD.KVQSHSTVFG....KVWMII.LF....LF..RIF---ILA----AG-----------------------
Q66HV7_DANRE/2-254SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
W5LS82_ASTMX/3-218EWGFLSKLLD.KVQSHSTVIG....KVWMTV.LF....VF..RIM---VLG----AG-----------------------
M3ZFG9_XIPMA/3-244DWSLLGNFLE.EVQEHSTSVG....KVWADISLFYCAKIW..KSL---ILE----GK-----------------------
I3JAN5_ORENI/5-241NWNWLEELIS.GVNNYSTVFG....RVWLSV.VF....VF..RVL---VFV----VA-----------------------
G5BBL6_HETGA/3-231DWSFLGAFLE.EVHKHSTIIG....KVWLTV.LF....IF..RML---VLG----TA-----------------------
F1QL21_DANRE/3-226DWSLLGNFLE.EVQEHSTSVG....KVWLTV.LF....IF..RIL---VLG----TA-----------------------
H2MKZ7_ORYLA/3-216DWSYLSLLLD.KVQSHSTVVG....KIWMSV.LF....LF..RIF---VLG----AA-----------------------
E4XEP0_OIKDI/2-239SWHFVERWLQ.KVNQHSTLIG....KFWLTF.LI....IFRTRIV---VVS----SV-----------------------
CXG1_XENTR/2-253SWSFLTRLLE.EINNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
F6WE26_XENTR/2-255SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LI....VF..RIV---LTV----VG-----------------------
G1PZ72_MYOLU/3-220DWSFLGNILE.EVSEHSTAVG....RVWLTV.LF....IF..RIL---ILG----TA-----------------------
G1U6K9_RABIT/5-215...FLRQLLA.EESRHSTAVG....RLLLPV.LL....GF..RLA---LLA----AS-----------------------
M4A0T3_XIPMA/2-208NWGNLVVLLS.GVNKYSTVFG....RLWFFM.VL....IF..RIL---VFV----VA-----------------------
L9KPJ4_TUPCH/4-215..RFLRRLLT.EESRHSTPVG....RLLLPV.LL....GF..RLV---LLA----AC-----------------------
Q4S8R0_TETNG/3-228DWNLLGKLLE.SAQEHSTVVG....KVWLTV.LF....IF..RIL---VLG----TA-----------------------
G1K926_ANOCA/4-219.WDSLGFLIL.ALSYNVTIIG....KIWLTL.VI....LL..RFM---VIF----LA-----------------------
I3JSR3_ORENI/2-262SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
G3PMN6_GASAC/2-239SWSFLTRLLD.EISNHSTFVG....KIWLTM.LI....VF..RIV---LTA----VG-----------------------
H0W6E8_CAVPO/2-210DWEFLYKRLS.GANKYSTALS....RIWLSV.VF....VF..RLL---VYL----VA-----------------------
W5NNM0_LEPOC/5-260SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
W5MSD7_LEPOC/2-251SWSFLTRLLE.EIHNHSTFVG....KVWLTI.LV....VF..RIV---LTA----VG-----------------------
F1QZN0_DANRE/2-206NWSGLQSLLS.GVNQYSTVFG....RVWLSV.VF....VF..RVL---VFV----VA-----------------------
I3NGZ1_SPETR/3-214EWAFLGSLLD.AVQLQSPLVG....RLWLVV.ML....IF..RIL---VLA----TV-----------------------
G3PLV3_GASAC/3-238.WPALYSQLV.GGNRHSTSLG....KIWLSV.LF....IF..RVM---VLV----VA-----------------------
CXG3_BOVIN/5-216...FLRRVAA.EESRHPTPVG....RLLLPA.LL....GL..RLV---LLA----AG-----------------------
Q7T2D7_DANRE/3-219DWGFLSSLLD.KVQSHSTVVG....KIWMSV.LF....IF..RIL---VLG----AA-----------------------
I3KYC0_ORENI/3-221EWSFLSDLLD.KVQFHSTVLG....KVWMSV.LF....LF..RIF---ILA----AG-----------------------
H2LLM1_ORYLA/2-208NWAALQALLS.GVNQYSTAFG....RVWLSM.VF....VF..RVM---VFV----VA-----------------------
H2SP60_TAKRU/3-224DWSLLGNFLE.EVQEHSTSVG....KVWLTI.LF....IF..RIL---VLG----TA-----------------------
H2XQL4_CIOIN/3-214.WHIVQKLVE.GVGEHSTLFG....KFWITL.FF....II..RFL---FVV----TL-----------------------
W5LSW9_ASTMX/2-210NWAFLQGLVS.GVNKYSTAFG....RIWLSV.VF....IF..RLL---VLL----VA-----------------------
E4XWI7_OIKDI/6-263...LIDQYAK.KIQKYSTPIS....HAWWTV.NF....VL..RMF---IVT----TI-----------------------
F7CJM7_CALJA/5-246SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LV....VF..RIV---LTA----VG-----------------------
H3DP97_TETNG/3-227EWDLLGRLLD.KVQTHSTVLG....KIWLTV.LF....VF..RIL---VLQ----TA-----------------------
W5M0U8_LEPOC/14-229........LV.EVRTFSISMG....VISITM.FV....SQ..RKI---YIF----KA-----------------------
W5LWP5_LEPOC/4-229.WNTLDFLFI.TLNYNITIVG....KIWLTL.MI....ML..RFL---VVL----FA-----------------------
F6UBJ9_CIOIN/3-265.WHLLEKIVE.HSAAHSTLLG....KWWIAF.MF....VF..RII---VVA----SI-----------------------
W5LTB5_ASTMX/3-205DFGFLSGLFE.SLQANSPMLG....RFWLLL.ML....VF..RML---ILG----TV-----------------------
Q6DEG1_DANRE/2-207NWLSLEVLLG.GVSQYSTVFG....RVYLSV.VF....IF..RIL---VFV----VS-----------------------
H2Y5A4_CIOSA/4-260.WHIIHSLLE.QVRLHSTFPG....KLWIIM.MF....IF..RIV---VVA----RI-----------------------
H2SK18_TAKRU/3-261EWTILERLLEAAVQQHSTMIG....RILLTV.VV....IF..RIL---IVA----IV-----------------------
V8N9D2_OPHHA/2-209NWSGLEDLLG.GVNKYSTAFG....RIWLSV.VF....IF..RLL---VYL----VA-----------------------
M3Y3X1_MUSPF/6-223...LLGFLLI.TVNCNMTIVG....KIWLIF.MV....LL..RMV---VII----LA-----------------------
Q4T8N8_TETNG/3-290EWTLLKRLLD.AVHQHSTMIG....RLWLTV.MV....IF..RLL---VVA----VA-----------------------
I3KVE6_ORENI/3-253EWDFISGFFD.ALQTRSPMLG....RFWLFL.VL....VF..RIV---ILE----TV-----------------------
W5NLN3_LEPOC/3-255DWSILGRFLT.EVQNHSTVIG....KIWLTM.LL....IF..RIL---LVT----LV-----------------------
L9JE20_TUPCH/2-210NWGSFRGLLS.GVNKYSTAFG....RIWLSL.VF....IF..RML---VFL----VA-----------------------
E4XXY1_OIKDI/3-267.WGAVEGVIV.KALHYSTPLS....YAWLFL.LF....TF..RSF---IVA----VV-----------------------
H2Y0D6_CIOIN/3-273SWALLEKLLG.EVATHSTLIG....KYWFSF.LF....VF..RVI---VVL----SV-----------------------
E4XG44_OIKDI/4-279.WHAVEGFIS.EAGKHSTWAG....KFYNTF.FD....VF..RLL---FLV----SI-----------------------
F7G2Z1_MACMU/11-217........II.TLNCNVTMVG....KLWFVL.TM....LL..RML---VIV----LA-----------------------
W5NP15_LEPOC/2-209NWAFLQGLLS.GVNKYSTAFG....RIWLSV.VF....IF..RVL---VFV----VA-----------------------
F7BU85_ORNAN/4-210.WDVLGFLII.TLNSNVTMVG....KMWLIL.MI....LL..RMA---VLV----LA-----------------------
F6W3E8_XENTR/2-203SWSFLRDILS.GVNKYSTGIG....RIWLSV.VF....IF..RLL---VYV----VA-----------------------
V8NGI0_OPHHA/252-482DWGFLEKLLD.QVQEHSTVIG....KIWLTV.LF....IF..RIL---ILG----LA-----------------------
H3AFY3_LATCH/2-215NWGTLYSVLG.GVNKHSTSIG....KIWLSV.LF....IF..RIM---ILI----VA-----------------------
H2UYD2_TAKRU/3-199EWGFLGGLFD.SLQAHSPMLG....RFWLLL.ML....IF..RIV---ILG----TV-----------------------
G1KPT6_ANOCA/3-235DWNLLGSILE.EVHIHSTIVG....KIWLTI.LF....IF..RML---VLG----VA-----------------------
F6XX97_XENTR/3-216EWGFLSSLLD.AVQEHSPMVG....RFWLVV.ML....IF..RIL---ILA----TV-----------------------
G1KFU5_ANOCA/5-260SWSFLTRLLE.EIHNHSTFVG....KIWLTV.LI....VF..RIV---LTA----VG-----------------------
W5LSX0_ASTMX/2-208DWKTLESLLS.GVNKYSTGFG....RIWLSL.VF....VF..RVM---VFV----VA-----------------------
F6TGH3_ORNAN/2-210NWASFQELLS.GVNKYSTALG....RIWLSV.VL....VF..RVL---VYV----VA-----------------------
W5NLV6_LEPOC/2-261SWSFLTRLLE.EIHNHSTFVG....KLWLTV.LI....VF..RIV---LTA----VG-----------------------
H0Z9S4_TAEGU/3-225DWSLLGRLLE.NAQEHSTVVG....KVWLTV.LF....VF..RIL---VLG----AA-----------------------
Q5SNV2_DANRE/2-203NWGFLENVLS.GVNRYSTVVG....RVWLSI.LF....IF..RIL---VFV----AA-----------------------
H2UN58_TAKRU/33-250DWSFLENLLE.EGQEYSTGIG....RVWLTV.LF....LF..RML---VLG----AS-----------------------
G7P3J8_MACFA/2-203SWMFLRDLLS.GVNKYSTGIG....RIWLAV.VF....VF..RLL---VYM----VA-----------------------
I3K6P7_ORENI/5-256SWSFLTRLLD.EISNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
E4WRX0_OIKDI/2-266SWHFVERWLE.KASQHATLVG....KFWLTF.LI....VC..RMV---IIA----SI-----------------------
I3KZU8_ORENI/2-252SWSFLTRLLD.EISNHSTFVG....KIWLTL.LI....VF..RIV---LTV----VG-----------------------
H3AFA2_LATCH/3-235DWSFLSRILE.QVHEHSTLVG....KVWLTV.LF....IF..RML---VLG----TA-----------------------
U3KK04_FICAL/2-203SWAFLRDLLS.GVNKYSTGIG....RIWVAV.VF....MF..RLL---VYV----AA-----------------------
Q0V9Q2_XENTR/5-255SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....IF..RIV---LTA----VG-----------------------
W5LS83_ASTMX/3-220EWGFLSNLLD.KVQSHSTSIG....KVWMTV.LL....IF..RIM---VLG----AG-----------------------
W5LKY1_ASTMX/5-260SWSFLTRLLE.EIHNHSTFVG....KVWLTV.LI....VF..RIV---LTA----VG-----------------------
I3KPM0_ORENI/3-228EWDLLGHLLD.KVQSHSTVIG....KVWLTV.LF....IF..RIM---VLQ----TG-----------------------
F6S9Q0_CIOIN/2-246SWHFLERWVE.KANQHSTLVG....KFWITF.LI....VC..RMV---IVA----SV-----------------------
W5NN38_LEPOC/3-253EWTLLKRLLD.AVHQHSTMIG....RLWLTV.MV....VF..RLL---IVA----VA-----------------------
W5LS84_ASTMX/3-216DWGFLSSLLD.KVQSHSTVIG....KIWMSV.LF....IF..RIL---VLG----AG-----------------------
H2LA31_ORYLA/2-253SWSFLTRLLD.EISNHSTFVG....KIWLTV.LI....IF..RIV---LTA----VG-----------------------
H2TW08_TAKRU/3-235DWSILGRFLT.EVQNHSTVIG....KIWLTM.LL....IF..RIL---LVA----LV-----------------------
E4WYD1_OIKDI/11-261.......IIE.SFSVYNTPFR....DFWLVT.LF....VF..RFL---AVE----II-----------------------
H3C8N2_TETNG/1-214DWSFLGNFLE.DVQEHSTSVG....KVWLTV.LF....IF..RIL---VLG----TA-----------------------
F7CCT5_MONDO/4-220.WDLLGFLII.TLNCNVTIVG....KIWLII.MI....ML..RMV---VII----LA-----------------------
H0WMY4_OTOGA/4-216.WDYLLYLLN.EVKKNSNVVG....KIWLTV.LF....IF..RIF---ILQ----VA-----------------------
H2Y5A2_CIOSA/4-264.WHIIHSLLE.QVRLHSTFPG....KLWIIM.MF....IF..RIV---VVA----RI-----------------------

PF00822

CLD7_HUMAN/4-182-------------------------------------------------.P.Q---------------------------
CCG2_MOUSE/6-197-------------------------------------------------.TDY---------------------------
EMP3_HUMAN/1-156-------------------------------------------------DKSW---------------------------
EMP1_MOUSE/1-154-------------------------------------------------.ANV---------------------------
CLD1_MOUSE/4-182-------------------------------------------------P..Q---------------------------
CLD10_HUMAN/4-179-------------------------------------------------PTDY---------------------------
PMP22_HUMAN/1-153-------------------------------------------------.VSQ---------------------------
EMP1_RABIT/1-154-------------------------------------------------.ANV---------------------------
LMIP_BOVIN/1-157-------------------------------------------------.TDH---------------------------
EMP2_MOUSE/1-165-------------------------------------------------.DNA---------------------------
CLD7B_DANRE/4-182-------------------------------------------------P..Q---------------------------
EMP1_HUMAN/1-151-------------------------------------------------.ANV---------------------------
EMP2_HUMAN/1-160-------------------------------------------------.DNA---------------------------

PF13903

TM235_HUMAN/16-197--------------------------------------------------SDY---------------------------
TM235_MOUSE/16-192--------------------------------------------------SDY---------------------------
B4Q2K5_DROYA/16-232--------------------------------------------------TDN---------------------------
TM182_XENTR/15-225--------------------------------------------------SDY---------------------------
A0A023EMM6_AEDAL/16-235--------------------------------------------------TDN---------------------------
TM182_MOUSE/15-220--------------------------------------------------SDY---------------------------
D2HQ99_AILME/17-198--------------------------------------------------TDH---------------------------
B4NZC2_DROYA/16-190--------------------------------------------------TPY---------------------------
Q1L8R4_DANRE/69-258--------------------------------------------------TEF---------------------------
B0WVP8_CULQU/16-190--------------------------------------------------SPY---------------------------
B4KVB2_DROMO/40-219--------------------------------------------------TPS---------------------------
Q17AR2_AEDAE/35-214--------------------------------------------------TPS---------------------------
Q6E5P4_TAKRU/18-198--------------------------------------------------LNE---------------------------
B7QNM3_IXOSC/25-197--------------------------------------------------SPY---------------------------

PF07062

O45670_CAEEL/8-219--------------------------------------------------SPA---------------------------
A8XPM2_CAEBR/9-213--------------------------------------------------TPA---------------------------
A8XPM1_CAEBR/5-202--------------------------------------------------TPS---------------------------
A8XPW0_CAEBR/10-221--------------------------------------------------TPS---------------------------
Q18135_CAEEL/11-221--------------------------------------------------SPS---------------------------

PF10242

Q7PMA1_ANOGA/11-202--------------------------------------------------LPK---------------------------
LHPL4_RAT/22-200--------------------------------------------------QPY---------------------------
TMHS_RAT/25-202--------------------------------------------------QPY---------------------------
TMHS_CHICK/25-202--------------------------------------------------QPY---------------------------
Q178A0_AEDAE/25-199--------------------------------------------------TPE---------------------------
Q2M056_DROPS/25-199--------------------------------------------------TPE---------------------------
Q9XVU1_CAEEL/19-183--------------------------------------------------HPT---------------------------
LHPL2_HUMAN/9-204--------------------------------------------------SAD---------------------------
Q4S279_TETNG/9-201--------------------------------------------------STD---------------------------
Q568B9_DANRE/9-197--------------------------------------------------SAE---------------------------
Q4RUW4_TETNG/9-195--------------------------------------------------SPD---------------------------
Q9W0X9_DROME/9-195--------------------------------------------------TPR---------------------------
Q292M2_DROPS/9-197--------------------------------------------------TPR---------------------------
LHFP_MOUSE/8-193--------------------------------------------------MPY---------------------------
LHPL1_RAT/8-192--------------------------------------------------LPY---------------------------
B1H157_XENTR/22-199--------------------------------------------------QPY---------------------------
H2SCC7_TAKRU/19-197--------------------------------------------------QPS---------------------------
H3CMV1_TETNG/22-199--------------------------------------------------QPY---------------------------

PF06653

Q8ITZ9_CAEEL/47-208--------------------------------------------------...---------------------------
Q9TZ35_CAEEL/1-155--------------------------------------------------TDS---------------------------
A8WY95_CAEBR/1-161--------------------------------------------------TPC---------------------------
A8XQE4_CAEBR/1-163--------------------------------------------------TPH---------------------------
A8WYV7_CAEBR/1-134--------------------------------------------------TKY---------------------------
A8WK96_CAEBR/1-140--------------------------------------------------TPG---------------------------
A8XRC8_CAEBR/1-182--------------------------------------------------TPG---------------------------
A8XQE5_CAEBR/1-150--------------------------------------------------TPG---------------------------
Q9XUZ7_CAEEL/1-168--------------------------------------------------SNA---------------------------
Q2WF57_CAEEL/1-166--------------------------------------------------TKL---------------------------
O45515_CAEEL/1-161--------------------------------------------------TPA---------------------------
A8XR11_CAEBR/1-188--------------------------------------------------TYG---------------------------
B6IEW4_CAEBR/1-156--------------------------------------------------TPN---------------------------
Q95YB5_CAEEL/1-123--------------------------------------------------...---------------------------
A8WK67_CAEBR/1-167--------------------------------------------------TKN---------------------------
Q95XC2_CAEEL/1-191--------------------------------------------------APC---------------------------
B6IFT2_CAEBR/1-179--------------------------------------------------LPD---------------------------
A8XQE6_CAEBR/1-167--------------------------------------------------TQA---------------------------
B6IEW3_CAEBR/1-114--------------------------------------------------...---------------------------
A8XWG5_CAEBR/1-169--------------------------------------------------LPY---------------------------
O45334_CAEEL/1-161--------------------------------------------------SQA---------------------------
A8WY98_CAEBR/1-166--------------------------------------------------TPA---------------------------
B6IKT5_CAEBR/1-215--------------------------------------------------SDC---------------------------
B6IKT4_CAEBR/1-120--------------------------------------------------...---------------------------

PF07344

A4I9X4_LEIIN/377-531-------------------------------------------------PSDM---------------------------
A4HBJ2_LEIBR/15-170-------------------------------------------------PLDM---------------------------
A4H6C8_LEIBR/15-170-------------------------------------------------PLDM---------------------------
Q4Q3F7_LEIMA/15-171-------------------------------------------------PLDM---------------------------
A4H5H1_LEIBR/15-170-------------------------------------------------PIDM---------------------------
A4HBJ0_LEIBR/15-171-------------------------------------------------PIDM---------------------------
A4HB47_LEIBR/18-199-------------------------------------------------PTGQ---------------------------
A4I9X2_LEIIN/15-169-------------------------------------------------PSDM---------------------------
Q4Q339_LEIMA/15-170-------------------------------------------------PLEI---------------------------
Q4E0S1_TRYCC/20-182-------------------------------------------------PTSQ---------------------------
Q4Q3A7_LEIMA/14-189-------------------------------------------------PLAM---------------------------
A4HAZ8_LEIBR/15-170-------------------------------------------------PIDM---------------------------
Q4QIA0_LEIMA/15-170-------------------------------------------------GVDM---------------------------
Q4Q8C7_LEIMA/145-338-------------------------------------------------ALSQ---------------------------
Q585K0_TRYB2/9-167-------------------------------------------------ALVF---------------------------
A4H5D1_LEIBR/15-173-------------------------------------------------PIDM---------------------------
A4HB02_LEIBR/15-170-------------------------------------------------PIDM---------------------------
A4H5G6_LEIBR/15-171-------------------------------------------------PIDM---------------------------
A4I9W9_LEIIN/15-171-------------------------------------------------PSDI---------------------------
A4HDL4_LEIBR/18-168-------------------------------------------------PISQ---------------------------
Q4QHJ3_LEIMA/241-414-------------------------------------------------GTAQ---------------------------
A4HAJ6_LEIBR/28-184-------------------------------------------------PIDM---------------------------
E9AG83_LEIIN/15-171-------------------------------------------------PIDM---------------------------
A4H7D7_LEIBR/15-172-------------------------------------------------PIDM---------------------------
A4I4J2_LEIIN/15-171-------------------------------------------------PFDM---------------------------
Q4QAK7_LEIMA/19-166-------------------------------------------------PTAQ---------------------------
Q4QI88_LEIMA/15-171-------------------------------------------------PIDM---------------------------
A4HBJ1_LEIBR/15-170-------------------------------------------------PLDV---------------------------
A4HGJ1_LEIBR/143-338-------------------------------------------------TLSQ---------------------------
Q4Q3A8_LEIMA/18-199-------------------------------------------------LIDQ---------------------------
A4HI41_LEIBR/20-195-------------------------------------------------PISQ---------------------------
A4HDI3_LEIBR/87-236-------------------------------------------------PISQ---------------------------
A4I4J3_LEIIN/81-236-------------------------------------------------PLDM---------------------------
E9AHT2_LEIIN/15-171-------------------------------------------------PLDV---------------------------
Q4Q327_LEIMA/15-169-------------------------------------------------PVDM---------------------------
A4HTM4_LEIIN/15-171-------------------------------------------------PIDM---------------------------
Q4Q8C6_LEIMA/374-525-------------------------------------------------PTSQ---------------------------
Q4Q397_LEIMA/79-235-------------------------------------------------PLDM---------------------------
A4IAL7_LEIIN/15-170-------------------------------------------------PLSM---------------------------
A4H5G0_LEIBR/15-170-------------------------------------------------PIDM---------------------------
Q4Q317_LEIMA/15-172-------------------------------------------------PLDI---------------------------
A4I0W5_LEIIN/18-168-------------------------------------------------PISQ---------------------------
A4I9W8_LEIIN/77-234-------------------------------------------------PIDM---------------------------
A4H5D2_LEIBR/15-171-------------------------------------------------LVDM---------------------------
A4H5G5_LEIBR/226-381-------------------------------------------------PLEM---------------------------
A4I9X1_LEIIN/15-170-------------------------------------------------PIDM---------------------------
Q384H4_TRYB2/118-295-------------------------------------------------SLSQ---------------------------
Q4CVL1_TRYCC/26-174-------------------------------------------------PIAM---------------------------
A4I5B9_LEIIN/26-190-------------------------------------------------PLGM---------------------------
A4I0W4_LEIIN/18-166-------------------------------------------------PISQ---------------------------
A4I9X0_LEIIN/31-188-------------------------------------------------PLDI---------------------------
A4IAM2_LEIIN/15-170-------------------------------------------------PLDM---------------------------
A4I9R7_LEIIN/15-171-------------------------------------------------PIDM---------------------------
A4HAL2_LEIBR/14-189-------------------------------------------------PLAM---------------------------
Q4DU87_TRYCC/14-171-------------------------------------------------PLDQ---------------------------
Q4Q309_LEIMA/15-169-------------------------------------------------PLDM---------------------------
A4H9E8_LEIBR/48-205-------------------------------------------------PIDM---------------------------
A4HI43_LEIBR/25-189-------------------------------------------------PLGM---------------------------
Q4Q6L8_LEIMA/15-171-------------------------------------------------GVDM---------------------------
A4HB00_LEIBR/15-170-------------------------------------------------PLDM---------------------------
A4I6E5_LEIIN/15-171-------------------------------------------------GVDM---------------------------
A4H605_LEIBR/152-298-------------------------------------------------PIPW---------------------------
A4H9E9_LEIBR/15-171-------------------------------------------------PLDV---------------------------
A4HAJ4_LEIBR/51-207-------------------------------------------------PIDM---------------------------
A4H5G7_LEIBR/15-171-------------------------------------------------PIDM---------------------------
Q4QHJ4_LEIMA/134-280-------------------------------------------------PIPW---------------------------
A4HGF8_LEIBR/158-312-------------------------------------------------PIPW---------------------------
Q4Q1U9_LEIMA/15-169-------------------------------------------------SADM---------------------------
A4IAM1_LEIIN/15-170-------------------------------------------------PLDM---------------------------
Q4QI87_LEIMA/15-171-------------------------------------------------PIDM---------------------------
Q384H3_TRYB2/301-450-------------------------------------------------PLSL---------------------------
A4I5B8_LEIIN/20-195-------------------------------------------------PISQ---------------------------
Q4DDC5_TRYCC/14-171-------------------------------------------------PIDQ---------------------------

PF07803

F1RBI8_DANRE/5-124--------------------------------------------------TSY---------------------------
H9GN86_ANOCA/23-152--------------------------------------------------TTH---------------------------
F1QA75_DANRE/4-115--------------------------------------------------SSY---------------------------
H3CZU3_TETNG/7-115--------------------------------------------------SSY---------------------------
GSG1L_XENTR/5-124--------------------------------------------------TSY---------------------------
G1RGF7_NOMLE/4-119--------------------------------------------------SSH---------------------------
H2SQP8_TAKRU/10-121--------------------------------------------------TSY---------------------------
GSG1_BOVIN/8-121--------------------------------------------------SNY---------------------------
I3KRK1_ORENI/5-112--------------------------------------------------TTY---------------------------
G1PJM9_MYOLU/8-122--------------------------------------------------SNS---------------------------
M4ANQ0_XIPMA/5-117--------------------------------------------------TSY---------------------------
E1BQK0_CHICK/10-122--------------------------------------------------SSY---------------------------
F6XCN0_XENTR/6-117--------------------------------------------------TTY---------------------------
H3A9A9_LATCH/14-126--------------------------------------------------STY---------------------------
X1WCY0_DANRE/5-116--------------------------------------------------TSY---------------------------
H2T2C4_TAKRU/9-124--------------------------------------------------TSY---------------------------
G1LVZ0_AILME/8-122--------------------------------------------------SSS---------------------------
W5N1L9_LEPOC/5-116--------------------------------------------------TSY---------------------------
F6QYE6_XENTR/5-114--------------------------------------------------SSY---------------------------
M0QWL6_MOUSE/5-119--------------------------------------------------SSH---------------------------
G5BYE9_HETGA/8-122--------------------------------------------------SSY---------------------------
H2ZT70_LATCH/6-119--------------------------------------------------TSY---------------------------
F5H0V9_HUMAN/24-137--------------------------------------------------SNY---------------------------
H3A6Q3_LATCH/5-111--------------------------------------------------TTY---------------------------
H3CN24_TETNG/5-116--------------------------------------------------TSY---------------------------
F6TBZ7_ORNAN/10-124--------------------------------------------------GSH---------------------------
W5MNB3_LEPOC/10-148--------------------------------------------------TSY---------------------------
I3JSS8_ORENI/21-128--------------------------------------------------TTY---------------------------
H9GMT0_ANOCA/6-119--------------------------------------------------TSY---------------------------
G3HB44_CRIGR/10-121--------------------------------------------------SSE---------------------------
W5NZF8_SHEEP/5-115--------------------------------------------------SSY---------------------------
W5L9X5_ASTMX/6-118--------------------------------------------------TSH---------------------------
G1M092_AILME/8-119--------------------------------------------------SSH---------------------------
V8PHH2_OPHHA/85-194--------------------------------------------------SSY---------------------------
H2NQH5_PONAB/15-140--------------------------------------------------TTH---------------------------
G1TTX9_RABIT/4-118--------------------------------------------------SSH---------------------------
H0XHA4_OTOGA/4-117--------------------------------------------------SSH---------------------------
F7BNL6_XENTR/10-120--------------------------------------------------SSY---------------------------
F1NVB9_CHICK/11-120--------------------------------------------------SNY---------------------------
F6WEP2_MONDO/5-117--------------------------------------------------TTH---------------------------
F7FP57_MONDO/12-123--------------------------------------------------GSY---------------------------

PF06687

Q7SFF9_NEUCR/5-294----------------------------.S-------------------KGFM---------------------------
MAC1_SCHPO/6-177----------------------------..-------------------SVPS---------------------------
Q5K881_CRYNJ/4-176----------------------------SI-------------------SPPA---------------------------
A0A0D1D1B0_USTMA/4-186----------------------------TI-------------------STPI---------------------------
Q5KGB3_CRYNJ/7-189----------------------------..-------------------TPLL---------------------------
A7A250_YEAS7/7-175----------------------------..-------------------TSPI---------------------------
Q6FSP2_CANGA/9-169----------------------------..-------------------TAPA---------------------------
A6ZNI8_YEAS7/5-176----------------------------..-------------------TAPI---------------------------
A7TT16_VANPO/7-179----------------------------..-------------------TAPV---------------------------
Q6CX71_KLULA/9-171----------------------------..-------------------SAPV---------------------------
Q757N9_ASHGO/7-167----------------------------..-------------------TAPV---------------------------
Q5ALR6_CANAL/7-166----------------------------..-------------------SYPV---------------------------
A3LTF9_PICST/7-165----------------------------..-------------------SPPV---------------------------
A5DUT6_LODEL/7-165----------------------------..-------------------SSPV---------------------------
Q6BIN6_DEBHA/7-162----------------------------..-------------------TSPV---------------------------
A5DHH0_PICGU/5-162----------------------------..-------------------SAPV---------------------------
A0A0D1DVQ9_USTMA/5-204----------------------------SD-------------------STPF---------------------------
MUG33_SCHPO/5-166----------------------------..-------------------TPPL---------------------------
PALI_ASHGO/5-170----------------------------..-------------------SVPL---------------------------
PALI2_KLULA/3-167----------------------------..-------------------SVPI---------------------------
PALI1_KLULA/4-168----------------------------..-------------------SVPI---------------------------
A7TPS6_VANPO/6-170----------------------------..-------------------TTPV---------------------------
PALI_CANGA/6-170----------------------------..-------------------TVPL---------------------------
A3LUV8_PICST/4-233----------------------------..-------------------SVPI---------------------------
PALI_CANAL/4-232----------------------------.F-------------------TTPD---------------------------
A5E4Z6_LODEL/4-205----------------------------..-------------------LTPL---------------------------
A5DJU1_PICGU/4-217----------------------------..-------------------SVPL---------------------------
PALI_DEBHA/4-238----------------------------..-------------------SVPI---------------------------
A6ZMC2_YEAS7/5-169----------------------------..-------------------TVPV---------------------------
Q2H463_CHAGB/5-183----------------------------IS-------------------AIPL---------------------------
PALI_NEUCR/5-170----------------------------IK-------------------QIPL---------------------------
PALI_MAGO7/5-169----------------------------..-------------------STPI---------------------------
PALI_YARLI/7-167----------------------------..-------------------SVPV---------------------------
Q0V6X2_PHANO/5-166----------------------------..-------------------STPV---------------------------
A6R830_AJECN/6-168----------------------------..-------------------STPV---------------------------
A2QF35_ASPNC/6-165----------------------------..-------------------STPI---------------------------
Q0CX64_ASPTN/6-167----------------------------..-------------------STPI---------------------------
Q4WWY3_ASPFU/6-166----------------------------..-------------------STPI---------------------------
Q55HH6_CRYNB/6-242----------------------------SS-------------------GALV---------------------------
Q6BME8_DEBHA/24-312----------------------------NR-------------------NIYI---------------------------
Q59US7_CANAL/25-311----------------------------TN-------------------TTYA---------------------------
Q7SG51_NEUCR/8-271----------------------------DK-------------------SMYM---------------------------
Q2HFG4_CHAGB/9-276----------------------------AD-------------------KSLY---------------------------
Q0TZ73_PHANO/4-276----------------------------.K-------------------QSFM---------------------------
Q6C1Y6_YARLI/7-199----------------------------RD-------------------SAPL---------------------------
A6R6X6_AJECN/8-204----------------------------RN-------------------TNPL---------------------------
A1CFA3_ASPCL/8-205----------------------------RN-------------------SNPL---------------------------
A2QNP6_ASPNC/8-205----------------------------RN-------------------SRPL---------------------------
Q0V6H1_PHANO/8-203----------------------------VN-------------------SAPL---------------------------
A7EBS7_SCLS1/8-206----------------------------TQ-------------------TTPL---------------------------
Q2H574_CHAGB/3-201----------------------------TH-------------------TSPL---------------------------
V5IRF3_NEUCR/8-206----------------------------TR-------------------TSPL---------------------------
A7TTI2_VANPO/7-207----------------------------TT-------------------SGTL---------------------------
SUR7_YEAST/9-206----------------------------TD-------------------HYPV---------------------------
A7TH74_VANPO/9-205----------------------------TN-------------------SFPI---------------------------
Q753Q0_ASHGO/8-202----------------------------IE-------------------SSPI---------------------------
Q6CXH5_KLULA/9-205----------------------------IE-------------------HSPV---------------------------
A5DC91_PICGU/5-198----------------------------TN-------------------HFPF---------------------------
Q6BLL9_DEBHA/5-198----------------------------SD-------------------NFPL---------------------------
SUR7_CANAL/5-199----------------------------SK-------------------HFPL---------------------------
A3LV33_PICST/5-198----------------------------SD-------------------HFPL---------------------------
Q75E26_ASHGO/7-202----------------------------KH-------------------TGVL---------------------------
A7TIB3_VANPO/11-209----------------------------RS-------------------TGTL---------------------------
Q6FT41_CANGA/7-205----------------------------RD-------------------SGTL---------------------------
Q6CJ71_KLULA/7-204----------------------------RT-------------------TGVL---------------------------
E7KHH6_YEASA/7-206----------------------------RT-------------------TGVL---------------------------
FMP45_YEAST/7-205----------------------------RE-------------------SGTL---------------------------
A5DAF8_PICGU/6-205----------------------------NN-------------------SSIL---------------------------
Q5AH49_CANAL/4-201----------------------------GT-------------------SSVL---------------------------
A5E7B2_LODEL/4-201----------------------------GT-------------------SSVL---------------------------
A7TGC8_VANPO/6-240----------------------------SN-------------------YNPI---------------------------
Q6CWP2_KLULA/5-243----------------------------QN-------------------STPL---------------------------
E7Q7C4_YEASB/6-240----------------------------KN-------------------YSPI---------------------------
Q6FPE4_CANGA/6-240----------------------------KN-------------------YYPI---------------------------
A3LZK7_PICST/5-323----------------------------KN-------------------ERFL---------------------------
Q5ADV0_CANAL/6-394----------------------------DN-------------------KKYL---------------------------
Q6BMS1_DEBHA/5-319----------------------------KN-------------------EAYL---------------------------
A5DG26_PICGU/5-318----------------------------KN-------------------ESYL---------------------------
A5E006_LODEL/6-375----------------------------KN-------------------ANYL---------------------------
A5E421_LODEL/6-397----------------------------KN-------------------ENYL---------------------------
PUN1_SCHPO/12-275----------------------------QH-------------------NIAF---------------------------
Q2TX92_ASPOR/9-279----------------------------KL-------------------TGLI---------------------------
Q5BDP9_EMENI/26-276----------------------------SD-------------------KPVL---------------------------
A2QQ39_ASPNC/26-275----------------------------AD-------------------KPVL---------------------------
Q2UBQ3_ASPOR/26-275----------------------------SN-------------------KPVL---------------------------
Q0CQ07_ASPTN/27-276----------------------------SN-------------------KPVL---------------------------
A2R5N4_ASPNC/9-229----------------------------MG-------------------SHEL---------------------------
Q2UF28_ASPOR/9-224----------------------------.R-------------------AHKA---------------------------
Q5B2L7_EMENI/9-256----------------------------NG-------------------TDSL---------------------------
A1DME7_NEOFI/9-255----------------------------SS-------------------SSTL---------------------------
A2QPC4_ASPNC/9-256----------------------------SS-------------------SSTL---------------------------
B8MW98_ASPFN/9-255----------------------------SG-------------------SSTL---------------------------
Q0CRK6_ASPTN/9-256----------------------------AN-------------------SGTL---------------------------
A6RDR9_AJECN/9-246----------------------------SP-------------------NAPL---------------------------
Q0V4X3_PHANO/9-258----------------------------SN-------------------KAPA---------------------------

PF12351

C1G9K9_PARBD/59-248-------------------------------------------------MKQN---------------------------
Q75CU4_ASHGO/65-257-------------------------------------------------LSNL---------------------------
A3LV03_PICST/62-245-------------------------------------------------VNIQ---------------------------
A7EL23_SCLS1/52-241-------------------------------------------------AYVG---------------------------
A7TJZ8_VANPO/66-260-------------------------------------------------IDKI---------------------------
B6HGM8_PENCW/52-252-------------------------------------------------VTQR---------------------------
B8MZW1_ASPFN/73-257-------------------------------------------------VSPS---------------------------
B8NY21_ASPFN/72-267-------------------------------------------------LTRS---------------------------
C0NA65_AJECG/81-270-------------------------------------------------LKQA---------------------------
C1GWT8_PARBA/74-258-------------------------------------------------IQPT---------------------------
C4JX23_UNCRE/51-235-------------------------------------------------IQKD---------------------------
C4QXD3_PICPG/65-260-------------------------------------------------VDTP---------------------------
C4YC02_CLAL4/51-224-------------------------------------------------VSAD---------------------------
C5DEC8_LACTC/64-258-------------------------------------------------VTGI---------------------------
C5DPI4_ZYGRC/66-266-------------------------------------------------ITNI---------------------------
C5G079_ARTOC/74-258-------------------------------------------------IQRN---------------------------
C5M8V3_CANTT/127-303-------------------------------------------------LSQD---------------------------
DNI1_SCHPO/33-201-------------------------------------------------VLSA---------------------------
Q0CSC3_ASPTN/220-409-------------------------------------------------MATN---------------------------
Q0U808_PHANO/74-259-------------------------------------------------INRD---------------------------
Q59WR6_CANAL/68-244-------------------------------------------------LSSS---------------------------
Q6BL79_DEBHA/62-241-------------------------------------------------VDI.---------------------------
Q6CH13_YARLI/62-243-------------------------------------------------ATVS---------------------------
Q6CW51_KLULA/66-265-------------------------------------------------INNI---------------------------
Q6FQP2_CANGA/65-266-------------------------------------------------IDKV---------------------------
A7UX97_NEUCR/65-265-------------------------------------------------GDDG---------------------------
FIG1_YEAST/66-265-------------------------------------------------IDNI---------------------------

PF12534

V8P1J9_OPHHA/785-1120............................MQ-------------------DKII.CLPK......................
M3ZMK4_XIPMA/1-325............................TQ-------------------DKMI.CLPC......................
H2LAB2_ORYLA/1-327............................MQ-------------------DKII.CLPQ......................
F7HZE8_CALJA/1-331............................TQ-------------------DKII.CLPN......................
I3KSZ5_ORENI/1-328............................MH-------------------DKII.CLPQ......................
W5KVQ3_ASTMX/1-344............................TQ-------------------EKIA.CLPD......................
H3AVZ2_LATCH/1-372............................TK-------------------DQVA.CLPFLDPENLHSASPAES........
B1H2G3_XENTR/1-381............................TK-------------------DQVV.CLPVLESAVNSRNAHLLSSENSPQVS
E7FB32_DANRE/1-334............................TQ-------------------DKIS.CLPN......................
G3NS96_GASAC/1-347............................SR-------------------DRVV.CIPM......................
G3TTR1_LOXAF/1-384............................TK-------------------DQVV.CLPVLPSPVNSKAH..TSPGNADVTT
W5L768_ASTMX/1-377............................SR-------------------DGVV.CVPV......................
W5LUY8_ASTMX/1-363............................TK-------------------DQVV.CLPVLDSWQDS.............VT
H3AKF0_LATCH/1-388PLCSSQLSQAESTFFKLRNLQSPSHLTVSH-------------------EKTI.CIPV......................
H3AX97_LATCH/1-334............................FP-------------------NVVL.CLPM......................
I3JWS5_ORENI/1-362............................TK-------------------DQVA.CLPYIDDAEEASGTSSLP........
H3AY71_LATCH/1-328............................TQ-------------------DKII.CLPN......................
V8PI59_OPHHA/1-329............................IH-------------------DKII.CLPN......................
A2BIH6_DANRE/1-360............................SK-------------------DQVA.CLPILEKNINLEGA............
G3Q7A0_GASAC/1-345............................TQ-------------------DKIS.CLPS......................
H3ARV9_LATCH/48-378............................SQ-------------------SKLL.CLPC......................
H2MNR6_ORYLA/1-346............................SR-------------------DRIV.CIPV......................
D4A758_RAT/1-334............................TQ-------------------SRVLCCLPC......................
M4B034_XIPMA/1-370............................TK-------------------DQVV.CLPILEQAQDGSGGFLETH.......
H2S8U7_TAKRU/1-339............................TQ-------------------DKIA.CLPS......................
R0K7Z6_ANAPL/1-340............................TQ-------------------DKMI.CLPC......................
H0Z736_TAEGU/1-380............................TK-------------------DQVV.CLPVLQSTVNSKAQP.DTAGKADFTT
H2S199_TAKRU/1-376............................TK-------------------DHMA.CLPCLENPQEESGAGHNSF.......
G3PSX6_GASAC/1-374............................TK-------------------DQVA.CLPCLEDQEDPSGAKPDSF.......
LRC8E_XENTR/1-341............................TQ-------------------DKII.CLPN......................
I3KNR5_ORENI/1-344............................TQ-------------------DKIA.CLPS......................
F6SMM9_XENTR/1-324............................MQ-------------------IKIV.CLPK......................
H0Z746_TAEGU/1-332............................TQ-------------------TRVLCCLPC......................
F7CMN6_XENTR/1-328............................TQ-------------------SRML.CLPC......................
M4A3B2_XIPMA/1-344............................SR-------------------DRVV.CIPS......................
G3X2F3_SARHA/1-331............................AD-------------------TKILCCLPC......................
W5KZ87_ASTMX/1-332............................MQ-------------------DKII.CLPL......................
E7FFH7_DANRE/1-330............................SR-------------------DGVV.CVPV......................
M4AYR0_XIPMA/1-374............................TK-------------------DQVA.CLPCPEETGGVSETEANLY.......
M3ZY99_XIPMA/1-333............................TQ-------------------DKIA.CLPS......................
H3AZN8_LATCH/1-348............................LK-------------------DAVA.CVPM......................
I3JMY0_ORENI/1-352............................SR-------------------DRVV.CIPL......................
B3DLX1_XENTR/1-330............................MP-------------------VKIL.CLPE......................
A7SYJ2_NEMVE/1-332............................SN-------------------GNLV.CLPA......................
E7F333_DANRE/1-326............................MQ-------------------DKII.CLPQ......................
W5LU14_ASTMX/1-373............................TK-------------------DQVA.CLPFLEERSKIESTTPYTT.......
W5MLZ0_LEPOC/1-351............................TQ-------------------DKIA.CLPT......................
V8P1J9_OPHHA/1-333............................TQ-------------------TRLLCCLPC......................

PF00876

D6WYF3_TRICA/20-351----------------------------SK..............QYF..GDPI---------------------------
B4M9Z6_DROVI/21-389----------------------------AK..............QYF..GEPI---------------------------
B7PM37_IXOSC/22-351----------------------------AK..............EYV..GSPI---------------------------
H2W3J0_CAEJA/23-398----------------------------AK..............QHF..GNPI---------------------------
G4VIL2_SCHMA/22-395----------------------------LK..............SYV..FEPL---------------------------
K1PTR0_CRAGI/36-398----------------------------GG..............QYV..GNPI---------------------------
T1J195_STRMM/20-353----------------------------SR..............QYI..GEPI---------------------------
T1FN93_HELRO/20-384----------------------------MG..............QYV..RNPI---------------------------
A0A068XA01_HYMMI/23-373----------------------------VR..............QYV..GKPI---------------------------
B4JXM9_DROGR/128-462----------------------------TR..............QYV..GNPI---------------------------
Q16YE3_AEDAE/22-378----------------------------SR..............QYI..GEHI---------------------------
J9EMK4_WUCBA/21-384----------------------------FK..............QFG..GRPM---------------------------
Q8JV09_CSIVT/20-354----------------------------SV..............QFF..RDPM---------------------------
A8XEP7_CAEBR/22-362----------------------------SK..............PLF..GTPI---------------------------
H2VGJ4_CAEJA/19-337----------------------------AK..............QYV..GESV---------------------------
K1RGD8_CRAGI/8-352----------------------------IG..............QLY..VGPV---------------------------
T1J195_STRMM/1266-1599----------------------------TK..............QYV..GNPI---------------------------
B7P7W9_IXOSC/20-348----------------------------GK..............QYV..GDPI---------------------------
A0A068XZR8_ECHMU/21-417----------------------------TN..............VYF..LPQI---------------------------
G0P5C9_CAEBE/23-398----------------------------AK..............QHF..GNPI---------------------------
G7YGP3_CLOSI/23-373----------------------------FR..............QYV..GKPL---------------------------
Q16QK9_AEDAE/26-359----------------------------AN..............NLI..GDPI---------------------------
F1L798_ASCSU/18-385----------------------------YQ..............SFF..GKAL---------------------------
T1KCG9_TETUR/13-350----------------------------MK..............QYF..GDPI---------------------------
A0A068XBQ8_HYMMI/22-391----------------------------VK..............QYI..LKPI---------------------------
E9HBX3_DAPPU/3-382----------------------------TK..............QFA..GEPI---------------------------
T1ELD9_HELRO/20-382----------------------------TK..............QFV..GDPI---------------------------
B4NCN0_DROWI/21-406----------------------------AK..............QYF..GEPI---------------------------
A0A087W1T2_ECHMU/23-384----------------------------TK..............QYL..FNPI---------------------------
B4R5W3_DROSI/22-374----------------------------SR..............QYI..GEHI---------------------------
H3DSX6_PRIPA/33-350----------------------------SA..............HVW..GQPI---------------------------
J9K934_ACYPI/20-353----------------------------SR..............QYI..GDPI---------------------------
A0A068XY87_ECHMU/25-463----------------------------SR..............QLV..GKPI---------------------------
G6CUL7_DANPL/23-376----------------------------SR..............EYF..GDHI---------------------------
B7PZQ6_IXOSC/22-356----------------------------AR..............QYV..GDPI---------------------------
J9K6I2_ACYPI/23-369----------------------------SR..............QYI..GEHI---------------------------
E3MG81_CAERE/18-377----------------------------GW..............SFV..GSPI---------------------------
B7QK18_IXOSC/21-355----------------------------SA..............QYF..GDPI---------------------------
F1L5G5_ASCSU/25-358----------------------------ST..............HIW..GEPI---------------------------
T1KCG2_TETUR/41-381----------------------------MK..............QYF..GDPI---------------------------
J9JUV0_ACYPI/22-352----------------------------AT..............QYV..GNPI---------------------------
G0P1Q9_CAEBE/46-404----------------------------LK..............MFG..GRPI---------------------------
T1KEY2_TETUR/40-390----------------------------YK..............EYF..GEEI---------------------------
T1ED09_HELRO/21-401----------------------------TK..............TFV..GDPI---------------------------
O61786_CAEEL/18-377----------------------------YH..............TYF..GRAI---------------------------
K1PIY5_CRAGI/20-383----------------------------AR..............QYV..GDPI---------------------------
T1FHL5_HELRO/20-384----------------------------TK..............QFV..GTPI---------------------------
T1JJS6_STRMM/20-348----------------------------AR..............QYV..GQPI---------------------------
A8XEP6_CAEBR/20-382----------------------------SN..............MMF..GQPI---------------------------
E1FZD3_LOALO/21-449----------------------------TK..............QHF..GSPI---------------------------
G7YU10_CLOSI/46-435----------------------------AN..............VYF..LRPI---------------------------
E3MU80_CAERE/20-379----------------------------AS..............QYV..GRPI---------------------------
A8XER5_CAEBR/20-386----------------------------AR..............QYV..GSPL---------------------------
Q6SA04_BOMMO/20-353----------------------------SR..............QYI..GDPI---------------------------
Q7Q5R9_ANOGA/21-353----------------------------AR..............QYF..GNPI---------------------------
E1FJE3_LOALO/20-378----------------------------FK..............QFS..GKPV---------------------------
E3M7W5_CAERE/20-359----------------------------AK..............TYV..GSAM---------------------------
G4V7R0_SCHMA/22-401----------------------------TK..............QYL..LNSI---------------------------
E9HSG3_DAPPU/20-354----------------------------AT..............QYV..GNPI---------------------------
W5J902_ANODA/22-378----------------------------SR..............QYI..GEHI---------------------------
E0VDS2_PEDHC/20-352----------------------------AN..............QFV..GNPI---------------------------
E2AUZ7_CAMFO/26-358----------------------------AN..............NLI..GDPI---------------------------
J9K6R4_ACYPI/20-351----------------------------CR..............QYL..GNPI---------------------------
J0XFG5_LOALO/19-380----------------------------FK..............QFG..GRPL---------------------------
Q8MXG8_CAEEL/25-374----------------------------AK..............QYV..GHPI---------------------------
E3LDS0_CAERE/21-371----------------------------CK..............QYV..GSAI---------------------------
INX8_CAEEL/20-359----------------------------AK..............TYV..GSAM---------------------------
G0M6M8_CAEBE/25-358----------------------------CK..............QYF..GQPI---------------------------
G7YTE6_CLOSI/24-379----------------------------IR..............QYV..GKPI---------------------------
A8Y214_CAEBR/25-362----------------------------SS..............HFI..GDPI---------------------------
A8XEF9_CAEBR/18-379----------------------------YN..............TYF..GTAI---------------------------
A0A068Y5E6_ECHMU/23-391----------------------------LK..............SYV..FEPF---------------------------
T1IXN4_STRMM/24-349----------------------------ST..............QHF..GKAI---------------------------
E1JJF3_DROME/20-353----------------------------SR..............QYI..GDPI---------------------------
K1QY06_CRAGI/32-418----------------------------SE..............EWF..EFPV---------------------------
A0A088AID2_APIME/26-358----------------------------AN..............NLI..GDPI---------------------------
J9JSD1_ACYPI/20-354----------------------------TR..............QYV..GNPI---------------------------
Q16FA3_AEDAE/20-353----------------------------AT..............QYV..GQPI---------------------------
T1G942_HELRO/20-384----------------------------TT..............QYV..GTPI---------------------------
A0A068X0D8_HYMMI/25-462----------------------------SR..............QLV..GKPI---------------------------
Q7PXM2_ANOGA/20-353----------------------------AT..............QYV..GNPI---------------------------
A8QBS0_BRUMA/4-385----------------------------AK..............QYV..GEPL---------------------------
G7YNX9_CLOSI/22-427----------------------------AK..............QYF..LNSI---------------------------
G4V9H2_SCHMA/22-390----------------------------VK..............QYM..MKPI---------------------------
D6X4I9_TRICA/22-374----------------------------SR..............QYI..GEHI---------------------------
E0VDS1_PEDHC/24-362----------------------------SQ..............EYI..GEHI---------------------------
G0MH94_CAEBE/20-359----------------------------AK..............SYV..GSPM---------------------------
D6X4I8_TRICA/22-359----------------------------FR..............EYI..GEHI---------------------------
T1ICS8_RHOPR/21-357----------------------------SR..............EFI..REHI---------------------------
E2BMI3_HARSA/21-353----------------------------AT..............QYV..GSPI---------------------------
E1ZXE9_CAMFO/20-352----------------------------SR..............QYI..GDPI---------------------------
T1HVH6_RHOPR/40-373----------------------------TR..............QYV..GNPI---------------------------
T1JXB6_TETUR/29-420----------------------------TK..............QYI..GDPI---------------------------
D6X4J0_TRICA/20-353----------------------------SR..............QYI..GDPI---------------------------
U1NYM9_ASCSU/445-793----------------------------AK..............QYV..GQPI---------------------------
U1M0X1_ASCSU/20-367----------------------------FK..............QFG..GKPV---------------------------
F4W7D6_ACREC/26-357----------------------------AN..............NLI..GDPI---------------------------
T1G4P9_HELRO/16-378----------------------------TS..............QYV..GEPI---------------------------
T1J6W8_STRMM/21-346----------------------------SS..............EHF..GRPI---------------------------
C9IY29_CAEEL/84-449----------------------------FK..............QFG..GRPI---------------------------
K1PRS3_CRAGI/35-396----------------------------TK..............QYV..GEPI---------------------------
K7J6Q9_NASVI/27-365----------------------------SR..............QFI..GEHI---------------------------
G7YWN9_CLOSI/22-427----------------------------LK..............QYV..FNPL---------------------------
E9HJ63_DAPPU/20-357----------------------------LK..............QYV..GDPI---------------------------
E9HSG1_DAPPU/20-353----------------------------SR..............QYI..GDPI---------------------------
A0A087W211_ECHMU/22-417----------------------------AK..............SYL..LKPI---------------------------
U1M8T6_ASCSU/413-766----------------------------AK..............QYV..GEPL---------------------------
A0A068XT33_HYMMI/22-423----------------------------MK..............QYI..FNSI---------------------------
E5SKQ0_TRISP/420-774----------------------------AK..............QYV..GQPI---------------------------
A0A068X0V5_HYMMI/31-381----------------------------LR..............QYV..GKPI---------------------------
E1GFD2_LOALO/19-366----------------------------AK..............QYV..GYPI---------------------------
U1NSW4_ASCSU/21-445----------------------------SK..............QMF..GEPI---------------------------
T1FAN8_HELRO/34-392----------------------------SK..............QFV..GNPI---------------------------
E9G961_DAPPU/20-354----------------------------TR..............QYV..GNPI---------------------------
A0NH37_ANOGA/20-352----------------------------SR..............QYI..GDPI---------------------------
E5SB89_TRISP/314-669----------------------------TR..............QWI..GQPI---------------------------
E2BKJ4_HARSA/20-355----------------------------AK..............QYI..GEPI---------------------------
Q6AHN7_CAEEL/20-380----------------------------FK..............QFG..GKPV---------------------------
INX19_CAEBR/21-398----------------------------AK..............QYG..GTPI---------------------------
B4M9W3_DROVI/22-375----------------------------SR..............QYI..GEHI---------------------------
A8XEL3_CAEBR/23-389----------------------------AK..............QHF..GNPI---------------------------
U1NL47_ASCSU/159-526----------------------------GM..............LYA..KHPV---------------------------
A0A068X9B8_HYMMI/21-407----------------------------VN..............IYF..VRPI---------------------------
J9K206_ACYPI/24-352----------------------------SI..............NLI..GNPI---------------------------
U1NF34_ASCSU/22-362----------------------------TK..............QYF..GAPI---------------------------
J9EPQ3_WUCBA/20-374----------------------------AT..............QYV..GKPI---------------------------
J0M383_LOALO/18-371----------------------------AK..............EYG..GDPI---------------------------
E5SKQ0_TRISP/18-378----------------------------GW..............SFV..GTPI---------------------------
K1QFN4_CRAGI/25-386----------------------------TG..............QFV..GEPI---------------------------
A0A068XF99_HYMMI/23-391----------------------------LK..............SYV..FEPL---------------------------
T1KQD2_TETUR/20-352----------------------------AR..............QYF..GDPI---------------------------
G6D2Y2_DANPL/26-354----------------------------AN..............NLI..GDPI---------------------------
H2WEX7_CAEJA/18-379----------------------------YN..............TYF..GSAI---------------------------
K1Q160_CRAGI/48-414----------------------------FL..............QFIIHKSPI---------------------------
G0NI48_CAEBE/22-370----------------------------SN...................ESRF---------------------------
Q174Z8_AEDAE/21-354----------------------------AR..............SYF..GEPI---------------------------
D6X4I6_TRICA/22-372----------------------------SR..............EYI..GEHI---------------------------
T1ITF1_STRMM/2-331----------------------------SR..............EHI..GEPI---------------------------
T1HXJ9_RHOPR/21-354----------------------------AR..............QYF..GDPI---------------------------
K7J6Q8_NASVI/20-354----------------------------AT..............QFV..GNPI---------------------------
K1PJW3_CRAGI/57-423----------------------------TN..............QYV..GDPI---------------------------
B7QN22_IXOSC/20-353----------------------------SR..............QYI..GDPI---------------------------
T1L390_TETUR/20-355----------------------------AR..............QYI..GDPI---------------------------
F1L4F5_ASCSU/21-387----------------------------AK..............QHF..GQPI---------------------------
T1J195_STRMM/918-1253----------------------------AR..............QYV..GQPI---------------------------
J9FAW5_WUCBA/102-549----------------------------TK..............QHF..GAPI---------------------------
D6X0D3_TRICA/26-358----------------------------AN..............NLI..GYPI---------------------------
U1MHH5_ASCSU/93-454----------------------------FK..............QFG..GHPL---------------------------
A0A068X744_HYMMI/28-419----------------------------TN..............VYF..LKAI---------------------------
H2W7D4_CAEJA/20-363----------------------------AK..............ANV..GSTI---------------------------
T1I6M9_RHOPR/26-360----------------------------AN..............NLI..GDPI---------------------------
H2KP32_CLOSI/22-393----------------------------LR..............QYF..MTPL---------------------------
B7PZQ9_IXOSC/20-357----------------------------TK..............QFV..GDPI---------------------------
A8PUQ6_BRUMA/208-570----------------------------AK..............QYV..GFPI---------------------------
Q29DR1_DROPS/20-356----------------------------SK..............QYF..GDPI---------------------------
T1EHZ6_HELRO/2-360----------------------------AR..............QCL..GEAI---------------------------
H2KV18_CLOSI/22-415----------------------------SK..............TYL..FSPI---------------------------
J9B6M7_WUCBA/21-372----------------------------AK..............QYV..GSPI---------------------------
T1KKV8_TETUR/27-356----------------------------CT..............QFF..GDPI---------------------------
T1KKV7_TETUR/27-357----------------------------SY..............QFF..GTPI---------------------------
B4R7B1_DROSI/20-385----------------------------AR..............QYF..GDPI---------------------------
W5JJF8_ANODA/21-353----------------------------AR..............QYF..GNPI---------------------------
T1KDH8_TETUR/79-412----------------------------TK..............QYV..GDPI---------------------------
E0V9G4_PEDHC/20-367----------------------------SK..............QYI..GDPI---------------------------
T1G9C5_HELRO/20-382----------------------------TK..............QFV..GVPM---------------------------
A0A088A2D0_APIME/27-384----------------------------AR..............QFI..GEHI---------------------------
T1JY39_TETUR/20-359----------------------------GR..............QYV..GEPI---------------------------
T1K2R1_TETUR/42-415----------------------------MK..............QYF..GEPI---------------------------
H3FJV0_PRIPA/15-362----------------------------AE..............QYF..GSPV---------------------------
E1ZXF1_CAMFO/20-353----------------------------AT..............QYV..GNPI---------------------------
G0NJM8_CAEBE/20-352----------------------------AK..............NYV..GEPM---------------------------
Q9N3R4_CAEEL/22-389----------------------------SK..............PMF..GSPI---------------------------
G4V7R4_SCHMA/123-528----------------------------AK..............QYF..LNSI---------------------------
D6X4I5_TRICA/20-353----------------------------AS..............QYV..GNPI---------------------------
A0A087W248_ECHMU/22-392----------------------------VK..............QYI..LKPI---------------------------
Q29GY9_DROPS/22-375----------------------------SR..............QYI..GEHI---------------------------
K1Q539_CRAGI/458-821----------------------------AK..............QFV..GEPI---------------------------
E5S9V0_TRISP/19-379----------------------------AK..............QYV..GYPI---------------------------
O44887_CAEEL/17-366----------------------------AK..............QYV..GQPI---------------------------
Q7PKP9_ANOGA/22-378----------------------------SR..............QYI..GEHI---------------------------
B7PLS3_IXOSC/49-405----------------------------TR..............QYI..GDPI---------------------------
U1LVB7_ASCSU/48-414----------------------------AKISGLLKTFHLLETSEYG..GKPI---------------------------
F1L3K8_ASCSU/22-368----------------------------AK..............QYF..GSPI---------------------------
Q9N3R5_CAEEL/20-377----------------------------SN..............MMF..GQPI---------------------------
E1ZXF0_CAMFO/28-380----------------------------SR..............QFI..GEHI---------------------------
F5HMP1_ANOGA/8-343----------------------------TR..............QYV..GNPI---------------------------
INX17_CAEEL/19-357----------------------------AK..............QYV..GQSI---------------------------
E0VDS4_PEDHC/20-354----------------------------TR..............QYV..GNPI---------------------------
E5SC05_TRISP/19-373----------------------------AK..............QYV..GSPI---------------------------
A8PTF8_BRUMA/22-367----------------------------AK..............QYF..GSPI---------------------------
J9JWH0_ACYPI/26-360----------------------------AN..............NLI..GDPI---------------------------
A0A068YJC6_ECHMU/46-414----------------------------VR..............QYF..MAPL---------------------------
T1FMB3_HELRO/20-382----------------------------TK..............QYV..GDPI---------------------------
F1KWR8_ASCSU/21-373----------------------------AK..............QYV..GSPI---------------------------
E5SJ06_TRISP/21-380----------------------------FK..............QFG..GRPI---------------------------
E9H086_DAPPU/26-366----------------------------AF..............DLI..GSPI---------------------------
H3EMZ6_PRIPA/18-385----------------------------GK..............QFM..GAPL---------------------------
H2KV19_CLOSI/22-392----------------------------VK..............QYL..MSAI---------------------------
T1EFQ7_HELRO/20-385----------------------------MN..............QYV..RNPI---------------------------
T1HJJ5_RHOPR/20-353----------------------------AT..............QYV..GNPI---------------------------
T1G065_HELRO/20-402----------------------------TK..............QFV..GRPI---------------------------
E3LLZ0_CAERE/22-389----------------------------SK..............PLF..GSPI---------------------------
A0A068YEL0_ECHMU/22-423----------------------------MK..............QYV..FNSI---------------------------
A0A068X4X8_HYMMI/22-417----------------------------AK..............SYL..LKPI---------------------------
U1M8T6_ASCSU/18-361----------------------------GK..............HYI..GKPL---------------------------
K7J6Q6_NASVI/20-355----------------------------TR..............QYV..GNPI---------------------------
B7PF54_IXOSC/22-357----------------------------TK..............QYV..GDPI---------------------------
E9HJ62_DAPPU/20-357----------------------------LN..............QYV..GDPI---------------------------
A0A068Y4Z1_ECHMU/24-412----------------------------AK..............TYI..LQPL---------------------------
B4I656_DROSE/21-389----------------------------AK..............QYF..GEPI---------------------------
J9EZB8_WUCBA/21-364----------------------------AK..............QHF..GTAI---------------------------
E9H085_DAPPU/26-359----------------------------AF..............AFF..GKPI---------------------------
E0VNL8_PEDHC/26-361----------------------------AN..............NLI..GDPI---------------------------
M9PGW0_DROME/20-353----------------------------AT..............QYV..GQPI---------------------------
H2KP29_CLOSI/22-395----------------------------LK..............SYV..FEPL---------------------------
G4LX80_SCHMA/26-424----------------------------GR..............QFI..GKPI---------------------------
E1FV40_LOALO/19-382----------------------------FK..............QFG..GRPL---------------------------
T1EHZ5_HELRO/4-356----------------------------LK..............QYA..GSPI---------------------------
A8X0X1_CAEBR/20-359----------------------------AK..............TYV..GSAM---------------------------
H3FKT7_PRIPA/38-405----------------------------AK..............QYG..GTPI---------------------------
A0A068Y3L2_ECHMU/21-416----------------------------TN..............VYF..LRPI---------------------------
E9HSG2_DAPPU/24-357----------------------------SR..............QYI..GEHI---------------------------
K1PRW3_CRAGI/26-393----------------------------TN..............EYV..GDPI---------------------------
A0A068YAQ8_ECHMU/95-570----------------------------IR..............QYV..GKPI---------------------------
K1P371_CRAGI/31-392----------------------------SG..............QYA..GNPI---------------------------
G4VSX3_SCHMA/25-419----------------------------AN..............VYF..LRPI---------------------------
T1G1G0_HELRO/20-382----------------------------TK..............QYV..GDPI---------------------------
T1F3K5_HELRO/20-382----------------------------TK..............QFV..GKPI---------------------------
A0A068Y4N3_ECHMU/22-392----------------------------VK..............QYL..LASI---------------------------
T1EE00_HELRO/20-448----------------------------MN..............QYV..RNPI---------------------------
T1G9L4_HELRO/20-374----------------------------TR..............QYV..SEPI---------------------------
K1Q8H1_CRAGI/20-381----------------------------SG..............QFF..KDPI---------------------------
T1JVL3_TETUR/20-350----------------------------AK..............EYV..GKPI---------------------------
T1FF42_HELRO/20-382----------------------------ST..............LII..DEPI---------------------------
F4WK99_ACREC/29-382----------------------------SR..............QFI..GEHI---------------------------
B4JMT0_DROGR/22-375----------------------------SR..............QYI..GEHI---------------------------
D6X4I2_TRICA/20-352----------------------------TR..............QYV..GNPI---------------------------
U1MEL2_ASCSU/21-373----------------------------AK..............QYG..GTPI---------------------------
T1KQA9_TETUR/21-353----------------------------GR..............QYF..GDPI---------------------------
B4JN21_DROGR/20-380----------------------------AR..............QYF..GDPI---------------------------
A8PZ15_BRUMA/19-373----------------------------AK..............QYV..GFPI---------------------------
G7YJJ0_CLOSI/22-391----------------------------VK..............QYM..MKPI---------------------------
T1KKN2_TETUR/42-372----------------------------MR..............QYF..GEPI---------------------------
E5SRT1_TRISP/18-357----------------------------FT..............DIL..TPRI---------------------------
B4NKS4_DROWI/26-356----------------------------AN..............NLI..GDPI---------------------------
A8X921_CAEBR/20-406----------------------------WK..............QFG..GTPI---------------------------
Q29GC9_DROPS/20-393----------------------------AR..............QYF..GDPI---------------------------
B7QK16_IXOSC/22-357----------------------------AT..............QFF..GNPI---------------------------
Q29GW8_DROPS/21-382----------------------------AK..............QYF..GEPI---------------------------
G0NJM8_CAEBE/372-710----------------------------AK..............QYV..GQSI---------------------------

PF00029

H3AWH1_LATCH/3-247-------------------------------------------------GDAI---------------------------
H2SPA6_TAKRU/4-236-------------------------------------------------AEDV---------------------------
F7EJU4_XENTR/1-220-------------------------------------------------GDAM---------------------------
I3KXW0_ORENI/2-217-------------------------------------------------AESV---------------------------
A7VKB2_DANRE/3-235-------------------------------------------------TEDV---------------------------
F6QD10_XENTR/3-234-------------------------------------------------AESS---------------------------
W5LSW7_ASTMX/5-245-------------------------------------------------AESA---------------------------
I3KZJ5_ORENI/3-218-------------------------------------------------AESV---------------------------
H2U506_TAKRU/3-235-------------------------------------------------CEKV---------------------------
H0YRM3_TAEGU/4-209-------------------------------------------------GYPL---------------------------
I3KDI4_ORENI/5-225-------------------------------------------------VQTV---------------------------
W5NMQ0_LEPOC/2-215-------------------------------------------------AESV---------------------------
M4AZZ1_XIPMA/2-209-------------------------------------------------AERV---------------------------
M3WS82_FELCA/3-231-------------------------------------------------VESA---------------------------
E7FEN2_DANRE/3-235-------------------------------------------------AEDV---------------------------
H0XEF8_OTOGA/3-277-------------------------------------------------GETV---------------------------
F7AWX4_CIOIN/3-233-------------------------------------------------GESV---------------------------
I3J6V1_ORENI/7-223-------------------------------------------------GYPL---------------------------
W5NNA4_LEPOC/2-203-------------------------------------------------AEQV---------------------------
H3CIE9_TETNG/2-271-------------------------------------------------GESI---------------------------
Q1LWG0_DANRE/5-240-------------------------------------------------VESA---------------------------
W5LK97_ASTMX/3-236-------------------------------------------------AEDV---------------------------
W5LT82_ASTMX/3-260-------------------------------------------------GDAV---------------------------
Q6NYU5_DANRE/3-235-------------------------------------------------AEDV---------------------------
G3PF51_GASAC/2-203-------------------------------------------------AEHV---------------------------
H3AVR6_LATCH/2-252-------------------------------------------------GESI---------------------------
I3KPL9_ORENI/3-219-------------------------------------------------AEKV---------------------------
I3KDJ0_ORENI/24-241-------------------------------------------------VQPV---------------------------
H2YD27_CIOSA/3-225-------------------------------------------------AKAS---------------------------
W5LS74_ASTMX/3-226-------------------------------------------------AEKV---------------------------
I3JLG4_ORENI/2-209-------------------------------------------------AERV---------------------------
G1LUU1_AILME/1-212-------------------------------------------------AEDV---------------------------
W5NL33_LEPOC/3-225-------------------------------------------------AEKV---------------------------
W5K246_ASTMX/3-256-------------------------------------------------GEKV---------------------------
E4XFG0_OIKDI/3-274-------------------------------------------------CDTV---------------------------
I3KZG9_ORENI/3-222-------------------------------------------------ADNV---------------------------
G1TBS7_RABIT/4-233-------------------------------------------------AGEI---------------------------
H2U507_TAKRU/2-210-------------------------------------------------CEKV---------------------------
Q28ED4_XENTR/2-214-------------------------------------------------AESV---------------------------
H2LYS6_ORYLA/3-266-------------------------------------------------GEKV---------------------------
H3AJ15_LATCH/3-212-------------------------------------------------ASDM---------------------------
F7ETX8_ORNAN/2-215-------------------------------------------------AEEV---------------------------
H2ZVD7_LATCH/5-257-------------------------------------------------GESI---------------------------
H2S6C1_TAKRU/3-218-------------------------------------------------AESV---------------------------
H3ALN1_LATCH/3-235-------------------------------------------------AEDV---------------------------
CX32_DANRE/3-215-------------------------------------------------AENV---------------------------
I3J613_ORENI/3-235-------------------------------------------------TEDV---------------------------
U3KL92_FICAL/2-214-------------------------------------------------AESV---------------------------
G3NQK0_GASAC/2-213-------------------------------------------------AQKV---------------------------
H3C889_TETNG/2-252-------------------------------------------------GETI---------------------------
M4AHN8_XIPMA/3-229-------------------------------------------------AEKV---------------------------
I3IYX3_ORENI/3-244-------------------------------------------------AESS---------------------------
M3XKA4_LATCH/4-217-------------------------------------------------VERV---------------------------
H2T4Y3_TAKRU/239-451-------------------------------------------------AEEV---------------------------
H3C2U7_TETNG/2-212-------------------------------------------------AEKV---------------------------
R0L8V9_ANAPL/2-256-------------------------------------------------GESI---------------------------
V8NXQ1_OPHHA/3-236-------------------------------------------------AEFV---------------------------
F7A3G7_MONDO/2-215-------------------------------------------------GEAI---------------------------
H2TXC6_TAKRU/12-223-------------------------------------------------GYPL---------------------------
F7EJS7_MONDO/2-210-------------------------------------------------SEKV---------------------------
H2T4Y3_TAKRU/2-222-------------------------------------------------AESV---------------------------
I3KZV2_ORENI/5-248-------------------------------------------------AESA---------------------------
W5LRY9_ASTMX/2-208-------------------------------------------------AQRV---------------------------
B3DID2_DANRE/3-226-------------------------------------------------AESS---------------------------
W5LRJ3_ASTMX/2-218-------------------------------------------------AETV---------------------------
H3DPE1_TETNG/2-203-------------------------------------------------AEQV---------------------------
G1P848_MYOLU/5-284-------------------------------------------------GESI---------------------------
H0VZC3_CAVPO/5-270-------------------------------------------------GESI---------------------------
H2QV11_PANTR/5-214-------------------------------------------------GPGV---------------------------
H9GHG0_ANOCA/3-256-------------------------------------------------GETV---------------------------
V8NGI0_OPHHA/2-210-------------------------------------------------AERV---------------------------
F6Z9W1_HORSE/5-215-------------------------------------------------GTGV---------------------------
L5MG71_MYODS/92-305-------------------------------------------------GSPV---------------------------
L5JSY3_PTEAL/60-308-------------------------------------------------GDAV---------------------------
R0LQP0_ANAPL/3-236-------------------------------------------------AESS---------------------------
F6XTB3_MONDO/3-229-------------------------------------------------GDAI---------------------------
W5LSK7_ASTMX/12-228-------------------------------------------------EMPW---------------------------
H2ML18_ORYLA/1-218-------------------------------------------------VESA---------------------------
F6S9P0_CIOIN/2-251-------------------------------------------------GDRV---------------------------
H2SUJ4_TAKRU/2-210-------------------------------------------------AEKV---------------------------
F7BMQ9_MONDO/3-212-------------------------------------------------GGAV---------------------------
V8P2C7_OPHHA/3-221-------------------------------------------------GSDV---------------------------
L9JDB3_TUPCH/201-431-------------------------------------------------GESV---------------------------
W5L1W8_ASTMX/2-257-------------------------------------------------GETI---------------------------
Q8JFD6_DANRE/3-260-------------------------------------------------GETV---------------------------
G3GSS7_CRIGR/3-235-------------------------------------------------AEDV---------------------------
H2ZYS4_LATCH/3-236-------------------------------------------------AESS---------------------------
CXG1_PIG/2-255-------------------------------------------------GESI---------------------------
G1PYG2_MYOLU/3-223-------------------------------------------------VESV---------------------------
Q6NVT8_XENTR/2-214-------------------------------------------------AESV---------------------------
W5NP42_LEPOC/3-225-------------------------------------------------IENV---------------------------
G3TTM6_LOXAF/5-249-------------------------------------------------GESI---------------------------
H3B5X0_LATCH/2-253-------------------------------------------------GETI---------------------------
I3N3J2_SPETR/5-215-------------------------------------------------GPGI---------------------------
G3QAJ1_GASAC/3-273-------------------------------------------------NSDV---------------------------
W5NMN4_LEPOC/3-227-------------------------------------------------AESS---------------------------
F6VRX7_CIOIN/3-218-------------------------------------------------ADTV---------------------------
W5NQJ6_SHEEP/2-210-------------------------------------------------AEEV---------------------------
X1WDX8_DANRE/3-220-------------------------------------------------LDKV---------------------------
F7E5W8_XENTR/2-210-------------------------------------------------AERV---------------------------
G1NQF9_MELGA/2-215-------------------------------------------------AERV---------------------------
I3KVE7_ORENI/1-203-------------------------------------------------ASDM---------------------------
E4X0Y2_OIKDI/2-275-------------------------------------------------GDRV---------------------------
G1KPR6_ANOCA/2-243-------------------------------------------------GESI---------------------------
H0YV03_TAEGU/2-256-------------------------------------------------GESI---------------------------
H3C492_TETNG/2-256-------------------------------------------------GESI---------------------------
F1STM7_PIG/2-210-------------------------------------------------AERV---------------------------
F6QCF2_XENTR/3-233-------------------------------------------------AEFV---------------------------
I3MGG4_SPETR/8-224-------------------------------------------------GYPI---------------------------
W5LSW6_ASTMX/2-208-------------------------------------------------AQPV---------------------------
Q5TYN9_DANRE/3-219-------------------------------------------------AEKV---------------------------
U3JNY0_FICAL/2-256-------------------------------------------------GESI---------------------------
F1QYI2_DANRE/2-260-------------------------------------------------GETI---------------------------
CXG3_MOUSE/16-226-------------------------------------------------GPGV---------------------------
CXA6_RAT/3-234-------------------------------------------------IESA---------------------------
H2Y3H1_CIOIN/3-269-------------------------------------------------GDMV---------------------------
G7NUB7_MACFA/3-235-------------------------------------------------AEDV---------------------------
R0LA62_ANAPL/1-208-------------------------------------------------AERV---------------------------
E1BQP7_CHICK/5-259-------------------------------------------------GESI---------------------------
W5LTI3_ASTMX/3-258-------------------------------------------------GDAV---------------------------
F6WJC3_XENTR/17-225-------------------------------------------------AGRV---------------------------
I3JAN6_ORENI/2-208-------------------------------------------------AQRV---------------------------
H0VLP6_CAVPO/5-215-------------------------------------------------GPGI---------------------------
F7BI06_MONDO/3-235-------------------------------------------------AEFV---------------------------
CXA4_XENTR/3-232-------------------------------------------------GESV---------------------------
H2S6B7_TAKRU/5-280-------------------------------------------------ADKV---------------------------
H3ASF8_LATCH/3-233-------------------------------------------------AESV---------------------------
I3KHF0_ORENI/2-267-------------------------------------------------GESI---------------------------
F6VXA2_MONDO/2-249-------------------------------------------------GESI---------------------------
W5JZ19_ASTMX/2-270-------------------------------------------------GESI---------------------------
H2LHM2_ORYLA/1-203-------------------------------------------------ADDT---------------------------
H2T1Y9_TAKRU/3-225-------------------------------------------------TEKV---------------------------
I3KF01_ORENI/2-208-------------------------------------------------AQRV---------------------------
G1N2B3_MELGA/4-211-------------------------------------------------GYPL---------------------------
E7FBZ4_DANRE/3-233-------------------------------------------------VESA---------------------------
H2LI61_ORYLA/2-265-------------------------------------------------GESI---------------------------
W5KYU2_ASTMX/9-217-------------------------------------------------GFPL---------------------------
E4WSZ4_OIKDI/3-276-------------------------------------------------AERA---------------------------
W5LUZ9_ASTMX/2-214-------------------------------------------------AESV---------------------------
H2YWV0_CIOSA/3-255-------------------------------------------------GDRV---------------------------
G1U794_RABIT/5-221-------------------------------------------------GESI---------------------------
H2ZV48_LATCH/2-203-------------------------------------------------AEQV---------------------------
H3API8_LATCH/2-210-------------------------------------------------AERV---------------------------
H2XJX2_CIOIN/3-260-------------------------------------------------GSSV---------------------------
CXG1_DANRE/2-250-------------------------------------------------GESI---------------------------
G1QTG3_NOMLE/2-211-------------------------------------------------AERV---------------------------
H3AJZ7_LATCH/3-233-------------------------------------------------VESA---------------------------
H0XZ54_OTOGA/6-222-------------------------------------------------GYPI---------------------------
Q8K4M6_CAVPO/2-215-------------------------------------------------TKEV---------------------------
E4XZI0_OIKDI/4-257-------------------------------------------------GDAV---------------------------
H2MKZ2_ORYLA/3-221-------------------------------------------------VEKV---------------------------
Q66HV7_DANRE/2-254-------------------------------------------------GESI---------------------------
W5LS82_ASTMX/3-218-------------------------------------------------AEKV---------------------------
M3ZFG9_XIPMA/3-244-------------------------------------------------HITQ---------------------------
I3JAN5_ORENI/5-241-------------------------------------------------AQGV---------------------------
G5BBL6_HETGA/3-231-------------------------------------------------AESS---------------------------
F1QL21_DANRE/3-226-------------------------------------------------AESS---------------------------
H2MKZ7_ORYLA/3-216-------------------------------------------------ADNV---------------------------
E4XEP0_OIKDI/2-239-------------------------------------------------GDRV---------------------------
CXG1_XENTR/2-253-------------------------------------------------GESI---------------------------
F6WE26_XENTR/2-255-------------------------------------------------GESI---------------------------
G1PZ72_MYOLU/3-220-------------------------------------------------AELV---------------------------
G1U6K9_RABIT/5-215-------------------------------------------------GPGV---------------------------
M4A0T3_XIPMA/2-208-------------------------------------------------AQRV---------------------------
L9KPJ4_TUPCH/4-215-------------------------------------------------GPGI---------------------------
Q4S8R0_TETNG/3-228-------------------------------------------------AEKV---------------------------
G1K926_ANOCA/4-219-------------------------------------------------AYPL---------------------------
I3JSR3_ORENI/2-262-------------------------------------------------GESI---------------------------
G3PMN6_GASAC/2-239-------------------------------------------------GESI---------------------------
H0W6E8_CAVPO/2-210-------------------------------------------------AKDV---------------------------
W5NNM0_LEPOC/5-260-------------------------------------------------GESI---------------------------
W5MSD7_LEPOC/2-251-------------------------------------------------GESI---------------------------
F1QZN0_DANRE/2-206-------------------------------------------------AQRV---------------------------
I3NGZ1_SPETR/3-214-------------------------------------------------GGAV---------------------------
G3PLV3_GASAC/3-238-------------------------------------------------AESV---------------------------
CXG3_BOVIN/5-216-------------------------------------------------GTGV---------------------------
Q7T2D7_DANRE/3-219-------------------------------------------------AESV---------------------------
I3KYC0_ORENI/3-221-------------------------------------------------VDKI---------------------------
H2LLM1_ORYLA/2-208-------------------------------------------------AQKV---------------------------
H2SP60_TAKRU/3-224-------------------------------------------------AESS---------------------------
H2XQL4_CIOIN/3-214-------------------------------------------------AEST---------------------------
W5LSW9_ASTMX/2-210-------------------------------------------------AEKV---------------------------
E4XWI7_OIKDI/6-263-------------------------------------------------GNAV---------------------------
F7CJM7_CALJA/5-246-------------------------------------------------GEAI---------------------------
H3DP97_TETNG/3-227-------------------------------------------------ADKV---------------------------
W5M0U8_LEPOC/14-229-------------------------------------------------AESA---------------------------
W5LWP5_LEPOC/4-229-------------------------------------------------GYPL---------------------------
F6UBJ9_CIOIN/3-265-------------------------------------------------GDAV---------------------------
W5LTB5_ASTMX/3-205-------------------------------------------------ASDM---------------------------
Q6DEG1_DANRE/2-207-------------------------------------------------VQQV---------------------------
H2Y5A4_CIOSA/4-260-------------------------------------------------GDMV---------------------------
H2SK18_TAKRU/3-261-------------------------------------------------GETV---------------------------
V8N9D2_OPHHA/2-209-------------------------------------------------AEKV---------------------------
M3Y3X1_MUSPF/6-223-------------------------------------------------GSPV---------------------------
Q4T8N8_TETNG/3-290-------------------------------------------------TEDV---------------------------
I3KVE6_ORENI/3-253-------------------------------------------------ASDM---------------------------
W5NLN3_LEPOC/3-255-------------------------------------------------GDAV---------------------------
L9JE20_TUPCH/2-210-------------------------------------------------AEKV---------------------------
E4XXY1_OIKDI/3-267-------------------------------------------------GGSV---------------------------
H2Y0D6_CIOIN/3-273-------------------------------------------------GDKV---------------------------
E4XG44_OIKDI/4-279-------------------------------------------------VDNT---------------------------
F7G2Z1_MACMU/11-217-------------------------------------------------GRPV---------------------------
W5NP15_LEPOC/2-209-------------------------------------------------AEKV---------------------------
F7BU85_ORNAN/4-210-------------------------------------------------GYPI---------------------------
F6W3E8_XENTR/2-203-------------------------------------------------AEAV---------------------------
V8NGI0_OPHHA/252-482-------------------------------------------------GESV---------------------------
H3AFY3_LATCH/2-215-------------------------------------------------AESV---------------------------
H2UYD2_TAKRU/3-199-------------------------------------------------ASDL---------------------------
G1KPT6_ANOCA/3-235-------------------------------------------------AEDV---------------------------
F6XX97_XENTR/3-216-------------------------------------------------GSDM---------------------------
G1KFU5_ANOCA/5-260-------------------------------------------------GESI---------------------------
W5LSX0_ASTMX/2-208-------------------------------------------------AERV---------------------------
F6TGH3_ORNAN/2-210-------------------------------------------------AEEV---------------------------
W5NLV6_LEPOC/2-261-------------------------------------------------GESI---------------------------
H0Z9S4_TAEGU/3-225-------------------------------------------------AERV---------------------------
Q5SNV2_DANRE/2-203-------------------------------------------------AEQV---------------------------
H2UN58_TAKRU/33-250-------------------------------------------------AESA---------------------------
G7P3J8_MACFA/2-203-------------------------------------------------TEHV---------------------------
I3K6P7_ORENI/5-256-------------------------------------------------GETI---------------------------
E4WRX0_OIKDI/2-266-------------------------------------------------GDRV---------------------------
I3KZU8_ORENI/2-252-------------------------------------------------GESI---------------------------
H3AFA2_LATCH/3-235-------------------------------------------------VESV---------------------------
U3KK04_FICAL/2-203-------------------------------------------------AESI---------------------------
Q0V9Q2_XENTR/5-255-------------------------------------------------GESI---------------------------
W5LS83_ASTMX/3-220-------------------------------------------------VDKV---------------------------
W5LKY1_ASTMX/5-260-------------------------------------------------GESI---------------------------
I3KPM0_ORENI/3-228-------------------------------------------------AEKV---------------------------
F6S9Q0_CIOIN/2-246-------------------------------------------------GDRV---------------------------
W5NN38_LEPOC/3-253-------------------------------------------------TEDV---------------------------
W5LS84_ASTMX/3-216-------------------------------------------------VENV---------------------------
H2LA31_ORYLA/2-253-------------------------------------------------GETI---------------------------
H2TW08_TAKRU/3-235-------------------------------------------------GDAV---------------------------
E4WYD1_OIKDI/11-261-------------------------------------------------GENI---------------------------
H3C8N2_TETNG/1-214-------------------------------------------------AESS---------------------------
F7CCT5_MONDO/4-220-------------------------------------------------GYPI---------------------------
H0WMY4_OTOGA/4-216-------------------------------------------------GKSV---------------------------
H2Y5A2_CIOSA/4-264-------------------------------------------------GDMV---------------------------

PF00822

CLD7_HUMAN/4-182---------------------------------------------W--QM------------------------------
CCG2_MOUSE/6-197---------------------------------------------W--LY------------------------------
EMP3_HUMAN/1-156---------------------------------------------W--TL------------------------------
EMP1_MOUSE/1-154---------------------------------------------W--MV------------------------------
CLD1_MOUSE/4-182---------------------------------------------W--KI------------------------------
CLD10_HUMAN/4-179---------------------------------------------W--KV------------------------------
PMP22_HUMAN/1-153---------------------------------------------W--IV------------------------------
EMP1_RABIT/1-154---------------------------------------------W--VV------------------------------
LMIP_BOVIN/1-157---------------------------------------------W--MQ------------------------------
EMP2_MOUSE/1-165---------------------------------------------W--WV------------------------------
CLD7B_DANRE/4-182---------------------------------------------W--KM------------------------------
EMP1_HUMAN/1-151---------------------------------------------W--LV------------------------------
EMP2_HUMAN/1-160---------------------------------------------W--WV------------------------------

PF13903

TM235_HUMAN/16-197---------------------------------------------W..YI.-----------------------------
TM235_MOUSE/16-192---------------------------------------------W..YI.-----------------------------
B4Q2K5_DROYA/16-232---------------------------------------------W..LH.-----------------------------
TM182_XENTR/15-225---------------------------------------------W..LLA-----------------------------
A0A023EMM6_AEDAL/16-235---------------------------------------------W..LS.-----------------------------
TM182_MOUSE/15-220---------------------------------------------W..LL.-----------------------------
D2HQ99_AILME/17-198---------------------------------------------W..AV.-----------------------------
B4NZC2_DROYA/16-190---------------------------------------------W..LV.-----------------------------
Q1L8R4_DANRE/69-258---------------------------------------------W..VE.-----------------------------
B0WVP8_CULQU/16-190---------------------------------------------W..LQ.-----------------------------
B4KVB2_DROMO/40-219---------------------------------------------W..LV.-----------------------------
Q17AR2_AEDAE/35-214---------------------------------------------W..LV.-----------------------------
Q6E5P4_TAKRU/18-198---------------------------------------------WRLWY.-----------------------------
B7QNM3_IXOSC/25-197---------------------------------------------W..LE.-----------------------------

PF07062

O45670_CAEEL/8-219---------------------------------------------W--QV------------------------------
A8XPM2_CAEBR/9-213---------------------------------------------W--QV------------------------------
A8XPM1_CAEBR/5-202---------------------------------------------W--QV------------------------------
A8XPW0_CAEBR/10-221---------------------------------------------W--QI------------------------------
Q18135_CAEEL/11-221---------------------------------------------W--QV------------------------------

PF10242

Q7PMA1_ANOGA/11-202---------------------------------------------W--LIG-----------------------------
LHPL4_RAT/22-200---------------------------------------------W--VGD-----------------------------
TMHS_RAT/25-202---------------------------------------------W--IGD-----------------------------
TMHS_CHICK/25-202---------------------------------------------W--IGD-----------------------------
Q178A0_AEDAE/25-199---------------------------------------------W--VGD-----------------------------
Q2M056_DROPS/25-199---------------------------------------------W--IGD-----------------------------
Q9XVU1_CAEEL/19-183---------------------------------------------W--IG.-----------------------------
LHPL2_HUMAN/9-204---------------------------------------------W--LIG-----------------------------
Q4S279_TETNG/9-201---------------------------------------------W--LVG-----------------------------
Q568B9_DANRE/9-197---------------------------------------------W--LVG-----------------------------
Q4RUW4_TETNG/9-195---------------------------------------------W--LMG-----------------------------
Q9W0X9_DROME/9-195---------------------------------------------W--LVG-----------------------------
Q292M2_DROPS/9-197---------------------------------------------W--LIG-----------------------------
LHFP_MOUSE/8-193---------------------------------------------W--LWG-----------------------------
LHPL1_RAT/8-192---------------------------------------------W--LFG-----------------------------
B1H157_XENTR/22-199---------------------------------------------W--IGD-----------------------------
H2SCC7_TAKRU/19-197---------------------------------------------W--VGT-----------------------------
H3CMV1_TETNG/22-199---------------------------------------------W--IGD-----------------------------

PF06653

Q8ITZ9_CAEEL/47-208---------------------------------------------.--ET------------------------------
Q9TZ35_CAEEL/1-155---------------------------------------------W--LV------------------------------
A8WY95_CAEBR/1-161---------------------------------------------W--LS------------------------------
A8XQE4_CAEBR/1-163---------------------------------------------W--MT------------------------------
A8WYV7_CAEBR/1-134---------------------------------------------W--IV------------------------------
A8WK96_CAEBR/1-140---------------------------------------------W--RS------------------------------
A8XRC8_CAEBR/1-182---------------------------------------------W--NT------------------------------
A8XQE5_CAEBR/1-150---------------------------------------------W--IV------------------------------
Q9XUZ7_CAEEL/1-168---------------------------------------------W--VT------------------------------
Q2WF57_CAEEL/1-166---------------------------------------------W--IS------------------------------
O45515_CAEEL/1-161---------------------------------------------W--LT------------------------------
A8XR11_CAEBR/1-188---------------------------------------------W--AT------------------------------
B6IEW4_CAEBR/1-156---------------------------------------------W--TS------------------------------
Q95YB5_CAEEL/1-123---------------------------------------------.--..------------------------------
A8WK67_CAEBR/1-167---------------------------------------------W--IN------------------------------
Q95XC2_CAEEL/1-191---------------------------------------------F--MV------------------------------
B6IFT2_CAEBR/1-179---------------------------------------------W--IV------------------------------
A8XQE6_CAEBR/1-167---------------------------------------------W--IV------------------------------
B6IEW3_CAEBR/1-114---------------------------------------------.--..------------------------------
A8XWG5_CAEBR/1-169---------------------------------------------W--IV------------------------------
O45334_CAEEL/1-161---------------------------------------------W--IT------------------------------
A8WY98_CAEBR/1-166---------------------------------------------W--VC------------------------------
B6IKT5_CAEBR/1-215---------------------------------------------W--IE------------------------------
B6IKT4_CAEBR/1-120---------------------------------------------.--..------------------------------

PF07344

A4I9X4_LEIIN/377-531-------------------------------------------..F.RERF-----------------------------
A4HBJ2_LEIBR/15-170-------------------------------------------..F.RFNS-----------------------------
A4H6C8_LEIBR/15-170-------------------------------------------..F.RVKD-----------------------------
Q4Q3F7_LEIMA/15-171-------------------------------------------..F.RGND-----------------------------
A4H5H1_LEIBR/15-170-------------------------------------------..F.HLRI-----------------------------
A4HBJ0_LEIBR/15-171-------------------------------------------..Y.RFRP-----------------------------
A4HB47_LEIBR/18-199-------------------------------------------..F.RVPN-----------------------------
A4I9X2_LEIIN/15-169-------------------------------------------..F.RIPN-----------------------------
Q4Q339_LEIMA/15-170-------------------------------------------..F.RAHN-----------------------------
Q4E0S1_TRYCC/20-182-------------------------------------------..F.RGKG-----------------------------
Q4Q3A7_LEIMA/14-189-------------------------------------------..Y.MPLN-----------------------------
A4HAZ8_LEIBR/15-170-------------------------------------------..F.RVKP-----------------------------
Q4QIA0_LEIMA/15-170-------------------------------------------..F.YNKP-----------------------------
Q4Q8C7_LEIMA/145-338-------------------------------------------..I.DVVG-----------------------------
Q585K0_TRYB2/9-167-------------------------------------------PVF.RMKN-----------------------------
A4H5D1_LEIBR/15-173-------------------------------------------YWF.RIGS-----------------------------
A4HB02_LEIBR/15-170-------------------------------------------..F....L-----------------------------
A4H5G6_LEIBR/15-171-------------------------------------------..Y.RFRR-----------------------------
A4I9W9_LEIIN/15-171-------------------------------------------..FIRTDH-----------------------------
A4HDL4_LEIBR/18-168-------------------------------------------..I.DSMT-----------------------------
Q4QHJ3_LEIMA/241-414-------------------------------------------NMW.....-----------------------------
A4HAJ6_LEIBR/28-184-------------------------------------------..Y.RFRP-----------------------------
E9AG83_LEIIN/15-171-------------------------------------------..F.RGTT-----------------------------
A4H7D7_LEIBR/15-172-------------------------------------------..F.RIRS-----------------------------
A4I4J2_LEIIN/15-171-------------------------------------------..F.REVK-----------------------------
Q4QAK7_LEIMA/19-166-------------------------------------------..F.QTPG-----------------------------
Q4QI88_LEIMA/15-171-------------------------------------------..F.RPHN-----------------------------
A4HBJ1_LEIBR/15-170-------------------------------------------..F.RFKP-----------------------------
A4HGJ1_LEIBR/143-338-------------------------------------------..I.DLVG-----------------------------
Q4Q3A8_LEIMA/18-199-------------------------------------------..F.RVQN-----------------------------
A4HI41_LEIBR/20-195-------------------------------------------..F.RGSG-----------------------------
A4HDI3_LEIBR/87-236-------------------------------------------..I.ESVF-----------------------------
A4I4J3_LEIIN/81-236-------------------------------------------..F.RIDP-----------------------------
E9AHT2_LEIIN/15-171-------------------------------------------..F.RGND-----------------------------
Q4Q327_LEIMA/15-169-------------------------------------------..F.RMPS-----------------------------
A4HTM4_LEIIN/15-171-------------------------------------------..F.RPHG-----------------------------
Q4Q8C6_LEIMA/374-525-------------------------------------------..L.DVVG-----------------------------
Q4Q397_LEIMA/79-235-------------------------------------------..F.RAAV-----------------------------
A4IAL7_LEIIN/15-170-------------------------------------------..F.SMAV-----------------------------
A4H5G0_LEIBR/15-170-------------------------------------------..F.RLRD-----------------------------
Q4Q317_LEIMA/15-172-------------------------------------------..F.RGVN-----------------------------
A4I0W5_LEIIN/18-168-------------------------------------------..I.DSKT-----------------------------
A4I9W8_LEIIN/77-234-------------------------------------------..F.RLKK-----------------------------
A4H5D2_LEIBR/15-171-------------------------------------------..F.HVNE-----------------------------
A4H5G5_LEIBR/226-381-------------------------------------------..F.RITD-----------------------------
A4I9X1_LEIIN/15-170-------------------------------------------..F.RSSN-----------------------------
Q384H4_TRYB2/118-295-------------------------------------------..L.DEVG-----------------------------
Q4CVL1_TRYCC/26-174-------------------------------------------..L.QPKL-----------------------------
A4I5B9_LEIIN/26-190-------------------------------------------LMIRSWGE-----------------------------
A4I0W4_LEIIN/18-166-------------------------------------------..L.DVKN-----------------------------
A4I9X0_LEIIN/31-188-------------------------------------------..F.RSNP-----------------------------
A4IAM2_LEIIN/15-170-------------------------------------------..F.RGDV-----------------------------
A4I9R7_LEIIN/15-171-------------------------------------------..F.RGTI-----------------------------
A4HAL2_LEIBR/14-189-------------------------------------------..Y.VPRS-----------------------------
Q4DU87_TRYCC/14-171-------------------------------------------..F.RPRT-----------------------------
Q4Q309_LEIMA/15-169-------------------------------------------..F.HIRT-----------------------------
A4H9E8_LEIBR/48-205-------------------------------------------..F.RLTG-----------------------------
A4HI43_LEIBR/25-189-------------------------------------------LMIRSWEE-----------------------------
Q4Q6L8_LEIMA/15-171-------------------------------------------..F.HVTP-----------------------------
A4HB00_LEIBR/15-170-------------------------------------------..F.RFRM-----------------------------
A4I6E5_LEIIN/15-171-------------------------------------------..F.YLKH-----------------------------
A4H605_LEIBR/152-298-------------------------------------------..M.RSSS-----------------------------
A4H9E9_LEIBR/15-171-------------------------------------------..F.HFKD-----------------------------
A4HAJ4_LEIBR/51-207-------------------------------------------..F.RLDQ-----------------------------
A4H5G7_LEIBR/15-171-------------------------------------------..Y.RFRP-----------------------------
Q4QHJ4_LEIMA/134-280-------------------------------------------..M.RGES-----------------------------
A4HGF8_LEIBR/158-312-------------------------------------------..Y.RGKN-----------------------------
Q4Q1U9_LEIMA/15-169-------------------------------------------..F.RIPR-----------------------------
A4IAM1_LEIIN/15-170-------------------------------------------..F.RGDL-----------------------------
Q4QI87_LEIMA/15-171-------------------------------------------..F.RVKG-----------------------------
Q384H3_TRYB2/301-450-------------------------------------------..M.DVVG-----------------------------
A4I5B8_LEIIN/20-195-------------------------------------------..F.RGRG-----------------------------
Q4DDC5_TRYCC/14-171-------------------------------------------..F.RTKE-----------------------------

PF07803

F1RBI8_DANRE/5-124---------------------------------------------W----------------------------------
H9GN86_ANOCA/23-152---------------------------------------------W----------------------------------
F1QA75_DANRE/4-115---------------------------------------------W----------------------------------
H3CZU3_TETNG/7-115---------------------------------------------W----------------------------------
GSG1L_XENTR/5-124---------------------------------------------W----------------------------------
G1RGF7_NOMLE/4-119---------------------------------------------W----------------------------------
H2SQP8_TAKRU/10-121---------------------------------------------W----------------------------------
GSG1_BOVIN/8-121---------------------------------------------W----------------------------------
I3KRK1_ORENI/5-112---------------------------------------------W----------------------------------
G1PJM9_MYOLU/8-122---------------------------------------------W----------------------------------
M4ANQ0_XIPMA/5-117---------------------------------------------W----------------------------------
E1BQK0_CHICK/10-122---------------------------------------------W----------------------------------
F6XCN0_XENTR/6-117---------------------------------------------W----------------------------------
H3A9A9_LATCH/14-126---------------------------------------------W----------------------------------
X1WCY0_DANRE/5-116---------------------------------------------W----------------------------------
H2T2C4_TAKRU/9-124---------------------------------------------W----------------------------------
G1LVZ0_AILME/8-122---------------------------------------------W----------------------------------
W5N1L9_LEPOC/5-116---------------------------------------------W----------------------------------
F6QYE6_XENTR/5-114---------------------------------------------W----------------------------------
M0QWL6_MOUSE/5-119---------------------------------------------W----------------------------------
G5BYE9_HETGA/8-122---------------------------------------------W----------------------------------
H2ZT70_LATCH/6-119---------------------------------------------W----------------------------------
F5H0V9_HUMAN/24-137---------------------------------------------W----------------------------------
H3A6Q3_LATCH/5-111---------------------------------------------W----------------------------------
H3CN24_TETNG/5-116---------------------------------------------W----------------------------------
F6TBZ7_ORNAN/10-124---------------------------------------------W----------------------------------
W5MNB3_LEPOC/10-148---------------------------------------------W----------------------------------
I3JSS8_ORENI/21-128---------------------------------------------W----------------------------------
H9GMT0_ANOCA/6-119---------------------------------------------W----------------------------------
G3HB44_CRIGR/10-121---------------------------------------------W----------------------------------
W5NZF8_SHEEP/5-115---------------------------------------------W----------------------------------
W5L9X5_ASTMX/6-118---------------------------------------------W----------------------------------
G1M092_AILME/8-119---------------------------------------------W----------------------------------
V8PHH2_OPHHA/85-194---------------------------------------------W----------------------------------
H2NQH5_PONAB/15-140---------------------------------------------W----------------------------------
G1TTX9_RABIT/4-118---------------------------------------------W----------------------------------
H0XHA4_OTOGA/4-117---------------------------------------------W----------------------------------
F7BNL6_XENTR/10-120---------------------------------------------W----------------------------------
F1NVB9_CHICK/11-120---------------------------------------------W----------------------------------
F6WEP2_MONDO/5-117---------------------------------------------W----------------------------------
F7FP57_MONDO/12-123---------------------------------------------W----------------------------------

PF06687

Q7SFF9_NEUCR/5-294------------------------------------E......SYDVVTFN-TSTLGQNLVYNQLSDNQPGSEADGVCEK
MAC1_SCHPO/6-177------------------------------------T......RMTLAKVE-GT..........................
Q5K881_CRYNJ/4-176------------------------------------WD.....QVGFLTTT-AG..........................
A0A0D1D1B0_USTMA/4-186------------------------------------IK.....SIYFLEAT-IGGNGPQS....................
Q5KGB3_CRYNJ/7-189------------------------------------K......SLYFLSAT-FS...SGSY...................
A7A250_YEAS7/7-175------------------------------------IR.....NWGLAQAA-GV..........................
Q6FSP2_CANGA/9-169------------------------------------FH.....QIGLAKSN-GF..........................
A6ZNI8_YEAS7/5-176------------------------------------FK.....QIGYSKYD-EI..........................
A7TT16_VANPO/7-179------------------------------------FK.....QIGLSKYN-NI..........................
Q6CX71_KLULA/9-171------------------------------------FD.....NVRLASFD-GI..........................
Q757N9_ASHGO/7-167------------------------------------VS.....DLGLADAD-GV..........................
Q5ALR6_CANAL/7-166------------------------------------V......DIFALSKT-SD..........................
A3LTF9_PICST/7-165------------------------------------V......STFALSKT-SD..........................
A5DUT6_LODEL/7-165------------------------------------VT.....TFNLGKTA-TY..........................
Q6BIN6_DEBHA/7-162------------------------------------S......SFGLGSTS-SY..........................
A5DHH0_PICGU/5-162------------------------------------VP.....SFALGQTT-SH..........................
A0A0D1DVQ9_USTMA/5-204------------------------------------D......FVRSTRLD-GVVDLSPN....................
MUG33_SCHPO/5-166------------------------------------AN.....NLTLGKYG-DV..........................
PALI_ASHGO/5-170------------------------------------SN.....GVTLSHFN-GY..........................
PALI2_KLULA/3-167------------------------------------TI.....GLYISEYN-GY..........................
PALI1_KLULA/4-168------------------------------------TS.....HLFISEYN-GY..........................
A7TPS6_VANPO/6-170------------------------------------ID.....HLMLSQLD-GI..........................
PALI_CANGA/6-170------------------------------------NK.....NLILGQYM-GY..........................
A3LUV8_PICST/4-233------------------------------------TSPST..NIYLSSYR-NF..........................
PALI_CANAL/4-232------------------------------------A......NIYLSYYN-NY..........................
A5E4Z6_LODEL/4-205------------------------------------SS.....KIYLSCFE-NF..........................
A5DJU1_PICGU/4-217------------------------------------TGKAVGYNLFLSEFN-DL..........................
PALI_DEBHA/4-238------------------------------------TGKGIGYNLHLSKYG-NY..........................
A6ZMC2_YEAS7/5-169------------------------------------TK.....YLSLSSFR-NH..........................
Q2H463_CHAGB/5-183------------------------------------G........SWLKES-TLASLGFAPRMA................
PALI_NEUCR/5-170------------------------------------S......SFEIKDVG-DL..........................
PALI_MAGO7/5-169------------------------------------IK.....AIPLGEYV-GV..........................
PALI_YARLI/7-167------------------------------------TK.....TISLGSYQ-DH..........................
Q0V6X2_PHANO/5-166------------------------------------IP.....AIPIATYR-GI..........................
A6R830_AJECN/6-168------------------------------------VK.....SIPIATVD-DI..........................
A2QF35_ASPNC/6-165------------------------------------VK.....SIALARHD-NI..........................
Q0CX64_ASPTN/6-167------------------------------------VK.....GIPLATFK-NV..........................
Q4WWY3_ASPFU/6-166------------------------------------IQ.....GIPLATFN-HV..........................
Q55HH6_CRYNB/6-242------------------------------------R......SIYMAEVN-VAAYGNGF....................
Q6BME8_DEBHA/24-312------------------------------------A......RINCARLD-VARGLYNSLRSSVSLSSSILGDSE....
Q59US7_CANAL/25-311------------------------------------A......RINCSHLD-VANGLYESLRNSVTQVFTPAIFNDQM..
Q7SG51_NEUCR/8-271------------------------------------F......DVNLSNFS-ISLADAGELLNLNESSILKAGAQQIFGR
Q2HFG4_CHAGB/9-276------------------------------------MFRVNVTDLSLSPAS-VSRILEGTGFNAPSFDDIDLPDVDLPDL
Q0TZ73_PHANO/4-276------------------------------------E......DYHLLTLN-TS.LLGETLLSESRPTDTSNP.......
Q6C1Y6_YARLI/7-199------------------------------------N......NFYWLEAE-TS.NIPGA....................
A6R6X6_AJECN/8-204------------------------------------N......RTWFLEAD-TS.NIPGA....................
A1CFA3_ASPCL/8-205------------------------------------N......RIYWLQAD-TS.NIPGA....................
A2QNP6_ASPNC/8-205------------------------------------N......EIFFLQVD-TS.NIPGA....................
Q0V6H1_PHANO/8-203------------------------------------N......KFYFLEAS-TN.GIPNA....................
A7EBS7_SCLS1/8-206------------------------------------D......KTHFLRAD-TS.SIAGA....................
Q2H574_CHAGB/3-201------------------------------------R......QTYFLRAD-TS.GIEGA....................
V5IRF3_NEUCR/8-206------------------------------------R......QTYFLRAD-TS.GISGA....................
A7TTI2_VANPO/7-207------------------------------------K......DFYWFDAN-TS.GIGGIA...................
SUR7_YEAST/9-206------------------------------------N......RFYWVQGN-TT.GIPNA....................
A7TH74_VANPO/9-205------------------------------------D......KFYWVEGN-TS.GIPNA....................
Q753Q0_ASHGO/8-202------------------------------------D......RLYWLRAQ-TD.GFNGA....................
Q6CXH5_KLULA/9-205------------------------------------N......EFYWLQAD-TS.NITGA....................
A5DC91_PICGU/5-198------------------------------------N......RFYWLKAD-TS.SISHA....................
Q6BLL9_DEBHA/5-198------------------------------------N......DFYWIKAD-TS.SISGA....................
SUR7_CANAL/5-199------------------------------------N......KFYWLEAD-TS.GIKNAP...................
A3LV33_PICST/5-198------------------------------------D......EFYWVSAD-TS.NISGAP...................
Q75E26_ASHGO/7-202------------------------------------K......NFYWLEAN-TS.NFNQA....................
A7TIB3_VANPO/11-209------------------------------------T......RFYWLEAD-TS.GFNSA....................
Q6FT41_CANGA/7-205------------------------------------K......NFYWFEAD-TS.GFNDA....................
Q6CJ71_KLULA/7-204------------------------------------D......KFYWFEAD-TS.GLPGA....................
E7KHH6_YEASA/7-206------------------------------------K......NFYWFQAS-TS.GFNSAP...................
FMP45_YEAST/7-205------------------------------------K......NFYWLQAD-TN.GFNSAP...................
A5DAF8_PICGU/6-205------------------------------------G......DFYWSEAE-TS.SISKAN...................
Q5AH49_CANAL/4-201------------------------------------G......KFYWSETD-TS.GLTGVP...................
A5E7B2_LODEL/4-201------------------------------------G......KFYWSETD-TS.GIQGAP...................
A7TGC8_VANPO/6-240------------------------------------N......KIYVAQLN-LRKIKQDTVFDKISQDIGTDIL......
Q6CWP2_KLULA/5-243------------------------------------N......QIYVAQID-IS.NISFS....................
E7Q7C4_YEASB/6-240------------------------------------N......KIYCAELD-LS..........................
Q6FPE4_CANGA/6-240------------------------------------N......QIFCAQLD-LS.NLDIA....................
A3LZK7_PICST/5-323------------------------------------T......NTYLVNVH-LTSLNTSALINMAASGANIQKRATSTIP
Q5ADV0_CANAL/6-394------------------------------------TDTYLI.NFHIDSLD-LTKLIDSSRITKRDGVGSKMVSINPRQG
Q6BMS1_DEBHA/5-319------------------------------------T......KIYLLDFH-LT.DLDVSQLIDFNGFSKRDTIHPDSKR
A5DG26_PICGU/5-318------------------------------------T......DIYLIDVH-LS.GLKLSKLFDVNNFKRELPPLVNEAL
A5E006_LODEL/6-375------------------------------------T......STYLINFH-LD.GLDLRQIISTSIGSGSRKIKRADTT
A5E421_LODEL/6-397------------------------------------T......STYLINFH-LD.GLDLRQIISTSVGSGSNKIKKRAQD
PUN1_SCHPO/12-275------------------------------------Q......NIYFIQLN-TTSIFSVANQTAVVNNTSNLLNELTGTL
Q2TX92_ASPOR/9-279------------------------------------SQRSVFDDSLAAVAE-TTSDVSSTLQDTSNTAQNEGNDAIDGV.
Q5BDP9_EMENI/26-276------------------------------------R......QTYFLKID-LSDIIPLS....................
A2QQ39_ASPNC/26-275------------------------------------R......QTYFLEIN-LANIIPLS....................
Q2UBQ3_ASPOR/26-275------------------------------------R......QTWFLKID-LSNIIPLS....................
Q0CQ07_ASPTN/27-276------------------------------------R......ETYFLKID-LSNIIPLS....................
A2R5N4_ASPNC/9-229------------------------------------E......RLNFFQLD-VQNSRNIS....................
Q2UF28_ASPOR/9-224------------------------------------E......NLYFLRFI-QA..........................
Q5B2L7_EMENI/9-256------------------------------------R......DLYFFRAD-LQDLNSSAPIQNS.......V.......
A1DME7_NEOFI/9-255------------------------------------N......DLYFFRAN-LQ.NLTTSSSVTSAVNSA..........
A2QPC4_ASPNC/9-256------------------------------------N......DLYFFRAN-LKNITSEASSTASTVSS...........
B8MW98_ASPFN/9-255------------------------------------N......DLYFFRAD-LQ.NMTTTATN.Q.....STI.......
Q0CRK6_ASPTN/9-256------------------------------------N......DLYFFRAN-LQ.NITSNSSSVT.....SEV.......
A6RDR9_AJECN/9-246------------------------------------N......DIYFVKAD-LK..........................
Q0V4X3_PHANO/9-258------------------------------------TSLGR..DLYFFKAD-TSAFQADSD...................

PF12351

C1G9K9_PARBD/59-248------------------------------------S..............-..--------------------------
Q75CU4_ASHGO/65-257------------------------------------PAAY.........PG-GP--------------------------
A3LV03_PICST/62-245------------------------------------.Q.............-.N--------------------------
A7EL23_SCLS1/52-241------------------------------------VEGNNGD...TFKNT-NG--------------------------
A7TJZ8_VANPO/66-260------------------------------------PSNFN........ST-SK--------------------------
B6HGM8_PENCW/52-252------------------------------------HT.............-.G--------------------------
B8MZW1_ASPFN/73-257------------------------------------GG.............-.A--------------------------
B8NY21_ASPFN/72-267------------------------------------DG.............-.A--------------------------
C0NA65_AJECG/81-270------------------------------------SG.............-.L--------------------------
C1GWT8_PARBA/74-258------------------------------------GG.............-.A--------------------------
C4JX23_UNCRE/51-235------------------------------------GG.............-.S--------------------------
C4QXD3_PICPG/65-260------------------------------------KLLQGNSTDEMKELG-SQ--------------------------
C4YC02_CLAL4/51-224------------------------------------.G.............-.S--------------------------
C5DEC8_LACTC/64-258------------------------------------PSTY.........SE-KS--------------------------
C5DPI4_ZYGRC/66-266------------------------------------PKDYD........KG-VK--------------------------
C5G079_ARTOC/74-258------------------------------------GG.............-.G--------------------------
C5M8V3_CANTT/127-303------------------------------------N..............-.D--------------------------
DNI1_SCHPO/33-201------------------------------------NA.............-.T--------------------------
Q0CSC3_ASPTN/220-409------------------------------------TGG............-DP--------------------------
Q0U808_PHANO/74-259------------------------------------GG.............-.G--------------------------
Q59WR6_CANAL/68-244------------------------------------SK.............-.D--------------------------
Q6BL79_DEBHA/62-241------------------------------------DK.............-.S--------------------------
Q6CH13_YARLI/62-243------------------------------------.N.............-.A--------------------------
Q6CW51_KLULA/66-265------------------------------------PSNYDRN....SSSK-SS--------------------------
Q6FQP2_CANGA/65-266------------------------------------PRVYN.......MDN-NS--------------------------
A7UX97_NEUCR/65-265------------------------------------.D.............-.T--------------------------
FIG1_YEAST/66-265------------------------------------PSQYSSYN..NMTTF-SN--------------------------

PF12534

V8P1J9_OPHHA/785-1120...............RVQPSPNISHLN.........MSDMDSSAAQFLPPK-PS--------------------------
M3ZMK4_XIPMA/1-325.............................KWI....VNETCKKN.......-..--------------------------
H2LAB2_ORYLA/1-327...............RTSPPN...............GSAVELKSLLLMQPN-TS--------------------------
F7HZE8_CALJA/1-331...............HEPQEN...............LSEAPCQQLLPRGVP-EQ--------------------------
I3KSZ5_ORENI/1-328...............RISLPPDN.............SSEVELKSPLHLQSN-TS--------------------------
W5KVQ3_ASTMX/1-344...............RISETS...............DENMDCNHLLQLREN-DS--------------------------
H3AVZ2_LATCH/1-372...............SNSPRKEGPEFTTSGNL....PSITSNTITTEKDLG-RT--------------------------
B1H2G3_XENTR/1-381SKFEETATEAKEKWQMTGATEPPETSPTKPSF....SPTNSGKSSGEQLNK-..--------------------------
E7FB32_DANRE/1-334...............RLTDPS...............GGHTDCSHVRQHRDN-QS--------------------------
G3NS96_GASAC/1-347.......................DPVTSANTS....NHGPSTSGP.ALTPS-SK--------------------------
G3TTR1_LOXAF/1-384DIPKIEAATDRDRDGQAANGISFGTSAVTPDIPLRATYPRTDPTVPSQEAR-..--------------------------
W5L768_ASTMX/1-377.....................................HSLSNNYSSGFRTP-SD--------------------------
W5LUY8_ASTMX/1-363TERPPETASGTGTGGNRVALTAAPTSKDQPET....DIPFPSPTAP.....-..--------------------------
H3AKF0_LATCH/1-388............................................PQDVSTQ-ER--------------------------
H3AX97_LATCH/1-334...............................E....QFGEGDDLAQRVSVA-AD--------------------------
I3JWS5_ORENI/1-362..........QQRPEDVTSSTRAPVGTIIPPI....TKDLTDEAVSKIYAL-RA--------------------------
H3AY71_LATCH/1-328...............HVSAKSLA.............EGTLNVSSNISSSSA-SQ--------------------------
V8PI59_OPHHA/1-329...............HVPSGTAFTDLTCEDFT....KKTINNSEPIKSSVH-Q.--------------------------
A2BIH6_DANRE/1-360...............QNRPECSLSVLGTGPST....TKDLPDSVANELLNT-QP--------------------------
G3Q7A0_GASAC/1-345...............PFTSKT...............PEAIDCSYIRTYRDN-ET--------------------------
H3ARV9_LATCH/48-378....................................KLTRDKNCTVAWDFG-DT--------------------------
H2MNR6_ORYLA/1-346.......................DPLSPPCMS....NHSMAQNSD..VKPS-PA--------------------------
D4A758_RAT/1-334....................................KVEFDNHCAVPWDLL-KA--------------------------
M4B034_XIPMA/1-370...TPEPSDGFWNKENAIGEQAAPLMSKRPPKGIVPSNPFPQSSAF.....-..--------------------------
H2S8U7_TAKRU/1-339...............HYTSPT...............PEAIDCSHIRHYGDN-RT--------------------------
R0K7Z6_ANAPL/1-340.............................KWV....TKDSCNDSVRGWTAA-AP--------------------------
H0Z736_TAEGU/1-380....VETTTGQEE..ASVRTVSFAPVTVTPDI....LQSRATSSQYQP..T-ES--------------------------
H2S199_TAKRU/1-376..........TEQTTQGSSGTSAPMFTSAPLV....TKDLPDSVVHEIHAT-QQ--------------------------
G3PSX6_GASAC/1-374..........TQQSLLKAATSAATVATFPPLV....TKDLPDNAVHEINVQ-QQ--------------------------
LRC8E_XENTR/1-341...............HTSADV...............VSQITCQEYDQQSPP-SN--------------------------
I3KNR5_ORENI/1-344...............HFTSPT...............PKAIDCSNISGYGDN-EK--------------------------
F6SMM9_XENTR/1-324........................................GIQNLHNSISS-SE--------------------------
H0Z746_TAEGU/1-332....................................KLEFDNHCAVPWDLV-KA--------------------------
F7CMN6_XENTR/1-328....................................KAEVDNQCVHPLEPV-LR--------------------------
M4A3B2_XIPMA/1-344.......................EP..PFNAS....DGVHPPVGSDAVLAS-SE--------------------------
G3X2F3_SARHA/1-331....................................KVELNDRCVVPLDMF-KL--------------------------
W5KZ87_ASTMX/1-332...............RTPL.................NQTVPLPNHTELTSS-SS--------------------------
E7FFH7_DANRE/1-330.....................................HSFPTNHTSTIDPI-PE--------------------------
M4AYR0_XIPMA/1-374..........STQKGSSATPTGAPVTPTIHSG....TTAQSNKAITGILTT-HR--------------------------
M3ZY99_XIPMA/1-333...............HIKN..................EAVDCNYIIDYSSN-NS--------------------------
H3AZN8_LATCH/1-348.......................DFPERGNSVPTAASTQNSESTPSHLDPT-AQ--------------------------
I3JMY0_ORENI/1-352.......................DSTT..NTT....DHSHSKSANVGLSPS-SQ--------------------------
B3DLX1_XENTR/1-330...............RLQAVYNSSDNNTFHSM....ANNLSASAPNPTASA-TA--------------------------
A7SYJ2_NEMVE/1-332...............VDCHPGMNEDIQIKNGS....CASYLHDYSNSSVIT-QS--------------------------
E7F333_DANRE/1-326....................................RTFSTNQTELMCPPP-SS--------------------------
W5LU14_ASTMX/1-373...............HGSMYTSTSSLGTAPLA....TQDLPDSVVHELHHT-EP--------------------------
W5MLZ0_LEPOC/1-351...............HLSAPS...............PEDINCDHITGNHVN-RS--------------------------
V8P1J9_OPHHA/1-333....................................KLEFDNHCAVPWHLI-KS--------------------------

PF00876

D6WYF3_TRICA/20-351-------------------------------------------NCK..VEE.NR--------------------------
B4M9Z6_DROVI/21-389-------------------------------------------LCL......SS--------------------------
B7PM37_IXOSC/22-351-------------------------------------------DCF....C.PT--------------------------
H2W3J0_CAEJA/23-398-------------------------------------------DCMLPKQHDEL--------------------------
G4VIL2_SCHMA/22-395-------------------------------------------SCYIPTTF.SG--------------------------
K1PTR0_CRAGI/36-398-------------------------------------------ECWCPAQF.T.--------------------------
T1J195_STRMM/20-353-------------------------------------------ECI..Q.P.DG--------------------------
T1FN93_HELRO/20-384-------------------------------------------TCWAPKHF.H.--------------------------
A0A068XA01_HYMMI/23-373-------------------------------------------QCWVPQEF.K.--------------------------
B4JXM9_DROGR/128-462-------------------------------------------DCV..H.T.KD--------------------------
Q16YE3_AEDAE/22-378-------------------------------------------RCITGGSI.PE--------------------------
J9EMK4_WUCBA/21-384-------------------------------------------ECMLPLGF.S.--------------------------
Q8JV09_CSIVT/20-354-------------------------------------------DCY....F.PD--------------------------
A8XEP7_CAEBR/22-362-------------------------------------------SCQLPKEW.P.--------------------------
H2VGJ4_CAEJA/19-337-------------------------------------------QCWAPRQF.K.--------------------------
K1RGD8_CRAGI/8-352-------------------------------------------ACNFPPEF.T.--------------------------
T1J195_STRMM/1266-1599-------------------------------------------ECT..H.S.KD--------------------------
B7P7W9_IXOSC/20-348-------------------------------------------DCI..S.K.DA--------------------------
A0A068XZR8_ECHMU/21-417-------------------------------------------SCNIPTLP.AD--------------------------
G0P5C9_CAEBE/23-398-------------------------------------------DCMLPKQHDDL--------------------------
G7YGP3_CLOSI/23-373-------------------------------------------HCWVPQEF.T.--------------------------
Q16QK9_AEDAE/26-359-------------------------------------------SCI..N.D.GA--------------------------
F1L798_ASCSU/18-385-------------------------------------------LCWTPVQF.R.--------------------------
T1KCG9_TETUR/13-350-------------------------------------------ECLN..AG.SP--------------------------
A0A068XBQ8_HYMMI/22-391-------------------------------------------SCYISTEV.GG--------------------------
E9HBX3_DAPPU/3-382-------------------------------------------ECFTPTYF.T.--------------------------
T1ELD9_HELRO/20-382-------------------------------------------QCWVPAHF.T.--------------------------
B4NCN0_DROWI/21-406-------------------------------------------LCI......SS--------------------------
A0A087W1T2_ECHMU/23-384-------------------------------------------SCFIATEV.GG--------------------------
B4R5W3_DROSI/22-374-------------------------------------------QCL......SD--------------------------
H3DSX6_PRIPA/33-350-------------------------------------------TCWTPAQF.Q.--------------------------
J9K934_ACYPI/20-353-------------------------------------------DCI..V...DD--------------------------
A0A068XY87_ECHMU/25-463-------------------------------------------SCWIPNDF.T.--------------------------
G6CUL7_DANPL/23-376-------------------------------------------KCISDQGV.PD--------------------------
B7PZQ6_IXOSC/22-356-------------------------------------------ECV..PPT.SD--------------------------
J9K6I2_ACYPI/23-369-------------------------------------------RCI......AT--------------------------
E3MG81_CAERE/18-377-------------------------------------------DCWFPAYY.K.--------------------------
B7QK18_IXOSC/21-355-------------------------------------------DCI..N.H.DS--------------------------
F1L5G5_ASCSU/25-358-------------------------------------------TCWTPAQF.T.--------------------------
T1KCG2_TETUR/41-381-------------------------------------------ECLN..AG.SP--------------------------
J9JUV0_ACYPI/22-352-------------------------------------------QCI..V.D.G.--------------------------
G0P1Q9_CAEBE/46-404-------------------------------------------ECWLPAEY.K.--------------------------
T1KEY2_TETUR/40-390-------------------------------------------TCSVE....EP--------------------------
T1ED09_HELRO/21-401-------------------------------------------YCFSPGEF.D.--------------------------
O61786_CAEEL/18-377-------------------------------------------SCWTPAEF.K.--------------------------
K1PIY5_CRAGI/20-383-------------------------------------------RCWCPAEF.P.--------------------------
T1FHL5_HELRO/20-384-------------------------------------------NCWCPAEF.T.--------------------------
T1JJS6_STRMM/20-348-------------------------------------------DCL..LSDKDA--------------------------
A8XEP6_CAEBR/20-382-------------------------------------------TCLVLPET.P.--------------------------
E1FZD3_LOALO/21-449-------------------------------------------RCLVDRQY.S.--------------------------
G7YU10_CLOSI/46-435-------------------------------------------SCTLPTAP.EN--------------------------
E3MU80_CAERE/20-379-------------------------------------------QCWVPAQF.T.--------------------------
A8XER5_CAEBR/20-386-------------------------------------------QCWVPAQF.T.--------------------------
Q6SA04_BOMMO/20-353-------------------------------------------DCI..V...DE--------------------------
Q7Q5R9_ANOGA/21-353-------------------------------------------DCVIGSGT.VS--------------------------
E1FJE3_LOALO/20-378-------------------------------------------ECLVPDIF.S.--------------------------
E3M7W5_CAERE/20-359-------------------------------------------ECWVPQTY.S.--------------------------
G4V7R0_SCHMA/22-401-------------------------------------------SCYIPVKP.AG--------------------------
E9HSG3_DAPPU/20-354-------------------------------------------QCI..N.D.ND--------------------------
W5J902_ANODA/22-378-------------------------------------------RCITGGSI.PE--------------------------
E0VDS2_PEDHC/20-352-------------------------------------------SCI..V.K.G.--------------------------
E2AUZ7_CAMFO/26-358-------------------------------------------NCI..S.E.LA--------------------------
J9K6R4_ACYPI/20-351-------------------------------------------DCI..V.D.RS--------------------------
J0XFG5_LOALO/19-380-------------------------------------------ECMFPSKF.P.--------------------------
Q8MXG8_CAEEL/25-374-------------------------------------------ECFVPAQF.T.--------------------------
E3LDS0_CAERE/21-371-------------------------------------------QCWMPMEF.K.--------------------------
INX8_CAEEL/20-359-------------------------------------------ECWLPQTY.S.--------------------------
G0M6M8_CAEBE/25-358-------------------------------------------KCWTPREF.S.--------------------------
G7YTE6_CLOSI/24-379-------------------------------------------HCWTPQEF.T.--------------------------
A8Y214_CAEBR/25-362-------------------------------------------TCWTPAQF.T.--------------------------
A8XEF9_CAEBR/18-379-------------------------------------------SCWTPAEF.K.--------------------------
A0A068Y5E6_ECHMU/23-391-------------------------------------------SCYTATTF.SG--------------------------
T1IXN4_STRMM/24-349-------------------------------------------SCG..PPP.PS--------------------------
E1JJF3_DROME/20-353-------------------------------------------DCI..V...DE--------------------------
K1QY06_CRAGI/32-418-------------------------------------------KCFCPNTF.T.--------------------------
A0A088AID2_APIME/26-358-------------------------------------------NCL..S.D.GG--------------------------
J9JSD1_ACYPI/20-354-------------------------------------------DCV..H.T.KD--------------------------
Q16FA3_AEDAE/20-353-------------------------------------------SCI..V.N.G.--------------------------
T1G942_HELRO/20-384-------------------------------------------HCWCPAFF.S.--------------------------
A0A068X0D8_HYMMI/25-462-------------------------------------------SCWIPNDF.T.--------------------------
Q7PXM2_ANOGA/20-353-------------------------------------------SCI..V.G.G.--------------------------
A8QBS0_BRUMA/4-385-------------------------------------------QCWVPAEF.Q.--------------------------
G7YNX9_CLOSI/22-427-------------------------------------------SCYIAVKP.TG--------------------------
G4V9H2_SCHMA/22-390-------------------------------------------SCYMATDL.GG--------------------------
D6X4I9_TRICA/22-374-------------------------------------------KCISDKGV.PE--------------------------
E0VDS1_PEDHC/24-362-------------------------------------------RCIH.....GD--------------------------
G0MH94_CAEBE/20-359-------------------------------------------DCWMPRTY.S.--------------------------
D6X4I8_TRICA/22-359-------------------------------------------KCINDM...PK--------------------------
T1ICS8_RHOPR/21-357-------------------------------------------NCI......SN--------------------------
E2BMI3_HARSA/21-353-------------------------------------------SCI..V.Q.G.--------------------------
E1ZXE9_CAMFO/20-352-------------------------------------------DCI..V...DE--------------------------
T1HVH6_RHOPR/40-373-------------------------------------------DCV..H.T.KD--------------------------
T1JXB6_TETUR/29-420-------------------------------------------ECFTPTYF.T.--------------------------
D6X4J0_TRICA/20-353-------------------------------------------DCI..V...DE--------------------------
U1NYM9_ASCSU/445-793-------------------------------------------QCWIPAQF.T.--------------------------
U1M0X1_ASCSU/20-367-------------------------------------------ECLVPDMF.S.--------------------------
F4W7D6_ACREC/26-357-------------------------------------------NCI..S.E.TS--------------------------
T1G4P9_HELRO/16-378-------------------------------------------HCWMPGHF.T.--------------------------
T1J6W8_STRMM/21-346-------------------------------------------SCG..PAP.PA--------------------------
C9IY29_CAEEL/84-449-------------------------------------------ECMFPNKF.P.--------------------------
K1PRS3_CRAGI/35-396-------------------------------------------HCWCPAEF.M.--------------------------
K7J6Q9_NASVI/27-365-------------------------------------------RCIADAGV.PG--------------------------
G7YWN9_CLOSI/22-427-------------------------------------------SCYIAIGP.SG--------------------------
E9HJ63_DAPPU/20-357-------------------------------------------DCIINAEK.SP--------------------------
E9HSG1_DAPPU/20-353-------------------------------------------DCI..V...EG--------------------------
A0A087W211_ECHMU/22-417-------------------------------------------ACYISTEV.GG--------------------------
U1M8T6_ASCSU/413-766-------------------------------------------QCWVPAEF.K.--------------------------
A0A068XT33_HYMMI/22-423-------------------------------------------SCYIPVSP.SG--------------------------
E5SKQ0_TRISP/420-774-------------------------------------------QCWVPAQF.T.--------------------------
A0A068X0V5_HYMMI/31-381-------------------------------------------QCWVPPEF.T.--------------------------
E1GFD2_LOALO/19-366-------------------------------------------QCWVPAQF.T.--------------------------
U1NSW4_ASCSU/21-445-------------------------------------------RCLIDQQY.A.--------------------------
T1FAN8_HELRO/34-392-------------------------------------------ECWCPAQF.T.--------------------------
E9G961_DAPPU/20-354-------------------------------------------DCI..H.T.KD--------------------------
A0NH37_ANOGA/20-352-------------------------------------------DCI..V...DE--------------------------
E5SB89_TRISP/314-669-------------------------------------------ECWVPAEF.K.--------------------------
E2BKJ4_HARSA/20-355-------------------------------------------SCM..T.D.GT--------------------------
Q6AHN7_CAEEL/20-380-------------------------------------------ECLVPDIF.S.--------------------------
INX19_CAEBR/21-398-------------------------------------------ECWVNPHS.R.--------------------------
B4M9W3_DROVI/22-375-------------------------------------------QCI......SD--------------------------
A8XEL3_CAEBR/23-389-------------------------------------------DCMLPKQHDEL--------------------------
U1NL47_ASCSU/159-526-------------------------------------------QCWVPAEFIP.--------------------------
A0A068X9B8_HYMMI/21-407-------------------------------------------SCDIQTLP...--------------------------
J9K206_ACYPI/24-352-------------------------------------------ECITNS.S.KK--------------------------
U1NF34_ASCSU/22-362-------------------------------------------QCITPSNF.P.--------------------------
J9EPQ3_WUCBA/20-374-------------------------------------------QCWVPAQF.T.--------------------------
J0M383_LOALO/18-371-------------------------------------------QCWLPAQLASQ--------------------------
E5SKQ0_TRISP/18-378-------------------------------------------QCWFPAYF.K.--------------------------
K1QFN4_CRAGI/25-386-------------------------------------------QCWCPAEF.T.--------------------------
A0A068XF99_HYMMI/23-391-------------------------------------------SCYTATTF.SG--------------------------
T1KQD2_TETUR/20-352-------------------------------------------DCI..S.R.DD--------------------------
G6D2Y2_DANPL/26-354-------------------------------------------SCI..S.D.GA--------------------------
H2WEX7_CAEJA/18-379-------------------------------------------SCWTPAEF.K.--------------------------
K1Q160_CRAGI/48-414-------------------------------------------DCWCPAEF.T.--------------------------
G0NI48_CAEBE/22-370-------------------------------------------DCIVPKYF...--------------------------
Q174Z8_AEDAE/21-354-------------------------------------------ECIS.....SA--------------------------
D6X4I6_TRICA/22-372-------------------------------------------KCVSDSVN.NK--------------------------
T1ITF1_STRMM/2-331-------------------------------------------ACM..H.D.DS--------------------------
T1HXJ9_RHOPR/21-354-------------------------------------------DCL..V...QG--------------------------
K7J6Q8_NASVI/20-354-------------------------------------------SCI..V.P.SA--------------------------
K1PJW3_CRAGI/57-423-------------------------------------------ECWCPADF.T.--------------------------
B7QN22_IXOSC/20-353-------------------------------------------DCI..S.K.DS--------------------------
T1L390_TETUR/20-355-------------------------------------------DCL..T.K.TE--------------------------
F1L4F5_ASCSU/21-387-------------------------------------------QCMLPAHL.DR--------------------------
T1J195_STRMM/918-1253-------------------------------------------DCV..LSDKDA--------------------------
J9FAW5_WUCBA/102-549-------------------------------------------RCLVDRQY.S.--------------------------
D6X0D3_TRICA/26-358-------------------------------------------QCI..N.D.RG--------------------------
U1MHH5_ASCSU/93-454-------------------------------------------ECMFPNKF.P.--------------------------
A0A068X744_HYMMI/28-419-------------------------------------------SCNLSHIP.SS--------------------------
H2W7D4_CAEJA/20-363-------------------------------------------ECWLPQTY.S.--------------------------
T1I6M9_RHOPR/26-360-------------------------------------------SCI..N.D.DG--------------------------
H2KP32_CLOSI/22-393-------------------------------------------VCYLPTTV.SG--------------------------
B7PZQ9_IXOSC/20-357-------------------------------------------DCS..K.S.AD--------------------------
A8PUQ6_BRUMA/208-570-------------------------------------------QCWVPATF.T.--------------------------
Q29DR1_DROPS/20-356-------------------------------------------QCM......RD--------------------------
T1EHZ6_HELRO/2-360-------------------------------------------YCWCPEIC.A.--------------------------
H2KV18_CLOSI/22-415-------------------------------------------ACHMPTAP.QG--------------------------
J9B6M7_WUCBA/21-372-------------------------------------------QCWVPMEF.K.--------------------------
T1KKV8_TETUR/27-356-------------------------------------------TCV..KSE.RF--------------------------
T1KKV7_TETUR/27-357-------------------------------------------MCL..TQA.KT--------------------------
B4R7B1_DROSI/20-385-------------------------------------------QCI......SE--------------------------
W5JJF8_ANODA/21-353-------------------------------------------DCVAGSGD.VA--------------------------
T1KDH8_TETUR/79-412-------------------------------------------DCI..K.D.EN--------------------------
E0V9G4_PEDHC/20-367-------------------------------------------NCI..L.D.SN--------------------------
T1G9C5_HELRO/20-382-------------------------------------------SCWCPPEF.K.--------------------------
A0A088A2D0_APIME/27-384-------------------------------------------RCIAGHGM.SD--------------------------
T1JY39_TETUR/20-359-------------------------------------------HCM..E.T.NN--------------------------
T1K2R1_TETUR/42-415-------------------------------------------ECLDIPSA.AQ--------------------------
H3FJV0_PRIPA/15-362-------------------------------------------ECWTPSEY.K.--------------------------
E1ZXF1_CAMFO/20-353-------------------------------------------SCI..T.Q.G.--------------------------
G0NJM8_CAEBE/20-352-------------------------------------------QCWTPNQF.N.--------------------------
Q9N3R4_CAEEL/22-389-------------------------------------------VCQVPKDW.P.--------------------------
G4V7R4_SCHMA/123-528-------------------------------------------SCYIPVKP.TG--------------------------
D6X4I5_TRICA/20-353-------------------------------------------QCI..V.D.G.--------------------------
A0A087W248_ECHMU/22-392-------------------------------------------SCYISTDV.GG--------------------------
Q29GY9_DROPS/22-375-------------------------------------------QCI......SD--------------------------
K1Q539_CRAGI/458-821-------------------------------------------SCWCPAQF.K.--------------------------
E5S9V0_TRISP/19-379-------------------------------------------QCWVPATF.T.--------------------------
O44887_CAEEL/17-366-------------------------------------------QCWIPAQF.T.--------------------------
Q7PKP9_ANOGA/22-378-------------------------------------------RCITGGSI.PE--------------------------
B7PLS3_IXOSC/49-405-------------------------------------------ECFTPTYF.T.--------------------------
U1LVB7_ASCSU/48-414-------------------------------------------QCWLPAELASQ--------------------------
F1L3K8_ASCSU/22-368-------------------------------------------QCWVPNEF.R.--------------------------
Q9N3R5_CAEEL/20-377-------------------------------------------TCLMLPET.P.--------------------------
E1ZXF0_CAMFO/28-380-------------------------------------------RCITDISI.PT--------------------------
F5HMP1_ANOGA/8-343-------------------------------------------DCV..H.T.RD--------------------------
INX17_CAEEL/19-357-------------------------------------------QCWAPKQF.K.--------------------------
E0VDS4_PEDHC/20-354-------------------------------------------DCI..H.T.KD--------------------------
E5SC05_TRISP/19-373-------------------------------------------HCWVPAQF.R.--------------------------
A8PTF8_BRUMA/22-367-------------------------------------------QCWVPMEF.R.--------------------------
J9JWH0_ACYPI/26-360-------------------------------------------ACI..T.D.GG--------------------------
A0A068YJC6_ECHMU/46-414-------------------------------------------VCYLPTTV.SG--------------------------
T1FMB3_HELRO/20-382-------------------------------------------QCWVPAEF.T.--------------------------
F1KWR8_ASCSU/21-373-------------------------------------------QCWMPMEF.K.--------------------------
E5SJ06_TRISP/21-380-------------------------------------------ECMVPEMF.S.--------------------------
E9H086_DAPPU/26-366-------------------------------------------DCI..T.D.DA--------------------------
H3EMZ6_PRIPA/18-385-------------------------------------------LCWTPAEF.K.--------------------------
H2KV19_CLOSI/22-392-------------------------------------------ACYIPTVP.SG--------------------------
T1EFQ7_HELRO/20-385-------------------------------------------TCWAPVHF.T.--------------------------
T1HJJ5_RHOPR/20-353-------------------------------------------QCI..V.D.G.--------------------------
T1G065_HELRO/20-402-------------------------------------------TCWCPANF.E.--------------------------
E3LLZ0_CAERE/22-389-------------------------------------------VCQVPKDW.P.--------------------------
A0A068YEL0_ECHMU/22-423-------------------------------------------SCYIPVQP.SG--------------------------
A0A068X4X8_HYMMI/22-417-------------------------------------------ACYISTEV.GG--------------------------
U1M8T6_ASCSU/18-361-------------------------------------------QCWVPAQF.K.--------------------------
K7J6Q6_NASVI/20-355-------------------------------------------DCI..H.S.KD--------------------------
B7PF54_IXOSC/22-357-------------------------------------------ECD..R.S.FG--------------------------
E9HJ62_DAPPU/20-357-------------------------------------------DCFINAEK.SP--------------------------
A0A068Y4Z1_ECHMU/24-412-------------------------------------------ACHVPTVP.SG--------------------------
B4I656_DROSE/21-389-------------------------------------------LCL......SS--------------------------
J9EZB8_WUCBA/21-364-------------------------------------------QCMAPTHF.P.--------------------------
E9H085_DAPPU/26-359-------------------------------------------DCIID....PG--------------------------
E0VNL8_PEDHC/26-361-------------------------------------------NCI..N.D.GA--------------------------
M9PGW0_DROME/20-353-------------------------------------------SCI..V.N.G.--------------------------
H2KP29_CLOSI/22-395-------------------------------------------SCYIPTSF.SG--------------------------
G4LX80_SCHMA/26-424-------------------------------------------ACWTPNEF.T.--------------------------
E1FV40_LOALO/19-382-------------------------------------------ECWVPAQF.T.--------------------------
T1EHZ5_HELRO/4-356-------------------------------------------DCWCPGNF.A.--------------------------
A8X0X1_CAEBR/20-359-------------------------------------------ECWVPQTY.S.--------------------------
H3FKT7_PRIPA/38-405-------------------------------------------ECWVNPHS.R.--------------------------
A0A068Y3L2_ECHMU/21-416-------------------------------------------SCTTPSAP.S.--------------------------
E9HSG2_DAPPU/24-357-------------------------------------------QCI..QDA.VA--------------------------
K1PRW3_CRAGI/26-393-------------------------------------------HCFCPTEF.T.--------------------------
A0A068YAQ8_ECHMU/95-570-------------------------------------------QCWIPQEF.T.--------------------------
K1P371_CRAGI/31-392-------------------------------------------ECWVPAEF.T.--------------------------
G4VSX3_SCHMA/25-419-------------------------------------------ACTLPTSP.DN--------------------------
T1G1G0_HELRO/20-382-------------------------------------------QCWVPAEF.T.--------------------------
T1F3K5_HELRO/20-382-------------------------------------------NCWCPAEF.K.--------------------------
A0A068Y4N3_ECHMU/22-392-------------------------------------------ACYIPTVP.SG--------------------------
T1EE00_HELRO/20-448-------------------------------------------TCMIPSSL...--------------------------
T1G9L4_HELRO/20-374-------------------------------------------SCWCPNYF.T.--------------------------
K1Q8H1_CRAGI/20-381-------------------------------------------VCWNPAEF.K.--------------------------
T1JVL3_TETUR/20-350-------------------------------------------ECL..T.D.ES--------------------------
T1FF42_HELRO/20-382-------------------------------------------SCWCPTEF.T.--------------------------
F4WK99_ACREC/29-382-------------------------------------------RCIADSGV.SS--------------------------
B4JMT0_DROGR/22-375-------------------------------------------QCI......SD--------------------------
D6X4I2_TRICA/20-352-------------------------------------------DCI..H.T.KD--------------------------
U1MEL2_ASCSU/21-373-------------------------------------------ECWVNPHS.R.--------------------------
T1KQA9_TETUR/21-353-------------------------------------------DCI..Q.R.DD--------------------------
B4JN21_DROGR/20-380-------------------------------------------QCI......SE--------------------------
A8PZ15_BRUMA/19-373-------------------------------------------QCWVPATF.T.--------------------------
G7YJJ0_CLOSI/22-391-------------------------------------------SCYMATDI.GG--------------------------
T1KKN2_TETUR/42-372-------------------------------------------ECMN..GG.RS--------------------------
E5SRT1_TRISP/18-357-------------------------------------------KCWSPHHF.V.--------------------------
B4NKS4_DROWI/26-356-------------------------------------------SCI..N.D.GS--------------------------
A8X921_CAEBR/20-406-------------------------------------------ECMVPLDF.T.--------------------------
Q29GC9_DROPS/20-393-------------------------------------------QCL......SE--------------------------
B7QK16_IXOSC/22-357-------------------------------------------YCI..T.H.DA--------------------------
Q29GW8_DROPS/21-382-------------------------------------------LCI......ST--------------------------
G0NJM8_CAEBE/372-710-------------------------------------------QCWMPKQF.K.--------------------------

PF00029

H3AWH1_LATCH/3-247---------------------------------------------Y....S-----------------------------
H2SPA6_TAKRU/4-236---------------------------------------------W....D-----------------------------
F7EJU4_XENTR/1-220---------------------------------------------Y....G-----------------------------
I3KXW0_ORENI/2-217---------------------------------------------W....G-----------------------------
A7VKB2_DANRE/3-235---------------------------------------------Y....T-----------------------------
F6QD10_XENTR/3-234---------------------------------------------W....G-----------------------------
W5LSW7_ASTMX/5-245---------------------------------------------W....D-----------------------------
I3KZJ5_ORENI/3-218---------------------------------------------W....G-----------------------------
H2U506_TAKRU/3-235---------------------------------------------W....G-----------------------------
H0YRM3_TAEGU/4-209---------------------------------------------Y....Q-----------------------------
I3KDI4_ORENI/5-225---------------------------------------------W....L-----------------------------
W5NMQ0_LEPOC/2-215---------------------------------------------W....G-----------------------------
M4AZZ1_XIPMA/2-209---------------------------------------------W....G-----------------------------
M3WS82_FELCA/3-231---------------------------------------------W....D-----------------------------
E7FEN2_DANRE/3-235---------------------------------------------W....V-----------------------------
H0XEF8_OTOGA/3-277---------------------------------------------Y....D-----------------------------
F7AWX4_CIOIN/3-233---------------------------------------------W....S-----------------------------
I3J6V1_ORENI/7-223---------------------------------------------Y....Q-----------------------------
W5NNA4_LEPOC/2-203---------------------------------------------W....K-----------------------------
H3CIE9_TETNG/2-271---------------------------------------------Y....Y-----------------------------
Q1LWG0_DANRE/5-240---------------------------------------------W....D-----------------------------
W5LK97_ASTMX/3-236---------------------------------------------Y....A-----------------------------
W5LT82_ASTMX/3-260---------------------------------------------Y....S-----------------------------
Q6NYU5_DANRE/3-235---------------------------------------------W....N-----------------------------
G3PF51_GASAC/2-203---------------------------------------------W....K-----------------------------
H3AVR6_LATCH/2-252---------------------------------------------Y....Y-----------------------------
I3KPL9_ORENI/3-219---------------------------------------------W....G-----------------------------
I3KDJ0_ORENI/24-241---------------------------------------------W....S-----------------------------
H2YD27_CIOSA/3-225---------------------------------------------W....S-----------------------------
W5LS74_ASTMX/3-226---------------------------------------------W....G-----------------------------
I3JLG4_ORENI/2-209---------------------------------------------W....S-----------------------------
G1LUU1_AILME/1-212---------------------------------------------W....N-----------------------------
W5NL33_LEPOC/3-225---------------------------------------------W....G-----------------------------
W5K246_ASTMX/3-256---------------------------------------------Y....E-----------------------------
E4XFG0_OIKDI/3-274---------------------------------------------Y....H-----------------------------
I3KZG9_ORENI/3-222---------------------------------------------W....A-----------------------------
G1TBS7_RABIT/4-233---------------------------------------------W....E-----------------------------
H2U507_TAKRU/2-210---------------------------------------------W....G-----------------------------
Q28ED4_XENTR/2-214---------------------------------------------W....G-----------------------------
H2LYS6_ORYLA/3-266---------------------------------------------Y....E-----------------------------
H3AJ15_LATCH/3-212---------------------------------------------F....E-----------------------------
F7ETX8_ORNAN/2-215---------------------------------------------W....G-----------------------------
H2ZVD7_LATCH/5-257---------------------------------------------Y....A-----------------------------
H2S6C1_TAKRU/3-218---------------------------------------------W....G-----------------------------
H3ALN1_LATCH/3-235---------------------------------------------W....N-----------------------------
CX32_DANRE/3-215---------------------------------------------W....G-----------------------------
I3J613_ORENI/3-235---------------------------------------------Y....T-----------------------------
U3KL92_FICAL/2-214---------------------------------------------W....G-----------------------------
G3NQK0_GASAC/2-213---------------------------------------------W....G-----------------------------
H3C889_TETNG/2-252---------------------------------------------Y....Y-----------------------------
M4AHN8_XIPMA/3-229---------------------------------------------W....P-----------------------------
I3IYX3_ORENI/3-244---------------------------------------------W....G-----------------------------
M3XKA4_LATCH/4-217---------------------------------------------W....G-----------------------------
H2T4Y3_TAKRU/239-451---------------------------------------------W....G-----------------------------
H3C2U7_TETNG/2-212---------------------------------------------W....G-----------------------------
R0L8V9_ANAPL/2-256---------------------------------------------Y....Y-----------------------------
V8NXQ1_OPHHA/3-236---------------------------------------------W....G-----------------------------
F7A3G7_MONDO/2-215---------------------------------------------Y....R-----------------------------
H2TXC6_TAKRU/12-223---------------------------------------------Y....Q-----------------------------
F7EJS7_MONDO/2-210---------------------------------------------W....S-----------------------------
H2T4Y3_TAKRU/2-222---------------------------------------------W....G-----------------------------
I3KZV2_ORENI/5-248---------------------------------------------W....D-----------------------------
W5LRY9_ASTMX/2-208---------------------------------------------W....G-----------------------------
B3DID2_DANRE/3-226---------------------------------------------W....G-----------------------------
W5LRJ3_ASTMX/2-218---------------------------------------------W....G-----------------------------
H3DPE1_TETNG/2-203---------------------------------------------W....K-----------------------------
G1P848_MYOLU/5-284---------------------------------------------Y....S-----------------------------
H0VZC3_CAVPO/5-270---------------------------------------------Y....S-----------------------------
H2QV11_PANTR/5-214---------------------------------------------Y....G-----------------------------
H9GHG0_ANOCA/3-256---------------------------------------------Y....E-----------------------------
V8NGI0_OPHHA/2-210---------------------------------------------W....G-----------------------------
F6Z9W1_HORSE/5-215---------------------------------------------Y....G-----------------------------
L5MG71_MYODS/92-305---------------------------------------------Y....Q-----------------------------
L5JSY3_PTEAL/60-308---------------------------------------------Y....G-----------------------------
R0LQP0_ANAPL/3-236---------------------------------------------W....G-----------------------------
F6XTB3_MONDO/3-229---------------------------------------------Y....G-----------------------------
W5LSK7_ASTMX/12-228---------------------------------------------F....S-----------------------------
H2ML18_ORYLA/1-218---------------------------------------------W....G-----------------------------
F6S9P0_CIOIN/2-251---------------------------------------------Y....N-----------------------------
H2SUJ4_TAKRU/2-210---------------------------------------------W....G-----------------------------
F7BMQ9_MONDO/3-212---------------------------------------------F....E-----------------------------
V8P2C7_OPHHA/3-221---------------------------------------------F....D-----------------------------
L9JDB3_TUPCH/201-431---------------------------------------------W....G-----------------------------
W5L1W8_ASTMX/2-257---------------------------------------------Y....H-----------------------------
Q8JFD6_DANRE/3-260---------------------------------------------Y....D-----------------------------
G3GSS7_CRIGR/3-235---------------------------------------------W....D-----------------------------
H2ZYS4_LATCH/3-236---------------------------------------------W....G-----------------------------
CXG1_PIG/2-255---------------------------------------------Y....Y-----------------------------
G1PYG2_MYOLU/3-223---------------------------------------------W....G-----------------------------
Q6NVT8_XENTR/2-214---------------------------------------------W....G-----------------------------
W5NP42_LEPOC/3-225---------------------------------------------W....G-----------------------------
G3TTM6_LOXAF/5-249---------------------------------------------Y....S-----------------------------
H3B5X0_LATCH/2-253---------------------------------------------Y....Y-----------------------------
I3N3J2_SPETR/5-215---------------------------------------------Y....G-----------------------------
G3QAJ1_GASAC/3-273---------------------------------------------S....P-----------------------------
W5NMN4_LEPOC/3-227---------------------------------------------W....G-----------------------------
F6VRX7_CIOIN/3-218---------------------------------------------F....G-----------------------------
W5NQJ6_SHEEP/2-210---------------------------------------------W....D-----------------------------
X1WDX8_DANRE/3-220---------------------------------------------W....G-----------------------------
F7E5W8_XENTR/2-210---------------------------------------------W....G-----------------------------
G1NQF9_MELGA/2-215---------------------------------------------W....G-----------------------------
I3KVE7_ORENI/1-203---------------------------------------------F....E-----------------------------
E4X0Y2_OIKDI/2-275---------------------------------------------Y....A-----------------------------
G1KPR6_ANOCA/2-243---------------------------------------------Y....Y-----------------------------
H0YV03_TAEGU/2-256---------------------------------------------Y....Y-----------------------------
H3C492_TETNG/2-256---------------------------------------------Y....Y-----------------------------
F1STM7_PIG/2-210---------------------------------------------W....S-----------------------------
F6QCF2_XENTR/3-233---------------------------------------------W....G-----------------------------
I3MGG4_SPETR/8-224---------------------------------------------Y....Q-----------------------------
W5LSW6_ASTMX/2-208---------------------------------------------W....G-----------------------------
Q5TYN9_DANRE/3-219---------------------------------------------W....S-----------------------------
U3JNY0_FICAL/2-256---------------------------------------------Y....Y-----------------------------
F1QYI2_DANRE/2-260---------------------------------------------Y....Q-----------------------------
CXG3_MOUSE/16-226---------------------------------------------F....G-----------------------------
CXA6_RAT/3-234---------------------------------------------W....S-----------------------------
H2Y3H1_CIOIN/3-269---------------------------------------------Y....H-----------------------------
G7NUB7_MACFA/3-235---------------------------------------------W....N-----------------------------
R0LA62_ANAPL/1-208---------------------------------------------W....S-----------------------------
E1BQP7_CHICK/5-259---------------------------------------------Y....S-----------------------------
W5LTI3_ASTMX/3-258---------------------------------------------Y....S-----------------------------
F6WJC3_XENTR/17-225---------------------------------------------W....G-----------------------------
I3JAN6_ORENI/2-208---------------------------------------------W....A-----------------------------
H0VLP6_CAVPO/5-215---------------------------------------------Y....S-----------------------------
F7BI06_MONDO/3-235---------------------------------------------W....G-----------------------------
CXA4_XENTR/3-232---------------------------------------------W....G-----------------------------
H2S6B7_TAKRU/5-280---------------------------------------------W....G-----------------------------
H3ASF8_LATCH/3-233---------------------------------------------W....G-----------------------------
I3KHF0_ORENI/2-267---------------------------------------------Y....Y-----------------------------
F6VXA2_MONDO/2-249---------------------------------------------Y....S-----------------------------
W5JZ19_ASTMX/2-270---------------------------------------------Y....Y-----------------------------
H2LHM2_ORYLA/1-203---------------------------------------------F....S-----------------------------
H2T1Y9_TAKRU/3-225---------------------------------------------W....G-----------------------------
I3KF01_ORENI/2-208---------------------------------------------W....A-----------------------------
G1N2B3_MELGA/4-211---------------------------------------------Y....Q-----------------------------
E7FBZ4_DANRE/3-233---------------------------------------------W....G-----------------------------
H2LI61_ORYLA/2-265---------------------------------------------Y....Y-----------------------------
W5KYU2_ASTMX/9-217---------------------------------------------F....W-----------------------------
E4WSZ4_OIKDI/3-276---------------------------------------------W....S-----------------------------
W5LUZ9_ASTMX/2-214---------------------------------------------W....G-----------------------------
H2YWV0_CIOSA/3-255---------------------------------------------Y....S-----------------------------
G1U794_RABIT/5-221---------------------------------------------Y....S-----------------------------
H2ZV48_LATCH/2-203---------------------------------------------W....K-----------------------------
H3API8_LATCH/2-210---------------------------------------------W....G-----------------------------
H2XJX2_CIOIN/3-260---------------------------------------------Y....S-----------------------------
CXG1_DANRE/2-250---------------------------------------------Y....Y-----------------------------
G1QTG3_NOMLE/2-211---------------------------------------------W....G-----------------------------
H3AJZ7_LATCH/3-233---------------------------------------------W....G-----------------------------
H0XZ54_OTOGA/6-222---------------------------------------------Y....Q-----------------------------
Q8K4M6_CAVPO/2-215---------------------------------------------W....G-----------------------------
E4XZI0_OIKDI/4-257---------------------------------------------Y....G-----------------------------
H2MKZ2_ORYLA/3-221---------------------------------------------W....K-----------------------------
Q66HV7_DANRE/2-254---------------------------------------------Y....S-----------------------------
W5LS82_ASTMX/3-218---------------------------------------------W....G-----------------------------
M3ZFG9_XIPMA/3-244---------------------------------------------H....V-----------------------------
I3JAN5_ORENI/5-241---------------------------------------------W....S-----------------------------
G5BBL6_HETGA/3-231---------------------------------------------W....G-----------------------------
F1QL21_DANRE/3-226---------------------------------------------W....G-----------------------------
H2MKZ7_ORYLA/3-216---------------------------------------------W....D-----------------------------
E4XEP0_OIKDI/2-239---------------------------------------------Y....S-----------------------------
CXG1_XENTR/2-253---------------------------------------------Y....Y-----------------------------
F6WE26_XENTR/2-255---------------------------------------------Y....Y-----------------------------
G1PZ72_MYOLU/3-220---------------------------------------------W....G-----------------------------
G1U6K9_RABIT/5-215---------------------------------------------F....S-----------------------------
M4A0T3_XIPMA/2-208---------------------------------------------W....G-----------------------------
L9KPJ4_TUPCH/4-215---------------------------------------------Y....S-----------------------------
Q4S8R0_TETNG/3-228---------------------------------------------W....G-----------------------------
G1K926_ANOCA/4-219---------------------------------------------Y....Q-----------------------------
I3JSR3_ORENI/2-262---------------------------------------------Y....S-----------------------------
G3PMN6_GASAC/2-239---------------------------------------------S....G-----------------------------
H0W6E8_CAVPO/2-210---------------------------------------------W....N-----------------------------
W5NNM0_LEPOC/5-260---------------------------------------------Y....S-----------------------------
W5MSD7_LEPOC/2-251---------------------------------------------Y....Y-----------------------------
F1QZN0_DANRE/2-206---------------------------------------------W....G-----------------------------
I3NGZ1_SPETR/3-214---------------------------------------------F....E-----------------------------
G3PLV3_GASAC/3-238---------------------------------------------W....G-----------------------------
CXG3_BOVIN/5-216---------------------------------------------FGG..G-----------------------------
Q7T2D7_DANRE/3-219---------------------------------------------W....G-----------------------------
I3KYC0_ORENI/3-221---------------------------------------------W....G-----------------------------
H2LLM1_ORYLA/2-208---------------------------------------------W....G-----------------------------
H2SP60_TAKRU/3-224---------------------------------------------W....G-----------------------------
H2XQL4_CIOIN/3-214---------------------------------------------W....T-----------------------------
W5LSW9_ASTMX/2-210---------------------------------------------W....G-----------------------------
E4XWI7_OIKDI/6-263---------------------------------------------Y....G-----------------------------
F7CJM7_CALJA/5-246---------------------------------------------Y....S-----------------------------
H3DP97_TETNG/3-227---------------------------------------------W....G-----------------------------
W5M0U8_LEPOC/14-229---------------------------------------------W....D-----------------------------
W5LWP5_LEPOC/4-229---------------------------------------------Y....Q-----------------------------
F6UBJ9_CIOIN/3-265---------------------------------------------Y....S-----------------------------
W5LTB5_ASTMX/3-205---------------------------------------------F....E-----------------------------
Q6DEG1_DANRE/2-207---------------------------------------------W....N-----------------------------
H2Y5A4_CIOSA/4-260---------------------------------------------Y....H-----------------------------
H2SK18_TAKRU/3-261---------------------------------------------Y....E-----------------------------
V8N9D2_OPHHA/2-209---------------------------------------------W....G-----------------------------
M3Y3X1_MUSPF/6-223---------------------------------------------Y....Q-----------------------------
Q4T8N8_TETNG/3-290---------------------------------------------Y....T-----------------------------
I3KVE6_ORENI/3-253---------------------------------------------F....E-----------------------------
W5NLN3_LEPOC/3-255---------------------------------------------Y....S-----------------------------
L9JE20_TUPCH/2-210---------------------------------------------W....S-----------------------------
E4XXY1_OIKDI/3-267---------------------------------------------Y....G-----------------------------
H2Y0D6_CIOIN/3-273---------------------------------------------Y....S-----------------------------
E4XG44_OIKDI/4-279---------------------------------------------F....K-----------------------------
F7G2Z1_MACMU/11-217---------------------------------------------Y....Q-----------------------------
W5NP15_LEPOC/2-209---------------------------------------------W....G-----------------------------
F7BU85_ORNAN/4-210---------------------------------------------Y....Q-----------------------------
F6W3E8_XENTR/2-203---------------------------------------------W....K-----------------------------
V8NGI0_OPHHA/252-482---------------------------------------------W....G-----------------------------
H3AFY3_LATCH/2-215---------------------------------------------W....G-----------------------------
H2UYD2_TAKRU/3-199---------------------------------------------F....E-----------------------------
G1KPT6_ANOCA/3-235---------------------------------------------W....D-----------------------------
F6XX97_XENTR/3-216---------------------------------------------F....E-----------------------------
G1KFU5_ANOCA/5-260---------------------------------------------Y....S-----------------------------
W5LSX0_ASTMX/2-208---------------------------------------------W....N-----------------------------
F6TGH3_ORNAN/2-210---------------------------------------------W....D-----------------------------
W5NLV6_LEPOC/2-261---------------------------------------------Y....Y-----------------------------
H0Z9S4_TAEGU/3-225---------------------------------------------W....G-----------------------------
Q5SNV2_DANRE/2-203---------------------------------------------W....K-----------------------------
H2UN58_TAKRU/33-250---------------------------------------------W....D-----------------------------
G7P3J8_MACFA/2-203---------------------------------------------W....K-----------------------------
I3K6P7_ORENI/5-256---------------------------------------------Y....Y-----------------------------
E4WRX0_OIKDI/2-266---------------------------------------------Y....A-----------------------------
I3KZU8_ORENI/2-252---------------------------------------------Y....Y-----------------------------
H3AFA2_LATCH/3-235---------------------------------------------W....G-----------------------------
U3KK04_FICAL/2-203---------------------------------------------W....K-----------------------------
Q0V9Q2_XENTR/5-255---------------------------------------------Y....S-----------------------------
W5LS83_ASTMX/3-220---------------------------------------------W....G-----------------------------
W5LKY1_ASTMX/5-260---------------------------------------------Y....S-----------------------------
I3KPM0_ORENI/3-228---------------------------------------------W....G-----------------------------
F6S9Q0_CIOIN/2-246---------------------------------------------Y....N-----------------------------
W5NN38_LEPOC/3-253---------------------------------------------Y....T-----------------------------
W5LS84_ASTMX/3-216---------------------------------------------W....G-----------------------------
H2LA31_ORYLA/2-253---------------------------------------------Y....Y-----------------------------
H2TW08_TAKRU/3-235---------------------------------------------Y....S-----------------------------
E4WYD1_OIKDI/11-261---------------------------------------------FKSNID-----------------------------
H3C8N2_TETNG/1-214---------------------------------------------W....G-----------------------------
F7CCT5_MONDO/4-220---------------------------------------------Y....Q-----------------------------
H0WMY4_OTOGA/4-216---------------------------------------------W....G-----------------------------
H2Y5A2_CIOSA/4-264---------------------------------------------Y....H-----------------------------

PF00822

CLD7_HUMAN/4-182--------------------------------------------------------------------------------
CCG2_MOUSE/6-197--------------------------------------------------------------------------------
EMP3_HUMAN/1-156--------------------------------------------------------------------------------
EMP1_MOUSE/1-154--------------------------------------------------------------------------------
CLD1_MOUSE/4-182--------------------------------------------------------------------------------
CLD10_HUMAN/4-179--------------------------------------------------------------------------------
PMP22_HUMAN/1-153--------------------------------------------------------------------------------
EMP1_RABIT/1-154--------------------------------------------------------------------------------
LMIP_BOVIN/1-157--------------------------------------------------------------------------------
EMP2_MOUSE/1-165--------------------------------------------------------------------------------
CLD7B_DANRE/4-182--------------------------------------------------------------------------------
EMP1_HUMAN/1-151--------------------------------------------------------------------------------
EMP2_HUMAN/1-160--------------------------------------------------------------------------------

PF13903

TM235_HUMAN/16-197--------------------------------------------------------------------------------
TM235_MOUSE/16-192--------------------------------------------------------------------------------
B4Q2K5_DROYA/16-232--------------------------------------------------------------------------------
TM182_XENTR/15-225--------------------------------------------------------------------------------
A0A023EMM6_AEDAL/16-235--------------------------------------------------------------------------------
TM182_MOUSE/15-220--------------------------------------------------------------------------------
D2HQ99_AILME/17-198--------------------------------------------------------------------------------
B4NZC2_DROYA/16-190--------------------------------------------------------------------------------
Q1L8R4_DANRE/69-258--------------------------------------------------------------------------------
B0WVP8_CULQU/16-190--------------------------------------------------------------------------------
B4KVB2_DROMO/40-219--------------------------------------------------------------------------------
Q17AR2_AEDAE/35-214--------------------------------------------------------------------------------
Q6E5P4_TAKRU/18-198--------------------------------------------------------------------------------
B7QNM3_IXOSC/25-197--------------------------------------------------------------------------------

PF07062

O45670_CAEEL/8-219--------------------------------------------------------------------------------
A8XPM2_CAEBR/9-213--------------------------------------------------------------------------------
A8XPM1_CAEBR/5-202--------------------------------------------------------------------------------
A8XPW0_CAEBR/10-221--------------------------------------------------------------------------------
Q18135_CAEEL/11-221--------------------------------------------------------------------------------

PF10242

Q7PMA1_ANOGA/11-202--------------------------------------------------------------------------------
LHPL4_RAT/22-200--------------------------------------------------------------------------------
TMHS_RAT/25-202--------------------------------------------------------------------------------
TMHS_CHICK/25-202--------------------------------------------------------------------------------
Q178A0_AEDAE/25-199--------------------------------------------------------------------------------
Q2M056_DROPS/25-199--------------------------------------------------------------------------------
Q9XVU1_CAEEL/19-183--------------------------------------------------------------------------------
LHPL2_HUMAN/9-204--------------------------------------------------------------------------------
Q4S279_TETNG/9-201--------------------------------------------------------------------------------
Q568B9_DANRE/9-197--------------------------------------------------------------------------------
Q4RUW4_TETNG/9-195--------------------------------------------------------------------------------
Q9W0X9_DROME/9-195--------------------------------------------------------------------------------
Q292M2_DROPS/9-197--------------------------------------------------------------------------------
LHFP_MOUSE/8-193--------------------------------------------------------------------------------
LHPL1_RAT/8-192--------------------------------------------------------------------------------
B1H157_XENTR/22-199--------------------------------------------------------------------------------
H2SCC7_TAKRU/19-197--------------------------------------------------------------------------------
H3CMV1_TETNG/22-199--------------------------------------------------------------------------------

PF06653

Q8ITZ9_CAEEL/47-208--------------------------------------------------------------------------------
Q9TZ35_CAEEL/1-155--------------------------------------------------------------------------------
A8WY95_CAEBR/1-161--------------------------------------------------------------------------------
A8XQE4_CAEBR/1-163--------------------------------------------------------------------------------
A8WYV7_CAEBR/1-134--------------------------------------------------------------------------------
A8WK96_CAEBR/1-140--------------------------------------------------------------------------------
A8XRC8_CAEBR/1-182--------------------------------------------------------------------------------
A8XQE5_CAEBR/1-150--------------------------------------------------------------------------------
Q9XUZ7_CAEEL/1-168--------------------------------------------------------------------------------
Q2WF57_CAEEL/1-166--------------------------------------------------------------------------------
O45515_CAEEL/1-161--------------------------------------------------------------------------------
A8XR11_CAEBR/1-188--------------------------------------------------------------------------------
B6IEW4_CAEBR/1-156--------------------------------------------------------------------------------
Q95YB5_CAEEL/1-123--------------------------------------------------------------------------------
A8WK67_CAEBR/1-167--------------------------------------------------------------------------------
Q95XC2_CAEEL/1-191--------------------------------------------------------------------------------
B6IFT2_CAEBR/1-179--------------------------------------------------------------------------------
A8XQE6_CAEBR/1-167--------------------------------------------------------------------------------
B6IEW3_CAEBR/1-114--------------------------------------------------------------------------------
A8XWG5_CAEBR/1-169--------------------------------------------------------------------------------
O45334_CAEEL/1-161--------------------------------------------------------------------------------
A8WY98_CAEBR/1-166--------------------------------------------------------------------------------
B6IKT5_CAEBR/1-215--------------------------------------------------------------------------------
B6IKT4_CAEBR/1-120--------------------------------------------------------------------------------

PF07344

A4I9X4_LEIIN/377-531--------------------------------------------------------------------------------
A4HBJ2_LEIBR/15-170--------------------------------------------------------------------------------
A4H6C8_LEIBR/15-170--------------------------------------------------------------------------------
Q4Q3F7_LEIMA/15-171--------------------------------------------------------------------------------
A4H5H1_LEIBR/15-170--------------------------------------------------------------------------------
A4HBJ0_LEIBR/15-171--------------------------------------------------------------------------------
A4HB47_LEIBR/18-199--------------------------------------------------------------------------------
A4I9X2_LEIIN/15-169--------------------------------------------------------------------------------
Q4Q339_LEIMA/15-170--------------------------------------------------------------------------------
Q4E0S1_TRYCC/20-182--------------------------------------------------------------------------------
Q4Q3A7_LEIMA/14-189--------------------------------------------------------------------------------
A4HAZ8_LEIBR/15-170--------------------------------------------------------------------------------
Q4QIA0_LEIMA/15-170--------------------------------------------------------------------------------
Q4Q8C7_LEIMA/145-338--------------------------------------------------------------------------------
Q585K0_TRYB2/9-167--------------------------------------------------------------------------------
A4H5D1_LEIBR/15-173--------------------------------------------------------------------------------
A4HB02_LEIBR/15-170--------------------------------------------------------------------------------
A4H5G6_LEIBR/15-171--------------------------------------------------------------------------------
A4I9W9_LEIIN/15-171--------------------------------------------------------------------------------
A4HDL4_LEIBR/18-168--------------------------------------------------------------------------------
Q4QHJ3_LEIMA/241-414--------------------------------------------------------------------------------
A4HAJ6_LEIBR/28-184--------------------------------------------------------------------------------
E9AG83_LEIIN/15-171--------------------------------------------------------------------------------
A4H7D7_LEIBR/15-172--------------------------------------------------------------------------------
A4I4J2_LEIIN/15-171--------------------------------------------------------------------------------
Q4QAK7_LEIMA/19-166--------------------------------------------------------------------------------
Q4QI88_LEIMA/15-171--------------------------------------------------------------------------------
A4HBJ1_LEIBR/15-170--------------------------------------------------------------------------------
A4HGJ1_LEIBR/143-338--------------------------------------------------------------------------------
Q4Q3A8_LEIMA/18-199--------------------------------------------------------------------------------
A4HI41_LEIBR/20-195--------------------------------------------------------------------------------
A4HDI3_LEIBR/87-236--------------------------------------------------------------------------------
A4I4J3_LEIIN/81-236--------------------------------------------------------------------------------
E9AHT2_LEIIN/15-171--------------------------------------------------------------------------------
Q4Q327_LEIMA/15-169--------------------------------------------------------------------------------
A4HTM4_LEIIN/15-171--------------------------------------------------------------------------------
Q4Q8C6_LEIMA/374-525--------------------------------------------------------------------------------
Q4Q397_LEIMA/79-235--------------------------------------------------------------------------------
A4IAL7_LEIIN/15-170--------------------------------------------------------------------------------
A4H5G0_LEIBR/15-170--------------------------------------------------------------------------------
Q4Q317_LEIMA/15-172--------------------------------------------------------------------------------
A4I0W5_LEIIN/18-168--------------------------------------------------------------------------------
A4I9W8_LEIIN/77-234--------------------------------------------------------------------------------
A4H5D2_LEIBR/15-171--------------------------------------------------------------------------------
A4H5G5_LEIBR/226-381--------------------------------------------------------------------------------
A4I9X1_LEIIN/15-170--------------------------------------------------------------------------------
Q384H4_TRYB2/118-295--------------------------------------------------------------------------------
Q4CVL1_TRYCC/26-174--------------------------------------------------------------------------------
A4I5B9_LEIIN/26-190--------------------------------------------------------------------------------
A4I0W4_LEIIN/18-166--------------------------------------------------------------------------------
A4I9X0_LEIIN/31-188--------------------------------------------------------------------------------
A4IAM2_LEIIN/15-170--------------------------------------------------------------------------------
A4I9R7_LEIIN/15-171--------------------------------------------------------------------------------
A4HAL2_LEIBR/14-189--------------------------------------------------------------------------------
Q4DU87_TRYCC/14-171--------------------------------------------------------------------------------
Q4Q309_LEIMA/15-169--------------------------------------------------------------------------------
A4H9E8_LEIBR/48-205--------------------------------------------------------------------------------
A4HI43_LEIBR/25-189--------------------------------------------------------------------------------
Q4Q6L8_LEIMA/15-171--------------------------------------------------------------------------------
A4HB00_LEIBR/15-170--------------------------------------------------------------------------------
A4I6E5_LEIIN/15-171--------------------------------------------------------------------------------
A4H605_LEIBR/152-298--------------------------------------------------------------------------------
A4H9E9_LEIBR/15-171--------------------------------------------------------------------------------
A4HAJ4_LEIBR/51-207--------------------------------------------------------------------------------
A4H5G7_LEIBR/15-171--------------------------------------------------------------------------------
Q4QHJ4_LEIMA/134-280--------------------------------------------------------------------------------
A4HGF8_LEIBR/158-312--------------------------------------------------------------------------------
Q4Q1U9_LEIMA/15-169--------------------------------------------------------------------------------
A4IAM1_LEIIN/15-170--------------------------------------------------------------------------------
Q4QI87_LEIMA/15-171--------------------------------------------------------------------------------
Q384H3_TRYB2/301-450--------------------------------------------------------------------------------
A4I5B8_LEIIN/20-195--------------------------------------------------------------------------------
Q4DDC5_TRYCC/14-171--------------------------------------------------------------------------------

PF07803

F1RBI8_DANRE/5-124--------------------------------------------------------------------------------
H9GN86_ANOCA/23-152--------------------------------------------------------------------------------
F1QA75_DANRE/4-115--------------------------------------------------------------------------------
H3CZU3_TETNG/7-115--------------------------------------------------------------------------------
GSG1L_XENTR/5-124--------------------------------------------------------------------------------
G1RGF7_NOMLE/4-119--------------------------------------------------------------------------------
H2SQP8_TAKRU/10-121--------------------------------------------------------------------------------
GSG1_BOVIN/8-121--------------------------------------------------------------------------------
I3KRK1_ORENI/5-112--------------------------------------------------------------------------------
G1PJM9_MYOLU/8-122--------------------------------------------------------------------------------
M4ANQ0_XIPMA/5-117--------------------------------------------------------------------------------
E1BQK0_CHICK/10-122--------------------------------------------------------------------------------
F6XCN0_XENTR/6-117--------------------------------------------------------------------------------
H3A9A9_LATCH/14-126--------------------------------------------------------------------------------
X1WCY0_DANRE/5-116--------------------------------------------------------------------------------
H2T2C4_TAKRU/9-124--------------------------------------------------------------------------------
G1LVZ0_AILME/8-122--------------------------------------------------------------------------------
W5N1L9_LEPOC/5-116--------------------------------------------------------------------------------
F6QYE6_XENTR/5-114--------------------------------------------------------------------------------
M0QWL6_MOUSE/5-119--------------------------------------------------------------------------------
G5BYE9_HETGA/8-122--------------------------------------------------------------------------------
H2ZT70_LATCH/6-119--------------------------------------------------------------------------------
F5H0V9_HUMAN/24-137--------------------------------------------------------------------------------
H3A6Q3_LATCH/5-111--------------------------------------------------------------------------------
H3CN24_TETNG/5-116--------------------------------------------------------------------------------
F6TBZ7_ORNAN/10-124--------------------------------------------------------------------------------
W5MNB3_LEPOC/10-148--------------------------------------------------------------------------------
I3JSS8_ORENI/21-128--------------------------------------------------------------------------------
H9GMT0_ANOCA/6-119--------------------------------------------------------------------------------
G3HB44_CRIGR/10-121--------------------------------------------------------------------------------
W5NZF8_SHEEP/5-115--------------------------------------------------------------------------------
W5L9X5_ASTMX/6-118--------------------------------------------------------------------------------
G1M092_AILME/8-119--------------------------------------------------------------------------------
V8PHH2_OPHHA/85-194--------------------------------------------------------------------------------
H2NQH5_PONAB/15-140--------------------------------------------------------------------------------
G1TTX9_RABIT/4-118--------------------------------------------------------------------------------
H0XHA4_OTOGA/4-117--------------------------------------------------------------------------------
F7BNL6_XENTR/10-120--------------------------------------------------------------------------------
F1NVB9_CHICK/11-120--------------------------------------------------------------------------------
F6WEP2_MONDO/5-117--------------------------------------------------------------------------------
F7FP57_MONDO/12-123--------------------------------------------------------------------------------

PF06687

Q7SFF9_NEUCR/5-294LGFLSKACEDATGA.............................................................VGDAK
MAC1_SCHPO/6-177................................................................................
Q5K881_CRYNJ/4-176................................................................................
A0A0D1D1B0_USTMA/4-186................................................................................
Q5KGB3_CRYNJ/7-189................................................................................
A7A250_YEAS7/7-175................................................................................
Q6FSP2_CANGA/9-169................................................................................
A6ZNI8_YEAS7/5-176................................................................................
A7TT16_VANPO/7-179................................................................................
Q6CX71_KLULA/9-171................................................................................
Q757N9_ASHGO/7-167................................................................................
Q5ALR6_CANAL/7-166................................................................................
A3LTF9_PICST/7-165................................................................................
A5DUT6_LODEL/7-165................................................................................
Q6BIN6_DEBHA/7-162................................................................................
A5DHH0_PICGU/5-162................................................................................
A0A0D1DVQ9_USTMA/5-204................................................................................
MUG33_SCHPO/5-166................................................................................
PALI_ASHGO/5-170................................................................................
PALI2_KLULA/3-167................................................................................
PALI1_KLULA/4-168................................................................................
A7TPS6_VANPO/6-170................................................................................
PALI_CANGA/6-170................................................................................
A3LUV8_PICST/4-233................................................................................
PALI_CANAL/4-232................................................................................
A5E4Z6_LODEL/4-205................................................................................
A5DJU1_PICGU/4-217................................................................................
PALI_DEBHA/4-238................................................................................
A6ZMC2_YEAS7/5-169................................................................................
Q2H463_CHAGB/5-183................................................................................
PALI_NEUCR/5-170................................................................................
PALI_MAGO7/5-169................................................................................
PALI_YARLI/7-167................................................................................
Q0V6X2_PHANO/5-166................................................................................
A6R830_AJECN/6-168................................................................................
A2QF35_ASPNC/6-165................................................................................
Q0CX64_ASPTN/6-167................................................................................
Q4WWY3_ASPFU/6-166................................................................................
Q55HH6_CRYNB/6-242..............................................................................QG
Q6BME8_DEBHA/24-312...........................................................................DNVLP
Q59US7_CANAL/25-311................................................................................
Q7SG51_NEUCR/8-271D..........................................................................VEATT
Q2HFG4_CHAGB/9-276...........................................................................SKIDI
Q0TZ73_PHANO/4-276...........................................................................LTNLL
Q6C1Y6_YARLI/7-199................................................................................
A6R6X6_AJECN/8-204................................................................................
A1CFA3_ASPCL/8-205................................................................................
A2QNP6_ASPNC/8-205................................................................................
Q0V6H1_PHANO/8-203................................................................................
A7EBS7_SCLS1/8-206................................................................................
Q2H574_CHAGB/3-201................................................................................
V5IRF3_NEUCR/8-206................................................................................
A7TTI2_VANPO/7-207................................................................................
SUR7_YEAST/9-206................................................................................
A7TH74_VANPO/9-205................................................................................
Q753Q0_ASHGO/8-202................................................................................
Q6CXH5_KLULA/9-205................................................................................
A5DC91_PICGU/5-198................................................................................
Q6BLL9_DEBHA/5-198................................................................................
SUR7_CANAL/5-199................................................................................
A3LV33_PICST/5-198................................................................................
Q75E26_ASHGO/7-202................................................................................
A7TIB3_VANPO/11-209................................................................................
Q6FT41_CANGA/7-205................................................................................
Q6CJ71_KLULA/7-204................................................................................
E7KHH6_YEASA/7-206................................................................................
FMP45_YEAST/7-205................................................................................
A5DAF8_PICGU/6-205................................................................................
Q5AH49_CANAL/4-201................................................................................
A5E7B2_LODEL/4-201................................................................................
A7TGC8_VANPO/6-240................................................................................
Q6CWP2_KLULA/5-243................................................................................
E7Q7C4_YEASB/6-240................................................................................
Q6FPE4_CANGA/6-240................................................................................
A3LZK7_PICST/5-323QVAAVWQSAQ.................................................................NGDIS
Q5ADV0_CANAL/6-394TPTKRAPAESGWYYVPGGSNTQSGPSATASSGGNAVASGSAINWWSPVESGSATSSGSGSGSTSSGSSGSDSSNSGSTSG
Q6BMS1_DEBHA/5-319DTILPGR.................................................................TVVEKDLA
A5DG26_PICGU/5-318IL.........................................................................EERAD
A5E006_LODEL/6-375ATATATVSTGTTFSTSSNTGLATTVASQVEAWANAASGL....................................TSSST
A5E421_LODEL/6-397TEATATATATPTTTTGGLQLPSQVNSWIGVATSYINQPGFSSEVAGLATSLGTSIPSSISIPASISLPSGISLPSDLSIP
PUN1_SCHPO/12-275...........................................................................VDTLE
Q2TX92_ASPOR/9-279...........................................................................MEAVG
Q5BDP9_EMENI/26-276................................................................................
A2QQ39_ASPNC/26-275................................................................................
Q2UBQ3_ASPOR/26-275................................................................................
Q0CQ07_ASPTN/27-276................................................................................
A2R5N4_ASPNC/9-229................................................................................
Q2UF28_ASPOR/9-224................................................................................
Q5B2L7_EMENI/9-256...........................................................................SSVLD
A1DME7_NEOFI/9-255..............................................................................LE
A2QPC4_ASPNC/9-256..............................................................................VV
B8MW98_ASPFN/9-255...........................................................................SQALS
Q0CRK6_ASPTN/9-256...........................................................................TNALE
A6RDR9_AJECN/9-246...........................................................................DLNLN
Q0V4X3_PHANO/9-258...........................................................................SLLDN

PF12351

C1G9K9_PARBD/59-248--------------------------------------------------------------------------------
Q75CU4_ASHGO/65-257--------------------------------------------------------------------------------
A3LV03_PICST/62-245--------------------------------------------------------------------------------
A7EL23_SCLS1/52-241--------------------------------------------------------------------------------
A7TJZ8_VANPO/66-260--------------------------------------------------------------------------------
B6HGM8_PENCW/52-252--------------------------------------------------------------------------------
B8MZW1_ASPFN/73-257--------------------------------------------------------------------------------
B8NY21_ASPFN/72-267--------------------------------------------------------------------------------
C0NA65_AJECG/81-270--------------------------------------------------------------------------------
C1GWT8_PARBA/74-258--------------------------------------------------------------------------------
C4JX23_UNCRE/51-235--------------------------------------------------------------------------------
C4QXD3_PICPG/65-260--------------------------------------------------------------------------------
C4YC02_CLAL4/51-224--------------------------------------------------------------------------------
C5DEC8_LACTC/64-258--------------------------------------------------------------------------------
C5DPI4_ZYGRC/66-266--------------------------------------------------------------------------------
C5G079_ARTOC/74-258--------------------------------------------------------------------------------
C5M8V3_CANTT/127-303--------------------------------------------------------------------------------
DNI1_SCHPO/33-201--------------------------------------------------------------------------------
Q0CSC3_ASPTN/220-409--------------------------------------------------------------------------------
Q0U808_PHANO/74-259--------------------------------------------------------------------------------
Q59WR6_CANAL/68-244--------------------------------------------------------------------------------
Q6BL79_DEBHA/62-241--------------------------------------------------------------------------------
Q6CH13_YARLI/62-243--------------------------------------------------------------------------------
Q6CW51_KLULA/66-265--------------------------------------------------------------------------------
Q6FQP2_CANGA/65-266--------------------------------------------------------------------------------
A7UX97_NEUCR/65-265--------------------------------------------------------------------------------
FIG1_YEAST/66-265--------------------------------------------------------------------------------

PF12534

V8P1J9_OPHHA/785-1120-------------------------------------------------------------------------TPPATV.
M3ZMK4_XIPMA/1-325-------------------------------------------------------------------------....LSS
H2LAB2_ORYLA/1-327-------------------------------------------------------------------------SGLR...
F7HZE8_CALJA/1-331-------------------------------------------------------------------------MGALQ..
I3KSZ5_ORENI/1-328-------------------------------------------------------------------------T......
W5KVQ3_ASTMX/1-344-------------------------------------------------------------------------MWEHAIT
H3AVZ2_LATCH/1-372-------------------------------------------------------------------------SHTSNSG
B1H2G3_XENTR/1-381-------------------------------------------------------------------------.......
E7FB32_DANRE/1-334-------------------------------------------------------------------------LWEFSIT
G3NS96_GASAC/1-347-------------------------------------------------------------------------PPTHVPR
G3TTR1_LOXAF/1-384-------------------------------------------------------------------------.......
W5L768_ASTMX/1-377-------------------------------------------------------------------------SPVLPFT
W5LUY8_ASTMX/1-363-------------------------------------------------------------------------.......
H3AKF0_LATCH/1-388-------------------------------------------------------------------------LWNLSML
H3AX97_LATCH/1-334-------------------------------------------------------------------------AMKVYLE
I3JWS5_ORENI/1-362-------------------------------------------------------------------------.......
H3AY71_LATCH/1-328-------------------------------------------------------------------------.......
V8PI59_OPHHA/1-329-------------------------------------------------------------------------.......
A2BIH6_DANRE/1-360-------------------------------------------------------------------------APLPKEG
G3Q7A0_GASAC/1-345-------------------------------------------------------------------------S.QRTVD
H3ARV9_LATCH/48-378-------------------------------------------------------------------------ISSVQSE
H2MNR6_ORYLA/1-346-------------------------------------------------------------------------PKSTNPQ
D4A758_RAT/1-334-------------------------------------------------------------------------SENTSSN
M4B034_XIPMA/1-370-------------------------------------------------------------------------.......
H2S8U7_TAKRU/1-339-------------------------------------------------------------------------A....LA
R0K7Z6_ANAPL/1-340-------------------------------------------------------------------------ERTYFNS
H0Z736_TAEGU/1-380-------------------------------------------------------------------------DQELKK.
H2S199_TAKRU/1-376-------------------------------------------------------------------------QMSAASE
G3PSX6_GASAC/1-374-------------------------------------------------------------------------HTAAEKY
LRC8E_XENTR/1-341-------------------------------------------------------------------------DSDLETT
I3KNR5_ORENI/1-344-------------------------------------------------------------------------L.QHTLV
F6SMM9_XENTR/1-324-------------------------------------------------------------------------SNSLVTN
H0Z746_TAEGU/1-332-------------------------------------------------------------------------NLNMSTS
F7CMN6_XENTR/1-328-------------------------------------------------------------------------HINLSSA
M4A3B2_XIPMA/1-344-------------------------------------------------------------------------APLHVPH
G3X2F3_SARHA/1-331-------------------------------------------------------------------------N.STPSN
W5KZ87_ASTMX/1-332-------------------------------------------------------------------------SPVPVFH
E7FFH7_DANRE/1-330-------------------------------------------------------------------------.......
M4AYR0_XIPMA/1-374-------------------------------------------------------------------------PGTAEQK
M3ZY99_XIPMA/1-333-------------------------------------------------------------------------D......
H3AZN8_LATCH/1-348-------------------------------------------------------------------------AHTIFAS
I3JMY0_ORENI/1-352-------------------------------------------------------------------------PQIHHAH
B3DLX1_XENTR/1-330-------------------------------------------------------------------------.......
A7SYJ2_NEMVE/1-332-------------------------------------------------------------------------.......
E7F333_DANRE/1-326-------------------------------------------------------------------------NQVSTMP
W5LU14_ASTMX/1-373-------------------------------------------------------------------------TTPARSQ
W5MLZ0_LEPOC/1-351-------------------------------------------------------------------------HLGLPTD
V8P1J9_OPHHA/1-333-------------------------------------------------------------------------NINESFT

PF00876

D6WYF3_TRICA/20-351--------------------------------------------------------------------------------
B4M9Z6_DROVI/21-389--------------------------------------------------------------------------------
B7PM37_IXOSC/22-351--------------------------------------------------------------------------------
H2W3J0_CAEJA/23-398--------------------------------------------------------------------------------
G4VIL2_SCHMA/22-395--------------------------------------------------------------------------------
K1PTR0_CRAGI/36-398--------------------------------------------------------------------------------
T1J195_STRMM/20-353--------------------------------------------------------------------------------
T1FN93_HELRO/20-384--------------------------------------------------------------------------------
A0A068XA01_HYMMI/23-373--------------------------------------------------------------------------------
B4JXM9_DROGR/128-462--------------------------------------------------------------------------------
Q16YE3_AEDAE/22-378--------------------------------------------------------------------------------
J9EMK4_WUCBA/21-384--------------------------------------------------------------------------------
Q8JV09_CSIVT/20-354--------------------------------------------------------------------------------
A8XEP7_CAEBR/22-362--------------------------------------------------------------------------------
H2VGJ4_CAEJA/19-337--------------------------------------------------------------------------------
K1RGD8_CRAGI/8-352--------------------------------------------------------------------------------
T1J195_STRMM/1266-1599--------------------------------------------------------------------------------
B7P7W9_IXOSC/20-348--------------------------------------------------------------------------------
A0A068XZR8_ECHMU/21-417--------------------------------------------------------------------------------
G0P5C9_CAEBE/23-398--------------------------------------------------------------------------------
G7YGP3_CLOSI/23-373--------------------------------------------------------------------------------
Q16QK9_AEDAE/26-359--------------------------------------------------------------------------------
F1L798_ASCSU/18-385--------------------------------------------------------------------------------
T1KCG9_TETUR/13-350--------------------------------------------------------------------------------
A0A068XBQ8_HYMMI/22-391--------------------------------------------------------------------------------
E9HBX3_DAPPU/3-382--------------------------------------------------------------------------------
T1ELD9_HELRO/20-382--------------------------------------------------------------------------------
B4NCN0_DROWI/21-406--------------------------------------------------------------------------------
A0A087W1T2_ECHMU/23-384--------------------------------------------------------------------------------
B4R5W3_DROSI/22-374--------------------------------------------------------------------------------
H3DSX6_PRIPA/33-350--------------------------------------------------------------------------------
J9K934_ACYPI/20-353-------------------------------------------------------------------------------