Sequence alignment for CL0379

PF06162

Q9XV89_CAEEL/13-179MLSMCNKYPDFDDEERVRRVDDDFRDVITVFDAPFEGKSPSPAVIVFDELVD-SDGSSKYLNF.KMEQSYEKVDEIPEK-
Q9XV88_CAEEL/13-169MLTMCNNFPGFEAP..MRYMIENSHDVVTVFDG.......SPAVIVLDELVK-AD.ESSYLPF.KMKKSYKKVDEIAAK-
Q9GYU1_CAEEL/13-167MLSMCNRQPFLMS..........LYSIFTVIDEPVEGKQPSSAVFVYEELAK-FG.DFCKLF..KMEESYINVDQVVQE-
Q9XV94_CAEEL/13-171MLSMCNKYPKFEDDDMERYVITNPHDVVTVFDG.......SPAVIVFDELVK-SD.TSKYLSF.KMEQSYGKVDEIAAK-
Q9GYU2_CAEEL/13-176MLSMCNKHPFFDDDDSERFVI..LYKICTVFDEPVEGKQPSSAVIVYEELAK-SG.GYCCRPS.KMEESYVKVDQVVQE-
A5JYY7_CAEEL/13-173ILTMCD....IPFPHSREVVMIKGIAIV.GFETSENATNPSNDVM..EQICS-EQYSDKMIFLIKFPLSYDPLKQKIDE-

PF01470

PCP_MYCTU/2-209-----------------------SKVLVTGFG-PYGVTPVNPAQLTAEELDG.RTIAGATVISRIVPNTFFESIAAAQQA
PCP_PSEFL/2-202-----------------------RIVLLTGFE-PFDQDPVNPSWEAVRQLDGVQLGSDVKIVARRLPCAFATAGECLTRL
PCP_BACSU/3-204-----------------------KKVLITGFD-PFDKETVNPSWEAAKRLNG.FETEEAIITAEQIPTVFRSALDTLRQA
PCP_PYRHO/1-200-----------------------MKILLTGFE-PFGGDDKNPTMDIVEALSE.R.IP..EVVGEILPVSFKRAREKLLKV
PCP_PYRFU/1-207-----------------------MKVLVTGFE-PFGGEKINPTERIAKDLDG.IKIGDAQVFGRVLPVVFGKAKEVLEKT
PCP_STAAU/1-202-----------------------MHILVTGFA-PFDNQDINPSWEAVTQLE..NIIGTHTIDKLKLPTSFKKVDTIINKT
PCP_LACLM/1-202-----------------------MKILVTGFD-PFGDDKINPAIEAVKRLP..DEIAGAQIVKLEIPTKFNVSADVVKDA
PCP_THELI/2-209-----------------------KKVLITGFE-PFGGDSKNPTEQIAKYFDR.KQIGNAMVYGRVLPVSVKRATIELKRY
PCP_STRP1/1-202-----------------------MKILVTGFD-PFGGEAINPALEAIKKLP..ATIHGAEIKCIEVPTVFQKSADVLQQH

PF06162

Q9XV89_CAEEL/13-179IDAERIRYAIHLGSHSQKNVLQIFQSAYSDGYT----EEDKNGKVPVGGKVKCAET-----------------ETGFRTK
Q9XV88_CAEEL/13-169MASEEIHFTIHLSSHSQKNVIQIFQSAYSDGYT----EEDKKGKIPEGGRVKCAGT-----------------ETGARSN
Q9GYU1_CAEEL/13-167IANIQSRYAIHLSSHSLKNTIQIVRTAFPNGYT----QNDKNGNVPEGNKVKFDGD-----------------ETVMKTT
Q9XV94_CAEEL/13-171MVTEEIHFTIHLCSHSQKNVIEIFQSAYSNGYT----EKDKKGKIPEGGKVKCAGT-----------------ETGARSK
Q9GYU2_CAEEL/13-176MAKITSKCAIHLSSHALKNTIQIVRTAFSGEYT----QNDKDGNVPEGNEVKFDGD-----------------ETVMKTT
A5JYY7_CAEEL/13-173LFECPGVVAFHFETHLVKNTIYVEKKAFQSGYH----QKDEKGYLPEGNKVSCESV-----------------DNTLETI

PF01470

PCP_MYCTU/2-209IAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPAD
PCP_PSEFL/2-202IDELHPAMVIATGLGPGRSDISVERVAININDA.R..IPDNLGEQPIDTAVVADGPAAFFTTLPIKAMVKAVREAGIAAS
PCP_BACSU/3-204IQKHQPDIVICVGQAGGRMQITPERVAINLADA.R..IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAA
PCP_PYRHO/1-200LDDVRPDITINLGLAPGRTHISVERVAVNMIDA.R..IPDNDGEQPKDEPIVEGGPAAYFATIPTREIVEEMKKNGIPAV
PCP_PYRFU/1-207LEEIKPDIAIHVGLAPGRSAISIERIAVNAIDA.R..IPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAY
PCP_STAAU/1-202LASNHYDVVLAIGQAGGRNAITPERVAINIDDA.R..IPDNDDFQPIDQAIHLDGAPRYFSNLPVKAMTQSVINQGLPGA
PCP_LACLM/1-202IAKEKPDYVLSIGQAGGRFELTPERVAINLDDG.R..IQDNAGYQPLNHTIHGDDENAYFTQLPIKAMAKAIREAGVPSA
PCP_THELI/2-209LEEIKPEIVINLGLAPTYSNITVERIAVNIIDA.R..IPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPAT
PCP_STRP1/1-202IESFQPDAVLCIGQAGGRTGLTPERVAINQDDA.R..IPDNEGNQPIDTPIRADGKAAYFSTLPIKAMVAAIHQAGLPAS

PF06162

Q9XV89_CAEEL/13-179IN-------CENVVTAVNEYMDSNR--EKFGELRIETLNK------------------------------------
Q9XV88_CAEEL/13-169VK-------CEEVAKEVNEYIDSNK--DKFGDLKVESLGK------------------------------------
Q9GYU1_CAEEL/13-167VD-------CEQLVKDIKEFMEEDR--QKYGELEIQIIEE------------------------------------
Q9XV94_CAEEL/13-171VN-------CEEVAKEVNERIDSAK--DKFGEFWESGEVS------------------------------------
Q9GYU2_CAEEL/13-176VN-------CEKLVEDINEFMEEDR--QMYGALEIQIMEE------------------------------------
A5JYY7_CAEEL/13-173ID-------CMDVVKKVTEKCGLDG--VKFGGLKVEVSED------------------------------------

PF01470

PCP_MYCTU/2-209VSDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAALDHNLG...VPSMSVQTAVAGVTAGIEAAIRQS
PCP_PSEFL/2-202VSQTAGTFVCNQVFYLLQHALAGSG..VRSGFIHVPFLPEQVAGSQ.R.....PSMALDAMVAGLQAAVLTAWHTP
PCP_BACSU/3-204VSYTAGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDKT.A.....PSLSLDTIVRALRIAAVTAAQYD
PCP_PYRHO/1-200LSYTAGTYLCNFAMYLTLHTSATKGYPKIAGFIHVPYTPDQVLEKKNT.....PSMSLDLEIKGVEIAIRVAQSAL
PCP_PYRFU/1-207ISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGK.GQVPPSMCYEMELEAVKVAIEVALEEL
PCP_STAAU/1-202LSNSAGTFVCNHVLYHLGYLQDKHYPHLRFGFIHVPYIPEQVVGKSDT.....PSMPLEQIVAGLTAAIEAISDHD
PCP_LACLM/1-202VSNTAGTYVCNHIFYQVQYMRDKMFPDIKAGFMHIPFLPEQVVTRPET.....PALSLDDDVLGITAAIKAIVSRD
PCP_THELI/2-209ISYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPDQVVNKFFLLGKNTPSMCLEAEIKAIELAVKVSLDYL
PCP_STRP1/1-202VSNTAGTFVCNHLMYQALYLVDKYCPNAKAGFMHIPFMMEQVVDKPNT.....AAMNLDDITRGIEAAIFAIVDFK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window