Sequence alignment for CL0379

PF06162

Q9XV94_CAEEL/13-171MLSMCNKYPKFEDDDMERYVITNPHDVVTVFDG.......SPAVIVFDELVKSD.TSKYLSF.KMEQSYGKVDEIAAK-M
Q9XV89_CAEEL/13-179MLSMCNKYPDFDDEERVRRVDDDFRDVITVFDAPFEGKSPSPAVIVFDELVDSDGSSKYLNF.KMEQSYEKVDEIPEK-I
Q9XV88_CAEEL/13-169MLTMCNNFPGFEAP..MRYMIENSHDVVTVFDG.......SPAVIVLDELVKAD.ESSYLPF.KMKKSYKKVDEIAAK-M
Q9GYU1_CAEEL/13-167MLSMCNRQPFLMS..........LYSIFTVIDEPVEGKQPSSAVFVYEELAKFG.DFCKLF..KMEESYINVDQVVQE-I
Q9GYU2_CAEEL/13-176MLSMCNKHPFFDDDDSERFVI..LYKICTVFDEPVEGKQPSSAVIVYEELAKSG.GYCCRPS.KMEESYVKVDQVVQE-M
A5JYY7_CAEEL/13-173ILTMCD....IPFPHSREVVMIKGIAIV.GFETSENATNPSNDVM..EQICSEQYSDKMIFLIKFPLSYDPLKQKIDE-L

PF01470

PCP_BACSU/3-204-----------------------KKVLITGFD-PFDKETVNPSWEAAKRLNGFETEEAIITAEQIPTVFRSALDTLRQAI
PCP_PYRFU/1-207-----------------------MKVLVTGFE-PFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTL
PCP_THELN/2-209-----------------------KKVLITGFE-PFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSVKRATIELKRYL
PCP_STRP1/1-202-----------------------MKILVTGFD-PFGGEAINPALEAIKKLP.ATIHGAEIKCIEVPTVFQKSADVLQQHI
PCP_MYCTU/3-208-----------------------.KVLVTGFG-PYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNTFFESIAAAQQAI
PCP_LACC3/1-201-----------------------MKILVTGFD-PFGDDKINPAIEAVKRLP.DEIAGAQIVKLEIPTKFNVSADVVKDAI
PCP_STAA8/1-199-----------------------MHILVTGFA-PFDNQNINPSWEAVTQLE.DIIGTHTIDKLKLPTSFKKVDNIINKTL

PF06162

Q9XV94_CAEEL/13-171VTEEIHFTIHLCSHSQKNVIEIFQSAYSNGYT----EKDKKGKIPEGGKVKCAGT-----------------ETGARSKV
Q9XV89_CAEEL/13-179DAERIRYAIHLGSHSQKNVLQIFQSAYSDGYT----EEDKNGKVPVGGKVKCAET-----------------ETGFRTKI
Q9XV88_CAEEL/13-169ASEEIHFTIHLSSHSQKNVIQIFQSAYSDGYT----EEDKKGKIPEGGRVKCAGT-----------------ETGARSNV
Q9GYU1_CAEEL/13-167ANIQSRYAIHLSSHSLKNTIQIVRTAFPNGYT----QNDKNGNVPEGNKVKFDGD-----------------ETVMKTTV
Q9GYU2_CAEEL/13-176AKITSKCAIHLSSHALKNTIQIVRTAFSGEYT----QNDKDGNVPEGNEVKFDGD-----------------ETVMKTTV
A5JYY7_CAEEL/13-173FECPGVVAFHFETHLVKNTIYVEKKAFQSGYH----QKDEKGYLPEGNKVSCESV-----------------DNTLETII

PF01470

PCP_BACSU/3-204QKHQPDIVICVGQAGGRMQITPERVAINLADA.R..IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAAV
PCP_PYRFU/1-207EEIKPDIAIHVGLAPGRSAISIERIAVNAIDA.R..IPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYI
PCP_THELN/2-209EEIKPEIVINLGLAPTYSNITVERIAVNIIDA.R..IPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPATI
PCP_STRP1/1-202ESFQPDAVLCIGQAGGRTGLTPERVAINQDDA.R..IPDNEGNQPIDTPIRADGKAAYFSTLPIKAMVAAIHQAGLPASV
PCP_MYCTU/3-208AEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADV
PCP_LACC3/1-201AKEKPDYVLSIGQAGGRFELTPERVAINLDDG.R..IQDNAGYQPLNHTIHGDGENAYFTQLPIKAMAKAIREAGVPAAV
PCP_STAA8/1-199ASNHYDVVLAIGQAGGRNAITPERVAINIDDA.R..IPDNDDFQPIDQAIHLDGAPAYFSNLPVKAMTQSIINQGLPGAL

PF06162

Q9XV94_CAEEL/13-171N-------CEEVAKEVNERIDSAK--DKFGEFWESGEKS------------------------------------
Q9XV89_CAEEL/13-179N-------CENVVTAVNEYMDSNR--EKFGELRIETLNK------------------------------------
Q9XV88_CAEEL/13-169K-------CEEVAKEVNEYIDSNK--DKFGDLKVESLGK------------------------------------
Q9GYU1_CAEEL/13-167D-------CEQLVKDIKEFMEEDR--QKYGELEIQIIEE------------------------------------
Q9GYU2_CAEEL/13-176N-------CEKLVEDINEFMEEDR--QMYGALEIQIMEE------------------------------------
A5JYY7_CAEEL/13-173D-------CMDVVKKVTEKCGLDG--VKFGGLKVEVSED------------------------------------

PF01470

PCP_BACSU/3-204SYTAGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDKT.A.....PSLSLDTIVRALRIAAVTAAQYD
PCP_PYRFU/1-207SNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQ.VPPSMCYEMELEAVKVAIEVALEEL
PCP_THELN/2-209SYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPDQVVNKFFLLGKNTPSMCLEAEIKAIELAVKVSLDYL
PCP_STRP1/1-202SNTAGTFVCNHLMYQALYLVDKYCPNAKAGFMHIPFMMEQVVDKPNT.....AAMNLDDITRGIEAAIFAIVDFK
PCP_MYCTU/3-208SDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAALDHNLG...VPSMSVQTAVAGVTAGIEAAIRQ.
PCP_LACC3/1-201SNTAGTYVCNHIFYQVQYMRDKMFPDIKAGFMHIPFLPEQVVTRPET.....PALSLDDDVLGITAAIRAIVSR.
PCP_STAA8/1-199SNSAGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVPYIPEQVIGKPDT.....PSMPLEKIVAGLTAAIEAIS...

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window