Sequence alignment for CL0380

PF01231

Q6F3I4_HALDV/3-383G.SIQLSDYHVSRDTGFLL.ENPQEYLP.D.YFEPWNRLA...KRMPDL.............VSR.YSMREAVE.EMPLL
MYG_HALDV/2-378A.DIQLSKYHVSKDIGFLL.EPLQDVLP.D.YFAPWNRLA...KSLPDL.............VAS.HKFRDAVK.EMPLL
Q6BIB0_DEBHA/3-424D.IPRMEDYEVFPNTGFLPSEFPLVKLP.QEYYQPWEILV...NNLPSL.............ILT.KKIRWHIDTNLPIL
I23O2_HUMAN/12-403V.PLSLESYHISEEYGFLL.PDSLKELP.D.HYRPWMEIA...NKLPQL.............IDA.HQLQAHVD.KMPLL
Q0UCE0_PHANO/4-409Q.LPVLRDYDVSPRNGFLPDEIPLEVLP.DAYYRPWETVV...LNFQKL.............ILA.KRLRQIIE.NLPIL
A4UHF3_MOUSE/12-401V.PLSLGRYHISEEYGFLL.PNPLEALP.D.HYKPWMEIA...LRLPHL.............IEN.RQLRAHVY.RMPLL
A1CHS9_ASPCL/5-426P.EIALDQYGLSSQHAFLPDIPPLQKLQ.DPYYSSWEEIV...NDLPTR.............IEA.GTIRQAVD.SLPVL
A1CWY2_NEOFI/5-427P.EIVLDQFCVSLRNGFLPDTLPLQKLK.DPYYSPWEEVV...ADLPAR.............LTA.GNVRQVVD.SLPIL
Q4P7T1_USTMA/163-708S.TLAAADFDVDVRSGFLPPEAPVRRLS.APYAEHWEHALDLAKRIPLMHGGGGTKTTPHQRLLA.RRWRRSIR.EMPIL
Q2U3U2_ASPOR/4-435P.VPALADYGISPDHGFLPPEPPLDVLP.DPFYARWEWMV...SNLQSL.............LLS.RRIRDVVD.QMPIL
Q6C0A4_YARLI/4-433A.LPNLADYEVSDKTGFLPEQLPLESLT.NPYYAPWEQVA...QNLPAL.............ILT.RRIRQYVDTRMPVL
A7ESB7_SCLS1/4-425PLNINLSEYGVSTKNGFLPDINPLPRLI...AYSEWEDLV...DEIPFL.............IKE.GLFRQHAD.ALPIL
A5E388_LODEL/1-406M.IPSLEDYDISPLWGFLPSQLPLTRLP.QDYYAQWETIA...DNLPSL.............ILT.KRIRNVID.KLPLL
A2Q0R5_DANRE/10-410T.VVSLRKFHISEEYGFIL.PEPLMDLP..VYYKPWMDIG...RNVTEL.............ISS.HSLRLRIH.NMPLL
Q5KJZ4_CRYNJ/56-570A.SLASADFEVDVRTGFLPATKNVERLS..GEYEVWEEAL....DAARGSAVGGGVMLGGKREKD.QLWRAGVE.SLPVV
Q3JAG5_NITOC/2-364N....FILNSSFTQRGFLPEPDPARRFPSDSELAVLDELG...RDLPSL.............LQD.PGCRRYLR.EQQIP
I23O1_RAT/12-404S.RRILEEYHIDEDVGFAL.PHPLEELP.D.TYRPWILVA...RNLPKL.............IEN.GKLREEVE.KLPTL
I23O_YEAST/19-446P.LPVLEKYCISPHHGFLDDRLPLTRLS.SKKYMKWEEIV...ADLPSL.............LQEDNKVRSVID.GLDVL
Q5BC72_EMENI/5-429P.DFSLEEYEFSAQTGFLPETPPLRCLP.DHYYAPWETVA...QDLAAS.............IEN.GTIRQAVE.SLPLL
A1CLC8_ASPCL/4-434P.IPALVDYGISPEHGFLPSEPPLDALP.DPYYAKWEWIV...SNLQSL.............LHS.GRIREAVD.HMPIL
A7SDW8_NEMVE/5-391K.VPFLEDYEVSPTRGFIQDEDPLQQLP.E.YFSPWEEVC...ERLPEM.............WKD.ETTRHWIE.QLPLL
Q5BAC1_EMENI/4-426P.IPIPAEYGISPDTGFLPSEPPLEHLP.DPYYAKWEWIV...ANIQAL.............LLS.RRMRRVVD.NMPIL
Q0CZX5_ASPTN/5-428P.EFSLDTYNVSLRTGFLPDDPPLRSLE.DPYYWPWEELV...RDLPLR.............IRN.KTIRDSVE.QMPVL
Q2UJE7_ASPOR/5-428P.EVSLDEYGVSLQNGFLPHSPPLKTME.SPYYWPWEHIV...SDLPDH.............IRF.RTIRQAVE.TLPVL
A7TMA0_VANPO/6-426S.IPRLEDYGVSERYGFLPRELPVQRLK.DDYYESWEDVI...SKLPDL.............LVN.RELRSEID.KLPEL
I23O1_HUMAN/8-400S.WTISKEYHIDEEVGFAL.PNPQENLP.D.FYNDWMFIA...KHLPDL.............IES.GQLRERVE.KLNML
A7MBF5_BOVIN/12-403S.WTIFKEYHIDEDVGFAL.PYPLEDLP.H.PYDAWISIA...RNLPEL.............IKN.NQLRVEVE.KLATL
A6QUU2_AJECN/4-463P.LPSLADYGISPVTGFLPQEPPLQSLP.DPYYAKWESIA...ANLQAL.............LLS.HRLRPTID.AMPIL
A2QU38_ASPNC/4-436P.IPALADYGISADHGFLPPEPPLEILP.DPYYAKWEWIV...SNLQAL.............LTS.RRIREVVD.HMSKL
Q6DFT5_XENTR/4-390Q.DINPKEFYVSEHYGFIL.QDPLEKLP.E.YYKPWMTIA...ENVCLL.............IET.KQVREAVR.QMPEL
O77056_TEGPF/2-369P.RLDVTQFEVSMKTGFLL.ENPLTKLP..AYFDPWNNLA...STMAQH.............VAN.KTMRDEVA.KLPVL
Q0UZJ9_PHANO/11-417S.IGALSQYGIS.KNGFLPAEIPLSRLP.QSYYQPWECII...EEIPSL.............IET.QTIRHRVD.KLSVL
A7EY92_SCLS1/4-439P.LPKLSKYGISPEYGFLPADLPLERLP.DPYYNKWEAII...ANLQGL.............ILS.KRLREVID.RLPVL
A2QJI6_ASPNC/5-428Q.DISLVAYGVSLQNGFLPEVPPVRRLE.DPYYSPWEEIA...QDLPGL.............IQS.GTIRRSVD.DLGIL
Q2BIS7_9GAMM/6-359A............TRGFLPCQDPATELALGEPYSVLDTVG...NSLPSL.............LLE.KDARDYLR.RVYVP
A3LQQ0_PICST/4-426V.IPKLEDYDVFPQSGFLPQSLPLERLP.QAYYLPWENLV...NNLPSL.............ILT.KRVRILVD.KLPLL
Q7S4S0_NEUCR/4-444P.IPVLADYGISPTHGFLPDVLPLTRLP.DPYYNKWEAIA...ANLQAL.............ILS.KRLRGVVD.RLPVL
Q75BT3_ASHGO/6-428P.LPVLEDYFVSAANAFLPDEFPVKELQ.DEYYRPWETIV...SNLPAL.............LLA.RQLRDVVD.QLKVL
Q59XE2_CANAL/2-414T.IPNIEEFDVFPNSGFLPSKLPLERLP.QEYYQPWENIV...NNLPSL.............ILT.KRIRAIID.KLPVL

PF08933

B8E4A3_SHEB2/5-391--TFNTEAFDDWIRSRFVELNSELEQL----YYQQTDR-----ANVLDI-------------GAE---AKLALE-SEGRE
A1SB64_SHEAM/5-391--TLNVEAFDDWLRTRFVELNNELEHL----YWLQTDK-----ANVTGV-------------GDD---LKAQLE-TEGRK
Q1YT13_9GAMM/2-390--TDKAKALDLWIRNDFRQINTALEAL----HFSQPDR-----LPAPGL-------------GEV---LKRRLV-EEGTA
Q4KAM6_PSEF5/14-358--THAAVAACDPLQAR..ALVLQLPAL----....NRD-----KDVPGI-------------VGL---LRDFLP-VSGVP
A4CE21_9GAMM/2-388--YDNFSQFDYWIRHQFVDINTALEEI----YWQQEDK-----TLISNA-------------AKP---LLEQLE-HQGKH
Q3IDE5_PSEHT/2-388--STHTAIFDRWIRSAFPQINSELEQL----YWQQDDK-----ANVEGL-------------GEP---LKQQLK-DEGNA
A4ABU7_9GAMM/2-390--SVKAQRYDEWIRSSFIEINSELEAL----YFAQEDR-----ADTSAG-------------GEA---LRQLLH-DEGRA
A3QIX5_SHELP/2-388--SQDVAAFDHWIRQEFVEINSALERL----YMQQSDP-----ANVVGI-------------GDE---LKARLE-AEGRT
A8H9J6_SHEPA/2-388--TGNTQAFDHWIRTRFVELNSKLESL----YAQQADR-----ANVEGV-------------GED---LKFQLE-SEGRE
Q12IK0_SHEDO/5-391--TTNTYAFDQWIRHRFVELNDELEVL----YFQQSDK-----ANVAGI-------------GQD---IKLALE-NEGRA
Q9RPG2_MYXFU/10-369--THEVIATLDPLDAL..ATMRRLPEL----....NQR-----SDVRGV-------------LEL---LQGILP-RLEIV

PF03301

T23O_CAEEL/22-371E-ECQQGVNKVEMGFGQT-----------YSEYLQLDKI----LTAQRL-------------KSEADGQRVDDE-HLFIV
T23O_ANOGA/11-358D-SVQGGHHLGSEA.GML-----------YGEYLMLDKV----LSAQRM-------------LSVEGKKPVHDE-HLFIV
T23O_RAT/26-372D-GAQTGVNRASKG.GLI-----------YGDYLQLEKI----LNAQEL-------------QSEIKGNKIHDE-HLFII
Q9X8R3_STRCO/1-271M-SHDAPNLDFEGS..TP-----------YEDYVKADVL----THLQHT-------------LSD.....DPGE-MVFLV
Q9RYH4_DEIRA/16-287H-SAEQAHRDFSRS..LS-----------YGDYLHLDEL----RSAHQP-------------ITD.....AHDE-HLFIA

PF01231

Q6F3I4_HALDV/3-383DHSR.L....TGYC.QKRLAHMQL---VLITSGYLWQEGDAGVVQ...................................
MYG_HALDV/2-378DSSK.L....AGYR.QKRLAHLQL---VLITSGYLWQEGEGGAVQ...................................
Q6BIB0_DEBHA/3-424STDK.L....KDIP.EYRRAYQVL---GFLAHAYIWGT..DKPTN...................................
I23O2_HUMAN/12-403SCQF.L....KGHR.EQRLAHLVL---SFLTMGYVWQEGEAQPAE...................................
Q0UCE0_PHANO/4-409ETDL.L....LTEA.EWRRAYSIL---GFMAHGYIWGG..EKPAD...................................
A4UHF3_MOUSE/12-401DCRF.L....KSYR.EQRLAHMAL---AAITMGFVWQEGEGQPQK...................................
A1CHS9_ASPCL/5-426STSR.L....QEDA.DWRRAYVVL---AFITHAYIWGG..GRPKD...................................
A1CWY2_NEOFI/5-427STSR.L....QEES.EWRRAYIVL---AFITHAYIWGG..ERPKD...................................
Q4P7T1_USTMA/163-708PLSDEL....ANDIRYARRGHVVL---SFLAHFYIHSQPRKVTAALAVAPQRTWLNMFSRKTPDDLQDEQDLADELAGKY
Q2U3U2_ASPOR/4-435STSY.L....QSEG.EWRRAYVVL---GFILHGYVWGG..SKPSE...................................
Q6C0A4_YARLI/4-433EIDQ.L....KTPE.EQRRAYSVL---SFIAHAYIWGSPGDDPRD...................................
A7ESB7_SCLS1/4-425DTSN.L....QEED.EWRRAYHLL---SFMTHSYIWGG..KLPSE...................................
A5E388_LODEL/1-406TIDN.L....NNDEREYRRAYQVL---GFLGHAYIWGT..DMPID...................................
A2Q0R5_DANRE/10-410TTDL.L....RTHR.ELRLAHLTL---SVMAMGYVWQEGEKETVK...................................
Q5KJZ4_CRYNJ/56-570ATDD.L....RASLPHLRRAHLVL---TFLAHFYVHTTPLPGPSAQK................................E
Q3JAG5_NITOC/2-364FWPA.QRNRSQDL.PELQLYYLRL---GFLASAYINQV.GEPRAT...................................
I23O1_RAT/12-404RTEE.L....RGHR.LQRLAHLAL---GYITMAYVWNRGDDDIRK...................................
I23O_YEAST/19-446DLDETI....LGDVRELRRAYSIL---GFMAHAYIWAS..GTPRD...................................
Q5BC72_EMENI/5-429NTTK.L....RTKP.EWRRAYVVL---SYLTHAYVWGG..EIPKE...................................
A1CLC8_ASPCL/4-434STSY.L....HSED.EWRRAYVLL---TFILHGYVWGG..NAPEE...................................
A7SDW8_NEMVE/5-391DHNK.L....TSAR.EWWRANLVL---VLMSHSYVWCEGETNPKK...................................
Q5BAC1_EMENI/4-426STSY.L....QAEP.EWRRAYSIL---GFILHGYVWGG..STPAE...................................
Q0CZX5_ASPTN/5-428STSS.L....QNEP.QWRRAYLLL---AYLTHAYVWGG..DKPKD...................................
Q2UJE7_ASPOR/5-428STSK.L....QGEP.EWRRAYLLL---AYLTHAYIWGG..EKPKD...................................
A7TMA0_VANPO/6-426KVKQSL....LDDIGQLRRSYCVL---CFLANAYVWGG..DKPAQ...................................
I23O1_HUMAN/8-400SIDH.L....TDHK.SQRLARLVL---GCITMAYVWGKGHGDVRK...................................
A7MBF5_BOVIN/12-403NING.L....RGHR.AQRLAHLVL---GYITMAYVWGQGDGDIRK...................................
A6QUU2_AJECN/4-463STTK.L....KTEP.EWRRAYVLL---VFMLHAYIWGG..DSPAE...................................
A2QU38_ASPNC/4-436STSY.L....QSEN.EWRRAYVVL---VFMLHGYVWGG..SKPAE...................................
Q6DFT5_XENTR/4-390TIQH.L....SGYR.EQRLARLIL---GHIVMGYVWQDGEQGAIK...................................
O77056_TEGPF/2-369DFNK.L....NGPN.EVKLGHLQL---AMMTSGYLWQNGIDEVPT...................................
Q0UZJ9_PHANO/11-417STSF.L....STEA.EWQRAYSML---ALIAQGYIWAG..PEPSE...................................
A7EY92_SCLS1/4-439STAG.L....EHDS.EWRRAYSLL---CFMAHSYIWGG..DSPEE...................................
A2QJI6_ASPNC/5-428STKK.L....KGEP.EWRRAYVVL---AYLTHAYIWGG..EKPKD...................................
Q2BIS7_9GAMM/6-359DWPY.VN.IPDDLWPQACLYYVRL---GFIASGYVNQI.GQPHCH...................................
A3LQQ0_PICST/4-426TVDN.L....ESEE.QYRRAYQIL---GFLSHAYIWGA..DEPMN...................................
Q7S4S0_NEUCR/4-444DTIG.L....EHDA.EWRRAYSLL---SFMAHGYIWSG..DSPSD...................................
Q75BT3_ASHGO/6-428EVKKEL....FEDMRQLRRAYSVL---GFIANAYVWGY..DDACD...................................
Q59XE2_CANAL/2-414ETTH.L....TSDE.EYRRAYQIL---GFLAHAYIWGT..DTPTD...................................

PF08933

B8E4A3_SHEB2/5-391LIKA-LLDEGNTDE-GFDSAFDLLGNVGLYMAACRRHEITEPSRE-----------------------------------
A1SB64_SHEAM/5-391HICA-LLDEGNTDE-GFDAAFDLLGNVGLYMAACRRHEITEPTRE-----------------------------------
Q1YT13_9GAMM/2-390LISD-LLNEGNTDE-GFDSGFDLLGNVGFYMAACRRHEITEPSRE-----------------------------------
Q4KAM6_PSEF5/14-358....-......SSW-GFVEAAAAMRDIGFFLGSLKRHG.HEPVD.-----------------------------------
A4CE21_9GAMM/2-388FITQ-LLAEGNTDQ-GFEHAFDLLGNVGLYMAACRRHEITEPSRE-----------------------------------
Q3IDE5_PSEHT/2-388LISN-LLAEGNTDE-GFDSAFDLLGNVGLFMAACRRHEITEPSRE-----------------------------------
A4ABU7_9GAMM/2-390HIIG-LHKEGNTDE-GFEAAFSLLGNVGLYMGACRRHGITEPSRE-----------------------------------
A3QIX5_SHELP/2-388LIKA-LLDEGNTDE-GFDAAFDLLGNVGLYMAACRRHEITEPSRE-----------------------------------
A8H9J6_SHEPA/2-388LIAC-LLAEGNTDE-GFDHAFDLLGNVGLYMAACRRHEITEPSRE-----------------------------------
Q12IK0_SHEDO/5-391LIKS-LLLEGNTDQ-GFDAAFDLLGNVGLYMAACRRHEITEPSRE-----------------------------------
Q9RPG2_MYXFU/10-369....-......ERW-DFPVAAAAMRDIGFFLGSLKRHG.HEPVE.-----------------------------------

PF03301

T23O_CAEEL/22-371IHQA-H---------ELWFKQIIF---DLDNVRKLLNNTIVDETK----------------------------------.
T23O_ANOGA/11-358THQA-Y---------ELWFKQIIF---ELDSIRDLFSTEHIEESR----------------------------------.
T23O_RAT/26-372THQA-Y---------ELWFKQILW---ELDSVREIFQNGHVRDER----------------------------------N
Q9X8R3_STRCO/1-271TTQV-M---------ELWFTVIVH---EWETAARALREDRTPVAT----------------------------------.
Q9RYH4_DEIRA/16-287IHHV-S---------EVWLSLIVR---ELQAAMRLLDAGITDAPL----------------------------------.

PF01231

Q6F3I4_HALDV/3-383..RLPECVAVPLWHV--SNTLGLKPVICHPDMCLANWK.....YTEDQ...........RDI..EVIYTVPGGSSS.VWF
MYG_HALDV/2-378..RLPECVAKPLWNV--SNDLGLKPVLTYGDVCLTNCR.....VKGGD.............I..EVMYNLPGGAGT.EWF
Q6BIB0_DEBHA/3-424..KLPEQIAKPLLEV--SEYLRLPPIATYAGLCLWNFK.....QIMPSD..KEGEKWDLDNL..TTINTFTGSIDE.SWF
I23O2_HUMAN/12-403..VLPRNLALPFVEV--SRNLGLPPILVHSDLVLTNWT.....KKDPD......GFLEIGNL..ETIISFPGGESL.HGF
Q0UCE0_PHANO/4-409..V............--.............SVCLWNWQ.....PLFRD.....APMDTLDNL..STQMTFTGSMDE.SWF
A4UHF3_MOUSE/12-401..VLPRSLAIPFVEV--SRNLGLPPILVHSDLVLTNWT.....KRNPE......GPLEISNL..ETIISFPGGESL.RGF
A1CHS9_ASPCL/5-426..VLPPAVSRPFLEV--SEYLELPPCATYAALNLWNFK.....MTSPD.....LDITDPDNL..SVINSFTRTKDE.EWF
A1CWY2_NEOFI/5-427..VLPPAVSCPILEV--SKHLELPPCATYAALNLWNFK.....VSSPD.....IDLTNPDNL..SILTSFTGTKDE.EWF
Q4P7T1_USTMA/163-708MRRLPAAIAVPWVQL--SQKLDLPPVLTYATTVLWNWD.....YIDPS......RGLEPDNL..SIVETFTATPSE.HHF
Q2U3U2_ASPOR/4-435..RIPPQITIPLLEV--CKHLELPPVATYAGVCLWNYR.....SIFPE.....EAADDVSNL..SCLNTFTGSLDE.QWF
Q6C0A4_YARLI/4-433..YIPPQITEPWVAI--SDLLELPPVCTYAGLCLWNHK.....TIMPVA...SSDQWDLDSL..ATITTYTGSFDE.SWF
A7ESB7_SCLS1/4-425..ILPPQISKPFLVV--SSHLGLPPTATYAALNLWNFT.....STSPT.....QDLTDLDHL..SCQHTFTNTPDE.SWF
A5E388_LODEL/1-406..KLPLQIAEPWIAV--ADKLGLPPVGTYASLCLWNYK.....QIIPS.....DDILDLDNL..TCINTFTGAIDE.HWF
A2Q0R5_DANRE/10-410..MLPQTLSVPFCDV--SRRLGLPPILIHADTVLANWK.....KTNPN......GPFTMENL..ELLLSLPGGQSL.RGF
Q5KJZ4_CRYNJ/56-570PTSIPPCISIPLLAV--SPLLGLPPILTYADTVLWNFL.....PLNSL.....IAPSAFSNPPNRIITTFTNTRSE.EQF
Q3JAG5_NITOC/2-364..VLPANIAHPLCQA--CALLERPPILSYDGYALYNWK.....RFRPE......GPIALGNI..DTLQNFVHLYDE.HWF
I23O1_RAT/12-404..VLPRNLAVPYCEL--SEKLGLPPILSYADCVLANWK.....KKDPN......GPMTYENM..DILFSFPGGDCD.KGF
I23O_YEAST/19-446..VLPECIARPLLET--AHILGVPPLATYSSLVLWNFK.....VTDECKK.TETGCLDLENI..TTINTFTGTVDE.SWF
Q5BC72_EMENI/5-429..VLPPAISVPYLEV--SRYLELPPVATYAALNLWNWS.....TSSPN.....DDLTCADNL..SVTLSYTGTKDE.EWF
A1CLC8_ASPCL/4-434..RVPPQLTIPLLEV--CDHLELPPVATYAAVCLWNYK.....PIFPD.....EPAHDVDNL..ACISTITGSIDE.RWF
A7SDW8_NEMVE/5-391..VLPKSLAIPLVGV--SEHLGMPPILTHYCYAIYNWR.....VIDIS......RPLTLDNI..KPINTFTGTPSE.DGF
Q5BAC1_EMENI/4-426..RIPPQLTVPLFEV--CDHLDLPPVATYAGLVLWNFK.....PIFSD.....EPMDDLDNL..ACINTITGTLDE.QWF
Q0CZX5_ASPTN/5-428..VLPPAIARPFLEV--SSHLELPPCATYAALNLWNYA.....IPDEN.....ADLTDPEIL..SVTASLTGTKDE.EWF
Q2UJE7_ASPOR/5-428..VLPPAISSPFLEV--SSHLELPPCATYAALNLWNYA.....TSDPN.....ADLTDPDLL..SVTASFTGTKDE.EWF
A7TMA0_VANPO/6-426..VLPDNIANPLLIT--SDKLGLPPLSTYASLILWNFKLNDGEAAFDIISTQQSHEINPDVV..TTINTFTGLIDE.SWF
I23O1_HUMAN/8-400..VLPRNIAVPYCQL--SKKLELPPILVYADCVLANWK.....KKDPN......KPLTYENM..DVLFSFRDGDCS.KGF
A7MBF5_BOVIN/12-403..VLPSNIAVPYCKL--SEKLGLPPILLYADCVLANWK.....KKDLN......GPMTYENM..DILFSFPGGDCG.KGF
A6QUU2_AJECN/4-463..IIPQSISIPLLKI--SAHHELPPIATYSGVCLWNYR.....PIFPD.....EPADNIENI..TSLFTFTGSLDE.QWF
A2QU38_ASPNC/4-436..KIPPQLTVPLFDV--CEHLGLPPVATYAGVCLWNYK.....PIFPE.....ESIDDLRNL..DTINTFTGSLDE.KWF
Q6DFT5_XENTR/4-390..ALPRCLAVPYFNL--SEVLGMPPILVHADLVLANWR.....RKNPQ......GPLTIENL..TTIVSLPGGDSL.QGF
O77056_TEGPF/2-369..SLPNCLAAPLYGI--YEKYDIPPVMTYGDIILNNSV.....AKGAP.........QPENI..GAIIDIPGDKKEWDWF
Q0UZJ9_PHANO/11-417..RLPPAITVPFLKA--AAHLEVNPIATYASYNLWNWR.....PLEED.....LDITNPDNL..VALQTASGSDDE.SWF
A7EY92_SCLS1/4-439..HLPPSITVPLLHI--SNYLEVPPVATYAAVCLWNFK.....PLFAD.....EHVDNLENL..ATLTTFTGSIDE.SWF
A2QJI6_ASPNC/5-428..VLPPCISRPFIEV--SNHLELPPCATYAALNLWNFS.....VPSTD.....TDVTDPDNL..SVVTSFTGTKDE.EWF
Q2BIS7_9GAMM/6-359..SLPANLAKPLCKI--AELMQRPPILSYDGYALYNWR.....RFDLR......KPIQLGNI..DTIQNFVHLYDE.HWF
A3LQQ0_PICST/4-426..KLPKQISEPWVQV--SEHLGLPPIATYAGLCLWNFK.....QIIPTA..EGEDIWDLDNL..TTINTFTGSIDE.SWF
Q7S4S0_NEUCR/4-444..RLPPSIAVPLLKI--SEHLEVPPVATYAAVCLWNFK.....PLFMD.....EDIDNLENL..ATLSTFTGAIDE.SWF
Q75BT3_ASHGO/6-428..TIPESVAAPLLKV--SEALGLPPLATYAGLVLWNFC.....PIFEDEALAGGSVWDLSNL..RTINTFTGSMDE.SWF
Q59XE2_CANAL/2-414..KLPSQIATPWIKV--SDHLGLPPIATYASLCLWNFK.....QIMPS.....DDIWDLDNL..TTINTFTGSIDE.SWF

PF08933

B8E4A3_SHEB2/5-391--TTSPLAEASALAMHIGASIGVTPRFATAHLTTHNRA--------HN----------------GIYKRFTDLPAE-KLF
A1SB64_SHEAM/5-391--TQSPLVEASALAMHIGASIGVTPRFATAHLTTHNLA--------RD----------------GKYKRFTDLPDE-RLF
Q1YT13_9GAMM/2-390--TGSPLREASALAMQLGASLGVIPRFASSHLETHNRA--------IS----------------GVYKTFTDLDDE-KLF
Q4KAM6_PSEF5/14-358--.LVPGLERVLLDL..ARVTDLPPRETLLHVTVWNPA--------AA----------------DAQRSYTGLPDE-AHL
A4CE21_9GAMM/2-388--THSPLQQASALAMHIGASIGVIPRFSTAHLTTHNKA--------VD----------------GVYKRFTTLIDE-KVF
Q3IDE5_PSEHT/2-388--TTSPLVEASALAMHIGASIGVTPRFATAHLTTHNKA--------LN----------------GTYKRFTNLPDE-KLF
A4ABU7_9GAMM/2-390--RSSPLVEASGLALHIGASLGVAPRFATSHLSTHNSA--------SN----------------GVYRSFTKLKDE-FLF
A3QIX5_SHELP/2-388--TSSPLLEASALAMHIGASIGVTPRFATAHLTTHNRA--------VN----------------GLYKRFTDLDDE-KLF
A8H9J6_SHEPA/2-388--RVSPLTEASALAMHIGASIGVTPRFATAHLTTHNRA--------HQ----------------GLYKRFTDLDAE-QLF
Q12IK0_SHEDO/5-391--THSPLTEASALAMHIGASIGVTPRFATAHLTSHNSA--------IN----------------GTYKRFTSLADE-KLF
Q9RPG2_MYXFU/10-369--.VVPGLEPILLAL..ARATQLPPRETLLHVTVWNPA--------AD----------------ELERRYTCCRDE-VHL

PF03301

T23O_CAEEL/22-371TLKIVSGLDRMTKILS-LLTEQITLLDTMSPLDFVDFR--------------------------KYLTPASGFQSL--QF
T23O_ANOGA/11-358TLEILKRLNRIVMILK-LLVDQVPILETMTPLDFMDFR--------------------------DYLSPASGFQSL--QF
T23O_RAT/26-372MLKVMTRMHRVVVIFK-LLVQQFSVLETMTALDFNDFR--------------------------EYLSPASGFQSL--QF
Q9X8R3_STRCO/1-271.....DALKRSVRELE-ALNASWTPLAGLTPAQFNSYR--------------------------SALGEGSGFQSA--MY
Q9RYH4_DEIRA/16-287.....KMLTRVVRAQE-QLTAAWDVLKTMTPADYLQFR--------------------------GAFGQASGFQSQ--NY

PF01231

Q6F3I4_HALDV/3-383FKVTCFVEMAFAKGLQSVQEVLDGVM.EDDN..VKVTSGLTGMTITVGNMQSAMKRMH------------EHLSVPTFYN
MYG_HALDV/2-378LKVCGLVELTLGKGAQSVQNVLDGAK.ANDK..AKMTSGLTELTTTIGNMQAALAKMN------------DNLTPDHFYN
Q6BIB0_DEBHA/3-424YLVSVYFEYKGSFAIKAGLDALGHAR.DGDT..KKLTESLQSMAQAIDSLGSVLMRME------------EMCDPHVFYF
I23O2_HUMAN/12-403ILVTALVEKEAVPGIKALVQATNAIL.QPNQ..EALLQALQRLRLSIQDITKTLGQMH------------DYVDPDIFYA
Q0UCE0_PHANO/4-409YLVSVAIEARAGPIVPLMLDAIAAAR.HNEI..NVVTKALRSFAERLDELGALLERMY------------ESCDPHVFYH
A4UHF3_MOUSE/12-401ILVTVLVEKAAVPGLKALVQGMEAIR.QHSQ..DTLLEALQQLRLSIQDITRALAQMH------------DYVDPDIFYS
A1CHS9_ASPCL/5-426FVISVAIEAKGAELIPLMLNAVYAAT.IDDS..QRVATLLHQLSEGLKELGILLERMY------------EKCSPPVFFH
A1CWY2_NEOFI/5-427FMISVAIEAKGADLITLMLNAIYAAN.LADD..QRVTTLLYQLSDGLKELGEILERMY------------EKCNPHVFFY
Q4P7T1_USTMA/163-708FFTSLLIEARGVEALELMRVSLDEAFVADRVARRRIAGYLNRLAVVIKSLTKLLHDVR------------NGCDPKIFYW
Q2U3U2_ASPOR/4-435YLISVAIEARGAPSLSLALQAIAAAR.AGNS..LVVTESLQKLAEVIDEVGALLERMY------------ENCDPYVFYH
Q6C0A4_YARLI/4-433YLVSTTMERQGGACIKAGLGAIAAAR.ENDF..ATVTSNLQYLAEAIDAIITLLGRMY------------EMCEPHTFYH
A7ESB7_SCLS1/4-425YLVSVAIEARGAEVIPLMIKAMNAVR.ADEP..SILISCLEKFSTCIHDCGILLERMY------------ERCDPEVFYH
A5E388_LODEL/1-406YLVSVYFEQKGALAIATGMEALKCAK.EGDI..PMLTKNLQQMAETIDLLGTALMRME------------EMCDPHIFYF
A2Q0R5_DANRE/10-410FLVTLLVELAAVPGLKAIIDVINGVH.YNDI..ERVTKALDVICQSIDSMKQALKRMH------------EYVDPSIFYG
Q5KJZ4_CRYNJ/56-570YLISALCEIAGAEALGLMRQSLDELFIADEKALRRVTIYLKKLADQIDRISDITMTLM------------NEVDPEEFYH
Q3JAG5_NITOC/2-364ILVHVEIEALAAGIFSGINRLLCEPW.QDDL....INPILQAIGATVWRQVTVLKRIP------------ERMDPALYYR
I23O1_RAT/12-404FLVSLMVEIAASPAIKAIPTVSSAVE.HQDP..KALEKALCSIAASLEKAKEIFKRMR------------DFVDPDTFFH
I23O_YEAST/19-446YLVSVRFEKIGSACLNHGLQILRAIR.SGDKGDANVIDGLEGLAATIERLSKALMEME------------LKCEPNVFYF
Q5BC72_EMENI/5-429FMVSVALEARGARVIEMMLNTIQAVT.VGDD..QRIVAYLNQITEGFNELARILERMY------------EKNRPAVFFH
A1CLC8_ASPCL/4-434YMISVAIEACGGPAIPLVLQAISAAR.AGNS..AVVTECLQSIAETIEQLGVLLERMY------------EHCDPYVFYH
A7SDW8_NEMVE/5-391ITVAVQVEMEFGKSVTSLIASQKAVL.SDDC..QLLRKELFSVQQMISRLTNALLKIH------------DVCKPRDFYC
Q5BAC1_EMENI/4-426YLVSVAIEARGGPAISLVLQAIAAAR.VGNT..AVVIEYLQALAEMIDEIGAVLERMY------------EHNDPYVFYN
Q0CZX5_ASPTN/5-428LMLSVAIEAKGAQVIPLMFEAIHAIS.VDDS..ARVANLLHRFSECLQELRRLLERMY------------EQCRPPVFFH
Q2UJE7_ASPOR/5-428LMISVALEAKGAQLIPLMLDTIHAVS.IDDA..QLACDSLLALSEGLKELRKLLERMY------------EKNRPSVFYH
A7TMA0_VANPO/6-426YIISMFYEKIGGVCLNAGLNLIRAAR.DDSK..AVFIEQINIIAEKVKILGDLFSRMD------------EKTNPDIFYN
I23O1_HUMAN/8-400FLVSLLVEIAAASAIKVIPTVFKAMQ.MQER..DTLLKALLEIASCLEKALQVFHQIH------------DHVNPKAFFS
A7MBF5_BOVIN/12-403FLVSLLVEIAAASAIKVIPSIFDAVQ.RKDS..DTLQKALLEISSSLHKALEVFSQIH------------KYVDPNLFFN
A6QUU2_AJECN/4-463YLVSIAMESHGASTIPLMLNAIAAAR.QNNT..PVVIDCLRTFAQRIHEISEILQRMY------------ENCDPHVFYH
A2QU38_ASPNC/4-436YLVSVAIEARGAPSIPLVLQAIAAAR.AGNS..LVVTECLQRLAEVLDEVGSLLERMY------------EHCDPYVFYH
Q6DFT5_XENTR/4-390ALVTLMVEVAAIPGVRAVCQAVNSLV.SQDE..PRLLQALKDLTESINRMSDALKLMH------------DYVDSDIFYN
O77056_TEGPF/2-369VGVSYMSEFEFAKAVPAIQNVFDGMD.ENND..DKIAAALKQIAEAVANMQKMMGRYG------------EKLPIEGLFP
Q0UZJ9_PHANO/11-417FIISNAMEARAGPMIETMLAAIDAVD.MDNR..ETVIDSLKSFRSSMEDIGGLVERMD------------ERCNPQRFYH
A7EY92_SCLS1/4-439YLVSVAIEARAAPVLPLMLAAIEAAR.KNDS..RTVTSCLRTFAERLDDLGTLLQRMH------------ESCDPHVFYH
A2QJI6_ASPNC/5-428FVLSVAIEAKGAQLIELMLDAMHAAN.VDDS..QRVISRLEQLNYGLKELGDLLERMY------------EKCAPPVFYH
Q2BIS7_9GAMM/6-359ILVHVEIEALAAQILEAVLSLQGECG.AQE.....VDAALDQINTAMTSIIQVLQRIP------------ERMSDELYFA
A3LQQ0_PICST/4-426YLVSVYFEHKGAFCIKMGMDALESAY.RGDT..AQLIKNLQNLAESIDHLGSVLMKME------------EMCDPHVFYF
Q7S4S0_NEUCR/4-444YLVSVAMEARGAPIIPLMLTAIAAAR.VGDG..ATVTRCLHTFAERLDDLTTLLQRMH------------ESCDPKIFYD
Q75BT3_ASHGO/6-428YLISVFFEKRGAQSMNDGLNAIRAVR.SGDR..AGVVAHLQALAEGIDSLGALLGRME------------EMCDPYVFYY
Q59XE2_CANAL/2-414YLVSVYFEHKGALAITTGLDAIKCAY.DNNT..KGLVENLQQLAEAIDSLGSVLMKME------------EMCDPHVFYF

PF08933

B8E4A3_SHEB2/5-391----VDYNTKGILAYKRAADALLKIQ-PLGITHPISHDLLRVAKQALQDVIESNTQLF------------NRLDTDRFFY
A1SB64_SHEAM/5-391----VDYNTKGILAYKRAADALLKIL-PLGVSHPITADLLKVARQALQDVMDSNTTLF------------NELDTDRFFY
Q1YT13_9GAMM/2-390----LDYNTRSVFAFIRASEALRQIL-PLGVSHPVTYDLLLSAKQSLEQVYAYNQTLF------------EKLDVDRFFY
Q4KAM6_PSEF5/14-358----LESVRISMAALEAAIALTVELS-DVSLRSPAFAQGCDELEAYLQKMVESIVYAY------------RFISPQVFYD
A4CE21_9GAMM/2-388----VDFNTKGILAYKQAADSLLRIK-PLGLSHPATAELLKAAVFALQNVHRHNEQLF------------NTLDTERFFY
Q3IDE5_PSEHT/2-388----IDYNTQGILAYKRASDALLKIL-PLGISHPTCAELLKVAKQALIDVIESNNALY------------TQLDTERFFN
A4ABU7_9GAMM/2-390----LDFNTRGIFAYKRAADALVRTV-PLGITHPVTADLLLAAHQTLEDVARYNEQLF------------EQLDPARFFY
A3QIX5_SHELP/2-388----VDYNTKGILAYKRAADALLKIQ-PLGISHPMTAELLEVALVALQQVIASNQTLF------------ERLDTQAFFN
A8H9J6_SHEPA/2-388----VDYNTKGILAYKRAADALLKIQ-PLGIDHPIAYDLLLVAKRALRDVIESNRVLF------------QRLDADDFFY
Q12IK0_SHEDO/5-391----VDYNTRGILAYKRAADALLKIQ-PLGISHPISHDLLIVCQQALQQVIDSNAILF------------ERLDSERFFN
Q9RPG2_MYXFU/10-369----LESVRLSMAALESALHLTVELY-DVPLDSASFAPMCDEITSHLKKMVDSIVYAY------------RNISPRTFMQ

PF03301

T23O_CAEEL/22-371RVLENKLGVRQERRIKYNAQHYKNVF-NDTDL..KTLNVTEEEKSLLTLIESWLERTPGLKSTSEDEGFWIKYEKSVNKY
T23O_ANOGA/11-358RLLENKLGVKSEHRVKYNQK.YTEVF-ASDPGAIERIGTTETEPSLADLVQKWLERTPGLEQDGFN..FWGKFQESVEQL
T23O_RAT/26-372RLLENKIGVLQSLRVPYNRKHYRDNF-EGDYN..ELLLKSEQEQTLLQLVEAWLERTPGLEPHGFN..FWGKFEKNILKG
Q9X8R3_STRCO/1-271RRLEFLLGDKSAS.............-.........MLVPHRGAPRVHAELEKALHEP.................SLYDE
Q9RYH4_DEIRA/16-287RMVEFLLGNRNS...........T..-.........LLRPHEHRADLHRPLAAALHAP.................SVYDL

PF01231

Q6F3I4_HALDV/3-383TVRPYLGGWGG.PSSPLP.NGLIF.................E....GVSEKPFQ...VIGGSAAQSTTLQLMDILLGVTH
MYG_HALDV/2-378VLRPFLGGFGG.PASPIS.GGLIY.................E....GVSDAPVT...MIGGSAAQSSAMQLLDNLLGVTH
Q6BIB0_DEBHA/3-424RIRPYLAGWKNMGDVGLDKDGVIY......................GSETKPRS...YAGGSNAQSSLIQFFDILLGIKH
I23O2_HUMAN/12-403GIRIFLSGWKDNPA..MP.AGLMY.................E....GVSQEPLK...YSGGSAAQSTVLHAFDEFLGIRH
Q0UCE0_PHANO/4-409RIRPYLAGSKNMSDAGLP.RGVIF.................DD..GTGTQPYVQ...FSGGSNAQSSIIQFFDIVLGVEH
A4UHF3_MOUSE/12-401VIRIFLSGWKDNPA..MP.VGLVY.................E....GVATEPLK...YSGGSAAQSSVLHAFDEFLGIEH
A1CHS9_ASPCL/5-426QLRPFLAGSKNMAAAGLP.KGVFY.................DL..G.GHGEWHQ...YSGGSNAQSSLIQTFDIFLGIEH
A1CWY2_NEOFI/5-427QLRPYLAGSKNMASAGLP.QGVFY.................DL..G.GHGEWHQ...YSGGSNAQSSLIQTFDIFLGVEH
Q4P7T1_USTMA/163-708GIRPWFVGSDT.VDKGEE.AGWHF.................E....GVDPEGIKR.VFSGPSAGQSSMIHAIDVFLDVDH
Q2U3U2_ASPOR/4-435RIRPYLAGSKNMADAGLP.HGLLY.................DD..GSTKPEYRQ...YGGGSNAQSSLIQFWDIALGVEH
Q6C0A4_YARLI/4-433RLRPYLSGSENMADRGLP.HGVKY.................QTRADPDSKEYRA...YAGGSNAQSSLIQTLDILLNVEH
A7ESB7_SCLS1/4-425VIRPFLAGSKNMAAAGLP.RGLFY.................DE..GEGNGEWRQ...YSGGSNAQSSLIQFWDAVLGVKH
A5E388_LODEL/1-406RIRPYLAGWKNMASVGLD.NGVFY......................GNEKAPRG...YAGGSNAQSSLIQFFDIILGVKH
A2Q0R5_DANRE/10-410VIRIFLSGWKDNPS..MA.EGLVY.................E....GVDDQPME...FSGGSAAQSSILHCLDELLGIQH
Q5KJZ4_CRYNJ/56-570LIRPWFRGGD..ADGPGS.VGWDYLGLAADNANVVAGTHEAE....SASTEGRRGKLFSGPSAGQSSLIHAIDIFLTVDH
Q3JAG5_NITOC/2-364TFRPYIRYFKN..........VVY.................E....GVKQAPMD...FRGETGAQSSLMPLLVALLKIPH
I23O1_RAT/12-404VLRIYLSGWKGNPK..LP.EGLLY.................E....GVWDTPKK...FSGGSAGQSSIFQSLDVLLGIKH
I23O_YEAST/19-446KIRPFLAGWTNMSHMGLP.QGVRY......................GAEGQYRI...FSGGSNAQSSLIQTLDILLGVKH
Q5BC72_EMENI/5-429LLRPYLAGSKNMASAGLP.NGLFF.................DQ..GNGKGEWLQ...YSGGSNAQSSLIQTFDIFLGVEH
A1CLC8_ASPCL/4-434RIRPYLAGSKNMADAGLP.NGLMY.................DD..GSEKPEYRQ...YGGGSNAQSSLIQFFDIALGIEH
A7SDW8_NEMVE/5-391FIRVFLNGWQSTSA..LP.EGLIY.................E....GVSSTPRQ...YPGGSAAESTVFQVLDAFLGIRH
Q5BAC1_EMENI/4-426KIRPYLAGSKNMADAGLP.NGLLY.................DD..G.KKPEYRQ...YGGGSNAQSSLIQFLDIALGIEH
Q0CZX5_ASPTN/5-428QLRPLLAGSKNMAKAGLP.NGVFY.................DV..GDGEGKWHQ...YSGGSNAQSSLIQTFDIFLGVEH
Q2UJE7_ASPOR/5-428QLRPLLAGSKNMASAGLP.NGVFY.................DI..GDGQGQWHQ...YSGGSNAQSSLIQTFDIFLGVEH
A7TMA0_VANPO/6-426VLRPFLSGWKGMENEGLP.NGVKY......................GKNGKFYK...YAGGSNAQSSLIQFLDVLLDVQH
I23O1_HUMAN/8-400VLRIYLSGWKGNPQ..LS.DGLVY.................E....GFWEDPKE...FAGGSAGQSSVFQCFDVLLGIQQ
A7MBF5_BOVIN/12-403VLRIYLSGWKGNPL..LS.EGLLY.................E....GIWDTPKK...FAGGSAAQSSIFQCFDVLLGIQH
A6QUU2_AJECN/4-463RVRPFLAGSRNMSDAGLP.DGIIY.................DD..GTGSQTRHY...YSGGSNAQSSLIQFFDIVLNIEH
A2QU38_ASPNC/4-436RIRPYLAGSKNMADAGLP.HGLLY.................DY..GNGQPEYRQ...YGGGSNAQSSLIQFFDIALGIEH
Q6DFT5_XENTR/4-390TIRLFLSGWKDNPS..MP.EGLLY.................E....GVAETPFS...FSGGSAAQSSVFQAFDELLGIKH
O77056_TEGPF/2-369KMWAFFGGYGELT...LR.DGLIF.................E....GVKDQPIK...MKGGNASQTPTMRVLDNLLGITH
Q0UZJ9_PHANO/11-417EIRPFLAGSMGMEAAGLP.EGVFY.................DE..GDGKGSWRK...YRGGSNGQSSLLQFCDAVLSVNH
A7EY92_SCLS1/4-439RIRPFLAGSRNMEEAGLP.NGVFY.................DE..GNGVGQYRK...LSGGSNAQSSILQFFDIVLGIEH
A2QJI6_ASPNC/5-428QLRPYLAGSKNMASAGLP.NGVFY.................DV..GEGRGEWHQ...YSGGSNAQSSLIQAFDIFLGVEH
Q2BIS7_9GAMM/6-359KFRPYIGQFNE..........VVY.................E....GVNINPIS...FRGETGAQSSIMPLLTELMKIPH
A3LQQ0_PICST/4-426RIRPYLAGWKNMADVGLDKNGIIY......................GSETKPRA...YSGGSNAQSSLIQFLDILLDVKH
Q7S4S0_NEUCR/4-444RIRPFLAGSKNMADAGLP.HGVIY.................ED..GSGKEEYRQ...YSGGSNAQSSLIQFFDIVLGIEH
Q75BT3_ASHGO/6-428RIRPYLAGWKNMADLGLP.NGVRY......................GDRGEYRT...YVGGSNAQSSLIQMLDILLGVEH
Q59XE2_CANAL/2-414RIRPYLAGWKNMTEVGL..KGVYY......................GEEKTVRN...YAGGSNAQSSLIQFLDILLGVKH

PF08933

B8E4A3_SHEB2/5-391CVRPYYKPYR---------VGSVI---------------------------------YRGANAGDFAGINVIDLTLGLCF
A1SB64_SHEAM/5-391CVRPYYKPYR---------VGSQV---------------------------------YRGANAGDFAGINVIDLLLGLCY
Q1YT13_9GAMM/2-390CVRPYYRPHR---------VGLHE---------------------------------YRGANAGDFSGINVIDLLLGLCR
Q4KAM6_PSEF5/14-358ELRPFYEPIR---------VGGQS---------------------------------YLGPGAVEMP.LFVLEHVLWGSQ
A4CE21_9GAMM/2-388CVRPYYKPHR---------VGSLV---------------------------------YRGANAGDFAGINVIDLLTGLCA
Q3IDE5_PSEHT/2-388CVRPYYKPHR---------VGNEI---------------------------------YRGANAGDFAGINVIDMLLGLCS
A4ABU7_9GAMM/2-390SVRPYYKPYR---------VGKSE---------------------------------YRGANAGDFAGINEIDLLLGLCR
A3QIX5_SHELP/2-388SVRPYYKPYR---------VGQQV---------------------------------YRGANAGDFAGINVIDLQLGLCF
A8H9J6_SHEPA/2-388CVRPYYKPYR---------VGSQI---------------------------------YRGANAGDFAGINVIDMLLGLCS
Q12IK0_SHEDO/5-391CVRPYYKPYR---------VGSQV---------------------------------FRGANAGDFAGINVIDLQLGLCV
Q9RPG2_MYXFU/10-369ELRPYYEPIR---------VGGQS---------------------------------YLGPGAVEMP.LFVLEHVLWGSR

PF03301

T23O_CAEEL/22-371LADLAKQAADPSNTEEIAKQLTAE---------------------------------YHKTADAFQSILDPRQHEQHIRN
T23O_ANOGA/11-358LAEQEASAMSEEHENVREYRL.MD---------------------------------IDKRREVYKSIFDAQVHDALVAR
T23O_RAT/26-372LEEEFLKIQAKKDSEEKEEQM.AE---------------------------------FRKQKEVLLCLFDEKRHDYLLSK
Q9X8R3_STRCO/1-271VVRLLARRGYDIPDAVLQRDLTRK---------------------------------YEAAPEVEAAWTA..........
Q9RYH4_DEIRA/16-287TLRLLAARGLPVPAEVLQRDYAQP---------------------------------YQTNEAVLASWLS..........

PF01231

Q6F3I4_HALDV/3-383SPD................................................................KQAFLNEMRNYMP
MYG_HALDV/2-378SPD................................................................KQAFLDEISNYMI
Q6BIB0_DEBHA/3-424YPTGGRPVPHATTAPKD.................................................GENNFMNEMRSYMP
I23O2_HUMAN/12-403SKE................................................................SGDFLYRMRDYMP
Q0UCE0_PHANO/4-409RPTGEKPSPNPSSSSSHD...............................SG.AV..........QSPPHGFIQDMRRYMP
A4UHF3_MOUSE/12-401CKE................................................................SVGFLHRMRDYMP
A1CHS9_ASPCL/5-426SATGEAKSKGQSKG.....................................................AVGYIQDMRNYMP
A1CWY2_NEOFI/5-427SATGEAKLNNTSQSKP...................................................KIGYIQDMRNYMP
Q4P7T1_USTMA/163-708TRRKQRLHRPAATTNAD.................................A.R............GADATFMERMSLYMP
Q2U3U2_ASPOR/4-435RPTGETRSETD..KDDKE...............................GV.TG...........APRHGFIHEMRSYMP
Q6C0A4_YARLI/4-433RATGQRPTSKKDNSTRDASP............................PAS.QAT........APPKQNNFIHEMRKYMP
A7ESB7_SCLS1/4-425VPTRPMGRSQSEVVPPK...................................K.............GGHGYLDEMRNYMP
A5E388_LODEL/1-406FATGDLKA...........................................................DSSFMDEMRQYMP
A2Q0R5_DANRE/10-410EGN................................................................NGAFLKRMRDYMP
Q5KJZ4_CRYNJ/56-570SPTEEERREAMEAAENRPEQSGVFIKMNSSPVNASTAPSASKPHGHSHGSIAPPVSNSNPSAAAPKSEATFLQRMLAYMP
Q3JAG5_NITOC/2-364QRSS...............................................................LTEHLADMRRYMP
I23O1_RAT/12-404DVGE...GS..........................................................AAEFLQEMREYMP
I23O_YEAST/19-446TANAAHSSQGDS.......................................................KINYLDEMKKYMP
Q5BC72_EMENI/5-429TAMGGPTKTELPKAKL..................................................GKTPYIQEMRNYMP
A1CLC8_ASPCL/4-434RPTGETRPTTSSPQNEKE...............................GV.AG...........SPRHGFIQEMRTYMP
A7SDW8_NEMVE/5-391HSPS...............................................................RTSFLKLMRKHMP
Q5BAC1_EMENI/4-426RPTGETRPSSS....ENG...............................GV.AA...........GPRHGFIQEMRSYMP
Q0CZX5_ASPTN/5-428TATGEVKPSSETQTGA...................................................KNGFMQEMRNYMP
Q2UJE7_ASPOR/5-428IATGGMKTNDAVQPRA...................................................KNGFMQEMRNYMP
A7TMA0_VANPO/6-426MPVGVKNQPQPTTTATTTK..............................SI.TQ..........KDNKKSFIYEMRSYMP
I23O1_HUMAN/8-400TAGG...GH..........................................................AAQFLQDMRRYMP
A7MBF5_BOVIN/12-403SIGGVPADS..........................................................AAEFLQEMRTYMP
A6QUU2_AJECN/4-463RPTGERKHSEKPELSQPPPD............................DGN.SSPT.......PSTKRHNFILEMRSYMP
A2QU38_ASPNC/4-436RPTGETRPSSTPMKDEKE...............................GV.VG...........APRHGFIQEMRTYMP
Q6DFT5_XENTR/4-390RAE................................................................SAEFLLRMREYMP
O77056_TEGPF/2-369PQD................................................................RNAFIEEVLKYIQ
Q0UZJ9_PHANO/11-417AR.................................................................CSGFHAEMRLYMP
A7EY92_SCLS1/4-439RPTGEKKDAASESEVEGS................................A.P............RTKHNFLLEMRKYMP
A2QJI6_ASPNC/5-428SATGETKPHGKSNPQV...................................................MTGFMQNMRNYMP
Q2BIS7_9GAMM/6-359QDNK...............................................................LIRHLYDMRQYMP
A3LQQ0_PICST/4-426YSTGERPIPHQKQTSQD.................................D.R.............PENGFMNEMRNYMP
Q7S4S0_NEUCR/4-444RPTGEKRGRPQEQGEVH.................................A.P............APKHNFLLEMRKYMP
Q75BT3_ASHGO/6-428FQTGVSKTAGRSISAGS.................................................NGNGYINDMRNYMP
Q59XE2_CANAL/2-414YSTGERPLPFKASTGVG.................................................AENGFMNEMREYMP

PF08933

B8E4A3_SHEB2/5-391ANEAS--------------------------------------------------------------YSQMLVDKFLYMM
A1SB64_SHEAM/5-391ANEPS--------------------------------------------------------------YSQMLVDKFLYMM
Q1YT13_9GAMM/2-390ADDPY--------------------------------------------------------------YSQLLVDKFLFMR
Q4KAM6_PSEF5/14-358SDDPA--------------------------------------------------------------YREFKETYLPYVL
A4CE21_9GAMM/2-388GNDPS--------------------------------------------------------------YSQMLVDKFLYMM
Q3IDE5_PSEHT/2-388ANEPS--------------------------------------------------------------YSQMLVDKFLYMM
A4ABU7_9GAMM/2-390AEDPS--------------------------------------------------------------YSQLLVDKFLYMM
A3QIX5_SHELP/2-388ANESA--------------------------------------------------------------YSQLLVDKFLYMM
A8H9J6_SHEPA/2-388ANEPG--------------------------------------------------------------YSQMLVDKFLYMM
Q12IK0_SHEDO/5-391ANDPS--------------------------------------------------------------YSQLLVDKFLYMM
Q9RPG2_MYXFU/10-369VEHPG--------------------------------------------------------------YKDFKETYVPYVL

PF03301

T23O_CAEEL/22-371GNRLLS-------------------------------------------------------------HDATKGAMMIYFY
T23O_ANOGA/11-358GERRFT-------------------------------------------------------------HKALQGAIMITFY
T23O_RAT/26-372GERRLS-------------------------------------------------------------YRALQGALMIYFY
Q9X8R3_STRCO/1-271......-------------------------------------------------------------...........VY
Q9RYH4_DEIRA/16-287......-------------------------------------------------------------...........VY

PF01231

Q6F3I4_HALDV/3-383PAHRQLLLDVMD..................................MPRKLTCMVADSEDS...------.ELTTAYSKC
MYG_HALDV/2-378PAHKQLLADLTK..................................MPRKVPQIVAEAKDA...------.NLSKAYSGC
Q6BIB0_DEBHA/3-424GGHQDFLMKIQE...................................ITNIREYVLGRYDSN..------PELTLSYDAC
I23O2_HUMAN/12-403PSHKAFIEDIHS...................................APSLRDYILSSGQD...------.HLLTAYNQC
Q0UCE0_PHANO/4-409GPHRRFLSHMEQ...................................VANIREFVNSHRDDR..------.ALTTAYDAC
A4UHF3_MOUSE/12-401PSHKAFLEDLHV...................................APSLRDYILASGPG...------.DCLMAYNQC
A1CHS9_ASPCL/5-426GPHRRFLEMLTR...................................ISNVRQYAMGHKPNT..------.EVRDAYNTA
A1CWY2_NEOFI/5-427GPHRRFLEMMIR...................................TSNVRQFAMSYKADT..------.EVRNAYNTA
Q4P7T1_USTMA/163-708GHHRAFLSHLRNISFDDADQDQDEELQDLEPREANSDADGEQQLRELPHPIRSLALKAKSEEHD------EGLPAAYDNA
Q2U3U2_ASPOR/4-435GPHRRFLEHVST...................................VANIREYVEARRSDK..------.ALCIAYDAC
Q6C0A4_YARLI/4-433GPHRRFLEHLQQ...................................VAEIRDFVLANQAEH..------PEIVLAYDAC
A7ESB7_SCLS1/4-425GPHRSFLQYIST...................................NSPIQTYIHETACSS..------.EASQAYNQA
A5E388_LODEL/1-406RKHREFLTALEP..................................YSTTIKQIVQAEEDK...------.ELTLAFDAC
A2Q0R5_DANRE/10-410PSHKQFIQEISI...................................CPSLRDFVLQQADE...------.RLTHAFDKC
Q5KJZ4_CRYNJ/56-570LPHRSFLIHLST..................................HPTPLRPLVLHFAASH..------PTLVQAYDGA
Q3JAG5_NITOC/2-364WKHLQVIKAVEE...................................LPELRPY..........------.AEKEIYNSV
I23O1_RAT/12-404PAHRNFLSSLES...................................APPVREFVILRRNE...------.DLKEAYNEC
I23O_YEAST/19-446REHREFLYHLES...................................VCNIREYVSRNASNR..------.ALQEAYGRC
Q5BC72_EMENI/5-429GPHRRFLEMLTR...................................NANLRPYAMSCKLGS..------.PVRDAYNTA
A1CLC8_ASPCL/4-434GPHRRFLEHVGA...................................VANIREYVGARRSDK..------.ALCIAYDAC
A7SDW8_NEMVE/5-391PKHNEFITAVEN...................................GPSVRHYVENSKDQ...------.RLHEQYNAC
Q5BAC1_EMENI/4-426GPHRKFLEHMGA...................................VANIREYVEARRSNK..------.PLSLAYDAC
Q0CZX5_ASPTN/5-428GPHRRFLEMLAR...................................IAYIRPYAMSHNVGS..------.PVRDAYNTA
Q2UJE7_ASPOR/5-428GPHRRFLEMLTR...................................VSNVRAYALSHKANS..------.PIRDAYNAA
A7TMA0_VANPO/6-426REHRQFLDHVKN...................................ASTIRSYVLANEDDP..------.EITRAYDAC
I23O1_HUMAN/8-400PAHRNFLCSLES...................................NPSVREFVLSKGDA...------.GLREAYDAC
A7MBF5_BOVIN/12-403PAHHSFLLSLKS...................................KPSVREFVLSEGNA...------.TLQEIYNKC
A6QUU2_AJECN/4-463GPHRRFLEHVAS...................................VANIRDYILKHRVDT..------.ALCAAYDSC
A2QU38_ASPNC/4-436AAHRRFLEHVNA...................................VANIRQYVEARRSDK..------.ALCIAYDAC
Q6DFT5_XENTR/4-390PAHRHFVERIGK...................................APSLPGYVQQCGDP...------.ELLSAFNEC
O77056_TEGPF/2-369PSHRKFIQAVAE....................................RQLKGKVDASGNA...------.GLKEAFGAL
Q0UZJ9_PHANO/11-417GPHARFLNDIES...................................IANIRSYVDSHRDDT..------.ELLSAFNEA
A7EY92_SCLS1/4-439GAHRRFLEDMTV...................................VANIRDYVEAHTDNH..------.ELCLAYDAC
A2QJI6_ASPNC/5-428GPHRRFLEMMLR...................................TSNVRSYVLSHKPGS..------.ALRDAYNMA
Q2BIS7_9GAMM/6-359RYDRELLEQVRA...................................MPDIKLL..........------.ASSAKFDAV
A3LQQ0_PICST/4-426GKHREFLQKLQE...................................ASNIRDYVLKHGDSC..------PELLLSFDAC
Q7S4S0_NEUCR/4-444GPHARFLDHVQS...................................VANIREFVEKHRGYR..------.SLGIAYDAC
Q75BT3_ASHGO/6-428EGHRLFLAHLQQ...................................VANIRDYVLSHNFDA..------.ELVLAYDAC
Q59XE2_CANAL/2-414GNHQKFLSKIQE...................................ITNINQYVLDHKDSH..------PELVLSYDAC

PF08933

B8E4A3_SHEB2/5-391PEDQQILRECMR-----------------------------------RPNLMDDFLQAKDSANQ..TWYQENLRLFIEVC
A1SB64_SHEAM/5-391PEDQAILRDCMR-----------------------------------RSSLMEHFLAATGAKEQ..SWYQDNLSLFLEVC
Q1YT13_9GAMM/2-390PDDQLVLRDCMR-----------------------------------RTSLLDSFLATADTDKQ.QPWVQRNLQLFLQVC
Q4KAM6_PSEF5/14-358PAYRAVYARFAT-----------------------------------KPALIDRALDEARAVGT....QGEHVRA.....
A4CE21_9GAMM/2-388PEDQTILRDCMR-----------------------------------QPNMLDQFMAFAGEQHQ..PWYQEHLKLFLELC
Q3IDE5_PSEHT/2-388PEDQQILREAMR-----------------------------------MQSFMDDFLQAQQYKDN..DWFKYHAKLFIQVC
A4ABU7_9GAMM/2-390PEDQARLRDSMR-----------------------------------RKSLMDQILEGLKSPGSCGRYFEENARLFLKVC
A3QIX5_SHELP/2-388PEDQRILRDCMR-----------------------------------RTSLMDDFLAAIEMRDQ..PWYQENLAQFLRVC
A8H9J6_SHEPA/2-388PEDQAILRDCMR-----------------------------------RTSFMDELLNLSHFSAE..PWYQQNVKLFLEVC
Q12IK0_SHEDO/5-391PEDQTLLRDCMR-----------------------------------RESLMNDFLNAREHSQQ..AWYQANLREFLTAC
Q9RPG2_MYXFU/10-369PRFRAVYHQFSD-----------------------------------QPSVLDRVLEGAGGPES....QTEHHRL.....

PF03301

T23O_CAEEL/22-371RDMPRFSQPY-------------------------------------------------------------QILTFLMDI
T23O_ANOGA/11-358RDEPRFSQPH-------------------------------------------------------------QLLMLLMDI
T23O_RAT/26-372REEPRFQVPF-------------------------------------------------------------QLLTSLMDI
Q9X8R3_STRCO/1-271SGDQNG.ELA-------------------------------------------------------------RLGEALTDV
Q9RYH4_DEIRA/16-287CDTETYWDLY-------------------------------------------------------------ELAEKLVDV

PF01231

Q6F3I4_HALDV/3-383LAAVTQFRSYHIQVVTKYVVSASKKGS...........................................RENSHLANMG
MYG_HALDV/2-378VAALTQYRTYHIQVVTKYIVTASKSDS.............................................PKSLAYKD
Q6BIB0_DEBHA/3-424LAMLKSFRDKHIQIVTRYIVLQSKQASKMGSTSTLR.............................SGLAKSKSKSGEERG
I23O2_HUMAN/12-403VQALAELRSYHITMVTKYLITAAAKAKHGKPN...................................HLPGPPQALKDRG
Q0UCE0_PHANO/4-409LAMLRSLRDKHIQLVSRYIIVKSREQTRSLSPQSAPSS........................KINLANTLARGGSKKLRG
A4UHF3_MOUSE/12-401VEALGELRSYHINVVARYIISAATRARSRGLT.....................................NPSPHALEDRG
A1CHS9_ASPCL/5-426VMAVGAFRDKHIQMVSRYIITAARTKPTHKSLVEVNLATV.....................TAASQAQRSDEAPAPGYSG
A1CWY2_NEOFI/5-427VMAVGAFRDKHIQMVSRYIITPSRTKPTQTSSAQVNLATV.....................TAAHQVTRSKDTPA.GYSG
Q4P7T1_USTMA/163-708LQELKALRDEHMKVAYLYIVAQARGSPPDAYAPLAKGFTGEPNVDRRLAA.KAKAHADAEAEARAILDTNSKDNGGGAKG
Q2U3U2_ASPOR/4-435LSMLRTLRDKHIQMVSRYIIIPSRDAK.GRAPRSSSPRRHA..................ATTNLANT.RNSDGKNKKLRG
Q6C0A4_YARLI/4-433LAMLRSFRDKHIQIVSRYIILQAKEKAKTGIALTA......................................PAGPERG
A7ESB7_SCLS1/4-425VETLTSFRDIHIQIVTRYIITPSRKAMAQGTEKENAGL..........................NLAVATTRKGGKDFRG
A5E388_LODEL/1-406LAMLKAFRDKHIQIVTRYVVLQAKKINKMGSNSTLR.............................SGLARKKQNG.EEKG
A2Q0R5_DANRE/10-410VAGLVDFRNCHINIVTRFITIPASRAKQLRANKQNLME..........................ELDTISRAPTALEERG
Q5KJZ4_CRYNJ/56-570LESLRRFRERHMRVVSKFIVQQARRKPGERIRRLTGME........................MEDDEDESTMANAGELRG
Q3JAG5_NITOC/2-364LEAVASFREFHYGLAWEYIQKRTDDPF....................................................G
I23O1_RAT/12-404VNGLVSLRMFHLSIVDTYIVKPSKQKPMGGHK.....................................SEEPSNTENRG
I23O_YEAST/19-446ISMLKIFRDNHIQIVTKYIILPSNSKQHGSNKPNVLSPIE....................PNTKASGCLGHKVASSKTIG
Q5BC72_EMENI/5-429VMALGSFRDKHVQIVTRYIILASKLPPPANTPVRINLAST.....................TQTQMKDSTEKVST.GFSG
A1CLC8_ASPCL/4-434LSMLRTMRDKHIQMVSRYIIVPSRNAR.NHNPGSSSPKRTS..................LAMNLANV....RPGSKKLRG
A7SDW8_NEMVE/5-391VTALQEYRNAHLSIVTKYIIIQANKDP..........................................ENPNRRLANKG
Q5BAC1_EMENI/4-426LSMLQSMRTKHIQMVSRYIITPSQKAR.EKPSRPASLN.........................LATARHSEKPDGSKLRG
Q0CZX5_ASPTN/5-428VMSLGRFRDTHIQIVTRYIIMAAKTAPPKDVPVQVNLASA.....................STEHVKHSKEDVTG.GLHG
Q2UJE7_ASPOR/5-428VMSLGVFRDSHIQIVTRYIIMAAKAKPPTNESTQVNLATS.....................TTTHMRDKNEKLTG.GIHG
A7TMA0_VANPO/6-426LDRLKEFRDKHMKLVARYIINPAKKQK............................................GTFGLATKG
I23O1_HUMAN/8-400VKALVSLRSYHLQIVTKYILIPASQQPKENKT.....................................SEDPSKLEAKG
A7MBF5_BOVIN/12-403VQAMVSLRNYHLQIVAKYIVIPARQQPQ.........................................VEENLEEENRG
A6QUU2_AJECN/4-463LAVLRGMRDKHIQMVSRYIIIKAREAR.AHEDKSTSPRAAPAAPGKSRAVNLARPVAAAANGVGADVTPASGSGSQGLKG
A2QU38_ASPNC/4-436LSMLRAMRDKHIQIVSRYIIIQSRDARPSRPARATSPKRA.....................INLATARHGEKPDSKKLRG
Q6DFT5_XENTR/4-390VLSLTDFRSLHIRIVCKYVSAAGARAKML........................................GNGVQHLQERG
O77056_TEGPF/2-369KAAVSNFRNSHVQVVTKYIVQAMEKNL...............................................PAAKQG
Q0UZJ9_PHANO/11-417VSALSGFRDKHIALVTRYIIIPSRMPKPASAIDRRDIA........................SASTKLAKEEPQTKELVG
A7EY92_SCLS1/4-439LAMLRTFRDKHIAIVTRYIVIKSRESRSHSRSMSPEANRSRK................VDIATASRGKGDDEEKKRKLKG
A2QJI6_ASPNC/5-428VMSLGGFRDKHVRMVTRYIIMAARTPPPNQVSSRTNLATT.....................TSTIVDNSHEKLNA.GVRG
Q2BIS7_9GAMM/6-359LEQMACFREVHYHWAIKYIARRCNDQQ....................................................G
A3LQQ0_PICST/4-426LAMLKSFRDKHIQIVTRYVVLQAKKTNNMGSSSTMR.............................SGLAKKKKNGAEEKG
Q7S4S0_NEUCR/4-444LAMLRALRDKHIAIVTRYIVLPSKEVRTRSRSRSPEAVRRKINLAT........ASRQQPPGIALDTRGDGKKD..NLKG
Q75BT3_ASHGO/6-428VSMMKSFRDRHIQLVTRYIVLQAKKKEPSTKPHATL.............................RSGLSKHSGTMEQRG
Q59XE2_CANAL/2-414LAMLKSFRDKHIQIVTRYVVLQAKKTEKMGSSSTLR.............................SGLARKKK...EERG

PF08933

B8E4A3_SHEB2/5-391ELHGETAIQHHNELVTKYIAEPSTSME--------------------------------------QQHLAK....VTASG
A1SB64_SHEAM/5-391ELHGQTAIQHHDQLVHKYIAEPSVNMQ--------------------------------------QQHMSK....VTASG
Q1YT13_9GAMM/2-390HAHGQTALQHHEQLVNKFIERPADKGS--------------------------------------LSETSG....ITASG
Q4KAM6_PSEF5/14-358...GLTALERVFKVLLRFRAPHLKLAE--------------------------------------RAYEAGRSGPTTGSG
A4CE21_9GAMM/2-388QWHGLTAIQHHNQLVEKYICQPATQLN--------------------------------------QSQMAT....LTASG
Q3IDE5_PSEHT/2-388KLHGDTAIGHHNQLVEKFIAQPSKQMQ--------------------------------------QQHMSK....VTASG
A4ABU7_9GAMM/2-390EAHGRTAAQHHDQLVERFIEKPSSALD--------------------------------------EKHLTH....ITASG
A3QIX5_SHELP/2-388EAHGQGAIQHHDQLVEKYIAQPAKQME--------------------------------------SQHIDK....VTASG
A8H9J6_SHEPA/2-388ALHGETAIQHHNELVAKYIAQPSKTME--------------------------------------QQHMSK....VTASG
Q12IK0_SHEDO/5-391ELHGATAIQHHEQLVSKYITAPSKQLG--------------------------------------QQHLDT....VTASG
Q9RPG2_MYXFU/10-369...GLKALDKVFDVLLRFRAPHVKLAE--------------------------------------QAYLSQQENHSVGSG

PF03301

T23O_CAEEL/22-371DSLFTKWRYNHVLLVQRML-------------------------------------------------------GA.KQG
T23O_ANOGA/11-358DSLITKWRYNHVIMVQRMI-------------------------------------------------------GSQQLG
T23O_RAT/26-372DTLMTKWRYNHVCMVHRML-------------------------------------------------------GS.KAG
Q9X8R3_STRCO/1-271AELVWRWRNDHLVATRRAM-------------------------------------------------------GS.KTG
Q9RYH4_DEIRA/16-287EDNFRRWRFNHLTTVERTI-------------------------------------------------------GF.KRG

PF01231

Q6F3I4_HALDV/3-383TGGTDLLPFLKALRDD---------------------TKKAVN
MYG_HALDV/2-378TGKSDLIPFLKEVRDD---------------------TEKMQK
Q6BIB0_DEBHA/3-424TGGTALLPFLKQCRDE---------------------TGDPAA
I23O2_HUMAN/12-403TGGTAVMSFLKSVRDK---------------------TLESIL
Q0UCE0_PHANO/4-409TGGTALIPFLKQARDE---------------------TGEPAI
A4UHF3_MOUSE/12-401TGGTAMLSFLKSVREK---------------------TMEALL
A1CHS9_ASPCL/5-426TGGTDLIPFLKQTRDT---------------------TKAAAN
A1CWY2_NEOFI/5-427TGGTDLIPFLKQTRDT---------------------TKAAAK
Q4P7T1_USTMA/163-708TGGTDLVTFLRDCRVN---------------------TIDALI
Q2U3U2_ASPOR/4-435TGGTALIPFLKQARDE---------------------TGEPAI
Q6C0A4_YARLI/4-433TGGTALIPFLKQARDE---------------------TGDPAA
A7ESB7_SCLS1/4-425TGGTQLIPFLKQSRDE---------------------TRDMFV
A5E388_LODEL/1-406TGGTSLLPFLKQCRDE---------------------TGNAAA
A2Q0R5_DANRE/10-410TGGSGIMTFLKTVRNE---------------------TKDSSI
Q5KJZ4_CRYNJ/56-570TGGTALFKFLKRCRDN---------------------TTKAML
Q3JAG5_NITOC/2-364TGGTPYIKWLKQLIDE---------------------TRAHQI
I23O1_RAT/12-404TGGTDVMNFLRSVKDT---------------------TKKALL
I23O_YEAST/19-446TGGTRLMPFLKQCRDE---------------------TVATAD
Q5BC72_EMENI/5-429TGGTDLIPFLRQTRDD---------------------TKATAY
A1CLC8_ASPCL/4-434TGGTALIPFLKQARDE---------------------TGEPAI
A7SDW8_NEMVE/5-391TGGSDLVKFLQRVRDE---------------------TKESKL
Q5BAC1_EMENI/4-426TGGTALIPFLKQARNE---------------------TGEPMI
Q0CZX5_ASPTN/5-428TGGTDLIPFLKQTRDA---------------------TKAAAS
Q2UJE7_ASPOR/5-428TGGTDLIPFLKQTRDT---------------------TKATAS
A7TMA0_VANPO/6-426TGSTDFLPFLKQCRDE---------------------TLKAEV
I23O1_HUMAN/8-400TGGTDLMNFLKTVRST---------------------TEKSLL
A7MBF5_BOVIN/12-403TGGTNVMDFLKTVRSK---------------------TKNSLL
A6QUU2_AJECN/4-463TGGTSLIPFLKQARDE---------------------TGESAV
A2QU38_ASPNC/4-436TGGTALIPFLKQARDE---------------------TGEPAI
Q6DFT5_XENTR/4-390TGGSNVMSFLKKVRGN---------------------CKEGVL
O77056_TEGPF/2-369.......E.LKPMKDS---------------------AMKIVQ
Q0UZJ9_PHANO/11-417TGGTKLIPFLRTSRDE---------------------TLETTV
A7EY92_SCLS1/4-439TGGTALIPFLKQARDE---------------------TGEPTI
A2QJI6_ASPNC/5-428TGGTDLIPFLKQTRDT---------------------TKAAAS
Q2BIS7_9GAMM/6-359TGGTPYMRWLKFLIEE---------------------TRGHKK
A3LQQ0_PICST/4-426TGGTSLLPFLKQCRDE---------------------TGDPAA
Q7S4S0_NEUCR/4-444TGGTALISFLKQARDE---------------------TGEPAV
Q75BT3_ASHGO/6-428TGGTSLIPFLKQCRDE---------------------TGSAAA
Q59XE2_CANAL/2-414TGGTSLLPFLKQCRDE---------------------TGDPAA

PF08933

B8E4A3_SHEB2/5-391PPLHVLLGSLERLRDRRAAVQ.RSDIRTRYYEIK...KLKESL
A1SB64_SHEAM/5-391PPLHVLIGALEKLRDRRAAAK.RSDIRTAWQDVA...RLKATL
Q1YT13_9GAMM/2-390PPLPVLLKSLRKLCDMRCAADVGGEFKTRHKDIE...YLKGLL
Q4KAM6_PSEF5/14-358GYAPSMLGDLLTLT...CAARSR...............IRAAL
A4CE21_9GAMM/2-388PPLEVLLNSLSKLRDRRAAAK.RDDIATRFNDLE...TLKATL
Q3IDE5_PSEHT/2-388PPLHVLLDSLEKLRDKRASAK.RDDIKTRYDDIN...LLKQWI
A4ABU7_9GAMM/2-390PPLEVLMAALQKLRDLRTAAP.RDDIQSRYKDIA...AIRSAL
A3QIX5_SHELP/2-388PPLPVLLGALEKLRDRRAAAK.RDDIRTRFDDIA...RLRASL
A8H9J6_SHEPA/2-388PPLDVLLNSLEKLRDRRAAAK.RSDIRTRYEDIQ...SLLASM
Q12IK0_SHEDO/5-391PPLEVLLASLEKLKDKRAASP.RRDIATRFDDIE...ALKASL
Q9RPG2_MYXFU/10-369GYAPGMLEELLALT...REARLRLTLASRAPSASGEPALKHTA

PF03301

T23O_CAEEL/22-371TGGSSGYMYLRSTVSD------------RYKVFLDLFNLSTWL
T23O_ANOGA/11-358TGGSSGYQYLRSTLSD------------RYKVFLDLFNLSTFL
T23O_RAT/26-372TGGSSGYYYLRSTVSD------------RYKVFVDLFNLSSYL
Q9X8R3_STRCO/1-271TGGSAGVAWLEK..RA------------RNNVFPELWTARSYV
Q9RYH4_DEIRA/16-287SGGTSGVGYLRG..AL------------DVVLFPELWDVRTQL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window