Sequence alignment for CL0384

PF03009

A0A017IJS9_ECOLX/36-350----------HRGASGYLP...........E-HTLPAKAMA--YAQGADYLEQDLV-------MTKDD---N--------
A0A023ZID6_YEASX/7-246----------HRAFKARYP...........E-NTLLAFEKA--YAAGADVIETDLQ-------MTSDG---M--------
A0A038FGR1_MYCTX/14-242----------HRGFTSFRL..........PM-NSMGAFQEA--AKLGFRYIETDVR-------ATRDG---V--------
A0A038LRN9_MYCTX/17-259----------HRGASAARP...........E-HTLAAYDLA--LKEGADGVECDVR-------LTRDG---H--------
B1X7Q7_ECODH/12-239----------HRGGGKLAP...........E-NTLASIDVG--AKYGHKMIEFDAK-------LSKDG---E--------
B2RZV2_BORHD/38-330----------HRGASGYLP...........E-HTLEAKAYA--YALGADYLEQDIV-------LTKDN---I--------
C9MK30_HAEIF/40-355----------HRGASGYLP...........E-HTLESKALA--FAQHSDYLEQDLA-------MTKDG---R--------
D6EQ07_STRLI/20-243----------HRGGAADGL...........E-NTLRQFRRA--VGAGYRYIETDVH-------ATRDG---K--------
G4EU08_BACIU/7-235----------HRGASGQFP...........E-NTMLAFEKG--IEAGADGIELDVQ-------LTKDG---R--------
J7JQM5_BACIU/43-285----------HRGASGYVP...........E-HTILSYETA--QKMKADFIELDLQ-------MTKDG---K--------
N1NX43_YEASC/877-1212----------HRGLGKNNPNKS....LQIGE-NTVESFIMA--ASLGASYVEFDVQ-------LTKDN---V--------
O02322_CAEEL/73-322----------HRGSAHDNI..........PE-NSLEAFSAV--KSEGGQLAEMDIQ-------ITMDG---V--------
PGC1_SCHPO/37-267----------HRGYKAKYP...........E-NTILAFQQA--VKAGADCVETDVR-------LTKDE---V--------
O86738_STRCO/16-227----------HRGDPYRHR...........E-NTLDSLRSA--LERGADAVETDVR-------LTRDG---V--------
GPC1A_CAEEL/406-706----------HRGAGNSYTKFA.....MARE-NTIHSLNTA--AKNGADYVEFDVQ-------LTKDR---I--------
GPC1B_CAEEL/349-649----------HRGMGSSYTKNI.....GQRE-NTIFSLNEA--ARRGADYVEMDVQ-------LTKDL---K--------
Q3BZN0_XANC5/274-516----------HRGLFDNHAG........IPE-NSLASIDHA--YEQGYRNLELDVE-------VSSDG---V--------
Q89384_PBCV1/5-217----------HRGCSALFP...........E-NTMMSFRHV--..IP.KAIEFDVR-------KTKDN---I--------
GDE1_SCHPO/752-1061----------HRGLGKNQPDRLS...LQLGE-NTLQSFIKA--ADLGASYVELDVQ-------MTKDM---V--------
Q9RSP0_DEIRA/37-277----------HQGGEALWP...........S-NTLTAYRGA--VALGVDLLEMDLH-------ATRDG---A--------
Q9RWX3_DEIRA/7-220----------HRGSPREHT...........E-NTLASFQAA--LDAGLDGIELDVR-------RLADG---T--------
Q9RZL4_DEIRA/249-566----------HRGSSGTRP...........E-HTLESYRTA--IEAGADFIEPDLV-------VTKDG---V--------
Q9SD81_ARATH/49-357----------HRGSNGELP...........E-ETAPAYMRA--IEEGADFIETDIL-------SSKDG---V--------
Q9SGA2_ARATH/39-318----------HRGHGMNMSQSPDLRFSALKE-NSILSFNAA--SKFPLDFIEFDVQ-------VTRDG---C--------
Q9UAW8_CAEEL/68-331----------HRGAPKSFP...........E-NSMAGFAQA--KADGADLIEFDVA-------LTKDG---K--------
Q9VQU3_DROME/375-661----------HRGSGTSFKAKD....AVIRE-NTITSLKNA--AEHGADMVEFDVQ-------LSKDL---V--------
Q9W2L6_DROME/349-632----------HRGLGKSLTVTTN..AAPLIE-NTVATMLAS--SELGADLVEFDVQ-------LTSDL---V--------
Q9X1V6_THEMA/6-217----------HRGYSAKYL...........E-NTLEAFMKA--IEAGANGVELDVR-------LSKDG---K--------
Q9YFI4_AERPE/15-220----------HRANSGRIA............-....IFYSM--..VGIKAVEV.DV-------SLKSG---K--------
Q9ZTU6_WHEAT/118-414----------HNGASGDYP...........D-CTDLAYQKA--VVDGADVIDCDVQ-------VTKDG---I--------

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441MTHPLKDYFINSSHNTYLSGDQFQ.....SS.SQIEMYRRA..LLAGCRCVELDCW.......DGKDN...D........
Q8IJR0_PLAF7/626-770MNLPLCNYWINSSHNSYLARKQIF.....ST.SNIEQYIYI..LLDGCRCVEFDCY.......YFNKN............
Q6BZ51_DEBHA/455-607FDHPLNEYFISSSHNTYLMGRQVA.....GD.SSIEGYIKA..LQRGCRCVEVDIW.......DGYID...GMDDND...
PLCG2_MOUSE/314-457MNNPLSHYWISSSHNTYLTGDQLR.....SE.SSTEAYIRC..LRAGCRCIELDCW.......DGPDG...K........
PLCL1_HUMAN/400-543MTQPLSHYYINASHNTYLIEDQFR.....GP.ADINGYIRA..LKMGCRSVELDVS.......DGSDN...E........
PLCD9_ARATH/109-254MNAPLSHYFIHTSLKSYFTGNNVF.....GRLYSIEPIIDA..LKQGVRVVELDLL......PFGKDG............
PLCD1_ARATH/107-250MNQPLSHYFLYTGHNSYLTGNQLN.....SN.SSIEPIVKA..LRNGVRVIELDLW......PNSSGK...E........
PLCD6_ARATH/139-282MTAPLSHYFIYTGHNSYLTGNQLS.....SD.CSEVPVIKA..LQRGVRVIELDLW......PNSTGT...D........
A5DAA1_PICGU/440-595FDHPLNDYFISSSHNTYLIGRQFV.....GD.SSIDGYIRA..FQRGCKCVEIDIW.......DGMSI...DGDLDNN..
PLCD4_RAT/292-436MTQPLSHYYINSSHNTYLLGDQFC.....GQ.SSVEGYIRA..LKRGCRCVEVDTW.......DGPDG...E........
PLCZ1_BOVIN/157-300MTHPLTDYFISSSHNTYLISDQLW.....GP.SDLWGYISA..LVKGCRCLEIDCW.......DGSQN...E........
PLCD3_ARATH/108-251MKAPLSHYFVYTGHNSYLTGNQVN.....SR.SSVEPIVQA..LRKGVKVIELDLW......PNPSGN...A........
A5E691_LODEL/21-192FSHPLTDYYISSSHNTYLIGRQVG.....GE.SSLEGYIKA..LKKGCRCVEIDVW.......DGSGG...GASSLVLDG
Q16W08_AEDAE/315-464MDQPLSHYYINSSHNTYLSGRQFG.....GK.SSVEMYRQT..LLAGCRCVELDCW.......DGKGED.EE........
PLCD5_ARATH/114-257MASPLSHYFIYTSHNSYLTGNQIN.....SE.CSDVPLIKA..LKRGVRALELDMW......PNSTKD...D........
Q5QIB9_STRPU/301-444MKQPLAHYFINSSHNTYLLDDQLR.....GP.SSTEAYISA..LQRGCRCVELDCW.......DGPDN...D........
Q6CSI9_KLULA/402-540YSRPLNEYFISSSHNTYLMGKQVV.....DE.VSVEAYTRA..LQQGCRCIEIDIW.......QGDHG............
PLCD3_HUMAN/339-483MNQPLAHYFISSSHNTYLTDSQIG.....GP.SSTEAYVRA..FAQGCRCVELDCW.......EGPGG...E........
Q385H1_TRYB2/248-393MTRPICEYFINSSHNTYLTGDQLL.....SK.SSTDMYKRV..LLDGCRCVELDCW.......DGRKG...Q........
Q16ZC0_AEDAE/42-189MNLPLSQYYIASSHNTYLTGHQLK.....GE.SSVELYSQV..LLTGARCVELDCW.......DGDDG...T........
PLCH1_HUMAN/301-445MDQPLCNYYIASSHNTYLTGDQLL.....SQ.SKVDMYARV..LQEGCRCVEVDCW.......DGPDG...E........
A2QEJ2_ASPNC/86-262LSAPITDYFISTSHNTYLTGNQLY.....SE.SKASAYTNV..LLSGCRSVEIDVW.......DGKAE....GFLGHHKP
Q4N7P5_THEPA/468-615LSLTLRDFWISSSHNTYLIGDQLG.....GS.ATAGALAEA..LLRGCRCIELDCQ.......DGAEE............
A7S279_NEMVE/319-466MNQPLSHYFINSSHNTYLVGRQFG.....GR.SSVEMYRQC..LIAGCRCIELDCW.......DGQND...E........
PLC_DICDI/324-466TSKPLSYYFINSSHNTYLSGHQLK.....GL.STSEMYTNT..LRQGCKCVELDVW.......DGNDG...D........
Q5BFL6_EMENI/534-676FDRPLNEYFISSSHNTYLLGRQVA.....GS.SSTEAYISA..LTQGCRCIEIDCW.......DGADG...R........
Q2HB23_CHAGB/553-696LDRPMNEYYISSSHNTYLIGRQVA.....SI.SSHEGYISA..LLRGCRCIEVDCW.......DGEGN...Q........
A6RBI2_AJECN/84-320LSLPMNNYFISSSHNTYLTGNQLY.....SE.SSTKVYRDV..LLKGCRCLEIDVW.......DGEPD...SSDSSASES
A0CKY8_PARTE/271-413MTKPLSHYYINSSHNTYLTKDQLA.....GD.SSVGQYVIA..LLNGCRCFELDCW.......DSISD...R........
Q5CLA7_CRYHO/367-509MDEPISHYWIASSHNTYLTGDQLT.....SK.SEIGQYITV..LLQGCRCVELDVW.......NGPDG...L........
E9AEI1_LEIMA/296-447MDHPLPHYFINSSHNTYLTGNQLN.....SE.SSCNMYRDV..LLAGCRCVEIDCW.......DGPAG...V........
Q9XWB7_CAEEL/306-468MREPINKYFINSSHNTYCSGNQLVYAIGHCS.ADVEMYRQA..LLSGSRCVELDMW.......DNKDK...DG.......
Q8IA75_CAEEL/367-517MKQPFSRYFISSSRKSYLVEDQL......GP.SSSDGFSSA..LKRNCRFLEFDIW.......DPNEA...DGD......
PLC1_YEAST/382-521YSKPLNHYFIASSHNTYLLGKQIA.....ET.PSVEGYIQV..LQQGCRCVEIDIW.......DGENG............
PLCE1_HUMAN/1394-1541LQLPLSYYYIESSHNTYLTGHQLK.....GE.SSVELYSQV..LLQGCRSVELDCW.......DGDDG...M........
A7RXP6_NEMVE/244-393MTQPISHYFINSSHNTYLTGHQLT.....GK.SSVEMYRQT..LLAGCRCIELDCW.......DGKTED.QE........
Q7QHE3_ANOGA/319-462MSRPLAHYWISSSHNTYLTGDQFS.....SE.SSVEAYARA..LRMGCRCIELDCW.......DGPDN...M........
A0BLC4_PARTE/285-429EDFPLTDYWINSSHNTYLMGDQLT.....SE.SSIQAYINA..FQKGCRCVELDCW.......DGDNN...Q........
Q6FY00_CANGA/381-519YSRPMNQYYIASSHNTYLTGKQIG.....GA.PSVEGYIQA..LQQGCRSVEIDMW.......DGESS............
A0BLM0_PARTE/262-404LSQPITKYLINSSHNTYLETNQLT.....GE.SSCFAYQDA..FKMGFKCVELDCW.......DGEDG...E........
Q59LC4_CANAL/566-727YDYPLNEYFISSSHNTYLTGRQVA.....GD.SSVEGYIRT..LQRGCRCVEIDIW.......NGDSN...TTTTTVIGT
Q2UPV6_ASPOR/98-321YSAPISDYFISSSHNTYLTGNQLY.....SD.SDASAYTNV..LLNGCRCVEIDVW.......DGERS...SESASADDT
Q4PDE8_USTMA/122-279RSRPLSEYFVSSSHNTYLLAHQLY.....GS.SSAVAYEHV..LIAGARCVEIDAW.......DNEDD...PQ.......
A7T501_NEMVE/158-302MTRPLSHYFIASSHNTYLTGDQLA.....SA.SSMDMYVRV..LQSGCRCLELDCW.......DGKDG...E........
A7ASE0_BABBO/522-670LKYPLNSFWIASSHNTYLTGNQVG.....GA.AAAGALADA..LLRGCRCIELDCQ.......DGPNG...E........
Q4PA81_USTMA/724-872MTRPLSEYYISSSHNTYLVGGQWK.....GD.STVEGYIRA..LLQGARSVELDCW.......DGPNN...V........
A7TR21_VANPO/381-520YSKPLNHYYIASSHNTYLLGKQFG.....ET.PSVEGYIQV..LQQGCRCVEIDIW.......DDENG............
Q75C92_ASHGO/397-535YSRPLSEYFISSSHNTYLLGNQVG.....SM.ASVEGYIQA..LQQGCRSVEIDIW.......DSDDG............
A7RPQ0_NEMVE/307-450MTQPLSHYFIASSHNTYLLDNQLS.....GR.SSIEGYIAA..LQQGCRCVELDCW.......DGPYD...E........
A7SXK4_NEMVE/94-237MNQPLSHYFIASSHNTYLLGHQLK.....GS.SSVQAYRDV..LERGCRCVELDCW.......DGDDE...E........
A4S165_OSTLU/1-153MTDELSHYFVNSSHNTYLDGGQLF.....SR.STSSAIAWA..LERGCRVVELDCY.......DGGSK...G........
Q7PW25_ANOGA/289-436MDQPMAHYFINSSHNTYLTGHQLT.....GK.SSVEIYRQS..LLAGCRCVELDFW.......NGRTE...E........
A7RKT2_NEMVE/272-413MDQPLSDYFINSSHNTYLTGHQLK.....GL.SSLEAYVRA..LLQGCRCIELDIW.......DGPDE............
A3LSB2_PICST/461-615MSYPLSEYYISSSHNTYLVGRQVA.....GD.SSVEGYIRA..LQRGCRCVEVDVW.......DGEVA...ESEEGVQ..
A3LNB7_PICST/20-167LSIPGTHNSAACHTALPSVQ............CQGKSVTDQ..LKHGVRFLDIRAGRQLIKNDDPKQE............
PLCH2_HUMAN/328-472MTQPLSHYFITSSHNTYLVGDQLM.....SQ.SRVDMYAWV..LQAGCRCVEVDCW.......DGPDG...E........
Q0UVV5_PHANO/116-337ESYPISNYFISSSHNTYLTGNQLS.....SE.SSTDAYKNV..LMRGCRCVEIDVW.......DGEPP...SDSSSDEEE
Q4QBH9_LEIMA/195-340MDQIMCCYFISSSHNTYLTGDQLT.....SK.SSAQMYKKG..ASRRVPVREAICR.......NGPHG...E........
Q0UE70_PHANO/101-258RNHPLPEYFISSSHNTYLMAHQLF.....GE.SHASAYEIA..LYTGSRCVEIDAW.......DNDDN...KE.......
PLCL2_MOUSE/429-572MKQPLSHYFINSSHNTYLIEDQFR.....GP.SDITGYIRA..LKMGCRSVELDVW.......DGPDN...E........
PLCZ1_CHICK/159-303MNHPLCDYFISSSHNTYLVSDQLI.....GP.SDLNGYISA..LLKGCRCLEIDCW.......DGSNN...D........
Q2GUM5_CHAGB/104-264RSHPLPEYFISSSHNTYLMSHQLF.....GA.SSAAAYETT..LKAGARCIEIDAW.......DNPDN...CT.......
Q21754_CAEEL/318-461MDQPLTHYFVNSSHNTYLTGLQVK.....GE.ATVEGYISA..LRKGARLLELDLF.......DGEHG...E........
A7SDH9_NEMVE/209-352MRQPLSHYFIASSHNTYLMEDQLK.....GP.SSVDAYINA..FNKGCRCVELDCW.......DGDNG...D........
A4HCK9_LEIBR/248-393MDQTISCYFINTSHNTYLTGDQLT.....SK.SSPEMYKRV..LLDGCRCVELDCW.......NGPHG...E........
PLC1_SCHPO/443-585MSRPLNEYLISSSHNTYLLGKQFG.....GE.SSIEGYIRS..LQRGCKCIEIDCW.......DGPNG............
Q013R6_OSTTA/119-269MTSEMSAYFVNSSHNTYLDGDQLF.....SR.ASVAAIAGA..LDRGCRVIELDVY.......DGKKR...GDK......
Q75IL8_ORYSJ/119-262MGLPLSHYFIYTGHNSYLTGNQLS.....SG.CSEVPIVKA..LHDGVRVIELDLW......PNAAKD...A........
PLCD8_ARATH/107-248MHAPLSHYFIHTSLNSYFTGNVF......GK.YSILPIIEA..LEQGVRVVELDLW......PDGRGS............
Q6CD33_YARLI/505-648LNRPLNEYYISTSHNTYLIGRQVA.....DT.SSEEGYIRA..LQSGCRSVEIDIW.......DGPDD...R........
A7UXE0_NEUCR/118-273.DYPLPEYFVSSSHNTYLCAHQLF.....GE.SSTDPYRHT..LQAGSRCVEIDVW.......DNPDNL.DE........
A9RJG9_PHYPA/150-293MNAPLSDYYIFSSHNTYLMGNQLC.....SP.SSTAPIVKA..LLDGCRVIELDCW.......NGSNK...R........
A9SXU1_PHYPA/108-250MTQPLSHYFIFTGHNSYLTGNQLS.....SD.SSDVPIAAA..LQRGVRVVELDLW.......PDDKG...G........
B4H106_DROPE/328-471MNMPLSSYWIASSHNTYLTGDQFS.....SE.SSCEAYARA..LRMGCRCIELDCW.......NGPDN...L........
B6C9K2_SOLLC/110-252MNAPLSHYFIFTGHNSYLTGNQLT.....SD.CSDVPIIKA..LKKGVRVIELDIW......PNSDKD...D........
B6KHA6_TOXGO/407-549MSLPLCNYWVKSSHNTYLCGDQVV.....GK.SAVGQYIDA..LLRGCRCVELDCW.......DGSDG...E........
E9QD74_DANRE/316-459MQQPLNHYFISSSHNTYLMEDQLK.....GP.SSTEAYIKA..LMKSCRCVELDIW.......DGANG...E........
F1R8S3_DANRE/294-437MNQPLSHYFISSSHNTYLMEDQLK.....GP.SSTEAYIRA..LLKGCRCVELDCW.......DGSDG...E........
F6HKS4_VITVI/112-254MNAPLSHYFIYTGHNSYLTGNQLS.....SI.CSDVPVINS..LQCGVRVIELDMW......PNSTKD...D........
F7DT82_CALJA/159-308MDHPLAHYFISSSHNTYLTGRQFG.....GK.SSVEMYRQV..LLAGCRCVELDCWD.....GKGEDQ...E........
G3GVA5_CRIGR/324-467MDQPLSHYLVSSSHNTYLLEDQLT.....GP.SSTEAYIRA..LCKGCRCLELDCW.......DGPNQ...E........
G3UXP4_MOUSE/322-465MNNPLSHYWISSSHNTYLTGDQFS.....SE.SSLEAYARC..LRMGCRCIELDCW.......DGPDG...M........
G4UMR8_NEUT9/110-362LSYPLSSYFISSSHNTYLTGNQLS.....SE.SSVDAYRNV..LLRGCRCIEVDVW.......DGSDS...ESEDDDGDA
PLCB_CAEEL/342-492MDQPLCHYYINSSHNTYLTGRQYG.....GK.SSSEIYRQV..LLSGCRCIELDCW.......DGTGENKGE........
H2SZT5_TAKRU/30-172MNNPLSHYWINSSHNTYLTGDQLR.....SE.SSTEAYVRA..LRLGCRCVELDCW.......EGPGE............
H2USZ2_TAKRU/343-506MTMPLSHYYISTSYRSYLLDDQVH.....GR.ADLGGLIKA..LQSGCRCVELGVT.......DGPEG...EPLLGVDY.
H3CD03_TETNG/306-449MEQPLCNYFIASSHNTYLTGDQLL.....SH.SKTDMYAWV..LQSGCRCVEVDCW.......DGPDG...E........
H3CYP8_TETNG/287-430MTQPLAHYFISSSHNTYLTKDQLT.....GD.SSTEPYIRA..LSRGCRCVELDCW.......DGDKG...E........
H3D277_TETNG/321-464MKQPLSHYYINSSHNTYLIEDQFR.....GP.SDVTGYIRA..LKMGCRSVELDVW.......DGPDG...E........
H3D2C1_TETNG/321-464MNQPLSHYYINSSHNASLLEDHFW.....GS.SDVSSYIRA..LRMGCRSVEVIVW.......DGPDN...E........
H3D5C7_TETNG/314-459MRQPLNHYFISSSHNTYLMEDQLK.....GP.SSTEAYINLQSTDEECRCVELDCW.......DGPNG...E........
H3DBV7_TETNG/298-442MSRPLAHYFISSSHNTYLTKDQVT.....SA.SSTEPYIRA..LNQGCRCVELDCW.......DGDRG...E........
H3DF29_TETNG/89-233MDQPLSSYFISSSHNTYLTGDQLV.....GK.SHLDAYVCA..LRKGCRCLEIDCW.......DGADM...E........
H3DK53_TETNG/325-468MSQPLSHYYICSSHNTYLIEDQIR.....GP.SDISGYIRA..LKMGCRCVEVDVW.......DGSDG...E........
I1R783_ORYGL/114-256MSAPFSHYYIYTGHNSYLTGNQLN.....SD.SSDIPIIKA..LQRGVRVIELDMW......PNSAKN...N........
K4A9N8_SETIT/153-295MNAPLSHYFIYTGHNSYLTGNQLS.....SD.CSDAPIIKA..LQIGVRVIELDIW......PNSSKD...D........
M1BNL7_SOLTU/113-255MTAPLSHYFIYTSHNTYLTGNQLN.....SD.CSDVPIIKA..LQQGVRVIELDMW......PNSSKD...N........
M1CL37_SOLTU/111-252MNAPLSHYFIYTGHNSYLTGNQLS.....SD.CSDVPIIQA..LHRGVRVIELDIW......PNSAKD...D........
M4FG24_BRARP/66-209MDAPISHYFIFTGHNSYLTGNQLS.....SD.CSEVPIIDA..LKKGVRVIELDIW......PNSNKN...D........
PLCB2_RAT/314-464MTQPLNHYFINSSHNTYLTAGQFS.....GP.SSAEMYRQV..LLSGCRCVELDCW.......KGKPPD.EE........
PLC_LISMO/61-198LSIPGTHDTMSYNGDITWTLTKPL.....AQ.TQTMSLYQQ..LEAGIRYIDIRAK..........DN............
PLCB3_MOUSE/319-469MTQPLSAYFINSSHNTYLTAGQLA.....GP.SSVEMYRQA..LLWGCRCVELDVW.......KGRPPE.EE........
Q236T7_TETTS/331-475MDKPLSDYFINSSFRSYLVYDLVT....QTK.DLTKAYIYL..LQKGVRHLDIYCQ.......DGESG...V........
PLC_STAA8/51-192.NIPGSHDSGSFTLKDPVKS..VW.....AK.TQDKDYLTQ..MKSGVRFFDIRGR.......ASADN...M........
Q4DUP6_TRYCC/248-392MNQPICNYFINSSHNTYLTGDQLT.....SN.SSADMYRKA..LLDGCRCVELDCW.......DGFAG...E........
Q4WX21_ASPFU/96-334LSAPITDYYVSSSHNTYLTGNQLY.....SD.AAAAAYTNV..LLNGCRCVEIDVW.......DGDAD...DDSVSGDDT
Q5A0L4_CANAL/21-164.SIPGTHNSAACHTALPSVQ............CQGASVTEQ..LEHGVRFLDIRVGKL...FVGNDVK...D........
Q5KJZ5_CRYNJ/160-301MTHPLQHYFISSSHNTYLVGEQWK.....GE.STVEGYIRV..LLAGCRCVEMDVQ.......SGDVE............
Q7SE08_NEUCR/136-356LTYPISNYFISSSHNTYLEGNQLS.....SK.SSAEAYKAV..LRNGCRCIEIDVW.......NGAPS...RTPSKSPNG
Q81A32_BACCR/58-194.SIPGTHDSGTFKLQNPIKQ..VW.....GM.TQEYDFRYQ..MDHGARIFDIRGR.......LTDDN...T........
PLCD4_ARATH/116-257MDAPLSHYFIFTGHNSYLTGNQLS.....SN.CSELPIADA..LRRGVRVVELDLW.......PRGTD...D........
W4XJU2_STRPU/318-467MEQPLSHYLINSSHNTYLTGRQFG.....GK.SSVEMYRQV..LLAGCRCVELDCW.......DGRSED.QE........

PF00387

G8BKQ6_CANPC/644-760VSELGVYLQGI.KFR.....N.......FSLPES.KIYN..............HCF-------SLSEK------------
A7RPQ0_NEMVE/492-607LSDLVSLCKSV.TFQ.DF..Q..................YSA...DNQK..FWELC-------SLNEA------------
F2ULH4_SALR5/541-656LSDLVNYCTPY.HFS.NF..D..................VAR...ANNN..CYHIS-------SFSEK------------
G4VBK4_SCHMA/531-646LSSFVNYAQPV.KFQ.GF..D..................VAE...DENI..HHHMS-------SFSET------------
S0DQT6_GIBF5/306-423LAELGVYAQSV.KPMDNS..W.......FEEG.SL..TN.....G.PHH....HLI-------NVSES------------
E9GFR8_DAPPU/479-594LSDLVNICEAK.KFG.GF..HQNIETGR.......................CFHIS-------SLSEI------------
G0WGC6_NAUDC/598-716....ISAIHGL.KFR.....N.......FSLSES.KATT..............HCF-------SLNEK------------
L0PAS0_PNEJ8/47-161LSNLSVYIKSI.KFH.....N.......FSLPES.KIFT..............HIF-------SFSEK------------
K0R6H0_THAOC/569-682LSRLTLF.NGI.KFK.SF..A........................DSSNLNPHDMH-------SFSET------------
I3JX91_ORENI/928-1039MSEVVVYCQPR.SKE.KD..R.......F................DSYS..YKEVR-------SFVEN------------
I3K883_ORENI/523-637LSDLVAIARTG............................SRSFYAQRASHNYWTLC-------SLGEG------------
E2BGZ2_HARSA/531-646LSSMINYAQPI.KFQ.SF..E..................IAE...SKNI..HHNMS-------SFSET------------
J3K9R2_COCIM/769-886LADLGVYARGY.KWR.....G.......FDTPES.KQFN..............HVY-------SFAER------------
I1G7J0_AMPQE/80-196MSDIVVYCQPTKAFT.ID..N.......P................TKGK..YYHMT-------SFVET------------
G8JQV5_ERECY/594-709.......VHGI.QFR.....N.......FSLPES.KTPT..............HCF-------SLSER------------
F6SF88_CIOIN/565-682LSVLVNYCQSV.KFP.GF..K.......K.........VQAE...SEKC..CFHMS-------SFSEN------------
G2R3P3_THITE/406-520LASLAIYTHSE.HYE.....D.......ETSLAL.RTPS..............HVF-------SLSED------------
F2U545_SALR5/2126-2244FTDLIQYTASTPTFE.GF..HHALLFNR.......................CWTMT-------SFGEN------------
PLC_DICDI/543-652.....IYLVSH.GFK.SG..N........................TTKEIPSYKIH-------SLVEE------------
B3SC97_TRIAD/538-653LSSVVIYTQPV.PFP.GF..E..................EAK...QRNL..HYNMS-------SFNES------------
T1J420_STRMM/330-445LSDLVNICTAV.HFR.SF..DHAKKQGK.......................WYEMS-------SLSED------------
E4XLQ6_OIKDI/964-1081LSDVVVYCQAT.TWSEEF..L.......................QPNNKREFRQMS-------SIGES------------
J9MUK9_FUSO4/781-897LGDLGVYCFGV.NYV.....G.......FDTAEA.KQYN..............HIF-------S.MES------------
U7PV69_SPOS1/502-615LGNLAVYTESR.HYH.....S.......FSNRDA.KLPS..............HIF-------SLSET------------
A5DAA1_PICGU/648-764LSDLAIYIQGI.KFR.....N.......FSLPES.KTFN..............HCI-------SLSEK------------
H2N2E2_ORYLA/491-606LSDCVIYCKSF.HFR.SF..KHSQMH.SK......................FYEVA-------SFTES------------
G8BYA3_TETPH/612-727.......IHGL.KFR.....N.......LSLPES.KSLT..............HCF-------SFNEK------------
D7ELR5_TRICA/967-1083MSNLIIYCRSI.TFN.IE..R.......A.........RQQG.....FI..FYEMS-------SFPET------------
A7SMY6_NEMVE/400-514LSDLIVYCQPV.PFD.IE..N.......L.........GNGK.........HYEMS-------SFPET------------
S7ZDD6_PENO1/368-480LSNMAVYTKAF.SFS.....H.......FDQPEA.KYPG..............HIF-------SLSEK------------
E9HXQ7_DAPPU/696-810LSDIIVYCQAT.HFN.QE..R..................ILS...KGRN..PCEMS-------SFCEP------------
H0ZA90_TAEGU/543-658MSSLVNYIQPI.KFN.SF..E..................VSA...KKNR..SYVIS-------SFTET------------
F6S6B2_CIOIN/946-1058LSDLIVYCRPV.QFN.EN..A.......K..................GH..CYEMS-------SFPES------------
F0XRH2_GROCL/838-956LGCLAVYCVGVHKAT.....P.......FDDAEC.KTFN..............HIL-------SWDES------------
G4N054_MAGO7/418-530LSDMGIFTRGV.SFK.....S.......LSQPEA.VMPT..............HIF-------SVSEK------------
T1KUP6_TETUR/217-327LSDL.IYLK...RFR........................CNDFGYVLKNQKLDQVC-------YLDEA------------
F6RLC5_XENTR/487-602LSDCVIYCKSV.PFV.SF..QHSRAH.YT......................LYEMS-------SVTEY------------
U1HY48_ENDPU/777-894LANLGVYLQGY.KYR.....S.......LIGPEC.GEYN..............HIF-------SLDET------------
B7P4X9_IXOSC/943-1057LSNLIIYCRSV.QFC.PE..R.......I..................GN..FTEMS-------SFPET------------
G2YC85_BOTF4/422-534LSKLGIYTHSE.HFV.....S.......FDVRAA.TKPS..............HIF-------SVGEK------------
L8FTI0_PSED2/766-883LGDLGVYTAGV.KFH.....G.......FDAPES.KTYN..............HIY-------SFMEA------------
U3JVN7_FICAL/532-647LSDIVVYCKSV.HFE.GF..DDPNHP.RA......................FYEMS-------SFSES------------
Q4PDE8_USTMA/317-433LCSLGVYAQSV.KPVNDS..W.......YAAT..L..TN.....G.PHD....HLI-------NISET------------
I3L7K2_PIG/492-608LSDMVIYCKSV.HFR.GF..PSPGTPGQA......................FYEMA-------SFSEN------------
H3BDF5_LATCH/514-630LSDCVIYCRNV.QFS.SF..KHSQLH.YK......................SYEIS-------SFTES------------
K5XX24_AGABU/562-680LLSLLVYTVGV.KCH.GIGPD........................TPVTYAPEHIF-------SLSEN------------
H2SZT4_TAKRU/541-665MSDLVVYCQPR.SKE.KD..R.......FGKGTQMLLGTNNV...NSYS..YKEIR-------SFVEN------------
H3CR59_TETNG/503-618LSDMVIYCKSV.HFS.GF..EDARKN.LS......................FYEMS-------SFKEG------------
H3A2I8_LATCH/834-950LSELVVYCRPV.PFE.EE..K.......I.........GTDK.....AC..YRDMS-------SFPET------------
R8BVG2_TOGMI/308-425LAELGVYAQSV.KPTNNS..W.......FDPG.EL..KS.....G.PHH....HLI-------NVSES------------
W5MU43_LEPOC/512-627LSDLVIYCKSV.HFP.GF..ESAREK.QS......................FYEMA-------SFKEG------------
M2UIG2_COCH5/302-418LANLGVYAQSV.KPVNNS..W.......FESH..L..EN.....A.PHH....QLI-------NVSES------------
S3DHJ9_GLAL2/313-430LADLGVYAQSV.KPSDNS..W.......YDQP.AL..TN.....G.PHH....HLI-------NVSES------------
W1QFP3_OGAPD/592-708LGNLGIYVIGI.KFR.....N.......FSLPES.KTFN..............HCF-------SFSDK------------
H2UH12_TAKRU/488-602LSDLVIYTKSV.RVH.DI..E........................TQAFTNSWQVS-------SLNET------------
L8FLM5_PSED2/482-594LSALGIYTHSS.HFS.....S.......LTASSA.SIPS..............HIY-------SLSEG------------
H2YFJ0_CIOSA/524-639MSSLVNYVQPV.RFK.SF..D..................ISE...RRKR..CYEIS-------SFTES------------
K7M553_SOYBN/345-454IHNT........KLK.........................GCMKDKLKTDGEVRRL-------SWSEK------------
F2U1Z4_SALR5/471-588FSDIVSL.KSV.HFN.........................PSSLDNLDAAAGNTMS-------SFGEA------------
G3P4B1_GASAC/508-622LSELVVYCSSV.PFR.GF..ENASEK..P......................PNEMS-------SFSES------------
R7YJ72_CONA1/333-445LSRLGVYTRSY.HFK.....S.......FSQPEA.RIPT..............HIF-------SLSEG------------
N4UQ90_FUSC1/308-422LAELGVYMRSE.PFQ.....G.......FNTSRA.KSPG..............HVF-------TLPEG------------
D5GAP7_TUBMM/347-465LAALGIYCSSH.HFP.....SR.AAQPFTEEPTS.RIPN..............HVY-------SFSEK------------
J9NP56_FUSO4/284-405LDGLEIYMRSK.PFE.....G.......FDNIGA.KDPA..............HVF-------SLQEQ------------
K1WAI4_MARBU/420-532LSNLGIYTHSE.HFV.....G.......FETKSA.TRPS..............HIY-------SIGES------------
S8A7Z1_DACHA/271-383LSALGVYASAM.KFAE....S.......FTDAVS.TRPN..............HVF-------SFSEK------------
Q013R6_OSTTA/352-465.LKRIVSVPNV.KFR...........................SFHEARDV.PRFSC-------SWSER------------
K1PZR1_CRAGI/575-690LSDLVNYCVST.RFQ.DF..Q.......V..........SQQ....KQK..FFEMC-------SFSES------------
Q9XWB7_CAEEL/528-650LSAITNYMQAY.ETSRGV..S..................TVVNLENATKDIVPCIV-------SADEN------------
C9SV93_VERA1/293-405LSDLGFNSRGV.SFK.....S.......LDQPEA.AMPT..............HIF-------SLAEK------------
A4S165_OSTLU/202-315..KALVSLRNL.KFH...........................GFKEAKDLGTKFSC-------SWSEN------------
N1RC01_FUSC4/282-393LAELAVYMRNE.PFE.....G.......FNTPWM.KSPT..............HVF-------SLPEH------------
C7ZJB8_NECH7/239-351LSDLAIYTQSE.AFR.....G.......FDTPAA.RKPS..............HIF-------SLSET------------
G0RBZ6_HYPJQ/342-459LAQLGVYAQSV.KPKDNS..W.......FDPG.QL..VD.....G.PHH....HLI-------NVSES------------
G7P2D3_MACFA/393-508LSSLVIYLKSV.SFR.SF..THSKKH.YH......................FYEIS-------SFSET------------
D2VS67_NAEGR/554-665LYDLLFFKSVV.DVHHEY..P.........................EETSQIHKMI-------NLSEG------------
A8Q3V0_BRUMA/969-1079LSDLVVYCQAV.PFN.SQ..F.......A................TQGN..FYEMC-------SFSET------------
A1CJQ9_ASPCL/375-487LSRLAIFTKGF.HFS.....Q.......FSQPEA.KVPG..............HVF-------SLSEH------------
H3A3M2_LATCH/610-722LSDLVVYTNSV.AAQ.DI..V.......DD.....G............S..FGNAL-------SFSET------------
Q21754_CAEEL/494-608LSALIGLPSVK...........................LSHNIYQDVNKHPFDGSP-------SLSEN------------
E9G040_DAPPU/487-602LSDLIALNRGS.SIK........................LPSSRDKSKK..KKCGY-------SLSES------------
E9C115_CAPO3/737-852LSELVIYTEPI.PFK.SF..A.......................DSRENARCNQMC-------SFGEA------------
V2Z343_MONRO/363-478.LPLLVYTVGV.KCR.GI..N........................KKEYYNPEEMF-------SLSEK------------
W4XRL3_STRPU/213-326FSRLIVYCRSV.PFS.EE..R.......I.........PGK..........YFEMS-------SFPET------------
W5N0K4_LEPOC/507-620LSELVVYCRST.PFR.GF..EQAAQL.........................PNEMS-------SFSES------------
N1QLI7_SPHMS/293-404LGSMGIFTRAF.HFR.....G.......FDDPTA.TIPT..............HVF-------SLGES------------
Q4PA81_USTMA/993-1113LASLLIYTIGV.KCR.GF..N........................KKESYATQHMV-------SLSEK------------
R7YQ07_CONA1/783-900LGDLGIYARGI.KYS.....S.......FSAPEA.NTYN..............HIF-------SFNER------------
PLCZ1_CHICK/377-492LSDLVIYTKSE.KFV.SF..EHSLAH.QK......................CYENN-------SIGEL------------
G1NLG3_MELGA/393-511ISYMVVYQKCFRYFS.............................HENLTKYFQFTK-------RFSKA------------
H3ERT0_PRIPA/495-607LSDLVNYIQAE.RSS........................QMKIDGSDKPKNFYIMH-------SLSEE------------
R1EKA9_BOTPV/390-502LSRLGVYTWAI.RFQ.....S.......LSQPEA.NYPA..............HIF-------SLSEG------------
H3CZG1_TETNG/283-398MSNLVIYIQPV.KFH.SF..E..................ASK...KINR..SYQMS-------SFVET------------
T1G6Y6_HELRO/929-1047FSDLIVYCQPV.KYS.EE..K.......V...........IS...NRIN..YYEMF-------SLPET------------
N4VFU7_COLOR/301-417LEALGVYAQSV.KPVDNS..W.......FEEV..L..KE.....A.PHH....HLI-------NVSES------------
PLC1_YEAST/590-709....ISGIHGI.KFR.....N.......FSLPES.KTIA..............HCF-------SLNER------------
Q4DUP6_TRYCC/458-575LSRVV.......SIE.SA..G.......FKGTSDTSYLEKRQ.........PYQCT-------SFVES------------
F4NTE5_BATDJ/674-789LEALIIYCKGV.SLH.....S.......VTLPQNPLKFD..............CMY-------SFSER------------
F2TZD4_SALR5/1418-1533LSALVHYTQAV.RFH.GF..D.......H................PNAAATAAFMS-------SFSEK------------
S3CWU2_GLAL2/446-558LSNLGIYTHSE.HFK.....S.......FDTLSA.KSPP..............HVF-------SIGEN------------
C5MGF2_CANTT/703-819LSDLGVYAQGL.KFR.....N.......FSLPES.KTYN..............HCF-------SLGEK------------
A7S279_NEMVE/566-681LSSLVNYIQPV.PFQ.GF..D..................ESE...KRNL..FYQMS-------SFNES------------
E5STY8_TRISP/976-1085LSDIMVYCQAI.PFN.PG..K........................IPGS..HREMC-------SFSEL------------
F9WW59_MYCGM/306-422LAELGVYAQSV.KPSNNS..W.......FESE..L..QD.....R.PHN....HLI-------NVSES------------
S3BUU6_OPHP1/912-1029LGSLAVYCMGVHKTT.....P.......FEDADC.KLFN..............HIL-------SWDEQ------------
F2U5I3_SALR5/965-1082LSALVFYSQSV.PFR.SF..E........................ENCSLEYFKMS-------SFSEK------------
K7H8T9_CAEJA/525-647LSEIINYMQAF.ESNKGL..G..................TAANLENALTDPTHFIV-------SADEN------------
G2WWA7_VERDV/450-561LGDLAIYTHSE.HFK.....G.......FET.VS.KKPS..............HIY-------SIAES------------
Q75C92_ASHGO/595-713....ISAIHGI.TFR.....N.......FSLPES.KTPT..............HCF-------SLSER------------
Q17CT3_AEDAE/942-1053MSDMIIYCRSV.PF........................KNSG.....WV..FYEMS-------SFPET------------
H2ARE2_KAZAF/619-733.......IYGL.KFR.....N.......FSLPES.KTVN..............HCF-------SLNEK------------
C3ZX35_BRAFL/216-331LSDLVNICEAV.HFH.SF..QHSREN.DM......................PYNMS-------SIKEG------------
A8Q4L8_MALGO/619-735LVRLLVYTVGV.PFR.GL..N........................KKEQYAAEHMF-------SLSER------------
B6JVB4_SCHJY/640-754LQELSTYSRSI.KFR.....N.......FSLPES.KTYD..............HIF-------SFSER------------
M7TCG9_EUTLA/559-676LGELGVYCTGV.KFH.....G.......FESSDC.KLNN..............HIL-------SFMEG------------
G3NGW3_GASAC/357-472LSNIVVYCKSV.HFN.SF..DHAKEM.QA......................FYEMS-------SFKES------------
A9V4B2_MONBE/210-323..QDLVYLHQT.EFHSLF..A..............SRYTTYAAASVFDWPQVAQLT-------RHHQS------------
G3WFA8_SARHA/54-171LSDLVIYTNSV.AAQ.DI..V.......DDALKQTG............T..TGNVL-------SFSET------------
G1KGF4_ANOCA/537-652LSDVVVYCQAV.PFQ.SL..SRALHN.QQ......................SNEMS-------SFSER------------
F4X6N0_ACREC/597-712ISALVNYVQPV.HFN.SF..E..................SAE...KKKR..MYEMS-------SFDEK------------
G3WAG3_SARHA/506-619LSDLVIYCCAL.KVE.KL..PRINPQ.........................PCWVP-------SFTEL------------
Q5KJZ5_CRYNJ/354-466LSELLVYTHGV.KYQ.GF..S........................KLNEYLPSHQF-------SVSER------------
G4UK54_NEUT9/327-448LAELGVYGQSV.KPPDNS..W.......FTSSDLLPSKD.....G.PHH....HLI-------NVSES------------
H3G127_PRIPA/946-1056LSNLVVYCQAV.PFN.PS..R.......I................KENS..FYEMC-------SFSES------------
F4PW61_DICFS/518-627......YFLTK.GFK.SV..E........................ESNTLPPWVMH-------SFSEA------------
G4TVY5_PIRID/719-847LVPLLVYTSGV.TFR.GL..Q........................PKKTYGPSQVF-------SLSES------------
M4A2J9_XIPMA/503-618MSNLVNYVQPV.KFK.GF..D..................NAL...RRRR..HYEMS-------SFVET------------
E9C1B4_CAPO3/887-1002LSDIVAYCRSI.PFE.SF..EASREK.TK......................YYEMS-------SFEEK------------
H0ZQ48_TAEGU/377-492LSDLVVYTKSQ.KFV.SF..EHSQQH.QQ......................CYENN-------SIGES------------
E4UYL4_ARTGP/377-489LSRLGIFTRGY.TFN.....N.......FAQPEA.KIPH..............HIF-------SLSEA------------
W5KFU3_ASTMX/71-182LSDLVVYTRSV.PFK.GF..SEAAKK..P......................PNEMS-------SFTEK------------
F8QEC8_SERL3/510-622..SLLVYTVGV.KCR.GI..N........................KKEHYAPEHLF-------SLSES------------
G8YRD2_PICSO/652-768LSDLAVYVQGI.KFR.....N.......FSLPES.KTFN..............HCF-------SLSEK------------
H6BNY9_EXODN/314-431LAELGIYAQSV.KPKDNS..W.......YAEV.GL..KD.....G.PHH....HLI-------NISET------------
N1Q1A9_MYCP1/804-922LGKLGVYTQGI.KFT.....G.......FEAPDA.KLYN..............HIY-------SLAEN------------
D3BQ91_POLPA/553-667LSRLI.YLIGS.GYK.SP..D........................LSKMKSPAYMH-------SLSEG------------
V2XG66_MONRO/249-363LAELGLYARSM.KPTPG...W.......LQQD..L..TD.......PRN....ILI-------NISEP------------
G2XH69_VERDV/316-433LSELGVYAQSV.KPPNNS..W.......FDPG.GQ..FV.....G.PHH....HLI-------NVSES------------
G9P5U2_HYPAI/366-478LARLAVYTQGV.TFK.....N.......WTQPEA.TMPT..............HMF-------SVSEK------------
F4S5V3_MELLP/586-701LSDIAVYTIGV.KAR.GF..N........................KITKYELEDCV-------SLSER------------
G3NDC5_GASAC/480-595LSDLVVYCKSV.HFQ.GF..EHARSQ.AK......................CYEMS-------SFSES------------
G3Y1M7_ASPNA/321-433LSKLAVFTKGF.HFS.....N.......FAQPEA.KVPS..............HVF-------SLSEK------------
V8NBX9_OPHHA/517-632LSDLVTICKSV.QFK.DF..E..................NSM...KKQN..YWEMC-------SFSEG------------
M2NIY8_BAUCO/658-779LGRLGIYTQGM.SFPKPW..G.......FDDPKL.RAYN..............HIL-------SFSED------------
E9F491_METAR/362-474LSKLGIYTRAV.SFK.....T.......WAQPEA.SMPT..............HIF-------SLAEK------------
B2APA5_PODAN/327-447LEELGVYAQSV.KPGDDS..W.......YAGECVL..RN.....R.PHH....HLI-------NISEA------------
U1NK79_ASCSU/575-691LSDLVNYMRAMGKLT.SF..E.......................ESESKQMSSELF-------SMTET------------
T5AMI8_OPHSC/302-414LSRLGVYTQAV.SFK.....A.......WTQPEA.QMPT..............HIF-------SLAEK------------
B7Q2N6_IXOSC/514-630LSNIVNYCKAS.HFK.SF..E........................EAEKWHFYEMA-------SFSEG------------
I1RRH2_GIBZE/358-468LSKMGFHCRGV.SFK.....S.......LSQPEA.GMPT..............HIF-------SLSEK------------
C3ZUS9_BRAFL/419-534LSDLVNVSQAK.HFH.SF..QHSQEK.DM......................ACNMS-------SITES------------
F7BFD4_HORSE/377-492LSDLVIYTKAE.KFR.SF..QHSRLH.QQ......................FNESN-------SIGES------------
C4R8N7_PICPG/562-681LSFLGIYLSGI.KFR.....N.......FSLPES.KSFN..............HVF-------SFSES------------
B6HG38_PENCW/308-420LAKLAVYTRAY.KFS.....H.......FDQPEA.KVPL..............HVF-------SLSEK------------
A7RPT6_NEMVE/607-722LSDLVAYTQSR.AFK.GL..E.......VE.....E.........DGEN..HWEVI-------SIPEP------------
G7PV15_MACFA/479-594LSALVVYCHAT.RLR.TL..HPAPDA.PQ......................PCQVS-------SLSER------------
G1KDV8_ANOCA/504-618LSDTIVYCKSV.HFK.GF..NSAT.P.PA......................FNEMT-------SFTES------------
F6V4E2_XENTR/493-608LSDTVVYCKSV.HFG.GF..DYALEH.QS......................FYEMS-------SLAED------------
E4Y2H6_OIKDI/537-648LSSMVNYCTSV.RFP.GF..D..................ESE...ATNR..CYQMS-------SFSET------------
B5YNJ7_THAPS/196-310LAKLTLF.HGT.KFR.TW..E........................ESSQTPTYHMH-------SFSES------------
E3RKS1_PYRTT/745-863LGNLGVYTKGV.KFN.....D.......FASASA.NTYN..............HVF-------SINER------------
C5GIH2_AJEDR/773-890LAELGVYSRGY.KFH.....S.......FNSPES.KRFN..............HVY-------SFAEK------------
Q6CD33_YARLI/707-821LGELGVYVQGL.KFR.....N.......FAFPES.KTTN..............HCF-------SFSER------------
E3QFQ0_COLGM/792-909LGDLGVYCAGV.KFG.....G.......FDAPDA.KAYN..............HIF-------SFMES------------
Q8IJR0_PLAF7/979-1086.......LKGY.VFRNFY.............................ETRNYNEIC-------SISEN------------
H3B651_LATCH/510-624LSDLVVYCKSI.HFP.GF..EEAKE..QP......................FYEMS-------SFDEN------------
B8JLR7_DANRE/165-276LSDLV.YMKSV.GMP.DF..E.......SQ.....G............V..TWQVS-------SMSET------------
L2GAB8_COLGN/486-597LSNLAIYTHSE.HFK.....S.......FETPAA.KKPG..............HIF-------SISES------------
Q6FY00_CANGA/576-698.LYELAGLRGV.KFR.....N.......FSLPES.KTLY..............HCF-------SLDER------------
H2MWG8_ORYLA/509-623LSELVVYTRSV.HFK.GF..DQAAKS..S......................PLQMS-------SFSER------------
L2FNL9_COLGN/331-443LSRLGIHTRGI.TFK.....S.......FEQLEA.SMPN..............HIF-------SLSEK------------
F4PW60_DICFS/469-579.....IYLLSK.GFS.SV..D........................DSNKLPVWVMH-------SFSED------------
M4FUS1_MAGP6/840-957LGDLAVYCAGI.KFQ.....G.......FDHADC.KMFN..............HIF-------SFPEG------------
W4Y1W0_STRPU/441-553LSDLVKYTRSV.AFK.GF..P........................ENMP..CWELP-------SLGEM------------
N1Q7T0_MYCFI/249-360LSNMGIFTRAF.HFH.....S.......FDQPES.RIPT..............HVF-------SLGES------------
G1X2N7_ARTOA/734-851LGELGVYTRGQ.KFK.....N.......FSLPES.KSFN..............HVF-------SLAER------------
D4A881_RAT/472-587LSALVVYLRTA.PFC.SF..THSKEN.YH......................IYDIS-------SFSES------------
J3PD85_GAGT3/457-567LSRLAVYTHSK.HFH.....G.......FNDRVC.KTPS..............HIF-------SLQEN------------
J9FJP4_WUCBA/677-792LSSLVNYTHPV.KFS.GF..D..................VAE...ANNL..HFHMS-------SFSES------------
E4WY87_OIKDI/494-609LSDLVIYTQSR.HLK.DF..D.......................EAQQNSDFRHIS-------SIDDK------------
G0RQN5_HYPJQ/375-487LSDLAVYTRSE.RFK.....S.......LSTPQA.KQPT..............HIF-------SISED------------
E5S0V3_TRISP/556-672LSALVNYMKAT.KFK.SF..E..................DSA...SRNF..SNEVT-------SFSEV------------
E9HCC3_DAPPU/480-597...LLNICRS...FT.NF..E..................KYEYHNTRHKSACYCVI-------SMSEL------------
G4U8M0_NEUT9/388-500LAALAIYTRSE.HFD.....D.......VNSLSS.TTPS..............HIF-------SVNED------------
H3A2R7_LATCH/432-547FSDVIVYCKSV.HFH.GF..EHAQNK.QA......................VYEMS-------SFAER------------
G0S1B2_CHATD/408-522LAALAIYTHSE.HYE.....D.......EHSLGS.RTPS..............HIF-------SLSED------------
G0VE13_NAUCC/579-693.......IHGI.KFR.....D.......FSLPES.KTCT..............HCF-------SINEK------------
U1LYV5_ASCSU/529-640...LISLPSVK...........................LSSNIYQDVKEHPMDGSP-------SLSET------------
F2TW56_SALR5/229-338......YLDFT.TFKSLY..G.........................SRFAATHAAT-------EFTYK------------
H2S9Y1_TAKRU/516-631LSDLVTLCRSV.RFI.DF..S..................TSS...KSQK..TWEMC-------SFHET------------
A4I027_LEIIN/518-635LSALV.......SIE.SS..K.......CHDVKDLSYLKDKQ.........PYHCS-------SYSER------------
A4I5X4_LEIIN/479-593.SHLLRSCVTVGAFK...........................TSDWGRDAEPYYIQ-------SYVET------------
J7S7W7_KAZNA/613-728.......MHGI.KFR.....N.......FSLPES.KTLM..............HCF-------SLNEK------------
I3LUM3_PIG/517-632LSDLVKYTKSV.GIH.DV..E.......TE.....G.........EGRR..VWQVS-------SFSET------------
Q2GUM5_CHAGB/309-422LAELGVYAQSV.KPRDDS..W.......YVEG.KV..KD.....GPPEH....HLI-------NVSES------------
E7F646_DANRE/482-596LSD.IMFCKSV.HFH.SF..EHSRIS.AK......................PYEMS-------SFSES------------
R1G5R1_BOTPV/762-880LSALAVYTRGI.KYS.....D.......FRAPEA.KTYN..............HIY-------SFAER------------
B7P6Q6_IXOSC/455-570MSALVNYIQPV.RFH.SF..E..................HAE...KRDR..SYEIS-------SFVET------------
C7YZS5_NECH7/344-456LSNMGIYKRGV.SFK.....A.......LDAPEA.SHPM..............HVF-------SLSET------------
E5S7A2_TRISP/292-403...LIAIVSAK............................LVNPLVDLERHPVNSMA-------SKSED------------
T5AHM7_OPHSC/836-953LGALGVYCAGV.KYF.....G.......FESPAA.KTFN..............HIF-------SFMET------------
W5K5D9_ASTMX/504-619LSDLVIYCKSV.HFS.GF..EHAKEK.QS......................FYEMA-------SFKES------------
V2XVI5_MONRO/531-646LLSLLVYTVGV.KCR.GF..S........................QTQHYAPEHIF-------SLSEN------------
A7TR21_VANPO/594-716ELSEIAGIQGL.KFR.....N.......FSLPES.KTRI..............HCF-------SLNEK------------
H6BSD8_EXODN/761-878LSALGVYLKGY.TLR.....E.......ARDLGF.QQYN..............HIF-------SLNEN------------
G1SZX7_RABIT/565-680LSTMINYAQPV.KFQ.GF..H..................VAE...ERNI..HYNMS-------SFNES------------
W5NED0_LEPOC/303-418LSDLVIYTKSV.KFI.SF..SHSSGN.QK......................FYENT-------SLGEN------------
H2Y8L4_CIOSA/418-534LSDLVVYCKSV.KFK.SL..T.......S..........NTT...KPDR..FADIS-------SFTEA------------
F6QRY0_ORNAN/482-597LSDLVTYCKSV.HFE.GF..EGSARD.RP......................FYEMS-------SLSEN------------
W5K097_ASTMX/925-1036MSDLVVYCQPR.SKD.KE..S.......F................DNYT..YKEVR-------SFVEN------------
R4GLW0_CHICK/523-638LSDCVVYCKNV.SFR.GF..QEARNH.SR......................PSEIS-------SLSEA------------
M7XIS4_RHOT1/672-788LANLLVYTIGV.KAR.GF..N........................KKEKYAATHVI-------SLGES------------
C4Y529_CLAL4/632-746LSDLGIYVQGT.KFR.....N.......FSLPES.KTFN..............HCF-------SLSEK------------
N1PRW4_MYCP1/309-425LAELGVYAQSV.KPRDNS..W.......FEAQ..L..QG.....G.PHD....HLI-------NVSES------------
K1PD91_CRAGI/941-1059LSDLIIYAVAV.PFD.HE..K.......V.........LKKM.....SH..IAEMS-------SFSEI------------
H0ZM24_TAEGU/68-179LSDLVVYTNSV.AAQDIV..D................DGTGLAQGWHVPWLAHHLR-------ELSAA------------
G4MWU9_MAGO7/371-483LSRMGVYTRGV.SFK.....S.......LSQAEA.TMPN..............HIF-------SLSEK------------
Q5QIB9_STRPU/495-609LSDLVT.LASV.HYG.SF..PASKEK.YK......................CHQMS-------SFGEA------------
S3CY83_OPHP1/495-607LSQLGIYTQGV.SFK.....S.......LSQPEA.NMPT..............HVF-------SLSEK------------
E9C539_CAPO3/1229-1344LADLAVYCQGV.SFV.SF..V.......HSR..............ENHT..NFMQS-------SFGET------------
E9C6P6_CAPO3/838-953LSDLVVYTKAV.TFE.SL..KQAHKDTR.......................CYEMS-------SVPEK------------
U9U0Y0_RHIID/792-909LSDLVVYCSAV.KFK.GF..DNSLNKGNSK.....................FYHMS-------SFSER------------
K1VS91_TRIAC/657-769LVDLAVYTQGT.KYR.GF..S........................KLVHYASNQMF-------SVSER------------
A4HCK9_LEIBR/443-560LSAIV.......SIE.AS..G.......YKGVKDLSYLLDKQ.........PYHCS-------SFSEG------------
F1QJ13_DANRE/490-604LSDLVVYTSSV.AFK.QF..DPSAKK..A......................PNEMS-------SFSES------------
G9MGY4_HYPVG/754-871LGKLGVYCAGL.KFS.....G.......FEAPAA.KKFN..............HIF-------SFMES------------
R4GHY9_CHICK/479-594LSAMVVYCQAT.PFP.GL..AQALQH.PR......................PYEMS-------SFSER------------
G7DTU8_MIXOS/579-693LARLAVYTQGV.QGR.GF..N........................KKEHYAPTHMI-------SLGER------------
U1HPN2_ENDPU/378-490LSQLGVYTRGF.TFK.....Q.......FDQPEA.SIPT..............HVF-------SLSEA------------
T1K2W1_TETUR/963-1075LSNLIIYCRSV.PFV.PE..K.......I..................GI..FTEMS-------SYPET------------
I4YJJ0_WALSC/187-305LSALGVIAMSV.KPGNRE..W.......WNARSRI..TE.......PRN....AVI-------NVGES------------
F0XQ81_GROCL/442-554LAQLAVYTRGV.SFK.....S.......LAQPEA.TMPT..............HVF-------SLSEK------------
U4LP91_PYROM/778-895LGRLGVYCRGQ.KFR.....N.......FALPES.KTYN..............HIF-------SFQEK------------
C1MLD2_MICPC/347-455.......IENI.KIK...........................VIKEALEIERVISC-------SWDEL------------
M3ZIE9_XIPMA/486-601LSDLVKYTCSV.GLY.DI..E.......TQ.....G.........ESNC..SWQVS-------SLSET------------
D8Q686_SCHCM/514-628LASLLVYTVGV.RCH.GL..E........................HIEDYSPEYIF-------SLSER------------
E0V9R3_PEDHC/981-1097MSNLIVYCRSV.AFN.ME..R.......L.........KKNG.....FI..FAEMS-------SFAEN------------
F1QS56_DANRE/596-708LSDLVVFTNSV.ASQ.EC..L.......DE.....G............S..PCNVL-------SFSEA------------
Q7ZZ38_DANRE/570-685MSTLVNYIEPV.KFK.SF..E..................VAA...KRKK..FFEMS-------SFVET------------
S3CK06_OPHP1/317-437LAAIGVYAQSV.KPSNNS..W.......FEPPGEL..TD.....R.PHH....HLI-------NVSES------------
I1FVA6_AMPQE/653-769LTELLNYVTAM.SFG.SF..E..................ASE...KLNC..HYIMS-------SFGEE------------
G2QE78_THIHA/369-481LSKLGIYTRGV.SFK.....S.......LTQPEA.TMPT..............HIF-------SLSEN------------
F9X062_MYCGM/294-423LSSMGVFTRAF.HFS.....N.......FEQPEA.KIPT..............HVF-------SLSES------------
B3S5L7_TRIAD/600-715LSDLINL.KCI.TFN.GF..Q.......E..........AKE...NNRN..YYETS-------SFEEV------------
U7PMJ4_SPOS1/852-970LGCLAVYCVGVHKTT.....P.......FEDPEC.KAFN..............HIL-------SWDET------------
K1R906_CRAGI/339-447.....VGFKAV.GFK............................GVEESINSKGIFV-------SLGEN------------
Q6CSI9_KLULA/623-738.......IHGV.RFR.....N.......FSLPES.KTTT..............HCF-------SLSEK------------
N1JC99_BLUG1/775-892LGELGVYTRGI.GFS.....G.......YDSPEC.KTYN..............HIF-------SFMES------------
E9BY96_CAPO3/640-755LSALVVYCKAV.HFK.SF..DDSAAN.GK......................YWEMS-------SFAEA------------
F1R8S3_DANRE/484-599LSDIVIYCKSV.PFH.GL..EDSREK.HS......................FYEMA-------SFKEG------------
C5DWX3_ZYGRC/549-664.......IYGL.KFR.....N.......FSLPGS.KTTT..............HCF-------SLNER------------
J3P931_GAGT3/353-465LSRLGIYTRGV.TFK.....S.......LSQPEA.AMPN..............HIF-------SLSEQ------------
G8ZY68_TORDC/585-700.......LHGL.KFR.....N.......LSLPES.KTVA..............HCF-------SFNEK------------
H9KC07_APIME/873-989MSNLIVYCRSV.AFN.LD..R.......I.........KTKG.....FT..FNEMS-------SFPET------------
J9EUZ4_WUCBA/174-288LSKLISLFQVK...........................LSNNLRDDIEKHPANCSV-------SISET------------
J9JQK0_ACYPI/173-289ISDLIIYCRSV.AFC.LE..T.......Q.........RERG.....FV..HNEMS-------SFPEN------------
T1FX15_HELRO/212-327LSDLVTICQST.SFT.SF..NHSASHHS.......................FQNIC-------SFDEN------------
PLC1_SCHPO/638-752LQQLAPYARSL.KFR.....N.......FSLPES.KTYS..............HIF-------SFSER------------
I4Y9T4_WALSC/324-435LLDLLIYTVGV.KFR.GF..N........................KKEHYNIEHIF-------SLSDR------------
I1RGV1_GIBZE/283-390LQKLAIYGAGK.RLPHPD..A.......ID.....SHRN..............FIY-------SMSET------------
A7RXP6_NEMVE/450-565LSELVNYFQPV.HFK.SF..D..................VSA...KRNR..SYEMS-------SFVET------------
M1WD50_CLAP2/329-446LAELGVYAQSV.KPIDNS..W.......FKPG.VL..TN.....G.PHH....HLI-------NISES------------
C7YLY8_NECH7/448-559LGSLAVYTRSQ.HYK.....S.......LATKEA.KIPP..............HIF-------SISEN------------
E4ZW47_LEPMJ/391-503LSRLGVYFGGY.SFK.....S.......LDAPEA.QIPT..............HVF-------SLSEK------------
T1JBA8_STRMM/526-641LSNLVNLCQAV.HFK.NF..NHSIHHGK.......................CYEIS-------SLSES------------
H2Z2T5_CIOSA/481-594LSNLVSICSCV.RFV.DF..Q..................GHE...RIHK..CSATS-------SLHEQ------------
G3B2Z3_CANTC/553-668LSDLAVYVQGQ.KFR.....N.......FSLPES.KTFN..............HCF-------SLSEK------------
F0Z941_DICPU/560-673.LSSLIYLVSH.SFK.SA..S........................NTKELPCYLMH-------SLSEE------------
F6XYJ8_XENTR/524-634LSDLVVYCQTV.EYR.GQ..P......GN......................VCEMS-------SFSED------------
R8BH76_TOGMI/661-777LGDLGVYCLGI.KFR.....G.......FDDAEC.KSFN..............HIL-------SFKER------------
G2Q018_THIHA/394-509LAELAIYTHSE.HYV.....D.......ENSLSSCESPS..............HIF-------SINEG------------
I3JP81_ORENI/305-420LSDLVIYTRSV.KFI.SF..SHSRDN.QN......................CYENT-------SMEEK------------
C6HRC6_AJECH/378-490LSRLGIYTRGH.TFS.....K.......FSQQEA.TQPN..............HIF-------SLSES------------
B0D2M8_LACBS/202-309LVALLVYTVGV.KCR.GI..N........................KKEEYAPVHMF-------SLSEN------------
Q1LWW2_DANRE/15-130MSNMVVYCQSI.KKK.TF..E.......N..................YN..YKEVR-------SLPDN------------
T1GAZ8_MEGSC/275-385MSDLIIYFRSV.PFR.EK..N..........................WT..IYEMS-------SFSET------------
F6Y1S7_CIOIN/466-581LSDLVIYAQSR.HFH.NF..P.......................DAKHNSDFRHIS-------SLNED------------
K5XNX9_AGABU/250-367LAEVGYYFRSM.KPSKN...W.......FSRL..I..PD.......PPN....ILL-------NISES------------
N1QL86_SPHMS/786-905LGKLGVYAQGI.KFG..A..G.......FLTPGS.KAYN..............HIY-------SFNEN------------
Q385H1_TRYB2/453-569LSRLI.......SIE.SI..G.......YKGVEDLSYLEMRQ.........PYHCS-------SFTEG------------
C1FE07_MICSR/227-338....LVYVENV.KLP...........................TPHQSTSLKSLHSC-------SWSES------------
E3MQ20_CAERE/991-1101LSNLVVYCQAV.PFD.PA..H.......I................QNDA..FYEMC-------SFVEG------------
Q2HB23_CHAGB/790-904LGELGVYCMGI.HFD.....G.......FDSPDA.KKFN..............HIF-------SFKEK------------
F7FGQ0_MONDO/286-401LSDLVIYTKAE.KFK.SF..HHAQIN.QK......................FNENN-------SIGEL------------
F6ZK74_CIOIN/369-484LSDLVIYTRSI.EFP.GF..D..................ATT...EVYR..AFEVW-------SFSEK------------
H2URW7_TAKRU/209-324LSELVSLCKSV.QFR.DF..E..................ITK...REQK..YWEMC-------SFNEV------------
A3LSB2_PICST/670-786LSDLGVYFQGL.KFR.....N.......FSLPES.KTYN..............HCF-------SLSEK------------
E9BX46_CAPO3/922-1038MSDVVVYTKSV.PFQ.SF..EHSKKTYK.......................CYEMS-------SFPEK------------
C3Z9I4_BRAFL/477-593LADLIVLCKSD.KIE.DL..P.......T..........SAS....ESC..AQYVC-------SFSQS------------
H2SZT3_TAKRU/428-542MSDLVVYCQPR.KCR.S...................ITSNGT...GIYS..YKEIR-------SFVEN------------
N1Q9A1_MYCFI/659-776LGKLGVYTQGI.KFN.....G.......FQAPNA.KTYN..............HIL-------SFSEG------------
B7S3T2_PHATC/601-716LARLTLF.HGT.KFK.AF..E........................QSITEPFSHMH-------SIGEA------------
W5KFE6_ASTMX/490-605LSDLVIYCKNE.NFT.NF..EDSRIN.GK......................PYDIS-------SFSES------------
Q2H4G2_CHAGB/405-520LSELAIYTHSQ.HYT.....D.......DSSLDTCQAPS..............HIF-------SLSED------------
F2UPR8_SALR5/1185-1317MSDLVIYTRAV.KFT.RF..A.......SKHPRAPGNGTCNAEGEPHLPVFAYEMS-------SFSEE------------
Q6BZ51_DEBHA/662-778LSDLGIYLQGV.KFR.....N.......FSLPES.KTFN..............HCF-------SLSEK------------
S0ELB2_GIBF5/852-959LQSLAVYGASR.RLPKNA..E.......FD.....THRN..............FIY-------SVSER------------
L5LI27_MYODS/450-565LSELVSICKSV.QFK.EF..Q..................VSF...QVQK..YWEVC-------SFNEV------------
A9VD11_MONBE/1221-1335LLELAVYFQSV.RLH.TF..E........................KNKPQAAYEMS-------SLSEK------------
K0KL98_WICCF/623-739LSALGVYALGY.KFT.....N.......FSLPES.KTIN..............HIF-------SFSEN------------
T1G934_HELRO/199-314LSDLIVYCQAK.SFK.SF..DSSKNN.DK......................HYEMC-------SFKEK------------
T1G0G0_HELRO/196-307FSDLVVYLQTV.KFK................................AE..CYQVA-------SLGEN------------
G3JGE5_CORMM/284-396LSDLGIYTRAV.SFK.....S.......WAQPEA.TMQG..............HIF-------SMSEK------------
J3PWL9_PUCT1/563-680LSSLIVYTVGV.KAR.GF..N........................KLTTYEPEHIL-------SLSER------------
G7XNJ5_ASPKW/783-900LSDLGVYTRGY.KWH.....S.......FTSAES.QRYN..............HVY-------SFAER------------
M4AIZ6_XIPMA/499-613LSELVVYTRSV.PFK.SF..EHAAKN..P......................PTDMC-------SFSES------------
M7SX13_EUTLA/137-249LSALAIHTHSE.HFE.....T.......FESTAA.KTPS..............HIF-------SISEK------------
T1IHK2_STRMM/849-956LSNLIVYCRSV.PFC.FE..R.......L.........VKEG...GPCN..FYEMS-------SFPET------------
R8BQP0_TOGMI/129-239LSNLAIYTHSE.HFK.....R.......FDTMSA.KTPS..............HIF-------SINEN------------
E9GUG0_DAPPU/494-609LLDMVNICEAV.KFH.SF..SHSLNKDQ.......................CYHIS-------SFSES------------
R4GB63_ANOCA/369-484LSELIIYTASR.KFA.SF..EDSKEK.QK......................FYQNN-------SIGEV------------
I2GWJ1_TETBL/468-586....ISAIHGI.RFR.....N.......TSLPES.KTVN..............HCF-------SLNEK------------
H3B2C6_LATCH/424-539LSDLVVYVKSV.HFY.GF..EHAKEE.QA......................FFEMS-------SFGES------------
M3D9Q9_SPHMS/307-425LAELGVYAQSV.KPTNQS..W.......FDPG.EL..QN.....G.PRH....HLI-------NVSES------------
K1V4M8_TRIAC/283-399LARLGVYAQSV.KPTSAG..W.......YDLA.....LD.....GYPHH....HLI-------NLSEV------------
W4Y2J6_STRPU/402-517MSALVNYVQPV.HFS.TF..E..................GSD...KRNH..SYEIS-------SFVET------------
J5JN06_BEAB2/465-578LKNLAIYTRGV.KFE.....G.......LDTKQA.TQPN..............HIF-------SISED------------
F7C6V1_CALJA/70-183LSDLVVYCKPT.SKT.KD..N.......L................ENPD..FREIR-------SFVET------------
G3AVU0_SPAPN/619-735LSALGVYIQGI.KYK.....N.......FSLPES.KTFN..............HCF-------SLNEK------------
S0EHF9_GIBF5/987-1097LAKLGVYLRQE.HFE.....S.......FNTPLA.KSPN..............HLF-------SFRED------------
G4TAH9_PIRID/235-351LEALGFYANSI.KPKDGW..L.......ERKI.....IN.......PLH....VLI-------NISES------------
G4NDT3_MAGO7/323-447LEELGVYAQSV.KLANDA..W.......FDATEQA..RDQTQPLALPHH....HLI-------NISES------------
V8PE75_OPHHA/356-482LSELVIYTKAQ.KFT.SF..EDSRKN.QR......................FYETN-------SIGEA------------
A9VBY6_MONBE/623-741.SNIVSL.SGV.KFK..................GVAQLQQSF...TEQK..AMQMS-------SFGEK------------
I1RPD3_GIBZE/774-890LGDLGVYCAGV.KFS.....G.......FDTVDA.KQYN..............HIF-------SFMES------------
S4ANZ4_CAPO3/1560-1674LAELAIYCRAA.HFV.SF..EDNMACQV.......................WYQMT-------SIGES------------
E3QYT0_COLGM/329-441LSDLGIYTFST.RFK.....S.......FEMPAA.KEPG..............HIF-------PMVEH------------
V8PDH0_OPHHA/598-706......KTHAI.EFV.KY..P.................CSEA...AITR..LFSLK-------QQGGN------------
M1VXY3_CLAP2/500-610LGDLAVYTRSE.HFK.....A.......FETKEA.KKPA..............HIF-------SISEK------------
H2ZU78_LATCH/223-338LSDLVIYTKAV.RFQ.SF..EYSRDN.QK......................FYEMN-------SLGET------------
H6C734_EXODN/365-479LSHLGVYTRAY.SFK.....H.......FKQPEA.SIPS..............HVF-------SLSEN------------
F1RBD7_DANRE/510-625LSDLVVYCKSV.HFT.SF..EQSRKK.QA......................FYEMA-------SFKEG------------
B7FP63_PHATC/607-714........HGN.KHK.TW..E........................ESLWSPRYHMH-------SFSEN------------
N1J7Z3_BLUG1/388-499LGKLGIYTQSE.HFT.....S.......FKDPSA.TTPS..............HIF-------SISES------------
C7Z5S0_NECH7/888-1002..DLAVYGPGK.RLPRPS..K.......VD.....ATGN..............FIY-------SVSEA------------
W5M435_LEPOC/940-1052MSDLVVYCQPR.SKD.KD..S.......F................AQYD..YKEIR-------SFVEN------------
A8PDD5_COPC7/582-696LASLLVYTIGV.KCH.GL..N........................DEVQYAPEHIF-------SLSEY------------
A7SDH9_NEMVE/403-518LSRCVNYISSV.GFK.NF..EHSKEN.AK......................FYQMS-------SFVES------------
M3HJN1_CANMX/678-794LSELGIYAQGL.KFR.....N.......FSLPES.KTYN..............HCF-------SLGEK------------
G5BJ13_HETGA/521-638LSALAVYCCAT.RLQ.TL..QPGPGP.AQ......................PCQVS-------SLSER------------
U4L657_PYROM/279-397LSRLGAYCSSH.HFP.....SRDPGRPFVEHKTS.LLAN..............HVY-------SFSEK------------
R4XC63_TAPDE/590-708LQVMAPYLKGV.KFR.....N.......FSLPES.KVFN..............HVF-------SLSER------------
M2R750_COCSN/398-510LARLGVYCGGY.SYK.....G.......LDTPEA.KIPT..............HVF-------SLSEG------------
B4JKL8_DROGR/976-1087MSDLIIYFRSV.PF........................RDHS.....WI..FQEMS-------SFPET------------
T1FQR0_HELRO/789-897MSDLVIYLQPI.RFI.SF..D..................TCK...QRMR..SYECT-------SFVES------------
E9CUF5_COCPS/374-486LSRLGIYTRGY.TFN.....G.......FSQPEA.TKPT..............HIF-------SLSEA------------
D8QLF1_SCHCM/503-623LLALLVYTMGV.KCR.GL..N........................KKETYEPSHMF-------SLSEN------------
I3K2K2_ORENI/545-660MSSIVNYIQPN.KFI.SF..E..................NAR...KKNK..SYVIS-------SFVET------------
G1X1C4_ARTOA/269-381LSSLGVYSSAM.TFPN....T.......FDHPSA.TRPN..............HIF-------SFSEK------------
A8PQQ4_BRUMA/386-499.SQLISLPSVK...........................LSNNIFKDIDEHPMDGSS-------SLSER------------
F7A0G1_CIOIN/490-605LSNLVSICTDV.ATVFDE..S........................GKTQSPRNSSS-------SIHEQ------------
T1KSZ4_TETUR/201-315LADLAVYCSAK.KFR...........................SLEDTLSWKFNEMF-------SLKET------------
H9ITM0_BOMMO/938-1054ISDLIIYCRSV.TFN.IE..R.......L.........RIKG.....FV..YNEMS-------SFPET------------
H2ZTT6_LATCH/71-184LSDLVIYCKPT.SKT.KD..N.......L................EKPD..YKEIR-------SFMET------------
I1GJ67_AMPQE/603-717LSKCVNYVQSV.HFK.GF..DSTHE..IP......................FFHMS-------SFGES------------
G4NJD0_MAGO7/442-555LSKLAVYTHSK.HFG.....G.......FSTRVA.KSPS..............HIF-------SLSEG------------
T1HV24_RHOPR/962-1078ISNLIIYCRSV.PFN.ID..K.......L.........KQTG.....FL..YAEMS-------SFPET------------
C5DES3_LACTC/577-692.......IHGV.KFR.....N.......FSLPES.KVPN..............HCF-------SLSEK------------
A7SXK4_NEMVE/280-395LSQLINYISNE.KFKSFI..E........................SMEMGHFSQTH-------SFVES------------
H0ES44_GLAL7/715-832LGELGVYSAGL.KFR.....G.......FDDPES.KTYN..............HIF-------SFMEK------------
M7SPN2_EUTLA/327-448LAELGVYAQSV.KPRDNS..W.......FEEVAGM..KD.....G.PHH....HLI-------NVSET------------
F7B628_XENTR/933-1046LSDLVMYCKPK.SEA.KE..K.......L................ESPD..FREIR-------SFAEN------------
B2AUG0_PODAN/415-528LADLAIYTHSE.HFD.....D.......HQSLHS.RTPS..............HIF-------SLSED------------

PF03009

A0A017IJS9_ECOLX/36-350--------------------------------------------------------------------------------
A0A023ZID6_YEASX/7-246--------------------------------------------------------------------------------
A0A038FGR1_MYCTX/14-242--------------------------------------------------------------------------------
A0A038LRN9_MYCTX/17-259--------------------------------------------------------------------------------
B1X7Q7_ECODH/12-239--------------------------------------------------------------------------------
B2RZV2_BORHD/38-330--------------------------------------------------------------------------------
C9MK30_HAEIF/40-355--------------------------------------------------------------------------------
D6EQ07_STRLI/20-243--------------------------------------------------------------------------------
G4EU08_BACIU/7-235--------------------------------------------------------------------------------
J7JQM5_BACIU/43-285--------------------------------------------------------------------------------
N1NX43_YEASC/877-1212--------------------------------------------------------------------------------
O02322_CAEEL/73-322--------------------------------------------------------------------------------
PGC1_SCHPO/37-267--------------------------------------------------------------------------------
O86738_STRCO/16-227--------------------------------------------------------------------------------
GPC1A_CAEEL/406-706--------------------------------------------------------------------------------
GPC1B_CAEEL/349-649--------------------------------------------------------------------------------
Q3BZN0_XANC5/274-516--------------------------------------------------------------------------------
Q89384_PBCV1/5-217--------------------------------------------------------------------------------
GDE1_SCHPO/752-1061--------------------------------------------------------------------------------
Q9RSP0_DEIRA/37-277--------------------------------------------------------------------------------
Q9RWX3_DEIRA/7-220--------------------------------------------------------------------------------
Q9RZL4_DEIRA/249-566--------------------------------------------------------------------------------
Q9SD81_ARATH/49-357--------------------------------------------------------------------------------
Q9SGA2_ARATH/39-318--------------------------------------------------------------------------------
Q9UAW8_CAEEL/68-331--------------------------------------------------------------------------------
Q9VQU3_DROME/375-661--------------------------------------------------------------------------------
Q9W2L6_DROME/349-632--------------------------------------------------------------------------------
Q9X1V6_THEMA/6-217--------------------------------------------------------------------------------
Q9YFI4_AERPE/15-220--------------------------------------------------------------------------------
Q9ZTU6_WHEAT/118-414--------------------------------------------------------------------------------

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441................................................................................
Q8IJR0_PLAF7/626-770................................................................................
Q6BZ51_DEBHA/455-607................................................................................
PLCG2_MOUSE/314-457................................................................................
PLCL1_HUMAN/400-543................................................................................
PLCD9_ARATH/109-254................................................................................
PLCD1_ARATH/107-250................................................................................
PLCD6_ARATH/139-282................................................................................
A5DAA1_PICGU/440-595................................................................................
PLCD4_RAT/292-436................................................................................
PLCZ1_BOVIN/157-300................................................................................
PLCD3_ARATH/108-251................................................................................
A5E691_LODEL/21-192NSANTN..........................................................................
Q16W08_AEDAE/315-464................................................................................
PLCD5_ARATH/114-257................................................................................
Q5QIB9_STRPU/301-444................................................................................
Q6CSI9_KLULA/402-540................................................................................
PLCD3_HUMAN/339-483................................................................................
Q385H1_TRYB2/248-393................................................................................
Q16ZC0_AEDAE/42-189................................................................................
PLCH1_HUMAN/301-445................................................................................
A2QEJ2_ASPNC/86-262STSSGSSG........................................................................
Q4N7P5_THEPA/468-615................................................................................
A7S279_NEMVE/319-466................................................................................
PLC_DICDI/324-466................................................................................
Q5BFL6_EMENI/534-676................................................................................
Q2HB23_CHAGB/553-696................................................................................
A6RBI2_AJECN/84-320DHGDPKVPQKNPKKNGKDRKGGTFNLSSLSNQLDR........................LSRGSTTQPQVAGAETAVVTT
A0CKY8_PARTE/271-413................................................................................
Q5CLA7_CRYHO/367-509................................................................................
E9AEI1_LEIMA/296-447................................................................................
Q9XWB7_CAEEL/306-468................................................................................
Q8IA75_CAEEL/367-517................................................................................
PLC1_YEAST/382-521................................................................................
PLCE1_HUMAN/1394-1541................................................................................
A7RXP6_NEMVE/244-393................................................................................
Q7QHE3_ANOGA/319-462................................................................................
A0BLC4_PARTE/285-429................................................................................
Q6FY00_CANGA/381-519................................................................................
A0BLM0_PARTE/262-404................................................................................
Q59LC4_CANAL/566-727K...............................................................................
Q2UPV6_ASPOR/98-321SSSSSDSISERKIKQGSKRERLKSMAKRHSR...............................LGSMSTKLGGLIGRKSSP
Q4PDE8_USTMA/122-279................................................................................
A7T501_NEMVE/158-302................................................................................
A7ASE0_BABBO/522-670................................................................................
Q4PA81_USTMA/724-872................................................................................
A7TR21_VANPO/381-520................................................................................
Q75C92_ASHGO/397-535................................................................................
A7RPQ0_NEMVE/307-450................................................................................
A7SXK4_NEMVE/94-237................................................................................
A4S165_OSTLU/1-153................................................................................
Q7PW25_ANOGA/289-436................................................................................
A7RKT2_NEMVE/272-413................................................................................
A3LSB2_PICST/461-615................................................................................
A3LNB7_PICST/20-167................................................................................
PLCH2_HUMAN/328-472................................................................................
Q0UVV5_PHANO/116-337MQKYGAPKVEKKNKDKKEKLSLRKRLELR....................................FGRKGASEEKERSLS
Q4QBH9_LEIMA/195-340................................................................................
Q0UE70_PHANO/101-258................................................................................
PLCL2_MOUSE/429-572................................................................................
PLCZ1_CHICK/159-303................................................................................
Q2GUM5_CHAGB/104-264................................................................................
Q21754_CAEEL/318-461................................................................................
A7SDH9_NEMVE/209-352................................................................................
A4HCK9_LEIBR/248-393................................................................................
PLC1_SCHPO/443-585................................................................................
Q013R6_OSTTA/119-269................................................................................
Q75IL8_ORYSJ/119-262................................................................................
PLCD8_ARATH/107-248................................................................................
Q6CD33_YARLI/505-648................................................................................
A7UXE0_NEUCR/118-273................................................................................
A9RJG9_PHYPA/150-293................................................................................
A9SXU1_PHYPA/108-250................................................................................
B4H106_DROPE/328-471................................................................................
B6C9K2_SOLLC/110-252................................................................................
B6KHA6_TOXGO/407-549................................................................................
E9QD74_DANRE/316-459................................................................................
F1R8S3_DANRE/294-437................................................................................
F6HKS4_VITVI/112-254................................................................................
F7DT82_CALJA/159-308................................................................................
G3GVA5_CRIGR/324-467................................................................................
G3UXP4_MOUSE/322-465................................................................................
G4UMR8_NEUT9/110-362ESVTSSSSSSSDDAYGSGEEGTASKLKRKAKSKLPSFLGGRKKSKDKKVPEPTTRTPPPPAAATTTEAAPVGLSAETNPL
PLCB_CAEEL/342-492................................................................................
H2SZT5_TAKRU/30-172................................................................................
H2USZ2_TAKRU/343-506................................................................................
H3CD03_TETNG/306-449................................................................................
H3CYP8_TETNG/287-430................................................................................
H3D277_TETNG/321-464................................................................................
H3D2C1_TETNG/321-464................................................................................
H3D5C7_TETNG/314-459................................................................................
H3DBV7_TETNG/298-442................................................................................
H3DF29_TETNG/89-233................................................................................
H3DK53_TETNG/325-468................................................................................
I1R783_ORYGL/114-256................................................................................
K4A9N8_SETIT/153-295................................................................................
M1BNL7_SOLTU/113-255................................................................................
M1CL37_SOLTU/111-252................................................................................
M4FG24_BRARP/66-209................................................................................
PLCB2_RAT/314-464................................................................................
PLC_LISMO/61-198................................................................................
PLCB3_MOUSE/319-469................................................................................
Q236T7_TETTS/331-475................................................................................
PLC_STAA8/51-192................................................................................
Q4DUP6_TRYCC/248-392................................................................................
Q4WX21_ASPFU/96-334SSSSSSSSEWSSDEENPSRRKKQDVQKTDGSTQSAKAPS................RRKGLSSKLGSLLGRKSSPPNGATD
Q5A0L4_CANAL/21-164................................................................................
Q5KJZ5_CRYNJ/160-301................................................................................
Q7SE08_NEUCR/136-356EHRRHISNVSAMSRTSVRHGSSLSVDQPG...................................LYTMRTPRDSGTSLDP
Q81A32_BACCR/58-194................................................................................
PLCD4_ARATH/116-257................................................................................
W4XJU2_STRPU/318-467................................................................................

PF00387

G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K9R2_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
J9MUK9_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
Q4PDE8_USTMA/317-433--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
J9NP56_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A8Q3V0_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
E9C115_CAPO3/737-852--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
Q4PA81_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_MYCGM/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
Q5KJZ5_CRYNJ/354-466--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
E9C1B4_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_MYCP1/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METAR/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
I1RRH2_GIBZE/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENCW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
M4FUS1_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_MYCFI/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
D4A881_RAT/472-587--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_MYCP1/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
E9C539_CAPO3/1229-1344--------------------------------------------------------------------------------
E9C6P6_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALSC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
F1QS56_DANRE/596-708--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_THIHA/369-481--------------------------------------------------------------------------------
F9X062_MYCGM/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
E9BY96_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
H9KC07_APIME/873-989--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALSC/324-435--------------------------------------------------------------------------------
I1RGV1_GIBZE/283-390--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_THIHA/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
E9BX46_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_MYCFI/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
J3PWL9_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
I1RPD3_GIBZE/774-890--------------------------------------------------------------------------------
S4ANZ4_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
A8PQQ4_BRUMA/386-499--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

A0A017IJS9_ECOLX/36-350----------------------LVVLHD..........HYLDRVTDVADRFPDRA.........RKDGRYYAIDFTLDEI
A0A023ZID6_YEASX/7-246----------------------VVVNHD..........SDTGRMWDKNL.....................VIGESTWEEV
A0A038FGR1_MYCTX/14-242----------------------AVILHD..........RRLAPGVGLSG.....................AVDRLDWRDV
A0A038LRN9_MYCTX/17-259----------------------LVCVHD..........RRLDRTSTGAG.....................LVSTMTLAQL
B1X7Q7_ECODH/12-239----------------------IFLLHD..........DNLERTSNGWG.....................VAGELNWQDL
B2RZV2_BORHD/38-330----------------------PVIMHD..........PELDTTTNVAKLFPERA.........RENGRYYSVDFTLDEL
C9MK30_HAEIF/40-355----------------------LVVIHD..........HFLDGLTDVAKKFPYRH.........RKDGRYYVIDFTLKEI
D6EQ07_STRLI/20-243----------------------LVAFHD..........GTLDRVTDGAG.....................RIADLPWENV
G4EU08_BACIU/7-235----------------------IVVIHD..........ERLNRTTSLKG.....................FVKDTAYDEV
J7JQM5_BACIU/43-285----------------------LIVMHD..........EKLDRTTNGMG.....................WVKDHTLADI
N1NX43_YEASC/877-1212----------------------PVVYHD..........FLVAETGVDIPMHELT...........LEQFLDLNNADKEHI
O02322_CAEEL/73-322----------------------PVICHD..........SNTVRVTGVDK.....................EISAMNITEF
PGC1_SCHPO/37-267----------------------VCILHD..........RNLNRVFGVDV.....................DVRDLDYELD
O86738_STRCO/16-227----------------------PVLLHD..........ETLKRLWQHDR.....................PLRSLSAEEV
GPC1A_CAEEL/406-706----------------------AVIYHD..........FHVLVSVARRDGLAMPP........PMTREQLDSSNLDYHEL
GPC1B_CAEEL/349-649----------------------TVVYHD..........FHVLVAVAGRDSPSSTPTAA...GENKSLHEIAIKDLTLAQL
Q3BZN0_XANC5/274-516----------------------PVLMHD..........FSIGRMAGDPQN...................RLVSQVPFAEL
Q89384_PBCV1/5-217----------------------PVVFHD..........STLDRMTHSCG.....................KVKNFTLNEL
GDE1_SCHPO/752-1061----------------------PVVYHD..........FIVNETGTDAQ......................VHSLTLEQF
Q9RSP0_DEIRA/37-277----------------------LVLSHD..........ATLDRLTDTQG.....................RIADLTLEQV
Q9RWX3_DEIRA/7-220----------------------LAVHHD.............AALPDGRQ......................LPHLTRAEL
Q9RZL4_DEIRA/249-566----------------------LVARHEPVIAAVDETGKVLEATTDVATRPEFRDRLTTKTLDGVKVHGYFVEDFTLAEL
Q9SD81_ARATH/49-357----------------------LICHHD..........VNLDDTTDVADHKEFADRKRTYEVQGMNMTGFFTVDFTLKEL
Q9SGA2_ARATH/39-318----------------------PIIFHD..........DFIYSEEQGVVY..................EKRVTEVCLSEF
Q9UAW8_CAEEL/68-331----------------------AVLMHD..........DDLDRTTDMKG.....................PIRDKTRAEL
Q9VQU3_DROME/375-661----------------------PVVYHD..........FMIYVSLKSKCSLQEH...........DFLALPMRELSLEQL
Q9W2L6_DROME/349-632----------------------PIIHHD..........FSIRVCIDSKTPTSKD...........DLTEVLLKDISYEQL
Q9X1V6_THEMA/6-217----------------------VVVSHD..........EDLKRLFGLDV.....................KIRDATVSEL
Q9YFI4_AERPE/15-220----------------------PMALHG.........RPSVRRATPIGR......................LWGWIDYKL
Q9ZTU6_WHEAT/118-414----------------------PICMSS.........IDLMDVTTVASSQFASQAGVI...SDIKAVAGVYTFNLTWEDI

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441......................PVIYH.----------------------------------------------------
Q8IJR0_PLAF7/626-770......................IVVYHG----------------------------------------------------
Q6BZ51_DEBHA/455-607.................KTNNEPIVSH.----------------------------------------------------
PLCG2_MOUSE/314-457......................PIIYH.----------------------------------------------------
PLCL1_HUMAN/400-543......................PILCN.----------------------------------------------------
PLCD9_ARATH/109-254......................ICVRP.----------------------------------------------------
PLCD1_ARATH/107-250......................AEVRH.----------------------------------------------------
PLCD6_ARATH/139-282......................INVLH.----------------------------------------------------
A5DAA1_PICGU/440-595...............ESEGIKGPIVNH.----------------------------------------------------
PLCD4_RAT/292-436......................PVVYH.----------------------------------------------------
PLCZ1_BOVIN/157-300......................PVVYH.----------------------------------------------------
PLCD3_ARATH/108-251......................AEVRH.----------------------------------------------------
A5E691_LODEL/21-192.......TNGGTSAATIAVVAEPVVNH.----------------------------------------------------
Q16W08_AEDAE/315-464......................PIITH.----------------------------------------------------
PLCD5_ARATH/114-257......................ILVLH.----------------------------------------------------
Q5QIB9_STRPU/301-444......................PIVYH.----------------------------------------------------
Q6CSI9_KLULA/402-540......................PVVCH.----------------------------------------------------
PLCD3_HUMAN/339-483......................PVIYH.----------------------------------------------------
Q385H1_TRYB2/248-393......................PVVYH.----------------------------------------------------
Q16ZC0_AEDAE/42-189......................PVIYH.----------------------------------------------------
PLCH1_HUMAN/301-445......................PVVHH.----------------------------------------------------
A2QEJ2_ASPNC/86-262......ESKASGSAIPVPGKPEPRVLH.----------------------------------------------------
Q4N7P5_THEPA/468-615......................PVLCHA----------------------------------------------------
A7S279_NEMVE/319-466......................PIITH.----------------------------------------------------
PLC_DICDI/324-466......................PIIFH.----------------------------------------------------
Q5BFL6_EMENI/534-676......................PIVSH.----------------------------------------------------
Q2HB23_CHAGB/553-696......................PVVTH.----------------------------------------------------
A6RBI2_AJECN/84-320TASMSPPGDAGTAASAVQLRREPLVFH.----------------------------------------------------
A0CKY8_PARTE/271-413.....................NPVVYH.----------------------------------------------------
Q5CLA7_CRYHO/367-509......................PIIYH.----------------------------------------------------
E9AEI1_LEIMA/296-447......................PVVYH.----------------------------------------------------
Q9XWB7_CAEEL/306-468.....................EPVITH.----------------------------------------------------
Q8IA75_CAEEL/367-517....................TEPMVQN.----------------------------------------------------
PLC1_YEAST/382-521......................PVVCH.----------------------------------------------------
PLCE1_HUMAN/1394-1541......................PIIYH.----------------------------------------------------
A7RXP6_NEMVE/244-393......................PVITH.----------------------------------------------------
Q7QHE3_ANOGA/319-462......................PLIFH.----------------------------------------------------
A0BLC4_PARTE/285-429......................PIIYH.----------------------------------------------------
Q6FY00_CANGA/381-519......................PVVCH.----------------------------------------------------
A0BLM0_PARTE/262-404......................PKVTH.----------------------------------------------------
Q59LC4_CANAL/566-727.............DDDDKNEYEPIVNH.----------------------------------------------------
Q2UPV6_ASPOR/98-321EDVPLDSSAPVDPATEVPPPPEPQVLH.----------------------------------------------------
Q4PDE8_USTMA/122-279.....................EPKVTH.----------------------------------------------------
A7T501_NEMVE/158-302......................PVVYH.----------------------------------------------------
A7ASE0_BABBO/522-670......................PVLCHS----------------------------------------------------
Q4PA81_USTMA/724-872......................PQITH.----------------------------------------------------
A7TR21_VANPO/381-520......................PVVCH.----------------------------------------------------
Q75C92_ASHGO/397-535......................PVVCH.----------------------------------------------------
A7RPQ0_NEMVE/307-450......................PIIYH.----------------------------------------------------
A7SXK4_NEMVE/94-237......................PIVYH.----------------------------------------------------
A4S165_OSTLU/1-153......................PIITH.----------------------------------------------------
Q7PW25_ANOGA/289-436......................PVIVH.----------------------------------------------------
A7RKT2_NEMVE/272-413......................PIITH.----------------------------------------------------
A3LSB2_PICST/461-615................FQHDKEPIVNH.----------------------------------------------------
A3LNB7_PICST/20-167......................LQVIH.----------------------------------------------------
PLCH2_HUMAN/328-472......................PIVHH.----------------------------------------------------
Q0UVV5_PHANO/116-337PSGKGEEKVEPWRSDSYAYRAEPRVLH.----------------------------------------------------
Q4QBH9_LEIMA/195-340......................PIVCH.----------------------------------------------------
Q0UE70_PHANO/101-258.....................EPKVTH.----------------------------------------------------
PLCL2_MOUSE/429-572......................PVIYT.----------------------------------------------------
PLCZ1_CHICK/159-303......................PVVYH.----------------------------------------------------
Q2GUM5_CHAGB/104-264.....................EPKVTH.----------------------------------------------------
Q21754_CAEEL/318-461......................PVITH.----------------------------------------------------
A7SDH9_NEMVE/209-352......................PIVYH.----------------------------------------------------
A4HCK9_LEIBR/248-393......................PIVHH.----------------------------------------------------
PLC1_SCHPO/443-585......................PVVCH.----------------------------------------------------
Q013R6_OSTTA/119-269....................PRPIVTH.----------------------------------------------------
Q75IL8_ORYSJ/119-262......................VEVLH.----------------------------------------------------
PLCD8_ARATH/107-248......................ICVRP.----------------------------------------------------
Q6CD33_YARLI/505-648......................PVVKH.----------------------------------------------------
A7UXE0_NEUCR/118-273......................PKVTH.----------------------------------------------------
A9RJG9_PHYPA/150-293......................IDVLH.----------------------------------------------------
A9SXU1_PHYPA/108-250......................IKVTH.----------------------------------------------------
B4H106_DROPE/328-471......................PYIFH.----------------------------------------------------
B6C9K2_SOLLC/110-252......................VHVLH.----------------------------------------------------
B6KHA6_TOXGO/407-549......................PSLFHG----------------------------------------------------
E9QD74_DANRE/316-459......................PVIYH.----------------------------------------------------
F1R8S3_DANRE/294-437......................PVIYH.----------------------------------------------------
F6HKS4_VITVI/112-254......................IDVLH.----------------------------------------------------
F7DT82_CALJA/159-308......................PIITH.----------------------------------------------------
G3GVA5_CRIGR/324-467......................PIIYH.----------------------------------------------------
G3UXP4_MOUSE/322-465......................PVIYH.----------------------------------------------------
G4UMR8_NEUT9/110-362ERSKSGGSASLFQTLSRKSTKEPRVLH.----------------------------------------------------
PLCB_CAEEL/342-492......................PIITH.----------------------------------------------------
H2SZT5_TAKRU/30-172......................PIIYH.----------------------------------------------------
H2USZ2_TAKRU/343-506..............GPDISRQHHHHHH.----------------------------------------------------
H3CD03_TETNG/306-449......................PMVQH.----------------------------------------------------
H3CYP8_TETNG/287-430......................PVIYH.----------------------------------------------------
H3D277_TETNG/321-464......................PVIYT.----------------------------------------------------
H3D2C1_TETNG/321-464......................PVVYV.----------------------------------------------------
H3D5C7_TETNG/314-459......................PIIYH.----------------------------------------------------
H3DBV7_TETNG/298-442......................PVIYH.----------------------------------------------------
H3DF29_TETNG/89-233......................PVVYH.----------------------------------------------------
H3DK53_TETNG/325-468......................PVVCT.----------------------------------------------------
I1R783_ORYGL/114-256......................IDILH.----------------------------------------------------
K4A9N8_SETIT/153-295......................IDVLH.----------------------------------------------------
M1BNL7_SOLTU/113-255......................VDILH.----------------------------------------------------
M1CL37_SOLTU/111-252......................VEVLH.----------------------------------------------------
M4FG24_BRARP/66-209......................IDVLH.----------------------------------------------------
PLCB2_RAT/314-464......................PIITH.----------------------------------------------------
PLC_LISMO/61-198......................LNIYH.----------------------------------------------------
PLCB3_MOUSE/319-469......................PFITH.----------------------------------------------------
Q236T7_TETTS/331-475......................PEALQ.----------------------------------------------------
PLC_STAA8/51-192......................ISVHH.----------------------------------------------------
Q4DUP6_TRYCC/248-392......................PIVYH.----------------------------------------------------
Q4WX21_ASPFU/96-334KPASTATAAAVGTAAQTLRRPEPRVLH.----------------------------------------------------
Q5A0L4_CANAL/21-164......................LQVIH.----------------------------------------------------
Q5KJZ5_CRYNJ/160-301......................PVVYH.----------------------------------------------------
Q7SE08_NEUCR/136-356KELSDRMDRSTSSSSGSVKRGEPIVHH.----------------------------------------------------
Q81A32_BACCR/58-194......................IVLHH.----------------------------------------------------
PLCD4_ARATH/116-257......................VCVKH.----------------------------------------------------
W4XJU2_STRPU/318-467......................PIITH.----------------------------------------------------

PF00387

G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K9R2_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
J9MUK9_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
Q4PDE8_USTMA/317-433--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
J9NP56_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A8Q3V0_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
E9C115_CAPO3/737-852--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
Q4PA81_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_MYCGM/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
Q5KJZ5_CRYNJ/354-466--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
E9C1B4_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_MYCP1/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METAR/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
I1RRH2_GIBZE/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENCW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
M4FUS1_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_MYCFI/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
D4A881_RAT/472-587--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_MYCP1/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
E9C539_CAPO3/1229-1344--------------------------------------------------------------------------------
E9C6P6_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALSC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
F1QS56_DANRE/596-708--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_THIHA/369-481--------------------------------------------------------------------------------
F9X062_MYCGM/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
E9BY96_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
H9KC07_APIME/873-989--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALSC/324-435--------------------------------------------------------------------------------
I1RGV1_GIBZE/283-390--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_THIHA/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
E9BX46_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_MYCFI/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
J3PWL9_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
I1RPD3_GIBZE/774-890--------------------------------------------------------------------------------
S4ANZ4_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
A8PQQ4_BRUMA/386-499--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

A0A017IJS9_ECOLX/36-350KSLKFTE.........................................GFDIENGKKVQTYPGRFPMGK...........
A0A023ZID6_YEASX/7-246KRLR.................................................CKEDGSLAMMTLK..............
A0A038FGR1_MYCTX/14-242RKAQ...............................................LGAGQSIPTLEDLL...............
A0A038LRN9_MYCTX/17-259RELE...............................................YGAWH.DSWRPDGSHGD............
B1X7Q7_ECODH/12-239LRVD...............................................AGSWYSKMFKGEPL...............
B2RZV2_BORHD/38-330KSLSLSE.........................................RFDPASRN..PIYPNRFPLNE...........
C9MK30_HAEIF/40-355QSLEMTE.........................................NFETKDGKQAQVYPNRFPLWK...........
D6EQ07_STRLI/20-243RHAR...............................................VAGEEPVPLFEELL...............
G4EU08_BACIU/7-235KTAN...............................................AAAGHDQAYSDIKV...............
J7JQM5_BACIU/43-285KKLD...............................................AGSWFNEAYPEKAKPQYV...........
N1NX43_YEASC/877-1212QRGAGHSPHHVNGADTALQKYRGRS.....VDDSDVSTLRRAWDLHDNDPNG.KSNNAHWSDNRMRLTKTFKKNNFKGNA
O02322_CAEEL/73-322RKLR..............................................FIGTNVSLPTFEEAVA..............
PGC1_SCHPO/37-267N...................................................GHFRTIQEPHEPL...............
O86738_STRCO/16-227RGLT.................................................AGG........................
GPC1A_CAEEL/406-706PVKDLKLSQLKLL.............................MLDHLSFPQ.KKENVKKLVEAG..EEEE..........
GPC1B_CAEEL/349-649NLLHFEHI......................................SRANGSSAESPVALSVTPSKTETD..........
Q3BZN0_XANC5/274-516REMP.................................................LVIRNPSDGNYV...............
Q89384_PBCV1/5-217SNLS.................................................IRN....STEKI...............
GDE1_SCHPO/752-1061LGASHSPSEEIKDDASDIQQKRRPRAYSSSFTPSGSQVNFGEFAEENARLKP.KVYKGNALGHTICA.............
Q9RSP0_DEIRA/37-277LRADAGY.........................................TLTPAGGSGFPFRGQGVQ..............
Q9RWX3_DEIRA/7-220PERV............................................................................
Q9RZL4_DEIRA/249-566RTLR................................................AVERLPQLRGKAYDGQ............
Q9SD81_ARATH/49-357KTLG................................................AKQR.YPFRDQQYNGK............
Q9SGA2_ARATH/39-318MSYGPQR........................................DTGKTGKPLLRKSKEGKIHKWSV..........
Q9UAW8_CAEEL/68-331DRCD...............................................ISATFKRTAPGDHCRLATV..........
Q9VQU3_DROME/375-661KKLKVYH.........................................IAEGLSRETRSFHNDDC.LE............
Q9W2L6_DROME/349-632KDLKTY...........................................QIVGNKIVEYPAHNNVEPPE...........
Q9X1V6_THEMA/6-217KELT.................................................DG.......KIT...............
Q9YFI4_AERPE/15-220FYRD............................................................................
Q9ZTU6_WHEAT/118-414ANNLK.............................................PMISNPFGQISLSRNPRNR...........

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441--------------------------------------------------------------------------------
Q8IJR0_PLAF7/626-770--------------------------------------------------------------------------------
Q6BZ51_DEBHA/455-607--------------------------------------------------------------------------------
PLCG2_MOUSE/314-457--------------------------------------------------------------------------------
PLCL1_HUMAN/400-543--------------------------------------------------------------------------------
PLCD9_ARATH/109-254--------------------------------------------------------------------------------
PLCD1_ARATH/107-250--------------------------------------------------------------------------------
PLCD6_ARATH/139-282--------------------------------------------------------------------------------
A5DAA1_PICGU/440-595--------------------------------------------------------------------------------
PLCD4_RAT/292-436--------------------------------------------------------------------------------
PLCZ1_BOVIN/157-300--------------------------------------------------------------------------------
PLCD3_ARATH/108-251--------------------------------------------------------------------------------
A5E691_LODEL/21-192--------------------------------------------------------------------------------
Q16W08_AEDAE/315-464--------------------------------------------------------------------------------
PLCD5_ARATH/114-257--------------------------------------------------------------------------------
Q5QIB9_STRPU/301-444--------------------------------------------------------------------------------
Q6CSI9_KLULA/402-540--------------------------------------------------------------------------------
PLCD3_HUMAN/339-483--------------------------------------------------------------------------------
Q385H1_TRYB2/248-393--------------------------------------------------------------------------------
Q16ZC0_AEDAE/42-189--------------------------------------------------------------------------------
PLCH1_HUMAN/301-445--------------------------------------------------------------------------------
A2QEJ2_ASPNC/86-262--------------------------------------------------------------------------------
Q4N7P5_THEPA/468-615--------------------------------------------------------------------------------
A7S279_NEMVE/319-466--------------------------------------------------------------------------------
PLC_DICDI/324-466--------------------------------------------------------------------------------
Q5BFL6_EMENI/534-676--------------------------------------------------------------------------------
Q2HB23_CHAGB/553-696--------------------------------------------------------------------------------
A6RBI2_AJECN/84-320--------------------------------------------------------------------------------
A0CKY8_PARTE/271-413--------------------------------------------------------------------------------
Q5CLA7_CRYHO/367-509--------------------------------------------------------------------------------
E9AEI1_LEIMA/296-447--------------------------------------------------------------------------------
Q9XWB7_CAEEL/306-468--------------------------------------------------------------------------------
Q8IA75_CAEEL/367-517--------------------------------------------------------------------------------
PLC1_YEAST/382-521--------------------------------------------------------------------------------
PLCE1_HUMAN/1394-1541--------------------------------------------------------------------------------
A7RXP6_NEMVE/244-393--------------------------------------------------------------------------------
Q7QHE3_ANOGA/319-462--------------------------------------------------------------------------------
A0BLC4_PARTE/285-429--------------------------------------------------------------------------------
Q6FY00_CANGA/381-519--------------------------------------------------------------------------------
A0BLM0_PARTE/262-404--------------------------------------------------------------------------------
Q59LC4_CANAL/566-727--------------------------------------------------------------------------------
Q2UPV6_ASPOR/98-321--------------------------------------------------------------------------------
Q4PDE8_USTMA/122-279--------------------------------------------------------------------------------
A7T501_NEMVE/158-302--------------------------------------------------------------------------------
A7ASE0_BABBO/522-670--------------------------------------------------------------------------------
Q4PA81_USTMA/724-872--------------------------------------------------------------------------------
A7TR21_VANPO/381-520--------------------------------------------------------------------------------
Q75C92_ASHGO/397-535--------------------------------------------------------------------------------
A7RPQ0_NEMVE/307-450--------------------------------------------------------------------------------
A7SXK4_NEMVE/94-237--------------------------------------------------------------------------------
A4S165_OSTLU/1-153--------------------------------------------------------------------------------
Q7PW25_ANOGA/289-436--------------------------------------------------------------------------------
A7RKT2_NEMVE/272-413--------------------------------------------------------------------------------
A3LSB2_PICST/461-615--------------------------------------------------------------------------------
A3LNB7_PICST/20-167--------------------------------------------------------------------------------
PLCH2_HUMAN/328-472--------------------------------------------------------------------------------
Q0UVV5_PHANO/116-337--------------------------------------------------------------------------------
Q4QBH9_LEIMA/195-340--------------------------------------------------------------------------------
Q0UE70_PHANO/101-258--------------------------------------------------------------------------------
PLCL2_MOUSE/429-572--------------------------------------------------------------------------------
PLCZ1_CHICK/159-303--------------------------------------------------------------------------------
Q2GUM5_CHAGB/104-264--------------------------------------------------------------------------------
Q21754_CAEEL/318-461--------------------------------------------------------------------------------
A7SDH9_NEMVE/209-352--------------------------------------------------------------------------------
A4HCK9_LEIBR/248-393--------------------------------------------------------------------------------
PLC1_SCHPO/443-585--------------------------------------------------------------------------------
Q013R6_OSTTA/119-269--------------------------------------------------------------------------------
Q75IL8_ORYSJ/119-262--------------------------------------------------------------------------------
PLCD8_ARATH/107-248--------------------------------------------------------------------------------
Q6CD33_YARLI/505-648--------------------------------------------------------------------------------
A7UXE0_NEUCR/118-273--------------------------------------------------------------------------------
A9RJG9_PHYPA/150-293--------------------------------------------------------------------------------
A9SXU1_PHYPA/108-250--------------------------------------------------------------------------------
B4H106_DROPE/328-471--------------------------------------------------------------------------------
B6C9K2_SOLLC/110-252--------------------------------------------------------------------------------
B6KHA6_TOXGO/407-549--------------------------------------------------------------------------------
E9QD74_DANRE/316-459--------------------------------------------------------------------------------
F1R8S3_DANRE/294-437--------------------------------------------------------------------------------
F6HKS4_VITVI/112-254--------------------------------------------------------------------------------
F7DT82_CALJA/159-308--------------------------------------------------------------------------------
G3GVA5_CRIGR/324-467--------------------------------------------------------------------------------
G3UXP4_MOUSE/322-465--------------------------------------------------------------------------------
G4UMR8_NEUT9/110-362--------------------------------------------------------------------------------
PLCB_CAEEL/342-492--------------------------------------------------------------------------------
H2SZT5_TAKRU/30-172--------------------------------------------------------------------------------
H2USZ2_TAKRU/343-506--------------------------------------------------------------------------------
H3CD03_TETNG/306-449--------------------------------------------------------------------------------
H3CYP8_TETNG/287-430--------------------------------------------------------------------------------
H3D277_TETNG/321-464--------------------------------------------------------------------------------
H3D2C1_TETNG/321-464--------------------------------------------------------------------------------
H3D5C7_TETNG/314-459--------------------------------------------------------------------------------
H3DBV7_TETNG/298-442--------------------------------------------------------------------------------
H3DF29_TETNG/89-233--------------------------------------------------------------------------------
H3DK53_TETNG/325-468--------------------------------------------------------------------------------
I1R783_ORYGL/114-256--------------------------------------------------------------------------------
K4A9N8_SETIT/153-295--------------------------------------------------------------------------------
M1BNL7_SOLTU/113-255--------------------------------------------------------------------------------
M1CL37_SOLTU/111-252--------------------------------------------------------------------------------
M4FG24_BRARP/66-209--------------------------------------------------------------------------------
PLCB2_RAT/314-464--------------------------------------------------------------------------------
PLC_LISMO/61-198--------------------------------------------------------------------------------
PLCB3_MOUSE/319-469--------------------------------------------------------------------------------
Q236T7_TETTS/331-475--------------------------------------------------------------------------------
PLC_STAA8/51-192--------------------------------------------------------------------------------
Q4DUP6_TRYCC/248-392--------------------------------------------------------------------------------
Q4WX21_ASPFU/96-334--------------------------------------------------------------------------------
Q5A0L4_CANAL/21-164--------------------------------------------------------------------------------
Q5KJZ5_CRYNJ/160-301--------------------------------------------------------------------------------
Q7SE08_NEUCR/136-356--------------------------------------------------------------------------------
Q81A32_BACCR/58-194--------------------------------------------------------------------------------
PLCD4_ARATH/116-257--------------------------------------------------------------------------------
W4XJU2_STRPU/318-467--------------------------------------------------------------------------------

PF00387

G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K9R2_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
J9MUK9_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
Q4PDE8_USTMA/317-433--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
J9NP56_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A8Q3V0_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
E9C115_CAPO3/737-852--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
Q4PA81_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_MYCGM/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
Q5KJZ5_CRYNJ/354-466--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
E9C1B4_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_MYCP1/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METAR/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
I1RRH2_GIBZE/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENCW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
M4FUS1_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_MYCFI/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
D4A881_RAT/472-587--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_MYCP1/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
E9C539_CAPO3/1229-1344--------------------------------------------------------------------------------
E9C6P6_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALSC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
F1QS56_DANRE/596-708--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_THIHA/369-481--------------------------------------------------------------------------------
F9X062_MYCGM/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
E9BY96_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
H9KC07_APIME/873-989--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALSC/324-435--------------------------------------------------------------------------------
I1RGV1_GIBZE/283-390--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_THIHA/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
E9BX46_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_MYCFI/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
J3PWL9_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
I1RPD3_GIBZE/774-890--------------------------------------------------------------------------------
S4ANZ4_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
A8PQQ4_BRUMA/386-499--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

A0A017IJS9_ECOLX/36-350....SDFRVHTFEEEIEF........VQGLNHSTGKNIGIYPEIKAPWFH.HQEGKDIAAKTLEVLKK...YGYTGKDDK
A0A023ZID6_YEASX/7-246.........EILTWAVCH.........PGAKLMLDIKFTNEKIIMIKTFVIMLEVKNDLKFWQERITW...GLWLLDWYD
A0A038FGR1_MYCTX/14-242.........TALPDMR...........VNIDIKAASAIEPTVNVIERCN...AHNRVLIGSFSERR........RRRALR
A0A038LRN9_MYCTX/17-259......TSLLTLDALVSLV......LDWHRPVKIFVETKHPVRYGSLVE....NKLLALLHRFGIAAP....AS.ADRSR
B1X7Q7_ECODH/12-239.........PLLSQVAER........CREHGMMANIEIKPTTGTGPLTG...KMVALAARELWAG..........MTPPL
B2RZV2_BORHD/38-330....HDFKIPTLEEEIQF........IQGLNKSTGRNVGIYPEIKKPLWH.KQQGKDISKIVIEILNK...YGYKSKEDK
C9MK30_HAEIF/40-355....SHFRIHTFEDEIEF........IQGLEKSTGKKVGIYPEIKAPWFH.HQNGKDIATETLKVLKK...YGYDKKTDM
D6EQ07_STRLI/20-243.........ETFPAVR...........WNVDVKAEPALEPLLELIGRHN...AWDRICVGSFSEAR........VVRAQR
G4EU08_BACIU/7-235.........PLLEDVLS..........WAVKKDFLINIELKNSVIRYEG....MEEKVLEAVKRFN..........VEDR
J7JQM5_BACIU/43-285.....GLKVPTLEEVLDR.........FGKHANYYIETKSPDTYPGMEEK..LIASLQKHKLLGKH.........SKPGQ
N1NX43_YEASC/877-1212RGHSIASSFVTLKELFKK.......IPANVGFNIECKFPMLDEAEEEELG..QIMMEMNHWVDTVLKV...VFDNANGRD
O02322_CAEEL/73-322.........HCVANNIMM........IWDVKNVDENLLKQFVIQIRTYN...LYSKVLVSGFNPIDTY...LVKMADPKI
PGC1_SCHPO/37-267.........PTYEQFLHE.......LTKHPGVNLLVDIKPVNDLLIIPR....MVDAMLRVNSDLD.........FWKDK
O86738_STRCO/16-227........VPTLAEALAA.........TDGARLMLDLPGGPGERAVRRVV..DVVRECGARDRVYY.............T
GPC1A_CAEEL/406-706....DFKPFPTLLEALTK.......VDPDVGFNVEVKYPMMQNNGEHEC...DHYFERNLFVDVILAD...VMKHAGNRR
GPC1B_CAEEL/349-649...ELHVPFPSLAQVLRH.......VDENVGLNIEIKYPMYMQDGSHEC...QGYFEQNKFVDIILAE...VAEHAGNRR
Q3BZN0_XANC5/274-516.........KTDQTIAGV.........EQMLEHVLKKPEPMSVALDCKENTGEAVAMLLMRRPDLR........KAAAIK
Q89384_PBCV1/5-217.........PTLNQVLDE.........FKDEYTYDIEIKSSDTASAVVET...IQKSNIPYENTLV..........T...
GDE1_SCHPO/752-1061.......PFTTLKDVLKE.......VPQSVGLNVEFKYPMLSEAEEEKLL..PIAYDYNFYVDTILSI...IKKYGGKRK
Q9RSP0_DEIRA/37-277........VAQLKDVLR..........EFPNTPLIIELKQASPSIAAPFC.AELRRAGATGRVIAAS.......FSDAAL
Q9RWX3_DEIRA/7-220.........PTLPEVLA..........WAVDCEAYVNLELKWESPLPDD....RVVRMLDSIRVHG..........LSRR
Q9RZL4_DEIRA/249-566......FTVPTLEEIIAL........VRDVEAKTGRKVGIYPETKHPTYMAEVAKVNTSQLLIDTLKR....LNFTDPAR
Q9SD81_ARATH/49-357......FPIITFDEYISIAL....DAPRVVGIYPEIKNPVFMNQQVKWADGKKFEDKFVETLKKYGYKGSYLSEDWLKQP
Q9SGA2_ARATH/39-318...ATDDSFCTLQEAFEKV......ENPNLGFNIELKLDDNVFYSSDHLS..RLLLPILQVVSDIG..........NDRT
Q9UAW8_CAEEL/68-331....SRERVPDMEDVVKWAVENNTRMLFDVKDSDNELVDQIANLFQKYN...LYDKAIVCSFFPWVVY...RIKKGDQKI
Q9VQU3_DROME/375-661.....HQPFPQLCDVLDA.......LDVHVGFNIEIKWSQRLEDGKMEEE.FEHVVDRNLYIDCILDV...ILRKAGNRR
Q9W2L6_DROME/349-632.....QRLFPTLQDFFER.......VNLSTGFDIEIKWPQQRADGLFES...EQTLDKNLFADRILAV...VRRHGCGRL
Q9X1V6_THEMA/6-217..........TLKEVFEN.........VSDDKIINIEIKEREAADAVLEI...SKKRKNLIFSSFD............LD
Q9YFI4_AERPE/15-220.........PLYKPMP...........LANWLERLWSMGFTKVVIDVKSG..GIDPTLLASEVERG..........WPGQ
Q9ZTU6_WHEAT/118-414....NAGKFMRLSDFLAF.........AKGEDLSGIMITVEHASFMAEKLGFGVVDAVIKAVDDSGY......SKQTAKK

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441---------------------------------------------------------------------------..GHT
Q8IJR0_PLAF7/626-770---------------------------------------------------------------------------FYGYK
Q6BZ51_DEBHA/455-607---------------------------------------------------------------------------..GRT
PLCG2_MOUSE/314-457---------------------------------------------------------------------------..GWT
PLCL1_HUMAN/400-543---------------------------------------------------------------------------..RNN
PLCD9_ARATH/109-254---------------------------------------------------------------------------..KWN
PLCD1_ARATH/107-250---------------------------------------------------------------------------..GGT
PLCD6_ARATH/139-282---------------------------------------------------------------------------..GRT
A5DAA1_PICGU/440-595---------------------------------------------------------------------------..GRS
PLCD4_RAT/292-436---------------------------------------------------------------------------..GRT
PLCZ1_BOVIN/157-300---------------------------------------------------------------------------..GYT
PLCD3_ARATH/108-251---------------------------------------------------------------------------..GRT
A5E691_LODEL/21-192---------------------------------------------------------------------------..GRT
Q16W08_AEDAE/315-464---------------------------------------------------------------------------..GMA
PLCD5_ARATH/114-257---------------------------------------------------------------------------..GWA
Q5QIB9_STRPU/301-444---------------------------------------------------------------------------..GHT
Q6CSI9_KLULA/402-540---------------------------------------------------------------------------..GL.
PLCD3_HUMAN/339-483---------------------------------------------------------------------------..GHT
Q385H1_TRYB2/248-393---------------------------------------------------------------------------..GYT
Q16ZC0_AEDAE/42-189---------------------------------------------------------------------------..GHT
PLCH1_HUMAN/301-445---------------------------------------------------------------------------..GYT
A2QEJ2_ASPNC/86-262---------------------------------------------------------------------------..GHT
Q4N7P5_THEPA/468-615---------------------------------------------------------------------------WKNCH
A7S279_NEMVE/319-466---------------------------------------------------------------------------..GNA
PLC_DICDI/324-466---------------------------------------------------------------------------..GNT
Q5BFL6_EMENI/534-676---------------------------------------------------------------------------..GRT
Q2HB23_CHAGB/553-696---------------------------------------------------------------------------..GHT
A6RBI2_AJECN/84-320---------------------------------------------------------------------------..GYT
A0CKY8_PARTE/271-413---------------------------------------------------------------------------..GYT
Q5CLA7_CRYHO/367-509---------------------------------------------------------------------------..GHT
E9AEI1_LEIMA/296-447---------------------------------------------------------------------------..GHT
Q9XWB7_CAEEL/306-468---------------------------------------------------------------------------..GPT
Q8IA75_CAEEL/367-517---------------------------------------------------------------------------..GQT
PLC1_YEAST/382-521---------------------------------------------------------------------------..GF.
PLCE1_HUMAN/1394-1541---------------------------------------------------------------------------..GHT
A7RXP6_NEMVE/244-393---------------------------------------------------------------------------..GMT
Q7QHE3_ANOGA/319-462---------------------------------------------------------------------------..GHT
A0BLC4_PARTE/285-429---------------------------------------------------------------------------..GFT
Q6FY00_CANGA/381-519---------------------------------------------------------------------------..GV.
A0BLM0_PARTE/262-404---------------------------------------------------------------------------..GHT
Q59LC4_CANAL/566-727---------------------------------------------------------------------------..GRT
Q2UPV6_ASPOR/98-321---------------------------------------------------------------------------..GHT
Q4PDE8_USTMA/122-279---------------------------------------------------------------------------..GYT
A7T501_NEMVE/158-302---------------------------------------------------------------------------..GYT
A7ASE0_BABBO/522-670---------------------------------------------------------------------------WKNCQ
Q4PA81_USTMA/724-872---------------------------------------------------------------------------..GRT
A7TR21_VANPO/381-520---------------------------------------------------------------------------..SF.
Q75C92_ASHGO/397-535---------------------------------------------------------------------------..GK.
A7RPQ0_NEMVE/307-450---------------------------------------------------------------------------..GHT
A7SXK4_NEMVE/94-237---------------------------------------------------------------------------..GHT
A4S165_OSTLU/1-153---------------------------------------------------------------------------..GGT
Q7PW25_ANOGA/289-436---------------------------------------------------------------------------..GYT
A7RKT2_NEMVE/272-413---------------------------------------------------------------------------..GRT
A3LSB2_PICST/461-615---------------------------------------------------------------------------..GRT
A3LNB7_PICST/20-167---------------------------------------------------------------------------..GKF
PLCH2_HUMAN/328-472---------------------------------------------------------------------------..GYT
Q0UVV5_PHANO/116-337---------------------------------------------------------------------------..GYT
Q4QBH9_LEIMA/195-340---------------------------------------------------------------------------..GYT
Q0UE70_PHANO/101-258---------------------------------------------------------------------------..GYT
PLCL2_MOUSE/429-572---------------------------------------------------------------------------..GHT
PLCZ1_CHICK/159-303---------------------------------------------------------------------------..GHT
Q2GUM5_CHAGB/104-264---------------------------------------------------------------------------..GYT
Q21754_CAEEL/318-461---------------------------------------------------------------------------..KRT
A7SDH9_NEMVE/209-352---------------------------------------------------------------------------..GHT
A4HCK9_LEIBR/248-393---------------------------------------------------------------------------..GYT
PLC1_SCHPO/443-585---------------------------------------------------------------------------..GHT
Q013R6_OSTTA/119-269---------------------------------------------------------------------------..GGT
Q75IL8_ORYSJ/119-262---------------------------------------------------------------------------..GRT
PLCD8_ARATH/107-248---------------------------------------------------------------------------..SWN
Q6CD33_YARLI/505-648---------------------------------------------------------------------------..GRT
A7UXE0_NEUCR/118-273---------------------------------------------------------------------------..GYT
A9RJG9_PHYPA/150-293---------------------------------------------------------------------------..GGT
A9SXU1_PHYPA/108-250---------------------------------------------------------------------------..GNT
B4H106_DROPE/328-471---------------------------------------------------------------------------..GHT
B6C9K2_SOLLC/110-252---------------------------------------------------------------------------..GRT
B6KHA6_TOXGO/407-549---------------------------------------------------------------------------VGGYQ
E9QD74_DANRE/316-459---------------------------------------------------------------------------..GHT
F1R8S3_DANRE/294-437---------------------------------------------------------------------------..GYT
F6HKS4_VITVI/112-254---------------------------------------------------------------------------..GRT
F7DT82_CALJA/159-308---------------------------------------------------------------------------..GKA
G3GVA5_CRIGR/324-467---------------------------------------------------------------------------..GYT
G3UXP4_MOUSE/322-465---------------------------------------------------------------------------..GHT
G4UMR8_NEUT9/110-362---------------------------------------------------------------------------..GYT
PLCB_CAEEL/342-492---------------------------------------------------------------------------..GKA
H2SZT5_TAKRU/30-172---------------------------------------------------------------------------..GWT
H2USZ2_TAKRU/343-506---------------------------------------------------------------------------..HYQ
H3CD03_TETNG/306-449---------------------------------------------------------------------------..GYT
H3CYP8_TETNG/287-430---------------------------------------------------------------------------..GHT
H3D277_TETNG/321-464---------------------------------------------------------------------------..GHT
H3D2C1_TETNG/321-464---------------------------------------------------------------------------..GSS
H3D5C7_TETNG/314-459---------------------------------------------------------------------------..GYT
H3DBV7_TETNG/298-442---------------------------------------------------------------------------..GHT
H3DF29_TETNG/89-233---------------------------------------------------------------------------..GYT
H3DK53_TETNG/325-468---------------------------------------------------------------------------..GHT
I1R783_ORYGL/114-256---------------------------------------------------------------------------..GGT
K4A9N8_SETIT/153-295---------------------------------------------------------------------------..GRT
M1BNL7_SOLTU/113-255---------------------------------------------------------------------------..GGT
M1CL37_SOLTU/111-252---------------------------------------------------------------------------..GGT
M4FG24_BRARP/66-209---------------------------------------------------------------------------..GRT
PLCB2_RAT/314-464---------------------------------------------------------------------------..GFT
PLC_LISMO/61-198---------------------------------------------------------------------------..GPI
PLCB3_MOUSE/319-469---------------------------------------------------------------------------..GFT
Q236T7_TETTS/331-475---------------------------------------------------------------------------..GVF
PLC_STAA8/51-192---------------------------------------------------------------------------..GMV
Q4DUP6_TRYCC/248-392---------------------------------------------------------------------------..GHT
Q4WX21_ASPFU/96-334---------------------------------------------------------------------------..GHT
Q5A0L4_CANAL/21-164---------------------------------------------------------------------------..GKF
Q5KJZ5_CRYNJ/160-301---------------------------------------------------------------------------..RKT
Q7SE08_NEUCR/136-356---------------------------------------------------------------------------..HGT
Q81A32_BACCR/58-194---------------------------------------------------------------------------..GPL
PLCD4_ARATH/116-257---------------------------------------------------------------------------..GRT
W4XJU2_STRPU/318-467---------------------------------------------------------------------------..GLA

PF00387

G8BKQ6_CANPC/644-760-----------------------------------------------TINK.MM...K........DEV..KKTS..LDK
A7RPQ0_NEMVE/492-607-----------------------------------------------LARR.LG....NAY..PE.E.............
F2ULH4_SALR5/541-656-----------------------------------------------KALR.LV....TGK..PE.E.............
G4VBK4_SCHMA/531-646-----------------------------------------------VALG.LL....KNQ..AI.E.............
S0DQT6_GIBF5/306-423-----------------------------------------------GLAS.HL..PE........HA.....SH..IAR
E9GFR8_DAPPU/479-594-----------------------------------------------KAKK.LI....RRE..RS.S.............
G0WGC6_NAUDC/598-716-----------------------------------------------KLDA.MS...M........DKS..LNLS..IDK
L0PAS0_PNEJ8/47-161-----------------------------------------------SFNN.II.............KN..SKTQ..LEK
K0R6H0_THAOC/569-682-----------------------------------------------KALK.IL..NNPLN..CD.Q.............
I3JX91_ORENI/928-1039-----------------------------------------------KLPG.......KSR..TK.D.............
I3K883_ORENI/523-637-----------------------------------------------EAGR.LT....SES..PE.D.............
E2BGZ2_HARSA/531-646-----------------------------------------------AALN.YL....KTH..SV.E.............
J3K9R2_COCIM/769-886-----------------------------------------------SIET.IC...R........DSE..NKAL..LEA
I1G7J0_AMPQE/80-196-----------------------------------------------RVER.FVKN.KEHA..G..N.............
G8JQV5_ERECY/594-709-----------------------------------------------KFDN.LC...K........DEN..QRLA..IDK
F6SF88_CIOIN/565-682-----------------------------------------------GGMN.YI....KSN..AV.N.............
G2R3P3_THITE/406-520-----------------------------------------------SFRS.L...AE........DST..KVHK..LLA
F2U545_SALR5/2126-2244-----------------------------------------------RLAA.LS....ANPTTAH.A.............
PLC_DICDI/543-652-----------------------------------------------KVKQ.LV....QSE..PR.E.............
B3SC97_TRIAD/538-653-----------------------------------------------TGFG.HF....KAS..PT.D.............
T1J420_STRMM/330-445-----------------------------------------------KAYT.LA....DSK..LE.K.............
E4XLQ6_OIKDI/964-1081-----------------------------------------------KIQKYLT....ESY..VK.S.............
J9MUK9_FUSO4/781-897-----------------------------------------------SFAK.NF...R........AKE..QKIA..VDL
U7PV69_SPOS1/502-615-----------------------------------------------TIQA.L.............HLK..NHEE..LFL
A5DAA1_PICGU/648-764-----------------------------------------------SFNS.LL...S........DEE..KRLS..LAK
H2N2E2_ORYLA/491-606-----------------------------------------------KARK.YL....KES..GA.E.............
G8BYA3_TETPH/612-727-----------------------------------------------KYLN.LC...T........DES..LKLS..FNK
D7ELR5_TRICA/967-1083-----------------------------------------------KAEK.LMCQ..QEK..K..F.............
A7SMY6_NEMVE/400-514-----------------------------------------------KAER.YISR..KYS..K..E.............
S7ZDD6_PENO1/368-480-----------------------------------------------ACQD.E.............HMN..QRER..LFE
E9HXQ7_DAPPU/696-810-----------------------------------------------E..K.LMTQ..QEY..Q..F.............
H0ZA90_TAEGU/543-658-----------------------------------------------KACD.LL....SKF..PM.Q.............
F6S6B2_CIOIN/946-1058-----------------------------------------------KAER.YACR..DKA..R..I.............
F0XRH2_GROCL/838-956-----------------------------------------------VYDK.QT...K........SRE..QRRA..VHW
G4N054_MAGO7/418-530-----------------------------------------------AVLD.L.............HEK..YGQE..LFD
T1KUP6_TETUR/217-327-----------------------------------------------FASK.LA..................LAS..PED
F6RLC5_XENTR/487-602-----------------------------------------------KARK.LV....REP..GN.D.............
U1HY48_ENDPU/777-894-----------------------------------------------KAGR.LC...R........DAL..SKAQ..FED
B7P4X9_IXOSC/943-1057-----------------------------------------------KVEK.WISP..QHC..S..F.............
G2YC85_BOTF4/422-534-----------------------------------------------VINE.L.............HEQ..KREQ..MFQ
L8FTI0_PSED2/766-883-----------------------------------------------TFTK.NS...K........TPD..TKRA..LVR
U3JVN7_FICAL/532-647-----------------------------------------------KALK.LA....QES..GT.S.............
Q4PDE8_USTMA/317-433-----------------------------------------------GLLD.LL..PK........HS.....TA..IKK
I3L7K2_PIG/492-608-----------------------------------------------RALR.LL....QES..GN.S.............
H3BDF5_LATCH/514-630-----------------------------------------------KARK.LI....REA..GGNE.............
K5XX24_AGABU/562-680-----------------------------------------------AANR.LM....KSGDVLK.N.............
H2SZT4_TAKRU/541-665-----------------------------------------------KVPG.......KSR..TK.E.............
H3CR59_TETNG/503-618-----------------------------------------------KAVK.LA....EES..AN.E.............
H3A2I8_LATCH/834-950-----------------------------------------------KAEK.YANR..SKG..K..K.............
R8BVG2_TOGMI/308-425-----------------------------------------------GLAS.SI..PT........FG.....DK..IGR
W5MU43_LEPOC/512-627-----------------------------------------------KAEK.LA....LVS..AS.A.............
M2UIG2_COCH5/302-418-----------------------------------------------GLKS.HL..PA........NS.....AK..IAH
S3DHJ9_GLAL2/313-430-----------------------------------------------GLSS.HM..PA........AS.....AK..IGA
W1QFP3_OGAPD/592-708-----------------------------------------------TLVK.MA...R........EEA..KFSA..IVK
H2UH12_TAKRU/488-602-----------------------------------------------VMNQ.IL....QLK..PD.H.............
L8FLM5_PSED2/482-594-----------------------------------------------DILE.L.............FAA..SPNA..LLA
H2YFJ0_CIOSA/524-639-----------------------------------------------AALR.LL....TFY..PM.D.............
K7M553_SOYBN/345-454-----------------------------------------------TLEK.....................ASESHGTD
F2U1Z4_SALR5/471-588-----------------------------------------------KAHK.LVNDILTAD.....K.............
G3P4B1_GASAC/508-622-----------------------------------------------EALR.LI....KDS..GK.L.............
R7YJ72_CONA1/333-445-----------------------------------------------VLME.V.............HES..DPRG..LFS
N4UQ90_FUSC1/308-422-----------------------------------------------KAQE.LI..S.........DSQ..TRTD..LLQ
D5GAP7_TUBMM/347-465-----------------------------------------------VFAN.L.............HAQ..HAES..IFH
J9NP56_FUSO4/284-405-----------------------------------------------GLQL.LL..SVPTDDISM.ENL..ERNQ..LFR
K1WAI4_MARBU/420-532-----------------------------------------------QIQD.L.............HET..RQQE..MFT
S8A7Z1_DACHA/271-383-----------------------------------------------KFNS.L.............HEA..QADA..LFQ
Q013R6_OSTTA/352-465-----------------------------------------------KLKL....................KIEKESSKD
K1PZR1_CRAGI/575-690-----------------------------------------------TAIK.LA....MSC..PE.E.............
Q9XWB7_CAEEL/528-650-----------------------------------------------TVYNCLR.............AN..SIDK..VQN
C9SV93_VERA1/293-405-----------------------------------------------KVID.V.............HEE..NSKA..LFA
A4S165_OSTLU/202-315-----------------------------------------------KAKK....................LVEKSSQKD
N1RC01_FUSC4/282-393-----------------------------------------------HLQD.LI.............SV..SHTN..LFR
C7ZJB8_NECH7/239-351-----------------------------------------------KLLE.L.............DEA..DGTG..LLF
G0RBZ6_HYPJQ/342-459-----------------------------------------------GLAA.HL..PQ........HA.....VA..IAR
G7P2D3_MACFA/393-508-----------------------------------------------KAKR.LI....KEA..GN.E.............
D2VS67_NAEGR/554-665-----------------------------------------------MGLTHIIKKGSH.....................
A8Q3V0_BRUMA/969-1079-----------------------------------------------KFEK.LVER..........G.............
A1CJQ9_ASPCL/375-487-----------------------------------------------AARE.A.............YAK..DAHA..LLE
H3A3M2_LATCH/610-722-----------------------------------------------RANQ.LI....QQK..PE.D.............
Q21754_CAEEL/494-608-----------------------------------------------KVYT.MF..................EAAVPIFT
E9G040_DAPPU/487-602-----------------------------------------------AASR.LH....ASS..PA.M.............
E9C115_CAPO3/737-852-----------------------------------------------TAEK.......HQKKSAR.D.............
V2Z343_MONRO/363-478-----------------------------------------------AANK.ML....KGGSTMV.D.............
W4XRL3_STRPU/213-326-----------------------------------------------KVER.YMCA..GKS..K..V.............
W5N0K4_LEPOC/507-620-----------------------------------------------EAQR.HI....KES..GT.A.............
N1QLI7_SPHMS/293-404-----------------------------------------------KLLE.A.............CEE..QPEK..LFK
Q4PA81_USTMA/993-1113-----------------------------------------------TALK.MIRDPISNE.....A.............
R7YQ07_CONA1/783-900-----------------------------------------------TFDA.KA...K........DPA..TKEL..LER
PLCZ1_CHICK/377-492-----------------------------------------------KAQK.FV....KHA..AN.Q.............
G1NLG3_MELGA/393-511-----------------------------------------------VTRG.LK.................IKSPLAALN
H3ERT0_PRIPA/495-607-----------------------------------------------GMSK.LVRNESRLS..A................
R1EKA9_BOTPV/390-502-----------------------------------------------RLME.V.............HQH..FPSE..LFQ
H3CZG1_TETNG/283-398-----------------------------------------------KALE.QL....TKS..PV.E.............
T1G6Y6_HELRO/929-1047-----------------------------------------------RIFD.KTSQANQQV..R..T.............
N4VFU7_COLOR/301-417-----------------------------------------------GLAS.HM..PD........AS.....EK..ISR
PLC1_YEAST/590-709-----------------------------------------------KVEY.MI...K........DKH..LKLS..LDK
Q4DUP6_TRYCC/458-575-----------------------------------------------KAKK.IA....VSN..AM.E.............
F4NTE5_BATDJ/674-789-----------------------------------------------TANA.LL.................QKQRDRLVH
F2TZD4_SALR5/1418-1533-----------------------------------------------KLNR.LI....HKS..SD.K.............
S3CWU2_GLAL2/446-558-----------------------------------------------QIMD.L.............HST..RKSD..MFN
C5MGF2_CANTT/703-819-----------------------------------------------TINR.IL...K........DES..TKNQ..LLK
A7S279_NEMVE/566-681-----------------------------------------------TGFG.LV....RAT..PL.D.............
E5STY8_TRISP/976-1085-----------------------------------------------KLER.LLEK..........D.............
F9WW59_MYCGM/306-422-----------------------------------------------GLAP.LM..AH........SS.....PK..ISK
S3BUU6_OPHP1/912-1029-----------------------------------------------VYEK.HT...K........TRD..SRQS..VYY
F2U5I3_SALR5/965-1082-----------------------------------------------KAMA.LV....REVNGQAEA.............
K7H8T9_CAEJA/525-647-----------------------------------------------TVWSCLK.............NN..TVDK..VQN
G2WWA7_VERDV/450-561-----------------------------------------------RILE.L.............YAT..MQSA..VFT
Q75C92_ASHGO/595-713-----------------------------------------------SFDN.LA...N........DDL..QRLA..IDK
Q17CT3_AEDAE/942-1053-----------------------------------------------KAEK.YFLQ..QET..K..L.............
H2ARE2_KAZAF/619-733-----------------------------------------------KVDF.MI...K........DSV..LSCS..LNK
C3ZX35_BRAFL/216-331-----------------------------------------------KANH.LV....EEQ..AA.D.............
A8Q4L8_MALGO/619-735-----------------------------------------------SAAR.LM....RQS..HA.D.............
B6JVB4_SCHJY/640-754-----------------------------------------------TISR.FG.............KS..IYPH..LKK
M7TCG9_EUTLA/559-676-----------------------------------------------TFRK.HS...K........NSD..SKTA..LAR
G3NGW3_GASAC/357-472-----------------------------------------------KALT.LA....ETS..AT.A.............
A9V4B2_MONBE/210-323-----------------------------------------------TLQE.............................
G3WFA8_SARHA/54-171-----------------------------------------------RAHQ.VV....QQK..SE.Q.............
G1KGF4_ANOCA/537-652-----------------------------------------------KARK.LI....KES..GN.Q.............
F4X6N0_ACREC/597-712-----------------------------------------------QATT.LL....KEK..PL.E.............
G3WAG3_SARHA/506-619-----------------------------------------------KARK.FI....KED..GN.S.............
Q5KJZ5_CRYNJ/354-466-----------------------------------------------TAAK.IL....KEN..KV.D.............
G4UK54_NEUT9/327-448-----------------------------------------------GLNA.LL............SSG..NGAS..IAK
H3G127_PRIPA/946-1056-----------------------------------------------KLEK.ILEK..........G.............
F4PW61_DICFS/518-627-----------------------------------------------KVKE.LV....KANGTYS...............
G4TVY5_PIRID/719-847-----------------------------------------------RAKG.LIHNPVQAD.....VKDSLKKSAHDSTL
M4A2J9_XIPMA/503-618-----------------------------------------------KAIE.IL....KTF..PF.E.............
E9C1B4_CAPO3/887-1002-----------------------------------------------KADK.II....RKQ..AA.D.............
H0ZQ48_TAEGU/377-492-----------------------------------------------QARK.LA....KIS..AK.E.............
E4UYL4_ARTGP/377-489-----------------------------------------------AVKS.A.............HEK..ERQA..LFE
W5KFU3_ASTMX/71-182-----------------------------------------------VALK.HI....KTS..GK.L.............
F8QEC8_SERL3/510-622-----------------------------------------------TANK.IL....KQG..ML.D.............
G8YRD2_PICSO/652-768-----------------------------------------------AANS.ML...K........DKE..KEVS..INK
H6BNY9_EXODN/314-431-----------------------------------------------ALRA.HL..PA........EI.....HR..IAR
N1Q1A9_MYCP1/804-922-----------------------------------------------QFDR.LC..AK........NTD..NKAL..LES
D3BQ91_POLPA/553-667-----------------------------------------------AINNVLG....SYD..SG.K.............
V2XG66_MONRO/249-363-----------------------------------------------GLGK.LL..PD.............FLHH..LIH
G2XH69_VERDV/316-433-----------------------------------------------GLGA.HL..PA........QS.....TH..IAN
G9P5U2_HYPAI/366-478-----------------------------------------------KFIE.Y.............HEK..QWEA..LFN
F4S5V3_MELLP/586-701-----------------------------------------------AVNK.FL....KSG..ST.D.............
G3NDC5_GASAC/480-595-----------------------------------------------KAKK.LA....KDA..GT.D.............
G3Y1M7_ASPNA/321-433-----------------------------------------------AVRE.A.............HAT..DGDA..LFE
V8NBX9_OPHHA/517-632-----------------------------------------------EASK.IA....NEC..PE.D.............
M2NIY8_BAUCO/658-779-----------------------------------------------TFQT.HC..KK........EAG..EKQA..LAK
E9F491_METAR/362-474-----------------------------------------------KFME.H.............REK..HAQA..LFD
B2APA5_PODAN/327-447-----------------------------------------------GLAR.HATDDV........NT.....AA..IQR
U1NK79_ASCSU/575-691-----------------------------------------------RAYE.LV....KQS..PI.E.............
T5AMI8_OPHSC/302-414-----------------------------------------------KFLE.H.............HER..RVPD..LFE
B7Q2N6_IXOSC/514-630-----------------------------------------------KAAK.LS....STDQGAR.D.............
I1RRH2_GIBZE/358-468-----------------------------------------------KVID.V.............HEE..QADA..LFN
C3ZUS9_BRAFL/419-534-----------------------------------------------KAMD.LV....KRQ..AA.D.............
F7BFD4_HORSE/377-492-----------------------------------------------KARK.LS....KLQ..AQ.E.............
C4R8N7_PICPG/562-681-----------------------------------------------KLKR.FM...K........EET..KIIA..LLK
B6HG38_PENCW/308-420-----------------------------------------------AARE.T.............HAN..QRDA..LFE
A7RPT6_NEMVE/607-722-----------------------------------------------RAYR.FT....DTK..AT.Q.............
G7PV15_MACFA/479-594-----------------------------------------------KAKK.LI....REA..GN.S.............
G1KDV8_ANOCA/504-618-----------------------------------------------KAFK.LA....QES..GT.S.............
F6V4E2_XENTR/493-608-----------------------------------------------KALK.LA....NDS..GN.K.............
E4Y2H6_OIKDI/537-648-----------------------------------------------QGLS.HL....GSR..SQ.E.............
B5YNJ7_THAPS/196-310-----------------------------------------------RVKA.FS.KSIQCH..K................
E3RKS1_PYRTT/745-863-----------------------------------------------AFDK.LT...KP.......GAR..EKHL..LEE
C5GIH2_AJEDR/773-890-----------------------------------------------AFER.LC...G........DSE..NKAL..LEA
Q6CD33_YARLI/707-821-----------------------------------------------KFIS.IC...K........DPE..NREQ..MMK
E3QFQ0_COLGM/792-909-----------------------------------------------SFTR.NS...K........SKE..ERRA..IER
Q8IJR0_PLAF7/979-1086-----------------------------------------------KFIK.LIKKNENE....................
H3B651_LATCH/510-624-----------------------------------------------KAFR.LA....QES..GH.E.............
B8JLR7_DANRE/165-276-----------------------------------------------KAHQ.LI....QQK..PV.P.............
L2GAB8_COLGN/486-597-----------------------------------------------KILE.L.............HTT..KARE..MFA
Q6FY00_CANGA/576-698-----------------------------------------------RLDK.ML...G........DAQ..VAAA..VDK
H2MWG8_ORYLA/509-623-----------------------------------------------EALK.LI....KDS..GV.L.............
L2FNL9_COLGN/331-443-----------------------------------------------AAFA.I.............QRR..MPRA..LFM
F4PW60_DICFS/469-579-----------------------------------------------KIME.FI....KSDYTAS...............
M4FUS1_MAGP6/840-957-----------------------------------------------TFQR.NS...R........PGD..AKRA..LYR
W4Y1W0_STRPU/441-553-----------------------------------------------RANN.LA....MTR..AA.D.............
N1Q7T0_MYCFI/249-360-----------------------------------------------KLLE.A.............CEK..KPKE..LFN
G1X2N7_ARTOA/734-851-----------------------------------------------TFIS.LC...K........DKE..KKAQ..LEK
D4A881_RAT/472-587-----------------------------------------------KAKN.LI....REA..GN.E.............
J3PD85_GAGT3/457-567-----------------------------------------------RIRD.L..................DAKA..IAA
J9FJP4_WUCBA/677-792-----------------------------------------------TGLG.YL....KQS..AP.E.............
E4WY87_OIKDI/494-609-----------------------------------------------VCSS.YA....KNQ..SR.A.............
G0RQN5_HYPJQ/375-487-----------------------------------------------RILE.L.............HDK..FPRE..VFT
E5S0V3_TRISP/556-672-----------------------------------------------KGYE.MM....QKD..VT.S.............
E9HCC3_DAPPU/480-597-----------------------------------------------EAST.YL....KKL..TA.D.............
G4U8M0_NEUT9/388-500-----------------------------------------------KFLD.MI..AQ........DKA..RL.K..IMD
H3A2R7_LATCH/432-547-----------------------------------------------KARK.LM....RES..GS.S.............
G0S1B2_CHATD/408-522-----------------------------------------------CFLS.L...AA........DSH..KLHK..VLA
G0VE13_NAUCC/579-693-----------------------------------------------KFDS.IR...L........DNS..LNLS..LDK
U1LYV5_ASCSU/529-640-----------------------------------------------KVQS.LM..................EGGTTLAI
F2TW56_SALR5/229-338-----------------------------------------------QLEK.HT.............RN..GASS..MME
H2S9Y1_TAKRU/516-631-----------------------------------------------LALR.LA....TES..PG.D.............
A4I027_LEIIN/518-635-----------------------------------------------KGKA.IA....REA..HD.A.............
A4I5X4_LEIIN/479-593-----------------------------------------------VVKE.LA....LSH..RD.E.............
J7S7W7_KAZNA/613-728-----------------------------------------------QLSS.MM...K........DVP..MRLS..VDK
I3LUM3_PIG/517-632-----------------------------------------------KAQQ.IL....QQK..PM.Q.............
Q2GUM5_CHAGB/309-422-----------------------------------------------GLAS.HT..RE........HA.....PE..IAR
E7F646_DANRE/482-596-----------------------------------------------KARK.YS....KEA..GS.D.............
R1G5R1_BOTPV/762-880-----------------------------------------------TFDN.LC..NK........DSV..SKEL..LEE
B7P6Q6_IXOSC/455-570-----------------------------------------------QATN.LL....KEH..PV.E.............
C7YZS5_NECH7/344-456-----------------------------------------------KVQD.V.............LDT..HACE..LFS
E5S7A2_TRISP/292-403-----------------------------------------------QLIA.MV.................EENQPAMVK
T5AHM7_OPHSC/836-953-----------------------------------------------SFAK.HS...R........TKE..AKMA..LDI
W5K5D9_ASTMX/504-619-----------------------------------------------KAKQ.LA....DNS..AS.A.............
V2XVI5_MONRO/531-646-----------------------------------------------SANR.YL....KRGS.MK.D.............
A7TR21_VANPO/594-716-----------------------------------------------KLEH.LC...K........DTT..QKLA..VDK
H6BSD8_EXODN/761-878-----------------------------------------------RAIE.LC...H........SPE..DKAM..FED
G1SZX7_RABIT/565-680-----------------------------------------------VGLG.YL....KTH..AI.E.............
W5NED0_LEPOC/303-418-----------------------------------------------KARK.LA....RNS..GC.E.............
H2Y8L4_CIOSA/418-534-----------------------------------------------KAFR.LA....KNK..LK.E.............
F6QRY0_ORNAN/482-597-----------------------------------------------KALR.LV....HEE..GT.S.............
W5K097_ASTMX/925-1036-----------------------------------------------KVPI.......KHR..PN.E.............
R4GLW0_CHICK/523-638-----------------------------------------------KARK.LI....RDA..GN.E.............
M7XIS4_RHOT1/672-788-----------------------------------------------RLTK.MLRDEAARQ.....D.............
C4Y529_CLAL4/632-746-----------------------------------------------SANS.MI...K........DDG..KRNA..LDK
N1PRW4_MYCP1/309-425-----------------------------------------------GLLG.LI..PT........HS.....EK..ISQ
K1PD91_CRAGI/941-1059-----------------------------------------------KIER.YCSQ..TYS..H..F.............
H0ZM24_TAEGU/68-179-----------------------------------------------VRVA.............................
G4MWU9_MAGO7/371-483-----------------------------------------------VAFD.T.............QRR..EPGA..FFE
Q5QIB9_STRPU/495-609-----------------------------------------------KAFG.LA....EDK..PG.D.............
S3CY83_OPHP1/495-607-----------------------------------------------SLME.I.............HAK..HGPA..LFS
E9C539_CAPO3/1229-1344-----------------------------------------------KAKK.IC....VSQ..AV.S.............
E9C6P6_CAPO3/838-953-----------------------------------------------KAFK.LA....RSN..GK.E.............
U9U0Y0_RHIID/792-909-----------------------------------------------VATR.LT....KTD..KQ.S.............
K1VS91_TRIAC/657-769-----------------------------------------------TSNK.IL.ASGQA....S.D.............
A4HCK9_LEIBR/443-560-----------------------------------------------KVEA.IA....REN..RD.A.............
F1QJ13_DANRE/490-604-----------------------------------------------DALK.LI....KES..GK.L.............
G9MGY4_HYPVG/754-871-----------------------------------------------SFAK.HS...Q........SKT..EKSQ..LNL
R4GHY9_CHICK/479-594-----------------------------------------------KARK.LI....KEA..GP.A.............
G7DTU8_MIXOS/579-693-----------------------------------------------RMLK.TIRDARME....................
U1HPN2_ENDPU/378-490-----------------------------------------------KVVD.M.............HES..DGHA..LFS
T1K2W1_TETUR/963-1075-----------------------------------------------KVEK.WLSP..QNC..P..A.............
I4YJJ0_WALSC/187-305-----------------------------------------------AMSK..V..CN........DTR..ALAD..VRH
F0XQ81_GROCL/442-554-----------------------------------------------GVQE.V.............HAK..DGPA..LFH
U4LP91_PYROM/778-895-----------------------------------------------SFLK.FC...K........DSD..KKVA..LEK
C1MLD2_MICPC/347-455-----------------------------------------------TLNN....................RKWALDKAT
M3ZIE9_XIPMA/486-601-----------------------------------------------KAHQ.LM....QQK..AA.S.............
D8Q686_SCHCM/514-628-----------------------------------------------KAKK.LM....DAD..MA.R.............
E0V9R3_PEDHC/981-1097-----------------------------------------------KAEK.LICK..EET..R..F.............
F1QS56_DANRE/596-708-----------------------------------------------RAQN.LV....HHR..AE.R.............
Q7ZZ38_DANRE/570-685-----------------------------------------------KGMD.TL....KNS..PT.E.............
S3CK06_OPHP1/317-437-----------------------------------------------GLAA.HLAEPA........NS.....AA..IAR
I1FVA6_AMPQE/653-769-----------------------------------------------KGMN.LI....KTK..PK.E.............
G2QE78_THIHA/369-481-----------------------------------------------GVME.V.............HEK..SARE..LFE
F9X062_MYCGM/294-423-----------------------------------------------KLLD.A.............CEE..HQEK..VLD
B3S5L7_TRIAD/600-715-----------------------------------------------SALK.LN....QAS..PD.E.............
U7PMJ4_SPOS1/852-970-----------------------------------------------VYDR.ST...K........ARD..YRQA..VYF
K1R906_CRAGI/339-447-----------------------------------------------KALK.LI....DND..RD.G.............
Q6CSI9_KLULA/623-738-----------------------------------------------KFIN.LD...K........DET..QKLA..INK
N1JC99_BLUG1/775-892-----------------------------------------------TFNK.NS...R........TPE..DKHA..IVR
E9BY96_CAPO3/640-755-----------------------------------------------KTKK.FA....SKL..PS.Q.............
F1R8S3_DANRE/484-599-----------------------------------------------KALK.LA....EES..AT.E.............
C5DWX3_ZYGRC/549-664-----------------------------------------------KIDN.LC...N........DRI..QELS..IDK
J3P931_GAGT3/353-465-----------------------------------------------GAAE.V.............QQK..QPVE..FFQ
G8ZY68_TORDC/585-700-----------------------------------------------SFYN.MQ...K........DKT..QELS..LDK
H9KC07_APIME/873-989-----------------------------------------------KAEK.LMCQ..QEN..K..F.............
J9EUZ4_WUCBA/174-288-----------------------------------------------KVRK.LM..............E..ITES..FTA
J9JQK0_ACYPI/173-289-----------------------------------------------KAEK.LMCH..QES..V..F.............
T1FX15_HELRO/212-327-----------------------------------------------KALE.LA....QTD..LN.G.............
PLC1_SCHPO/638-752-----------------------------------------------TIKK.HG.............KA..MVPR..LSK
I4Y9T4_WALSC/324-435-----------------------------------------------SARK.CI....NTS..SA.E.............
I1RGV1_GIBZE/283-390-----------------------------------------------KLSK.RI...S........K.....EKP..LGL
A7RXP6_NEMVE/450-565-----------------------------------------------VATT.QL....KEK..PV.E.............
M1WD50_CLAP2/329-446-----------------------------------------------ELLS.HL..PA........ES.....TA..VAA
C7YLY8_NECH7/448-559-----------------------------------------------RILE.L.............HQK..QHRD..MFT
E4ZW47_LEPMJ/391-503-----------------------------------------------ALME.V.............HST..NPAG..LFT
T1JBA8_STRMM/526-641-----------------------------------------------KALS.MA....EAE..PS.A.............
H2Z2T5_CIOSA/481-594-----------------------------------------------DAAK.LV....ENE..AG.D.............
G3B2Z3_CANTC/553-668-----------------------------------------------TIDL.ML...K........DET..KQKS..VDK
F0Z941_DICPU/560-673-----------------------------------------------KVKA.LV....QTD..SK.E.............
F6XYJ8_XENTR/524-634-----------------------------------------------KVRR.LI....KDS..GI.N.............
R8BH76_TOGMI/661-777-----------------------------------------------TFLK.NS...E........SKV..DKRA..LYR
G2Q018_THIHA/394-509-----------------------------------------------SFLS.L...VE........DES..KLHK..VLK
I3JP81_ORENI/305-420-----------------------------------------------KARK.LL....KAS..GS.D.............
C6HRC6_AJECH/378-490-----------------------------------------------AVRN.A.............HEN..ERQA..LFE
B0D2M8_LACBS/202-309-----------------------------------------------AANK.ML....KFG..MM.D.............
Q1LWW2_DANRE/15-130-----------------------------------------------IIPK.EGNESGMEK..SD.C.............
T1GAZ8_MEGSC/275-385-----------------------------------------------KAKQ.II....QQN..PL.G.............
F6Y1S7_CIOIN/466-581-----------------------------------------------KAMN.LY....NSQ..AE.E.............
K5XNX9_AGABU/250-367-----------------------------------------------SLLS.LL..TS........SNT..ILDA..LIV
N1QL86_SPHMS/786-905-----------------------------------------------TFDD.LC..TK........KTD..NKAI..MEK
Q385H1_TRYB2/453-569-----------------------------------------------KAGK.IA....SSN..QE.E.............
C1FE07_MICSR/227-338-----------------------------------------------KLVS....................QVEEIGREL
E3MQ20_CAERE/991-1101-----------------------------------------------KLDK.LVEK..........G.............
Q2HB23_CHAGB/790-904-----------------------------------------------TFAE.KN...Q........LSE..GKRA..LYR
F7FGQ0_MONDO/286-401-----------------------------------------------RARK.LS....KQK..AR.E.............
F6ZK74_CIOIN/369-484-----------------------------------------------KAQA.LV....ESR..AS.D.............
H2URW7_TAKRU/209-324-----------------------------------------------DANR.YA....NEF..PE.E.............
A3LSB2_PICST/670-786-----------------------------------------------SINS.ML...K........DET..KKAS..IDK
E9BX46_CAPO3/922-1038-----------------------------------------------KARK.VA....SRQ..TAAK.............
C3Z9I4_BRAFL/477-593-----------------------------------------------GAIR.LA....VSF..PE.E.............
H2SZT3_TAKRU/428-542-----------------------------------------------KVPG.......KSR..TK.E.............
N1Q9A1_MYCFI/659-776-----------------------------------------------VFDR.LS...K........NHE..TKVE..LEQ
B7S3T2_PHATC/601-716-----------------------------------------------KIGK.IL.SKNPAN..TD.L.............
W5KFE6_ASTMX/490-605-----------------------------------------------KARK.II....KES..AA.D.............
Q2H4G2_CHAGB/405-520-----------------------------------------------SFEA.L...TE........DHN..KLQK..MLK
F2UPR8_SALR5/1185-1317-----------------------------------------------ADKM.PV....RKM..LV.S.............
Q6BZ51_DEBHA/662-778-----------------------------------------------SINT.ML...K........DDI..KCTS..IDK
S0ELB2_GIBF5/852-959-----------------------------------------------NFKK.HT...K........D.....NCS..LDL
L5LI27_MYODS/450-565-----------------------------------------------LASK.YA....NEN..PG.D.............
A9VD11_MONBE/1221-1335-----------------------------------------------KLMR.FV....QKQ..SR.H.............
K0KL98_WICCF/623-739-----------------------------------------------STNS.MI...K........DSD..KKYL..IEK
T1G934_HELRO/199-314-----------------------------------------------KALR.LC....KEE..VT.N.............
T1G0G0_HELRO/196-307-----------------------------------------------KAKQ.LC....RKH..ND.S.............
G3JGE5_CORMM/284-396-----------------------------------------------MFTT.H.............HTD..NSAK..LFE
J3PWL9_PUCT1/563-680-----------------------------------------------TVNK.FL.KGGTLR..ML.D.............
G7XNJ5_ASPKW/783-900-----------------------------------------------SFES.IC...R........DSD..SKAV..FEK
M4AIZ6_XIPMA/499-613-----------------------------------------------EALR.LS....KDS..GM.H.............
M7SX13_EUTLA/137-249-----------------------------------------------KILE.L.............HET..KNRE..MFT
T1IHK2_STRMM/849-956-----------------------------------------------KVEK.WIGR..QFC..K..I.............
R8BQP0_TOGMI/129-239-----------------------------------------------KILE.L.............HQS..KHKE..MFT
E9GUG0_DAPPU/494-609-----------------------------------------------KASD.LI....AES..AD.A.............
R4GB63_ANOCA/369-484-----------------------------------------------KGQK.LI....KRR..AP.D.............
I2GWJ1_TETBL/468-586-----------------------------------------------KIDK.LC...Q........DKT..LKLA..IDK
H3B2C6_LATCH/424-539-----------------------------------------------KAFK.LA....KES..GS.D.............
M3D9Q9_SPHMS/307-425-----------------------------------------------GLLGLNL..EL........NG.....SR..IST
K1V4M8_TRIAC/283-399-----------------------------------------------GLGT.HL..PA........NC.....DK..VRA
W4Y2J6_STRPU/402-517-----------------------------------------------SAMN.RV....KEN..PV.E.............
J5JN06_BEAB2/465-578-----------------------------------------------DILN.L.............DQK..HHRA..MFL
F7C6V1_CALJA/70-183-----------------------------------------------KADS.IIRQ..KPV.....D.............
G3AVU0_SPAPN/619-735-----------------------------------------------SINV.MI...K........DED..KKIA..LDK
S0EHF9_GIBF5/987-1097-----------------------------------------------RVQG.LI..RA.............SPTE..LFQ
G4TAH9_PIRID/235-351-----------------------------------------------ALLS.LLKIPE........NH.....AR..LAE
G4NDT3_MAGO7/323-447-----------------------------------------------GLSR.HL..PE........AA.....GK..IAA
V8PE75_OPHHA/356-482-----------------------------------------------KARK.LL....KLK..AN.E.............
A9VBY6_MONBE/623-741-----------------------------------------------RAMR.LVEN..EHD..TN.V.............
I1RPD3_GIBZE/774-890-----------------------------------------------SFAK.HS...R........AKD..QKMA..LDI
S4ANZ4_CAPO3/1560-1674-----------------------------------------------KAKK.LA....QTN..LA.E.............
E3QYT0_COLGM/329-441-----------------------------------------------RFLA.L.............HAT..KPRE..IFS
V8PDH0_OPHHA/598-706-----------------------------------------------SATN.......NTQ..YL.N.............
M1VXY3_CLAP2/500-610-----------------------------------------------RILE.L.............YQK..NERD..VFL
H2ZU78_LATCH/223-338-----------------------------------------------KAIK.LG....RQA..AC.D.............
H6C734_EXODN/365-479-----------------------------------------------KVLY.M.............HSDPYDGPA..LFD
F1RBD7_DANRE/510-625-----------------------------------------------KAMN.LA....EQS..AN.A.............
B7FP63_PHATC/607-714-----------------------------------------------KVRS....KCRHKE..AQ.T.............
N1J7Z3_BLUG1/388-499-----------------------------------------------DILN.L.............SKN..QKLE..MFT
C7Z5S0_NECH7/888-1002-----------------------------------------------NFKS.YL...K........QKH..GENS..LGF
W5M435_LEPOC/940-1052-----------------------------------------------KAP...VPK..RTA..K..E.............
A8PDD5_COPC7/582-696-----------------------------------------------SANK.LL....KVG..MW.D.............
A7SDH9_NEMVE/403-518-----------------------------------------------KVAT.LA....QNK..AA.G.............
M3HJN1_CANMX/678-794-----------------------------------------------SINR.MI...K........EED..KKIA..LDK
G5BJ13_HETGA/521-638-----------------------------------------------KARK.LL....REA..GR.S.............
U4L657_PYROM/279-397-----------------------------------------------VFAS.H.............HEK..WRED..IFT
R4XC63_TAPDE/590-708-----------------------------------------------TIKQ.FS..HE.............TTMQ..VRK
M2R750_COCSN/398-510-----------------------------------------------TLMD.L.............HES..KPTE..IFE
B4JKL8_DROGR/976-1087-----------------------------------------------KAEK.QFIQ..QNM..A..I.............
T1FQR0_HELRO/789-897-----------------------------------------------QALV.LL....KAF..PI.E.............
E9CUF5_COCPS/374-486-----------------------------------------------TLKD.A.............HEN..QRKA..LFD
D8QLF1_SCHCM/503-623-----------------------------------------------RANKMLL....KTPTGML.D.............
I3K2K2_ORENI/545-660-----------------------------------------------KGEA.MI....AKS..AV.E.............
G1X1C4_ARTOA/269-381-----------------------------------------------KFNK.L.............HEE..QTDA..LFT
A8PQQ4_BRUMA/386-499-----------------------------------------------KIAN.YM..................ESGYSLAA
F7A0G1_CIOIN/490-605-----------------------------------------------EAAK.LV....ENE..AG.D.............
T1KSZ4_TETUR/201-315-----------------------------------------------VSAD..........................LAN
H9ITM0_BOMMO/938-1054-----------------------------------------------KAER.LMSQ..QEN..T..F.............
H2ZTT6_LATCH/71-184-----------------------------------------------KADS.IVKQ..KPN.....D.............
I1GJ67_AMPQE/603-717-----------------------------------------------SAFK.SS....EES..GA.H.............
G4NJD0_MAGO7/442-555-----------------------------------------------SIQR.W.............AKE..DPEG..MKS
T1HV24_RHOPR/962-1078-----------------------------------------------KAEK.LMCQ..QEI..R..F.............
C5DES3_LACTC/577-692-----------------------------------------------KLDN.LG...K........DEA..QRLA..IDK
A7SXK4_NEMVE/280-395-----------------------------------------------EMLY.FL....DKS..AS.E.............
H0ES44_GLAL7/715-832-----------------------------------------------TFDT.NS...K........DQE..DRRA..IMR
M7SPN2_EUTLA/327-448-----------------------------------------------GLAA.HL..PA........ATG..AKEK..IAR
F7B628_XENTR/933-1046-----------------------------------------------KGES.IA....RQK..SI.E.............
B2AUG0_PODAN/415-528-----------------------------------------------CFHA.L...AH........DAT..KIRT..LLS

PF03009

A0A017IJS9_ECOLX/36-350VYLQCFDADELKR--IKNELEP-KMG------ME-------------L-NL----VQLIAYTDWNETQQKQPDGSWVNYN
A0A023ZID6_YEASX/7-246FGIETGVLKDFKV--IVISLS.-...------..-------------L-DI----ASQFVKRSLTLND..........PH
A0A038FGR1_MYCTX/14-242LL..TKRVASSAG--TGALLA.-...------.W-------------L-TA----RPLGS.RAYAWRM.......M..RD
A0A038LRN9_MYCTX/17-259AVVMSFSAAAVWR--IRRAAP.-...------.L-------------L-PT----VLLGKTPRYLTSS...........A
B1X7Q7_ECODH/12-239LS..SFEIDALEA--AQQAAP.-...------.E-------------L-PR----GLLLD..EWRDDW.......R..EL
B2RZV2_BORHD/38-330IYLQTFDFDELKR--IREELG.-...------YQ-------------G-KL----IMLVGENDWDEAP..........TD
C9MK30_HAEIF/40-355VYLQTFDFNELKR--IKTELLP-QMG------MD-------------L-KL----VQLIAYTDWKETQEKDPKGYWVNYN
D6EQ07_STRLI/20-243LA..GPRLATSCG--TRGVLG.-...------..-------------L-RL----RSWG..VPVAPR...........RS
G4EU08_BACIU/7-235VILSTFNHDSLAL--CARLAP.-...------.H-------------I-ER----AVLTSDVLYQADR...........Y
J7JQM5_BACIU/43-285VIIQSFSKESLVK--VHQLQP.-...------.N-------------L-PT----VQLLEAKQMASMT.........DAA
N1NX43_YEASC/877-1212IIFSSFHPDICIM--LSLKQP.-...------.V-------------I-PI----LFLTEGGSEQMA.DL..RASSLQNG
O02322_CAEEL/73-322LTGFTWRSWELST--TDEAAT.-...------.T-------------P-RF----TGTLHAVASVLDV.......LAFGL
PGC1_SCHPO/37-267VSFCLWSHRFIPA--CDRYAP.-...------.S-------------I-PL----YHIGFNFAYAERH.........FVM
O86738_STRCO/16-227AG.....AATMLA--VRAADP.-...------.A-------------A-EI----AMTWTTAAPPRAG...........L
GPC1A_CAEEL/406-706IMFSSFDPDICSM--VATKQN.-...------.K-------------Y-PV----LFLCVGETQRYTPFQDQRTSTSMTA
GPC1B_CAEEL/349-649IIFSCFEPDICTM--ITKKQH.-...------.K-------------Y-PV----SFLVVGATNRYMPFQDIRSDCSKIA
Q3BZN0_XANC5/274-516VYAKYYTGGFDQF--LSNLYK.-...------.H-------------Y-QI----NPLHSQDAPRRAA.......LD.RL
Q89384_PBCV1/5-217....SFKWDEIQH--VRTIDD.-...------.K-------------I-PT----GLISVIRPAKTIR...........F
GDE1_SCHPO/752-1061YIFSSFNPDICIL--LSLKST.-...------..-------------N-PV----LFLTEGGTAYRTDV...RAASLRQA
Q9RSP0_DEIRA/37-277NEFRRLCPEVMTS--MTEREL.-...------..-------------R-PL----VLLSKVGLSALAP..........TP
Q9RWX3_DEIRA/7-220VIVSSFNPLLLRA--ARELAP.-...------.E-------------V-ER----GLLYHRPYRLGPL......NLPEAV
Q9RZL4_DEIRA/249-566VFIQSFEVGNLKD--LNTRIMP-AAG------VK-------------L-PL----VQLISSPDEAPYDW...AAAGDGRK
Q9SD81_ARATH/49-357IFIQSFAATSLVY--ISNMTD.-...------..-------------S-PK----LFLIDDVTILTED........TNKT
Q9SGA2_ARATH/39-318IIFSSFHPDAALL--VRKLQT.-...------.T-------------Y-PV----FFLTNGGTEMYHDT...RRNSLEEA
Q9UAW8_CAEEL/68-331LTGLTWRLKFWSY--HDIENIR-P.R------YS-------------G-PK----QMLFEMIDVAHVW......LLKKVT
Q9VQU3_DROME/375-661IVLSCFDPDICTI--LRFKQN.-...------.R-------------Y-PV----MFLTLGRTTKYQKYMDPRGNSMELA
Q9W2L6_DROME/349-632NVIKSFDADLCSL--LRFKQH.-...------.M-------------Y-PV----LFLSSSKENVFNDP...RTSTVEQS
Q9X1V6_THEMA/6-217LLDEKFKGTKYGY--LIDEEN.-...------..-------------Y-GS----IENFVERVEKERP...........Y
Q9YFI4_AERPE/15-220VIYTSENHRYLRR--LREEAS.-...------.A-------------V-VY----TTYSILPVDVADP............
Q9ZTU6_WHEAT/118-414VMIQSTNSSTLVK--FKQLAKY-..N------LV-------------Y-KI----DEVVKDAAPSSLA.....DIKKFAD

PF13653

A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_CLOB3/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q010C1_OSTTA/112-141--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

A4I5X4_LEIIN/300-441RT...SKIRFVDV--IDTIRRH-AFT------AS.P...........F-PV----ILSLEVHT.SDEQ------------
Q8IJR0_PLAF7/626-770LT...SSILFCDT--LIACKMF-GFT------TS.P...........Y-PI----ILSLEIHC.KNKH------------
Q6BZ51_DEBHA/455-607FT...SSISLNNV--FKTIKKY-AFI------TS.P...........F-PL----IISLEINC.SIDN------------
PLCG2_MOUSE/314-457RT...TKIKFDDV--VQAIRDH-AFV------TS.S...........F-PV----ILSIEEHC.SVEQ------------
PLCL1_HUMAN/400-543MT...THVSFRSV--IEVINKF-AFV------AS.E...........Y-PL----ILCLGNHC.SLPQ------------
PLCD9_ARATH/109-254FE...KPLELQEC--LDAIKQH-AFT------PTRS...........Y-PV----IITIKDSL.KPDL------------
PLCD1_ARATH/107-250LT...SREDLQKC--LNVVKEN-AFQ------VS.A...........Y-PV----VLTLEDHL.TPIL------------
PLCD6_ARATH/139-282LT...TPVPLMKC--LKSIRDY-AFS------SS.P...........Y-PV----IITLEDHL.TPDL------------
A5DAA1_PICGU/440-595FT...SSISLKNV--LSTVKKY-AFS------SS.S...........W-PV----ILSLEVHC.NAEN------------
PLCD4_RAT/292-436LT...SRILFKDV--LATLAQY-AFQ------SS.D...........Y-PL----ILSLDNHC.TWEQ------------
PLCZ1_BOVIN/157-300FT...SKLLFKTV--IQAINKY-AFL------AS.E...........Y-PV----VLSLENHC.SPSQ------------
PLCD3_ARATH/108-251LT...SHEDLQKC--LTAIKDN-AFH------VS.D...........Y-PV----IITLEDHL.PPKL------------
A5E691_LODEL/21-192FT...KSIKFSDV--IRTIKEY-AFE------SS.P...........Y-PV----ILSLEINC.SANY------------
Q16W08_AEDAE/315-464MC...SDILFKDV--IYALRDT-AFV------TS.D...........Y-PV----ILSFENHC.CRSQ------------
PLCD5_ARATH/114-257WT...PPVELVKC--LRSIKEH-AFY------AS.A...........Y-PV----ILTLEDHL.TPDL------------
Q5QIB9_STRPU/301-444LT...SKIKFRDI--IEVVDKY-AFA------AS.E...........Y-PL----ILSFENHC.SVEQ------------
Q6CSI9_KLULA/402-540FT...QSIPLEDV--VKTIRKY-AFI------TS.P...........Y-PL----IVSLEIHC.KKDY------------
PLCD3_HUMAN/339-483LT...SKILFRDV--VQAVRDH-AFT------LS.P...........Y-PV----ILSLENHC.GLEQ------------
Q385H1_TRYB2/248-393RT...SKLWFRDC--ISTIKKY-AFV------NS.I...........Y-PV----ILSLEVHT.SLRQ------------
Q16ZC0_AEDAE/42-189FT...TKIPFRAV--VEAINKS-AFV------QS.A...........Y-PV----ILSIENHC.SVTQ------------
PLCH1_HUMAN/301-445LT...SKILFRDV--VETINKH-AFV------KN.E...........F-PV----ILSIENHC.SIQQ------------
A2QEJ2_ASPNC/86-262LT...RETSFREV--CYAIRDS-AFV------AS.D...........L-PV----IVSLEVHT.CLEQ------------
Q4N7P5_THEPA/468-615LT...GSVTLREG--LIAIKES-AFE------SN.K...........L-PV----ILSFEMHC.SDEF------------
A7S279_NEMVE/319-466MC...TKILFKDV--IEAIRDS-AFQ------TS.D...........F-PV----ILSFENHC.SKHQ------------
PLC_DICDI/324-466LT...SQIKFSHV--CETIKAR-GFE------TS.P...........Y-PV----ILSLEVHC.SVPQ------------
Q5BFL6_EMENI/534-676MT...TSVLFADC--ITVINRY-AFF------SS.E...........F-PL----VISLEVHC.NPEQ------------
Q2HB23_CHAGB/553-696LT...TSISFLEV--IKTINKY-AFA------KS.R...........F-PL----WISLEVRC.SPNT------------
A6RBI2_AJECN/84-320LT...KEITFRDV--CNTIRDH-AFV------TS.D...........L-PI----IVSLEVHA.CLEQ------------
A0CKY8_PARTE/271-413LT...SKILFEDA--ILALDKF-GFM------FS.S...........Y-PI----ILSLELHC.SIDQ------------
Q5CLA7_CRYHO/367-509LT...SKVYFEDV--IRACKDY-AFQ------IS.P...........Y-PI----ILSLEMHA.SDKQ------------
E9AEI1_LEIMA/296-447MT...TKIAFDDV--VRTINDY-AFQ------NP.SNNQEAAWNPREL-PV----IVSLEVHT.SPEQ------------
Q9XWB7_CAEEL/306-468AVMGMNEIGLKEV--CEAIKEC-AFK------TS.P...........Y-PV----ILSIENHL.GRKQ------------
Q8IA75_CAEEL/367-517AT...SKITISSA--LRIIREF-AFE------RS.R...........Y-PL----LLKVSVHC.STDW------------
PLC1_YEAST/382-521LT...SAIPLKTV--IRVIKKY-AFI------TS.P...........Y-PL----IISLEINC.NKDN------------
PLCE1_HUMAN/1394-1541LT...TKIPFKEV--VEAIDRS-AFI------NS.D...........L-PI----IISIENHC.SLPQ------------
A7RXP6_NEMVE/244-393LC...TEISFKDV--IEAIAEC-AFK------TS.D...........Y-PV----ILSFENHC.TPKQ------------
Q7QHE3_ANOGA/319-462FT...TRIKFMDV--IRTIKEH-AFI------TS.E...........Y-PL----ILSIEQNC.SLTQ------------
A0BLC4_PARTE/285-429MT...SKISFESV--IETIKEY-GFK------YS.K...........Y-PL----ILSLEVHC.CVKQ------------
Q6FY00_CANGA/381-519LT...SALPLSSV--TQIIRKY-AFI------TS.P...........Y-PL----IISMEVRC.NSKN------------
A0BLM0_PARTE/262-404LV...NDIKFKDV--ISTVRDF-AFY------KD.N...........N-PA----ILSLEMHC.CLKQ------------
Q59LC4_CANAL/566-727FT...KPISFANV--IRAIKKF-AFI------VS.P...........W-PL----ILSLEIHC.SPEC------------
Q2UPV6_ASPOR/98-321LT...KGTTFRDV--CYAIRDS-AFV------TS.D...........L-PV----IVSLEVHA.SLEQ------------
Q4PDE8_USTMA/122-279LA...SHVPFRAV--CETMKQA-IQK------EQDEAQRD..HSFKVA-PI----LLSLENHC.GHAG------------
A7T501_NEMVE/158-302MT...SKVKFRYV--ILNINDF-AFL------NN.R...........Y-PV----ILSLENHC.SVEQ------------
A7ASE0_BABBO/522-670LT...GSITLSEA--LIACKET-AFK------FS.K...........L-PV----ILSMQMHC.TDEC------------
Q4PA81_USTMA/724-872LT...SRVPFQDV--ISAIARY-AFV------TS.P...........Y-PL----ILSLEVHA.DPPQ------------
A7TR21_VANPO/381-520LT...SSIPLLDV--ASVIRKY-AFI------TS.P...........Y-PL----IISLETNC.NKIN------------
Q75C92_ASHGO/397-535LT...SSLPLRNV--VDVINKY-AFI------TS.P...........Y-PL----ILSLEIHC.RSEG------------
A7RPQ0_NEMVE/307-450LT...SKIMFKET--VEAIEEH-AFD------VS.P...........Y-PV----ILSIENHC.CVKQ------------
A7SXK4_NEMVE/94-237LT...SKVLFKDI--VQAIKES-AFK------VS.P...........Y-PV----IVSLENHC.SVQF------------
A4S165_OSTLU/1-153AV...RPMLFKDA--IAVINDR-AHV------AS.E...........Y-PV----IVTLENHA.SRET------------
Q7PW25_ANOGA/289-436FV...PEICAKDV--LEAIAET-AFK------TS.E...........F-PV----ILSFENHC.NPRQ------------
A7RKT2_NEMVE/272-413LT...SKIRFRDV--VQIIKEY-AFE------VS.E...........Y-PL----ILSLENHC.NIQQ------------
A3LSB2_PICST/461-615FT...TAISFSNV--ISTIKKY-AFF------TS.P...........Y-PL----VISLEINC.SVAS------------
A3LNB7_PICST/20-167PVRIPFPIQLEDV--LKEVYDF-LDD------NK.S...........E-TV----IVSLKQEG.SNDW------------
PLCH2_HUMAN/328-472LT...SKILFKDV--IETINKY-AFI------KN.E...........Y-PV----ILSIENHC.SVIQ------------
Q0UVV5_PHANO/116-337LT...KDLPFRAV--CATIRDY-AFK------TS.N...........L-PL----IVSLEVHT.CPEQ------------
Q4QBH9_LEIMA/195-340RT...SCIAFEEC--VKMIRQY-AFT------AS.A...........Y-LV----ILSLGVHT.SVEQ------------
Q0UE70_PHANO/101-258LV...SNIPFRTV--CETLRDV-VDK------EAAEER.......HAA-PI----MISLENHC.DAHG------------
PLCL2_MOUSE/429-572MT...SQIVFRSV--IDIINKY-AFF------AS.E...........Y-PL----ILCLENHC.SIKQ------------
PLCZ1_CHICK/159-303LT...SKITFCSV--IHVVDKY-AFA------AS.D...........Y-PV----VLSLENHC.STKQ------------
Q2GUM5_CHAGB/104-264LV...SNIPFRVV--CETIRDV-VDH------EETAARGR...GYTPA-PI----LVSLENHC.DRNG------------
Q21754_CAEEL/318-461FI...ESITLRNS--LEAIKRT-AFE------TS.P...........Y-PV----ILTLENHV.GFVQ------------
A7SDH9_NEMVE/209-352LT...SKIKFKDI--IQAVAEH-AFK------VS.D...........Y-PV----ILSLENHC.NIEN------------
A4HCK9_LEIBR/248-393PT...SRIAFRDC--ITVIRQH-AFT------AS.P...........Y-PV----ILSLEVHA.SVAQ------------
PLC1_SCHPO/443-585FT...SMIKFNDV--IDAIRKY-AFV------VS.P...........Y-PL----FISLEIHC.CPDQ------------
Q013R6_OSTTA/119-269AV...RPMYFEDA--IKVIAER-AHV------AS.E...........Y-PV----IVTLENHA.SKET------------
Q75IL8_ORYSJ/119-262LT...SPVGLMKC--LEAIREY-AFV------AS.P...........Y-PV----ILTLEDHL.TPDL------------
PLCD8_ARATH/107-248FE...KPLKLQEC--LDSIKEH-AFT------KC.T...........Y-PL----IITFKDGL.KPEL------------
Q6CD33_YARLI/505-648FT...SSVSVEDV--CSAIRKY-GFI------AS.P...........N-PL----ILSLEIHC.SASN------------
A7UXE0_NEUCR/118-273LV...SNIPFREV--CKIILQV-VEE------EE.ESGGG...GGGGA-PV----LISLENHC.GAQG------------
A9RJG9_PHYPA/150-293LT...KAVPFEDC--VKAIKDN-AFT------TS.A...........Y-PV----VVTIESHL.DLEH------------
A9SXU1_PHYPA/108-250LT...SPVAFEKC--IKAIKAN-AFV------SS.K...........Y-PV----VITLEDHL.SSPL------------
B4H106_DROPE/328-471MT...SKIKFMDV--VKTIKDH-AFT------TS.E...........Y-PV----ILSIEQNC.SLEQ------------
B6C9K2_SOLLC/110-252VT...TPVELIRC--LKSIKEH-AFS------AS.P...........Y-PV----VITLEDHL.TPDL------------
B6KHA6_TOXGO/407-549LT...SRIKFKDV--IQACKDY-GFQ------RS.K...........F-PI----ILSLEMHC.STKQ------------
E9QD74_DANRE/316-459LT...SKVPFKDV--IKAIKDY-AFK------AS.P...........Y-PV----ILSLENHC.SLEQ------------
F1R8S3_DANRE/294-437LT...SKILFKDV--IKAIKEY-AFK------TS.E...........Y-PV----ILSLENHC.GVEQ------------
F6HKS4_VITVI/112-254LT...TPVKLSKC--LISIKKY-AFV------AS.E...........Y-PV----IITLEDHL.TPDL------------
F7DT82_CALJA/159-308MC...TDILFKDV--IQAIKET-AFV------TS.E...........Y-PV----ILSFENHC.SKYQ------------
G3GVA5_CRIGR/324-467FT...SKILFYDV--LRAIRDY-AFK------AS.P...........Y-PV----ILSLENHC.SLEQ------------
G3UXP4_MOUSE/322-465LT...TKIKFSDV--LHTIKEH-AFV------AS.E...........Y-PV----ILSIEDHC.SIAQ------------
G4UMR8_NEUT9/110-362LT...KDITFRDV--CEAIKDY-GFA------TT.D...........L-PL----IVSLEVHC.SAEQ------------
PLCB_CAEEL/342-492MC...TDVFFKDV--LVQIRDT-AFA------RS.D...........F-PV----VLSFENHC.SKSN------------
H2SZT5_TAKRU/30-172RT...TKIKFEDV--VKAINDH-AFV------TS.E...........F-PV----ILSIEEHC.PIEQ------------
H2USZ2_TAKRU/343-506QH...TPITIRSA--LEVINKY-AFL------TS.Q...........Y-PL----LVYLCHRC.SPAQ------------
H3CD03_TETNG/306-449LT...SKIPFRFV--IETINKY-AFI------NN.Q...........F-PV----ILSIENHC.TIQQ------------
H3CYP8_TETNG/287-430LT...SKVPFVEV--VQTINEY-AFK------SS.P...........Y-PL----ILSLENHC.SVEQ------------
H3D277_TETNG/321-464MT...SQVSFRSV--IDVVNKY-AFV------AS.E...........F-PV----ILCLENHC.SLKQ------------
H3D2C1_TETNG/321-464VA...SHLVFSKI--VDIINQY-AFE------SS.E...........Y-PL----ILCLVTHC.CIPQ------------
H3D5C7_TETNG/314-459IT...SKVLFRDV--IKAIKDY-AFK------TS.Q...........Y-PV----ILSLENHC.SVDQ------------
H3DBV7_TETNG/298-442LT...SKVPFKEV--IETIAQY-AFK------AS.P...........Y-PL----ILSLENHC.SVEQ------------
H3DF29_TETNG/89-233LT...TKILFKEV--ITTVEQH-AFE------KS.P...........Y-PV----ILSLENHC.CKEQ------------
H3DK53_TETNG/325-468LS...PPLALHSV--LEAIEKC-AFV------AS.D...........Y-PL----IVCIENHC.SYQQ------------
I1R783_ORYGL/114-256LT...APVQIIKC--LKSIKEY-AFC------AS.P...........Y-PL----VITLEDHL.TPDL------------
K4A9N8_SETIT/153-295LT...APVSLIKC--LRSIKEY-AFV------AS.P...........Y-PV----IITFEDHL.TPDL------------
M1BNL7_SOLTU/113-255LT...PPVELIQC--LKSIKEH-AFV------AS.E...........Y-PV----IITLEDHL.TPDL------------
M1CL37_SOLTU/111-252LT...TPVALIKC--LKSIKEH-AFT------VS.E...........Y-PV----VITLEDHL.TTDL------------
M4FG24_BRARP/66-209LT...SPVELIKC--LRAIKTH-AFE------VS.D...........Y-PV----VVTLEDHL.TPEL------------
PLCB2_RAT/314-464MT...TDILFKEA--VEAIAES-AFK------TS.P...........Y-PV----ILSFENHVDSPRQ------------
PLC_LISMO/61-198FL....NASLSGV--LETITQF-LKK------NP.K...........E-TI----IMRLKDEQNSNDS------------
PLCB3_MOUSE/319-469MT...TEVPLRDV--LEAIAEA-AFK------TS.P...........Y-PV----ILSFENHVDSAKQ------------
Q236T7_TETTS/331-475QV...TPVSVEDI--FKAIKQY-GFE------RS.V...........Y-PI----IINLEHEC.SVNQ------------
PLC_STAA8/51-192YL....HHELGKF--LDDAKYY-LSA------YP.N...........E-TI----VMSMKKDY...DS------------
Q4DUP6_TRYCC/248-392RT...SKISFLSC--IKVIKEY-AFK------AS.E...........Y-PV----ILSIEVHT.SSAQ------------
Q4WX21_ASPFU/96-334LT...KGTKFRDV--CYAIRDS-AFV------AS.D...........L-PV----IVSLEVHT.CIEQ------------
Q5A0L4_CANAL/21-164PVKIPFPLKLKDT--LEEVYKF-LAH------NS.S...........E-TV----IVSIKQEG.SDDW------------
Q5KJZ5_CRYNJ/160-301LT...SSVPVRDI--CRAIKQY-GFV------TS.P...........Y-PI----IISTEIHC.ASEQ------------
Q7SE08_NEUCR/136-356MT...TTVPFREV--CKAVREE-AFV------TN.H...........L-PI----IVSLEVGA.DREQ------------
Q81A32_BACCR/58-194YL....YVTLHEF--INEAKQF-LRD------NP.S...........E-TI----IMSLKKEY...ED------------
PLCD4_ARATH/116-257LT...KEVKLGKC--LESIKAN-AFA------IS.K...........Y-PV----IITLEDHL.TPKL------------
W4XJU2_STRPU/318-467MC...TDIQFKEV--IQAIRDT-AFV------TS.D...........F-PV----ILSFENHC.SKPQ------------

PF00387

G8BKQ6_CANPC/644-760.....HN...RKY..FVRVYPS.GYR.V....TSTN-----------F.NP....IKYWEHGV-----------------
A7RPQ0_NEMVE/492-607FVN..YN...KRC..LSRIYPS.GKR.V....GSSN-----------Y.NP....QDMWNCGC-----------------
F2ULH4_SALR5/541-656FVD..YN...KMQ..LSRIYPQ.GTR.I....NSTN-----------F.NP....QAFWNVGC-----------------
G4VBK4_SCHMA/531-646FVN..YN...KRQ..MSRIYPR.GNR.V....DSSN-----------Y.MP....QIFWNAGC-----------------
S0DQT6_GIBF5/306-423.....HN...AHH..LMRVYPK.GTR.I....SSTN-----------L.KP....VPYWGIGA-----------------
E9GFR8_DAPPU/479-594FIQ..HT...SNQ..LVRIYPK.GSR.T....DSSN-----------Y.DP....SQFWSAGC-----------------
G0WGC6_NAUDC/598-716.....HN...RKY..LMRVYPN.IFR.Y....KSSN-----------F.NP....IKFWKSGC-----------------
L0PAS0_PNEJ8/47-161.....HN...VKY..LMRLYPN.FTR.I....NSTN-----------F.EP....QQYWQKGV-----------------
K0R6H0_THAOC/569-682WRE..YN...TNH..MSRVYPK.GIR.T....DSSN-----------Y.NP....LPAWHAGC-----------------
I3JX91_ORENI/928-1039FLQ..YN...RKA..LSRIYPK.GQR.V....ESSN-----------Y.DP....YPMWALGC-----------------
I3K883_ORENI/523-637LVM..FT...KRT..LTRVRPS.SVR.L....DSSN-----------P.NP....QGYWKGGV-----------------
E2BGZ2_HARSA/531-646FVN..YN...KRQ..MSRIYPK.GTR.A....DSSN-----------Y.MP....QVFWNAGC-----------------
J3K9R2_COCIM/769-886.....HN...RLY..LTRVYPS.GYR.L....RSSN-----------F.DP....NSFWRRGV-----------------
I1G7J0_AMPQE/80-196FIQ..YS...RLQ..LSRVYPK.GQR.I....DSSN-----------Y.DP....IPMWCSGS-----------------
G8JQV5_ERECY/594-709.....HN...RRH..LMRTYPH.ALR.Y....KSSN-----------F.DP....IKCWKVGV-----------------
F6SF88_CIOIN/565-682LTN..YN...KSQ..LSRIYPR.GNR.V....DSSN-----------Y.MP....QIFWNVGC-----------------
G2R3P3_THITE/406-520.....HN...REY..FMRIYPQ.GWR.V....DSSN-----------P.DP....TFPWRRGA-----------------
F2U545_SALR5/2126-2244LVT..LS...CAQ..NTRTFPA.GTR.V....NSSN-----------F.DP....QQMWIAGC-----------------
PLC_DICDI/543-652VVE..AS...QNH..LLRVYPR.GTR.F....DSSN-----------F.DP....MPGWSIGC-----------------
B3SC97_TRIAD/538-653YVN..YN...KRQ..LSRIYPK.GSR.V....ESSN-----------F.IP....QIFWNAGS-----------------
T1J420_STRMM/330-445FVE..YN...RKQ..LIRIYPS.GKR.Q....DSSN-----------Y.DP....IPLWNVGS-----------------
E4XLQ6_OIKDI/964-1081FLD..YN...TFQ..ISRAYPK.GAR.I....HSEN-----------Y.NP....ISCWNAGV-----------------
J9MUK9_FUSO4/781-897.....HN...LRY..MMRVYPD.RTR.I....TSNN-----------F.DP....LLYWRRGI-----------------
U7PV69_SPOS1/502-615.....HN...KKY..MMRAYPN.ATKHV....TSSN-----------P.DP....ACCWRRGV-----------------
A5DAA1_PICGU/648-764.....HN...RKF..LMRVYPS.KMR.I....GSSN-----------F.NP....ITQWNYGV-----------------
H2N2E2_ORYLA/491-606FVQ..HN...SRQ..LTRVYPT.GFR.T....DSSN-----------F.NP....QEMWNAGC-----------------
G8BYA3_TETPH/612-727.....HN...RKY..LTRVYPH.AFR.Y....KSSN-----------F.NP....VFFWESGV-----------------
D7ELR5_TRICA/967-1083FVK..YH...QHQ..FSRVYPK.GQR.V....DSSN-----------Y.NP....INMWNIGS-----------------
A7SMY6_NEMVE/400-514FVK..YH...RRQ..ISRVYPK.GSR.I....DSSN-----------Y.DP....VMMWNCGV-----------------
S7ZDD6_PENO1/368-480.....HN...RSS..FMRIYPY.ALR.V....NSSN-----------L.DP....SFCWRRGA-----------------
E9HXQ7_DAPPU/696-810FLW..YH...QVM..LSRIYPA.GKR.I....DSSN-----------Y.NP....VPFWNVGS-----------------
H0ZA90_TAEGU/543-658FVE..YN...KWQ..MSRIYPK.GTR.M....DSSN-----------Y.QP....QMFWNVGC-----------------
F6S6B2_CIOIN/946-1058FIN..YN...RKQ..FSRIYPK.GSR.V....ESSN-----------Y.NP....MPFWNCGT-----------------
F0XRH2_GROCL/838-956.....HN...MRY..LMRVYPK.PYR.I....GSSN-----------F.SP....LAHWRRGV-----------------
G4N054_MAGO7/418-530.....HN...RHY..LMRTYPS.GMR.I....GSSN-----------L.DP....VVFWRKGI-----------------
T1KUP6_TETUR/217-327FAH..HN...KNY..LTQVAPD.RGR.I....DSSN-----------I.NP....LDFWNCGS-----------------
F6RLC5_XENTR/487-602FVR..HN...AWQ..LMRVYPT.GLR.T....DSSN-----------Y.NP....QEMWNVGC-----------------
U1HY48_ENDPU/777-894.....HN...MRH..MFRVYPK.GMR.L....DSSN-----------F.DP....NTFWRRGV-----------------
B7P4X9_IXOSC/943-1057FLK..YP...FYDCLFSRVYPK.GSR.I....DSSN-----------Y.DP....VHLWNCGC-----------------
G2YC85_BOTF4/422-534.....HN...RNF..FMRAFPA.GSR.F....DSSN-----------L.DP....SVCWRKGI-----------------
L8FTI0_PSED2/766-883.....HN...MRH..MMRVYPN.RWR.V....ASTN-----------F.DP....LTYWRRGV-----------------
U3JVN7_FICAL/532-647FIH..HN...IRH..LSRIYPA.GWR.T....DSSN-----------Y.SP....VDLWNVGC-----------------
Q4PDE8_USTMA/317-433.....HN...AQH..LMRVYPK.GTR.I....SSKN-----------L.NP....VPFWGVGA-----------------
I3L7K2_PIG/492-608FVR..HN...VNH..LSRIYPA.GWR.T....DSSN-----------Y.NP....VEMWNSGC-----------------
H3BDF5_LATCH/514-630FVA..HN...AWQ..LSRVYPS.ALR.T....DSSN-----------F.NP....QDVWNVGC-----------------
K5XX24_AGABU/562-680LIR..HT...QKS..LVRTYPK.GMR.I....NSSN-----------Y.EP....HRYWAAGA-----------------
H2SZT4_TAKRU/541-665FLL..YN...RKA..LSRTYPK.GQR.V....ESSN-----------Y.DP....YPLWAVGC-----------------
H3CR59_TETNG/503-618YIR..HN...AEK..LSRIYPA.GVR.T....DSSN-----------Y.NP....VPLWNAGC-----------------
H3A2I8_LATCH/834-950FLQ..YN...RRQ..LSRIYPK.GQR.L....DSSN-----------Y.DP....LPMWLCGS-----------------
R8BVG2_TOGMI/308-425.....HN...AQH..LMRVFPK.GTR.I....SSEN-----------L.HP....VPFWGVGA-----------------
W5MU43_LEPOC/512-627YVC..HN...IDK..LSRIYPA.GSR.T....DSSN-----------Y.NP....VNLWNVGC-----------------
M2UIG2_COCH5/302-418.....HN...AHH..LMRVYPK.GTR.I....SSKN-----------L.AP....VPFWSIGA-----------------
S3DHJ9_GLAL2/313-430.....HN...AHH..LMRVFPK.GTR.I....SSKN-----------L.NP....VPFWGVGA-----------------
W1QFP3_OGAPD/592-708.....HN...RRF..LMRIYPS.IYR.F....SSNN-----------F.NP....FFFWELGC-----------------
H2UH12_TAKRU/488-602LVR..FN...QRQ..LLRVYPS.NYR.V....DSSN-----------F.NP....QPYWNTGC-----------------
L8FLM5_PSED2/482-594.....HN...RRY..MMRAYPA.GHR.I....DSSN-----------P.DP....SVFWRKGI-----------------
H2YFJ0_CIOSA/524-639FVR..YN...RRQ..MSRIYPK.GAR.V....DSSN-----------Y.MP....QIFWNAGC-----------------
K7M553_SOYBN/345-454ILR..FT...QKN..ILRVYPS.AMR.V....KSSN-----------F.KP....HIGWMYGA-----------------
F2U1Z4_SALR5/471-588FVK..RN...IRQ..LARVYPS.GFR.I....DSSN-----------Y.PP....QEMWNAGC-----------------
G3P4B1_GASAC/508-622FVR..HN...SRQ..LSRIYPS.GQR.L....QSSN-----------Y.DP....QAMWNGGC-----------------
R7YJ72_CONA1/333-445.....HN...KNF..LMRAYPK.GVR.F....SSSN-----------L.DP....AVFWRKGV-----------------
N4UQ90_FUSC1/308-422.....HN...QNY..FFRVNPK.SLK.F....DTSN-----------P.EP....LQFWRRGV-----------------
D5GAP7_TUBMM/347-465.....HN...KNY..MMRVYPF.GLR.F....SSSN-----------A.DP....TEFWQRGV-----------------
J9NP56_FUSO4/284-405.....HN...RDF..FFQVTPN.SAR.V....DSSN-----------L.EP....LQFWKHGV-----------------
K1WAI4_MARBU/420-532.....HN...RNF..FMRAYPG.GFR.I....DSSN-----------V.DP....SELWRKGV-----------------
S8A7Z1_DACHA/271-383.....HN...RHF..LTRVYPH.GLR.I....SSSN-----------L.NP....QDFWRRGA-----------------
Q013R6_OSTTA/352-465IIE..FT...NAH..LLRTYPA.GHR.I....FSNN-----------Y.DP....SEAWDVGA-----------------
K1PZR1_CRAGI/575-690FVN..HN...KKF..LSRIYPN.GMR.V....DSSN-----------Y.NP....QDLWNCGC-----------------
Q9XWB7_CAEEL/528-650.....LN...KSK..ITRIYPK.ASR.I....YSTN-----------Y.NP....MIHWLTGS-----------------
C9SV93_VERA1/293-405.....HN...QNY..MMRAYPS.GMR.I....RSSN-----------L.DP....APFWRKGI-----------------
A4S165_OSTLU/202-315LLE..FT...KAH..LLRTYPG.GQR.I....MSNN-----------Y.DP....SDAWSIGA-----------------
N1RC01_FUSC4/282-393.....HN...QNH..FFCVTPD.SAS.V....YPSN-----------L.DP....LQFWKHGV-----------------
C7ZJB8_NECH7/239-351.....HN...KNY..FMGCFPS.GRR.I....DSSN-----------P.DP....SLFWHMGV-----------------
G0RBZ6_HYPJQ/342-459.....HN...ARH..LMRVFPK.GTR.I....SSSN-----------L.RP....VRFWAVGA-----------------
G7P2D3_MACFA/393-508FVQ..HN...TWQ..LSRVYPS.GLR.T....DSSN-----------Y.NP....QELWNAGC-----------------
D2VS67_NAEGR/554-665FFK..HN...ETL..MTRIYPK.ATR.V....FSTN-----------F.SP....VMYWAAGC-----------------
A8Q3V0_BRUMA/969-1079LVQ..FN...ARQ..LSRVYPQ.GSR.V....TSAN-----------Y.DP....VPMWNAAC-----------------
A1CJQ9_ASPCL/375-487.....HN...RRF..FMRVYPY.GLR.I....NSSN-----------L.DP....TFFWRCGT-----------------
H3A3M2_LATCH/610-722FIL..FN...QKQ..LIRVYPS.AYR.I....DSSN-----------F.YP....QTYWNVGC-----------------
Q21754_CAEEL/494-608.....YT...AER..LVKSYPK.GLR.Q....DSSN-----------M.HP....MVSWLCGI-----------------
E9G040_DAPPU/487-602.....WTEMVQRS..LLRVFPN.GSR.V....DSSN-----------F.SP....LEFWNAGV-----------------
E9C115_CAPO3/737-852FML..YN...MRQ..FSRIYPS.GKR.I....DSTN-----------Y.NP....QPHWNSGC-----------------
V2Z343_MONRO/363-478LIK..HT...RGK..LVRIYPK.GIR.V....SSSN-----------Y.EP....HRYWSAGC-----------------
W4XRL3_STRPU/213-326LLD..YN...RKQ..VSRTYPK.GQR.I....DSSN-----------Y.DP....IPIWFCGC-----------------
W5N0K4_LEPOC/507-620FVQ..HN...TRQ..LSRIYPS.GQR.I....QSSN-----------Y.NP....QDMWNCGC-----------------
N1QLI7_SPHMS/293-404.....H</