Sequence alignment for CL0384

PF03009

GLPQ_ECOLI/36-350----------HRGASGYL--P...........E-HTLPAKAMA--YAQGADYLEQDLV-------MTKDD---N------
E7KVC5_YEASL/7-246----------HRAFKARY--P...........E-NTLLAFEKA--YAAGADVIETDLQ-------MTSDG---M------
O07244_MYCTU/14-242----------HRGFTSFR--L..........PM-NSMGAFQEA--AKLGFRYIETDVR-------ATRDG---V------
GLPQ1_MYCTU/17-259----------HRGASAAR--P...........E-HTLAAYDLA--LKEGADGVECDVR-------LTRDG---H------
UGPQ_ECOLI/12-239----------HRGGGKLA--P...........E-NTLASIDVG--AKYGHKMIEFDAK-------LSKDG---E------
Q45201_BORHE/38-330----------HRGASGYL--P...........E-HTLEAKAYA--YALGADYLEQDIV-------LTKDN---I------
GLPQ_HAEIN/40-355----------HRGASGYL--P...........E-HTLESKALA--FAQHSDYLEQDLA-------MTKDG---R------
Q9RKX8_STRCO/20-243----------HRGGAADG--L...........E-NTLRQFRRA--VGAGYRYIETDVH-------ATRDG---K------
YQIK_BACSU/7-235----------HRGASGQF--P...........E-NTMLAFEKG--IEAGADGIELDVQ-------LTKDG---R------
GLPQ_BACSU/43-285----------HRGASGYV--P...........E-HTILSYETA--QKMKADFIELDLQ-------MTKDG---K------
GDE1_YEAST/877-1212----------HRGLGKNN--PNKS....LQIGE-NTVESFIMA--ASLGASYVEFDVQ-------LTKDN---V------
O02322_CAEEL/73-322----------HRGSAHDN--I..........PE-NSLEAFSAV--KSEGGQLAEMDIQ-------ITMDG---V------
PGC1_SCHPO/37-267----------HRGYKAKY--P...........E-NTILAFQQA--VKAGADCVETDVR-------LTKDE---V------
O86738_STRCO/16-227----------HRGDPYRH--R...........E-NTLDSLRSA--LERGADAVETDVR-------LTRDG---V------
GPCP2_CAEEL/406-706----------HRGAGNSY--TKFA.....MARE-NTIHSLNTA--AKNGADYVEFDVQ-------LTKDR---I------
GPCP1_CAEEL/349-649----------HRGMGSSY--TKNI.....GQRE-NTIFSLNEA--ARRGADYVEMDVQ-------LTKDL---K------
Q3BZN0_XANC5/274-516----------HRGLFDNH--AG........IPE-NSLASIDHA--YEQGYRNLELDVE-------VSSDG---V------
Q89384_PBCV1/5-217----------HRGCSALF--P...........E-NTMMSFRHV--..IP.KAIEFDVR-------KTKDN---I------
GDE1_SCHPO/752-1061----------HRGLGKNQ--PDRLS...LQLGE-NTLQSFIKA--ADLGASYVELDVQ-------MTKDM---V------
Q9RSP0_DEIRA/37-277----------HQGGEALW--P...........S-NTLTAYRGA--VALGVDLLEMDLH-------ATRDG---A------
Q9RWX3_DEIRA/7-220----------HRGSPREH--T...........E-NTLASFQAA--LDAGLDGIELDVR-------RLADG---T------
Q9RZL4_DEIRA/249-566----------HRGSSGTR--P...........E-HTLESYRTA--IEAGADFIEPDLV-------VTKDG---V------
GDPD6_ARATH/49-357----------HRGSNGEL--P...........E-ETAPAYMRA--IEEGADFIETDIL-------SSKDG---V------
GDPD1_ARATH/39-318----------HRGHGMNM--SQSPDLRFSALKE-NSILSFNAA--SKFPLDFIEFDVQ-------VTRDG---C------
Q9UAW8_CAEEL/68-331----------HRGAPKSF--P...........E-NSMAGFAQA--KADGADLIEFDVA-------LTKDG---K------
Q9VQU3_DROME/375-661----------HRGSGTSF--KAKD....AVIRE-NTITSLKNA--AEHGADMVEFDVQ-------LSKDL---V------
Q9W2L6_DROME/349-632----------HRGLGKSL--TVTTN..AAPLIE-NTVATMLAS--SELGADLVEFDVQ-------LTSDL---V------
Q9X1V6_THEMA/6-217----------HRGYSAKY--L...........E-NTLEAFMKA--IEAGANGVELDVR-------LSKDG---K------
Q9YFI4_AERPE/15-220----------HRANSGRI--A............-....IFYSM--..VGIKAVEV.DV-------SLKSG---K------
Q9ZTU6_WHEAT/118-414----------HNGASGDY--P...........D-CTDLAYQKA--VVDGADVIDCDVQ-------VTKDG---I------

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393MTHPLQHYFISSSHNTYL--VGEQWK.....GE.STVEGYIRV..LLAGCRCVEMDVQ.......SGDVE..........
A4I5X4_LEIIN/300-441MTHPLKDYFINSSHNTYL--SGDQFQ.....SS.SQIEMYRRA..LLAGCRCVELDCW.......DGKDN...D......
Q8IJR0_PLAF7/626-770MNLPLCNYWINSSHNSYL--ARKQIF.....ST.SNIEQYIYI..LLDGCRCVEFDCY.......YFNKN..........
Q6BZ51_DEBHA/455-607FDHPLNEYFISSSHNTYL--MGRQVA.....GD.SSIEGYIKA..LQRGCRCVEVDIW.......DGYID...GMDDND.
PLCG2_MOUSE/314-457MNNPLSHYWISSSHNTYL--TGDQLR.....SE.SSTEAYIRC..LRAGCRCIELDCW.......DGPDG...K......
PLCL1_HUMAN/400-543MTQPLSHYYINASHNTYL--IEDQFR.....GP.ADINGYIRA..LKMGCRSVELDVS.......DGSDN...E......
PLCD9_ARATH/109-254MNAPLSHYFIHTSLKSYF--TGNNVF.....GRLYSIEPIIDA..LKQGVRVVELDLL......PFGKDG..........
PLCD1_ARATH/107-250MNQPLSHYFLYTGHNSYL--TGNQLN.....SN.SSIEPIVKA..LRNGVRVIELDLW......PNSSGK...E......
PLCD6_ARATH/139-282MTAPLSHYFIYTGHNSYL--TGNQLS.....SD.CSEVPVIKA..LQRGVRVIELDLW......PNSTGT...D......
A5DAA1_PICGU/440-595FDHPLNDYFISSSHNTYL--IGRQFV.....GD.SSIDGYIRA..FQRGCKCVEIDIW.......DGMSI...DGDLDNN
PLCD4_RAT/292-436MTQPLSHYYINSSHNTYL--LGDQFC.....GQ.SSVEGYIRA..LKRGCRCVEVDTW.......DGPDG...E......
PLCZ1_BOVIN/157-300MTHPLTDYFISSSHNTYL--ISDQLW.....GP.SDLWGYISA..LVKGCRCLEIDCW.......DGSQN...E......
PLCD3_ARATH/108-251MKAPLSHYFVYTGHNSYL--TGNQVN.....SR.SSVEPIVQA..LRKGVKVIELDLW......PNPSGN...A......
A5E691_LODEL/21-192FSHPLTDYYISSSHNTYL--IGRQVG.....GE.SSLEGYIKA..LKKGCRCVEIDVW.......DGSGG...GASSLVL
Q16W08_AEDAE/315-464MDQPLSHYYINSSHNTYL--SGRQFG.....GK.SSVEMYRQT..LLAGCRCVELDCW.......DGKGED.EE......
PLCD5_ARATH/114-257MASPLSHYFIYTSHNSYL--TGNQIN.....SE.CSDVPLIKA..LKRGVRALELDMW......PNSTKD...D......
Q5QIB9_STRPU/301-444MKQPLAHYFINSSHNTYL--LDDQLR.....GP.SSTEAYISA..LQRGCRCVELDCW.......DGPDN...D......
Q6CSI9_KLULA/402-540YSRPLNEYFISSSHNTYL--MGKQVV.....DE.VSVEAYTRA..LQQGCRCIEIDIW.......QGDHG..........
PLCD3_HUMAN/339-483MNQPLAHYFISSSHNTYL--TDSQIG.....GP.SSTEAYVRA..FAQGCRCVELDCW.......EGPGG...E......
Q385H1_TRYB2/248-393MTRPICEYFINSSHNTYL--TGDQLL.....SK.SSTDMYKRV..LLDGCRCVELDCW.......DGRKG...Q......
Q16ZC0_AEDAE/42-189MNLPLSQYYIASSHNTYL--TGHQLK.....GE.SSVELYSQV..LLTGARCVELDCW.......DGDDG...T......
PLCH1_HUMAN/301-445MDQPLCNYYIASSHNTYL--TGDQLL.....SQ.SKVDMYARV..LQEGCRCVEVDCW.......DGPDG...E......
A2QEJ2_ASPNC/86-262LSAPITDYFISTSHNTYL--TGNQLY.....SE.SKASAYTNV..LLSGCRSVEIDVW.......DGKAE....GFLGHH
Q4N7P5_THEPA/468-615LSLTLRDFWISSSHNTYL--IGDQLG.....GS.ATAGALAEA..LLRGCRCIELDCQ.......DGAEE..........
A7S279_NEMVE/319-466MNQPLSHYFINSSHNTYL--VGRQFG.....GR.SSVEMYRQC..LIAGCRCIELDCW.......DGQND...E......
PLC_DICDI/324-466TSKPLSYYFINSSHNTYL--SGHQLK.....GL.STSEMYTNT..LRQGCKCVELDVW.......DGNDG...D......
Q5BFL6_EMENI/534-676FDRPLNEYFISSSHNTYL--LGRQVA.....GS.SSTEAYISA..LTQGCRCIEIDCW.......DGADG...R......
Q2HB23_CHAGB/553-696LDRPMNEYYISSSHNTYL--IGRQVA.....SI.SSHEGYISA..LLRGCRCIEVDCW.......DGEGN...Q......
A6RBI2_AJECN/84-320LSLPMNNYFISSSHNTYL--TGNQLY.....SE.SSTKVYRDV..LLKGCRCLEIDVW.......DGEPD...SSDSSAS
A0CKY8_PARTE/271-413MTKPLSHYYINSSHNTYL--TKDQLA.....GD.SSVGQYVIA..LLNGCRCFELDCW.......DSISD...R......
E9AEI1_LEIMA/296-447MDHPLPHYFINSSHNTYL--TGNQLN.....SE.SSCNMYRDV..LLAGCRCVEIDCW.......DGPAG...V......
Q9XWB7_CAEEL/306-468MREPINKYFINSSHNTYC--SGNQLVYAIGHCS.ADVEMYRQA..LLSGSRCVELDMW.......DNKDK...DG.....
Q8IA75_CAEEL/367-517MKQPFSRYFISSSRKSYL--VEDQL......GP.SSSDGFSSA..LKRNCRFLEFDIW.......DPNEA...DGD....
PLC1_YEAST/382-521YSKPLNHYFIASSHNTYL--LGKQIA.....ET.PSVEGYIQV..LQQGCRCVEIDIW.......DGENG..........
PLCE1_HUMAN/1394-1541LQLPLSYYYIESSHNTYL--TGHQLK.....GE.SSVELYSQV..LLQGCRSVELDCW.......DGDDG...M......
A7RXP6_NEMVE/244-393MTQPISHYFINSSHNTYL--TGHQLT.....GK.SSVEMYRQT..LLAGCRCIELDCW.......DGKTED.QE......
Q7QHE3_ANOGA/319-462MSRPLAHYWISSSHNTYL--TGDQFS.....SE.SSVEAYARA..LRMGCRCIELDCW.......DGPDN...M......
A0BLC4_PARTE/285-429EDFPLTDYWINSSHNTYL--MGDQLT.....SE.SSIQAYINA..FQKGCRCVELDCW.......DGDNN...Q......
Q6FY00_CANGA/381-519YSRPMNQYYIASSHNTYL--TGKQIG.....GA.PSVEGYIQA..LQQGCRSVEIDMW.......DGESS..........
A0BLM0_PARTE/262-404LSQPITKYLINSSHNTYL--ETNQLT.....GE.SSCFAYQDA..FKMGFKCVELDCW.......DGEDG...E......
Q59LC4_CANAL/566-727YDYPLNEYFISSSHNTYL--TGRQVA.....GD.SSVEGYIRT..LQRGCRCVEIDIW.......NGDSN...TTTTTVI
Q2UPV6_ASPOR/98-321YSAPISDYFISSSHNTYL--TGNQLY.....SD.SDASAYTNV..LLNGCRCVEIDVW.......DGERS...SESASAD
A7T501_NEMVE/158-302MTRPLSHYFIASSHNTYL--TGDQLA.....SA.SSMDMYVRV..LQSGCRCLELDCW.......DGKDG...E......
A7ASE0_BABBO/522-670LKYPLNSFWIASSHNTYL--TGNQVG.....GA.AAAGALADA..LLRGCRCIELDCQ.......DGPNG...E......
A0A0D1CR16_USTMA/724-872MTRPLSEYYISSSHNTYL--VGGQWK.....GD.STVEGYIRA..LLQGARSVELDCW.......DGPNN...V......
A7TR21_VANPO/381-520YSKPLNHYYIASSHNTYL--LGKQFG.....ET.PSVEGYIQV..LQQGCRCVEIDIW.......DDENG..........
Q75C92_ASHGO/397-535YSRPLSEYFISSSHNTYL--LGNQVG.....SM.ASVEGYIQA..LQQGCRSVEIDIW.......DSDDG..........
A7RPQ0_NEMVE/307-450MTQPLSHYFIASSHNTYL--LDNQLS.....GR.SSIEGYIAA..LQQGCRCVELDCW.......DGPYD...E......
A7SXK4_NEMVE/94-237MNQPLSHYFIASSHNTYL--LGHQLK.....GS.SSVQAYRDV..LERGCRCVELDCW.......DGDDE...E......
A4S165_OSTLU/1-153MTDELSHYFVNSSHNTYL--DGGQLF.....SR.STSSAIAWA..LERGCRVVELDCY.......DGGSK...G......
Q7PW25_ANOGA/289-436MDQPMAHYFINSSHNTYL--TGHQLT.....GK.SSVEIYRQS..LLAGCRCVELDFW.......NGRTE...E......
A7RKT2_NEMVE/272-413MDQPLSDYFINSSHNTYL--TGHQLK.....GL.SSLEAYVRA..LLQGCRCIELDIW.......DGPDE..........
A3LSB2_PICST/461-615MSYPLSEYYISSSHNTYL--VGRQVA.....GD.SSVEGYIRA..LQRGCRCVEVDVW.......DGEVA...ESEEGVQ
A3LNB7_PICST/20-167LSIPGTHNSAACHTALPS--VQ............CQGKSVTDQ..LKHGVRFLDIRAGRQLIKNDDPKQE..........
PLCH2_HUMAN/328-472MTQPLSHYFITSSHNTYL--VGDQLM.....SQ.SRVDMYAWV..LQAGCRCVEVDCW.......DGPDG...E......
Q0UVV5_PHANO/116-337ESYPISNYFISSSHNTYL--TGNQLS.....SE.SSTDAYKNV..LMRGCRCVEIDVW.......DGEPP...SDSSSDE
Q4QBH9_LEIMA/195-340MDQIMCCYFISSSHNTYL--TGDQLT.....SK.SSAQMYKKG..ASRRVPVREAICR.......NGPHG...E......
Q0UE70_PHANO/101-258RNHPLPEYFISSSHNTYL--MAHQLF.....GE.SHASAYEIA..LYTGSRCVEIDAW.......DNDDN...KE.....
PLCL2_MOUSE/429-572MKQPLSHYFINSSHNTYL--IEDQFR.....GP.SDITGYIRA..LKMGCRSVELDVW.......DGPDN...E......
PLCZ1_CHICK/159-303MNHPLCDYFISSSHNTYL--VSDQLI.....GP.SDLNGYISA..LLKGCRCLEIDCW.......DGSNN...D......
Q2GUM5_CHAGB/104-264RSHPLPEYFISSSHNTYL--MSHQLF.....GA.SSAAAYETT..LKAGARCIEIDAW.......DNPDN...CT.....
Q21754_CAEEL/318-461MDQPLTHYFVNSSHNTYL--TGLQVK.....GE.ATVEGYISA..LRKGARLLELDLF.......DGEHG...E......
A7SDH9_NEMVE/209-352MRQPLSHYFIASSHNTYL--MEDQLK.....GP.SSVDAYINA..FNKGCRCVELDCW.......DGDNG...D......
A4HCK9_LEIBR/248-393MDQTISCYFINTSHNTYL--TGDQLT.....SK.SSPEMYKRV..LLDGCRCVELDCW.......NGPHG...E......
PLC1_SCHPO/443-585MSRPLNEYLISSSHNTYL--LGKQFG.....GE.SSIEGYIRS..LQRGCKCIEIDCW.......DGPNG..........
Q013R6_OSTTA/119-269MTSEMSAYFVNSSHNTYL--DGDQLF.....SR.ASVAAIAGA..LDRGCRVIELDVY.......DGKKR...GDK....
Q75IL8_ORYSJ/119-262MGLPLSHYFIYTGHNSYL--TGNQLS.....SG.CSEVPIVKA..LHDGVRVIELDLW......PNAAKD...A......
PLCD8_ARATH/107-248MHAPLSHYFIHTSLNSYF--TGNVF......GK.YSILPIIEA..LEQGVRVVELDLW......PDGRGS..........
Q6CD33_YARLI/505-648LNRPLNEYYISTSHNTYL--IGRQVA.....DT.SSEEGYIRA..LQSGCRSVEIDIW.......DGPDD...R......
A7UXE0_NEUCR/118-273.DYPLPEYFVSSSHNTYL--CAHQLF.....GE.SSTDPYRHT..LQAGSRCVEIDVW.......DNPDNL.DE......
A9RJG9_PHYPA/150-293MNAPLSDYYIFSSHNTYL--MGNQLC.....SP.SSTAPIVKA..LLDGCRVIELDCW.......NGSNK...R......
A9SXU1_PHYPA/108-250MTQPLSHYFIFTGHNSYL--TGNQLS.....SD.SSDVPIAAA..LQRGVRVVELDLW.......PDDKG...G......
B4H106_DROPE/328-471MNMPLSSYWIASSHNTYL--TGDQFS.....SE.SSCEAYARA..LRMGCRCIELDCW.......NGPDN...L......
B6C9K2_SOLLC/110-252MNAPLSHYFIFTGHNSYL--TGNQLT.....SD.CSDVPIIKA..LKKGVRVIELDIW......PNSDKD...D......
B6KHA6_TOXGO/407-549MSLPLCNYWVKSSHNTYL--CGDQVV.....GK.SAVGQYIDA..LLRGCRCVELDCW.......DGSDG...E......
E9QD74_DANRE/316-459MQQPLNHYFISSSHNTYL--MEDQLK.....GP.SSTEAYIKA..LMKSCRCVELDIW.......DGANG...E......
F1R8S3_DANRE/294-437MNQPLSHYFISSSHNTYL--MEDQLK.....GP.SSTEAYIRA..LLKGCRCVELDCW.......DGSDG...E......
F6HKS4_VITVI/112-254MNAPLSHYFIYTGHNSYL--TGNQLS.....SI.CSDVPVINS..LQCGVRVIELDMW......PNSTKD...D......
F7DT82_CALJA/159-308MDHPLAHYFISSSHNTYL--TGRQFG.....GK.SSVEMYRQV..LLAGCRCVELDCWD.....GKGEDQ...E......
G3GVA5_CRIGR/324-467MDQPLSHYLVSSSHNTYL--LEDQLT.....GP.SSTEAYIRA..LCKGCRCLELDCW.......DGPNQ...E......
G3UXP4_MOUSE/322-465MNNPLSHYWISSSHNTYL--TGDQFS.....SE.SSLEAYARC..LRMGCRCIELDCW.......DGPDG...M......
G4UMR8_NEUT9/110-362LSYPLSSYFISSSHNTYL--TGNQLS.....SE.SSVDAYRNV..LLRGCRCIEVDVW.......DGSDS...ESEDDDG
PLCB_CAEEL/342-492MDQPLCHYYINSSHNTYL--TGRQYG.....GK.SSSEIYRQV..LLSGCRCIELDCW.......DGTGENKGE......
H2SZT5_TAKRU/30-172MNNPLSHYWINSSHNTYL--TGDQLR.....SE.SSTEAYVRA..LRLGCRCVELDCW.......EGPGE..........
H2USZ2_TAKRU/343-506MTMPLSHYYISTSYRSYL--LDDQVH.....GR.ADLGGLIKA..LQSGCRCVELGVT.......DGPEG...EPLLGVD
H3CD03_TETNG/306-449MEQPLCNYFIASSHNTYL--TGDQLL.....SH.SKTDMYAWV..LQSGCRCVEVDCW.......DGPDG...E......
H3CYP8_TETNG/287-430MTQPLAHYFISSSHNTYL--TKDQLT.....GD.SSTEPYIRA..LSRGCRCVELDCW.......DGDKG...E......
H3D277_TETNG/321-464MKQPLSHYYINSSHNTYL--IEDQFR.....GP.SDVTGYIRA..LKMGCRSVELDVW.......DGPDG...E......
H3D2C1_TETNG/321-464MNQPLSHYYINSSHNASL--LEDHFW.....GS.SDVSSYIRA..LRMGCRSVEVIVW.......DGPDN...E......
H3D5C7_TETNG/314-459MRQPLNHYFISSSHNTYL--MEDQLK.....GP.SSTEAYINLQSTDEECRCVELDCW.......DGPNG...E......
H3DBV7_TETNG/298-442MSRPLAHYFISSSHNTYL--TKDQVT.....SA.SSTEPYIRA..LNQGCRCVELDCW.......DGDRG...E......
H3DF29_TETNG/89-233MDQPLSSYFISSSHNTYL--TGDQLV.....GK.SHLDAYVCA..LRKGCRCLEIDCW.......DGADM...E......
H3DK53_TETNG/325-468MSQPLSHYYICSSHNTYL--IEDQIR.....GP.SDISGYIRA..LKMGCRCVEVDVW.......DGSDG...E......
I1R783_ORYGL/114-256MSAPFSHYYIYTGHNSYL--TGNQLN.....SD.SSDIPIIKA..LQRGVRVIELDMW......PNSAKN...N......
K4A9N8_SETIT/153-295MNAPLSHYFIYTGHNSYL--TGNQLS.....SD.CSDAPIIKA..LQIGVRVIELDIW......PNSSKD...D......
M1BNL7_SOLTU/113-255MTAPLSHYFIYTSHNTYL--TGNQLN.....SD.CSDVPIIKA..LQQGVRVIELDMW......PNSSKD...N......
M1CL37_SOLTU/111-252MNAPLSHYFIYTGHNSYL--TGNQLS.....SD.CSDVPIIQA..LHRGVRVIELDIW......PNSAKD...D......
M4FG24_BRARP/66-209MDAPISHYFIFTGHNSYL--TGNQLS.....SD.CSEVPIIDA..LKKGVRVIELDIW......PNSNKN...D......
PLCB2_RAT/314-464MTQPLNHYFINSSHNTYL--TAGQFS.....GP.SSAEMYRQV..LLSGCRCVELDCW.......KGKPPD.EE......
PLC_LISMO/61-198LSIPGTHDTMSYNGDITW--TLTKPL.....AQ.TQTMSLYQQ..LEAGIRYIDIRAK..........DN..........
PLCB3_MOUSE/319-469MTQPLSAYFINSSHNTYL--TAGQLA.....GP.SSVEMYRQA..LLWGCRCVELDVW.......KGRPPE.EE......
Q236T7_TETTS/331-475MDKPLSDYFINSSFRSYL--VYDLVT....QTK.DLTKAYIYL..LQKGVRHLDIYCQ.......DGESG...V......
PLC_STAA8/51-192.NIPGSHDSGSFTLKDPV--KS..VW.....AK.TQDKDYLTQ..MKSGVRFFDIRGR.......ASADN...M......
Q4DUP6_TRYCC/248-392MNQPICNYFINSSHNTYL--TGDQLT.....SN.SSADMYRKA..LLDGCRCVELDCW.......DGFAG...E......
Q4WX21_ASPFU/96-334LSAPITDYYVSSSHNTYL--TGNQLY.....SD.AAAAAYTNV..LLNGCRCVEIDVW.......DGDAD...DDSVSGD
Q5A0L4_CANAL/21-164.SIPGTHNSAACHTALPS--VQ............CQGASVTEQ..LEHGVRFLDIRVGKL...FVGNDVK...D......
Q7SE08_NEUCR/136-356LTYPISNYFISSSHNTYL--EGNQLS.....SK.SSAEAYKAV..LRNGCRCIEIDVW.......NGAPS...RTPSKSP
Q81A32_BACCR/58-194.SIPGTHDSGTFKLQNPI--KQ..VW.....GM.TQEYDFRYQ..MDHGARIFDIRGR.......LTDDN...T......
PLCD4_ARATH/116-257MDAPLSHYFIFTGHNSYL--TGNQLS.....SN.CSELPIADA..LRRGVRVVELDLW.......PRGTD...D......
W4XJU2_STRPU/318-467MEQPLSHYLINSSHNTYL--TGRQFG.....GK.SSVEMYRQV..LLAGCRCVELDCW.......DGRSED.QE......

PF00387

Q5KJZ5_CRYNJ/446-558LSELLVYTHGV.KYQ.GF..SK..................LNEYLPSHQFSVSERTAAK.IL....KEN.----------
F1QS56_DANRE/608-720LSDLVVFTNSV.ASQ.EC..LD...................EG.SPCNVLSFSEARAQN.LV....HHR.----------
F1RBD7_DANRE/510-625LSDLVVYCKSV.HFT.SF..EQSR...............KKQA..FYEMASFKEGKAMN.LA....EQS.----------
G8BKQ6_CANPC/644-760VSELGVYLQGI.KFR.....N.FSLPE.........SKIYN......HCFSLSEKTINK.MM...K....----------
A7RPQ0_NEMVE/492-607LSDLVSLCKSV.TFQ.DF..Q.YS..............ADNQK..FWELCSLNEALARR.LG....NAY.----------
F2ULH4_SALR5/541-656LSDLVNYCTPY.HFS.NF..D.VA..............RANNN..CYHISSFSEKKALR.LV....TGK.----------
G4VBK4_SCHMA/531-646LSSFVNYAQPV.KFQ.GF..D.VA..............EDENI..HHHMSSFSETVALG.LL....KNQ.----------
S0DQT6_GIBF5/306-423LAELGVYAQSV.KPMDNS..W.FEEGS.........LTNGPHH....HLINVSESGLAS.HLP..E....----------
E9GFR8_DAPPU/479-594LSDLVNICEAK.KFG.GF..HQNIE.............TGR....CFHISSLSEIKAKK.LI....RRE.----------
G0WGC6_NAUDC/598-716....ISAIHGL.KFR.....N.FSLSE.........SKATT......HCFSLNEKKLDA.MS...M....----------
L0PAS0_PNEJ8/47-161LSNLSVYIKSI.KFH.....N.FSLPE.........SKIFT......HIFSFSEKSFNN.II........----------
K0R6H0_THAOC/569-682LSRLTLF.NGI.KFK.SF..A.D.................SSNLNPHDMHSFSETKALK.ILN..NPLN.----------
I3JX91_ORENI/928-1039MSEVVVYCQPR.SKE.KD..R.F................DSYS..YKEVRSFVENKLPG.......KSR.----------
I3K883_ORENI/523-637LSDLVAIARTG...........SRSF...........YAQRASHNYWTLCSLGEGEAGR.LT....SES.----------
E2BGZ2_HARSA/531-646LSSMINYAQPI.KFQ.SF..E.IA..............ESKNI..HHNMSSFSETAALN.YL....KTH.----------
J3K909_COCIM/769-886LADLGVYARGY.KWR.....G.FDTPE.........SKQFN......HVYSFAERSIET.IC...R....----------
I1G7J0_AMPQE/80-196MSDIVVYCQPTKAFT.ID..N.P................TKGK..YYHMTSFVETRVER.FVK.NKEHA.----------
G8JQV5_ERECY/594-709.......VHGI.QFR.....N.FSLPE.........SKTPT......HCFSLSERKFDN.LC...K....----------
F6SF88_CIOIN/565-682LSVLVNYCQSV.KFP.GF..K.KVQ............AESEKC..CFHMSSFSENGGMN.YI....KSN.----------
G2R3P3_THITE/406-520LASLAIYTHSE.HYE.....D.ETSLA.........LRTPS......HVFSLSEDSFRS.L.A..E....----------
F2U545_SALR5/2126-2244FTDLIQYTASTPTFE.GF..HHALL.............FNR....CWTMTSFGENRLAA.LS....ANPT----------
PLC_DICDI/543-652.....IYLVSH.GFK.SG..N.T.................TKEIPSYKIHSLVEEKVKQ.LV....QSE.----------
B3SC97_TRIAD/538-653LSSVVIYTQPV.PFP.GF..E.EA..............KQRNL..HYNMSSFNESTGFG.HF....KAS.----------
T1J420_STRMM/330-445LSDLVNICTAV.HFR.SF..DHAKK.............QGK....WYEMSSLSEDKAYT.LA....DSK.----------
E4XLQ6_OIKDI/964-1081LSDVVVYCQAT.TWSEEF..L.Q................PNNKREFRQMSSIGESKIQKYLT....ESY.----------
A0A0D2XRJ6_FUSO4/781-897LGDLGVYCFGV.NYV.....G.FDTAE.........AKQYN......HIFS.MESSFAK.NF...R....----------
U7PV69_SPOS1/502-615LGNLAVYTESR.HYH.....S.FSNRD.........AKLPS......HIFSLSETTIQA.L.........----------
A5DAA1_PICGU/648-764LSDLAIYIQGI.KFR.....N.FSLPE.........SKTFN......HCISLSEKSFNS.LL...S....----------
H2N2E2_ORYLA/491-606LSDCVIYCKSF.HFR.SF..KHSQM.............HSK....FYEVASFTESKARK.YL....KES.----------
G8BYA3_TETPH/612-727.......IHGL.KFR.....N.LSLPE.........SKSLT......HCFSFNEKKYLN.LC...T....----------
D7ELR5_TRICA/967-1083MSNLIIYCRSI.TFN.IE..R.AR..............QQGFI..FYEMSSFPETKAEK.LMC..QQEK.----------
A7SMY6_NEMVE/400-514LSDLIVYCQPV.PFD.IE..N.LG..............NGK....HYEMSSFPETKAER.YIS..RKYS.----------
S7ZDD6_PENO1/368-480LSNMAVYTKAF.SFS.....H.FDQPE.........AKYPG......HIFSLSEKACQD.E.........----------
E9HXQ7_DAPPU/696-810LSDIIVYCQAT.HFN.QE..R.IL..............SKGRN..PCEMSSFCEPE..K.LMT..QQEY.----------
H0ZA90_TAEGU/543-658MSSLVNYIQPI.KFN.SF..E.VS..............AKKNR..SYVISSFTETKACD.LL....SKF.----------
F6S6B2_CIOIN/946-1058LSDLIVYCRPV.QFN.EN..A...................KGH..CYEMSSFPESKAER.YAC..RDKA.----------
F0XRH2_GROCL/838-956LGCLAVYCVGVHKAT.....P.FDDAE.........CKTFN......HILSWDESVYDK.QT...K....----------
G4N054_MAGO7/418-530LSDMGIFTRGV.SFK.....S.LSQPE.........AVMPT......HIFSVSEKAVLD.L.........----------
T1KUP6_TETUR/217-327LSDL.IYLK...RFR.......CNDF...........GYVLKNQKLDQVCYLDEAFASK.LA........----------
F6RLC5_XENTR/487-602LSDCVIYCKSV.PFV.SF..QHSRA.............HYT....LYEMSSVTEYKARK.LV....REP.----------
U1HY48_ENDPU/777-894LANLGVYLQGY.KYR.....S.LIGPE.........CGEYN......HIFSLDETKAGR.LC...R....----------
B7P4X9_IXOSC/943-1057LSNLIIYCRSV.QFC.PE..R...................IGN..FTEMSSFPETKVEK.WIS..PQHC.----------
G2YC85_BOTF4/422-534LSKLGIYTHSE.HFV.....S.FDVRA.........ATKPS......HIFSVGEKVINE.L.........----------
L8FTI0_PSED2/766-883LGDLGVYTAGV.KFH.....G.FDAPE.........SKTYN......HIYSFMEATFTK.NS...K....----------
U3JVN7_FICAL/532-647LSDIVVYCKSV.HFE.GF..DDPNH.............PRA....FYEMSSFSESKALK.LA....QES.----------
I3L7K2_PIG/492-608LSDMVIYCKSV.HFR.GF..PSPGT............PGQA....FYEMASFSENRALR.LL....QES.----------
H3BDF5_LATCH/514-630LSDCVIYCRNV.QFS.SF..KHSQL.............HYK....SYEISSFTESKARK.LI....REAG----------
K5XX24_AGABU/562-680LLSLLVYTVGV.KCH.GIGPD.T.................PVTYAPEHIFSLSENAANR.LM....KSGD----------
H2SZT4_TAKRU/541-665MSDLVVYCQPR.SKE.KD..R.FGKGTQML...LGTNNVNSYS..YKEIRSFVENKVPG.......KSR.----------
H3CR59_TETNG/503-618LSDMVIYCKSV.HFS.GF..EDARK.............NLS....FYEMSSFKEGKAVK.LA....EES.----------
H3A2I8_LATCH/834-950LSELVVYCRPV.PFE.EE..K.IG..............TDKAC..YRDMSSFPETKAEK.YAN..RSKG.----------
R8BVG2_TOGMI/308-425LAELGVYAQSV.KPTNNS..W.FDPGE.........LKSGPHH....HLINVSESGLAS.SIP..T....----------
W5MU43_LEPOC/512-627LSDLVIYCKSV.HFP.GF..ESARE.............KQS....FYEMASFKEGKAEK.LA....LVS.----------
M2UIG2_COCH5/302-418LANLGVYAQSV.KPVNNS..W.FESH..........LENAPHH....QLINVSESGLKS.HLP..A....----------
S3DHJ9_GLAL2/313-430LADLGVYAQSV.KPSDNS..W.YDQPA.........LTNGPHH....HLINVSESGLSS.HMP..A....----------
W1QFP3_OGAPD/592-708LGNLGIYVIGI.KFR.....N.FSLPE.........SKTFN......HCFSFSDKTLVK.MA...R....----------
H2UH12_TAKRU/488-602LSDLVIYTKSV.RVH.DI..E.T.................QAFTNSWQVSSLNETVMNQ.IL....QLK.----------
L8FLM5_PSED2/482-594LSALGIYTHSS.HFS.....S.LTASS.........ASIPS......HIYSLSEGDILE.L.........----------
H2YFJ0_CIOSA/524-639MSSLVNYVQPV.RFK.SF..D.IS..............ERRKR..CYEISSFTESAALR.LL....TFY.----------
K7M553_SOYBN/345-454IHNT........KLK.......GCM............KDKLKTDGEVRRLSWSEKTLEK...........----------
F2U1Z4_SALR5/471-588FSDIVSL.KSV.HFN.......PSS............LDNLDAAAGNTMSSFGEAKAHK.LVNDILTA..----------
G3P4B1_GASAC/508-622LSELVVYCSSV.PFR.GF..ENAS..............EKP....PNEMSSFSESEALR.LI....KDS.----------
R7YJ72_CONA1/333-445LSRLGVYTRSY.HFK.....S.FSQPE.........ARIPT......HIFSLSEGVLME.V.........----------
N4UQ90_FUSC1/308-422LAELGVYMRSE.PFQ.....G.FNTSR.........AKSPG......HVFTLPEGKAQE.LI...S....----------
D5GAP7_TUBMM/347-465LAALGIYCSSH.HFP.....SRAAQPFTE....EPTSRIPN......HVYSFSEKVFAN.L.........----------
A0A0C4DI92_FUSO4/284-405LDGLEIYMRSK.PFE.....G.FDNIG.........AKDPA......HVFSLQEQGLQL.LLS..VPTDD----------
K1WAI4_MARBU/420-532LSNLGIYTHSE.HFV.....G.FETKS.........ATRPS......HIYSIGESQIQD.L.........----------
S8A7Z1_DACHA/271-383LSALGVYASAM.KFAE....S.FTDAV.........STRPN......HVFSFSEKKFNS.L.........----------
Q013R6_OSTTA/352-465.LKRIVSVPNV.KFR.......SF..............HEARD.VPRFSCSWSERKLKL...........----------
K1PZR1_CRAGI/575-690LSDLVNYCVST.RFQ.DF..Q.VS..............QQKQK..FFEMCSFSESTAIK.LA....MSC.----------
Q9XWB7_CAEEL/528-650LSAITNYMQAY.ETSRGV..S.TVVN...........LENATKDIVPCIVSADENTVYNCLR........----------
C9SV93_VERA1/293-405LSDLGFNSRGV.SFK.....S.LDQPE.........AAMPT......HIFSLAEKKVID.V.........----------
A4S165_OSTLU/202-315..KALVSLRNL.KFH.......GF..............KEAKDLGTKFSCSWSENKAKK...........----------
N1RC01_FUSC4/282-393LAELAVYMRNE.PFE.....G.FNTPW.........MKSPT......HVFSLPEHHLQD.LI........----------
C7ZJB8_NECH7/239-351LSDLAIYTQSE.AFR.....G.FDTPA.........ARKPS......HIFSLSETKLLE.L.........----------
G0RBZ6_HYPJQ/342-459LAQLGVYAQSV.KPKDNS..W.FDPGQ.........LVDGPHH....HLINVSESGLAA.HLP..Q....----------
G7P2D3_MACFA/393-508LSSLVIYLKSV.SFR.SF..THSKK.............HYH....FYEISSFSETKAKR.LI....KEA.----------
D2VS67_NAEGR/554-665LYDLLFFKSVV.DVHHEY..P...................EETSQIHKMINLSEGMGLTHIIKKGSH...----------
A0A0J9XXP4_BRUMA/969-1079LSDLVVYCQAV.PFN.SQ..F.A................TQGN..FYEMCSFSETKFEK.LVE..R....----------
A1CJQ9_ASPCL/375-487LSRLAIFTKGF.HFS.....Q.FSQPE.........AKVPG......HVFSLSEHAARE.A.........----------
H3A3M2_LATCH/610-722LSDLVVYTNSV.AAQ.DI..V.D................DG.S..FGNALSFSETRANQ.LI....QQK.----------
Q21754_CAEEL/494-608LSALIGLPSVK...........LSHN..........IYQDVNKHPFDGSPSLSENKVYT.MF........----------
E9G040_DAPPU/487-602LSDLIALNRGS.SIK.......LPSS...........RDKSKK..KKCGYSLSESAASR.LH....ASS.----------
V2Z343_MONRO/363-478.LPLLVYTVGV.KCR.GI..N.K.................KEYYNPEEMFSLSEKAANK.ML....KGGS----------
W4XRL3_STRPU/213-326FSRLIVYCRSV.PFS.EE..R.IP...............GK....YFEMSSFPETKVER.YMC..AGKS.----------
W5N0K4_LEPOC/507-620LSELVVYCRST.PFR.GF..EQAA...............QL....PNEMSSFSESEAQR.HI....KES.----------
N1QLI7_SPHMS/293-404LGSMGIFTRAF.HFR.....G.FDDPT.........ATIPT......HVFSLGESKLLE.A.........----------
A0A0D1CR16_USTMA/993-1113LASLLIYTIGV.KCR.GF..N.K.................KESYATQHMVSLSEKTALK.MIRDPISN..----------
R7YQ07_CONA1/783-900LGDLGIYARGI.KYS.....S.FSAPE.........ANTYN......HIFSFNERTFDA.KA...K....----------
PLCZ1_CHICK/377-492LSDLVIYTKSE.KFV.SF..EHSLA.............HQK....CYENNSIGELKAQK.FV....KHA.----------
G1NLG3_MELGA/393-511ISYMVVYQKCFRYFS.......H................ENLTKYFQFTKRFSKAVTRG.LK........----------
H3ERT0_PRIPA/495-607LSDLVNYIQAE.RSS.......QMKI...........DGSDKPKNFYIMHSLSEEGMSK.LVRNESRLS.----------
R1EKA9_BOTPV/390-502LSRLGVYTWAI.RFQ.....S.LSQPE.........ANYPA......HIFSLSEGRLME.V.........----------
H3CZG1_TETNG/283-398MSNLVIYIQPV.KFH.SF..E.AS..............KKINR..SYQMSSFVETKALE.QL....TKS.----------
T1G6Y6_HELRO/929-1047FSDLIVYCQPV.KYS.EE..K.VI..............SNRIN..YYEMFSLPETRIFD.KTSQANQQV.----------
N4VFU7_COLOR/301-417LEALGVYAQSV.KPVDNS..W.FEEV..........LKEAPHH....HLINVSESGLAS.HMP..D....----------
PLC1_YEAST/590-709....ISGIHGI.KFR.....N.FSLPE.........SKTIA......HCFSLNERKVEY.MI...K....----------
Q4DUP6_TRYCC/458-575LSRVV.......SIE.SA..G.FKGTSDT.....SYLEKRQ....PYQCTSFVESKAKK.IA....VSN.----------
F4NTE5_BATDJ/674-789LEALIIYCKGV.SLH.....S.VTLPQ........NPLKFD......CMYSFSERTANA.LL........----------
F2TZD4_SALR5/1418-1533LSALVHYTQAV.RFH.GF..D.H................PNAAATAAFMSSFSEKKLNR.LI....HKS.----------
S3CWU2_GLAL2/446-558LSNLGIYTHSE.HFK.....S.FDTLS.........AKSPP......HVFSIGENQIMD.L.........----------
C5MGF2_CANTT/703-819LSDLGVYAQGL.KFR.....N.FSLPE.........SKTYN......HCFSLGEKTINR.IL...K....----------
A7S279_NEMVE/566-681LSSLVNYIQPV.PFQ.GF..D.ES..............EKRNL..FYQMSSFNESTGFG.LV....RAT.----------
E5STY8_TRISP/976-1085LSDIMVYCQAI.PFN.PG..K.I.................PGS..HREMCSFSELKLER.LLE..K....----------
F9WW59_ZYMTI/306-422LAELGVYAQSV.KPSNNS..W.FESE..........LQDRPHN....HLINVSESGLAP.LMA..H....----------
S3BUU6_OPHP1/912-1029LGSLAVYCMGVHKTT.....P.FEDAD.........CKLFN......HILSWDEQVYEK.HT...K....----------
F2U5I3_SALR5/965-1082LSALVFYSQSV.PFR.SF..E.E.................NCSLEYFKMSSFSEKKAMA.LV....REVN----------
K7H8T9_CAEJA/525-647LSEIINYMQAF.ESNKGL..G.TAAN...........LENALTDPTHFIVSADENTVWSCLK........----------
G2WWA7_VERDV/450-561LGDLAIYTHSE.HFK.....G.FETV..........SKKPS......HIYSIAESRILE.L.........----------
Q75C92_ASHGO/595-713....ISAIHGI.TFR.....N.FSLPE.........SKTPT......HCFSLSERSFDN.LA...N....----------
Q17CT3_AEDAE/942-1053MSDMIIYCRSV.PF........KN...............SGWV..FYEMSSFPETKAEK.YFL..QQET.----------
H2ARE2_KAZAF/619-733.......IYGL.KFR.....N.FSLPE.........SKTVN......HCFSLNEKKVDF.MI...K....----------
C3ZX35_BRAFL/216-331LSDLVNICEAV.HFH.SF..QHSRE.............NDM....PYNMSSIKEGKANH.LV....EEQ.----------
A8Q4L8_MALGO/619-735LVRLLVYTVGV.PFR.GL..N.K.................KEQYAAEHMFSLSERSAAR.LM....RQS.----------
B6JVB4_SCHJY/640-754LQELSTYSRSI.KFR.....N.FSLPE.........SKTYD......HIFSFSERTISR.FG........----------
M7TCG9_EUTLA/559-676LGELGVYCTGV.KFH.....G.FESSD.........CKLNN......HILSFMEGTFRK.HS...K....----------
G3NGW3_GASAC/357-472LSNIVVYCKSV.HFN.SF..DHAKE.............MQA....FYEMSSFKESKALT.LA....ETS.----------
A9V4B2_MONBE/210-323..QDLVYLHQT.EFHSLF..A.SRYTTY.......AAASVFDWPQVAQLTRHHQSTLQE...........----------
G3WFA8_SARHA/54-171LSDLVIYTNSV.AAQ.DI..V.DDAL...........KQTG.T..TGNVLSFSETRAHQ.VV....QQK.----------
G1KGF4_ANOCA/537-652LSDVVVYCQAV.PFQ.SL..SRALH.............NQQ....SNEMSSFSERKARK.LI....KES.----------
F4X6N0_ACREC/597-712ISALVNYVQPV.HFN.SF..E.SA..............EKKKR..MYEMSSFDEKQATT.LL....KEK.----------
G3WAG3_SARHA/506-619LSDLVIYCCAL.KVE.KL..PRIN...............PQ....PCWVPSFTELKARK.FI....KED.----------
G4UK54_NEUT9/327-448LAELGVYGQSV.KPPDNS..W.FTSSDL......LPSKDGPHH....HLINVSESGLNA.LL........----------
H3G127_PRIPA/946-1056LSNLVVYCQAV.PFN.PS..R.I................KENS..FYEMCSFSESKLEK.ILE..K....----------
F4PW61_DICFS/518-627......YFLTK.GFK.SV..E.E.................SNTLPPWVMHSFSEAKVKE.LV....KANG----------
G4TVY5_PIRID/719-847LVPLLVYTSGV.TFR.GL..Q.P.................KKTYGPSQVFSLSESRAKG.LIHNPVQA..----------
M4A2J9_XIPMA/503-618MSNLVNYVQPV.KFK.GF..D.NA..............LRRRR..HYEMSSFVETKAIE.IL....KTF.----------
A0A0D2WK99_CAPO3/887-1002LSDIVAYCRSI.PFE.SF..EASRE.............KTK....YYEMSSFEEKKADK.II....RKQ.----------
H0ZQ48_TAEGU/377-492LSDLVVYTKSQ.KFV.SF..EHSQQ.............HQQ....CYENNSIGESQARK.LA....KIS.----------
E4UYL4_ARTGP/377-489LSRLGIFTRGY.TFN.....N.FAQPE.........AKIPH......HIFSLSEAAVKS.A.........----------
W5KFU3_ASTMX/71-182LSDLVVYTRSV.PFK.GF..SEAA..............KKP....PNEMSSFTEKVALK.HI....KTS.----------
F8QEC8_SERL3/510-622..SLLVYTVGV.KCR.GI..N.K.................KEHYAPEHLFSLSESTANK.IL....KQG.----------
G8YRD2_PICSO/652-768LSDLAVYVQGI.KFR.....N.FSLPE.........SKTFN......HCFSLSEKAANS.ML...K....----------
H6BNY9_EXODN/314-431LAELGIYAQSV.KPKDNS..W.YAEVG.........LKDGPHH....HLINISETALRA.HLP..A....----------
N1Q1A9_DOTSN/804-922LGKLGVYTQGI.KFT.....G.FEAPD.........AKLYN......HIYSLAENQFDR.LCA..K....----------
D3BQ91_POLPA/553-667LSRLI.YLIGS.GYK.SP..D.L.................SKMKSPAYMHSLSEGAINNVLG....SYD.----------
V2XG66_MONRO/249-363LAELGLYARSM.KPTPG...W.LQQD...........LTDPRN....ILINISEPGLGK.LLP..D....----------
G2XH69_VERDV/316-433LSELGVYAQSV.KPPNNS..W.FDPGG.........QFVGPHH....HLINVSESGLGA.HLP..A....----------
G9P5U2_HYPAI/366-478LARLAVYTQGV.TFK.....N.WTQPE.........ATMPT......HMFSVSEKKFIE.Y.........----------
F4S5V3_MELLP/586-701LSDIAVYTIGV.KAR.GF..N.K.................ITKYELEDCVSLSERAVNK.FL....KSG.----------
G3NDC5_GASAC/480-595LSDLVVYCKSV.HFQ.GF..EHARS.............QAK....CYEMSSFSESKAKK.LA....KDA.----------
G3Y1M7_ASPNA/321-433LSKLAVFTKGF.HFS.....N.FAQPE.........AKVPS......HVFSLSEKAVRE.A.........----------
V8NBX9_OPHHA/517-632LSDLVTICKSV.QFK.DF..E.NS..............MKKQN..YWEMCSFSEGEASK.IA....NEC.----------
M2NIY8_BAUCO/658-779LGRLGIYTQGM.SFPKPW..G.FDDPK.........LRAYN......HILSFSEDTFQT.HCK..K....----------
E9F491_METRA/362-474LSKLGIYTRAV.SFK.....T.WAQPE.........ASMPT......HIFSLAEKKFME.H.........----------
B2APA5_PODAN/327-447LEELGVYAQSV.KPGDDS..W.YAGEC........VLRNRPHH....HLINISEAGLAR.HATDDV....----------
U1NK79_ASCSU/575-691LSDLVNYMRAMGKLT.SF..E.E................SESKQMSSELFSMTETRAYE.LV....KQS.----------
T5AMI8_OPHSC/302-414LSRLGVYTQAV.SFK.....A.WTQPE.........AQMPT......HIFSLAEKKFLE.H.........----------
B7Q2N6_IXOSC/514-630LSNIVNYCKAS.HFK.SF..E.E.................AEKWHFYEMASFSEGKAAK.LS....STDQ----------
A0A098DQ28_GIBZA/358-468LSKMGFHCRGV.SFK.....S.LSQPE.........AGMPT......HIFSLSEKKVID.V.........----------
C3ZUS9_BRAFL/419-534LSDLVNVSQAK.HFH.SF..QHSQE.............KDM....ACNMSSITESKAMD.LV....KRQ.----------
F7BFD4_HORSE/377-492LSDLVIYTKAE.KFR.SF..QHSRL.............HQQ....FNESNSIGESKARK.LS....KLQ.----------
C4R8N7_PICPG/562-681LSFLGIYLSGI.KFR.....N.FSLPE.........SKSFN......HVFSFSESKLKR.FM...K....----------
B6HG38_PENRW/308-420LAKLAVYTRAY.KFS.....H.FDQPE.........AKVPL......HVFSLSEKAARE.T.........----------
A7RPT6_NEMVE/607-722LSDLVAYTQSR.AFK.GL..E.VE..............EDGEN..HWEVISIPEPRAYR.FT....DTK.----------
G7PV15_MACFA/479-594LSALVVYCHAT.RLR.TL..HPAPD.............APQ....PCQVSSLSERKAKK.LI....REA.----------
G1KDV8_ANOCA/504-618LSDTIVYCKSV.HFK.GF..NSAT..............PPA....FNEMTSFTESKAFK.LA....QES.----------
F6V4E2_XENTR/493-608LSDTVVYCKSV.HFG.GF..DYALE.............HQS....FYEMSSLAEDKALK.LA....NDS.----------
E4Y2H6_OIKDI/537-648LSSMVNYCTSV.RFP.GF..D.ES..............EATNR..CYQMSSFSETQGLS.HL....GSR.----------
B5YNJ7_THAPS/196-310LAKLTLF.HGT.KFR.TW..E.E.................SSQTPTYHMHSFSESRVKA.FSK.SIQCH.----------
E3RKS1_PYRTT/745-863LGNLGVYTKGV.KFN.....D.FASAS.........ANTYN......HVFSINERAFDK.LT...KP...----------
C5GIH2_AJEDR/773-890LAELGVYSRGY.KFH.....S.FNSPE.........SKRFN......HVYSFAEKAFER.LC...G....----------
Q6CD33_YARLI/707-821LGELGVYVQGL.KFR.....N.FAFPE.........SKTTN......HCFSFSERKFIS.IC...K....----------
E3QFQ0_COLGM/792-909LGDLGVYCAGV.KFG.....G.FDAPD.........AKAYN......HIFSFMESSFTR.NS...K....----------
Q8IJR0_PLAF7/979-1086.......LKGY.VFRNFY.......................ETRNYNEICSISENKFIK.LIKKNENE..----------
H3B651_LATCH/510-624LSDLVVYCKSI.HFP.GF..EEAK..............EQP....FYEMSSFDENKAFR.LA....QES.----------
B8JLR7_DANRE/165-276LSDLV.YMKSV.GMP.DF..E.S................QG.V..TWQVSSMSETKAHQ.LI....QQK.----------
L2GAB8_COLGN/486-597LSNLAIYTHSE.HFK.....S.FETPA.........AKKPG......HIFSISESKILE.L.........----------
Q6FY00_CANGA/576-698.LYELAGLRGV.KFR.....N.FSLPE.........SKTLY......HCFSLDERRLDK.ML...G....----------
H2MWG8_ORYLA/509-623LSELVVYTRSV.HFK.GF..DQAA..............KSS....PLQMSSFSEREALK.LI....KDS.----------
L2FNL9_COLGN/331-443LSRLGIHTRGI.TFK.....S.FEQLE.........ASMPN......HIFSLSEKAAFA.I.........----------
F4PW60_DICFS/469-579.....IYLLSK.GFS.SV..D.D.................SNKLPVWVMHSFSEDKIME.FI....KSDY----------
A0A0C4DV60_MAGP6/840-957LGDLAVYCAGI.KFQ.....G.FDHAD.........CKMFN......HIFSFPEGTFQR.NS...R....----------
W4Y1W0_STRPU/441-553LSDLVKYTRSV.AFK.GF..P.E.................NMP..CWELPSLGEMRANN.LA....MTR.----------
N1Q7T0_PSEFD/249-360LSNMGIFTRAF.HFH.....S.FDQPE.........SRIPT......HVFSLGESKLLE.A.........----------
G1X2N7_ARTOA/734-851LGELGVYTRGQ.KFK.....N.FSLPE.........SKSFN......HVFSLAERTFIS.LC...K....----------
J3PD85_GAGT3/457-567LSRLAVYTHSK.HFH.....G.FNDRV.........CKTPS......HIFSLQENRIRD.L.........----------
J9FJP4_WUCBA/677-792LSSLVNYTHPV.KFS.GF..D.VA..............EANNL..HFHMSSFSESTGLG.YL....KQS.----------
E4WY87_OIKDI/494-609LSDLVIYTQSR.HLK.DF..D.E................AQQNSDFRHISSIDDKVCSS.YA....KNQ.----------
G0RQN5_HYPJQ/375-487LSDLAVYTRSE.RFK.....S.LSTPQ.........AKQPT......HIFSISEDRILE.L.........----------
E5S0V3_TRISP/556-672LSALVNYMKAT.KFK.SF..E.DS..............ASRNF..SNEVTSFSEVKGYE.MM....QKD.----------
E9HCC3_DAPPU/480-597...LLNICRS...FT.NF..E.KYEY...........HNTRHKSACYCVISMSELEAST.YL....KKL.----------
G4U8M0_NEUT9/388-500LAALAIYTRSE.HFD.....D.VNSLS.........STTPS......HIFSVNEDKFLD.MIA..Q....----------
H3A2R7_LATCH/432-547FSDVIVYCKSV.HFH.GF..EHAQN.............KQA....VYEMSSFAERKARK.LM....RES.----------
G0S1B2_CHATD/408-522LAALAIYTHSE.HYE.....D.EHSLG.........SRTPS......HIFSLSEDCFLS.L.A..A....----------
G0VE13_NAUCC/579-693.......IHGI.KFR.....D.FSLPE.........SKTCT......HCFSINEKKFDS.IR...L....----------
U1LYV5_ASCSU/529-640...LISLPSVK...........LSSN..........IYQDVKEHPMDGSPSLSETKVQS.LM........----------
F2TW56_SALR5/229-338......YLDFT.TFKSLY..G...................SRFAATHAATEFTYKQLEK.HT........----------
H2S9Y1_TAKRU/516-631LSDLVTLCRSV.RFI.DF..S.TS..............SKSQK..TWEMCSFHETLALR.LA....TES.----------
A4I027_LEIIN/518-635LSALV.......SIE.SS..K.CHDVKDL.....SYLKDKQ....PYHCSSYSERKGKA.IA....REA.----------
A4I5X4_LEIIN/479-593.SHLLRSCVTVGAFK.......TS..............DWGRDAEPYYIQSYVETVVKE.LA....LSH.----------
J7S7W7_KAZNA/613-728.......MHGI.KFR.....N.FSLPE.........SKTLM......HCFSLNEKQLSS.MM...K....----------
I3LUM3_PIG/517-632LSDLVKYTKSV.GIH.DV..E.TE..............GEGRR..VWQVSSFSETKAQQ.IL....QQK.----------
Q2GUM5_CHAGB/309-422LAELGVYAQSV.KPRDDS..W.YVEGK........VKDGPPEH....HLINVSESGLAS.HTR..E....----------
E7F646_DANRE/482-596LSD.IMFCKSV.HFH.SF..EHSRI.............SAK....PYEMSSFSESKARK.YS....KEA.----------
R1G5R1_BOTPV/762-880LSALAVYTRGI.KYS.....D.FRAPE.........AKTYN......HIYSFAERTFDN.LCN..K....----------
B7P6Q6_IXOSC/455-570MSALVNYIQPV.RFH.SF..E.HA..............EKRDR..SYEISSFVETQATN.LL....KEH.----------
C7YZS5_NECH7/344-456LSNMGIYKRGV.SFK.....A.LDAPE.........ASHPM......HVFSLSETKVQD.V.........----------
E5S7A2_TRISP/292-403...LIAIVSAK...........LVNP...........LVDLERHPVNSMASKSEDQLIA.MV........----------
T5AHM7_OPHSC/836-953LGALGVYCAGV.KYF.....G.FESPA.........AKTFN......HIFSFMETSFAK.HS...R....----------
W5K5D9_ASTMX/504-619LSDLVIYCKSV.HFS.GF..EHAKE.............KQS....FYEMASFKESKAKQ.LA....DNS.----------
V2XVI5_MONRO/531-646LLSLLVYTVGV.KCR.GF..S.Q.................TQHYAPEHIFSLSENSANR.YL....KRGS----------
A7TR21_VANPO/594-716ELSEIAGIQGL.KFR.....N.FSLPE.........SKTRI......HCFSLNEKKLEH.LC...K....----------
H6BSD8_EXODN/761-878LSALGVYLKGY.TLR.....E.ARDLG.........FQQYN......HIFSLNENRAIE.LC...H....----------
G1SZX7_RABIT/565-680LSTMINYAQPV.KFQ.GF..H.VA..............EERNI..HYNMSSFNESVGLG.YL....KTH.----------
W5NED0_LEPOC/303-418LSDLVIYTKSV.KFI.SF..SHSSG.............NQK....FYENTSLGENKARK.LA....RNS.----------
H2Y8L4_CIOSA/418-534LSDLVVYCKSV.KFK.SL..T.SNT.............TKPDR..FADISSFTEAKAFR.LA....KNK.----------
F6QRY0_ORNAN/482-597LSDLVTYCKSV.HFE.GF..EGSAR.............DRP....FYEMSSLSENKALR.LV....HEE.----------
W5K097_ASTMX/925-1036MSDLVVYCQPR.SKD.KE..S.F................DNYT..YKEVRSFVENKVPI.......KHR.----------
R4GLW0_CHICK/523-638LSDCVVYCKNV.SFR.GF..QEARN.............HSR....PSEISSLSEAKARK.LI....RDA.----------
M7XIS4_RHOT1/672-788LANLLVYTIGV.KAR.GF..N.K.................KEKYAATHVISLGESRLTK.MLRDEAAR..----------
C4Y529_CLAL4/632-746LSDLGIYVQGT.KFR.....N.FSLPE.........SKTFN......HCFSLSEKSANS.MI...K....----------
N1PRW4_DOTSN/309-425LAELGVYAQSV.KPRDNS..W.FEAQ..........LQGGPHD....HLINVSESGLLG.LIP..T....----------
K1PD91_CRAGI/941-1059LSDLIIYAVAV.PFD.HE..K.VL..............KKMSH..IAEMSSFSEIKIER.YCS..QTYS.----------
H0ZM24_TAEGU/68-179LSDLVVYTNSV.AAQDIV..D.DGTGL.........AQGWHVPWLAHHLRELSAAVRVA...........----------
G4MWU9_MAGO7/371-483LSRMGVYTRGV.SFK.....S.LSQAE.........ATMPN......HIFSLSEKVAFD.T.........----------
Q5QIB9_STRPU/495-609LSDLVT.LASV.HYG.SF..PASKE.............KYK....CHQMSSFGEAKAFG.LA....EDK.----------
S3CY83_OPHP1/495-607LSQLGIYTQGV.SFK.....S.LSQPE.........ANMPT......HVFSLSEKSLME.I.........----------
A0A0D2UAN0_CAPO3/1229-1344LADLAVYCQGV.SFV.SF..V.HS..............RENHT..NFMQSSFGETKAKK.IC....VSQ.----------
A0A0D2VPS8_CAPO3/838-953LSDLVVYTKAV.TFE.SL..KQAHK.............DTR....CYEMSSVPEKKAFK.LA....RSN.----------
U9U0Y0_RHIID/792-909LSDLVVYCSAV.KFK.GF..DNSLNK...........GNSK....FYHMSSFSERVATR.LT....KTD.----------
K1VS91_TRIAC/657-769LVDLAVYTQGT.KYR.GF..S.K.................LVHYASNQMFSVSERTSNK.ILA.SGQA..----------
A4HCK9_LEIBR/443-560LSAIV.......SIE.AS..G.YKGVKDL.....SYLLDKQ....PYHCSSFSEGKVEA.IA....REN.----------
F1QJ13_DANRE/490-604LSDLVVYTSSV.AFK.QF..DPSA..............KKA....PNEMSSFSESDALK.LI....KES.----------
G9MGY4_HYPVG/754-871LGKLGVYCAGL.KFS.....G.FEAPA.........AKKFN......HIFSFMESSFAK.HS...Q....----------
R4GHY9_CHICK/479-594LSAMVVYCQAT.PFP.GL..AQALQ.............HPR....PYEMSSFSERKARK.LI....KEA.----------
G7DTU8_MIXOS/579-693LARLAVYTQGV.QGR.GF..N.K.................KEHYAPTHMISLGERRMLK.TIRDARME..----------
U1HPN2_ENDPU/378-490LSQLGVYTRGF.TFK.....Q.FDQPE.........ASIPT......HVFSLSEAKVVD.M.........----------
T1K2W1_TETUR/963-1075LSNLIIYCRSV.PFV.PE..K...................IGI..FTEMSSYPETKVEK.WLS..PQNC.----------
I4YJJ0_WALMC/187-305LSALGVIAMSV.KPGNRE..W.WNARS.........RITEPRN....AVINVGESAMSK..VC..N....----------
F0XQ81_GROCL/442-554LAQLAVYTRGV.SFK.....S.LAQPE.........ATMPT......HVFSLSEKGVQE.V.........----------
U4LP91_PYROM/778-895LGRLGVYCRGQ.KFR.....N.FALPE.........SKTYN......HIFSFQEKSFLK.FC...K....----------
C1MLD2_MICPC/347-455.......IENI.KIK.......VI..............KEALEIERVISCSWDELTLNN...........----------
M3ZIE9_XIPMA/486-601LSDLVKYTCSV.GLY.DI..E.TQ..............GESNC..SWQVSSLSETKAHQ.LM....QQK.----------
D8Q686_SCHCM/514-628LASLLVYTVGV.RCH.GL..E.H.................IEDYSPEYIFSLSERKAKK.LM....DAD.----------
E0V9R3_PEDHC/981-1097MSNLIVYCRSV.AFN.ME..R.LK..............KNGFI..FAEMSSFAENKAEK.LIC..KEET.----------
Q7ZZ38_DANRE/570-685MSTLVNYIEPV.KFK.SF..E.VA..............AKRKK..FFEMSSFVETKGMD.TL....KNS.----------
S3CK06_OPHP1/317-437LAAIGVYAQSV.KPSNNS..W.FEPPG........ELTDRPHH....HLINVSESGLAA.HLAEPA....----------
I1FVA6_AMPQE/653-769LTELLNYVTAM.SFG.SF..E.AS..............EKLNC..HYIMSSFGEEKGMN.LI....KTK.----------
G2QE78_MYCTT/369-481LSKLGIYTRGV.SFK.....S.LTQPE.........ATMPT......HIFSLSENGVME.V.........----------
F9X062_ZYMTI/294-423LSSMGVFTRAF.HFS.....N.FEQPE.........AKIPT......HVFSLSESKLLD.A.........----------
B3S5L7_TRIAD/600-715LSDLINL.KCI.TFN.GF..Q.EAK.............ENNRN..YYETSSFEEVSALK.LN....QAS.----------
U7PMJ4_SPOS1/852-970LGCLAVYCVGVHKTT.....P.FEDPE.........CKAFN......HILSWDETVYDR.ST...K....----------
K1R906_CRAGI/339-447.....VGFKAV.GFK.......GV...............EESINSKGIFVSLGENKALK.LI....DND.----------
Q6CSI9_KLULA/623-738.......IHGV.RFR.....N.FSLPE.........SKTTT......HCFSLSEKKFIN.LD...K....----------
N1JC99_BLUG1/775-892LGELGVYTRGI.GFS.....G.YDSPE.........CKTYN......HIFSFMESTFNK.NS...R....----------
A0A0D2U0B6_CAPO3/640-755LSALVVYCKAV.HFK.SF..DDSAA.............NGK....YWEMSSFAEAKTKK.FA....SKL.----------
F1R8S3_DANRE/484-599LSDIVIYCKSV.PFH.GL..EDSRE.............KHS....FYEMASFKEGKALK.LA....EES.----------
C5DWX3_ZYGRC/549-664.......IYGL.KFR.....N.FSLPG.........SKTTT......HCFSLNERKIDN.LC...N....----------
J3P931_GAGT3/353-465LSRLGIYTRGV.TFK.....S.LSQPE.........AAMPN......HIFSLSEQGAAE.V.........----------
G8ZY68_TORDC/585-700.......LHGL.KFR.....N.LSLPE.........SKTVA......HCFSFNEKSFYN.MQ...K....----------
J9EUZ4_WUCBA/174-288LSKLISLFQVK...........LSNN..........LRDDIEKHPANCSVSISETKVRK.LM........----------
J9JQK0_ACYPI/173-289ISDLIIYCRSV.AFC.LE..T.QR..............ERGFV..HNEMSSFPENKAEK.LMC..HQES.----------
T1FX15_HELRO/212-327LSDLVTICQST.SFT.SF..NHSAS.............HHS....FQNICSFDENKALE.LA....QTD.----------
PLC1_SCHPO/638-752LQQLAPYARSL.KFR.....N.FSLPE.........SKTYS......HIFSFSERTIKK.HG........----------
I4Y9T4_WALMC/324-435LLDLLIYTVGV.KFR.GF..N.K.................KEHYNIEHIFSLSDRSARK.CI....NTS.----------
A7RXP6_NEMVE/450-565LSELVNYFQPV.HFK.SF..D.VS..............AKRNR..SYEMSSFVETVATT.QL....KEK.----------
M1WD50_CLAP2/329-446LAELGVYAQSV.KPIDNS..W.FKPGV.........LTNGPHH....HLINISESELLS.HLP..A....----------
C7YLY8_NECH7/448-559LGSLAVYTRSQ.HYK.....S.LATKE.........AKIPP......HIFSISENRILE.L.........----------
E4ZW47_LEPMJ/391-503LSRLGVYFGGY.SFK.....S.LDAPE.........AQIPT......HVFSLSEKALME.V.........----------
T1JBA8_STRMM/526-641LSNLVNLCQAV.HFK.NF..NHSIH.............HGK....CYEISSLSESKALS.MA....EAE.----------
H2Z2T5_CIOSA/481-594LSNLVSICSCV.RFV.DF..Q.GH..............ERIHK..CSATSSLHEQDAAK.LV....ENE.----------
G3B2Z3_CANTC/553-668LSDLAVYVQGQ.KFR.....N.FSLPE.........SKTFN......HCFSLSEKTIDL.ML...K....----------
F0Z941_DICPU/560-673.LSSLIYLVSH.SFK.SA..S.N.................TKELPCYLMHSLSEEKVKA.LV....QTD.----------
F6XYJ8_XENTR/524-634LSDLVVYCQTV.EYR.GQ..P.G.................N....VCEMSSFSEDKVRR.LI....KDS.----------
R8BH76_TOGMI/661-777LGDLGVYCLGI.KFR.....G.FDDAE.........CKSFN......HILSFKERTFLK.NS...E....----------
G2Q018_MYCTT/394-509LAELAIYTHSE.HYV.....D.ENSLS........SCESPS......HIFSINEGSFLS.L.V..E....----------
I3JP81_ORENI/305-420LSDLVIYTRSV.KFI.SF..SHSRD.............NQN....CYENTSMEEKKARK.LL....KAS.----------
C6HRC6_AJECH/378-490LSRLGIYTRGH.TFS.....K.FSQQE.........ATQPN......HIFSLSESAVRN.A.........----------
B0D2M8_LACBS/202-309LVALLVYTVGV.KCR.GI..N.K.................KEEYAPVHMFSLSENAANK.ML....KFG.----------
Q1LWW2_DANRE/15-130MSNMVVYCQSI.KKK.TF..E...................NYN..YKEVRSLPDNIIPK.EGNESGMEK.----------
T1GAZ8_MEGSC/275-385MSDLIIYFRSV.PFR.EK..N....................WT..IYEMSSFSETKAKQ.II....QQN.----------
F6Y1S7_CIOIN/466-581LSDLVIYAQSR.HFH.NF..P.D................AKHNSDFRHISSLNEDKAMN.LY....NSQ.----------
K5XNX9_AGABU/250-367LAEVGYYFRSM.KPSKN...W.FSRL...........IPDPPN....ILLNISESSLLS.LLT..S....----------
N1QL86_SPHMS/786-905LGKLGVYAQGI.KFG..A..G.FLTPG.........SKAYN......HIYSFNENTFDD.LCT..K....----------
Q385H1_TRYB2/453-569LSRLI.......SIE.SI..G.YKGVEDL.....SYLEMRQ....PYHCSSFTEGKAGK.IA....SSN.----------
C1FE07_MICSR/227-338....LVYVENV.KLP.......TP..............HQSTSLKSLHSCSWSESKLVS...........----------
E3MQ20_CAERE/991-1101LSNLVVYCQAV.PFD.PA..H.I................QNDA..FYEMCSFVEGKLDK.LVE..K....----------
Q2HB23_CHAGB/790-904LGELGVYCMGI.HFD.....G.FDSPD.........AKKFN......HIFSFKEKTFAE.KN...Q....----------
F7FGQ0_MONDO/286-401LSDLVIYTKAE.KFK.SF..HHAQI.............NQK....FNENNSIGELRARK.LS....KQK.----------
F6ZK74_CIOIN/369-484LSDLVIYTRSI.EFP.GF..D.AT..............TEVYR..AFEVWSFSEKKAQA.LV....ESR.----------
H2URW7_TAKRU/209-324LSELVSLCKSV.QFR.DF..E.IT..............KREQK..YWEMCSFNEVDANR.YA....NEF.----------
A3LSB2_PICST/670-786LSDLGVYFQGL.KFR.....N.FSLPE.........SKTYN......HCFSLSEKSINS.ML...K....----------
A0A0D2WHU8_CAPO3/922-1038MSDVVVYTKSV.PFQ.SF..EHSKK.............TYK....CYEMSSFPEKKARK.VA....SRQT----------
C3Z9I4_BRAFL/477-593LADLIVLCKSD.KIE.DL..P.TS..............ASESC..AQYVCSFSQSGAIR.LA....VSF.----------
H2SZT3_TAKRU/428-542MSDLVVYCQPR.KCR.S.....ITSN...........GTGIYS..YKEIRSFVENKVPG.......KSR.----------
N1Q9A1_PSEFD/659-776LGKLGVYTQGI.KFN.....G.FQAPN.........AKTYN......HILSFSEGVFDR.LS...K....----------
B7S3T2_PHATC/601-716LARLTLF.HGT.KFK.AF..E.Q.................SITEPFSHMHSIGEAKIGK.ILS.KNPAN.----------
W5KFE6_ASTMX/490-605LSDLVIYCKNE.NFT.NF..EDSRI.............NGK....PYDISSFSESKARK.II....KES.----------
Q2H4G2_CHAGB/405-520LSELAIYTHSQ.HYT.....D.DSSLD........TCQAPS......HIFSLSEDSFEA.L.T..E....----------
F2UPR8_SALR5/1185-1317MSDLVIYTRAV.KFT.RF..A.SKHPRAPGNGTCNAEGEPHLPVFAYEMSSFSEEADKM.PV....RKM.----------
Q6BZ51_DEBHA/662-778LSDLGIYLQGV.KFR.....N.FSLPE.........SKTFN......HCFSLSEKSINT.ML...K....----------
S0ELB2_GIBF5/852-959LQSLAVYGASR.RLPKNA..E.FDT.............HRN......FIYSVSERNFKK.HT...K....----------
L5LI27_MYODS/450-565LSELVSICKSV.QFK.EF..Q.VS..............FQVQK..YWEVCSFNEVLASK.YA....NEN.----------
A9VD11_MONBE/1221-1335LLELAVYFQSV.RLH.TF..E.K.................NKPQAAYEMSSLSEKKLMR.FV....QKQ.----------
K0KL98_WICCF/623-739LSALGVYALGY.KFT.....N.FSLPE.........SKTIN......HIFSFSENSTNS.MI...K....----------
T1G934_HELRO/199-314LSDLIVYCQAK.SFK.SF..DSSKN.............NDK....HYEMCSFKEKKALR.LC....KEE.----------
T1G0G0_HELRO/196-307FSDLVVYLQTV.KFK..........................AE..CYQVASLGENKAKQ.LC....RKH.----------
G3JGE5_CORMM/284-396LSDLGIYTRAV.SFK.....S.WAQPE.........ATMQG......HIFSMSEKMFTT.H.........----------
A0A0C4ERW5_PUCT1/563-680LSSLIVYTVGV.KAR.GF..N.K.................LTTYEPEHILSLSERTVNK.FLK.GGTLR.----------
G7XNJ5_ASPKW/783-900LSDLGVYTRGY.KWH.....S.FTSAE.........SQRYN......HVYSFAERSFES.IC...R....----------
M4AIZ6_XIPMA/499-613LSELVVYTRSV.PFK.SF..EHAA..............KNP....PTDMCSFSESEALR.LS....KDS.----------
M7SX13_EUTLA/137-249LSALAIHTHSE.HFE.....T.FESTA.........AKTPS......HIFSISEKKILE.L.........----------
T1IHK2_STRMM/849-956LSNLIVYCRSV.PFC.FE..R.LVK............EGGPCN..FYEMSSFPETKVEK.WIG..RQFC.----------
R8BQP0_TOGMI/129-239LSNLAIYTHSE.HFK.....R.FDTMS.........AKTPS......HIFSINENKILE.L.........----------
E9GUG0_DAPPU/494-609LLDMVNICEAV.KFH.SF..SHSLN.............KDQ....CYHISSFSESKASD.LI....AES.----------
R4GB63_ANOCA/369-484LSELIIYTASR.KFA.SF..EDSKE.............KQK....FYQNNSIGEVKGQK.LI....KRR.----------
I2GWJ1_TETBL/468-586....ISAIHGI.RFR.....N.TSLPE.........SKTVN......HCFSLNEKKIDK.LC...Q....----------
H3B2C6_LATCH/424-539LSDLVVYVKSV.HFY.GF..EHAKE.............EQA....FFEMSSFGESKAFK.LA....KES.----------
M3D9Q9_SPHMS/307-425LAELGVYAQSV.KPTNQS..W.FDPGE.........LQNGPRH....HLINVSESGLLGLNLE..L....----------
K1V4M8_TRIAC/283-399LARLGVYAQSV.KPTSAG..W.YDLA..........LDGYPHH....HLINLSEVGLGT.HLP..A....----------
W4Y2J6_STRPU/402-517MSALVNYVQPV.HFS.TF..E.GS..............DKRNH..SYEISSFVETSAMN.RV....KEN.----------
J5JN06_BEAB2/465-578LKNLAIYTRGV.KFE.....G.LDTKQ.........ATQPN......HIFSISEDDILN.L.........----------
F7C6V1_CALJA/70-183LSDLVVYCKPT.SKT.KD..N.L................ENPD..FREIRSFVETKADS.IIR..QKP..----------
G3AVU0_SPAPN/619-735LSALGVYIQGI.KYK.....N.FSLPE.........SKTFN......HCFSLNEKSINV.MI...K....----------
S0EHF9_GIBF5/987-1097LAKLGVYLRQE.HFE.....S.FNTPL.........AKSPN......HLFSFREDRVQG.LIR..A....----------
G4TAH9_PIRID/235-351LEALGFYANSI.KPKDGW..L.ERK............IINPLH....VLINISESALLS.LLKIPE....----------
G4NDT3_MAGO7/323-447LEELGVYAQSV.KLANDA..W.FDATEQAR..DQTQPLALPHH....HLINISESGLSR.HLP..E....----------
V8PE75_OPHHA/356-482LSELVIYTKAQ.KFT.SF..EDSRK.............NQR....FYETNSIGEAKARK.LL....KLK.----------
A9VBY6_MONBE/623-741.SNIVSL.SGV.KFK.......GVAQL........QQSFTEQK..AMQMSSFGEKRAMR.LVE..NEHD.----------
A0A016Q5G1_GIBZA/774-890LGDLGVYCAGV.KFS.....G.FDTVD.........AKQYN......HIFSFMESSFAK.HS...R....----------
A0A0D2X2F7_CAPO3/1560-1674LAELAIYCRAA.HFV.SF..EDNMA.............CQV....WYQMTSIGESKAKK.LA....QTN.----------
E3QYT0_COLGM/329-441LSDLGIYTFST.RFK.....S.FEMPA.........AKEPG......HIFPMVEHRFLA.L.........----------
V8PDH0_OPHHA/598-706......KTHAI.EFV.KY..P.CSE.............AAITR..LFSLKQQGGNSATN.......NTQ.----------
M1VXY3_CLAP2/500-610LGDLAVYTRSE.HFK.....A.FETKE.........AKKPA......HIFSISEKRILE.L.........----------
H2ZU78_LATCH/223-338LSDLVIYTKAV.RFQ.SF..EYSRD.............NQK....FYEMNSLGETKAIK.LG....RQA.----------
H6C734_EXODN/365-479LSHLGVYTRAY.SFK.....H.FKQPE.........ASIPS......HVFSLSENKVLY.M.........----------
B7FP63_PHATC/607-714........HGN.KHK.TW..E.E.................SLWSPRYHMHSFSENKVRS...K.CRHKE.----------
N1J7Z3_BLUG1/388-499LGKLGIYTQSE.HFT.....S.FKDPS.........ATTPS......HIFSISESDILN.L.........----------
C7Z5S0_NECH7/888-1002..DLAVYGPGK.RLPRPS..K.VDA.............TGN......FIYSVSEANFKS.YL...K....----------
W5M435_LEPOC/940-1052MSDLVVYCQPR.SKD.KD..S.F................AQYD..YKEIRSFVENKAP...VP..KRTA.----------
A8PDD5_COPC7/582-696LASLLVYTIGV.KCH.GL..N.D.................EVQYAPEHIFSLSEYSANK.LL....KVG.----------
A7SDH9_NEMVE/403-518LSRCVNYISSV.GFK.NF..EHSKE.............NAK....FYQMSSFVESKVAT.LA....QNK.----------
M3HJN1_CANMX/678-794LSELGIYAQGL.KFR.....N.FSLPE.........SKTYN......HCFSLGEKSINR.MI...K....----------
G5BJ13_HETGA/521-638LSALAVYCCAT.RLQ.TL..QPGPG.............PAQ....PCQVSSLSERKARK.LL....REA.----------
U4L657_PYROM/279-397LSRLGAYCSSH.HFP.....SRDPGRPFVE...HKTSLLAN......HVYSFSEKVFAS.H.........----------
R4XC63_TAPDE/590-708LQVMAPYLKGV.KFR.....N.FSLPE.........SKVFN......HVFSLSERTIKQ.FSH..E....----------
M2R750_COCSN/398-510LARLGVYCGGY.SYK.....G.LDTPE.........AKIPT......HVFSLSEGTLMD.L.........----------
B4JKL8_DROGR/976-1087MSDLIIYFRSV.PF........RD...............HSWI..FQEMSSFPETKAEK.QFI..QQNM.----------
T1FQR0_HELRO/789-897MSDLVIYLQPI.RFI.SF..D.TC..............KQRMR..SYECTSFVESQALV.LL....KAF.----------
E9CUF5_COCPS/374-486LSRLGIYTRGY.TFN.....G.FSQPE.........ATKPT......HIFSLSEATLKD.A.........----------
D8QLF1_SCHCM/503-623LLALLVYTMGV.KCR.GL..N.K.................KETYEPSHMFSLSENRANKMLL....KTPT----------
I3K2K2_ORENI/545-660MSSIVNYIQPN.KFI.SF..E.NA..............RKKNK..SYVISSFVETKGEA.MI....AKS.----------
G1X1C4_ARTOA/269-381LSSLGVYSSAM.TFPN....T.FDHPS.........ATRPN......HIFSFSEKKFNK.L.........----------
F7A0G1_CIOIN/490-605LSNLVSICTDV.ATVFDE..S.G.................KTQSPRNSSSSIHEQEAAK.LV....ENE.----------
T1KSZ4_TETUR/201-315LADLAVYCSAK.KFR.......SL..............EDTLSWKFNEMFSLKETVSAD...........----------
H9ITM0_BOMMO/938-1054ISDLIIYCRSV.TFN.IE..R.LR..............IKGFV..YNEMSSFPETKAER.LMS..QQEN.----------
H2ZTT6_LATCH/71-184LSDLVIYCKPT.SKT.KD..N.L................EKPD..YKEIRSFMETKADS.IVK..QKP..----------
I1GJ67_AMPQE/603-717LSKCVNYVQSV.HFK.GF..DSTH..............EIP....FFHMSSFGESSAFK.SS....EES.----------
G4NJD0_MAGO7/442-555LSKLAVYTHSK.HFG.....G.FSTRV.........AKSPS......HIFSLSEGSIQR.W.........----------
T1HV24_RHOPR/962-1078ISNLIIYCRSV.PFN.ID..K.LK..............QTGFL..YAEMSSFPETKAEK.LMC..QQEI.----------
C5DES3_LACTC/577-692.......IHGV.KFR.....N.FSLPE.........SKVPN......HCFSLSEKKLDN.LG...K....----------
A7SXK4_NEMVE/280-395LSQLINYISNE.KFKSFI..E.S.................MEMGHFSQTHSFVESEMLY.FL....DKS.----------
H0ES44_GLAL7/715-832LGELGVYSAGL.KFR.....G.FDDPE.........SKTYN......HIFSFMEKTFDT.NS...K....----------
M7SPN2_EUTLA/327-448LAELGVYAQSV.KPRDNS..W.FEEVA........GMKDGPHH....HLINVSETGLAA.HLP..A....----------
F7B628_XENTR/933-1046LSDLVMYCKPK.SEA.KE..K.L................ESPD..FREIRSFAENKGES.IA....RQK.----------
B2AUG0_PODAN/415-528LADLAIYTHSE.HFD.....D.HQSLH.........SRTPS......HIFSLSEDCFHA.L.A..H....----------

PF03009

GLPQ_ECOLI/36-350--------------------------------------------------------------------------------
E7KVC5_YEASL/7-246--------------------------------------------------------------------------------
O07244_MYCTU/14-242--------------------------------------------------------------------------------
GLPQ1_MYCTU/17-259--------------------------------------------------------------------------------
UGPQ_ECOLI/12-239--------------------------------------------------------------------------------
Q45201_BORHE/38-330--------------------------------------------------------------------------------
GLPQ_HAEIN/40-355--------------------------------------------------------------------------------
Q9RKX8_STRCO/20-243--------------------------------------------------------------------------------
YQIK_BACSU/7-235--------------------------------------------------------------------------------
GLPQ_BACSU/43-285--------------------------------------------------------------------------------
GDE1_YEAST/877-1212--------------------------------------------------------------------------------
O02322_CAEEL/73-322--------------------------------------------------------------------------------
PGC1_SCHPO/37-267--------------------------------------------------------------------------------
O86738_STRCO/16-227--------------------------------------------------------------------------------
GPCP2_CAEEL/406-706--------------------------------------------------------------------------------
GPCP1_CAEEL/349-649--------------------------------------------------------------------------------
Q3BZN0_XANC5/274-516--------------------------------------------------------------------------------
Q89384_PBCV1/5-217--------------------------------------------------------------------------------
GDE1_SCHPO/752-1061--------------------------------------------------------------------------------
Q9RSP0_DEIRA/37-277--------------------------------------------------------------------------------
Q9RWX3_DEIRA/7-220--------------------------------------------------------------------------------
Q9RZL4_DEIRA/249-566--------------------------------------------------------------------------------
GDPD6_ARATH/49-357--------------------------------------------------------------------------------
GDPD1_ARATH/39-318--------------------------------------------------------------------------------
Q9UAW8_CAEEL/68-331--------------------------------------------------------------------------------
Q9VQU3_DROME/375-661--------------------------------------------------------------------------------
Q9W2L6_DROME/349-632--------------------------------------------------------------------------------
Q9X1V6_THEMA/6-217--------------------------------------------------------------------------------
Q9YFI4_AERPE/15-220--------------------------------------------------------------------------------
Q9ZTU6_WHEAT/118-414--------------------------------------------------------------------------------

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393................................................................................
A4I5X4_LEIIN/300-441................................................................................
Q8IJR0_PLAF7/626-770................................................................................
Q6BZ51_DEBHA/455-607................................................................................
PLCG2_MOUSE/314-457................................................................................
PLCL1_HUMAN/400-543................................................................................
PLCD9_ARATH/109-254................................................................................
PLCD1_ARATH/107-250................................................................................
PLCD6_ARATH/139-282................................................................................
A5DAA1_PICGU/440-595................................................................................
PLCD4_RAT/292-436................................................................................
PLCZ1_BOVIN/157-300................................................................................
PLCD3_ARATH/108-251................................................................................
A5E691_LODEL/21-192DGNSANTN........................................................................
Q16W08_AEDAE/315-464................................................................................
PLCD5_ARATH/114-257................................................................................
Q5QIB9_STRPU/301-444................................................................................
Q6CSI9_KLULA/402-540................................................................................
PLCD3_HUMAN/339-483................................................................................
Q385H1_TRYB2/248-393................................................................................
Q16ZC0_AEDAE/42-189................................................................................
PLCH1_HUMAN/301-445................................................................................
A2QEJ2_ASPNC/86-262KPSTSSGSSG......................................................................
Q4N7P5_THEPA/468-615................................................................................
A7S279_NEMVE/319-466................................................................................
PLC_DICDI/324-466................................................................................
Q5BFL6_EMENI/534-676................................................................................
Q2HB23_CHAGB/553-696................................................................................
A6RBI2_AJECN/84-320ESDHGDPKVPQKNPKKNGKDRKGGTFNLSSLSNQLDR........................LSRGSTTQPQVAGAETAVV
A0CKY8_PARTE/271-413................................................................................
E9AEI1_LEIMA/296-447................................................................................
Q9XWB7_CAEEL/306-468................................................................................
Q8IA75_CAEEL/367-517................................................................................
PLC1_YEAST/382-521................................................................................
PLCE1_HUMAN/1394-1541................................................................................
A7RXP6_NEMVE/244-393................................................................................
Q7QHE3_ANOGA/319-462................................................................................
A0BLC4_PARTE/285-429................................................................................
Q6FY00_CANGA/381-519................................................................................
A0BLM0_PARTE/262-404................................................................................
Q59LC4_CANAL/566-727GTK.............................................................................
Q2UPV6_ASPOR/98-321DTSSSSSDSISERKIKQGSKRERLKSMAKRHSR...............................LGSMSTKLGGLIGRKS
A7T501_NEMVE/158-302................................................................................
A7ASE0_BABBO/522-670................................................................................
A0A0D1CR16_USTMA/724-872................................................................................
A7TR21_VANPO/381-520................................................................................
Q75C92_ASHGO/397-535................................................................................
A7RPQ0_NEMVE/307-450................................................................................
A7SXK4_NEMVE/94-237................................................................................
A4S165_OSTLU/1-153................................................................................
Q7PW25_ANOGA/289-436................................................................................
A7RKT2_NEMVE/272-413................................................................................
A3LSB2_PICST/461-615................................................................................
A3LNB7_PICST/20-167................................................................................
PLCH2_HUMAN/328-472................................................................................
Q0UVV5_PHANO/116-337EEMQKYGAPKVEKKNKDKKEKLSLRKRLELR....................................FGRKGASEEKERS
Q4QBH9_LEIMA/195-340................................................................................
Q0UE70_PHANO/101-258................................................................................
PLCL2_MOUSE/429-572................................................................................
PLCZ1_CHICK/159-303................................................................................
Q2GUM5_CHAGB/104-264................................................................................
Q21754_CAEEL/318-461................................................................................
A7SDH9_NEMVE/209-352................................................................................
A4HCK9_LEIBR/248-393................................................................................
PLC1_SCHPO/443-585................................................................................
Q013R6_OSTTA/119-269................................................................................
Q75IL8_ORYSJ/119-262................................................................................
PLCD8_ARATH/107-248................................................................................
Q6CD33_YARLI/505-648................................................................................
A7UXE0_NEUCR/118-273................................................................................
A9RJG9_PHYPA/150-293................................................................................
A9SXU1_PHYPA/108-250................................................................................
B4H106_DROPE/328-471................................................................................
B6C9K2_SOLLC/110-252................................................................................
B6KHA6_TOXGO/407-549................................................................................
E9QD74_DANRE/316-459................................................................................
F1R8S3_DANRE/294-437................................................................................
F6HKS4_VITVI/112-254................................................................................
F7DT82_CALJA/159-308................................................................................
G3GVA5_CRIGR/324-467................................................................................
G3UXP4_MOUSE/322-465................................................................................
G4UMR8_NEUT9/110-362DAESVTSSSSSSSDDAYGSGEEGTASKLKRKAKSKLPSFLGGRKKSKDKKVPEPTTRTPPPPAAATTTEAAPVGLSAETN
PLCB_CAEEL/342-492................................................................................
H2SZT5_TAKRU/30-172................................................................................
H2USZ2_TAKRU/343-506Y...............................................................................
H3CD03_TETNG/306-449................................................................................
H3CYP8_TETNG/287-430................................................................................
H3D277_TETNG/321-464................................................................................
H3D2C1_TETNG/321-464................................................................................
H3D5C7_TETNG/314-459................................................................................
H3DBV7_TETNG/298-442................................................................................
H3DF29_TETNG/89-233................................................................................
H3DK53_TETNG/325-468................................................................................
I1R783_ORYGL/114-256................................................................................
K4A9N8_SETIT/153-295................................................................................
M1BNL7_SOLTU/113-255................................................................................
M1CL37_SOLTU/111-252................................................................................
M4FG24_BRARP/66-209................................................................................
PLCB2_RAT/314-464................................................................................
PLC_LISMO/61-198................................................................................
PLCB3_MOUSE/319-469................................................................................
Q236T7_TETTS/331-475................................................................................
PLC_STAA8/51-192................................................................................
Q4DUP6_TRYCC/248-392................................................................................
Q4WX21_ASPFU/96-334DTSSSSSSSSEWSSDEENPSRRKKQDVQKTDGSTQSAKAPS................RRKGLSSKLGSLLGRKSSPPNGA
Q5A0L4_CANAL/21-164................................................................................
Q7SE08_NEUCR/136-356NGEHRRHISNVSAMSRTSVRHGSSLSVDQPG...................................LYTMRTPRDSGTSL
Q81A32_BACCR/58-194................................................................................
PLCD4_ARATH/116-257................................................................................
W4XJU2_STRPU/318-467................................................................................

PF00387

Q5KJZ5_CRYNJ/446-558--------------------------------------------------------------------------------
F1QS56_DANRE/608-720--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K909_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
A0A0D2XRJ6_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
A0A0C4DI92_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A0A0J9XXP4_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
A0A0D1CR16_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_ZYMTI/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
A0A0D2WK99_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_DOTSN/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METRA/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
A0A098DQ28_GIBZA/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENRW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
A0A0C4DV60_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_PSEFD/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_DOTSN/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
A0A0D2UAN0_CAPO3/1229-1344--------------------------------------------------------------------------------
A0A0D2VPS8_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALMC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_MYCTT/369-481--------------------------------------------------------------------------------
F9X062_ZYMTI/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
A0A0D2U0B6_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALMC/324-435--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_MYCTT/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
A0A0D2WHU8_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_PSEFD/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
A0A0C4ERW5_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
A0A016Q5G1_GIBZA/774-890--------------------------------------------------------------------------------
A0A0D2X2F7_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

GLPQ_ECOLI/36-350------------------------LVVLHD..........HYLDRVTDVADRFPDRA.........RKDGRYYAIDFTLD
E7KVC5_YEASL/7-246------------------------VVVNHD..........SDTGRMWDKNL.....................VIGESTWE
O07244_MYCTU/14-242------------------------AVILHD..........RRLAPGVGLSG.....................AVDRLDWR
GLPQ1_MYCTU/17-259------------------------LVCVHD..........RRLDRTSTGAG.....................LVSTMTLA
UGPQ_ECOLI/12-239------------------------IFLLHD..........DNLERTSNGWG.....................VAGELNWQ
Q45201_BORHE/38-330------------------------PVIMHD..........PELDTTTNVAKLFPERA.........RENGRYYSVDFTLD
GLPQ_HAEIN/40-355------------------------LVVIHD..........HFLDGLTDVAKKFPYRH.........RKDGRYYVIDFTLK
Q9RKX8_STRCO/20-243------------------------LVAFHD..........GTLDRVTDGAG.....................RIADLPWE
YQIK_BACSU/7-235------------------------IVVIHD..........ERLNRTTSLKG.....................FVKDTAYD
GLPQ_BACSU/43-285------------------------LIVMHD..........EKLDRTTNGMG.....................WVKDHTLA
GDE1_YEAST/877-1212------------------------PVVYHD..........FLVAETGVDIPMHELT...........LEQFLDLNNADKE
O02322_CAEEL/73-322------------------------PVICHD..........SNTVRVTGVDK.....................EISAMNIT
PGC1_SCHPO/37-267------------------------VCILHD..........RNLNRVFGVDV.....................DVRDLDYE
O86738_STRCO/16-227------------------------PVLLHD..........ETLKRLWQHDR.....................PLRSLSAE
GPCP2_CAEEL/406-706------------------------AVIYHD..........FHVLVSVARRDGLAMPP........PMTREQLDSSNLDYH
GPCP1_CAEEL/349-649------------------------TVVYHD..........FHVLVAVAGRDSPSSTPTAA...GENKSLHEIAIKDLTLA
Q3BZN0_XANC5/274-516------------------------PVLMHD..........FSIGRMAGDPQN...................RLVSQVPFA
Q89384_PBCV1/5-217------------------------PVVFHD..........STLDRMTHSCG.....................KVKNFTLN
GDE1_SCHPO/752-1061------------------------PVVYHD..........FIVNETGTDAQ......................VHSLTLE
Q9RSP0_DEIRA/37-277------------------------LVLSHD..........ATLDRLTDTQG.....................RIADLTLE
Q9RWX3_DEIRA/7-220------------------------LAVHHD.............AALPDGRQ......................LPHLTRA
Q9RZL4_DEIRA/249-566------------------------LVARHEPVIAAVDETGKVLEATTDVATRPEFRDRLTTKTLDGVKVHGYFVEDFTLA
GDPD6_ARATH/49-357------------------------LICHHD..........VNLDDTTDVADHKEFADRKRTYEVQGMNMTGFFTVDFTLK
GDPD1_ARATH/39-318------------------------PIIFHD..........DFIYSEEQGVVY..................EKRVTEVCLS
Q9UAW8_CAEEL/68-331------------------------AVLMHD..........DDLDRTTDMKG.....................PIRDKTRA
Q9VQU3_DROME/375-661------------------------PVVYHD..........FMIYVSLKSKCSLQEH...........DFLALPMRELSLE
Q9W2L6_DROME/349-632------------------------PIIHHD..........FSIRVCIDSKTPTSKD...........DLTEVLLKDISYE
Q9X1V6_THEMA/6-217------------------------VVVSHD..........EDLKRLFGLDV.....................KIRDATVS
Q9YFI4_AERPE/15-220------------------------PMALHG.........RPSVRRATPIGR......................LWGWIDY
Q9ZTU6_WHEAT/118-414------------------------PICMSS.........IDLMDVTTVASSQFASQAGVI...SDIKAVAGVYTFNLTWE

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393........................PVVYH.--------------------------------------------------
A4I5X4_LEIIN/300-441........................PVIYH.--------------------------------------------------
Q8IJR0_PLAF7/626-770........................IVVYHG--------------------------------------------------
Q6BZ51_DEBHA/455-607...................KTNNEPIVSH.--------------------------------------------------
PLCG2_MOUSE/314-457........................PIIYH.--------------------------------------------------
PLCL1_HUMAN/400-543........................PILCN.--------------------------------------------------
PLCD9_ARATH/109-254........................ICVRP.--------------------------------------------------
PLCD1_ARATH/107-250........................AEVRH.--------------------------------------------------
PLCD6_ARATH/139-282........................INVLH.--------------------------------------------------
A5DAA1_PICGU/440-595.................ESEGIKGPIVNH.--------------------------------------------------
PLCD4_RAT/292-436........................PVVYH.--------------------------------------------------
PLCZ1_BOVIN/157-300........................PVVYH.--------------------------------------------------
PLCD3_ARATH/108-251........................AEVRH.--------------------------------------------------
A5E691_LODEL/21-192.........TNGGTSAATIAVVAEPVVNH.--------------------------------------------------
Q16W08_AEDAE/315-464........................PIITH.--------------------------------------------------
PLCD5_ARATH/114-257........................ILVLH.--------------------------------------------------
Q5QIB9_STRPU/301-444........................PIVYH.--------------------------------------------------
Q6CSI9_KLULA/402-540........................PVVCH.--------------------------------------------------
PLCD3_HUMAN/339-483........................PVIYH.--------------------------------------------------
Q385H1_TRYB2/248-393........................PVVYH.--------------------------------------------------
Q16ZC0_AEDAE/42-189........................PVIYH.--------------------------------------------------
PLCH1_HUMAN/301-445........................PVVHH.--------------------------------------------------
A2QEJ2_ASPNC/86-262........ESKASGSAIPVPGKPEPRVLH.--------------------------------------------------
Q4N7P5_THEPA/468-615........................PVLCHA--------------------------------------------------
A7S279_NEMVE/319-466........................PIITH.--------------------------------------------------
PLC_DICDI/324-466........................PIIFH.--------------------------------------------------
Q5BFL6_EMENI/534-676........................PIVSH.--------------------------------------------------
Q2HB23_CHAGB/553-696........................PVVTH.--------------------------------------------------
A6RBI2_AJECN/84-320TTTASMSPPGDAGTAASAVQLRREPLVFH.--------------------------------------------------
A0CKY8_PARTE/271-413.......................NPVVYH.--------------------------------------------------
E9AEI1_LEIMA/296-447........................PVVYH.--------------------------------------------------
Q9XWB7_CAEEL/306-468.......................EPVITH.--------------------------------------------------
Q8IA75_CAEEL/367-517......................TEPMVQN.--------------------------------------------------
PLC1_YEAST/382-521........................PVVCH.--------------------------------------------------
PLCE1_HUMAN/1394-1541........................PIIYH.--------------------------------------------------
A7RXP6_NEMVE/244-393........................PVITH.--------------------------------------------------
Q7QHE3_ANOGA/319-462........................PLIFH.--------------------------------------------------
A0BLC4_PARTE/285-429........................PIIYH.--------------------------------------------------
Q6FY00_CANGA/381-519........................PVVCH.--------------------------------------------------
A0BLM0_PARTE/262-404........................PKVTH.--------------------------------------------------
Q59LC4_CANAL/566-727...............DDDDKNEYEPIVNH.--------------------------------------------------
Q2UPV6_ASPOR/98-321SPEDVPLDSSAPVDPATEVPPPPEPQVLH.--------------------------------------------------
A7T501_NEMVE/158-302........................PVVYH.--------------------------------------------------
A7ASE0_BABBO/522-670........................PVLCHS--------------------------------------------------
A0A0D1CR16_USTMA/724-872........................PQITH.--------------------------------------------------
A7TR21_VANPO/381-520........................PVVCH.--------------------------------------------------
Q75C92_ASHGO/397-535........................PVVCH.--------------------------------------------------
A7RPQ0_NEMVE/307-450........................PIIYH.--------------------------------------------------
A7SXK4_NEMVE/94-237........................PIVYH.--------------------------------------------------
A4S165_OSTLU/1-153........................PIITH.--------------------------------------------------
Q7PW25_ANOGA/289-436........................PVIVH.--------------------------------------------------
A7RKT2_NEMVE/272-413........................PIITH.--------------------------------------------------
A3LSB2_PICST/461-615..................FQHDKEPIVNH.--------------------------------------------------
A3LNB7_PICST/20-167........................LQVIH.--------------------------------------------------
PLCH2_HUMAN/328-472........................PIVHH.--------------------------------------------------
Q0UVV5_PHANO/116-337LSPSGKGEEKVEPWRSDSYAYRAEPRVLH.--------------------------------------------------
Q4QBH9_LEIMA/195-340........................PIVCH.--------------------------------------------------
Q0UE70_PHANO/101-258.......................EPKVTH.--------------------------------------------------
PLCL2_MOUSE/429-572........................PVIYT.--------------------------------------------------
PLCZ1_CHICK/159-303........................PVVYH.--------------------------------------------------
Q2GUM5_CHAGB/104-264.......................EPKVTH.--------------------------------------------------
Q21754_CAEEL/318-461........................PVITH.--------------------------------------------------
A7SDH9_NEMVE/209-352........................PIVYH.--------------------------------------------------
A4HCK9_LEIBR/248-393........................PIVHH.--------------------------------------------------
PLC1_SCHPO/443-585........................PVVCH.--------------------------------------------------
Q013R6_OSTTA/119-269......................PRPIVTH.--------------------------------------------------
Q75IL8_ORYSJ/119-262........................VEVLH.--------------------------------------------------
PLCD8_ARATH/107-248........................ICVRP.--------------------------------------------------
Q6CD33_YARLI/505-648........................PVVKH.--------------------------------------------------
A7UXE0_NEUCR/118-273........................PKVTH.--------------------------------------------------
A9RJG9_PHYPA/150-293........................IDVLH.--------------------------------------------------
A9SXU1_PHYPA/108-250........................IKVTH.--------------------------------------------------
B4H106_DROPE/328-471........................PYIFH.--------------------------------------------------
B6C9K2_SOLLC/110-252........................VHVLH.--------------------------------------------------
B6KHA6_TOXGO/407-549........................PSLFHG--------------------------------------------------
E9QD74_DANRE/316-459........................PVIYH.--------------------------------------------------
F1R8S3_DANRE/294-437........................PVIYH.--------------------------------------------------
F6HKS4_VITVI/112-254........................IDVLH.--------------------------------------------------
F7DT82_CALJA/159-308........................PIITH.--------------------------------------------------
G3GVA5_CRIGR/324-467........................PIIYH.--------------------------------------------------
G3UXP4_MOUSE/322-465........................PVIYH.--------------------------------------------------
G4UMR8_NEUT9/110-362PLERSKSGGSASLFQTLSRKSTKEPRVLH.--------------------------------------------------
PLCB_CAEEL/342-492........................PIITH.--------------------------------------------------
H2SZT5_TAKRU/30-172........................PIIYH.--------------------------------------------------
H2USZ2_TAKRU/343-506................GPDISRQHHHHHH.--------------------------------------------------
H3CD03_TETNG/306-449........................PMVQH.--------------------------------------------------
H3CYP8_TETNG/287-430........................PVIYH.--------------------------------------------------
H3D277_TETNG/321-464........................PVIYT.--------------------------------------------------
H3D2C1_TETNG/321-464........................PVVYV.--------------------------------------------------
H3D5C7_TETNG/314-459........................PIIYH.--------------------------------------------------
H3DBV7_TETNG/298-442........................PVIYH.--------------------------------------------------
H3DF29_TETNG/89-233........................PVVYH.--------------------------------------------------
H3DK53_TETNG/325-468........................PVVCT.--------------------------------------------------
I1R783_ORYGL/114-256........................IDILH.--------------------------------------------------
K4A9N8_SETIT/153-295........................IDVLH.--------------------------------------------------
M1BNL7_SOLTU/113-255........................VDILH.--------------------------------------------------
M1CL37_SOLTU/111-252........................VEVLH.--------------------------------------------------
M4FG24_BRARP/66-209........................IDVLH.--------------------------------------------------
PLCB2_RAT/314-464........................PIITH.--------------------------------------------------
PLC_LISMO/61-198........................LNIYH.--------------------------------------------------
PLCB3_MOUSE/319-469........................PFITH.--------------------------------------------------
Q236T7_TETTS/331-475........................PEALQ.--------------------------------------------------
PLC_STAA8/51-192........................ISVHH.--------------------------------------------------
Q4DUP6_TRYCC/248-392........................PIVYH.--------------------------------------------------
Q4WX21_ASPFU/96-334TDKPASTATAAAVGTAAQTLRRPEPRVLH.--------------------------------------------------
Q5A0L4_CANAL/21-164........................LQVIH.--------------------------------------------------
Q7SE08_NEUCR/136-356DPKELSDRMDRSTSSSSGSVKRGEPIVHH.--------------------------------------------------
Q81A32_BACCR/58-194........................IVLHH.--------------------------------------------------
PLCD4_ARATH/116-257........................VCVKH.--------------------------------------------------
W4XJU2_STRPU/318-467........................PIITH.--------------------------------------------------

PF00387

Q5KJZ5_CRYNJ/446-558--------------------------------------------------------------------------------
F1QS56_DANRE/608-720--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K909_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
A0A0D2XRJ6_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
A0A0C4DI92_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A0A0J9XXP4_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
A0A0D1CR16_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_ZYMTI/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
A0A0D2WK99_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_DOTSN/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METRA/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
A0A098DQ28_GIBZA/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENRW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
A0A0C4DV60_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_PSEFD/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_DOTSN/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
A0A0D2UAN0_CAPO3/1229-1344--------------------------------------------------------------------------------
A0A0D2VPS8_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALMC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_MYCTT/369-481--------------------------------------------------------------------------------
F9X062_ZYMTI/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
A0A0D2U0B6_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALMC/324-435--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_MYCTT/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
A0A0D2WHU8_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_PSEFD/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
A0A0C4ERW5_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
A0A016Q5G1_GIBZA/774-890--------------------------------------------------------------------------------
A0A0D2X2F7_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

GLPQ_ECOLI/36-350EIKSLKFTE.........................................GFDIENGKKVQTYPGRFPMGK.........
E7KVC5_YEASL/7-246EVKRLR.................................................CKEDGSLAMMTLK............
O07244_MYCTU/14-242DVRKAQ...............................................LGAGQSIPTLEDLL.............
GLPQ1_MYCTU/17-259QLRELE...............................................YGAWH.DSWRPDGSHGD..........
UGPQ_ECOLI/12-239DLLRVD...............................................AGSWYSKMFKGEPL.............
Q45201_BORHE/38-330ELKSLSLSE.........................................RFDPASRN..PIYPNRFPLNE.........
GLPQ_HAEIN/40-355EIQSLEMTE.........................................NFETKDGKQAQVYPNRFPLWK.........
Q9RKX8_STRCO/20-243NVRHAR...............................................VAGEEPVPLFEELL.............
YQIK_BACSU/7-235EVKTAN...............................................AAAGHDQAYSDIKV.............
GLPQ_BACSU/43-285DIKKLD...............................................AGSWFNEAYPEKAKPQYV.........
GDE1_YEAST/877-1212HIQRGAGHSPHHVNGADTALQKYRGRS.....VDDSDVSTLRRAWDLHDNDPNG.KSNNAHWSDNRMRLTKTFKKNNFKG
O02322_CAEEL/73-322EFRKLR..............................................FIGTNVSLPTFEEAVA............
PGC1_SCHPO/37-267LDN...................................................GHFRTIQEPHEPL.............
O86738_STRCO/16-227EVRGLT.................................................AGG......................
GPCP2_CAEEL/406-706ELPVKDLKLSQLKLL.............................MLDHLSFPQ.KKENVKKLVEAG..EEEE........
GPCP1_CAEEL/349-649QLNLLHFEHI......................................SRANGSSAESPVALSVTPSKTETD........
Q3BZN0_XANC5/274-516ELREMP.................................................LVIRNPSDGNYV.............
Q89384_PBCV1/5-217ELSNLS.................................................IRN....STEKI.............
GDE1_SCHPO/752-1061QFLGASHSPSEEIKDDASDIQQKRRPRAYSSSFTPSGSQVNFGEFAEENARLKP.KVYKGNALGHTICA...........
Q9RSP0_DEIRA/37-277QVLRADAGY.........................................TLTPAGGSGFPFRGQGVQ............
Q9RWX3_DEIRA/7-220ELPERV..........................................................................
Q9RZL4_DEIRA/249-566ELRTLR................................................AVERLPQLRGKAYDGQ..........
GDPD6_ARATH/49-357ELKTLG................................................AKQR.YPFRDQQYNGK..........
GDPD1_ARATH/39-318EFMSYGPQR........................................DTGKTGKPLLRKSKEGKIHKWSV........
Q9UAW8_CAEEL/68-331ELDRCD...............................................ISATFKRTAPGDHCRLATV........
Q9VQU3_DROME/375-661QLKKLKVYH.........................................IAEGLSRETRSFHNDDC.LE..........
Q9W2L6_DROME/349-632QLKDLKTY...........................................QIVGNKIVEYPAHNNVEPPE.........
Q9X1V6_THEMA/6-217ELKELT.................................................DG.......KIT.............
Q9YFI4_AERPE/15-220KLFYRD..........................................................................
Q9ZTU6_WHEAT/118-414DIANNLK.............................................PMISNPFGQISLSRNPRNR.........

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393--------------------------------------------------------------------------------
A4I5X4_LEIIN/300-441--------------------------------------------------------------------------------
Q8IJR0_PLAF7/626-770--------------------------------------------------------------------------------
Q6BZ51_DEBHA/455-607--------------------------------------------------------------------------------
PLCG2_MOUSE/314-457--------------------------------------------------------------------------------
PLCL1_HUMAN/400-543--------------------------------------------------------------------------------
PLCD9_ARATH/109-254--------------------------------------------------------------------------------
PLCD1_ARATH/107-250--------------------------------------------------------------------------------
PLCD6_ARATH/139-282--------------------------------------------------------------------------------
A5DAA1_PICGU/440-595--------------------------------------------------------------------------------
PLCD4_RAT/292-436--------------------------------------------------------------------------------
PLCZ1_BOVIN/157-300--------------------------------------------------------------------------------
PLCD3_ARATH/108-251--------------------------------------------------------------------------------
A5E691_LODEL/21-192--------------------------------------------------------------------------------
Q16W08_AEDAE/315-464--------------------------------------------------------------------------------
PLCD5_ARATH/114-257--------------------------------------------------------------------------------
Q5QIB9_STRPU/301-444--------------------------------------------------------------------------------
Q6CSI9_KLULA/402-540--------------------------------------------------------------------------------
PLCD3_HUMAN/339-483--------------------------------------------------------------------------------
Q385H1_TRYB2/248-393--------------------------------------------------------------------------------
Q16ZC0_AEDAE/42-189--------------------------------------------------------------------------------
PLCH1_HUMAN/301-445--------------------------------------------------------------------------------
A2QEJ2_ASPNC/86-262--------------------------------------------------------------------------------
Q4N7P5_THEPA/468-615--------------------------------------------------------------------------------
A7S279_NEMVE/319-466--------------------------------------------------------------------------------
PLC_DICDI/324-466--------------------------------------------------------------------------------
Q5BFL6_EMENI/534-676--------------------------------------------------------------------------------
Q2HB23_CHAGB/553-696--------------------------------------------------------------------------------
A6RBI2_AJECN/84-320--------------------------------------------------------------------------------
A0CKY8_PARTE/271-413--------------------------------------------------------------------------------
E9AEI1_LEIMA/296-447--------------------------------------------------------------------------------
Q9XWB7_CAEEL/306-468--------------------------------------------------------------------------------
Q8IA75_CAEEL/367-517--------------------------------------------------------------------------------
PLC1_YEAST/382-521--------------------------------------------------------------------------------
PLCE1_HUMAN/1394-1541--------------------------------------------------------------------------------
A7RXP6_NEMVE/244-393--------------------------------------------------------------------------------
Q7QHE3_ANOGA/319-462--------------------------------------------------------------------------------
A0BLC4_PARTE/285-429--------------------------------------------------------------------------------
Q6FY00_CANGA/381-519--------------------------------------------------------------------------------
A0BLM0_PARTE/262-404--------------------------------------------------------------------------------
Q59LC4_CANAL/566-727--------------------------------------------------------------------------------
Q2UPV6_ASPOR/98-321--------------------------------------------------------------------------------
A7T501_NEMVE/158-302--------------------------------------------------------------------------------
A7ASE0_BABBO/522-670--------------------------------------------------------------------------------
A0A0D1CR16_USTMA/724-872--------------------------------------------------------------------------------
A7TR21_VANPO/381-520--------------------------------------------------------------------------------
Q75C92_ASHGO/397-535--------------------------------------------------------------------------------
A7RPQ0_NEMVE/307-450--------------------------------------------------------------------------------
A7SXK4_NEMVE/94-237--------------------------------------------------------------------------------
A4S165_OSTLU/1-153--------------------------------------------------------------------------------
Q7PW25_ANOGA/289-436--------------------------------------------------------------------------------
A7RKT2_NEMVE/272-413--------------------------------------------------------------------------------
A3LSB2_PICST/461-615--------------------------------------------------------------------------------
A3LNB7_PICST/20-167--------------------------------------------------------------------------------
PLCH2_HUMAN/328-472--------------------------------------------------------------------------------
Q0UVV5_PHANO/116-337--------------------------------------------------------------------------------
Q4QBH9_LEIMA/195-340--------------------------------------------------------------------------------
Q0UE70_PHANO/101-258--------------------------------------------------------------------------------
PLCL2_MOUSE/429-572--------------------------------------------------------------------------------
PLCZ1_CHICK/159-303--------------------------------------------------------------------------------
Q2GUM5_CHAGB/104-264--------------------------------------------------------------------------------
Q21754_CAEEL/318-461--------------------------------------------------------------------------------
A7SDH9_NEMVE/209-352--------------------------------------------------------------------------------
A4HCK9_LEIBR/248-393--------------------------------------------------------------------------------
PLC1_SCHPO/443-585--------------------------------------------------------------------------------
Q013R6_OSTTA/119-269--------------------------------------------------------------------------------
Q75IL8_ORYSJ/119-262--------------------------------------------------------------------------------
PLCD8_ARATH/107-248--------------------------------------------------------------------------------
Q6CD33_YARLI/505-648--------------------------------------------------------------------------------
A7UXE0_NEUCR/118-273--------------------------------------------------------------------------------
A9RJG9_PHYPA/150-293--------------------------------------------------------------------------------
A9SXU1_PHYPA/108-250--------------------------------------------------------------------------------
B4H106_DROPE/328-471--------------------------------------------------------------------------------
B6C9K2_SOLLC/110-252--------------------------------------------------------------------------------
B6KHA6_TOXGO/407-549--------------------------------------------------------------------------------
E9QD74_DANRE/316-459--------------------------------------------------------------------------------
F1R8S3_DANRE/294-437--------------------------------------------------------------------------------
F6HKS4_VITVI/112-254--------------------------------------------------------------------------------
F7DT82_CALJA/159-308--------------------------------------------------------------------------------
G3GVA5_CRIGR/324-467--------------------------------------------------------------------------------
G3UXP4_MOUSE/322-465--------------------------------------------------------------------------------
G4UMR8_NEUT9/110-362--------------------------------------------------------------------------------
PLCB_CAEEL/342-492--------------------------------------------------------------------------------
H2SZT5_TAKRU/30-172--------------------------------------------------------------------------------
H2USZ2_TAKRU/343-506--------------------------------------------------------------------------------
H3CD03_TETNG/306-449--------------------------------------------------------------------------------
H3CYP8_TETNG/287-430--------------------------------------------------------------------------------
H3D277_TETNG/321-464--------------------------------------------------------------------------------
H3D2C1_TETNG/321-464--------------------------------------------------------------------------------
H3D5C7_TETNG/314-459--------------------------------------------------------------------------------
H3DBV7_TETNG/298-442--------------------------------------------------------------------------------
H3DF29_TETNG/89-233--------------------------------------------------------------------------------
H3DK53_TETNG/325-468--------------------------------------------------------------------------------
I1R783_ORYGL/114-256--------------------------------------------------------------------------------
K4A9N8_SETIT/153-295--------------------------------------------------------------------------------
M1BNL7_SOLTU/113-255--------------------------------------------------------------------------------
M1CL37_SOLTU/111-252--------------------------------------------------------------------------------
M4FG24_BRARP/66-209--------------------------------------------------------------------------------
PLCB2_RAT/314-464--------------------------------------------------------------------------------
PLC_LISMO/61-198--------------------------------------------------------------------------------
PLCB3_MOUSE/319-469--------------------------------------------------------------------------------
Q236T7_TETTS/331-475--------------------------------------------------------------------------------
PLC_STAA8/51-192--------------------------------------------------------------------------------
Q4DUP6_TRYCC/248-392--------------------------------------------------------------------------------
Q4WX21_ASPFU/96-334--------------------------------------------------------------------------------
Q5A0L4_CANAL/21-164--------------------------------------------------------------------------------
Q7SE08_NEUCR/136-356--------------------------------------------------------------------------------
Q81A32_BACCR/58-194--------------------------------------------------------------------------------
PLCD4_ARATH/116-257--------------------------------------------------------------------------------
W4XJU2_STRPU/318-467--------------------------------------------------------------------------------

PF00387

Q5KJZ5_CRYNJ/446-558--------------------------------------------------------------------------------
F1QS56_DANRE/608-720--------------------------------------------------------------------------------
F1RBD7_DANRE/510-625--------------------------------------------------------------------------------
G8BKQ6_CANPC/644-760--------------------------------------------------------------------------------
A7RPQ0_NEMVE/492-607--------------------------------------------------------------------------------
F2ULH4_SALR5/541-656--------------------------------------------------------------------------------
G4VBK4_SCHMA/531-646--------------------------------------------------------------------------------
S0DQT6_GIBF5/306-423--------------------------------------------------------------------------------
E9GFR8_DAPPU/479-594--------------------------------------------------------------------------------
G0WGC6_NAUDC/598-716--------------------------------------------------------------------------------
L0PAS0_PNEJ8/47-161--------------------------------------------------------------------------------
K0R6H0_THAOC/569-682--------------------------------------------------------------------------------
I3JX91_ORENI/928-1039--------------------------------------------------------------------------------
I3K883_ORENI/523-637--------------------------------------------------------------------------------
E2BGZ2_HARSA/531-646--------------------------------------------------------------------------------
J3K909_COCIM/769-886--------------------------------------------------------------------------------
I1G7J0_AMPQE/80-196--------------------------------------------------------------------------------
G8JQV5_ERECY/594-709--------------------------------------------------------------------------------
F6SF88_CIOIN/565-682--------------------------------------------------------------------------------
G2R3P3_THITE/406-520--------------------------------------------------------------------------------
F2U545_SALR5/2126-2244--------------------------------------------------------------------------------
PLC_DICDI/543-652--------------------------------------------------------------------------------
B3SC97_TRIAD/538-653--------------------------------------------------------------------------------
T1J420_STRMM/330-445--------------------------------------------------------------------------------
E4XLQ6_OIKDI/964-1081--------------------------------------------------------------------------------
A0A0D2XRJ6_FUSO4/781-897--------------------------------------------------------------------------------
U7PV69_SPOS1/502-615--------------------------------------------------------------------------------
A5DAA1_PICGU/648-764--------------------------------------------------------------------------------
H2N2E2_ORYLA/491-606--------------------------------------------------------------------------------
G8BYA3_TETPH/612-727--------------------------------------------------------------------------------
D7ELR5_TRICA/967-1083--------------------------------------------------------------------------------
A7SMY6_NEMVE/400-514--------------------------------------------------------------------------------
S7ZDD6_PENO1/368-480--------------------------------------------------------------------------------
E9HXQ7_DAPPU/696-810--------------------------------------------------------------------------------
H0ZA90_TAEGU/543-658--------------------------------------------------------------------------------
F6S6B2_CIOIN/946-1058--------------------------------------------------------------------------------
F0XRH2_GROCL/838-956--------------------------------------------------------------------------------
G4N054_MAGO7/418-530--------------------------------------------------------------------------------
T1KUP6_TETUR/217-327--------------------------------------------------------------------------------
F6RLC5_XENTR/487-602--------------------------------------------------------------------------------
U1HY48_ENDPU/777-894--------------------------------------------------------------------------------
B7P4X9_IXOSC/943-1057--------------------------------------------------------------------------------
G2YC85_BOTF4/422-534--------------------------------------------------------------------------------
L8FTI0_PSED2/766-883--------------------------------------------------------------------------------
U3JVN7_FICAL/532-647--------------------------------------------------------------------------------
I3L7K2_PIG/492-608--------------------------------------------------------------------------------
H3BDF5_LATCH/514-630--------------------------------------------------------------------------------
K5XX24_AGABU/562-680--------------------------------------------------------------------------------
H2SZT4_TAKRU/541-665--------------------------------------------------------------------------------
H3CR59_TETNG/503-618--------------------------------------------------------------------------------
H3A2I8_LATCH/834-950--------------------------------------------------------------------------------
R8BVG2_TOGMI/308-425--------------------------------------------------------------------------------
W5MU43_LEPOC/512-627--------------------------------------------------------------------------------
M2UIG2_COCH5/302-418--------------------------------------------------------------------------------
S3DHJ9_GLAL2/313-430--------------------------------------------------------------------------------
W1QFP3_OGAPD/592-708--------------------------------------------------------------------------------
H2UH12_TAKRU/488-602--------------------------------------------------------------------------------
L8FLM5_PSED2/482-594--------------------------------------------------------------------------------
H2YFJ0_CIOSA/524-639--------------------------------------------------------------------------------
K7M553_SOYBN/345-454--------------------------------------------------------------------------------
F2U1Z4_SALR5/471-588--------------------------------------------------------------------------------
G3P4B1_GASAC/508-622--------------------------------------------------------------------------------
R7YJ72_CONA1/333-445--------------------------------------------------------------------------------
N4UQ90_FUSC1/308-422--------------------------------------------------------------------------------
D5GAP7_TUBMM/347-465--------------------------------------------------------------------------------
A0A0C4DI92_FUSO4/284-405--------------------------------------------------------------------------------
K1WAI4_MARBU/420-532--------------------------------------------------------------------------------
S8A7Z1_DACHA/271-383--------------------------------------------------------------------------------
Q013R6_OSTTA/352-465--------------------------------------------------------------------------------
K1PZR1_CRAGI/575-690--------------------------------------------------------------------------------
Q9XWB7_CAEEL/528-650--------------------------------------------------------------------------------
C9SV93_VERA1/293-405--------------------------------------------------------------------------------
A4S165_OSTLU/202-315--------------------------------------------------------------------------------
N1RC01_FUSC4/282-393--------------------------------------------------------------------------------
C7ZJB8_NECH7/239-351--------------------------------------------------------------------------------
G0RBZ6_HYPJQ/342-459--------------------------------------------------------------------------------
G7P2D3_MACFA/393-508--------------------------------------------------------------------------------
D2VS67_NAEGR/554-665--------------------------------------------------------------------------------
A0A0J9XXP4_BRUMA/969-1079--------------------------------------------------------------------------------
A1CJQ9_ASPCL/375-487--------------------------------------------------------------------------------
H3A3M2_LATCH/610-722--------------------------------------------------------------------------------
Q21754_CAEEL/494-608--------------------------------------------------------------------------------
E9G040_DAPPU/487-602--------------------------------------------------------------------------------
V2Z343_MONRO/363-478--------------------------------------------------------------------------------
W4XRL3_STRPU/213-326--------------------------------------------------------------------------------
W5N0K4_LEPOC/507-620--------------------------------------------------------------------------------
N1QLI7_SPHMS/293-404--------------------------------------------------------------------------------
A0A0D1CR16_USTMA/993-1113--------------------------------------------------------------------------------
R7YQ07_CONA1/783-900--------------------------------------------------------------------------------
PLCZ1_CHICK/377-492--------------------------------------------------------------------------------
G1NLG3_MELGA/393-511--------------------------------------------------------------------------------
H3ERT0_PRIPA/495-607--------------------------------------------------------------------------------
R1EKA9_BOTPV/390-502--------------------------------------------------------------------------------
H3CZG1_TETNG/283-398--------------------------------------------------------------------------------
T1G6Y6_HELRO/929-1047--------------------------------------------------------------------------------
N4VFU7_COLOR/301-417--------------------------------------------------------------------------------
PLC1_YEAST/590-709--------------------------------------------------------------------------------
Q4DUP6_TRYCC/458-575--------------------------------------------------------------------------------
F4NTE5_BATDJ/674-789--------------------------------------------------------------------------------
F2TZD4_SALR5/1418-1533--------------------------------------------------------------------------------
S3CWU2_GLAL2/446-558--------------------------------------------------------------------------------
C5MGF2_CANTT/703-819--------------------------------------------------------------------------------
A7S279_NEMVE/566-681--------------------------------------------------------------------------------
E5STY8_TRISP/976-1085--------------------------------------------------------------------------------
F9WW59_ZYMTI/306-422--------------------------------------------------------------------------------
S3BUU6_OPHP1/912-1029--------------------------------------------------------------------------------
F2U5I3_SALR5/965-1082--------------------------------------------------------------------------------
K7H8T9_CAEJA/525-647--------------------------------------------------------------------------------
G2WWA7_VERDV/450-561--------------------------------------------------------------------------------
Q75C92_ASHGO/595-713--------------------------------------------------------------------------------
Q17CT3_AEDAE/942-1053--------------------------------------------------------------------------------
H2ARE2_KAZAF/619-733--------------------------------------------------------------------------------
C3ZX35_BRAFL/216-331--------------------------------------------------------------------------------
A8Q4L8_MALGO/619-735--------------------------------------------------------------------------------
B6JVB4_SCHJY/640-754--------------------------------------------------------------------------------
M7TCG9_EUTLA/559-676--------------------------------------------------------------------------------
G3NGW3_GASAC/357-472--------------------------------------------------------------------------------
A9V4B2_MONBE/210-323--------------------------------------------------------------------------------
G3WFA8_SARHA/54-171--------------------------------------------------------------------------------
G1KGF4_ANOCA/537-652--------------------------------------------------------------------------------
F4X6N0_ACREC/597-712--------------------------------------------------------------------------------
G3WAG3_SARHA/506-619--------------------------------------------------------------------------------
G4UK54_NEUT9/327-448--------------------------------------------------------------------------------
H3G127_PRIPA/946-1056--------------------------------------------------------------------------------
F4PW61_DICFS/518-627--------------------------------------------------------------------------------
G4TVY5_PIRID/719-847--------------------------------------------------------------------------------
M4A2J9_XIPMA/503-618--------------------------------------------------------------------------------
A0A0D2WK99_CAPO3/887-1002--------------------------------------------------------------------------------
H0ZQ48_TAEGU/377-492--------------------------------------------------------------------------------
E4UYL4_ARTGP/377-489--------------------------------------------------------------------------------
W5KFU3_ASTMX/71-182--------------------------------------------------------------------------------
F8QEC8_SERL3/510-622--------------------------------------------------------------------------------
G8YRD2_PICSO/652-768--------------------------------------------------------------------------------
H6BNY9_EXODN/314-431--------------------------------------------------------------------------------
N1Q1A9_DOTSN/804-922--------------------------------------------------------------------------------
D3BQ91_POLPA/553-667--------------------------------------------------------------------------------
V2XG66_MONRO/249-363--------------------------------------------------------------------------------
G2XH69_VERDV/316-433--------------------------------------------------------------------------------
G9P5U2_HYPAI/366-478--------------------------------------------------------------------------------
F4S5V3_MELLP/586-701--------------------------------------------------------------------------------
G3NDC5_GASAC/480-595--------------------------------------------------------------------------------
G3Y1M7_ASPNA/321-433--------------------------------------------------------------------------------
V8NBX9_OPHHA/517-632--------------------------------------------------------------------------------
M2NIY8_BAUCO/658-779--------------------------------------------------------------------------------
E9F491_METRA/362-474--------------------------------------------------------------------------------
B2APA5_PODAN/327-447--------------------------------------------------------------------------------
U1NK79_ASCSU/575-691--------------------------------------------------------------------------------
T5AMI8_OPHSC/302-414--------------------------------------------------------------------------------
B7Q2N6_IXOSC/514-630--------------------------------------------------------------------------------
A0A098DQ28_GIBZA/358-468--------------------------------------------------------------------------------
C3ZUS9_BRAFL/419-534--------------------------------------------------------------------------------
F7BFD4_HORSE/377-492--------------------------------------------------------------------------------
C4R8N7_PICPG/562-681--------------------------------------------------------------------------------
B6HG38_PENRW/308-420--------------------------------------------------------------------------------
A7RPT6_NEMVE/607-722--------------------------------------------------------------------------------
G7PV15_MACFA/479-594--------------------------------------------------------------------------------
G1KDV8_ANOCA/504-618--------------------------------------------------------------------------------
F6V4E2_XENTR/493-608--------------------------------------------------------------------------------
E4Y2H6_OIKDI/537-648--------------------------------------------------------------------------------
B5YNJ7_THAPS/196-310--------------------------------------------------------------------------------
E3RKS1_PYRTT/745-863--------------------------------------------------------------------------------
C5GIH2_AJEDR/773-890--------------------------------------------------------------------------------
Q6CD33_YARLI/707-821--------------------------------------------------------------------------------
E3QFQ0_COLGM/792-909--------------------------------------------------------------------------------
Q8IJR0_PLAF7/979-1086--------------------------------------------------------------------------------
H3B651_LATCH/510-624--------------------------------------------------------------------------------
B8JLR7_DANRE/165-276--------------------------------------------------------------------------------
L2GAB8_COLGN/486-597--------------------------------------------------------------------------------
Q6FY00_CANGA/576-698--------------------------------------------------------------------------------
H2MWG8_ORYLA/509-623--------------------------------------------------------------------------------
L2FNL9_COLGN/331-443--------------------------------------------------------------------------------
F4PW60_DICFS/469-579--------------------------------------------------------------------------------
A0A0C4DV60_MAGP6/840-957--------------------------------------------------------------------------------
W4Y1W0_STRPU/441-553--------------------------------------------------------------------------------
N1Q7T0_PSEFD/249-360--------------------------------------------------------------------------------
G1X2N7_ARTOA/734-851--------------------------------------------------------------------------------
J3PD85_GAGT3/457-567--------------------------------------------------------------------------------
J9FJP4_WUCBA/677-792--------------------------------------------------------------------------------
E4WY87_OIKDI/494-609--------------------------------------------------------------------------------
G0RQN5_HYPJQ/375-487--------------------------------------------------------------------------------
E5S0V3_TRISP/556-672--------------------------------------------------------------------------------
E9HCC3_DAPPU/480-597--------------------------------------------------------------------------------
G4U8M0_NEUT9/388-500--------------------------------------------------------------------------------
H3A2R7_LATCH/432-547--------------------------------------------------------------------------------
G0S1B2_CHATD/408-522--------------------------------------------------------------------------------
G0VE13_NAUCC/579-693--------------------------------------------------------------------------------
U1LYV5_ASCSU/529-640--------------------------------------------------------------------------------
F2TW56_SALR5/229-338--------------------------------------------------------------------------------
H2S9Y1_TAKRU/516-631--------------------------------------------------------------------------------
A4I027_LEIIN/518-635--------------------------------------------------------------------------------
A4I5X4_LEIIN/479-593--------------------------------------------------------------------------------
J7S7W7_KAZNA/613-728--------------------------------------------------------------------------------
I3LUM3_PIG/517-632--------------------------------------------------------------------------------
Q2GUM5_CHAGB/309-422--------------------------------------------------------------------------------
E7F646_DANRE/482-596--------------------------------------------------------------------------------
R1G5R1_BOTPV/762-880--------------------------------------------------------------------------------
B7P6Q6_IXOSC/455-570--------------------------------------------------------------------------------
C7YZS5_NECH7/344-456--------------------------------------------------------------------------------
E5S7A2_TRISP/292-403--------------------------------------------------------------------------------
T5AHM7_OPHSC/836-953--------------------------------------------------------------------------------
W5K5D9_ASTMX/504-619--------------------------------------------------------------------------------
V2XVI5_MONRO/531-646--------------------------------------------------------------------------------
A7TR21_VANPO/594-716--------------------------------------------------------------------------------
H6BSD8_EXODN/761-878--------------------------------------------------------------------------------
G1SZX7_RABIT/565-680--------------------------------------------------------------------------------
W5NED0_LEPOC/303-418--------------------------------------------------------------------------------
H2Y8L4_CIOSA/418-534--------------------------------------------------------------------------------
F6QRY0_ORNAN/482-597--------------------------------------------------------------------------------
W5K097_ASTMX/925-1036--------------------------------------------------------------------------------
R4GLW0_CHICK/523-638--------------------------------------------------------------------------------
M7XIS4_RHOT1/672-788--------------------------------------------------------------------------------
C4Y529_CLAL4/632-746--------------------------------------------------------------------------------
N1PRW4_DOTSN/309-425--------------------------------------------------------------------------------
K1PD91_CRAGI/941-1059--------------------------------------------------------------------------------
H0ZM24_TAEGU/68-179--------------------------------------------------------------------------------
G4MWU9_MAGO7/371-483--------------------------------------------------------------------------------
Q5QIB9_STRPU/495-609--------------------------------------------------------------------------------
S3CY83_OPHP1/495-607--------------------------------------------------------------------------------
A0A0D2UAN0_CAPO3/1229-1344--------------------------------------------------------------------------------
A0A0D2VPS8_CAPO3/838-953--------------------------------------------------------------------------------
U9U0Y0_RHIID/792-909--------------------------------------------------------------------------------
K1VS91_TRIAC/657-769--------------------------------------------------------------------------------
A4HCK9_LEIBR/443-560--------------------------------------------------------------------------------
F1QJ13_DANRE/490-604--------------------------------------------------------------------------------
G9MGY4_HYPVG/754-871--------------------------------------------------------------------------------
R4GHY9_CHICK/479-594--------------------------------------------------------------------------------
G7DTU8_MIXOS/579-693--------------------------------------------------------------------------------
U1HPN2_ENDPU/378-490--------------------------------------------------------------------------------
T1K2W1_TETUR/963-1075--------------------------------------------------------------------------------
I4YJJ0_WALMC/187-305--------------------------------------------------------------------------------
F0XQ81_GROCL/442-554--------------------------------------------------------------------------------
U4LP91_PYROM/778-895--------------------------------------------------------------------------------
C1MLD2_MICPC/347-455--------------------------------------------------------------------------------
M3ZIE9_XIPMA/486-601--------------------------------------------------------------------------------
D8Q686_SCHCM/514-628--------------------------------------------------------------------------------
E0V9R3_PEDHC/981-1097--------------------------------------------------------------------------------
Q7ZZ38_DANRE/570-685--------------------------------------------------------------------------------
S3CK06_OPHP1/317-437--------------------------------------------------------------------------------
I1FVA6_AMPQE/653-769--------------------------------------------------------------------------------
G2QE78_MYCTT/369-481--------------------------------------------------------------------------------
F9X062_ZYMTI/294-423--------------------------------------------------------------------------------
B3S5L7_TRIAD/600-715--------------------------------------------------------------------------------
U7PMJ4_SPOS1/852-970--------------------------------------------------------------------------------
K1R906_CRAGI/339-447--------------------------------------------------------------------------------
Q6CSI9_KLULA/623-738--------------------------------------------------------------------------------
N1JC99_BLUG1/775-892--------------------------------------------------------------------------------
A0A0D2U0B6_CAPO3/640-755--------------------------------------------------------------------------------
F1R8S3_DANRE/484-599--------------------------------------------------------------------------------
C5DWX3_ZYGRC/549-664--------------------------------------------------------------------------------
J3P931_GAGT3/353-465--------------------------------------------------------------------------------
G8ZY68_TORDC/585-700--------------------------------------------------------------------------------
J9EUZ4_WUCBA/174-288--------------------------------------------------------------------------------
J9JQK0_ACYPI/173-289--------------------------------------------------------------------------------
T1FX15_HELRO/212-327--------------------------------------------------------------------------------
PLC1_SCHPO/638-752--------------------------------------------------------------------------------
I4Y9T4_WALMC/324-435--------------------------------------------------------------------------------
A7RXP6_NEMVE/450-565--------------------------------------------------------------------------------
M1WD50_CLAP2/329-446--------------------------------------------------------------------------------
C7YLY8_NECH7/448-559--------------------------------------------------------------------------------
E4ZW47_LEPMJ/391-503--------------------------------------------------------------------------------
T1JBA8_STRMM/526-641--------------------------------------------------------------------------------
H2Z2T5_CIOSA/481-594--------------------------------------------------------------------------------
G3B2Z3_CANTC/553-668--------------------------------------------------------------------------------
F0Z941_DICPU/560-673--------------------------------------------------------------------------------
F6XYJ8_XENTR/524-634--------------------------------------------------------------------------------
R8BH76_TOGMI/661-777--------------------------------------------------------------------------------
G2Q018_MYCTT/394-509--------------------------------------------------------------------------------
I3JP81_ORENI/305-420--------------------------------------------------------------------------------
C6HRC6_AJECH/378-490--------------------------------------------------------------------------------
B0D2M8_LACBS/202-309--------------------------------------------------------------------------------
Q1LWW2_DANRE/15-130--------------------------------------------------------------------------------
T1GAZ8_MEGSC/275-385--------------------------------------------------------------------------------
F6Y1S7_CIOIN/466-581--------------------------------------------------------------------------------
K5XNX9_AGABU/250-367--------------------------------------------------------------------------------
N1QL86_SPHMS/786-905--------------------------------------------------------------------------------
Q385H1_TRYB2/453-569--------------------------------------------------------------------------------
C1FE07_MICSR/227-338--------------------------------------------------------------------------------
E3MQ20_CAERE/991-1101--------------------------------------------------------------------------------
Q2HB23_CHAGB/790-904--------------------------------------------------------------------------------
F7FGQ0_MONDO/286-401--------------------------------------------------------------------------------
F6ZK74_CIOIN/369-484--------------------------------------------------------------------------------
H2URW7_TAKRU/209-324--------------------------------------------------------------------------------
A3LSB2_PICST/670-786--------------------------------------------------------------------------------
A0A0D2WHU8_CAPO3/922-1038--------------------------------------------------------------------------------
C3Z9I4_BRAFL/477-593--------------------------------------------------------------------------------
H2SZT3_TAKRU/428-542--------------------------------------------------------------------------------
N1Q9A1_PSEFD/659-776--------------------------------------------------------------------------------
B7S3T2_PHATC/601-716--------------------------------------------------------------------------------
W5KFE6_ASTMX/490-605--------------------------------------------------------------------------------
Q2H4G2_CHAGB/405-520--------------------------------------------------------------------------------
F2UPR8_SALR5/1185-1317--------------------------------------------------------------------------------
Q6BZ51_DEBHA/662-778--------------------------------------------------------------------------------
S0ELB2_GIBF5/852-959--------------------------------------------------------------------------------
L5LI27_MYODS/450-565--------------------------------------------------------------------------------
A9VD11_MONBE/1221-1335--------------------------------------------------------------------------------
K0KL98_WICCF/623-739--------------------------------------------------------------------------------
T1G934_HELRO/199-314--------------------------------------------------------------------------------
T1G0G0_HELRO/196-307--------------------------------------------------------------------------------
G3JGE5_CORMM/284-396--------------------------------------------------------------------------------
A0A0C4ERW5_PUCT1/563-680--------------------------------------------------------------------------------
G7XNJ5_ASPKW/783-900--------------------------------------------------------------------------------
M4AIZ6_XIPMA/499-613--------------------------------------------------------------------------------
M7SX13_EUTLA/137-249--------------------------------------------------------------------------------
T1IHK2_STRMM/849-956--------------------------------------------------------------------------------
R8BQP0_TOGMI/129-239--------------------------------------------------------------------------------
E9GUG0_DAPPU/494-609--------------------------------------------------------------------------------
R4GB63_ANOCA/369-484--------------------------------------------------------------------------------
I2GWJ1_TETBL/468-586--------------------------------------------------------------------------------
H3B2C6_LATCH/424-539--------------------------------------------------------------------------------
M3D9Q9_SPHMS/307-425--------------------------------------------------------------------------------
K1V4M8_TRIAC/283-399--------------------------------------------------------------------------------
W4Y2J6_STRPU/402-517--------------------------------------------------------------------------------
J5JN06_BEAB2/465-578--------------------------------------------------------------------------------
F7C6V1_CALJA/70-183--------------------------------------------------------------------------------
G3AVU0_SPAPN/619-735--------------------------------------------------------------------------------
S0EHF9_GIBF5/987-1097--------------------------------------------------------------------------------
G4TAH9_PIRID/235-351--------------------------------------------------------------------------------
G4NDT3_MAGO7/323-447--------------------------------------------------------------------------------
V8PE75_OPHHA/356-482--------------------------------------------------------------------------------
A9VBY6_MONBE/623-741--------------------------------------------------------------------------------
A0A016Q5G1_GIBZA/774-890--------------------------------------------------------------------------------
A0A0D2X2F7_CAPO3/1560-1674--------------------------------------------------------------------------------
E3QYT0_COLGM/329-441--------------------------------------------------------------------------------
V8PDH0_OPHHA/598-706--------------------------------------------------------------------------------
M1VXY3_CLAP2/500-610--------------------------------------------------------------------------------
H2ZU78_LATCH/223-338--------------------------------------------------------------------------------
H6C734_EXODN/365-479--------------------------------------------------------------------------------
B7FP63_PHATC/607-714--------------------------------------------------------------------------------
N1J7Z3_BLUG1/388-499--------------------------------------------------------------------------------
C7Z5S0_NECH7/888-1002--------------------------------------------------------------------------------
W5M435_LEPOC/940-1052--------------------------------------------------------------------------------
A8PDD5_COPC7/582-696--------------------------------------------------------------------------------
A7SDH9_NEMVE/403-518--------------------------------------------------------------------------------
M3HJN1_CANMX/678-794--------------------------------------------------------------------------------
G5BJ13_HETGA/521-638--------------------------------------------------------------------------------
U4L657_PYROM/279-397--------------------------------------------------------------------------------
R4XC63_TAPDE/590-708--------------------------------------------------------------------------------
M2R750_COCSN/398-510--------------------------------------------------------------------------------
B4JKL8_DROGR/976-1087--------------------------------------------------------------------------------
T1FQR0_HELRO/789-897--------------------------------------------------------------------------------
E9CUF5_COCPS/374-486--------------------------------------------------------------------------------
D8QLF1_SCHCM/503-623--------------------------------------------------------------------------------
I3K2K2_ORENI/545-660--------------------------------------------------------------------------------
G1X1C4_ARTOA/269-381--------------------------------------------------------------------------------
F7A0G1_CIOIN/490-605--------------------------------------------------------------------------------
T1KSZ4_TETUR/201-315--------------------------------------------------------------------------------
H9ITM0_BOMMO/938-1054--------------------------------------------------------------------------------
H2ZTT6_LATCH/71-184--------------------------------------------------------------------------------
I1GJ67_AMPQE/603-717--------------------------------------------------------------------------------
G4NJD0_MAGO7/442-555--------------------------------------------------------------------------------
T1HV24_RHOPR/962-1078--------------------------------------------------------------------------------
C5DES3_LACTC/577-692--------------------------------------------------------------------------------
A7SXK4_NEMVE/280-395--------------------------------------------------------------------------------
H0ES44_GLAL7/715-832--------------------------------------------------------------------------------
M7SPN2_EUTLA/327-448--------------------------------------------------------------------------------
F7B628_XENTR/933-1046--------------------------------------------------------------------------------
B2AUG0_PODAN/415-528--------------------------------------------------------------------------------

PF03009

GLPQ_ECOLI/36-350......SDFRVHTFEEEIEF........VQGLNHSTGKNIGIYPEIKAPWFH.HQEGKDIAAKTLEVLKK...YGYTGKD
E7KVC5_YEASL/7-246...........EILTWAVCH.........PGAKLMLDIKFTNEKIIMIKTFVIMLEVKNDLKFWQERITW...GLWLLDW
O07244_MYCTU/14-242...........TALPDMR...........VNIDIKAASAIEPTVNVIERCN...AHNRVLIGSFSERR........RRRA
GLPQ1_MYCTU/17-259........TSLLTLDALVSLV......LDWHRPVKIFVETKHPVRYGSLVE....NKLLALLHRFGIAAP....AS.ADR
UGPQ_ECOLI/12-239...........PLLSQVAER........CREHGMMANIEIKPTTGTGPLTG...KMVALAARELWAG..........MTP
Q45201_BORHE/38-330......HDFKIPTLEEEIQF........IQGLNKSTGRNVGIYPEIKKPLWH.KQQGKDISKIVIEILNK...YGYKSKE
GLPQ_HAEIN/40-355......SHFRIHTFEDEIEF........IQGLEKSTGKKVGIYPEIKAPWFH.HQNGKDIATETLKVLKK...YGYDKKT
Q9RKX8_STRCO/20-243...........ETFPAVR...........WNVDVKAEPALEPLLELIGRHN...AWDRICVGSFSEAR........VVRA
YQIK_BACSU/7-235...........PLLEDVLS..........WAVKKDFLINIELKNSVIRYEG....MEEKVLEAVKRFN..........VE
GLPQ_BACSU/43-285.......GLKVPTLEEVLDR.........FGKHANYYIETKSPDTYPGMEEK..LIASLQKHKLLGKH.........SKP
GDE1_YEAST/877-1212NARGHSIASSFVTLKELFKK.......IPANVGFNIECKFPMLDEAEEEELG..QIMMEMNHWVDTVLKV...VFDNANG
O02322_CAEEL/73-322...........HCVANNIMM........IWDVKNVDENLLKQFVIQIRTYN...LYSKVLVSGFNPIDTY...LVKMADP
PGC1_SCHPO/37-267...........PTYEQFLHE.......LTKHPGVNLLVDIKPVNDLLIIPR....MVDAMLRVNSDLD.........FWK
O86738_STRCO/16-227..........VPTLAEALAA.........TDGARLMLDLPGGPGERAVRRVV..DVVRECGARDRVYY............
GPCP2_CAEEL/406-706......DFKPFPTLLEALTK.......VDPDVGFNVEVKYPMMQNNGEHEC...DHYFERNLFVDVILAD...VMKHAGN
GPCP1_CAEEL/349-649.....ELHVPFPSLAQVLRH.......VDENVGLNIEIKYPMYMQDGSHEC...QGYFEQNKFVDIILAE...VAEHAGN
Q3BZN0_XANC5/274-516...........KTDQTIAGV.........EQMLEHVLKKPEPMSVALDCKENTGEAVAMLLMRRPDLR........KAAA
Q89384_PBCV1/5-217...........PTLNQVLDE.........FKDEYTYDIEIKSSDTASAVVET...IQKSNIPYENTLV..........T.
GDE1_SCHPO/752-1061.........PFTTLKDVLKE.......VPQSVGLNVEFKYPMLSEAEEEKLL..PIAYDYNFYVDTILSI...IKKYGGK
Q9RSP0_DEIRA/37-277..........VAQLKDVLR..........EFPNTPLIIELKQASPSIAAPFC.AELRRAGATGRVIAAS.......FSDA
Q9RWX3_DEIRA/7-220...........PTLPEVLA..........WAVDCEAYVNLELKWESPLPDD....RVVRMLDSIRVHG..........LS
Q9RZL4_DEIRA/249-566........FTVPTLEEIIAL........VRDVEAKTGRKVGIYPETKHPTYMAEVAKVNTSQLLIDTLKR....LNFTDP
GDPD6_ARATH/49-357........FPIITFDEYISIAL....DAPRVVGIYPEIKNPVFMNQQVKWADGKKFEDKFVETLKKYGYKGSYLSEDWLK
GDPD1_ARATH/39-318.....ATDDSFCTLQEAFEKV......ENPNLGFNIELKLDDNVFYSSDHLS..RLLLPILQVVSDIG..........ND
Q9UAW8_CAEEL/68-331......SRERVPDMEDVVKWAVENNTRMLFDVKDSDNELVDQIANLFQKYN...LYDKAIVCSFFPWVVY...RIKKGDQ
Q9VQU3_DROME/375-661.......HQPFPQLCDVLDA.......LDVHVGFNIEIKWSQRLEDGKMEEE.FEHVVDRNLYIDCILDV...ILRKAGN
Q9W2L6_DROME/349-632.......QRLFPTLQDFFER.......VNLSTGFDIEIKWPQQRADGLFES...EQTLDKNLFADRILAV...VRRHGCG
Q9X1V6_THEMA/6-217............TLKEVFEN.........VSDDKIINIEIKEREAADAVLEI...SKKRKNLIFSSFD............
Q9YFI4_AERPE/15-220...........PLYKPMP...........LANWLERLWSMGFTKVVIDVKSG..GIDPTLLASEVERG..........WP
Q9ZTU6_WHEAT/118-414......NAGKFMRLSDFLAF.........AKGEDLSGIMITVEHASFMAEKLGFGVVDAVIKAVDDSGY......SKQTA

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393-----------------------------------------------------------------------------..R
A4I5X4_LEIIN/300-441-----------------------------------------------------------------------------..G
Q8IJR0_PLAF7/626-770-----------------------------------------------------------------------------FYG
Q6BZ51_DEBHA/455-607-----------------------------------------------------------------------------..G
PLCG2_MOUSE/314-457-----------------------------------------------------------------------------..G
PLCL1_HUMAN/400-543-----------------------------------------------------------------------------..R
PLCD9_ARATH/109-254-----------------------------------------------------------------------------..K
PLCD1_ARATH/107-250-----------------------------------------------------------------------------..G
PLCD6_ARATH/139-282-----------------------------------------------------------------------------..G
A5DAA1_PICGU/440-595-----------------------------------------------------------------------------..G
PLCD4_RAT/292-436-----------------------------------------------------------------------------..G
PLCZ1_BOVIN/157-300-----------------------------------------------------------------------------..G
PLCD3_ARATH/108-251-----------------------------------------------------------------------------..G
A5E691_LODEL/21-192-----------------------------------------------------------------------------..G
Q16W08_AEDAE/315-464-----------------------------------------------------------------------------..G
PLCD5_ARATH/114-257-----------------------------------------------------------------------------..G
Q5QIB9_STRPU/301-444-----------------------------------------------------------------------------..G
Q6CSI9_KLULA/402-540-----------------------------------------------------------------------------..G
PLCD3_HUMAN/339-483-----------------------------------------------------------------------------..G
Q385H1_TRYB2/248-393-----------------------------------------------------------------------------..G
Q16ZC0_AEDAE/42-189-----------------------------------------------------------------------------..G
PLCH1_HUMAN/301-445-----------------------------------------------------------------------------..G
A2QEJ2_ASPNC/86-262-----------------------------------------------------------------------------..G
Q4N7P5_THEPA/468-615-----------------------------------------------------------------------------WKN
A7S279_NEMVE/319-466-----------------------------------------------------------------------------..G
PLC_DICDI/324-466-----------------------------------------------------------------------------..G
Q5BFL6_EMENI/534-676-----------------------------------------------------------------------------..G
Q2HB23_CHAGB/553-696-----------------------------------------------------------------------------..G
A6RBI2_AJECN/84-320-----------------------------------------------------------------------------..G
A0CKY8_PARTE/271-413-----------------------------------------------------------------------------..G
E9AEI1_LEIMA/296-447-----------------------------------------------------------------------------..G
Q9XWB7_CAEEL/306-468-----------------------------------------------------------------------------..G
Q8IA75_CAEEL/367-517-----------------------------------------------------------------------------..G
PLC1_YEAST/382-521-----------------------------------------------------------------------------..G
PLCE1_HUMAN/1394-1541-----------------------------------------------------------------------------..G
A7RXP6_NEMVE/244-393-----------------------------------------------------------------------------..G
Q7QHE3_ANOGA/319-462-----------------------------------------------------------------------------..G
A0BLC4_PARTE/285-429-----------------------------------------------------------------------------..G
Q6FY00_CANGA/381-519-----------------------------------------------------------------------------..G
A0BLM0_PARTE/262-404-----------------------------------------------------------------------------..G
Q59LC4_CANAL/566-727-----------------------------------------------------------------------------..G
Q2UPV6_ASPOR/98-321-----------------------------------------------------------------------------..G
A7T501_NEMVE/158-302-----------------------------------------------------------------------------..G
A7ASE0_BABBO/522-670-----------------------------------------------------------------------------WKN
A0A0D1CR16_USTMA/724-872-----------------------------------------------------------------------------..G
A7TR21_VANPO/381-520-----------------------------------------------------------------------------..S
Q75C92_ASHGO/397-535-----------------------------------------------------------------------------..G
A7RPQ0_NEMVE/307-450-----------------------------------------------------------------------------..G
A7SXK4_NEMVE/94-237-----------------------------------------------------------------------------..G
A4S165_OSTLU/1-153-----------------------------------------------------------------------------..G
Q7PW25_ANOGA/289-436-----------------------------------------------------------------------------..G
A7RKT2_NEMVE/272-413-----------------------------------------------------------------------------..G
A3LSB2_PICST/461-615-----------------------------------------------------------------------------..G
A3LNB7_PICST/20-167-----------------------------------------------------------------------------..G
PLCH2_HUMAN/328-472-----------------------------------------------------------------------------..G
Q0UVV5_PHANO/116-337-----------------------------------------------------------------------------..G
Q4QBH9_LEIMA/195-340-----------------------------------------------------------------------------..G
Q0UE70_PHANO/101-258-----------------------------------------------------------------------------..G
PLCL2_MOUSE/429-572-----------------------------------------------------------------------------..G
PLCZ1_CHICK/159-303-----------------------------------------------------------------------------..G
Q2GUM5_CHAGB/104-264-----------------------------------------------------------------------------..G
Q21754_CAEEL/318-461-----------------------------------------------------------------------------..K
A7SDH9_NEMVE/209-352-----------------------------------------------------------------------------..G
A4HCK9_LEIBR/248-393-----------------------------------------------------------------------------..G
PLC1_SCHPO/443-585-----------------------------------------------------------------------------..G
Q013R6_OSTTA/119-269-----------------------------------------------------------------------------..G
Q75IL8_ORYSJ/119-262-----------------------------------------------------------------------------..G
PLCD8_ARATH/107-248-----------------------------------------------------------------------------..S
Q6CD33_YARLI/505-648-----------------------------------------------------------------------------..G
A7UXE0_NEUCR/118-273-----------------------------------------------------------------------------..G
A9RJG9_PHYPA/150-293-----------------------------------------------------------------------------..G
A9SXU1_PHYPA/108-250-----------------------------------------------------------------------------..G
B4H106_DROPE/328-471-----------------------------------------------------------------------------..G
B6C9K2_SOLLC/110-252-----------------------------------------------------------------------------..G
B6KHA6_TOXGO/407-549-----------------------------------------------------------------------------VGG
E9QD74_DANRE/316-459-----------------------------------------------------------------------------..G
F1R8S3_DANRE/294-437-----------------------------------------------------------------------------..G
F6HKS4_VITVI/112-254-----------------------------------------------------------------------------..G
F7DT82_CALJA/159-308-----------------------------------------------------------------------------..G
G3GVA5_CRIGR/324-467-----------------------------------------------------------------------------..G
G3UXP4_MOUSE/322-465-----------------------------------------------------------------------------..G
G4UMR8_NEUT9/110-362-----------------------------------------------------------------------------..G
PLCB_CAEEL/342-492-----------------------------------------------------------------------------..G
H2SZT5_TAKRU/30-172-----------------------------------------------------------------------------..G
H2USZ2_TAKRU/343-506-----------------------------------------------------------------------------..H
H3CD03_TETNG/306-449-----------------------------------------------------------------------------..G
H3CYP8_TETNG/287-430-----------------------------------------------------------------------------..G
H3D277_TETNG/321-464-----------------------------------------------------------------------------..G
H3D2C1_TETNG/321-464-----------------------------------------------------------------------------..G
H3D5C7_TETNG/314-459-----------------------------------------------------------------------------..G
H3DBV7_TETNG/298-442-----------------------------------------------------------------------------..G
H3DF29_TETNG/89-233-----------------------------------------------------------------------------..G
H3DK53_TETNG/325-468-----------------------------------------------------------------------------..G
I1R783_ORYGL/114-256-----------------------------------------------------------------------------..G
K4A9N8_SETIT/153-295-----------------------------------------------------------------------------..G
M1BNL7_SOLTU/113-255-----------------------------------------------------------------------------..G
M1CL37_SOLTU/111-252-----------------------------------------------------------------------------..G
M4FG24_BRARP/66-209-----------------------------------------------------------------------------..G
PLCB2_RAT/314-464-----------------------------------------------------------------------------..G
PLC_LISMO/61-198-----------------------------------------------------------------------------..G
PLCB3_MOUSE/319-469-----------------------------------------------------------------------------..G
Q236T7_TETTS/331-475-----------------------------------------------------------------------------..G
PLC_STAA8/51-192-----------------------------------------------------------------------------..G
Q4DUP6_TRYCC/248-392-----------------------------------------------------------------------------..G
Q4WX21_ASPFU/96-334-----------------------------------------------------------------------------..G
Q5A0L4_CANAL/21-164-----------------------------------------------------------------------------..G
Q7SE08_NEUCR/136-356-----------------------------------------------------------------------------..H
Q81A32_BACCR/58-194-----------------------------------------------------------------------------..G
PLCD4_ARATH/116-257-----------------------------------------------------------------------------..G
W4XJU2_STRPU/318-467-----------------------------------------------------------------------------..G

PF00387

Q5KJZ5_CRYNJ/446-558----------------------------------------------------------------..KVD...........
F1QS56_DANRE/608-720----------------------------------------------------------------..AER...........
F1RBD7_DANRE/510-625----------------------------------------------------------------..ANA...........
G8BKQ6_CANPC/644-760----------------------------------------------------------------....DEVKK....TSL
A7RPQ0_NEMVE/492-607----------------------------------------------------------------..PEE...........
F2ULH4_SALR5/541-656----------------------------------------------------------------..PEE...........
G4VBK4_SCHMA/531-646----------------------------------------------------------------..AIE...........
S0DQT6_GIBF5/306-423----------------------------------------------------------------....HASH.......I
E9GFR8_DAPPU/479-594----------------------------------------------------------------..RSS...........
G0WGC6_NAUDC/598-716----------------------------------------------------------------....DKSLN....LSI
L0PAS0_PNEJ8/47-161----------------------------------------------------------------.....KNSK....TQL
K0R6H0_THAOC/569-682----------------------------------------------------------------..CDQ...........
I3JX91_ORENI/928-1039----------------------------------------------------------------..TKD...........
I3K883_ORENI/523-637----------------------------------------------------------------..PED...........
E2BGZ2_HARSA/531-646----------------------------------------------------------------..SVE...........
J3K909_COCIM/769-886----------------------------------------------------------------....DSENK....ALL
I1G7J0_AMPQE/80-196----------------------------------------------------------------...GN...........
G8JQV5_ERECY/594-709----------------------------------------------------------------....DENQR....LAI
F6SF88_CIOIN/565-682----------------------------------------------------------------..AVN...........
G2R3P3_THITE/406-520----------------------------------------------------------------....DSTKV....HKL
F2U545_SALR5/2126-2244----------------------------------------------------------------.TAHA...........
PLC_DICDI/543-652----------------------------------------------------------------..PRE...........
B3SC97_TRIAD/538-653----------------------------------------------------------------..PTD...........
T1J420_STRMM/330-445----------------------------------------------------------------..LEK...........
E4XLQ6_OIKDI/964-1081----------------------------------------------------------------..VKS...........
A0A0D2XRJ6_FUSO4/781-897----------------------------------------------------------------....AKEQK....IAV
U7PV69_SPOS1/502-615----------------------------------------------------------------....HLKNH....EEL
A5DAA1_PICGU/648-764----------------------------------------------------------------....DEEKR....LSL
H2N2E2_ORYLA/491-606----------------------------------------------------------------..GAE...........
G8BYA3_TETPH/612-727----------------------------------------------------------------....DESLK....LSF
D7ELR5_TRICA/967-1083----------------------------------------------------------------...KF...........
A7SMY6_NEMVE/400-514----------------------------------------------------------------...KE...........
S7ZDD6_PENO1/368-480----------------------------------------------------------------....HMNQR....ERL
E9HXQ7_DAPPU/696-810----------------------------------------------------------------...QF...........
H0ZA90_TAEGU/543-658----------------------------------------------------------------..PMQ...........
F6S6B2_CIOIN/946-1058----------------------------------------------------------------...RI...........
F0XRH2_GROCL/838-956----------------------------------------------------------------....SREQR....RAV
G4N054_MAGO7/418-530----------------------------------------------------------------....HEKYG....QEL
T1KUP6_TETUR/217-327----------------------------------------------------------------.....LAS.......P
F6RLC5_XENTR/487-602----------------------------------------------------------------..GND...........
U1HY48_ENDPU/777-894----------------------------------------------------------------....DALSK....AQF
B7P4X9_IXOSC/943-1057----------------------------------------------------------------...SF...........
G2YC85_BOTF4/422-534----------------------------------------------------------------....HEQKR....EQM
L8FTI0_PSED2/766-883----------------------------------------------------------------....TPDTK....RAL
U3JVN7_FICAL/532-647----------------------------------------------------------------..GTS...........
I3L7K2_PIG/492-608----------------------------------------------------------------..GNS...........
H3BDF5_LATCH/514-630----------------------------------------------------------------..GNE...........
K5XX24_AGABU/562-680----------------------------------------------------------------.VLKN...........
H2SZT4_TAKRU/541-665----------------------------------------------------------------..TKE...........
H3CR59_TETNG/503-618----------------------------------------------------------------..ANE...........
H3A2I8_LATCH/834-950----------------------------------------------------------------...KK...........
R8BVG2_TOGMI/308-425----------------------------------------------------------------....FGDK.......I
W5MU43_LEPOC/512-627----------------------------------------------------------------..ASA...........
M2UIG2_COCH5/302-418----------------------------------------------------------------....NSAK.......I
S3DHJ9_GLAL2/313-430----------------------------------------------------------------....ASAK.......I
W1QFP3_OGAPD/592-708----------------------------------------------------------------....EEAKF....SAI
H2UH12_TAKRU/488-602----------------------------------------------------------------..PDH...........
L8FLM5_PSED2/482-594----------------------------------------------------------------....FAASP....NAL
H2YFJ0_CIOSA/524-639----------------------------------------------------------------..PMD...........
K7M553_SOYBN/345-454----------------------------------------------------------------.....ASES.....HG
F2U1Z4_SALR5/471-588----------------------------------------------------------------...DK...........
G3P4B1_GASAC/508-622----------------------------------------------------------------..GKL...........
R7YJ72_CONA1/333-445----------------------------------------------------------------....HESDP....RGL
N4UQ90_FUSC1/308-422----------------------------------------------------------------....DSQTR....TDL
D5GAP7_TUBMM/347-465----------------------------------------------------------------....HAQHA....ESI
A0A0C4DI92_FUSO4/284-405----------------------------------------------------------------.ISMENLER....NQL
K1WAI4_MARBU/420-532----------------------------------------------------------------....HETRQ....QEM
S8A7Z1_DACHA/271-383----------------------------------------------------------------....HEAQA....DAL
Q013R6_OSTTA/352-465----------------------------------------------------------------.....KIEK....ESS
K1PZR1_CRAGI/575-690----------------------------------------------------------------..PEE...........
Q9XWB7_CAEEL/528-650----------------------------------------------------------------.....ANSI....DKV
C9SV93_VERA1/293-405----------------------------------------------------------------....HEENS....KAL
A4S165_OSTLU/202-315----------------------------------------------------------------.....LVEK....SSQ
N1RC01_FUSC4/282-393----------------------------------------------------------------.....SVSH....TNL
C7ZJB8_NECH7/239-351----------------------------------------------------------------....DEADG....TGL
G0RBZ6_HYPJQ/342-459----------------------------------------------------------------....HAVA.......I
G7P2D3_MACFA/393-508----------------------------------------------------------------..GNE...........
D2VS67_NAEGR/554-665----------------------------------------------------------------................
A0A0J9XXP4_BRUMA/969-1079----------------------------------------------------------------....G...........
A1CJQ9_ASPCL/375-487----------------------------------------------------------------....YAKDA....HAL
H3A3M2_LATCH/610-722----------------------------------------------------------------..PED...........
Q21754_CAEEL/494-608----------------------------------------------------------------.....EAAV.....PI
E9G040_DAPPU/487-602----------------------------------------------------------------..PAM...........
V2Z343_MONRO/363-478----------------------------------------------------------------.TMVD...........
W4XRL3_STRPU/213-326----------------------------------------------------------------...KV...........
W5N0K4_LEPOC/507-620----------------------------------------------------------------..GTA...........
N1QLI7_SPHMS/293-404----------------------------------------------------------------....CEEQP....EKL
A0A0D1CR16_USTMA/993-1113----------------------------------------------------------------...EA...........
R7YQ07_CONA1/783-900----------------------------------------------------------------....DPATK....ELL
PLCZ1_CHICK/377-492----------------------------------------------------------------..ANQ...........
G1NLG3_MELGA/393-511----------------------------------------------------------------.....IKSP....LAA
H3ERT0_PRIPA/495-607----------------------------------------------------------------...A............
R1EKA9_BOTPV/390-502----------------------------------------------------------------....HQHFP....SEL
H3CZG1_TETNG/283-398----------------------------------------------------------------..PVE...........
T1G6Y6_HELRO/929-1047----------------------------------------------------------------...RT...........
N4VFU7_COLOR/301-417----------------------------------------------------------------....ASEK.......I
PLC1_YEAST/590-709----------------------------------------------------------------....DKHLK....LSL
Q4DUP6_TRYCC/458-575----------------------------------------------------------------..AME...........
F4NTE5_BATDJ/674-789----------------------------------------------------------------.....QKQR....DRL
F2TZD4_SALR5/1418-1533----------------------------------------------------------------..SDK...........
S3CWU2_GLAL2/446-558----------------------------------------------------------------....HSTRK....SDM
C5MGF2_CANTT/703-819----------------------------------------------------------------....DESTK....NQL
A7S279_NEMVE/566-681----------------------------------------------------------------..PLD...........
E5STY8_TRISP/976-1085----------------------------------------------------------------....D...........
F9WW59_ZYMTI/306-422----------------------------------------------------------------....SSPK.......I
S3BUU6_OPHP1/912-1029----------------------------------------------------------------....TRDSR....QSV
F2U5I3_SALR5/965-1082----------------------------------------------------------------GQAEA...........
K7H8T9_CAEJA/525-647----------------------------------------------------------------.....NNTV....DKV
G2WWA7_VERDV/450-561----------------------------------------------------------------....YATMQ....SAV
Q75C92_ASHGO/595-713----------------------------------------------------------------....DDLQR....LAI
Q17CT3_AEDAE/942-1053----------------------------------------------------------------...KL...........
H2ARE2_KAZAF/619-733----------------------------------------------------------------....DSVLS....CSL
C3ZX35_BRAFL/216-331----------------------------------------------------------------..AAD...........
A8Q4L8_MALGO/619-735----------------------------------------------------------------..HAD...........
B6JVB4_SCHJY/640-754----------------------------------------------------------------.....KSIY....PHL
M7TCG9_EUTLA/559-676----------------------------------------------------------------....NSDSK....TAL
G3NGW3_GASAC/357-472----------------------------------------------------------------..ATA...........
A9V4B2_MONBE/210-323----------------------------------------------------------------................
G3WFA8_SARHA/54-171----------------------------------------------------------------..SEQ...........
G1KGF4_ANOCA/537-652----------------------------------------------------------------..GNQ...........
F4X6N0_ACREC/597-712----------------------------------------------------------------..PLE...........
G3WAG3_SARHA/506-619----------------------------------------------------------------..GNS...........
G4UK54_NEUT9/327-448----------------------------------------------------------------....SSGNG....ASI
H3G127_PRIPA/946-1056----------------------------------------------------------------....G...........
F4PW61_DICFS/518-627----------------------------------------------------------------.TYS............
G4TVY5_PIRID/719-847----------------------------------------------------------------...DVKDSLKKSAHDS
M4A2J9_XIPMA/503-618----------------------------------------------------------------..PFE...........
A0A0D2WK99_CAPO3/887-1002----------------------------------------------------------------..AAD...........
H0ZQ48_TAEGU/377-492----------------------------------------------------------------..AKE...........
E4UYL4_ARTGP/377-489----------------------------------------------------------------....HEKER....QAL
W5KFU3_ASTMX/71-182----------------------------------------------------------------..GKL...........
F8QEC8_SERL3/510-622----------------------------------------------------------------..MLD...........
G8YRD2_PICSO/652-768----------------------------------------------------------------....DKEKE....VSI
H6BNY9_EXODN/314-431----------------------------------------------------------------....EIHR.......I
N1Q1A9_DOTSN/804-922----------------------------------------------------------------....NTDNK....ALL
D3BQ91_POLPA/553-667----------------------------------------------------------------..SGK...........
V2XG66_MONRO/249-363----------------------------------------------------------------.....FLH......HL
G2XH69_VERDV/316-433----------------------------------------------------------------....QSTH.......I
G9P5U2_HYPAI/366-478----------------------------------------------------------------....HEKQW....EAL
F4S5V3_MELLP/586-701----------------------------------------------------------------..STD...........
G3NDC5_GASAC/480-595----------------------------------------------------------------..GTD...........
G3Y1M7_ASPNA/321-433----------------------------------------------------------------....HATDG....DAL
V8NBX9_OPHHA/517-632----------------------------------------------------------------..PED...........
M2NIY8_BAUCO/658-779----------------------------------------------------------------....EAGEK....QAL
E9F491_METRA/362-474----------------------------------------------------------------....REKHA....QAL
B2APA5_PODAN/327-447----------------------------------------------------------------....NTAA.......I
U1NK79_ASCSU/575-691----------------------------------------------------------------..PIE...........
T5AMI8_OPHSC/302-414----------------------------------------------------------------....HERRV....PDL
B7Q2N6_IXOSC/514-630----------------------------------------------------------------.GARD...........
A0A098DQ28_GIBZA/358-468----------------------------------------------------------------....HEEQA....DAL
C3ZUS9_BRAFL/419-534----------------------------------------------------------------..AAD...........
F7BFD4_HORSE/377-492----------------------------------------------------------------..AQE...........
C4R8N7_PICPG/562-681----------------------------------------------------------------....EETKI....IAL
B6HG38_PENRW/308-420----------------------------------------------------------------....HANQR....DAL
A7RPT6_NEMVE/607-722----------------------------------------------------------------..ATQ...........
G7PV15_MACFA/479-594----------------------------------------------------------------..GNS...........
G1KDV8_ANOCA/504-618----------------------------------------------------------------..GTS...........
F6V4E2_XENTR/493-608----------------------------------------------------------------..GNK...........
E4Y2H6_OIKDI/537-648----------------------------------------------------------------..SQE...........
B5YNJ7_THAPS/196-310----------------------------------------------------------------...K............
E3RKS1_PYRTT/745-863----------------------------------------------------------------....GAREK....HLL
C5GIH2_AJEDR/773-890----------------------------------------------------------------....DSENK....ALL
Q6CD33_YARLI/707-821----------------------------------------------------------------....DPENR....EQM
E3QFQ0_COLGM/792-909----------------------------------------------------------------....SKEER....RAI
Q8IJR0_PLAF7/979-1086----------------------------------------------------------------................
H3B651_LATCH/510-624----------------------------------------------------------------..GHE...........
B8JLR7_DANRE/165-276----------------------------------------------------------------..PVP...........
L2GAB8_COLGN/486-597----------------------------------------------------------------....HTTKA....REM
Q6FY00_CANGA/576-698----------------------------------------------------------------....DAQVA....AAV
H2MWG8_ORYLA/509-623----------------------------------------------------------------..GVL...........
L2FNL9_COLGN/331-443----------------------------------------------------------------....QRRMP....RAL
F4PW60_DICFS/469-579----------------------------------------------------------------.TAS............
A0A0C4DV60_MAGP6/840-957----------------------------------------------------------------....PGDAK....RAL
W4Y1W0_STRPU/441-553----------------------------------------------------------------..AAD...........
N1Q7T0_PSEFD/249-360----------------------------------------------------------------....CEKKP....KEL
G1X2N7_ARTOA/734-851----------------------------------------------------------------....DKEKK....AQL
J3PD85_GAGT3/457-567----------------------------------------------------------------.....DAK......AI
J9FJP4_WUCBA/677-792----------------------------------------------------------------..APE...........
E4WY87_OIKDI/494-609----------------------------------------------------------------..SRA...........
G0RQN5_HYPJQ/375-487----------------------------------------------------------------....HDKFP....REV
E5S0V3_TRISP/556-672----------------------------------------------------------------..VTS...........
E9HCC3_DAPPU/480-597----------------------------------------------------------------..TAD...........
G4U8M0_NEUT9/388-500----------------------------------------------------------------....DKARL.....KI
H3A2R7_LATCH/432-547----------------------------------------------------------------..GSS...........
G0S1B2_CHATD/408-522----------------------------------------------------------------....DSHKL....HKV
G0VE13_NAUCC/579-693----------------------------------------------------------------....DNSLN....LSL
U1LYV5_ASCSU/529-640----------------------------------------------------------------.....EGGT.....TL
F2TW56_SALR5/229-338----------------------------------------------------------------.....RNGA....SSM
H2S9Y1_TAKRU/516-631----------------------------------------------------------------..PGD...........
A4I027_LEIIN/518-635----------------------------------------------------------------..HDA...........
A4I5X4_LEIIN/479-593----------------------------------------------------------------..RDE...........
J7S7W7_KAZNA/613-728----------------------------------------------------------------....DVPMR....LSV
I3LUM3_PIG/517-632----------------------------------------------------------------..PMQ...........
Q2GUM5_CHAGB/309-422----------------------------------------------------------------....HAPE.......I
E7F646_DANRE/482-596----------------------------------------------------------------..GSD...........
R1G5R1_BOTPV/762-880----------------------------------------------------------------....DSVSK....ELL
B7P6Q6_IXOSC/455-570----------------------------------------------------------------..PVE...........
C7YZS5_NECH7/344-456----------------------------------------------------------------....LDTHA....CEL
E5S7A2_TRISP/292-403----------------------------------------------------------------.....EENQ....PAM
T5AHM7_OPHSC/836-953----------------------------------------------------------------....TKEAK....MAL
W5K5D9_ASTMX/504-619----------------------------------------------------------------..ASA...........
V2XVI5_MONRO/531-646----------------------------------------------------------------..MKD...........
A7TR21_VANPO/594-716----------------------------------------------------------------....DTTQK....LAV
H6BSD8_EXODN/761-878----------------------------------------------------------------....SPEDK....AMF
G1SZX7_RABIT/565-680----------------------------------------------------------------..AIE...........
W5NED0_LEPOC/303-418----------------------------------------------------------------..GCE...........
H2Y8L4_CIOSA/418-534----------------------------------------------------------------..LKE...........
F6QRY0_ORNAN/482-597----------------------------------------------------------------..GTS...........
W5K097_ASTMX/925-1036----------------------------------------------------------------..PNE...........
R4GLW0_CHICK/523-638----------------------------------------------------------------..GNE...........
M7XIS4_RHOT1/672-788----------------------------------------------------------------...QD...........
C4Y529_CLAL4/632-746----------------------------------------------------------------....DDGKR....NAL
N1PRW4_DOTSN/309-425----------------------------------------------------------------....HSEK.......I
K1PD91_CRAGI/941-1059----------------------------------------------------------------...HF...........
H0ZM24_TAEGU/68-179----------------------------------------------------------------................
G4MWU9_MAGO7/371-483----------------------------------------------------------------....QRREP....GAF
Q5QIB9_STRPU/495-609----------------------------------------------------------------..PGD...........
S3CY83_OPHP1/495-607----------------------------------------------------------------....HAKHG....PAL
A0A0D2UAN0_CAPO3/1229-1344----------------------------------------------------------------..AVS...........
A0A0D2VPS8_CAPO3/838-953----------------------------------------------------------------..GKE...........
U9U0Y0_RHIID/792-909----------------------------------------------------------------..KQS...........
K1VS91_TRIAC/657-769----------------------------------------------------------------...SD...........
A4HCK9_LEIBR/443-560----------------------------------------------------------------..RDA...........
F1QJ13_DANRE/490-604----------------------------------------------------------------..GKL...........
G9MGY4_HYPVG/754-871----------------------------------------------------------------....SKTEK....SQL
R4GHY9_CHICK/479-594----------------------------------------------------------------..GPA...........
G7DTU8_MIXOS/579-693----------------------------------------------------------------................
U1HPN2_ENDPU/378-490----------------------------------------------------------------....HESDG....HAL
T1K2W1_TETUR/963-1075----------------------------------------------------------------...PA...........
I4YJJ0_WALMC/187-305----------------------------------------------------------------....DTRAL....ADV
F0XQ81_GROCL/442-554----------------------------------------------------------------....HAKDG....PAL
U4LP91_PYROM/778-895----------------------------------------------------------------....DSDKK....VAL
C1MLD2_MICPC/347-455----------------------------------------------------------------.....RKWA....LDK
M3ZIE9_XIPMA/486-601----------------------------------------------------------------..AAS...........
D8Q686_SCHCM/514-628----------------------------------------------------------------..MAR...........
E0V9R3_PEDHC/981-1097----------------------------------------------------------------...RF...........
Q7ZZ38_DANRE/570-685----------------------------------------------------------------..PTE...........
S3CK06_OPHP1/317-437----------------------------------------------------------------....NSAA.......I
I1FVA6_AMPQE/653-769----------------------------------------------------------------..PKE...........
G2QE78_MYCTT/369-481----------------------------------------------------------------....HEKSA....REL
F9X062_ZYMTI/294-423----------------------------------------------------------------....CEEHQ....EKV
B3S5L7_TRIAD/600-715----------------------------------------------------------------..PDE...........
U7PMJ4_SPOS1/852-970----------------------------------------------------------------....ARDYR....QAV
K1R906_CRAGI/339-447----------------------------------------------------------------..RDG...........
Q6CSI9_KLULA/623-738----------------------------------------------------------------....DETQK....LAI
N1JC99_BLUG1/775-892----------------------------------------------------------------....TPEDK....HAI
A0A0D2U0B6_CAPO3/640-755----------------------------------------------------------------..PSQ...........
F1R8S3_DANRE/484-599----------------------------------------------------------------..ATE...........
C5DWX3_ZYGRC/549-664----------------------------------------------------------------....DRIQE....LSI
J3P931_GAGT3/353-465----------------------------------------------------------------....QQKQP....VEF
G8ZY68_TORDC/585-700----------------------------------------------------------------....DKTQE....LSL
J9EUZ4_WUCBA/174-288----------------------------------------------------------------.....EITE.....SF
J9JQK0_ACYPI/173-289----------------------------------------------------------------...VF...........
T1FX15_HELRO/212-327----------------------------------------------------------------..LNG...........
PLC1_SCHPO/638-752----------------------------------------------------------------.....KAMV....PRL
I4Y9T4_WALMC/324-435----------------------------------------------------------------..SAE...........
A7RXP6_NEMVE/450-565----------------------------------------------------------------..PVE...........
M1WD50_CLAP2/329-446----------------------------------------------------------------....ESTA.......V
C7YLY8_NECH7/448-559----------------------------------------------------------------....HQKQH....RDM
E4ZW47_LEPMJ/391-503----------------------------------------------------------------....HSTNP....AGL
T1JBA8_STRMM/526-641----------------------------------------------------------------..PSA...........
H2Z2T5_CIOSA/481-594----------------------------------------------------------------..AGD...........
G3B2Z3_CANTC/553-668----------------------------------------------------------------....DETKQ....KSV
F0Z941_DICPU/560-673----------------------------------------------------------------..SKE...........
F6XYJ8_XENTR/524-634----------------------------------------------------------------..GIN...........
R8BH76_TOGMI/661-777----------------------------------------------------------------....SKVDK....RAL
G2Q018_MYCTT/394-509----------------------------------------------------------------....DESKL....HKV
I3JP81_ORENI/305-420----------------------------------------------------------------..GSD...........
C6HRC6_AJECH/378-490----------------------------------------------------------------....HENER....QAL
B0D2M8_LACBS/202-309----------------------------------------------------------------..MMD...........
Q1LWW2_DANRE/15-130----------------------------------------------------------------..SDC...........
T1GAZ8_MEGSC/275-385----------------------------------------------------------------..PLG...........
F6Y1S7_CIOIN/466-581----------------------------------------------------------------..AEE...........
K5XNX9_AGABU/250-367----------------------------------------------------------------....SNTIL....DAL
N1QL86_SPHMS/786-905----------------------------------------------------------------....KTDNK....AIM
Q385H1_TRYB2/453-569----------------------------------------------------------------..QEE...........
C1FE07_MICSR/227-338----------------------------------------------------------------.....QVEE....IGR
E3MQ20_CAERE/991-1101----------------------------------------------------------------....G...........
Q2HB23_CHAGB/790-904----------------------------------------------------------------....LSEGK....RAL
F7FGQ0_MONDO/286-401----------------------------------------------------------------..ARE...........
F6ZK74_CIOIN/369-484----------------------------------------------------------------..ASD...........
H2URW7_TAKRU/209-324----------------------------------------------------------------..PEE...........
A3LSB2_PICST/670-786----------------------------------------------------------------....DETKK....ASI
A0A0D2WHU8_CAPO3/922-1038----------------------------------------------------------------..AAK...........
C3Z9I4_BRAFL/477-593----------------------------------------------------------------..PEE...........
H2SZT3_TAKRU/428-542----------------------------------------------------------------..TKE...........
N1Q9A1_PSEFD/659-776----------------------------------------------------------------....NHETK....VEL
B7S3T2_PHATC/601-716----------------------------------------------------------------..TDL...........
W5KFE6_ASTMX/490-605----------------------------------------------------------------..AAD...........
Q2H4G2_CHAGB/405-520----------------------------------------------------------------....DHNKL....QKM
F2UPR8_SALR5/1185-1317----------------------------------------------------------------..LVS...........
Q6BZ51_DEBHA/662-778----------------------------------------------------------------....DDIKC....TSI
S0ELB2_GIBF5/852-959----------------------------------------------------------------....DNCS.......L
L5LI27_MYODS/450-565----------------------------------------------------------------..PGD...........
A9VD11_MONBE/1221-1335----------------------------------------------------------------..SRH...........
K0KL98_WICCF/623-739----------------------------------------------------------------....DSDKK....YLI
T1G934_HELRO/199-314----------------------------------------------------------------..VTN...........
T1G0G0_HELRO/196-307----------------------------------------------------------------..NDS...........
G3JGE5_CORMM/284-396----------------------------------------------------------------....HTDNS....AKL
A0A0C4ERW5_PUCT1/563-680----------------------------------------------------------------..MLD...........
G7XNJ5_ASPKW/783-900----------------------------------------------------------------....DSDSK....AVF
M4AIZ6_XIPMA/499-613----------------------------------------------------------------..GMH...........
M7SX13_EUTLA/137-249----------------------------------------------------------------....HETKN....REM
T1IHK2_STRMM/849-956----------------------------------------------------------------...KI...........
R8BQP0_TOGMI/129-239----------------------------------------------------------------....HQSKH....KEM
E9GUG0_DAPPU/494-609----------------------------------------------------------------..ADA...........
R4GB63_ANOCA/369-484----------------------------------------------------------------..APD...........
I2GWJ1_TETBL/468-586----------------------------------------------------------------....DKTLK....LAI
H3B2C6_LATCH/424-539----------------------------------------------------------------..GSD...........
M3D9Q9_SPHMS/307-425----------------------------------------------------------------....NGSR.......I
K1V4M8_TRIAC/283-399----------------------------------------------------------------....NCDK.......V
W4Y2J6_STRPU/402-517----------------------------------------------------------------..PVE...........
J5JN06_BEAB2/465-578----------------------------------------------------------------....DQKHH....RAM
F7C6V1_CALJA/70-183----------------------------------------------------------------...VD...........
G3AVU0_SPAPN/619-735----------------------------------------------------------------....DEDKK....IAL
S0EHF9_GIBF5/987-1097----------------------------------------------------------------.....SPT......EL
G4TAH9_PIRID/235-351----------------------------------------------------------------....NHAR.......L
G4NDT3_MAGO7/323-447----------------------------------------------------------------....AAGK.......I
V8PE75_OPHHA/356-482----------------------------------------------------------------..ANE...........
A9VBY6_MONBE/623-741----------------------------------------------------------------..TNV...........
A0A016Q5G1_GIBZA/774-890----------------------------------------------------------------....AKDQK....MAL
A0A0D2X2F7_CAPO3/1560-1674----------------------------------------------------------------..LAE...........
E3QYT0_COLGM/329-441----------------------------------------------------------------....HATKP....REI
V8PDH0_OPHHA/598-706----------------------------------------------------------------..YLN...........
M1VXY3_CLAP2/500-610----------------------------------------------------------------....YQKNE....RDV
H2ZU78_LATCH/223-338----------------------------------------------------------------..ACD...........
H6C734_EXODN/365-479----------------------------------------------------------------....HSDPYD..GPAL
B7FP63_PHATC/607-714----------------------------------------------------------------..AQT...........
N1J7Z3_BLUG1/388-499----------------------------------------------------------------....SKNQK....LEM
C7Z5S0_NECH7/888-1002----------------------------------------------------------------....QKHGE....NSL
W5M435_LEPOC/940-1052----------------------------------------------------------------...KE...........
A8PDD5_COPC7/582-696----------------------------------------------------------------..MWD...........
A7SDH9_NEMVE/403-518----------------------------------------------------------------..AAG...........
M3HJN1_CANMX/678-794----------------------------------------------------------------....EEDKK....IAL
G5BJ13_HETGA/521-638----------------------------------------------------------------..GRS...........
U4L657_PYROM/279-397----------------------------------------------------------------....HEKWR....EDI
R4XC63_TAPDE/590-708----------------------------------------------------------------.....TTM......QV
M2R750_COCSN/398-510----------------------------------------------------------------....HESKP....TEI
B4JKL8_DROGR/976-1087----------------------------------------------------------------...AI...........
T1FQR0_HELRO/789-897----------------------------------------------------------------..PIE...........
E9CUF5_COCPS/374-486----------------------------------------------------------------....HENQR....KAL
D8QLF1_SCHCM/503-623----------------------------------------------------------------.GMLD...........
I3K2K2_ORENI/545-660----------------------------------------------------------------..AVE...........
G1X1C4_ARTOA/269-381----------------------------------------------------------------....HEEQT....DAL
F7A0G1_CIOIN/490-605----------------------------------------------------------------..AGD...........
T1KSZ4_TETUR/201-315----------------------------------------------------------------.....L..........
H9ITM0_BOMMO/938-1054----------------------------------------------------------------...TF...........
H2ZTT6_LATCH/71-184----------------------------------------------------------------...ND...........
I1GJ67_AMPQE/603-717----------------------------------------------------------------..GAH...........
G4NJD0_MAGO7/442-555----------------------------------------------------------------....AKEDP....EGM
T1HV24_RHOPR/962-1078----------------------------------------------------------------...RF...........
C5DES3_LACTC/577-692----------------------------------------------------------------....DEAQR....LAI
A7SXK4_NEMVE/280-395----------------------------------------------------------------..ASE...........
H0ES44_GLAL7/715-832----------------------------------------------------------------....DQEDR....RAI
M7SPN2_EUTLA/327-448----------------------------------------------------------------....ATGAK....EKI
F7B628_XENTR/933-1046----------------------------------------------------------------..SIE...........
B2AUG0_PODAN/415-528----------------------------------------------------------------....DATKI....RTL

PF03009

GLPQ_ECOLI/36-350DKVYLQCFDADELKR--IKNELEP-KMG------ME-------------L-NL----VQLIAYTDWNETQQKQPDGSWVN
E7KVC5_YEASL/7-246YDFGIETGVLKDFKV--IVISLS.-...------..-------------L-DI----ASQFVKRSLTLND..........
O07244_MYCTU/14-242LRLL..TKRVASSAG--TGALLA.-...------.W-------------L-TA----RPLGS.RAYAWRM.......M..
GLPQ1_MYCTU/17-259SRAVVMSFSAAAVWR--IRRAAP.-...------.L-------------L-PT----VLLGKTPRYLTSS..........
UGPQ_ECOLI/12-239PLLS..SFEIDALEA--AQQAAP.-...------.E-------------L-PR----GLLLD..EWRDDW.......R..
Q45201_BORHE/38-330DKIYLQTFDFDELKR--IREELG.-...------YQ-------------G-KL----IMLVGENDWDEAP..........
GLPQ_HAEIN/40-355DMVYLQTFDFNELKR--IKTELLP-QMG------MD-------------L-KL----VQLIAYTDWKETQEKDPKGYWVN
Q9RKX8_STRCO/20-243QRLA..GPRLATSCG--TRGVLG.-...------..-------------L-RL----RSWG..VPVAPR...........
YQIK_BACSU/7-235DRVILSTFNHDSLAL--CARLAP.-...------.H-------------I-ER----AVLTSDVLYQADR..........
GLPQ_BACSU/43-285GQVIIQSFSKESLVK--VHQLQP.-...------.N-------------L-PT----VQLLEAKQMASMT.........D
GDE1_YEAST/877-1212RDIIFSSFHPDICIM--LSLKQP.-...------.V-------------I-PI----LFLTEGGSEQMA.DL..RASSLQ
O02322_CAEEL/73-322KILTGFTWRSWELST--TDEAAT.-...------.T-------------P-RF----TGTLHAVASVLDV.......LAF
PGC1_SCHPO/37-267DKVSFCLWSHRFIPA--CDRYAP.-...------.S-------------I-PL----YHIGFNFAYAERH.........F
O86738_STRCO/16-227.TAG.....AATMLA--VRAADP.-...------.A-------------A-EI----AMTWTTAAPPRAG..........
GPCP2_CAEEL/406-706RRIMFSSFDPDICSM--VATKQN.-...------.K-------------Y-PV----LFLCVGETQRYTPFQDQRTSTSM
GPCP1_CAEEL/349-649RRIIFSCFEPDICTM--ITKKQH.-...------.K-------------Y-PV----SFLVVGATNRYMPFQDIRSDCSK
Q3BZN0_XANC5/274-516IKVYAKYYTGGFDQF--LSNLYK.-...------.H-------------Y-QI----NPLHSQDAPRRAA.......LD.
Q89384_PBCV1/5-217......SFKWDEIQH--VRTIDD.-...------.K-------------I-PT----GLISVIRPAKTIR..........
GDE1_SCHPO/752-1061RKYIFSSFNPDICIL--LSLKST.-...------..-------------N-PV----LFLTEGGTAYRTDV...RAASLR
Q9RSP0_DEIRA/37-277ALNEFRRLCPEVMTS--MTEREL.-...------..-------------R-PL----VLLSKVGLSALAP..........
Q9RWX3_DEIRA/7-220RRVIVSSFNPLLLRA--ARELAP.-...------.E-------------V-ER----GLLYHRPYRLGPL......NLPE
Q9RZL4_DEIRA/249-566ARVFIQSFEVGNLKD--LNTRIMP-AAG------VK-------------L-PL----VQLISSPDEAPYDW...AAAGDG
GDPD6_ARATH/49-357QPIFIQSFAATSLVY--ISNMTD.-...------..-------------S-PK----LFLIDDVTILTED........TN
GDPD1_ARATH/39-318RTIIFSSFHPDAALL--VRKLQT.-...------.T-------------Y-PV----FFLTNGGTEMYHDT...RRNSLE
Q9UAW8_CAEEL/68-331KILTGLTWRLKFWSY--HDIENIR-P.R------YS-------------G-PK----QMLFEMIDVAHVW......LLKK
Q9VQU3_DROME/375-661RRIVLSCFDPDICTI--LRFKQN.-...------.R-------------Y-PV----MFLTLGRTTKYQKYMDPRGNSME
Q9W2L6_DROME/349-632RLNVIKSFDADLCSL--LRFKQH.-...------.M-------------Y-PV----LFLSSSKENVFNDP...RTSTVE
Q9X1V6_THEMA/6-217LDLLDEKFKGTKYGY--LIDEEN.-...------..-------------Y-GS----IENFVERVEKERP..........
Q9YFI4_AERPE/15-220GQVIYTSENHRYLRR--LREEAS.-...------.A-------------V-VY----TTYSILPVDVADP..........
Q9ZTU6_WHEAT/118-414KKVMIQSTNSSTLVK--FKQLAKY-..N------LV-------------Y-KI----DEVVKDAAPSSLA.....DIKKF

PF13653

H0YEF5_HUMAN/34-61--------------------------------------------------------------------------------
A8I2Q7_CHLRE/208-237--------------------------------------------------------------------------------
C1EA09_MICSR/311-340--------------------------------------------------------------------------------
D3R0L3_MAGIU/197-226--------------------------------------------------------------------------------
Q53JJ0_ORYSJ/166-195--------------------------------------------------------------------------------
B3RWH1_TRIAD/177-217--------------------------------------------------------------------------------
C5XX04_SORBI/147-190--------------------------------------------------------------------------------
C3KNM3_RHISN/284-318--------------------------------------------------------------------------------
A1SJR5_NOCSJ/183-212--------------------------------------------------------------------------------
C5Y879_SORBI/258-287--------------------------------------------------------------------------------
D2QM66_SPILD/215-245--------------------------------------------------------------------------------
D3PWH3_STANL/239-274--------------------------------------------------------------------------------
A4F9Z1_SACEN/227-262--------------------------------------------------------------------------------
A4AS02_MARSH/212-242--------------------------------------------------------------------------------
C7PNH8_CHIPD/228-258--------------------------------------------------------------------------------
C5C387_BEUC1/626-661--------------------------------------------------------------------------------
A3HWH1_9BACT/215-245--------------------------------------------------------------------------------
Q6MRA8_BDEBA/253-282--------------------------------------------------------------------------------
A6WFY1_KINRD/264-299--------------------------------------------------------------------------------
A7T397_NEMVE/56-86--------------------------------------------------------------------------------
C6W5T4_DYAFD/220-250--------------------------------------------------------------------------------
B7Q3W8_IXOSC/213-242--------------------------------------------------------------------------------
D2QQ87_SPILD/603-633--------------------------------------------------------------------------------
C7NM04_KYTSD/250-284--------------------------------------------------------------------------------
Q7UF88_RHOBA/253-283--------------------------------------------------------------------------------
C7P9S2_CHIPD/217-247--------------------------------------------------------------------------------
B7QFM3_IXOSC/67-96--------------------------------------------------------------------------------
A5FEV6_FLAJ1/213-243--------------------------------------------------------------------------------
Q4Z7T4_PLABA/27-60--------------------------------------------------------------------------------
B7PW58_IXOSC/226-255--------------------------------------------------------------------------------
C6W721_DYAFD/221-251--------------------------------------------------------------------------------
F4CCK5_SPHS2/221-250--------------------------------------------------------------------------------
R5U7A9_9BACE/225-253--------------------------------------------------------------------------------
R7CP54_9FIRM/261-289--------------------------------------------------------------------------------
U7DST0_POPTR/47-89--------------------------------------------------------------------------------

PF00388

Q5KJZ5_CRYNJ/252-393KTLT...SSVPVRDI--CRAIKQY-GFV------TS.P...........Y-PI----IISTEIHC.ASEQ----------
A4I5X4_LEIIN/300-441HTRT...SKIRFVDV--IDTIRRH-AFT------AS.P...........F-PV----ILSLEVHT.SDEQ----------
Q8IJR0_PLAF7/626-770YKLT...SSILFCDT--LIACKMF-GFT------TS.P...........Y-PI----ILSLEIHC.KNKH----------
Q6BZ51_DEBHA/455-607RTFT...SSISLNNV--FKTIKKY-AFI------TS.P...........F-PL----IISLEINC.SIDN----------
PLCG2_MOUSE/314-457WTRT...TKIKFDDV--VQAIRDH-AFV------TS.S...........F-PV----ILSIEEHC.SVEQ----------
PLCL1_HUMAN/400-543NNMT...THVSFRSV--IEVINKF-AFV------AS.E...........Y-PL----ILCLGNHC.SLPQ----------
PLCD9_ARATH/109-254WNFE...KPLELQEC--LDAIKQH-AFT------PTRS...........Y-PV----IITIKDSL.KPDL----------
PLCD1_ARATH/107-250GTLT...SREDLQKC--LNVVKEN-AFQ------VS.A...........Y-PV----VLTLEDHL.TPIL----------
PLCD6_ARATH/139-282RTLT...TPVPLMKC--LKSIRDY-AFS------SS.P...........Y-PV----IITLEDHL.TPDL----------
A5DAA1_PICGU/440-595RSFT...SSISLKNV--LSTVKKY-AFS------SS.S...........W-PV----ILSLEVHC.NAEN----------
PLCD4_RAT/292-436RTLT...SRILFKDV--LATLAQY-AFQ------SS.D...........Y-PL----ILSLDNHC.TWEQ----------
PLCZ1_BOVIN/157-300YTFT...SKLLFKTV--IQAINKY-AFL------AS.E...........Y-PV----VLSLENHC.SPSQ----------
PLCD3_ARATH/108-251RTLT...SHEDLQKC--LTAIKDN-AFH------VS.D...........Y-PV----IITLEDHL.PPKL----------
A5E691_LODEL/21-192RTFT...KSIKFSDV--IRTIKEY-AFE------SS.P...........Y-PV----ILSLEINC.SANY----------
Q16W08_AEDAE/315-464MAMC...SDILFKDV--IYALRDT-AFV------TS.D...........Y-PV----ILSFENHC.CRSQ----------
PLCD5_ARATH/114-257WAWT...PPVELVKC--LRSIKEH-AFY------AS.A...........Y-PV----ILTLEDHL.TPDL----------
Q5QIB9_STRPU/301-444HTLT...SKIKFRDI--IEVVDKY-AFA------AS.E...........Y-PL----ILSFENHC.SVEQ----------
Q6CSI9_KLULA/402-540L.FT...QSIPLEDV--VKTIRKY-AFI------TS.P...........Y-PL----IVSLEIHC.KKDY----------
PLCD3_HUMAN/339-483HTLT...SKILFRDV--VQAVRDH-AFT------LS.P...........Y-PV----ILSLENHC.GLEQ----------
Q385H1_TRYB2/248-393YTRT...SKLWFRDC--ISTIKKY-AFV------NS.I...........Y-PV----ILSLEVHT.SLRQ----------
Q16ZC0_AEDAE/42-189HTFT...TKIPFRAV--VEAINKS-AFV------QS.A...........Y-PV----ILSIENHC.SVTQ----------
PLCH1_HUMAN/301-445YTLT...SKILFRDV--VETINKH-AFV------KN.E...........F-PV----ILSIENHC.SIQQ----------
A2QEJ2_ASPNC/86-262HTLT...RETSFREV--CYAIRDS-AFV------AS.D...........L-PV----IVSLEVHT.CLEQ----------
Q4N7P5_THEPA/468-615CHLT...GSVTLREG--LIAIKES-AFE------SN.K...........L-PV----ILSFEMHC.SDEF----------
A7S279_NEMVE/319-466NAMC...TKILFKDV--IEAIRDS-AFQ------TS.D...........F-PV----ILSFENHC.SKHQ----------
PLC_DICDI/324-466NTLT...SQIKFSHV--CETIKAR-GFE------TS.P...........Y-PV----ILSLEVHC.SVPQ----------
Q5BFL6_EMENI/534-676RTMT...TSVLFADC--ITVINRY-AFF------SS.E...........F-PL----VISLEVHC.NPEQ----------
Q2HB23_CHAGB/553-696HTLT...TSISFLEV--IKTINKY-AFA------KS.R...........F-PL----WISLEVRC.SPNT----------
A6RBI2_AJECN/84-320YTLT...KEITFRDV--CNTIRDH-AFV------TS.D...........L-PI----IVSLEVHA.CLEQ----------
A0CKY8_PARTE/271-413YTLT...SKILFEDA--ILALDKF-GFM------FS.S...........Y-PI----ILSLELHC.SIDQ----------
E9AEI1_LEIMA/296-447HTMT...TKIAFDDV--VRTINDY-AFQ------NP.SNNQEAAWNPREL-PV----IVSLEVHT.SPEQ----------
Q9XWB7_CAEEL/306-468PTAVMGMNEIGLKEV--CEAIKEC-AFK------TS.P...........Y-PV----ILSIENHL.GRKQ----------
Q8IA75_CAEEL/367-517QTAT...SKITISSA--LRIIREF-AFE------RS.R...........Y-PL----LLKVSVHC.STDW----------
PLC1_YEAST/382-521F.LT...SAIPLKTV--IRVIKKY-AFI------TS.P...........Y-PL----IISLEINC.NKDN----------
PLCE1_HUMAN/1394-1541HTLT...TKIPFKEV--VEAIDRS-AFI------NS.D...........L-PI----IISIENHC.SLPQ----------
A7RXP6_NEMVE/244-393MTLC...TEISFKDV--IEAIAEC-AFK------TS.D...........Y-PV----ILSFENHC.TPKQ----------
Q7QHE3_ANOGA/319-462HTFT...TRIKFMDV--IRTIKEH-AFI------TS.E...........Y-PL----ILSIEQNC.SLTQ----------
A0BLC4_PARTE/285-429FTMT...SKISFESV--IETIKEY-GFK------YS.K...........Y-PL----ILSLEVHC.CVKQ----------
Q6FY00_CANGA/381-519V.LT...SALPLSSV--TQIIRKY-AFI------TS.P...........Y-PL----IISMEVRC.NSKN----------
A0BLM0_PARTE/262-404HTLV...NDIKFKDV--ISTVRDF-AFY------KD.N...........N-PA----ILSLEMHC.CLKQ----------
Q59LC4_CANAL/566-727RTFT...KPISFANV--IRAIKKF-AFI------VS.P...........W-PL----ILSLEIHC.SPEC----------
Q2UPV6_ASPOR/98-321HTLT...KGTTFRDV--CYAIRDS-AFV------TS.D...........L-PV----IVSLEVHA.SLEQ----------
A7T501_NEMVE/158-302YTMT...SKVKFRYV--ILNINDF-AFL------NN.R...........Y-PV----ILSLENHC.SVEQ----------
A7ASE0_BABBO/522-670CQLT...GSITLSEA--LIACKET-AFK------FS.K...........L-PV----ILSMQMHC.TDEC----------
A0A0D1CR16_USTMA/724-872RTLT...SRVPFQDV--ISAIARY-AFV------TS.P...........Y-PL----ILSLEVHA.DPPQ----------
A7TR21_VANPO/381-520F.LT...SSIPLLDV--ASVIRKY-AFI------TS.P...........Y-PL----IISLETNC.NKIN----------
Q75C92_ASHGO/397-535K.LT...SSLPLRNV--VDVINKY-AFI------TS.P...........Y-PL----ILSLEIHC.RSEG----------
A7RPQ0_NEMVE/307-450HTLT...SKIMFKET--VEAIEEH-AFD------VS.P...........Y-PV----ILSIENHC.CVKQ----------
A7SXK4_NEMVE/94-237HTLT...SKVLFKDI--VQAIKES-AFK------VS.P...........Y-PV----IVSLENHC.SVQF----------
A4S165_OSTLU/1-153GTAV...RPMLFKDA--IAVINDR-AHV------AS.E...........Y-PV----IVTLENHA.SRET----------
Q7PW25_ANOGA/289-436YTFV...PEICAKDV--LEAIAET-AFK------TS.E...........F-PV----ILSFENHC.NPRQ----------
A7RKT2_NEMVE/272-413RTLT...SKIRFRDV--VQIIKEY-AFE------VS.E...........Y-PL----ILSLENHC.NIQQ----------
A3LSB2_PICST/461-615RTFT...TAISFSNV--ISTIKKY-AFF------TS.P...........Y-PL----VISLEINC.SVAS----------
A3LNB7_PICST/20-167KFPVRIPFPIQLEDV--LKEVYDF-LDD------NK.S...........E-TV----IVSLKQEG.SNDW----------
PLCH2_HUMAN/328-472YTLT...SKILFKDV--IETINKY-AFI------KN.E...........Y-PV----ILSIENHC.SVIQ----------
Q0UVV5_PHANO/116-337YTLT...KDLPFRAV--CATIRDY-AFK------TS.N...........L-PL----IVSLEVHT.CPEQ----------
Q4QBH9_LEIMA/195-340YTRT...SCIAFEEC--VKMIRQY-AFT------AS.A...........Y-LV----ILSLGVHT.SVEQ----------
Q0UE70_PHANO/101-258YTLV...SNIPFRTV--CETLRDV-VDK------EAAEER.......HAA-PI----MISLENHC.DAHG----------
PLCL2_MOUSE/429-572HTMT...SQIVFRSV--IDIINKY-AFF------AS.E...........Y-PL----ILCLENHC.SIKQ----------
PLCZ1_CHICK/159-303HTLT...SKITFCSV--IHVVDKY-AFA------AS.D...........Y-PV----VLSLENHC.STKQ----------
Q2GUM5_CHAGB/104-264YTLV...SNIPFRVV--CETIRDV-VDH------EETAARGR...GYTPA-PI----LVSLENHC.DRNG----------
Q21754_CAEEL/318-461RTFI...ESITLRNS--LEAIKRT-AFE------TS.P...........Y-PV----ILTLENHV.GFVQ----------
A7SDH9_NEMVE/209-352HTLT...SKIKFKDI--IQAVAEH-AFK------VS.D...........Y-PV----ILSLENHC.NIEN----------
A4HCK9_LEIBR/248-393YTPT...SRIAFRDC--ITVIRQH-AFT------AS.P...........Y-PV----ILSLEVHA.SVAQ----------
PLC1_SCHPO/443-585HTFT...SMIKFNDV--IDAIRKY-AFV------VS.P...........Y-PL----FISLEIHC.CPDQ----------
Q013R6_OSTTA/119-269GTAV...RPMYFEDA--IKVIAER-AHV------AS.E...........Y-PV----IVTLENHA.SKET----------
Q75IL8_ORYSJ/119-262RTLT...SPVGLMKC--LEAIREY-AFV------AS.P...........Y-PV----ILTLEDHL.TPDL----------
PLCD8_ARATH/107-248WNFE...KPLKLQEC--LDSIKEH-AFT------KC.T...........Y-PL----IITFKDGL.KPEL----------
Q6CD33_YARLI/505-648RTFT...SSVSVEDV--CSAIRKY-GFI------AS.P...........N-PL----ILSLEIHC.SASN----------
A7UXE0_NEUCR/118-273YTLV...SNIPFREV--CKIILQV-VEE------EE.ESGGG...GGGGA-PV----LISLENHC.GAQG----------
A9RJG9_PHYPA/150-293GTLT...KAVPFEDC--VKAIKDN-AFT------TS.A...........Y-PV----VVTIESHL.DLEH----------
A9SXU1_PHYPA/108-250NTLT...SPVAFEKC--IKAIKAN-AFV------SS.K...........Y-PV----VITLEDHL.SSPL----------
B4H106_DROPE/328-471HTMT...SKIKFMDV--VKTIKDH-AFT------TS.E...........Y-PV----ILSIEQNC.SLEQ----------
B6C9K2_SOLLC/110-252RTVT...TPVELIRC--LKSIKEH-AFS------AS.P...........Y-PV----VITLEDHL.TPDL----------
B6KHA6_TOXGO/407-549YQLT...SRIKFKDV--IQACKDY-GFQ------RS.K...........F-PI----ILSLEMHC.STKQ----------
E9QD74_DANRE/316-459HTLT...SKVPFKDV--IKAIKDY-AFK------AS.P...........Y-PV----ILSLENHC.SLEQ----------
F1R8S3_DANRE/294-437YTLT...SKILFKDV--IKAIKEY-AFK------TS.E...........Y-PV----ILSLENHC.GVEQ----------
F6HKS4_VITVI/112-254RTLT...TPVKLSKC--LISIKKY-AFV------AS.E...........Y-PV----IITLEDHL.TPDL----------
F7DT82_CALJA/159-308KAMC...TDILFKDV--IQAIKET-AFV------TS.E...........Y-PV----ILSFENHC.SKYQ----------
G3GVA5_CRIGR/324-467YTFT...SKILFYDV--LRAIRDY-AFK------AS.P...........Y-PV----ILSLENHC.SLEQ----------
G3UXP4_MOUSE/322-465HTLT...TKIKFSDV--LHTIKEH-AFV------AS.E...........Y-PV----ILSIEDHC.SIAQ----------
G4UMR8_NEUT9/110-362YTLT...KDITFRDV--CEAIKDY-GFA------TT.D...........L-PL----IVSLEVHC.SAEQ----------
PLCB_CAEEL/342-492KAMC...TDVFFKDV--LVQIRDT-AFA------RS.D...........F-PV----VLSFENHC.SKSN----------
H2SZT5_TAKRU/30-172WTRT...TKIKFEDV--VKAINDH-AFV------TS.E...........F-PV----ILSIEEHC.PIEQ----------
H2USZ2_TAKRU/343-506YQQH...TPITIRSA--LEVINKY-AFL------TS.Q...........Y-PL----LVYLCHRC.SPAQ----------
H3CD03_TETNG/306-449YTLT...SKIPFRFV--IETINKY-AFI------NN.Q...........F-PV----ILSIENHC.TIQQ----------
H3CYP8_TETNG/287-430HTLT...SKVPFVEV--VQTINEY-AFK------SS.P...........Y-PL----ILSLENHC.SVEQ----------
H3D277_TETNG/321-464HTMT...SQVSFRSV--IDVVNKY-AFV------AS.E...........F-PV----ILCLENHC.SLKQ----------
H3D2C1_TETNG/321-464SSVA...SHLVFSKI--VDIINQY-AFE------SS.E...........Y-PL----ILCLVTHC.CIPQ----------
H3D5C7_TETNG/314-459YTIT...SKVLFRDV--IKAIKDY-AFK------TS.Q...........Y-PV----ILSLENHC.SVDQ----------
H3DBV7_TETNG/298-442HTLT...SKVPFKEV--IETIAQY-AFK------AS.P...........Y-PL----ILSLENHC.SVEQ----------
H3DF29_TETNG/89-233YTLT...TKILFKEV--ITTVEQH-AFE------KS.P...........Y-PV----ILSLENHC.CKEQ----------
H3DK53_TETNG/325-468HTLS...PPLALHSV--LEAIEKC-AFV------AS.D...........Y-PL----IVCIENHC.SYQQ----------
I1R783_ORYGL/114-256GTLT...APVQIIKC--LKSIKEY-AFC------AS.P...........Y-PL----VITLEDHL.TPDL----------
K4A9N8_SETIT/153-295RTLT...APVSLIKC--LRSIKEY-AFV------AS.P...........Y-PV----IITFEDHL.TPDL----------
M1BNL7_SOLTU/113-255GTLT...PPVELIQC--LKSIKEH-AFV------AS.E...........Y-PV----IITLEDHL.TPDL----------
M1CL37_SOLTU/111-252GTLT...TPVALIKC--LKSIKEH-AFT------VS.E...........Y-PV----VITLEDHL.TTDL----------
M4FG24_BRARP/66-209RTLT...SPVELIKC--LRAIKTH-AFE------VS.D...........Y-PV----VVTLEDHL.TPEL----------
PLCB2_RAT/314-464FTMT...TDILFKEA--VEAIAES-AFK------TS.P...........Y-PV----ILSFENHVDSPRQ----------
PLC_LISMO/61-198PIFL....NASLSGV--LETITQF-LKK------NP.K...........E-TI----IMRLKDEQNSNDS----------
PLCB3_MOUSE/319-469FTMT...TEVPLRDV--LEAIAEA-AFK------TS.P...........Y-PV----ILSFENHVDSAKQ----------
Q236T7_TETTS/331-475VFQV...TPVSVEDI--FKAIKQY-GFE------RS.V...........Y-PI----IINLEHEC.SVNQ----------
PLC_STAA8/51-192MVYL....HHELGKF--LDDAKYY-LSA------YP.N...........E-TI----VMSMKKDY...DS----------
Q4DUP6_TRYCC/248-392HTRT...SKISFLSC--IKVIKEY-AFK------AS.E...........Y-PV----ILSIEVHT.SSAQ----------
Q4WX21_ASPFU/96-334HTLT...KGTKFRDV--CYAIRDS-AFV------AS.D...........L-PV----IVSLEVHT.CIEQ----------
Q5A0L4_CANAL/21-164KFPVKIPFPLKLKDT--LEEVYKF-LAH------NS.S...........E-TV----IVSIKQEG.SDDW----------
Q7SE08_NEUCR/136-356GTMT...TTVPFREV--CKAVREE-AFV------TN.H...........L-PI----IVSLEVGA.DREQ----------
Q81A32_BACCR/58-194PLYL....YVTLHEF--INEAKQF-LRD------NP.S...........E-TI----IMSLKKEY...ED----------
PLCD4_ARATH/116-257RTLT...KEVKLGKC--LESIKAN-AFA------IS.K...........Y-PV----IITLEDHL.TPKL----------
W4XJU2_STRPU/318-467LAMC...TDIQFKEV--IQAIRDT-AFV------TS.D...........F-PV----ILSFENHC.SKPQ----------

PF00387

Q5KJZ5_CRYNJ/446-558..WIK..HN...FKH..ISRVYPR.GTR.L....GSTN-----------F.NP....VDSWSAGC---------------
F1QS56_DANRE/608-720..FLT..FN...QRQ..LSRIYPS.AYR.I....DSSN-----------F.NP....QTYWNVGC---------------
F1RBD7_DANRE/510-625..FIR..HN...IDK..LSRIYPA.GSR.T....DSSN-----------Y.NP....VPLWNAGC---------------
G8BKQ6_CANPC/644-760DK.....HN...RKY..FVRVYPS.GYR.V....TSTN-----------F.NP....IKYWEHGV---------------
A7RPQ0_NEMVE/492-607..FVN..YN...KRC..LSRIYPS.GKR.V....GSSN-----------Y.NP....QDMWNCGC---------------
F2ULH4_SALR5/541-656..FVD..YN...KMQ..LSRIYPQ.GTR.I....NSTN-----------F.NP....QAFWNVGC---------------
G4VBK4_SCHMA/531-646..FVN..YN...KRQ..MSRIYPR.GNR.V....DSSN-----------Y.MP....QIFWNAGC---------------
S0DQT6_GIBF5/306-423AR.....HN...AHH..LMRVYPK.GTR.I....SSTN-----------L.KP....VPYWGIGA---------------
E9GFR8_DAPPU/479-594..FIQ..HT...SNQ..LVRIYPK.GSR.T....DSSN-----------Y.DP....SQFWSAGC---------------
G0WGC6_NAUDC/598-716DK.....HN...RKY..LMRVYPN.IFR.Y....KSSN-----------F.NP....IKFWKSGC---------------
L0PAS0_PNEJ8/47-161EK.....HN...VKY..LMRLYPN.FTR.I....NSTN-----------F.EP....QQYWQKGV---------------
K0R6H0_THAOC/569-682..WRE..YN...TNH..MSRVYPK.GIR.T....DSSN-----------Y.NP....LPAWHAGC---------------
I3JX91_ORENI/928-1039..FLQ..YN...RKA..LSRIYPK.GQR.V....ESSN-----------Y.DP....YPMWALGC---------------
I3K883_ORENI/523-637..LVM..FT...KRT..LTRVRPS.SVR.L....DSSN-----------P.NP....QGYWKGGV---------------
E2BGZ2_HARSA/531-646..FVN..YN...KRQ..MSRIYPK.GTR.A....DSSN-----------Y.MP....QVFWNAGC---------------
J3K909_COCIM/769-886EA.....HN...RLY..LTRVYPS.GYR.L....RSSN-----------F.DP....NSFWRRGV---------------
I1G7J0_AMPQE/80-196..FIQ..YS...RLQ..LSRVYPK.GQR.I....DSSN-----------Y.DP....IPMWCSGS---------------
G8JQV5_ERECY/594-709DK.....HN...RRH..LMRTYPH.ALR.Y....KSSN-----------F.DP....IKCWKVGV---------------
F6SF88_CIOIN/565-682..LTN..YN...KSQ..LSRIYPR.GNR.V....DSSN-----------Y.MP....QIFWNVGC---------------
G2R3P3_THITE/406-520LA.....HN...REY..FMRIYPQ.GWR.V....DSSN-----------P.DP....TFPWRRGA---------------
F2U545_SALR5/2126-2244..LVT..LS...CAQ..NTRTFPA.GTR.V....NSSN-----------F.DP....QQMWIAGC---------------
PLC_DICDI/543-652..VVE..AS...QNH..LLRVYPR.GTR.F....DSSN-----------F.DP....MPGWSIGC---------------
B3SC97_TRIAD/538-653..YVN..YN...KRQ..LSRIYPK.GSR.V....ESSN-----------F.IP....QIFWNAGS---------------
T1J420_STRMM/330-445..FVE..YN...RKQ..LIRIYPS.GKR.Q....DSSN-----------Y.DP....IPLWNVGS---------------
E4XLQ6_OIKDI/964-1081..FLD..YN...TFQ..ISRAYPK.GAR.I....HSEN-----------Y.NP....ISCWNAGV---------------
A0A0D2XRJ6_FUSO4/781-897DL.....HN...LRY..MMRVYPD.RTR.I....TSNN-----------F.DP....LLYWRRGI---------------
U7PV69_SPOS1/502-615FL.....HN...KKY..MMRAYPN.ATKHV....TSSN-----------P.DP....ACCWRRGV---------------
A5DAA1_PICGU/648-764AK.....HN...RKF..LMRVYPS.KMR.I....GSSN-----------F.NP....ITQWNYGV---------------
H2N2E2_ORYLA/491-606..FVQ..HN...SRQ..LTRVYPT.GFR.T....DSSN-----------F.NP....QEMWNAGC---------------
G8BYA3_TETPH/612-727NK.....HN...RKY..LTRVYPH.AFR.Y....KSSN-----------F.NP....VFFWESGV---------------
D7ELR5_TRICA/967-1083..FVK..YH...QHQ..FSRVYPK.GQR.V....DSSN-----------Y.NP....INMWNIGS---------------
A7SMY6_NEMVE/400-514..FVK..YH...RRQ..ISRVYPK.GSR.I....DSSN-----------Y.DP....VMMWNCGV---------------
S7ZDD6_PENO1/368-480FE.....HN...RSS..FMRIYPY.ALR.V....NSSN-----------L.DP....SFCWRRGA---------------
E9HXQ7_DAPPU/696-810..FLW..YH...QVM..LSRIYPA.GKR.I....DSSN-----------Y.NP....VPFWNVGS---------------
H0ZA90_TAEGU/543-658..FVE..YN...KWQ..MSRIYPK.GTR.M....DSSN-----------Y.QP....QMFWNVGC---------------
F6S6B2_CIOIN/946-1058..FIN..YN...RKQ..FSRIYPK.GSR.V....ESSN-----------Y.NP....MPFWNCGT---------------
F0XRH2_GROCL/838-956HW.....HN...MRY..LMRVYPK.PYR.I....GSSN-----------F.SP....LAHWRRGV---------------
G4N054_MAGO7/418-530FD.....HN...RHY..LMRTYPS.GMR.I....GSSN-----------L.DP....VVFWRKGI---------------
T1KUP6_TETUR/217-327EDFAH..HN...KNY..LTQVAPD.RGR.I....DSSN-----------I.NP....LDFWNCGS---------------
F6RLC5_XENTR/487-602..FVR..HN...AWQ..LMRVYPT.GLR.T....DSSN-----------Y.NP....QEMWNVGC---------------
U1HY48_ENDPU/777-894ED.....HN...MRH..MFRVYPK.GMR.L....DSSN-----------F.DP....NTFWRRGV---------------
B7P4X9_IXOSC/943-1057..FLK..YP...FYDCLFSRVYPK.GSR.I....DSSN-----------Y.DP....VHLWNCGC---------------
G2YC85_BOTF4/422-534FQ.....HN...RNF..FMRAFPA.GSR.F....DSSN-----------L.DP....SVCWRKGI---------------
L8FTI0_PSED2/766-883VR.....HN...MRH..MMRVYPN.RWR.V....ASTN-----------F.DP....LTYWRRGV---------------
U3JVN7_FICAL/532-647..FIH..HN...IRH..LSRIYPA.GWR.T....DSSN-----------Y.SP....VDLWNVGC---------------
I3L7K2_PIG/492-608..FVR..HN...VNH..LSRIYPA.GWR.T....DSSN-----------Y.NP....VEMWNSGC---------------
H3BDF5_LATCH/514-630..FVA..HN...AWQ..LSRVYPS.ALR.T....DSSN-----------F.NP....QDVWNVGC---------------
K5XX24_AGABU/562-680..LIR..HT...QKS..LVRTYPK.GMR.I....NSSN-----------Y.EP....HRYWAAGA---------------
H2SZT4_TAKRU/541-665..FLL..YN...RKA..LSRTYPK.GQR.V....ESSN-----------Y.DP....YPLWAVGC---------------
H3CR59_TETNG/503-618..YIR..HN...AEK..LSRIYPA.GVR.T....DSSN-----------Y.NP....VPLWNAGC---------------
H3A2I8_LATCH/834-950..FLQ..YN...RRQ..LSRIYPK.GQR.L....DSSN-----------Y.DP....LPMWLCGS---------------
R8BVG2_TOGMI/308-425GR.....HN...AQH..LMRVFPK.GTR.I....SSEN-----------L.HP....VPFWGVGA---------------
W5MU43_LEPOC/512-627..YVC..HN...IDK..LSRIYPA.GSR.T....DSSN-----------Y.NP....VNLWNVGC---------------
M2UIG2_COCH5/302-418AH.....HN...AHH..LMRVYPK.GTR.I....SSKN-----------L.AP....VPFWSIGA---------------
S3DHJ9_GLAL2/313-430GA.....HN...AHH..LMRVFPK.GTR.I....SSKN-----------L.NP....VPFWGVGA---------------
W1QFP3_OGAPD/592-708VK.....HN...RRF..LMRIYPS.IYR.F....SSNN-----------F.NP....FFFWELGC---------------
H2UH12_TAKRU/488-602..LVR..FN...QRQ..LLRVYPS.NYR.V....DSSN-----------F.NP....QPYWNTGC---------------
L8FLM5_PSED2/482-594LA.....HN...RRY..MMRAYPA.GHR.I....DSSN-----------P.DP....SVFWRKGI---------------
H2YFJ0_CIOSA/524-639..FVR..YN...RRQ..MSRIYPK.GAR.V....DSSN-----------Y.MP....QIFWNAGC---------------
K7M553_SOYBN/345-454TDILR..FT...QKN..ILRVYPS.AMR.V....KSSN-----------F.KP....HIGWMYGA---------------
F2U1Z4_SALR5/471-588..FVK..RN...IRQ..LARVYPS.GFR.I....DSSN-----------Y.PP....QEMWNAGC---------------
G3P4B1_GASAC/508-622..FVR..HN...SRQ..LSRIYPS.GQR.L....QSSN-----------Y.DP....QAMWNGGC---------------
R7YJ72_CONA1/333-445FS.....HN...KNF..LMRAYPK.GVR.F....SSSN-----------L.DP....AVFWRKGV---------------
N4UQ90_FUSC1/308-422LQ.....HN...QNY..FFRVNPK.SLK.F....DTSN-----------P.EP....LQFWRRGV---------------
D5GAP7_TUBMM/347-465FH.....HN...KNY..MMRVYPF.GLR.F....SSSN-----------A.DP....TEFWQRGV---------------
A0A0C4DI92_FUSO4/284-405FR.....HN...RDF..FFQVTPN.SAR.V....DSSN-----------L.EP....LQFWKHGV---------------
K1WAI4_MARBU/420-532FT.....HN...RNF..FMRAYPG.GFR.I....DSSN-----------V.DP....SELWRKGV---------------
S8A7Z1_DACHA/271-383FQ.....HN...RHF..LTRVYPH.GLR.I....SSSN-----------L.NP....QDFWRRGA---------------
Q013R6_OSTTA/352-465KDIIE..FT...NAH..LLRTYPA.GHR.I....FSNN-----------Y.DP....SEAWDVGA---------------
K1PZR1_CRAGI/575-690..FVN..HN...KKF..LSRIYPN.GMR.V....DSSN-----------Y.NP....QDLWNCGC---------------
Q9XWB7_CAEEL/528-650QN.....LN...KSK..ITRIYPK.ASR.I....YSTN-----------Y.NP....MIHWLTGS---------------
C9SV93_VERA1/293-405FA.....HN...QNY..MMRAYPS.GMR.I....RSSN-----------L.DP....APFWRKGI---------------
A4S165_OSTLU/202-315KDLLE..FT...KAH..LLRTYPG.GQR.I....MSNN-----------Y.DP....SDAWSIGA---------------
N1RC01_FUSC4/282-393FR.....HN...QNH..FFCVTPD.SAS.V....YPSN-----------L.DP....LQFWKHGV---------------
C7ZJB8_NECH7/239-351LF.....HN...KNY..FMGCFPS.GRR.I....DSSN-----------P.DP....SLFWHMGV---------------
G0RBZ6_HYPJQ/342-459AR.....HN...ARH..LMRVFPK.GTR.I....SSSN-----------L.RP....VRFWAVGA---------------
G7P2D3_MACFA/393-508..FVQ..HN...TWQ..LSRVYPS.GLR.T....DSSN-----------Y.NP....QELWNAGC---------------
D2VS67_NAEGR/554-665..FFK..HN...ETL..MTRIYPK.ATR.V....FSTN-----------F.SP....VMYWAAGC---------------
A0A0J9XXP4_BRUMA/969-1079..LVQ..FN...ARQ..LSRVYPQ.GSR.V....TSAN-----------Y.DP....VPMWNAAC---------------
A1CJQ9_ASPCL/375-487LE.....HN...RRF..FMRVYPY.GLR.I....NSSN-----------L.DP....TFFWRCGT---------------
H3A3M2_LATCH/610-722..FIL..FN...QKQ..LIRVYPS.AYR.I....DSSN-----------F.YP....QTYWNVGC---------------
Q21754_CAEEL/494-608FT.....YT...AER..LVKSYPK.GLR.Q....DSSN-----------M.HP....MVSWLCGI---------------
E9G040_DAPPU/487-602.......WTEMVQRS..LLRVFPN.GSR.V....DSSN-----------F.SP....LEFWNAGV---------------
V2Z343_MONRO/363-478..LIK..HT...RGK..LVRIYPK.GIR.V....SSSN-----------Y.EP....HRYWSAGC---------------
W4XRL3_STRPU/213-326..LLD..YN...RKQ..VSRTYPK.GQR.I....DSSN-----------Y.DP....IPIWFCGC---------------
W5N0K4_LEPOC/507-620..FVQ..HN...TRQ..LSRIYPS.GQR.I....QSSN-----------Y.NP....QDMWNCGC---------------
N1QLI7_SPHMS/293-404FK.....HN...LHY..LMRAYPK.GTR.L....RSTN-----------L.DP....TPFWRQGV---------------
A0A0D1CR16_USTMA/993-1113..LIK..HN...RSH..LTRIYPS.MMS.FARLHASRN-----------F.VP....LDMWAAGC---------------
R7YQ07_CONA1/783-900ER.....HN...MRY..LMRVYPA.GWR.I....NSSN-----------F.EP....HRYWRRGV---------------
PLCZ1_CHICK/377-492..FVS..HT...SRF..ITRIYPK.GTR.A....GSSN-----------Y.NP....QEFWNVGC---------------
G1NLG3_MELGA/393-511LNFVNSCRGMNFREY..CAKSFTH.....L....SESG-----------F.KF....QHKFDCNC---------------
H3ERT0_PRIPA/495-607..LVK..HT...TRQ..IVRVYPS.GIR.V....SSSN-----------F.LP....LFCWMAGA---------------
R1EKA9_BOTPV/390-502FQ.....HN...KKY..MMRAYPK.GTR.V....SSSN-----------L.DA....PVFWRQGV---------------
H3CZG1_TETNG/283-398..FVE..YN...KLQ..LSRIYPK.GTR.V....DSSN-----------Y.NP....QLFWNAGC---------------
T1G6Y6_HELRO/929-1047..LVQ..AN...RKC..LTRIYPK.GQR.I....DSSN-----------Y.DP....MPMWNSGC---------------
N4VFU7_COLOR/301-417SR.....HN...AHH..LMRVFPK.GTR.I....SSKN-----------L.HP....VPFWGIGA---------------
PLC1_YEAST/590-709DK.....HN...RRY..LMRVYPH.VLR.Y....KSSN-----------F.NP....IPFWKAGV---------------
Q4DUP6_TRYCC/458-575..FKL..IN...QHC..LSRIYPA.GSR.V....GSSN-----------Y.NP....QLFWNCGC---------------
F4NTE5_BATDJ/674-789VH.....IN...QSH..LSRVYPS.VIR.I....TSSN-----------M.DP....VPLWKCGT---------------
F2TZD4_SALR5/1418-1533..LYT..FT...QQR..LTRVYPA.YHR.F....KSAN-----------Y.DP....QVYWNFGC---------------
S3CWU2_GLAL2/446-558FN.....HN...RDY..FMRAYPA.GFR.I....DSSN-----------L.DP....SVFWRKGI---------------
C5MGF2_CANTT/703-819LK.....HN...RKF..LMRVYPG.GTR.I....NSTN-----------Y.SP....LPYWGVGC---------------
A7S279_NEMVE/566-681..FVK..YN...KRQ..MSRIYPR.GSR.V....DSSN-----------Y.MP....QVFWNVGC---------------
E5STY8_TRISP/976-1085..LLR..FN...RHQ..LSRVYPN.ACR.L....TSSN-----------F.NP....IPMWNAGC---------------
F9WW59_ZYMTI/306-422SK.....HN...SQH..LMRVYPK.GIR.I....SSKN-----------L.NP....VPFWGIGA---------------
S3BUU6_OPHP1/912-1029YY.....HN...MRY..MMRVYPK.AMR.I....GSSN-----------F.NP....LAHWRRGV---------------
F2U5I3_SALR5/965-1082..FNR..YN...IRQ..LSRVYPN.GKR.V....DSSN-----------F.DP....RVMWNAGM---------------
K7H8T9_CAEJA/525-647QN.....LN...KSK..IMRIYPK.ASR.I....YSTN-----------Y.NP....MIHWLTGA---------------
G2WWA7_VERDV/450-561FT.....HN...KNY..FMRAFPN.GAR.F....DSSN-----------P.DS....SLFWRKGV---------------
Q75C92_ASHGO/595-713DK.....HN...RRH..LMRVYPH.AFR.Y....KSSN