Sequence alignment for CL0385

PF00477

M8AP09_TRIUA/1-99MASGQQERSQLDRKAREGETVVPGGTGGTNLQAQENLAEGGVGGGGSRGG..........GHRGGETRKEQMGEEGYREM
I1N2Z5_SOYBN/1-109MESQQANREELDEKARQGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRKQQLGSEGYHEMGTKGGQTRKEQMGREGYQEM
B6T8E4_MAIZE/1-109MASGQESREELARMAEEGQTVVPGGTGGKTLEAQEHLAEGRSHGGQTRSEQLGHEGYSEMGSKGGQTRKEQLGHEGYSEM
B9SWY7_RICCO/2-108..SSDQERAELDARAKRGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRREQLGTEGYKELGHKGGETRREQIGTEGYQEM

PF10685

F2K9S1_PSEBN/11-31-------------------------------------------------------------------NFAN.DREKASAA
H1ZDR5_MYROD/176-197-------------------------------------------------------------------GFAAMSKAKRTEI
F2K9S1_PSEBN/33-53-------------------------------------------------------------------NFAN.NPERASEA
B6JIG6_OLICO/33-53-------------------------------------------------------------------SFSQ.DRELAAEA
T0KID3_COLGC/8-29-------------------------------------------------------------------NFANLPTEEVQAI
R4PVW7_9BACT/15-35-------------------------------------------------------------------NLAK.DPNFYAKI
Q2RPY2_RHORT/37-57-------------------------------------------------------------------SFSK.DHELAAEA
H8KQI3_SOLCM/168-188-------------------------------------------------------------------GFASMDRDEVRRI
Q9I1S5_PSEAE/88-108-------------------------------------------------------------------NFAN.DREKASEA
C4JWK9_UNCRE/9-30-------------------------------------------------------------------NFANRPREEVSEI
A1VMD0_POLNA/25-46-------------------------------------------------------------------GFAAMNPERQRAI
Q65N74_BACLD/64-84-------------------------------------------------------------------SRNH.DKEFYQEI
B0UNQ6_METS4/37-57-------------------------------------------------------------------SFSQ.DRELASSA
U4LG38_PYROM/8-29-------------------------------------------------------------------NFANLPKEEVREL
W0HUX6_9ENTR/36-56-------------------------------------------------------------------NFKN.DPQKASEA
A9HNT7_GLUDA/78-98-------------------------------------------------------------------NFAE.DPERAAEA
F6AHU1_PSEF1/8-28-------------------------------------------------------------------NFAN.DRAKAAEA
B8M151_TALSN/9-30-------------------------------------------------------------------NFSNRSREEVQQI
D7A5A5_STAND/14-34-------------------------------------------------------------------NFAE.DRERAREA
E3RUS8_PYRTT/8-29-------------------------------------------------------------------NFANLPKDELKEI
B9TKS4_RICCO/42-62-------------------------------------------------------------------AHEF.DSEEARRA
A9HNT7_GLUDA/33-53-------------------------------------------------------------------NFAN.NPQKASEA
G0RRG7_HYPJQ/33-54-------------------------------------------------------------------GFASMPKEKVQEI
R0IJT8_SETT2/33-54-------------------------------------------------------------------GFASMDAEKQHDI
Q9I1S5_PSEAE/22-42-------------------------------------------------------------------SRSH.GKEFYQEI
I2BAI7_SHIBC/10-30-------------------------------------------------------------------NFAE.DRERASEA
G9AUI7_PANAN/10-30-------------------------------------------------------------------NFAD.NPQKASEA
Q832V5_ENTFA/11-31-------------------------------------------------------------------.FSERSVDEAREL
B3ERQ6_AMOA5/26-47-------------------------------------------------------------------GFASMPHDKVVEI
A8IPQ2_AZOC5/59-79-------------------------------------------------------------------NFAQ.NPERAAEA
C1DH84_AZOVD/47-67-------------------------------------------------------------------NFRN.DPERASEA
W0HUR7_9ENTR/32-52-------------------------------------------------------------------NFKN.DPQRASTA
S7ZXT6_DACHA/77-98-------------------------------------------------------------------GFGSRPKEEVQEI
H8GPP4_METAL/16-37-------------------------------------------------------------------GFASMDEEKQRAI
C1DH84_AZOVD/25-45-------------------------------------------------------------------AASH.DREFYQEI
H8H0S4_DEIGI/10-31-------------------------------------------------------------------GFAGMDPDKQREI
J7Q4Y3_METSZ/13-34-------------------------------------------------------------------GFASMTPERQREI
B2IC65_BEII9/16-37-------------------------------------------------------------------GFASMDAEKQRAI
E3RUS8_PYRTT/46-66-------------------------------------------------------------------TFAK.GSELAKEL
B2FI17_STRMK/12-33-------------------------------------------------------------------GFASMDQDKQRAI
B6QFR3_PENMQ/63-84-------------------------------------------------------------------NFANRPKEELREI
J3PH43_GAGT3/8-29-------------------------------------------------------------------NFANRPKEEVLAA
Q2RPY1_RHORT/62-82-------------------------------------------------------------------SFSK.DRDLAVQA
B6QFR3_PENMQ/91-111-------------------------------------------------------------------GFHDMDPEKQREI
B8NBA4_ASPFN/9-30-------------------------------------------------------------------NFANRPHDEVEDI
Q8P823_XANCP/52-73-------------------------------------------------------------------NAHEFSSEEAREA
A9F393_SORC5/43-64-------------------------------------------------------------------GFAAMDEDRQRKI
D5QHX6_KOMHA/35-55-------------------------------------------------------------------NFAN.DPKQASGA
K9FYG2_PEND2/78-99-------------------------------------------------------------------GFHNMDPEKQHAI
B2WKF3_PYRTR/9-30-------------------------------------------------------------------NFANRPKEEVKAA
B2IC65_BEII9/67-87-------------------------------------------------------------------SFSQ.NHQLASEA
A9GA31_SORC5/12-33-------------------------------------------------------------------GFAAMDQKQQRAI
T0KID3_COLGC/108-129-------------------------------------------------------------------GFASMDPERQREI
I2BAI7_SHIBC/32-52-------------------------------------------------------------------NFKN.DPQRASEA
A2QAA7_ASPNC/9-30-------------------------------------------------------------------NFANRSHDEVSNI
K2SBH3_MACPH/33-54-------------------------------------------------------------------GFASMDPDKQHEI
Q1QTW4_CHRSD/37-57-------------------------------------------------------------------NFAN.DAARAAEA
H2J2L5_RAHAC/10-30-------------------------------------------------------------------NFAE.DHEKASEA
B1HXT7_LYSSC/15-35-------------------------------------------------------------------SRNH.DRDFYEEI
E3E7D8_PAEPS/64-84-------------------------------------------------------------------SKNH.GKEFYQEI
H6CAI8_EXODN/9-30-------------------------------------------------------------------NFANRPKEEVQEI
G7Z9B2_AZOL4/67-86-------------------------------------------------------------------.FSK.NPSLAAEA
G8ANG5_AZOBR/18-38-------------------------------------------------------------------NFKN.DPERAAEA
Q2RPY2_RHORT/11-32-------------------------------------------------------------------GFASMDEDKQRDI
A4XUQ0_PSEMY/51-71-------------------------------------------------------------------NLAN.DRQKASEA
A4XUQ0_PSEMY/73-93-------------------------------------------------------------------SFAN.DRQKATEA
B6HU15_PENCW/49-70-------------------------------------------------------------------NFANRPREQLSEI
W0HUX6_9ENTR/10-30-------------------------------------------------------------------NFAE.DKQKASEA
Q2Y9I5_NITMU/15-36-------------------------------------------------------------------GFASMDVNKQREI
G2I3R1_GLUMN/55-75-------------------------------------------------------------------NFAE.GPQRATGA
Q5FP81_GLUOX/107-127-------------------------------------------------------------------GFAK.DPQKASEA
Q2Y9I5_NITMU/41-61-------------------------------------------------------------------AHEF.DSEEAREA
Q0CU25_ASPTN/9-30-------------------------------------------------------------------NFSNRPQEQVENI
D5QHX6_KOMHA/79-99-------------------------------------------------------------------NFAN.DPQRAADA
Q0CVP9_ASPTN/33-54-------------------------------------------------------------------GFASMDEDKQRNI
T0KID3_COLGC/45-66-------------------------------------------------------------------NFQNRPTEEVREI
Q1H3J7_METFK/9-30-------------------------------------------------------------------GFAAMSPEKQRQI
G8THY5_NIAKG/328-349-------------------------------------------------------------------GFASMPKEDVSRI
Q1QTW4_CHRSD/60-79-------------------------------------------------------------------.FKH.DPGRAAEA
Q0CMC2_ASPTN/33-54-------------------------------------------------------------------GFASMDPDKQRDI
C1DLN6_AZOVD/9-29-------------------------------------------------------------------NFAN.DPERAAAA
Q2RPY2_RHORT/62-82-------------------------------------------------------------------SFSK.DHELASQA

PF00477

M8AP09_TRIUA/1-99GRKGGLSTNDESGGERAAREGIDIDESKF
I1N2Z5_SOYBN/1-109GRKGGLSTMDKSGGERAEEEGIEIDESKF
B6T8E4_MAIZE/1-109GRKGGLSTMQESGGERAAREGIEIDESKF
B9SWY7_RICCO/2-108GRKGGLSTIDKSGGERAAEEGIEIDESKY

PF10685

F2K9S1_PSEBN/11-31GKKGGHASG--------------------
H1ZDR5_MYROD/176-197ARMGGRASH--------------------
F2K9S1_PSEBN/33-53GRKGGQASG--------------------
B6JIG6_OLICO/33-53GRKGGEHSH--------------------
T0KID3_COLGC/8-29ASKGGQASH--------------------
R4PVW7_9BACT/15-35GRKGGQNGH--------------------
Q2RPY2_RHORT/37-57GRKGGQNVP--------------------
H8KQI3_SOLCM/168-188ASMGGRAS.--------------------
Q9I1S5_PSEAE/88-108GRKGGQHSH--------------------
C4JWK9_UNCRE/9-30GKKGGQASH--------------------
A1VMD0_POLNA/25-46ASEGGKAAH--------------------
Q65N74_BACLD/64-84GEKGGEATS--------------------
B0UNQ6_METS4/37-57GRKGGQASG--------------------
U4LG38_PYROM/8-29AAKGGRSQG--------------------
W0HUX6_9ENTR/36-56GKKGGQHSH--------------------
A9HNT7_GLUDA/78-98GRKDGQHSH--------------------
F6AHU1_PSEF1/8-28GRKGGKQSG--------------------
B8M151_TALSN/9-30GKKGGQSSH--------------------
D7A5A5_STAND/14-34GRKGGEHSH--------------------
E3RUS8_PYRTT/8-29AAKGGHASH--------------------
B9TKS4_RICCO/42-62GQKGGEAVS--------------------
A9HNT7_GLUDA/33-53GHKGGQHSS--------------------
G0RRG7_HYPJQ/33-54ASKGGQASS--------------------
R0IJT8_SETT2/33-54ASKGGKASS--------------------
Q9I1S5_PSEAE/22-42GHKGGQASG--------------------
I2BAI7_SHIBC/10-30GRKGGKMSG--------------------
G9AUI7_PANAN/10-30GKKGGKSSG--------------------
Q832V5_ENTFA/11-31GRKGGKASG--------------------
B3ERQ6_AMOA5/26-47ASKGGHASH--------------------
A8IPQ2_AZOC5/59-79GRKGGQSVP--------------------
C1DH84_AZOVD/47-67GSKGGRNSG--------------------
W0HUR7_9ENTR/32-52GEKGGRRSN--------------------
S7ZXT6_DACHA/77-98GRKGGQARG--------------------
H8GPP4_METAL/16-37ASKGGHASH--------------------
C1DH84_AZOVD/25-45GSKGGQHSG--------------------
H8H0S4_DEIGI/10-31ASEGGRAAH--------------------
J7Q4Y3_METSZ/13-34ARKGGKSVP--------------------
B2IC65_BEII9/16-37ARKGGESVP--------------------
E3RUS8_PYRTT/46-66GAQGGHASH--------------------
B2FI17_STRMK/12-33AAKGGRAAH--------------------
B6QFR3_PENMQ/63-84GRKGGQKGG--------------------
J3PH43_GAGT3/8-29ASKGGKASS--------------------
Q2RPY1_RHORT/62-82GRKGGKSSS--------------------
B6QFR3_PENMQ/91-111ASKGGRAS.--------------------
B8NBA4_ASPFN/9-30ARKGGQSSH--------------------
Q8P823_XANCP/52-73GKKGGQSSG--------------------
A9F393_SORC5/43-64ASKGGKAAH--------------------
D5QHX6_KOMHA/35-55GHKGGRHSP--------------------
K9FYG2_PEND2/78-99AAKGGRARG--------------------
B2WKF3_PYRTR/9-30AQKGGEHSH--------------------
B2IC65_BEII9/67-87GRKGGHASH--------------------
A9GA31_SORC5/12-33ASMGGKAAH--------------------
T0KID3_COLGC/108-129ASEGGKASS--------------------
I2BAI7_SHIBC/32-52GRKGGKNSH--------------------
A2QAA7_ASPNC/9-30AKKGGQSSH--------------------
K2SBH3_MACPH/33-54ASKGGHASG--------------------
Q1QTW4_CHRSD/37-57GRKGGRMSP--------------------
H2J2L5_RAHAC/10-30GKKGGQKSG--------------------
B1HXT7_LYSSC/15-35GRKGGEARS--------------------
E3E7D8_PAEPS/64-84GRKGGEARG--------------------
H6CAI8_EXODN/9-30ASKGGQSSH--------------------
G7Z9B2_AZOL4/67-86GRKGGQASH--------------------
G8ANG5_AZOBR/18-38GHKGGQVSG--------------------
Q2RPY2_RHORT/11-32ASKGGQSVP--------------------
A4XUQ0_PSEMY/51-71GKKGGRSSG--------------------
A4XUQ0_PSEMY/73-93GRKGGRNSH--------------------
B6HU15_PENCW/49-70GHKGGKKGG--------------------
W0HUX6_9ENTR/10-30GRKGGQSSS--------------------
Q2Y9I5_NITMU/15-36ASKGGKAAH--------------------
G2I3R1_GLUMN/55-75GRKGSQHSH--------------------
Q5FP81_GLUOX/107-127GRKGGQASH--------------------
Q2Y9I5_NITMU/41-61GRKGGRAAH--------------------
Q0CU25_ASPTN/9-30ARKGGQSSH--------------------
D5QHX6_KOMHA/79-99GRKGGLHSH--------------------
Q0CVP9_ASPTN/33-54ASMGGQASG--------------------
T0KID3_COLGC/45-66AAKGGHASH--------------------
Q1H3J7_METFK/9-30ASMGGKAAH--------------------
G8THY5_NIAKG/328-349GRMGGEASH--------------------
Q1QTW4_CHRSD/60-79GRKGGRQSP--------------------
Q0CMC2_ASPTN/33-54SSQGGKASS--------------------
C1DLN6_AZOVD/9-29GRKGGHNSG--------------------
Q2RPY2_RHORT/62-82GQKGGQNSG--------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window