Sequence alignment for CL0385

PF00477

Q9M4N9_SECCE/1-89MASG.........QQERSQLDRKAREGETVVPGGTGGTNLQAQENLAEGRSRGGQTRKEQMGEEGYR.............
Q41804_MAIZE/1-106MASG.........QESREELARMAEEGQTVV..ARGGKTLEAQEHLAEGRSHGGQTRSEQLGHEGYSEMGSKGGQTRKEQ
Q41684_VIGRR/1-109MASK.........QANREELHERAKQGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRKQQLGSEGYHEMGTKGGQTRKEQ
Q53WZ7_GOSHI/1-98MASEQYQAMRNAPQEEKEELDARAKQGETVVPGGTRGKSLDAQINLAEGRHKGGETRKQQLGTEGYQ.............
Q5KTS7_DAUCA/1-109MASG.........QEKRSELDARAKQGETVVPGGTGGKSLEAQEHLAEGRSKGGHTRKEQLGTEGYQEIGTKGGETRREQ

PF10685

Q4WEQ4_ASPFU/69-91------------------GFHDMDPEKQH---------------------------------------------------
Q2Y9I5_NITMU/40-62------------------TAHEFDSEEAR---------------------------------------------------
Q832V5_ENTFA/10-32------------------PFSERSVDEAR---------------------------------------------------
Q1QTW4_CHRSD/81-102------------------NFKQ.DSDRAR---------------------------------------------------
Q2TZZ4_ASPOR/33-55------------------GFASTDEDKQR---------------------------------------------------
Q5B365_EMENI/33-55------------------GFASMDSEKQR---------------------------------------------------
Q0CMC2_ASPTN/33-55------------------GFASMDPDKQR---------------------------------------------------
Q0CVP9_ASPTN/33-55------------------GFASMDEDKQR---------------------------------------------------
Q2RPY2_RHORT/11-33------------------GFASMDEDKQR---------------------------------------------------
A3WUR6_9BRAD/21-43------------------GFASMDEQKQR---------------------------------------------------
A1CMJ5_ASPCL/34-56------------------GFASMDPQKQK---------------------------------------------------
A1W2V9_ACISJ/33-55------------------GFASMDPDRQR---------------------------------------------------
Q1H3J7_METFK/9-31------------------GFAAMSPEKQR---------------------------------------------------
A1VMD0_POLNA/25-47------------------GFAAMNPERQR---------------------------------------------------
Q8PJH4_XANAC/36-58------------------GFASMDEDKQR---------------------------------------------------
Q2P183_XANOM/13-35------------------GFAALDPEKRR---------------------------------------------------
Q4UJZ9_RICFE/7-29------------------GFASMDKEKVR---------------------------------------------------
B8IBL9_METNO/11-33------------------GFASMDMERQR---------------------------------------------------
A7IGX3_XANP2/25-47------------------GFAAMDAEKQK---------------------------------------------------
B0T1F5_CAUSK/13-35------------------GFAAMDPERRR---------------------------------------------------
Q0CMC2_ASPTN/9-31------------------NFANRPQEEVE---------------------------------------------------
Q2H2H1_CHAGB/11-33------------------NFANRPKEEVR---------------------------------------------------
A2QAA7_ASPNC/9-31------------------NFANRSHDEVS---------------------------------------------------
Q0U8C2_PHANO/8-30------------------NFANLPKDELR---------------------------------------------------
A1C4V1_ASPCL/40-62------------------NFANRSKEEMS---------------------------------------------------
C1DH84_AZOVD/24-46------------------TAASHDREFYQ---------------------------------------------------
Q9I1S5_PSEAE/21-43------------------TSRSHGKEFYQ---------------------------------------------------
Q5FP81_GLUOX/107-128------------------GFAK.DPQKAS---------------------------------------------------
A6V695_PSEA7/10-31------------------HFAD.DPQKVS---------------------------------------------------
Q8XG29_SALTI/32-53------------------NFKN.DPQRAS---------------------------------------------------
Q88FW4_PSEPK/21-42------------------NFAN.DPQRAS---------------------------------------------------
C1DH84_AZOVD/47-68------------------NFRN.DPERAS---------------------------------------------------
A7ZYV8_ECOHS/10-31------------------NFAE.DRERAS---------------------------------------------------
C1DLN6_AZOVD/31-52------------------NFAN.DPKKAS---------------------------------------------------
A4XUQ0_PSEMY/51-72------------------NLAN.DRQKAS---------------------------------------------------
B0KSL6_PSEPG/24-45------------------NFAN.DREKAS---------------------------------------------------
Q83ZG0_PSEPU/43-64------------------NFAN.DRQRAS---------------------------------------------------
Q5FP81_GLUOX/65-86------------------NFSQ.DRERAS---------------------------------------------------
Q2RPY2_RHORT/84-105------------------NFAN.DPERAA---------------------------------------------------
B0KSK2_PSEPG/21-42------------------NFAN.DRERAS---------------------------------------------------
C5AW15_METEA/37-58------------------SFSQ.DRELAS---------------------------------------------------
Q2RPY1_RHORT/62-83------------------SFSK.DRDLAV---------------------------------------------------
Q2RPY2_RHORT/62-83------------------SFSK.DHELAS---------------------------------------------------
Q2RPY2_RHORT/37-58------------------SFSK.DHELAA---------------------------------------------------
Q1QTW4_CHRSD/37-58------------------NFAN.DAARAA---------------------------------------------------

PF00477

Q9M4N9_SECCE/1-89.......EMGRKGGLSTNDESGGERAAREGIDIDESKF
Q41804_MAIZE/1-106LGHEGYSEMGRKGGLSTMQESG.ERAAREGIEIDESKF
Q41684_VIGRR/1-109MGTEGYKEMGRKGGLSTMDKSGAERAEEKGIEIDESKF
Q53WZ7_GOSHI/1-98.......EMGRKGGLSNSDMSGGERAADEGVTIDESKF
Q5KTS7_DAUCA/1-109MGKEGYEQMGRMGGLATKDKSGAERAEEEGIDIDQSKF

PF10685

Q4WEQ4_ASPFU/69-91-------EIASRGGRATNK-------------------
Q2Y9I5_NITMU/40-62-------EAGRKGGRAAHL-------------------
Q832V5_ENTFA/10-32-------ELGRKGGKASGE-------------------
Q1QTW4_CHRSD/81-102-------EAGRKGGRQRAS-------------------
Q2TZZ4_ASPOR/33-55-------DIASKGGHASSG-------------------
Q5B365_EMENI/33-55-------NIASQGGHASSG-------------------
Q0CMC2_ASPTN/33-55-------DISSQGGKASSG-------------------
Q0CVP9_ASPTN/33-55-------NIASMGGQASGG-------------------
Q2RPY2_RHORT/11-33-------DIASKGGQSVPN-------------------
A3WUR6_9BRAD/21-43-------DIASKGGQAQGR-------------------
A1CMJ5_ASPCL/34-56-------EIASKGGHASSG-------------------
A1W2V9_ACISJ/33-55-------EIAAEGGRAAHA-------------------
Q1H3J7_METFK/9-31-------QIASMGGKAAHA-------------------
A1VMD0_POLNA/25-47-------AIASEGGKAAHQ-------------------
Q8PJH4_XANAC/36-58-------EIASKGGKAAHE-------------------
Q2P183_XANOM/13-35-------VLASSGGKAAHA-------------------
Q4UJZ9_RICFE/7-29-------EIAAKGGHASHG-------------------
B8IBL9_METNO/11-33-------EIASKGGRSVPA-------------------
A7IGX3_XANP2/25-47-------AIARKGGESVPA-------------------
B0T1F5_CAUSK/13-35-------EIARKGGASVPS-------------------
Q0CMC2_ASPTN/9-31-------DIARKGGQSSHQ-------------------
Q2H2H1_CHAGB/11-33-------DIASKGGQASHS-------------------
A2QAA7_ASPNC/9-31-------NIAKKGGQSSHS-------------------
Q0U8C2_PHANO/8-30-------EIAAKGGHASHG-------------------
A1C4V1_ASPCL/40-62-------EIGRKGGRKGGQ-------------------
C1DH84_AZOVD/24-46-------EIGSKGGQHSGG-------------------
Q9I1S5_PSEAE/21-43-------EIGHKGGQASGG-------------------
Q5FP81_GLUOX/107-128-------EAGRKGGQASHK-------------------
A6V695_PSEA7/10-31-------EAGRKGSRHAGG-------------------
Q8XG29_SALTI/32-53-------EAGKKGGQNSHS-------------------
Q88FW4_PSEPK/21-42-------EAGQKGGQMSGG-------------------
C1DH84_AZOVD/47-68-------EAGSKGGRNSGG-------------------
A7ZYV8_ECOHS/10-31-------EAGKKGGQHSGG-------------------
C1DLN6_AZOVD/31-52-------EAGRKGGRNSHG-------------------
A4XUQ0_PSEMY/51-72-------EAGKKGGRSSGG-------------------
B0KSL6_PSEPG/24-45-------EAGRKGGQSSGS-------------------
Q83ZG0_PSEPU/43-64-------DAGRKGGQNSHG-------------------
Q5FP81_GLUOX/65-86-------EAGRKGGEHSHG-------------------
Q2RPY2_RHORT/84-105-------EAGRKGGEASHG-------------------
B0KSK2_PSEPG/21-42-------RAGQKGGKASGG-------------------
C5AW15_METEA/37-58-------SAGRKGGQSTGR-------------------
Q2RPY1_RHORT/62-83-------QAGRKGGKSSSI-------------------
Q2RPY2_RHORT/62-83-------QAGQKGGQNSGG-------------------
Q2RPY2_RHORT/37-58-------EAGRKGGQNVPD-------------------
Q1QTW4_CHRSD/37-58-------EAGRKGGRMSPT-------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window