Sequence alignment for CL0386

PF02876

Q99QN1_STRP1/123-230SKIVGNLLIDGVQQKTL...INPIKIDKPIFTIQEFDFKIRQYLMQTYKIY............DPNSPYIKGQLEIAING
SPEH_STRP1/132-236IKVPVNVWDKSKQQP.....PMFITVNKPKVTAQEVDIKVRKLLIKKYDIY...........NNREQKYSKGTVTLDLNS
Q2FXX5_STAA8/127-232KNIPCNLWIDGHQTEIE...LTAVKTKKKIVTIQELEVQLRNYLNEKYKLY............EQGGDIVKGYVKYYNDD
E8SDQ3_STAPH/157-262.TIYVKVFENSKHII.....TFEIQADKKLVTAQELDAKARKFLIDKLNLY...........EFKGSPYETGYIKFIEND
Q99XW1_STRP1/134-231.........NRKQIPVP...YNQISTNKTTVTAQEIDLKVRKFLISQHQLY............SSGSSYKSGKLVFHTND
Q99ZZ1_STRP1/101-220KNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQKHFNIYGFGDVKDFGRSSRFQSGFEEGNIIFHLNS
SPEG_STRP1/129-232.....ILNQDGKETYLP...SEAVRIKKKQFTLQEFDFKIRKFLMEKYNIY............DSESRYTSGSLFLATKD

PF03642

Q2FWW1_STAA8/51-138--VPYAITVNGTSQNIL---SSLTFNKNQNISYKDLEDRVKSVLKSDRGIS------------DIDLRL-----------
Q2FWW1_STAA8/481-568--VPYTIAVNGTSTPIL---SKLKISNKQLISYKYLNDKVKSVLKSERGIS------------DLDLKF-----------
E8SIY6_STAPH/43-130--IPYSTTIDGATPFVQ---SYLKLSNENVSNFKQLNQKVKSTLKQDYKIS------------ATQIEK-----------
Q2FWW2_STAA8/2-88--.KFPVTINKFENIVS---NEFVFYNASKITINDLSIKLKSAMANDQGIT------------KHDIGL-----------
Q2FWW1_STAA8/376-463--VPYTIAVNGTSTPIL---SDLKFTGDPRVGYKDISKKVKSVLKHDRGIG------------ERELKY-----------
Q2FZS2_STAA8/48-135--VPYTIAVDGIMAFNQ---SYLNLPKDSQLSYLDLGNKVKALLYDERGVT------------PEKIRN-----------
Q2FW51_STAA8/47-134--VPYTISVDGITALHR---TYFIFPENKNVLYQEIDSKVKNELASQRGVT------------TEKINN-----------
E8SIY6_STAPH/149-237--VPYTVTIDGQTAYVQ---SFLNISNKNVTNFYQLNQKVKSALNNEYQLS------------NKDINR-----------
Q2FWW1_STAA8/271-358--VPYSINLNGTSTNIL---SNLSFSNKPWTNYKNLTSQIKSVLKHDRGIS------------EQDLKY-----------

PF02876

Q99QN1_STRP1/123-230.NKHESFNLYDATS.SSTRSDIFKKYKDNKTINMKDFSHFDIYLW
SPEH_STRP1/132-236.GKDIVFDLYYFGN..GDFNSMLKIYSNNERIDSTQF.HVDVSIS
Q2FXX5_STAA8/127-232.EQNVEYDFYNLNG..EYGREVLKMYADNKTINSDKL.HLDIYLF
E8SDQ3_STAPH/157-262.DKSFWYDLMPPPGNNFNQSKYLTMYSDNKTVESKDI.KIEVHLT
Q99XW1_STRP1/134-231NSDKYSLDLFYVGY..RDKESIFKVYKDNKSFNIDKIGHLDIEI.
Q99ZZ1_STRP1/101-220.GERISYNLFDTGH..GDRESMLKKYSDNKTAYSDQL.HIDIYL.
SPEG_STRP1/129-232.SKHYEVDLFNKDDKLLSRDSFFKRYKDNKIFNSEEISHFDIYLK

PF03642

Q2FWW1_STAA8/51-138-SKQAKYTVYFKNGTKKVIDLKAGIY.TADLINTSEIK-------
Q2FWW1_STAA8/481-568-AKQAKYTVYFKNGKKQVVNLKSDIF.TPNLFSAKDIK-------
E8SIY6_STAPH/43-130-SKTAQYTVTWKNGKKQTISLKNDAALSAQKLNVKDI.-------
Q2FWW2_STAA8/2-88-AERAVYKVYFKNGSSKYVDLKTEYK.DERVFKATDIK-------
Q2FWW1_STAA8/376-463-AKKATYTVHFKNGTKKVININSNIS.QLNLLYVQDIK-------
Q2FZS2_STAA8/48-135-AKSAVYTITWKDGSKKEVDLKKDSY.TANLFDSNSIK-------
Q2FW51_STAA8/47-134-AQTATYTLTLNDGNKKVVNLKKNDD.AKNSIDPSTIK-------
E8SIY6_STAPH/149-237-AKTAKYTVTWNNGKKQTINLKSHAQLPGNQISGKDIK-------
Q2FWW1_STAA8/271-358-AKKAYYTVYFKNGGKRILQLNSKNY.TANLVHAKDVK-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window