Sequence alignment for CL0387

PF00186

A9CIC8_AGRT5/5-170-RVTIIVAVSENGVIGRDLDMPWK----LSTD----------------LKRFKA..MTMGKPLIMGRKTFLSV.G...ER
B9LR90_HALLT/20-191-DLVLVAAVAENRVIGDDGGMPWH----YPAD----------------LARFKR..LTTGHPVIVGRATYESI.ADRIGG
Q03Y56_LEUMM/3-164-KIKMVWAEDRQHAIGKDGGIPWH----MPDD----------------LKLFRD..ETVNTLMIMGRPTWLSI.....GR
Q31I54_THICR/13-172-NISMIAAMDKHRIIGADNDMPWH----LPDD----------------LKFFKA..NTVNKPVIMGRKTFESI.G...SK
Q2FYK6_STAA8/2-157-TLSILVAHDLQRVIGFENQLPWH----LPND----------------LKHVKK..LSTGHTLVMGRKTFESI.G....K
Q8EQG1_OCEIH/1-161-MISLLLAMDRNHVIGVNNQLPWH----LPKD----------------LRFFKE..KTTGNTIIMGRKTFESM.G....G
Q5KZ26_GEOKA/1-160-MISHIVAMDENRVIGKDNRLPWH----LPAD----------------LAYFKR..VTMGHAIVMGRKTFEAI.G....R
Q3XZC6_ENTFC/1-161-MLAAIWAQDENGLIGKEDRLPWR----LPND----------------LKFFKQ..MTEANTLVMGRKTFEGM.G...SR
Q03S94_LACBA/1-162-MLIFLWAESQGRVIGLHGGLPWH----LPAD----------------MHYFKT..VTTGHTIVAGSKTFASF.P....R
Q38WX9_LACSS/1-163-MIAFLWAEDQNGLIGQDGHLPWR----LPND----------------LANFKR..ETINEAVIMGRKTYDSL.P...KK
Q1GAP1_LACDA/1-160-MLSYVWAEDEKGAIGYQGRLPWH----LPAD----------------LAHFKA..KTMGHPMLMGRKTFESL.P....G
Q74IU4_LACJO/1-166-MIRFIWAEDENGCIGYQGALPWH----LPAD----------------LKHFKE..LTSNHIIVMGRKTFDSF.P....G
Q1QUE0_CHRSD/18-183-PIALVAAMSRNRVIGVDNKLPWH----LPED----------------LKFFKA..VTMSKPLVMGRKTFESI.G....R
Q3SH97_THIDA/8-166-RVSVIAALAKNRVIGIENRLPWR----LPED----------------LAHFKA..LTLDHPVLMGRKTFESL.G....R
Q168V7_ROSDO/1-156-MITLIVARAENGAIGRDGTIPWD----IPED----------------LKFFQR..ETLGGALIMGRNTWESL.P..VK.
Q5YPL6_NOCFA/9-167-TIGLIWAQTTDGVIGFENTIPWR----VPED----------------MANFRT..VTWGHPVIMGRRTWDSL.PP.KFR
Q5F669_NEIG1/3-161-KITIIAACAENLCIGAGNAMPWH----IPED----------------FAFFKA..YTLGKPVIMGRKTWESL.P...VK
A1SJ32_NOCSJ/7-159-RVVLVAAVARNGVIGDGPDIPWQ----LPGE----------------QRLFKG..LTWGHILVMGRATYDSI.G....R
A1WYQ0_HALHL/3-160-EIVLVAIVGRNGVIGADGDQPWH----FRCD----------------LQRFKA..LTRGHPVIMGRRTLAAI.....GR
Q6A762_PROAC/2-154-KVVAIAAVADNGVIGSGQDMLWH----ISED----------------FRRFKT..VTMGHTLIFGRRTFEQI.G.....
Q0C500_HYPNA/6-171-KLCLIVAQARNRIIGAAGALPWR----LKDD----------------MAFFKA..TTMGAPVIMGRKTWESF.P...KR
A7IF75_XANP2/10-175-PLALVVAVSQNGVIGTDGGLPWR----LPSD----------------LKRFRA..LTWGKPLLMGRRTYESI.G....R
A3HTR7_9BACT/2-163-WISLIAAVAKNGVIGKGNDLVWK----IPTD----------------FKRFKA..ITSGNYILMGRKTFESL.G....K
A5FJX2_FLAJ1/1-159-MIIMIAAVAENNTLGKNNELVWH----LPND----------------FKRFKS..LTTNHHIIMGRKTFESF.P....K
Q1H2G1_METFK/3-159-NLSLIVAVARNRVIGLNNALPWH----LPED----------------LKRFRA..LTTGHHIIMGRKTYESL.N....R
Q13PE2_BURXL/6-160-RVVLVAAMAANRVIGLGNDIPWR----IPGE----------------QKRFRE..LTMNQLVVMGRRTFESI.G....K
A5GBA2_GEOUR/2-155-VISLIAAMAENRVIGRNNAIPWD----IPAD----------------RKRFRA..LTLGHPVIMGRKTFESLAG.....
DRTS_PARTE/6-165-TFSMVLAMTLNGGIGYQNRLPWK----LKED----------------LQRFKK..ITTGGIVIMGRKTFESM.N..SK.
Q6FER8_ACIAD/7-169-EVVHVVAMDQKQCIGKGNALPWH----IPAD----------------LKHFKE..ITQDGVVIMGRKTLESM.G....R
Q6MID1_BDEBA/2-168-ILTHVVACSQNRVIGAQGGLPWS----LPED----------------MKFFRE..TTKGHIMIMGRKTFDSF.N...GR
A5EUV9_DICNV/5-163-KIHLIAAQTLNRVIGKDGGMPWH----LPRD----------------LQHFKQ..RTSGHTIIMGRKTFQSL.K....K
Q9RR65_DEIRA/16-174-DIVAIAAQTENRVIGRDGGMPWH----LPAD----------------FAHFRA..LSVGKPNIMGRKVFDTL....RRK
A1R8Y8_ARTAT/3-172-GIGLVWAQTKSGVIGKDGAMPWH----LPED----------------LKHFSQ..LTTGHPVIMGRKTWLSF.PE.KYR
Q6D0D5_PECAS/2-159-VISLIAALAVDRVIGMENAMPWH----LPAD----------------LAWFKR..NTLNKPIIMGRNTFRSI.G....Q
Q8D3H9_WIGBR/2-161-DISLIWAQSKNKVIGHDQYIPWN----LPED----------------ISWFKK..NTINKPVIMGRKTFESI.K....K
Q7VM78_HAEDU/2-160-FISLIVARTKNHVIGRHNQMPWH----LPRD----------------LMWFRE..KTIDKPIIMGRKTYESI.G....R
Q3JEI1_NITOC/2-160-IISFIVAMDENHLIGANRRLPWH----LPAD----------------LKYFRR..MTMGKPMLMGRSTHEAI.G....R
A1AXR7_RUTMC/2-160-KLSIIVAMDDNQLIGKNNALPWY----LPAD----------------LAYFKK..TTIGKAVLMGRKTYDSI.G....R
A6M379_CLOB8/1-162-MISIIVAIAKDNVIGKDNKLLWH----ISED----------------LKRFKK..ITTGKKMIMGRKTFESL.P....G
Q97EV2_CLOAB/1-152-MLSIIAALNENYVIGNENKLIWH----ISDD----------------LKRFKK..LTTGKTIIMGRKTFESL.P....G
A0PY39_CLONN/1-163-MLSIVVAIGKNNVIGKDHSLPWH----LPND----------------LKYFKKVTLTESKTMIMGRKTFQSL.K....A
Q03F97_PEDPA/1-160-MISMIWAEDLRHGIGKQQSIPWH----IPGD----------------MAFFKK..TTSGNTVVMGRKTFDSI.G....K
A5VJL0_LACRD/3-160-ELNLIWAEDLNGWIGKDNTIPWH----VSAD----------------MKHFKT..KTTGHPIIMGRRTFASL.G...NK
Q6YQS9_ONYPE/1-156-MINLITAFDGNYLIGKDNKLPWH----YSQD----------------LQYFKK..ITLNQNVLMGYETYKSL.KN.YFK
Q47FU1_DECAR/7-169-LISAIGAVASNGMLGLAGWLPWD----IPEE----------------LAYFEK..TVAGAALVIGRLTYESM.......
Q5ZYR2_LEGPH/3-160-LISLIAAIDETGGLGINNQLLCY----LPAD----------------LQHFKS..ITMGKPIIMGRKTYESI.G....K
Q83AB2_COXBU/2-160-IITLIAAMDKNRLIGRNNELPWH----LPAD----------------LAHFKS..ITLGKPIVMGRRTFDSI.G....K
A6LIC1_PARD8/3-163-TISIIAAIADKSAIGKNQQLLCH----MPSD----------------MKRFKE..LTTGHAVIMGRKTFESL.P...VA
D0J2N2_COMT2/3-165-.IQLIYARAANGVIGKDNTMPWH----LPED----------------MAHFKE..LTRGCAVIMGRKTWDSL.PP.RFR
I6SE23_ENTHA/2-162-.FISMWAQDKNGLIGKDGLLPWR----LPND----------------MRFFRE..HTMDKILVMGRKTYEGM.G...KL
DYR_HAEIN/3-159-.FSLIVATTLNNVIGKDNQMPWH----LPAD----------------LAWFRQ..NTTGKPVIMGRKTFESI.G....R
Q04F50_OENOB/1-163-MITSIWAQSKNNVIGRNNHLPWS----LPDD----------------LKFFRQ..ETKNKAVVMGRKTYESF.G...SK
Q5NHY1_FRATT/1-162-MISLIVAYDKNFGIGKENTLAWK----LSED----------------LKNFKK..ITENNYIVMGRKTFESI.G....R
Q63S46_BURPS/4-163-.LTLIVARARNGVIGRDNRLPWK----LPED----------------LAFFKR..TTMGAPIVMGRKTHESI.G....R
Q7CRB0_STRR6/4-163-KIVAIWAQDEEGLIGKENRLPWH----LPAE----------------LQHFKE..TTLNHAILMGRVTFDGM.G...RR
Q8DZ08_STRA5/5-164-.IIAIWAEDEDHLIGVNGGLPWR----LPKE----------------LHHFKE..TTMGQALLMGRKTFDGM.N...RR
Q8Y627_LISMO/1-159-MIIFVWAQDRAGNIGKDNKMPWH----LPGD----------------LQFFKK..TTTGKTLVMGRKTYESL.G....K
R5UBL0_9FIRM/2-161-..NAIVAADKNWAIGYKNKLLVS----IPAD----------------MKFFRQ..MTGGKVVVMGRKTLESF.P..NGL
R5UF95_9BACE/3-162-KISIIAAVDRRMAIGFENKLLFW----LPND----------------LKRFKA..LTTGNTIVMGRKTFESL.P...KG
R5ZA66_9ACTN/4-169-KLSAIVAVCDDWGIGCEGDMVVS----NRAD----------------MRHFVA..CTKGCPVIMGRKTLLSF.P..GGR

PF01872

Q9XBD7_AMYOR/2-196ATVNCNITISADGYSAGHNQTEQRPFGDDGGDGTGDKLHAWMFDSPEENQAEIDQMTA.ATAFIMGRNMFGPVRGEWDRP
RIB7_ARCFU/3-213PYVFVNVAASLDGKISDESRKQLR....ISCEE...............DLRIVDRLRAESDAIMVGI...GTVLADDPRL
RIB7_AQUAE/4-215PYVIIVSEVSVDGKLTLYRGASSKELMSLMDEE...............AYKYLHEIRAKVDGIMVGC...ETVRTDNPSL
Q983M6_RHILO/2-170RKLIVTEFISVDGIAEVEK.............LPGVTWNDE.......MNRFKEDELADSGAMLLGRTTYEIFAGSWP..
Q9XBC6_AMYOR/17-198RTLISTSFVSLDGKLDPTGGDPA.........LHSTKWTFKTVDFLPEAYEIKGREQEEAGALLLGRASYELFAPVWP..
Q98I97_RHILO/10-193RKIIAATFVSLDGVMQAPGGPEED....PVGGFKFGGWTFHYFDEV..GGAAMDELFSKPFTLLLGRRTYDIFTAYWP..
RIBD_BACAM/146-354PYVTLKAAASLDGKTATETGDSKW....ITSEA...............ARLDAQQYRKSHQRILVGA...GTVKADNPSL
Q98JM8_RHILO/2-188KKLILQMQMSVDGFVGANDDHRWQ....LWEWGHDIGWDEE.......LKQDFNAVFAGIDTILLSR...KMAEEGYLTH
C9MFY4_HAEIF/152-365PFVQLKLAMSLDGRTAMASGESKW....ITGPD...............ARSDVQKMRAKSSALLSTS...TTVIADDPSL
Q98HZ2_RHILO/2-179RKLIVFNSISLDGYFTDRHGAMDW....AHSQDPE.............WNAFVADNAKGGGMLVLGRVTYDLMIQFWP..
F7USG8_SYNYG/148-353PFGIFKYAMTLDGKIATAQAHSSW....VTSSS...............ARHWVHQLRSQCQAVIIGG...NTVRRDNPLL
RIB7_METJA/9-218PYIISNVGMTLDGKLATINNDSR.....ISCEE...............DLIRVHKIRANVDGIMVGI...GTVLKDDPRL
B8ZRG4_MYCLB/49-262VWIRANFITSIDGGATADGRTGA.....MAGPG...............DRFVFNMLRELADVIVVGA...GTVRIENYSG
Q9L023_STRCO/25-206RTLISTAFVSLDGVVEAPGGEPG.........YRNTGWTVKLVDFLPEAYEIKGREQEEASALLLGRVSYEAFSPVWP..
J7JWM8_BACIU/146-354PYVTLKAAASLDGKIATSTGDSKW....ITSEA...............ARQDAQQYRKTHQSILVGV...GTVKADNPSL
A0A038FCH1_MYCTX/154-334PHVTWKYATSIDGRSAAADGSSQW....ISSEA...............ARLDLHRRRAIADAILVGT...GTVLADDPAL
Q9F3D0_STRCO/2-176ASLMVDFIISLDGYAAADGWPGFW....GMEGPEYLAW..............LDGDAEKQHTSLMGATTYRLMSGFAR..
Q98LQ3_RHILO/2-178AKIVYSMLTSLDGYIAGPDGDIGL....PVPETE..............LHQHFNDMMRQASAVLAGRRMYETMRFWDS..
RIB7_METTH/3-210PYVILNAAMTLDGKIATATGSSE.....ISGEE...............DLRRVHELRRECDAIMVGI...NTVLADDPRL
RIBD_AQUAE/150-351PYITLKWAQTLDGKLATLTGSSKW....ITSKE...............SRKVAHILRREATAVLVGV...NTVIKDDPHL
RIBD_CORAM/159-333PHVTLKFAQTIDGFTAAADGTSQW....ITGEM...............ARDYVHADREHRDAIIIGT...GTALIDNPSL
RIBD_ACTPL/159-368PYVLMKYAMTADGKIATGSGESKW....ITGES...............ARARVQQTRHQYSAIMVGV...DTVLADNPML
N1PAT9_YEASC/30-237PFVTLTYAQSLDARVSRGPGVRTT....ISHPE...............TKTMTHYLRHHHDGILVGS...GTVLADNPGL
A0A017K3N7_ECOLX/147-362PYIQLKLGASLDGRTAMASGESQW....ITSPQ...............ARRDVQLLRAQSHAILTSS...ATVLADDPAL
D0KPY9_SULS9/5-206PYVIIFSTVSIDGRLATKTGYSE.....LSCPY...............DKQRQHEIRSEVDAVMVGA...NTVRVDNPSL
C4PNP1_CHLTZ/152-363PWVVMKTAASLDGQTADRGGSSQW....ISGEL...............ARADVGKLRAESQAIIVGA...RTVCLDNPRL
A0A038FC92_MYCTX/39-252TWLRANFISSLDGGATVDGTSGA.....MAGPG...............DRFVFNLLRELADVIVVGV...GTVRIEGYSG

PF00186

A9CIC8_AGRT5/5-170..PL----------------PGRPHIIVS.RNAD..YRP....E.G...VD..VVSS-----------------------
B9LR90_HALLT/20-191..PL----------------PDRTSVVLT.TRDL..DLP....E.G...AV..VAND-----------------------
Q03Y56_LEUMM/3-164..PL----------------PKRTTVVMT.RQEDWTPSY..........PEVKVIHS-----------------------
Q31I54_THICR/13-172..PL----------------PNRRNLVIT.RNDA..YEA....N.G...AE..VFHS-----------------------
Q2FYK6_STAA8/2-157..PL----------------PNRRNVVLT.SDTS..FNV....E.G...VD..VIHS-----------------------
Q8EQG1_OCEIH/1-161..AL----------------PNRKNIVLT.SRSD..VQY....P.N...AK..IIHH-----------------------
Q5KZ26_GEOKA/1-160..PL----------------PGRDNVVVT.RNRS..FRP....E.G...CL..VLHS-----------------------
Q3XZC6_ENTFC/1-161..PL----------------PNRQTIVLT.RDSS..YKA....E.G...VH..VMHS-----------------------
Q03S94_LACBA/1-162..PL----------------PNRKNIVVS.HQPA..TAF....PEN...VS..VLHS-----------------------
Q38WX9_LACSS/1-163..PL----------------PGRQNIVIT.RQSG..LTV....AKD...VL..VFNE-----------------------
Q1GAP1_LACDA/1-160..LL----------------PGRQHVVLS.T.....RKLD..LPAG...VL..QLKS-----------------------
Q74IU4_LACJO/1-166..LL----------------PKRKHIILS.TNPILQRRYQ..DNSD...VK..VFSQ-----------------------
Q1QUE0_CHRSD/18-183..PL----------------PGRLNIVVT.RDRG..YAQ...DHDG...IR..VCHD-----------------------
Q3SH97_THIDA/8-166..PL----------------PRRTNVVIT.RNAD..YRP....D.G...CL..VAAS-----------------------
Q168V7_ROSDO/1-156..PL----------------PRRFNIVVS.SNSD...............IAEVVAPS-----------------------
Q5YPL6_NOCFA/9-167..PL----------------AGRRNVVVT.RQPDWSAPG..........AE..RAGS-----------------------
Q5F669_NEIG1/3-161..PL----------------PGRRNIVIS.RQAD..YCA....A.G...AE..TVAS-----------------------
A1SJ32_NOCSJ/7-159..PL----------------PGRTTIVLT.RSPDWSAEG..........VH..VAHD-----------------------
A1WYQ0_HALHL/3-160..PL----------------PQRTNIVLT.RDPG..FHA....D.G...VE..VATD-----------------------
Q6A762_PROAC/2-154..KL----------------PGRRHIICT.RDPH..WS.....HEG...VD..VATS-----------------------
Q0C500_HYPNA/6-171..PL----------------PGRENIVLT.RDWD..YDA....A.E...AR..VYSS-----------------------
A7IF75_XANP2/10-175..PL----------------PGRTSVVVS.TDPA..FTV...PE.G...VL..KGAS-----------------------
A3HTR7_9BACT/2-163..PL----------------PNRTHLVIS.RNKN..YKV....PEG...HH..LFEN-----------------------
A5FJX2_FLAJ1/1-159..PL----------------PNRTHIIIT.RQTD..YN.....PEG...CI..VVDS-----------------------
Q1H2G1_METFK/3-159..LL----------------PDRTTIIVT.RNQN..YHV....P.G...AM..IAHS-----------------------
Q13PE2_BURXL/6-160..PL----------------PGRDLLVLS.SGTS.........RLG...TV.RTVKS-----------------------
A5GBA2_GEOUR/2-155..PL----------------PGRKNIIIT.RQMD..YRA....E.G...CF..IAHD-----------------------
DRTS_PARTE/6-165..PL----------------PNRVNVVIS.KN....MKS...S......NEVQVFPR-----------------------
Q6FER8_ACIAD/7-169..TL----------------PKRVNWVIT.RDPNWQ......FEGA...K...VASS-----------------------
Q6MID1_BDEBA/2-168..AL----------------PNRYHIVVT.RDPS..KQSF..NSTESSPVV..FVAS-----------------------
A5EUV9_DICNV/5-163..PL----------------PNRKNIVIS.HSGQ.........PLH...ADVAVFPA-----------------------
Q9RR65_DEIRA/16-174..PL----------------PERVNIVLT.RNENLKF............DGCLIAHS-----------------------
A1R8Y8_ARTAT/3-172..PL----------------PGRTNIVVT.RNAEWGSTP...EAEG...AV..VVSS-----------------------
Q6D0D5_PECAS/2-159..PL----------------PGRLNIVVS.NHPG..DD.....E.R...VT..WVSS-----------------------
Q8D3H9_WIGBR/2-161..PL----------------ENRINIVLS.KNLY..RNV...MS.N...LK..IAKN-----------------------
Q7VM78_HAEDU/2-160..LL----------------PKRPNIILS.RTEL..KI.....D.G...AY..TATS-----------------------
Q3JEI1_NITOC/2-160..PL----------------PGRHNIVVT.HNPD..YKA....P.G...CT..VVHT-----------------------
A1AXR7_RUTMC/2-160..PL----------------SNRRNIIVS.RNTK..LKV....D.G...CE..VVGS-----------------------
A6M379_CLOB8/1-162..IL----------------PNREHIVLT.RDNN..FNVD..SD.K...VT..IEHD-----------------------
Q97EV2_CLOAB/1-152..VL----------------PNRKHIVIT.K..N..LNYS..RE.N...VS..IVHS-----------------------
A0PY39_CLONN/1-163..LL----------------PGRKHIILT.KNKN..FNMK..DS.N...VE..IINK-----------------------
Q03F97_PEDPA/1-160..AL----------------PNRKNIVLS.HHPTSLPDS..........VV..GVGS-----------------------
A5VJL0_LACRD/3-160..PL----------------PKRENIVLTSRNID.........AEG...VE..VVHS-----------------------
Q6YQS9_ONYPE/1-156NKPF----------------NFKKTYVAS.LKHDLELPN............CTVVSD-----------------------
Q47FU1_DECAR/7-169..DV----------------VPEDSFVVS.RQADLVVRPG.CS......RVASVEEG-----------------------
Q5ZYR2_LEGPH/3-160..PL----------------PGRLNIVIS.QSIQ..SI.....P.G...VV..VVDS-----------------------
Q83AB2_COXBU/2-160..PL----------------PHRRNIVIT.QQKN..LII....E.G...CD..IFYS-----------------------
A6LIC1_PARD8/3-163..PL----------------PNRKNVVLT.TMPE..AGFV..NCFA...CE.....S-----------------------
D0J2N2_COMT2/3-165..PL----------------PGRSNIVVT.RQAD..WQAEPASD.Q...VL..RAAS-----------------------
I6SE23_ENTHA/2-162..SL----------------PYRHIIVLT.TQKD..FKV....EKN...AE..VLHS-----------------------
DYR_HAEIN/3-159..PL----------------PKRTNIVLS.RQ.L..FEH....E.G...VI..WKDS-----------------------
Q04F50_OENOB/1-163..AL----------------PKRLNIILT.SNMD..FKS...NDPE...VK..IVHS-----------------------
Q5NHY1_FRATT/1-162..PL----------------PNRKNIILT.RDKD..YKQ....D.K...CL..IINS-----------------------
Q63S46_BURPS/4-163..PL----------------PGRRNIVVT.RDAA..RRF....D.G...CD..TVTS-----------------------
Q7CRB0_STRR6/4-163..LL----------------PKRETLILT.RNPE..EKI....D.G...VA..TFQD-----------------------
Q8DZ08_STRA5/5-164..VL----------------PGRETIILT.KDEQ..FQA....D.G...VT..VLNS-----------------------
Q8Y627_LISMO/1-159..AL----------------PNRKTIVLT.RDQG..LKL....D.D...AE..ILHS-----------------------
R5UBL0_9FIRM/2-161..PL----------------KNRTNIVLT.GNPN..YHV....K.D...AV..IVHT-----------------------
R5UF95_9BACE/3-162..AL----------------PNRRNVVLS.SNPA..AEC....P.G...AE..VFPS-----------------------
R5ZA66_9ACTN/4-169..PL----------------KNRRNIVLT.RDEG..FAS....E.G...VD..VVHS-----------------------

PF01872

Q9XBD7_AMYOR/2-196WNGWWGDNPP..........FHGPVFVLT-HHERDPQPMDGGTTYH-------FVTDG......................
RIB7_ARCFU/3-213TVKSAELREKRQKDGKE...PNPLRVVVD-SRCRVPLTAR......-------ILNDE.ARTLVAVSRIAPEEKVREVK.
RIB7_AQUAE/4-215TVRYAKG.............KNPVRIIPC-STANVPLDAN......-------VLNTKEAPTIIATTERAPKERLEKIK.
Q983M6_RHILO/2-170..........EETGDFADRFNALPKYVAS-TSLK....ALDWKPAE-------LLTGS......................
Q9XBC6_AMYOR/17-198............GMAEFARYKGLPKYVVS-TTLTENDLVDDWGDNT-------ILR........................
Q98I97_RHILO/10-193..........YQKDPIADAFNPATKYVAT-HRPD....TLTWQNTQ-------WLGED......................
RIBD_BACAM/146-354TCRLPDAV............KQPVRVILD-TKLTVPETAN......-------VLTDGAAPTWIFTAAGSDVRKKDRLT.
Q98JM8_RHILO/2-188WGNAAKKFPADPFYAFAQRIVEVRKVVPS-DRLK....TSRWERST-------VVSGD......................
C9MFY4_HAEIF/152-365NVRWDEFPENLKTEYKKEWLRQPVRVILD-SQHRIQPTHK......-------.LFLTHSPVWLVSSEPRDLTGFPDFCE
Q98HZ2_RHILO/2-179.....TPMAAQIAPVVAERMNAMPKVVFS-RTLD....TVSWNNTE-------LVKSG......................
F7USG8_SYNYG/148-353TNHGVGE.............VNPLRVVLS-RSLDLPIEAQ......-------LWDQDVAKTLVITEKTCDRNTLSHLE.
RIB7_METJA/9-218TVHKIKSD............RNPVRIVVD-SKLRVPLNAR......-------VLNKD.AKTIIATTEDTNEEKEKKIKI
B8ZRG4_MYCLB/49-262AHLPVTKRQQRQARGQS...EVPQLAIVT-NSGRLDRDMA......-------VFTRTEIAPLVLTCTETAKKLRTRLA.
Q9L023_STRCO/25-206............DMAEFPGYRAMPKYVVS-TTLAEDDLVTNWGETT-------ILR........................
J7JWM8_BACIU/146-354TCRLPNVT............KQPVRVILD-TVLSIPEDAK......-------VICDQIAPTWIFTTARADEEKKKRLS.
A0A038FCH1_MYCTX/154-334TARLADGSLAP.........QQPLRVVVG-KR.DIPPEAR......-------VLNDEARTMMIRTHE............
Q9F3D0_STRCO/2-176.........EMPDDPGFEGITAMPKVVFS-STLR...TPLSWDNTE-------LVPGD......................
Q98LQ3_RHILO/2-178..PDRETGATEVERDFADAWRDTPKIVFS-TTLR.....QVGSNAR-------LVNGD......................
RIB7_METTH/3-210TVHRVDAAPG..........DNPVRVVVD-SMARTPPHFR......-------VLNDE.APTVIGVSESAPPERVAELR.
RIBD_AQUAE/150-351TVRFVPTE............KQPVRIILD-PELEVPLSAK......-------VLNTEEAPTIVITKK..ENEKAEKLK.
RIBD_CORAM/159-333TARYPDGTQRE.........HQPRRVVIG-RRN.............-------IADAGDAASNLNRLGF...........
RIBD_ACTPL/159-368NSRMPNA.............KQPVRIVCD-SQLRTPLDCQ......-------LVQTAKEYRTVIATVSDDLQKIEQFR.
N1PAT9_YEASC/30-237NCKWGPDPAA..........NSPRPIIID-TKQKWRFDGSKMQELF-------IKRQGKPPIVVVTSEPIIKEQHVDYA.
A0A017K3N7_ECOLX/147-362TVRWSELDEQTQALYPQQNLRQPIRIVID-SQNRVTPVHR......-------.IVQQPGETWFARTQEDSREWPETVR.
D0KPY9_SULS9/5-206TVKYGKNR............RNPIRVVVT-RSFNLDPSYK......-------IFTT..PPSTVIYTSNYESEKVEEFI.
C4PNP1_CHLTZ/152-363SARFPHGDLYE.........RQPLRVVVD-SRGTVPLESR......-------VFDLSSGSTLFATTQQCPKEYIQKLK.
A0A038FC92_MYCTX/39-252VRMGVVQRQHRQARGQS...EVPQLAIVT-RSGRLDRDMA......-------VFTRTEMAPLVLTTTAVADDTRQRLA.

PF00186

A9CIC8_AGRT5/5-170-------------------LDEAV......K.LAKTKAVELGVDEVF.VAGGGEIYRQAMPFAD...QLSVTHVA..VKL
B9LR90_HALLT/20-191-------------------LDEAVDLAGADA.ADRGV......DDVY.VIGGATVYEQFLDRAD...RMVLTEVP..EQP
Q03Y56_LEUMM/3-164-------------------IEEAK......NLIAKEE.....R.DIT.IAGGAAVYREFMPYAT...DLVITRVDGVID.
Q31I54_THICR/13-172-------------------AEEAL......K.SCKSE......VEII.IMGGGQLYAQMMPFAN...KLYVTLVD..AEV
Q2FYK6_STAA8/2-157-------------------IEDIYQ....LP............GHVF.IFGGQTLFEEMIDKVD...DMYITVIE..GKF
Q8EQG1_OCEIH/1-161-------------------IDTIKQ....WN.IENPE......EEYF.VIGGANLFQQVMDIAD...RMYITWID..ESF
Q5KZ26_GEOKA/1-160-------------------LEEVK......QWIASRA......DEVF.IIGGAELFRATMPIVD...RLYVTKIF..ASF
Q3XZC6_ENTFC/1-161-------------------VEDVL......A.LEKET......DGIFFIAGGSAVYQEFLPFCT...ILYRTVIH..HVF
Q03S94_LACBA/1-162-------------------LPAVR......A.YAAAR....PQEKIF.VVGGAQLFAGLLDDVD...FLYRTRID..AGF
Q38WX9_LACSS/1-163-------------------RTQLL......D.YQKEH....PMQKLF.IIGGADIFKLFAADVD...YLYVTKIA..EKF
Q1GAP1_LACDA/1-160-------------------EEEVS......AWLKE......QAGEVC.VIGGSSLFALLADQVD...KLEVTRIK..GIF
Q74IU4_LACJO/1-166-------------------IEQLK......NWIED......HTEEIIDIIGGAEVFKEFKDEVD...VLEKTKIH..HIF
Q1QUE0_CHRSD/18-183-------------------LASALDMADGQA.IIDGV......EDIC.VIGGGEIFAEALPCAT...RLYLTEVD..IEV
Q3SH97_THIDA/8-166-------------------MPAAI......A.LCQGA......DEIF.FIGGAELYAQAIPLAD...RLYLTEVD..AEP
Q168V7_ROSDO/1-156-------------------VETAI......EIAKAQD....HQ.RIY.GIGGASIYAEMLPLAH...RLLISEVQ..LQV
Q5YPL6_NOCFA/9-167-------------------LTEAL..........ALT....EPESVW.IAGGAQIYETAMDFAT...ELLVTEVQVSVQ.
Q5F669_NEIG1/3-161-------------------LEVAL......A.LCAGA......EEAV.IMGGAQIYGQAMPLAT...DLRITEVD..LSV
A1SJ32_NOCSJ/7-159-------------------LPAAL........ALADT....LEGEVM.VAGGGQVYAAALPVAD...EQVLSEVDLEPQ.
A1WYQ0_HALHL/3-160-------------------PEAALARAAESA....GG......ERVM.ILGGGDVYRLFLPRAH...RLALTEVD..DAP
Q6A762_PROAC/2-154-------------------PRQAV........EMARE....AGEEICFVAGGGQIYADAFELCD...ELDITEVH..QNP
Q0C500_HYPNA/6-171-------------------FPAAMNAARAIA.AREGK......DEAF.VIGGAEIYALALPFAD...RIYLTEVD..AEI
A7IF75_XANP2/10-175-------------------LEDGLRLADEAA.DAMGA......DEIM.VIGGARLFHDTLPLAR...TLHLTQVH..AAP
A3HTR7_9BACT/2-163-------------------VEDAF......I.YCNKL....GIEKLY.VIGGGEIYKQTISIAD...ELLITEVD..ATP
A5FJX2_FLAJ1/1-159-------------------MEKAI......AACPENE.......DSY.IIGGGEIYNLGLPYAD...IIEITKVH..HTF
Q1H2G1_METFK/3-159-------------------LEQAI......D.MAADD......AEAF.LIGGAELYQAGLKLAD...RLYITEID..AEF
Q13PE2_BURXL/6-160-------------------FAEVT......A.AVNND....PREAIF.VGGGQQVYAMLMPYAD...VVYLTEID..LRP
A5GBA2_GEOUR/2-155-------------------LASAL......A.MAGET......DEIF.ICGGGEIYRQALPIAD...RIYLTIIH..SRF
DRTS_PARTE/6-165-------------------IEDAL......QFYNTSH.....Q.KLY.LIGGKRIFEEGL.ATDKCSDVHLTRIGVETK.
Q6FER8_ACIAD/7-169-------------------IEAALK...GAAQDLQHT....DKKTLF.IIGGGEIFKQTINIAD...RLELTHVE..LDV
Q6MID1_BDEBA/2-168-------------------IEEAVK....HAEPLTAK....WGDEVF.IIGGGEIYKQAMPITD...KIYLTLIH..REF
A5EUV9_DICNV/5-163-------------------ISEAL......A.FCCND......EKVF.IIGGGSLYAATIDEAD...FLTITWIH..TEL
Q9RR65_DEIRA/16-174-------------------PEEAL......QLAGDAP.......EIA.IIGGEEIYRLYWDRLT...RLEMTLIHAELD.
A1R8Y8_ARTAT/3-172-------------------LDAALL...ESQFAPGGQ.......KVW.IIGGGEIFEQSMGIAN...LAVITIIDADLE.
Q6D0D5_PECAS/2-159-------------------LDAAL......A.AAGEV......EEVM.VIGGGSVYQQMLSQAN...RLYLTHID..AEV
Q8D3H9_WIGBR/2-161-------------------PKQAL......F.FAKNY......NEVM.IIGGKQIYKIFLPKAT...KLYLTVIN..AEI
Q7VM78_HAEDU/2-160-------------------LAEAI......E.LAKKF....TAEEIM.VIGGGELFKQALPLAQ...RLYLTEIE..ADI
Q3JEI1_NITOC/2-160-------------------VEAGL......Q.AAGEA......EEVT.VIGGASLYEQLLPQAR...RIYLTLVR..GHF
A1AXR7_RUTMC/2-160-------------------INVAL......N.LVNGA......NELM.IMGGVSFYEQMIDKVD...RIYITEVN..GKF
A6M379_CLOB8/1-162-------------------FNSVL......QRYSECE......DEVF.VIGGAEIYKQFLPYAK...KLYLTKVD..EEF
Q97EV2_CLOAB/1-152-------------------IDEII......E.LKDTT......EENF.IIGGGEIYRALIPYCS...ILYLTKVH..SNQ
A0PY39_CLONN/1-163-------------------ID.ML......KPIINDK......KEYF.VIGGGEIFSLLLPYTE...KIYMTKIH..HNF
Q03F97_PEDPA/1-160-------------------LSELQ........AIFET....HPNEKFYIIGGSHLYNALLSQAD...ELLITRIQ..KDY
A5VJL0_LACRD/3-160-------------------LAALK........EYLKA....NPNEYF.VIGGATIYQQLLPMAT...KLTRTVIN..KQI
Q6YQS9_ONYPE/1-156-------------------LQSFM..........ASD....AAQDIF.IIGGGKIYQQTLPWVT...TLYITHIL..QR.
Q47FU1_DECAR/7-169-------------------LHRAL..........ATG.....K.PVF.VIGGASVYAAAWRYCH...RFYLTRIERAFD.
Q5ZYR2_LEGPH/3-160-------------------LGRAI......K.ETADA......SEVM.IIGGAKIYSQAISMAN...RLYITRIH..HQF
Q83AB2_COXBU/2-160-------------------LDDAL......S.ALTKE......PEVI.IIGGARIFKEALPKAD...KMILTIIN..HSF
A6LIC1_PARD8/3-163-------------------MGAAL......D.LCEKE......DEIF.IIGGALVYRQALRIAD...KMYITRIH..HEF
D0J2N2_COMT2/3-165-------------------LSEAL......E.LGRNL.....SQDVW.VIGGAQIYAQALPLAD...AVEVTEIG..RDF
I6SE23_ENTHA/2-162-------------------IDELL......A.YAKDI.....PEDIY.VSGGSRIFQALLPETK...IIWRTLID..AEF
DYR_HAEIN/3-159-------------------FESAV......N.FVRDF......DEIM.LIGGGELFKQYLPKAD...KLYLTQIQ..TEL
Q04F50_OENOB/1-163-------------------PIEAV......N.TAKEQ.....HLPLY.VIGGASVYESFMNMAD...RLLITLVD..ANI
Q5NHY1_FRATT/1-162-------------------TQDIL......N.FAESK....PHYEIF.IIGGAQIYKEFLKYAD...RLYITEVD..AEM
Q63S46_BURPS/4-163-------------------LDDAL......A.LAARD....GAAEAF.LIGGAQLYEEGLRHAD...KLIVTEID..QDF
Q7CRB0_STRR6/4-163-------------------VQSVL......D.WYQDQ.....EKNLY.IIGGKQIFQAFEPYLD...EVIVTHIH..ARV
Q8DZ08_STRA5/5-164-------------------VEQVI......K.WFQEH.....NKTLF.IVGGASIYKAFLPYCE...AIIKTKVH..GKF
Q8Y627_LISMO/1-159-------------------KEAVL......A.LAETG......EPIY.IVGGAEIYRLFMDVAD...QLIVTKID..AEF
R5UBL0_9FIRM/2-161-------------------TEELL......E.ELKKY....DEEEIF.VIGGESIYRMMLPYCS...KVYVTKID..HAY
R5UF95_9BACE/3-162-------------------LEAAL......Q.SCKED......EHVY.IIGGASVYQQALPFAD...ELCLTEID.STAP
R5ZA66_9ACTN/4-169-------------------IDEAL......A.AVADE......PVAW.VLGGGEVYRQFLPYCV...EAEVTHNH..CTH

PF01872

Q9XBD7_AMYOR/2-196...................IESAL------EQARAAA----GDGEVT-ILGGATTINQ.YLAAGLIDEVRLHIVP--FTL
RIB7_ARCFU/3-213...KVAEVAVFG..EERVELSALL------EFLHRK.----GVRRLM-VEGGGTLISS.LISQNLVDEIRIYYGP--IFI
RIB7_AQUAE/4-215..ELGAEVIVVG..DELVDFDKLL------PELYRR.----GIKSLM-VEGGASINWE.FVRRRVVDEIRLIHLP--VIV
Q983M6_RHILO/2-170...................LPEAV------RTLKQG.----SGGNIY-VHGSLSLAQE.LLRHGLVDRVRLLSYP--GAV
Q9XBC6_AMYOR/17-198...................SLDEV------AELKQT.----EGDPIL-VHGSATLNRA.LHEAGLIDRYHLLVFP--ILL
Q98I97_RHILO/10-193...................IVAAL------RRLSKQ.----DGPDLL-IQRSADLIQT.LLANGLIDEIRLMIFP--LLL
RIBD_BACAM/146-354..ALGIKVFTLE..TDRIHIPEVL------SILAEN.----GIMSVY-VEGGASVHGS.FVKAGCFDELHFYFAP--ILI
Q98JM8_RHILO/2-188...................LPREV------NALKAG.----EGGDII-VFGGAGFASS.LIAAGLVDEFQLFVNP--AVL
C9MFY4_HAEIF/152-365QIIFPKENL..........LKELM------RELGKR.----QINTLW-VEAGANLSGS.LIDAKLVDELIIYIAP--KLL
Q98HZ2_RHILO/2-179...................PAAKL------RELKQQ.----PGNHMT-ILGSGNLVAQ.LAEENLIDEYQFVIVP--IML
F7USG8_SYNYG/148-353..KLEVETLVLE....QLTPLAVM------EELYQR.----NCLQVL-WECGGILAAE.AIAMGTVQKVHAFLAP--KII
RIB7_METJA/9-218LEDMGVEVVKCG..RGKVDLKKLM------DILYDK.----GIKSIL-LEGGGTLNWG.MFKEGLVDEVSVYIAP--KIF
B8ZRG4_MYCLB/49-262..DLAYVVSCSGDDPSKVDETVVL------ATLQTR.----GLRRVL-TEGGPMLLGS.FIQHGMLDELCLTIAP--LIV
Q9L023_STRCO/25-206...................SLDEV------AALKEG.----EGGPII-VHGSAALNRS.LSDAGLIDRYHLLVFP--LLL
J7JWM8_BACIU/146-354..AFGVNIFTLE..TERIQIPDVL------KILAEE.----GIMSVY-VEGGSAVHGS.FVKEGCFQEIIFYFAP--KLI
A0A038FCH1_MYCTX/154-334...................PMEVL------RALSDR.----..TDVL-LEGGPTLAGA.FLRAGAINRILAYVAP--ILL
Q9F3D0_STRCO/2-176...................PVPAV------RDMKRH.----GTRPLR-TLGSLTLCRS.LLRAGLVDRFRVVVFP--VIT
Q98LQ3_RHILO/2-178...................AETAV------RSLKTK.----.TDGLV-ILGGADLAAD.LTRAGLIDEYRLYMHP--VVL
RIB7_METTH/3-210...KRAEVVVAG..TRRVDLHLLL------ERLHGM.----GIERLM-LEGGSTLNYS.MLTGGLVDEVRVCIAP--MIV
RIBD_AQUAE/150-351..EKGVQVLILK....GFNLKNIL------KKLKEL.----EIMHLM-VEGGPRTLTS.FLKEGFFDRIVVFIAP--KIM
RIBD_CORAM/159-333..............EQYATIDEAL------AELYAT.----GARDVL-VEGGAGLASG.FANQGLVDWLQVYQAP--LLL
RIBD_ACTPL/159-368..PLGVDVLVCKARNKRVDLQDLL------QKLGEM.----QIDSLL-LEGGSSLNFS.ALESGIVNRVHCYIAP--KLV
N1PAT9_YEASC/30-237.......ICPINDTTKLVDWKKLF------EILKEEF----NIRSVM-VEGGANVINQLLLRSDIVNSLIITIGS--TFL
A0A017K3N7_ECOLX/147-362.......TLLIPEHKGHLDLVVLM------MQLGKQ.----QINSIW-VEAGPTLAGA.LLQAGLVDELIVYIAP--KLL
D0KPY9_SULS9/5-206..RKGVIV......RKFLHLDDLL------EDLYDNF----NVRRLM-VEGGGHLIWW.FIKDNLYDEIRITISP--RIF
C4PNP1_CHLTZ/152-363..DLGVEVWESS..SHQVDLKGLL------RYLAER.----GCLQVL-VEGGAQLHSA.FWQQKLVNAGVIYWGP--KFL
A0A038FC92_MYCTX/39-252..GLAEVIACSGDDPGTVDEAVLV------SQLAAR.----GLRRIL-TEGGPTLLGT.FVERDVLDELCLTIAP--YVV

PF00186

A9CIC8_AGRT5/5-170.D.GDTFFP.EIDP.AVFEKTEEKAASAGEK....DNYPVLFTTYVR
B9LR90_HALLT/20-191.D.GDTRFP.DWDD.EEWVETEREVVGADGER.GGEADALAFVTYER
Q03Y56_LEUMM/3-164...GDTFVD.EVDL.TQFQLKSSEPHAKDDN....HDYAFVVERYER
Q31I54_THICR/13-172.A.GDTTFP.EWLT.DEWQEISKEWHDKDER....HAYAFEFVTLIR
Q2FYK6_STAA8/2-157.R.GDTFFP.PYTF.EDWEVASSVEGKLDEK....NTIPHTFLHLIR
Q8EQG1_OCEIH/1-161.T.GDTFFP.KFNQ.EDWIISSKIKGDKDEK....NPYDYYFIQYDR
Q5KZ26_GEOKA/1-160.P.GDTFYP.PISD.DEWEIVSYTPGGKDEK....NPYEHAFIIYER
Q3XZC6_ENTFC/1-161.D.GDAYFP.PVDW.SDWSLINTSQGEMDEK....NRYPHQFETYQR
Q03S94_LACBA/1-162.D.GDTWMP.VIDY.SQFTLIDQQPGIRNEK....NPYDFVFEQYQR
Q38WX9_LACSS/1-163.K.GDVYMP.TIDY.TQFKLISQKAGAVDER....NQYPHTFEIYQR
Q1GAP1_LACDA/1-160.S.ADTYMP.NLDW.AAFALVKSEAHRADGK....NKYDYVFETYLR
Q74IU4_LACJO/1-166.K.CDTWMP.ELKY.EDFKLVNSESHHPNGN....NKFDYDFLEYKR
Q1QUE0_CHRSD/18-183.E.GDAWFP.AFDA.REWQETQRVPGQGGE.....GKPEYAFVHYTR
Q3SH97_THIDA/8-166.E.GDAWFP.EFDR.AAFREISRASHVGEKG....DVLRFDFVVYER
Q168V7_ROSDO/1-156PD.ADTFFP.HVDL.AEWHQIDRRSLR........ESDPACFVVEHL
Q5YPL6_NOCFA/9-167...GDAHAP.VI..GAQWRLAEAGPER....T.STTGLKFRINRYVR
Q5F669_NEIG1/3-161.E.GDAFFP.EIDR.THWREAERTERRVSSK.....GVAYTFVHYLK
A1SJ32_NOCSJ/7-159...GDAFYP.EFDR.SEWRETAREQHD...........GYDRVVLVR
A1WYQ0_HALHL/3-160.P.GDTTFP.AIGP..EWQETARE...EAEE....DGYRLTFRTLLR
Q6A762_PROAC/2-154.N.GAARFP.AIDP.EVWVEVRRE...........SRDGFDFVGYRR
Q0C500_HYPNA/6-171.E.GDTLFP.ELDL.RQWRSDEIATHPAGEG....NDHAFIIRRLDR
A7IF75_XANP2/10-175.D.GDVFFP.AFDE.AQWREIARDGPIQGEK....DEAAFTALTLVR
A3HTR7_9BACT/2-163.V.GDTYFP.EIDK.NTWKIVSKESFPSDEI....NQHPFSFINYER
A5FJX2_FLAJ1/1-159.E.GDAFFP.KISK.SEWQLVESEENFKDEK....HLYDYTYETYIR
Q1H2G1_METFK/3-159.A.GDAFLP.AFDL.RDWQKVASEEMV..SA....QGLPFRYITYVR
Q13PE2_BURXL/6-160.P.GDAFFP.EIPE..RFSLPDSVDFPG........EIRYTFNTYAV
A5GBA2_GEOUR/2-155.D.GDTRFP.EI.P.ERFVEVGRETVE........NAIPYSFVLYDK
DRTS_PARTE/6-165...CDVYLNKNI..FSTFQVNKTSQTK....S..ENGINYDYQHLIN
Q6FER8_ACIAD/7-169.Q.GDAYYP.AI.P.SQFNKVSSEKHF.DDK....TGIAFEFVSYQK
Q6MID1_BDEBA/2-168.P.GDTYYP.EIDE.KVFTQTERRDIE........TPIPFSFLTYLR
A5EUV9_DICNV/5-163.L.GDTFFP.PIRP.QDWQETHRSHFAADAK....NAFALDFVDYQR
Q9RR65_DEIRA/16-174...GDTFFP.EI..GPEWELAQETFRPADEK....NRYDLTFQTWRR
A1R8Y8_ARTAT/3-172...GDTYAP.EL..GDDWTFDAVAPAD.GWLT.AKNGTNYRFTTWRR
Q6D0D5_PECAS/2-159.E.GDTHFP.DYEP.DEWQSVFSEFHDADER....NSHSYCFEILER
Q8D3H9_WIGBR/2-161.N.GNIFFP.RYNR.KKWILSFEKYFNSDTK....NKYSMYFRIFNK
Q7VM78_HAEDU/2-160.E.GDTYF..AFNE.QDWQLIRKESSEIDEH....NNYVCHFMQFER
Q3JEI1_NITOC/2-160.Q.GDTWFP.AFDP.GTWVEVWREDYDPDPQ....NPYPYSFIRLER
A1AXR7_RUTMC/2-160.D.GDTYFP.EFDR.TKFSELSRESHQPDEK....NLHAHNFVILQK
A6M379_CLOB8/1-162.E.GDTYFP.GINY.SNYNTEYTSEKFIDEK....NGLHYTFVNLIQ
Q97EV2_CLOAB/1-152.T.GDAFFP.KFDE.NDYSIIAT......EK....HG.DYDFVTFKR
A0PY39_CLONN/1-163.I.GDTFFP.NINR.YDWNTTKEIQGITDEK....NVYNHTFLILNR
Q03F97_PEDPA/1-160.Q.CEVLAP.DITQ.NEFKLASSVEHESTER....NP.AYTFETWIR
A5VJL0_LACRD/3-160.V.GDTKMP.TIDY.DRWHLVNHNNYEKDDQ......LICRFEEWEL
Q6YQS9_ONYPE/1-156.HQGNVFFP.KIDL.SQYQLIQKEIHP...........QLIFAIYQK
Q47FU1_DECAR/7-169...GDSRFPESVQL.SDWKVESETVRQLREYK.SNTDVTCRFLIYQQ
Q5ZYR2_LEGPH/3-160.T.ADVFFP.KINE.LAWCCRSKEYRQHDDK....NQYDMTFCVYER
Q83AB2_COXBU/2-160.E.GDVYFP.EWND.KEWKITSQIKHERDEK....NPYPFQFLELRR
A6LIC1_PARD8/3-163PD.ATSFFP.VVNW.DLWEETEREEYPADEK....NPYPYTYITYVR
D0J2N2_COMT2/3-165.E.GDAFAP.EL.G.EQWQAVSRSEHV..SA....NGLPYCFVRFER
I6SE23_ENTHA/2-162.E.GDTFIG.EIDF.TSFELVEEHEGIVNQE....NQYPHRFQKWQK
DYR_HAEIN/3-159.D.GDTFFP.QLNW.EEWEIEFDEYRKADEQ....NRYDCRFLILTR
Q04F50_OENOB/1-163.K.GDTFAP.NFSE.KSFSLVSQCHHAQDKK....HAYSFDFLTYER
Q5NHY1_FRATT/1-162TD.LDAFFP.QWDK.SKYKRIGHKQFKKDDK....NEFDFTFSVFEK
Q63S46_BURPS/4-163.E.GDASFP.APDP.AQWEAVSRDAHRAAQP....NDFTYAFVVYRR
Q7CRB0_STRR6/4-163.E.GDTYFPEELDL.SLFETVSSKFYAKDEK....NPYDFTIQYR..
Q8DZ08_STRA5/5-164.K.GDTYFP.DVNL.SEFKVISRDYFEKDEQ....NAHAFTVTYFEK
Q8Y627_LISMO/1-159.E.ADTAFP.EVDW.ENFSEVAKEFHEKDEK....NKYNYTFYTYER
R5UBL0_9FIRM/2-161.Q.ADTYFP.NLDQLEDWEMTEVSEEH..TC....FDLEYVFSTYER
R5UF95_9BACE/3-162.E.ADAFFP.EVSP.AVWHEKNREAHPADEK....HLCSYAFVDYV.
R5ZA66_9ACTN/4-169.A.VDTYFP.DLDADPAWEIARRGGVATIASGEGDEGVDYEFVTYRR

PF01872

Q9XBD7_AMYOR/2-196---GA..GTRLFEG-VPP.......LKLEQVKSRATTSVTHV-----
RIB7_ARCFU/3-213---GGRDSPTVCDG-ESFL......KKCRIEKIERIGEGFAV-----
RIB7_AQUAE/4-215---GGENVPTLVGG-EGFKKLKNL.LHLRLRSHFVRGKQLIT-----
Q983M6_RHILO/2-170---GQ..GKPLFPQ-GEQVA.......LELISATPFSNGVVA-----
Q9XBC6_AMYOR/17-198---GA..GKPLFSD-ADLPA.....TRLKLVEHEVYPNGIQK-----
Q98I97_RHILO/10-193---GK..GKRLFGD-GAMP......AAFKLVKSQTSSTGVII-----
RIBD_BACAM/146-354---GGTLAPSLISG-EGFQSMKDV.PHLQFTQITQIGPDIKL-----
Q98JM8_RHILO/2-188---GA..GRRIFDQ-GGFRN.......LRLLGSKAYACGMVV-----
C9MFY4_HAEIF/152-365---GD.NARGLCQL-PNLTKLADA.PLWQLNELEQIGDDIKL-----
Q98HZ2_RHILO/2-179---GA..GRTMFEG-IGNR......LNVKLARSQAFGNGNVF-----
F7USG8_SYNYG/148-353---GGVAAPTPVGE-LGFQQMTQA.LNLTDLHCQAIGPDWLF-----
RIB7_METJA/9-218---GGKEAPTYVDG-EGFKTVDEC.VKLELKNFYRLGEGIVL-----
B8ZRG4_MYCLB/49-262---GGRARRIATGP-EQLL......TRMRCAHVLTDDAGYLY-----
Q9L023_STRCO/25-206---GA..GKRLFSD-SDKDA.....RKLRLVEHEVYANGIQK-----
J7JWM8_BACIU/146-354---GGTHAPSLISG-EGFQSMKDV.PLLQFTDITQIGRDIKL-----
A0A038FCH1_MYCTX/154-334---GG..PVTAVDD-VGVSNITNA.LRWQFDSVEKVGPDLLL-----
Q9F3D0_STRCO/2-176---GATGRERIFDQ-YPDVT.......LDLVGSRTFDGRLQL-----
Q98LQ3_RHILO/2-178---GG..GKPYFQS-GLSLA.......LKPLGTESLPQGVTL-----
RIB7_METTH/3-210---GGRDARTLVDG-EGIDEMADA.IRLELKRSYTLGEDLIV-----
RIBD_AQUAE/150-351---GE...GLSIGD-LGIRSIEES.LKVRKKKVENLGEDLVI-----
RIBD_CORAM/159-333---GE.........-.GISVLAHP.LTNTLKGASALCPRAAS-----
RIBD_ACTPL/159-368---GGKQAKTPIGG-EGIQQIDQA.VKLKLKSTELIGEDILL-----
N1PAT9_YEASC/30-237---GSSGTEVSPPQ-T.........VNLKDMSWWKGITDVVL-----
A0A017K3N7_ECOLX/147-362---GS.DARGLCTL-PGLEKLADA.PQFKFKEIRHVGPDVCL-----
D0KPY9_SULS9/5-206---GN..GVSFTQG-EGFIGEDSPRLELIDAKICECGNEVHL-----
C4PNP1_CHLTZ/152-363---GDQGQPMLRDL-QLSLVTAEH.VRITETSLVRDSVKTCF-----
A0A038FC92_MYCTX/39-252---GGLARRIVTGP-GQVL......TRMRCAHVLTDDSGYLY-----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window