Sequence alignment for CL0387

PF00186

B7X1J0_COMTE/2-165-AIQLIYARAANGVIGKDNTMPWH----LPED----------------MAHFKE..LTRGCAVIMGRKTWDSL.PA.RFR
A9CIC8_AGRT5/5-170-RVTIIVAVSENGVIGRDLDMPWK----LSTD----------------LKRFKA..MTMGKPLIMGRKTFLSV.G...ER
B9LR90_HALLT/20-191-DLVLVAAVAENRVIGDDGGMPWH----YPAD----------------LARFKR..LTTGHPVIVGRATYESI.ADRIGG
C5IKW9_9PSED/7-162-RIYLVAAMGANRVIGNGPNIPWK----IPGE----------------QKIFRR..LTEGKVVVMGRKTFESI.G....K
DYR_STAHA/6-164-KISLIVAMDKKRVIGKDNDIPWR----ISSD----------------WEYVKN..TTKGHAIILGRKNLQSI.G....R
Q6A328_PASMD/4-169-KYSLIVAIGKHREMGADNDLLWH----LPRD----------------MQFFKE..TTTGHAVVMGRKSWESI.PQ.KYR
A6DH01_9BACT/2-160-KTSMICAMASNRGIGYKNTLPWR----LSND----------------LQHFKA..LTMGKAIVMGRKTYESI.G....R
A7JK21_FRANO/15-176-MISLIVAYDKNFGIGKENTLAWK----LSED----------------LKNFKK..ITENNYIVMGRKTFESI.G....R
A4IUE2_YERRU/27-189-IISLILAMADNGTIGDKNALPWH----LPND----------------LQFLKK..STMGKPIVMGRKTYQSI.G....R
Q4EPM7_LISMN/1-159-MIIFVWAQDRAGNIGKDNKMPWH----LPGD----------------LQFFKK..TTTGKTLVMGRKTYESL.G....K
A0NJB2_OENOE/1-163-MITSIWAQSKNNVIGRNNRLPWS----LPDD----------------LKFFRQ..ETKNKAVVMGRKTYESF.G...SK
Q03Y56_LEUMM/3-164-KIKMVWAEDRQHAIGKDGGIPWH----MPDD----------------LKLFRD..ETVNTLMIMGRPTWLSI.....GR
Q31I54_THICR/13-172-NISMIAAMDKHRIIGADNDMPWH----LPDD----------------LKFFKA..NTVNKPVIMGRKTFESI.G...SK
Q2FYK6_STAA8/2-157-TLSILVAHDLQRVIGFENQLPWH----LPND----------------LKHVKK..LSTGHTLVMGRKTFESI.G....K
Q8EQG1_OCEIH/1-161-MISLLLAMDRNHVIGVNNQLPWH----LPKD----------------LRFFKE..KTTGNTIIMGRKTFESM.G....G
Q5KZ26_GEOKA/1-160-MISHIVAMDENRVIGKDNRLPWH----LPAD----------------LAYFKR..VTMGHAIVMGRKTFEAI.G....R
Q3XZC6_ENTFC/1-161-MLAAIWAQDENGLIGKEDRLPWR----LPND----------------LKFFKQ..MTEANTLVMGRKTFEGM.G...SR
Q3K0J8_STRA1/4-164-QIIAIWAEDEDHLIGVNGGLPWR----LPKE----------------LHHFKE..TTMGQALLMGRKTFDGM.N...RR
Q6J2S2_STRPN/4-165-KIVAIWAQDEEGVIGKKNRLPWH----LPAE----------------LQHFKE..TTLNHAILMGRVTFDGM.G...RR
Q03S94_LACBA/1-162-MLIFLWAESQGRVIGLHGGLPWH----LPAD----------------MHYFKT..VTTGHTIVAGSKTFASF.P....R
Q38WX9_LACSS/1-163-MIAFLWAEDQNGLIGQDGHLPWR----LPND----------------LANFKR..ETINEAVIMGRKTYDSL.P...KK
DYR_LACCA/1-161-MTAFLWAQDRDGLIGKDGHLPWH----LPDD----------------LHYFRA..QTVGKIMVVGRRTYESF.P...KR
DYR_ENTFC/1-162-MFISMWAQDKNGLIGKDGLLPWR----LPND----------------MRFFRE..HTMDKILVMGRKTYEGM.G...KL
Q1GAP1_LACDA/1-160-MLSYVWAEDEKGAIGYQGRLPWH----LPAD----------------LAHFKA..KTMGHPMLMGRKTFESL.P....G
Q74IU4_LACJO/1-166-MIRFIWAEDENGCIGYQGALPWH----LPAD----------------LKHFKE..LTSNHIIVMGRKTFDSF.P....G
A4LE85_BURPE/3-163-TLTLIVARARNGVIGRDNRLPWK----LPED----------------LAFFKR..TTMGAPIVMGRKTHESI.G....R
Q1QUE0_CHRSD/18-183-PIALVAAMSRNRVIGVDNKLPWH----LPED----------------LKFFKA..VTMSKPLVMGRKTFESI.G....R
Q3SH97_THIDA/8-166-RVSVIAALAKNRVIGIENRLPWR----LPED----------------LAHFKA..LTLDHPVLMGRKTFESL.G....R
Q82WU4_NITEU/10-168-RLAILAAVSANRVIGLNNTLPWH----LPAD----------------LKHFKQ..LTTGQIVVMGRRTFDSI.G....R
Q168V7_ROSDO/1-156-MITLIVARAENGAIGRDGTIPWD----IPED----------------LKFFQR..ETLGGALIMGRNTWESL.PV..K.
Q5YPL6_NOCFA/9-167-TIGLIWAQTTDGVIGFENTIPWR----VPED----------------MANFRT..VTWGHPVIMGRRTWDSL.PP.KFR
Q5F669_NEIG1/3-161-KITIIAACAENLCIGAGNAMPWH----IPED----------------FAFFKA..YTLGKPVIMGRKTWESL.P...VK
A3ZN23_9PLAN/2-161-TVSLIVAASQNNVIGRDGDMPWR----LSAD----------------LQRFKK..LTMGHSIVMGRKTYESI.G....R
Q6FZ92_BARQU/4-168-PVCLIAAVAENGVIGREGAMPWH----LSTD----------------LRRFKA..LTFGKPIIMGRKTWDSL.G....R
Q5GWB6_XANOR/2-163-KVILIVAFDRNNAIGRDNDLPWK----LPDD----------------LKRFKA..LTLGKPILMGRKTAQSL.....RR
A0Z2N0_9GAMM/12-176-PVVLVLAVSENGVIGRGNALPWD----LPDD----------------LQHFKK..ATMGCPILMGRKTFESV.....GR
A3WEP6_9SPHN/5-164-EIVLIYARASNGAIGFEGRLPWH----IPAD----------------LKRFKA..LTMGKPMIMGRKTFESL.P....G
Q0G0R9_9RHIZ/7-171-EFVAVVAAAKNGVIGADGGMPWS----IPSD----------------LKRYRS..LTMGKPMIMGRKTLEAI.....GK
A1SJ32_NOCSJ/7-159-RVVLVAAVARNGVIGDGPDIPWQ----LPGE----------------QRLFKG..LTWGHILVMGRATYDSI.G....R
A1WYQ0_HALHL/3-160-EIVLVAIVGRNGVIGADGDQPWH----FRCD----------------LQRFKA..LTRGHPVIMGRRTLAAI.....GR
Q6A762_PROAC/2-154-KVVAIAAVADNGVIGSGQDMLWH----ISED----------------FRRFKT..VTMGHTLIFGRRTFEQI.G.....
Q0C500_HYPNA/6-171-KLCLIVAQARNRIIGAAGALPWR----LKDD----------------MAFFKA..TTMGAPVIMGRKTWESF.P...KR
A3UE72_9RHOB/5-169-KLAIVVAVAKNGVIGRDGDLPWR----IPSD----------------LKRFKQ..VTLGKPVVMGRKTWDSL.P...RK
A5EPD1_BRASB/3-168-EIVLIVAMAENGVIGAAGAIPWR----QKSD----------------MQRFKA..MTMGRPIVMGRKTFISF.P...RR
A7IF75_XANP2/10-175-PLALVVAVSQNGVIGTDGGLPWR----LPSD----------------LKRFRA..LTWGKPLLMGRRTYESI.G....R
A3HTR7_9BACT/2-163-WISLIAAVAKNGVIGKGNDLVWK----IPTD----------------FKRFKA..ITSGNYILMGRKTFESL.G....K
A5FJX2_FLAJ1/1-159-MIIMIAAVAENNTLGKNNELVWH----LPND----------------FKRFKS..LTTNHHIIMGRKTFESF.P....K
Q1H2G1_METFK/3-159-NLSLIVAVARNRVIGLNNALPWH----LPED----------------LKRFRA..LTTGHHIIMGRKTYESL.N....R
Q9ZIF9_ENTFL/1-155-MIGLIVARSKNNVIGKNGNIPWK----IKGE----------------QKQFRE..LTTGNVVIMGRKSYEEI.G...H.
Q13PE2_BURXL/6-160-RVVLVAAMAANRVIGLGNDIPWR----IPGE----------------QKRFRE..LTMNQLVVMGRRTFESI.G....K
A5GBA2_GEOUR/2-155-VISLIAAMAENRVIGRNNAIPWD----IPAD----------------RKRFRA..LTLGHPVIMGRKTFESLAG.....
Q4F6N1_ACIBA/2-156-KLSLMVAISKNGVIGNGPDIPWS----AKGE----------------QLLFKA..ITYNQWLLVGRKTFESM.G.....
DRTS_PARTE/6-165-TFSMVLAMTLNGGIGYQNRLPWK----LKED----------------LQRFKK..ITTGGIVIMGRKTFESM.NS..K.
Q6FER8_ACIAD/7-169-EVVHVVAMDQKQCIGKGNALPWH----IPAD----------------LKHFKE..ITQDGVVIMGRKTLESM.G....R
Q6MID1_BDEBA/2-168-ILTHVVACSQNRVIGAQGGLPWS----LPED----------------MKFFRE..TTKGHIMIMGRKTFDSF.N...GR
A5EUV9_DICNV/5-163-KIHLIAAQTLNRVIGKDGGMPWH----LPRD----------------LQHFKQ..RTSGHTIIMGRKTFQSL.K....K
Q9RR65_DEIRA/16-174-DIVAIAAQTENRVIGRDGGMPWH----LPAD----------------FAHFRA..LSVGKPNIMGRKVFDTL..R..RK
A1R8Y8_ARTAT/3-172-GIGLVWAQTKSGVIGKDGAMPWH----LPED----------------LKHFSQ..LTTGHPVIMGRKTWLSF.PE.KYR
Q6D0D5_ERWCT/2-159-VISLIAALAVDRVIGMENAMPWH----LPAD----------------LAWFKR..NTLNKPIIMGRNTFRSI.G....Q
Q8D3H9_WIGBR/2-161-DISLIWAQSKNKVIGHDQYIPWN----LPED----------------ISWFKK..NTINKPVIMGRKTFESI.K....K
Q494F1_BLOPB/2-160-IISLIAALTTNHIIGKKNVIPWY----LPID----------------IKWFKY..HTLYKPIIMGRKTFESI.G...KK
DYR_BUCAP/2-161-KISLISAISNNLVIGHNNKIPWY----LPED----------------LKWFKK..NTIHKDIIMGRLTWESI.L...NH
A4NZZ8_HAEIF/2-159-TFSLIVATTLNSVIGKDNQIPWH----LPAD----------------LAWFRQ..NTTGKPVIMGRKTFESI.G....R
Q7VM78_HAEDU/2-160-FISLIVARTKNHVIGRHNQMPWH----LPRD----------------LMWFRE..KTIDKPIIMGRKTYESI.G....R
A0PBE3_PASPI/4-169-TISLIVATANNNVVGLNNRMPWH----LPKD----------------LQYFKA..TTMKKPMIMGRKTWDSI.G...GR
Q3JEI1_NITOC/2-160-IISFIVAMDENHLIGANRRLPWH----LPAD----------------LKYFRR..MTMGKPMLMGRSTHEAI.G....R
A1AXR7_RUTMC/2-160-KLSIIVAMDDNQLIGKNNALPWY----LPAD----------------LAYFKK..TTIGKAVLMGRKTYDSI.G....R
A8H0U7_SHEPA/2-158-KIAMIAAMANNRVIGKDNQMPWH----LPED----------------LRHFKA..MTLGKPVVMGRKTYESI.G....R
DYR9_ECOLX/3-167-SLNMIVAVNKTGGIGFENQIPWH----EPED----------------LKHFKA..VTMNSVLIMGRKTFASL.P...K.
A6M379_CLOB8/1-162-MISIIVAIAKDNVIGKDNKLLWH----ISED----------------LKRFKK..ITTGKKMIMGRKTFESL.P....G
Q97EV2_CLOAB/1-152-MLSIIAALNENYVIGNENKLIWH----ISDD----------------LKRFKK..LTTGKTIIMGRKTFESL.P....G
A0PY39_CLONN/1-163-MLSIVVAIGKNNVIGKDHSLPWH----LPND----------------LKYFKKVTLTESKTMIMGRKTFQSL.K....A
Q0SWS9_CLOPS/1-160-MFSIIVAKSINNIIGVNNKIPWN----IPSD----------------LKRFKE..LTMGKKILMGRKTFESL.P....F
Q03F97_PEDPA/1-160-MISMIWAEDLRHGIGKQQSIPWH----IPGD----------------MAFFKK..TTSGNTVVMGRKTFDSI.G....K
A5VJL0_LACRD/3-160-ELNLIWAEDLNGWIGKDNTIPWH----VSAD----------------MKHFKT..KTTGHPIIMGRRTFASL.G...NK
Q6YQS9_ONYPE/1-156-MINLITAFDGNYLIGKDNKLPWH----YSQD----------------LQYFKK..ITLNQNVLMGYETYKSL.KN.YFK
SCPA_MYCGA/1-153-MIKLIWCEDLNHGIAKNNQIPWK----IDEE----------------LNHFHQ..TTTNHPIIMGYNTYLAM.....NK
A6DQ18_9BACT/1-147-MLSLISAMDKNGLIGTGKALPWK----VEEE----------------YQRYLD..TVKGKKIIVGRKTFEIS.G....L
Q47FU1_DECAR/7-169-LISAIGAVASNGMLGLAGWLPWD----IPEE----------------LAYFEK..TVAGAALVIGRLTYESM.......
A8GUE9_RICB8/5-161-KITGIMACDPKGVIGLKGRMPWS----YPEE----------------FEYFYQ..IVKNNIIVMGHKTFDSL.PP.KI.
O84618_CHLTR/3-153-QATGIVAIDPRGVMGALGKLPWS----YPED----------------LRFFAE..TIRNHPIIMGRKTWESL.PD.KY.
A7B732_RUMGN/8-169-NMNAIVAADKNWAIGYKNKLLVS----IPAD----------------MKFFRQ..MTGGKVVVMGRKTLESF.PN.GL.
A4E6S4_9ACTN/4-169-KLSAIVAVCDDWGIGCEGDMVVS----NRAD----------------MRHFVA..CTKGCPVIMGRKTLLSF.PG.GR.
Q3F0Y0_BACTI/1-170-MISLIVAADENNAIGFENKLLCR----LKDD----------------MKHFIK..KTKGKPIIMGYKTFASL.GH..K.
Q5ZYR2_LEGPH/3-160-LISLIAAIDETGGLGINNQLLCY----LPAD----------------LQHFKS..ITMGKPIIMGRKTYESI.G....K
Q83AB2_COXBU/2-160-IITLIAAMDKNRLIGRNNELPWH----LPAD----------------LAHFKS..ITLGKPIVMGRRTFDSI.G....K
A6EGV0_9SPHI/2-160-IVSIIVALAEDHGIGRDNQLLWH----LPAD----------------LKFFKN..TTTGHTIIMGRKTYDSI.G....R
A6LIC1_PARD8/3-163-TISIIAAIADKSAIGKNQQLLCH----MPSD----------------MKRFKE..LTTGHAVIMGRKTFESL.P...VA
A5ZJU5_9BACE/15-175-KISIIAAVDRRMAIGFENKLLFW----LPND----------------LKRFKA..LTTGNTIVMGRKTFESL.P...KG

PF01872

Q9XBD7_AMYOR/2-196ATVNCNITISADGYSAGHNQTEQRPFGDDGGDGTGDKLHAWMFDSPEENQAEIDQMTA.ATAFIMGRNMFGPVRGEWDRP
RIB7_ARCFU/3-213PYVFVNVAASLDGKISDESRKQLR....ISCEE...............DLRIVDRLRAESDAIMVGI...GTVLADDPRL
O66747_AQUAE/4-215PYVIIVSEVSVDGKLTLYRGASSKELMSLMDEE...............AYKYLHEIRAKVDGIMVGC...ETVRTDNPSL
Q983M6_RHILO/2-170RKLIVTEFISVDGIAEVEK.............LPGVTWNDE.......MNRFKEDELADSGAMLLGRTTYEIFAGSWP..
Q9XBC6_AMYOR/17-198RTLISTSFVSLDGKLDPTGGDPA.........LHSTKWTFKTVDFLPEAYEIKGREQEEAGALLLGRASYELFAPVWP..
Q98I97_RHILO/10-193RKIIAATFVSLDGVMQAPGGPEED....PVGGFKFGGWTFHYFDEV..GGAAMDELFSKPFTLLLGRRTYDIFTAYWP..
RIBD_BACAM/146-354PYVTLKAAASLDGKTATETGDSKW....ITSEA...............ARLDAQQYRKSHQRILVGA...GTVKADNPSL
Q98JM8_RHILO/2-188KKLILQMQMSVDGFVGANDDHRWQ....LWEWGHDIGWDEE.......LKQDFNAVFAGIDTILLSR...KMAEEGYLTH
RIBD_HAEIN/152-365PFVQLKLAMSLDGRTAMASGESKW....ITGPD...............ARSDVQKMRAKSSALLSTS...TTVIADDPSL
Q98HZ2_RHILO/2-179RKLIVFNSISLDGYFTDRHGAMDW....AHSQDPE.............WNAFVADNAKGGGMLVLGRVTYDLMIQFWP..
RIBD_SYNY3/148-353PFGIFKYAMTLDGKIATAQAHSSW....VTSSS...............ARHWVHQLRSQCQAVIIGG...NTVRRDNPLL
RIB7_METJA/9-218PYIISNVGMTLDGKLATINNDSR.....ISCEE...............DLIRVHKIRANVDGIMVGI...GTVLKDDPRL
O05684_MYCLE/49-262VWIRANFITSIDGGATADGRTGA.....MAGPG...............DRFVFNMLRELADVIVVGA...GTVRIENYSG
Q9L023_STRCO/25-206RTLISTAFVSLDGVVEAPGGEPG.........YRNTGWTVKLVDFLPEAYEIKGREQEEASALLLGRVSYEAFSPVWP..
RIBD_BACSU/146-354PYVTLKAAASLDGKIATSTGDSKW....ITSEA...............ARQDAQQYRKTHQSILVGV...GTVKADNPSL
RIBD_MYCTU/154-334PHVTWKYATSIDGRSAAADGSSQW....ISSEA...............ARLDLHRRRAIADAILVGT...GTVLADDPAL
Q9F3D0_STRCO/2-176ASLMVDFIISLDGYAAADGWPGFW....GMEGPEYLAW..............LDGDAEKQHTSLMGATTYRLMSGFAR..
Q98LQ3_RHILO/2-178AKIVYSMLTSLDGYIAGPDGDIGL....PVPETE..............LHQHFNDMMRQASAVLAGRRMYETMRFWDS..
RIB7_METTH/3-210PYVILNAAMTLDGKIATATGSSE.....ISGEE...............DLRRVHELRRECDAIMVGI...NTVLADDPRL
RIBD_AQUAE/150-351PYITLKWAQTLDGKLATLTGSSKW....ITSKE...............SRKVAHILRREATAVLVGV...NTVIKDDPHL
RIBD_CORAM/159-333PHVTLKFAQTIDGFTAAADGTSQW....ITGEM...............ARDYVHADREHRDAIIIGT...GTALIDNPSL
RIBD_ACTPL/159-368PYVLMKYAMTADGKIATGSGESKW....ITGES...............ARARVQQTRHQYSAIMVGV...DTVLADNPML
RIB7_YEAST/30-237PFVTLTYAQSLDARVSRGPGVRTT....ISHPE...............TKTMTHYLRHHHDGILVGS...GTVLADNPGL
RIBD_ECOLI/147-362PYIQLKLGASLDGRTAMASGESQW....ITSPQ...............ARRDVQLLRAQSHAILTSS...ATVLADDPAL
RIB7_SULSO/5-206PYVIIFSTVSIDGRLATKTGYSE.....LSCPY...............DKQRQHEIRSEVDAVMVGA...NTVRVDNPSL
RIBD_CHLTR/152-363PWVVMKTAASLDGQTADRGGSSQW....ISGEL...............ARADVGKLRAESQAIIVGA...RTVCLDNPRL
P71968_MYCTU/39-252TWLRANFISSLDGGATVDGTSGA.....MAGPG...............DRFVFNLLRELADVIVVGV...GTVRIEGYSG

PF00186

B7X1J0_COMTE/2-165..PL----------------PGRSNIVVT.RQAD..WQTEPASD.Q...VL..RAAS-----------------------
A9CIC8_AGRT5/5-170..PL----------------PGRPHIIVS.RNAD..YRP....E.G...VD..VVSS-----------------------
B9LR90_HALLT/20-191..PL----------------PDRTSVVLT.TRDL..DLP....E.G...AV..VAND-----------------------
C5IKW9_9PSED/7-162..PL----------------PNRHTLVIS.RQAN..YRA....T.G...CV..VVST-----------------------
DYR_STAHA/6-164..AL----------------PDRRNIILT.RDKN..FNF....K.D...CE..IAHS-----------------------
Q6A328_PASMD/4-169..PL----------------PNRLNFVLT.RDKNYSAEG...A......TVIYDLKE-----------------------
A6DH01_9BACT/2-160..PL----------------PGRRNLILS.RDPN..LEI....P.G...TE..CFTS-----------------------
A7JK21_FRANO/15-176..PL----------------PNRKNIILT.RDKD..YKQ....D.K...CL..IINS-----------------------
A4IUE2_YERRU/27-189..PL----------------PGRTNVVIS.RSLE..KEA...LP.G...CL..IYSD-----------------------
Q4EPM7_LISMN/1-159..AL----------------PNRKTIVLT.RDQG..LKL....D.D...AE..ILHS-----------------------
A0NJB2_OENOE/1-163..AL----------------PKRLNIILT.SNMD..FKS...NDPE...VK..IVHS-----------------------
Q03Y56_LEUMM/3-164..PL----------------PKRTTVVMT.RQEDWTPSY..........PEVKVIHS-----------------------
Q31I54_THICR/13-172..PL----------------PNRRNLVIT.RNDA..YEA....N.G...AE..VFHS-----------------------
Q2FYK6_STAA8/2-157..PL----------------PNRRNVVLT.SDTS..FNV....E.G...VD..VIHS-----------------------
Q8EQG1_OCEIH/1-161..AL----------------PNRKNIVLT.SRSD..VQY....P.N...AK..IIHH-----------------------
Q5KZ26_GEOKA/1-160..PL----------------PGRDNVVVT.RNRS..FRP....E.G...CL..VLHS-----------------------
Q3XZC6_ENTFC/1-161..PL----------------PNRQTIVLT.RDSS..YKA....E.G...VH..VMHS-----------------------
Q3K0J8_STRA1/4-164..VL----------------PGRETIILT.KDEQ..FQA....D.G...VT..VLNS-----------------------
Q6J2S2_STRPN/4-165..LL----------------PKRETLILT.RNPE..EKI....D.G...VA..TFQD-----------------------
Q03S94_LACBA/1-162..PL----------------PNRKNIVVS.HQPA..TAF....PEN...VS..VLHS-----------------------
Q38WX9_LACSS/1-163..PL----------------PGRQNIVIT.RQSG..LTV....AKD...VL..VFNE-----------------------
DYR_LACCA/1-161..PL----------------PERTNVVLT.HQED..YQ.....AQG...AV..VVHD-----------------------
DYR_ENTFC/1-162..SL----------------PYRHIIVLT.TQKD..FKV....EKN...AE..VLHS-----------------------
Q1GAP1_LACDA/1-160..LL----------------PGRQHVVLS.T.....RKLD..LPAG...VL..QLKS-----------------------
Q74IU4_LACJO/1-166..LL----------------PKRKHIILS.TNPILQRRYQ..DNSD...VK..VFSQ-----------------------
A4LE85_BURPE/3-163..PL----------------PGRRNIVVT.RDAA..RRF....D.G...CD..TVTS-----------------------
Q1QUE0_CHRSD/18-183..PL----------------PGRLNIVVT.RDRG..YAQ...DHDG...IR..VCHD-----------------------
Q3SH97_THIDA/8-166..PL----------------PRRTNVVIT.RNAD..YRP....D.G...CL..VAAS-----------------------
Q82WU4_NITEU/10-168..PL----------------PDRTNVVLT.RQRH..FNQ....P.G...IL..TAGS-----------------------
Q168V7_ROSDO/1-156..PL----------------PRRFNIVVS.SNSD...............IAEVVAPS-----------------------
Q5YPL6_NOCFA/9-167..PL----------------AGRRNVVVT.RQPDWSAPG..........AE..RAGS-----------------------
Q5F669_NEIG1/3-161..PL----------------PGRRNIVIS.RQAD..YCA....A.G...AE..TVAS-----------------------
A3ZN23_9PLAN/2-161..LL----------------PGRQTVIVT.RQAD..YAV....E.G...AV..IAAN-----------------------
Q6FZ92_BARQU/4-168..AL----------------PGRTNIVIT.RNYA..FMA....E.G...AV..IAHS-----------------------
Q5GWB6_XANOR/2-163..AL----------------PGRLNLVLT.RSGL..VPF....D.G...MQ..AVAS-----------------------
A0Z2N0_9GAMM/12-176..PL----------------PGRTNLVLT.RDST..WQA....P.G...VT..IFSS-----------------------
A3WEP6_9SPHN/5-164..LL----------------PGRRHIVLT.R.....RDSW..DSEG...AE..HVCS-----------------------
Q0G0R9_9RHIZ/7-171..AL----------------DGRDSIVLT.RENR..LAV....D.G...AM..LASG-----------------------
A1SJ32_NOCSJ/7-159..PL----------------PGRTTIVLT.RSPDWSAEG..........VH..VAHD-----------------------
A1WYQ0_HALHL/3-160..PL----------------PQRTNIVLT.RDPG..FHA....D.G...VE..VATD-----------------------
Q6A762_PROAC/2-154..KL----------------PGRRHIICT.RDPH..WS.....HEG...VD..VATS-----------------------
Q0C500_HYPNA/6-171..PL----------------PGRENIVLT.RDWD..YDA....A.E...AR..VYSS-----------------------
A3UE72_9RHOB/5-169..PL----------------PGRANFVIS.RSVT..AAA......G...AY..VFAD-----------------------
A5EPD1_BRASB/3-168..PL----------------PGRTNIIVT.RDAA..FHA....P.G...AI..VTHS-----------------------
A7IF75_XANP2/10-175..PL----------------PGRTSVVVS.TDPA..FTV...PE.G...VL..KGAS-----------------------
A3HTR7_9BACT/2-163..PL----------------PNRTHLVIS.RNKN..YKV....PEG...HH..LFEN-----------------------
A5FJX2_FLAJ1/1-159..PL----------------PNRTHIIIT.RQTD..YN.....PEG...CI..VVDS-----------------------
Q1H2G1_METFK/3-159..LL----------------PDRTTIIVT.RNQN..YHV....P.G...AM..IAHS-----------------------
Q9ZIF9_ENTFL/1-155..PL----------------PNRMNIVVSTTT..........EYQG...DNLVSVKS-----------------------
Q13PE2_BURXL/6-160..PL----------------PGRDLLVLS.SGTS.........RLG...TV.RTVKS-----------------------
A5GBA2_GEOUR/2-155..PL----------------PGRKNIIIT.RQMD..YRA....E.G...CF..IAHD-----------------------
Q4F6N1_ACIBA/2-156..AL----------------PNRKYAVVT.RSSF..TSD....NEN...VV..IFPS-----------------------
DRTS_PARTE/6-165..PL----------------PNRVNVVIS.KN....MKS...S......NEVQVFPR-----------------------
Q6FER8_ACIAD/7-169..TL----------------PKRVNWVIT.RDPNWQ......FEGA...K...VASS-----------------------
Q6MID1_BDEBA/2-168..AL----------------PNRYHIVVT.RDPS..KQSF..NSTESSPVV..FVAS-----------------------
A5EUV9_DICNV/5-163..PL----------------PNRKNIVIS.HSGQ.........PLH...ADVAVFPA-----------------------
Q9RR65_DEIRA/16-174..PL----------------PERVNIVLT.RNENLKF............DGCLIAHS-----------------------
A1R8Y8_ARTAT/3-172..PL----------------PGRTNIVVT.RNAEWGSTP...EAEG...AV..VVSS-----------------------
Q6D0D5_ERWCT/2-159..PL----------------PGRLNIVVS.NHPG..DD.....E.R...VT..WVSS-----------------------
Q8D3H9_WIGBR/2-161..PL----------------ENRINIVLS.KNLY..RNV...MS.N...LK..IAKN-----------------------
Q494F1_BLOPB/2-160..PL----------------LNRLNIVLS.RNLL..NN....YN.G...VF..IAEN-----------------------
DYR_BUCAP/2-161..PL----------------PMRKNIVIS.HKEI..IHK....D.....VI..WANS-----------------------
A4NZZ8_HAEIF/2-159..PL----------------PKRTNIVLS.RQLF..EH.....E.G...VI..WKDS-----------------------
Q7VM78_HAEDU/2-160..LL----------------PKRPNIILS.RTEL..KI.....D.G...AY..TATS-----------------------
A0PBE3_PASPI/4-169..PL----------------PGRPHFVIS.RQKD..LVL....E.G...AQ..RVAN-----------------------
Q3JEI1_NITOC/2-160..PL----------------PGRHNIVVT.HNPD..YKA....P.G...CT..VVHT-----------------------
A1AXR7_RUTMC/2-160..PL----------------SNRRNIIVS.RNTK..LKV....D.G...CE..VVGS-----------------------
A8H0U7_SHEPA/2-158..PL----------------PGRHNIVIS.RQDS..LVI....D.G...VT..RVSS-----------------------
DYR9_ECOLX/3-167..VL----------------PGRLHVVVS.KTVPPTQNT..........DQVVYVST-----------------------
A6M379_CLOB8/1-162..IL----------------PNREHIVLT.RDNN..FNVD..SD.K...VT..IEHD-----------------------
Q97EV2_CLOAB/1-152..VL----------------PNRKHIVIT.K..N..LNYS..RE.N...VS..IVHS-----------------------
A0PY39_CLONN/1-163..LL----------------PGRKHIILT.KNKN..FNMK..DS.N...VE..IINK-----------------------
Q0SWS9_CLOPS/1-160..VL----------------PGRTHLVLT.TKKD..FSYN..HK.D...VI..IYND-----------------------
Q03F97_PEDPA/1-160..AL----------------PNRKNIVLS.HHPTSLPDS..........VV..GVGS-----------------------
A5VJL0_LACRD/3-160..PL----------------PKRENIVLTSRNID.........AEG...VE..VVHS-----------------------
Q6YQS9_ONYPE/1-156NKPF----------------NFKKTYVAS.LKHDLELPN............CTVVSD-----------------------
SCPA_MYCGA/1-153..IL----------------ANQANIVIS.KKHQRELKN...K......NELFLYSD-----------------------
A6DQ18_9BACT/1-147..DL----------------KDEQVHILS.SR...........SQG...TN..YYNN-----------------------
Q47FU1_DECAR/7-169..DV----------------VPEDSFVVS.RQADLVVRPG.CS......RVASVEEG-----------------------
A8GUE9_RICB8/5-161...L----------------QNCICIVFS.RNTP.........TSD...NDVFFVES-----------------------
O84618_CHLTR/3-153...K----------------HGRDIVVFS.RR...........MHP...PQCIGVSS-----------------------
A7B732_RUMGN/8-169..PL----------------KNRTNIVLT.GNPNYHVKD...A......VIVHTTEE-----------------------
A4E6S4_9ACTN/4-169..PL----------------KNRRNIVLT.RDDDFAP............GGVDVVHS-----------------------
Q3F0Y0_BACTI/1-170..PL----------------KDRFNIVLT.RSPMALTLDH..LHLV...GENLVFES-----------------------
Q5ZYR2_LEGPH/3-160..PL----------------PGRLNIVIS.QSIQ..SI.....P.G...VV..VVDS-----------------------
Q83AB2_COXBU/2-160..PL----------------PHRRNIVIT.QQKN..LII....E.G...CD..IFYS-----------------------
A6EGV0_9SPHI/2-160..PL----------------PNRRNIVIT.RNAA..LEI....P.G...AE..VLTS-----------------------
A6LIC1_PARD8/3-163..PL----------------PNRKNVVLT.TMPE..AGFV..NCFA...CE.....S-----------------------
A5ZJU5_9BACE/15-175..AL----------------PNRRNVVLS.SNPA..A.....ECPG...AE..VFPS-----------------------

PF01872

Q9XBD7_AMYOR/2-196WNGWWGDNPP..........FHGPVFVLT-HHERDPQPMDGGTTYH-------FVTDG......................
RIB7_ARCFU/3-213TVKSAELREKRQKDGKE...PNPLRVVVD-SRCRVPLTAR......-------ILNDE.ARTLVAVSRIAPEEKVREVK.
O66747_AQUAE/4-215TVRYAKG.............KNPVRIIPC-STANVPLDAN......-------VLNTKEAPTIIATTERAPKERLEKIK.
Q983M6_RHILO/2-170..........EETGDFADRFNALPKYVAS-TSLK....ALDWKPAE-------LLTGS......................
Q9XBC6_AMYOR/17-198............GMAEFARYKGLPKYVVS-TTLTENDLVDDWGDNT-------ILR........................
Q98I97_RHILO/10-193..........YQKDPIADAFNPATKYVAT-HRPD....TLTWQNTQ-------WLGED......................
RIBD_BACAM/146-354TCRLPDAV............KQPVRVILD-TKLTVPETAN......-------VLTDGAAPTWIFTAAGSDVRKKDRLT.
Q98JM8_RHILO/2-188WGNAAKKFPADPFYAFAQRIVEVRKVVPS-DRLK....TSRWERST-------VVSGD......................
RIBD_HAEIN/152-365NVRWDEFPENLKTEYKKEWLRQPVRVILD-SQHRIQPTHK......-------.LFLTHSPVWLVSSEPRDLTGFPDFCE
Q98HZ2_RHILO/2-179.....TPMAAQIAPVVAERMNAMPKVVFS-RTLD....TVSWNNTE-------LVKSG......................
RIBD_SYNY3/148-353TNHGVGE.............VNPLRVVLS-RSLDLPIEAQ......-------LWDQDVAKTLVITEKTCDRNTLSHLE.
RIB7_METJA/9-218TVHKIKSD............RNPVRIVVD-SKLRVPLNAR......-------VLNKD.AKTIIATTEDTNEEKEKKIKI
O05684_MYCLE/49-262AHLPVTKRQQRQARGQS...EVPQLAIVT-NSGRLDRDMA......-------VFTRTEIAPLVLTCTETAKKLRTRLA.
Q9L023_STRCO/25-206............DMAEFPGYRAMPKYVVS-TTLAEDDLVTNWGETT-------ILR........................
RIBD_BACSU/146-354TCRLPNVT............KQPVRVILD-TVLSIPEDAK......-------VICDQIAPTWIFTTARADEEKKKRLS.
RIBD_MYCTU/154-334TARLADGSLAP.........QQPLRVVVG-KR.DIPPEAR......-------VLNDEARTMMIRTHE............
Q9F3D0_STRCO/2-176.........EMPDDPGFEGITAMPKVVFS-STLR...TPLSWDNTE-------LVPGD......................
Q98LQ3_RHILO/2-178..PDRETGATEVERDFADAWRDTPKIVFS-TTLR.....QVGSNAR-------LVNGD......................
RIB7_METTH/3-210TVHRVDAAPG..........DNPVRVVVD-SMARTPPHFR......-------VLNDE.APTVIGVSESAPPERVAELR.
RIBD_AQUAE/150-351TVRFVPTE............KQPVRIILD-PELEVPLSAK......-------VLNTEEAPTIVITKK..ENEKAEKLK.
RIBD_CORAM/159-333TARYPDGTQRE.........HQPRRVVIG-RRN.............-------IADAGDAASNLNRLGF...........
RIBD_ACTPL/159-368NSRMPNA.............KQPVRIVCD-SQLRTPLDCQ......-------LVQTAKEYRTVIATVSDDLQKIEQFR.
RIB7_YEAST/30-237NCKWGPDPAA..........NSPRPIIID-TKQKWRFDGSKMQELF-------IKRQGKPPIVVVTSEPIIKEQHVDYA.
RIBD_ECOLI/147-362TVRWSELDEQTQALYPQQNLRQPIRIVID-SQNRVTPVHR......-------.IVQQPGETWFARTQEDSREWPETVR.
RIB7_SULSO/5-206TVKYGKNR............RNPIRVVVT-RSFNLDPSYK......-------IFTT..PPSTVIYTSNYESEKVEEFI.
RIBD_CHLTR/152-363SARFPHGDLYE.........RQPLRVVVD-SRGTVPLESR......-------VFDLSSGSTLFATTQQCPKEYIQKLK.
P71968_MYCTU/39-252VRMGVVQRQHRQARGQS...EVPQLAIVT-RSGRLDRDMA......-------VFTRTEMAPLVLTTTAVADDTRQRLA.

PF00186

B7X1J0_COMTE/2-165-------------------LPEAL......E.LG....RKL.....SPDVW.VIGGAQIYAQ-ALP..LAD...AVEVTE
A9CIC8_AGRT5/5-170-------------------LDEAV......K.LA....KTKAVELGVDEVF.VAGGGEIYRQ-AMP..FAD...QLSVTH
B9LR90_HALLT/20-191-------------------LDEAVDLAGADA.AD....RGV......DDVY.VIGGATVYEQ-FLD..RAD...RMVLTE
C5IKW9_9PSED/7-162-------------------LSHAI......A.LA....SEL.....GNELY.VAGGAEIYTL-ALP..HAH...GVFLSE
DYR_STAHA/6-164-------------------IEAAF.....K..LC....ENE......EEVF.IFGGEQIYVM-FLP..YVE...KMYVTK
Q6A328_PASMD/4-169-------------------VAQHL..............EGKN....L.TCF.IIGGAQIYQL-AL...ETGLLNEMYVTQ
A6DH01_9BACT/2-160-------------------YDEIR......E.NC....AQE......EEVF.IIGGAQIYEI-LFD..EVD...TLHLTL
A7JK21_FRANO/15-176-------------------TQDIL......N.FA....ESKP....HYEIF.IIGGAQIYKE-FLK..YAD...RLYITE
A4IUE2_YERRU/27-189-------------------LSVAI......AALK....KEPE....VEEIM.IMGGAQIYRA-ALP..MMD...RLYLTH
Q4EPM7_LISMN/1-159-------------------K.EAV......L.AL....AET.....GEPIY.IVGGAEIYRL-FMD..VAD...QLIVTK
A0NJB2_OENOE/1-163-------------------PIEAV......NTAK....EQH......LPLY.VIGGASVYES-FMN..MAD...RLLITL
Q03Y56_LEUMM/3-164-------------------IEEAK......NLIA....KEE.....R.DIT.IAGGAAVYRE-FMP..YAT...DLVITR
Q31I54_THICR/13-172-------------------AEEAL......K.SC....KSE......VEII.IMGGGQLYAQ-MMP..FAN...KLYVTL
Q2FYK6_STAA8/2-157-------------------IEDIYQ....LP................GHVF.IFGGQTLFEE-MID..KVD...DMYITV
Q8EQG1_OCEIH/1-161-------------------IDTIKQ....WN.IE....NPE......EEYF.VIGGANLFQQ-VMD..IAD...RMYITW
Q5KZ26_GEOKA/1-160-------------------LEEVK......QWIA....SRA......DEVF.IIGGAELFRA-TMP..IVD...RLYVTK
Q3XZC6_ENTFC/1-161-------------------VEDVL......A.LE....KET......DGIFFIAGGSAVYQE-FLP..FCT...ILYRTV
Q3K0J8_STRA1/4-164-------------------VEQVI......KWFQ....EHN......KTLF.IVGGASIYKA-FLP..YCE...AIIKTK
Q6J2S2_STRPN/4-165-------------------VQSVL......DWYQ....AQE......KNLY.IIGGKQIFQA-FEA..YLD...EVIVTH
Q03S94_LACBA/1-162-------------------LPAVR......A.YA....AARP....QEKIF.VVGGAQLFAG-LLD..DVD...FLYRTR
Q38WX9_LACSS/1-163-------------------RTQLL......D.YQ....KEHP....MQKLF.IIGGADIFKL-FAA..DVD...YLYVTK
DYR_LACCA/1-161-------------------VAAVF......A.YA....KQHP....DQELV.IAGGAQIFTA-FKD..DVD...TLLVTR
DYR_ENTFC/1-162-------------------IDELL......A.YA....KDI.....PEDIY.VSGGSRIFQA-LLP..ETK...IIWRTL
Q1GAP1_LACDA/1-160-------------------EEEVS......AWLK....E..Q....AGEVC.VIGGSSLFAL-LAD..QVD...KLEVTR
Q74IU4_LACJO/1-166-------------------IEQLK......NWIE....D..H....TEEIIDIIGGAEVFKE-FKD..EVD...VLEKTK
A4LE85_BURPE/3-163-------------------LDDALA....LA.AR....DGA......AEAF.LIGGAQLYEE-GLR..HAD...KLIVTE
Q1QUE0_CHRSD/18-183-------------------LASALDMADGQA.II....DGV......EDIC.VIGGGEIFAE-ALP..CAT...RLYLTE
Q3SH97_THIDA/8-166-------------------MPAAI......A.LC....QGA......DEIF.FIGGAELYAQ-AIP..LAD...RLYLTE
Q82WU4_NITEU/10-168-------------------IQEVL......EHFC....GDD......RQIF.IIGGAEIYQQ-TLP..FCQ...RLYLTE
Q168V7_ROSDO/1-156-------------------VETAI......EIAK....AQDH....Q.RIY.GIGGASIYAE-MLP..LAH...RLLISE
Q5YPL6_NOCFA/9-167-------------------LTEAL..............ALTE....PESVW.IAGGAQIYET-AMD..FAT...ELLVTE
Q5F669_NEIG1/3-161-------------------LEVAL......A.LC....AGA......EEAV.IMGGAQIYGQ-AMP..LAT...DLRITE
A3ZN23_9PLAN/2-161-------------------VAEAL......QTPS....TSG.......EIF.VVGGGEIYAQ-AID..LAD...QIYLTR
Q6FZ92_BARQU/4-168-------------------LSEACFIAKRVA.SQ....NGA......DAVF.IIGGGEIFQQ-GFN..IAD...RIFLTE
Q5GWB6_XANOR/2-163-------------------VAQAVE....RA.VQ....DGA......QELC.VIGGGEVYRL-TME..RAD...LLAVTE
A0Z2N0_9GAMM/12-176-------------------VDKALALAEAQA.LI....DGA......SAVC.VVGGAEIYRL-CLP..RAD...RILLTL
A3WEP6_9SPHN/5-164-------------------VDEAI......ATAK....DGNE....TGEIA.VVGGSAIYDV-FRP..VAH...RIEVTE
Q0G0R9_9RHIZ/7-171-------------------PAEAIAKAIECA.SA....RRA......SEIA.VVGGAEIYRL-LWD..HID...RIALTE
A1SJ32_NOCSJ/7-159-------------------LPAAL........AL....ADTL....EGEVM.VAGGGQVYAA-ALP..VAD...EQVLSE
A1WYQ0_HALHL/3-160-------------------PEAALARAAESA........GG......ERVM.ILGGGDVYRL-FLP..RAH...RLALTE
Q6A762_PROAC/2-154-------------------PRQAV........EM....AREA....GEEICFVAGGGQIYAD-AFE..LCD...ELDITE
Q0C500_HYPNA/6-171-------------------FPAAMNAARAIA.AR....EGK......DEAF.VIGGAEIYAL-ALP..FAD...RIYLTE
A3UE72_9RHOB/5-169-------------------VEACLEEARGAA.VE....AGV......DEVC.LIGGAQLYAD-LLP..KVD...RIYLTE
A5EPD1_BRASB/3-168-------------------VGEALTIARGDA.LR....RSA......AEIA.IIGGAEIYAA-TMP..LAD...RLEITE
A7IF75_XANP2/10-175-------------------LEDGLRLADEAA.DA....MGA......DEIM.VIGGARLFHD-TLP..LAR...TLHLTQ
A3HTR7_9BACT/2-163-------------------VEDAF......I.YC....NKLG....IEKLY.VIGGGEIYKQ-TIS..IAD...ELLITE
A5FJX2_FLAJ1/1-159-------------------MEKAI......AACP....ENE.......DSY.IIGGGEIYNL-GLP..YAD...IIEITK
Q1H2G1_METFK/3-159-------------------LEQAI......D.MA....ADD......AEAF.LIGGAELYQA-GLK..LAD...RLYITE
Q9ZIF9_ENTFL/1-155-------------------LEDAL..............LLAK....GRDVY.ISGGYGLFKE-ALQ..IVD...KMYITE
Q13PE2_BURXL/6-160-------------------FAEVT......A.AV....NNDP....REAIF.VGGGQQVYAM-LMP..YAD...VVYLTE
A5GBA2_GEOUR/2-155-------------------LASAL......A.MA....GET......DEIF.ICGGGEIYRQ-ALP..IAD...RIYLTI
Q4F6N1_ACIBA/2-156-------------------IKDAL........TN....LKKI....TDHV.IVSGGGEIYKS-LID..QVD...TLHIST
DRTS_PARTE/6-165-------------------IEDAL......QFYN....TSH.....Q.KLY.LIGGKRIFEE-GL...ATDKCSDVHLTR
Q6FER8_ACIAD/7-169-------------------IEAALK...GAAQDL....QHTD....KKTLF.IIGGGEIFKQ-TIN..IAD...RLELTH
Q6MID1_BDEBA/2-168-------------------IEEAVK....HAEPL....TAKW....GDEVF.IIGGGEIYKQ-AMP..ITD...KIYLTL
A5EUV9_DICNV/5-163-------------------ISEAL......A.FC....CND......EKVF.IIGGGSLYAA-TID..EAD...FLTITW
Q9RR65_DEIRA/16-174-------------------PEEAL......QLAG....DAP.......EIA.IIGGEEIYRL-YWD..RLT...RLEMTL
A1R8Y8_ARTAT/3-172-------------------LDAALL...ESQFAP....GGQ.......KVW.IIGGGEIFEQ-SMG..IAN...LAVITI
Q6D0D5_ERWCT/2-159-------------------LDAAL......A.AA....GEV......EEVM.VIGGGSVYQQ-MLS..QAN...RLYLTH
Q8D3H9_WIGBR/2-161-------------------PKQAL......F.FA....KNY......NEVM.IIGGKQIYKI-FLP..KAT...KLYLTV
Q494F1_BLOPB/2-160-------------------IDEAL......S.LI....QDA......YEVM.VIGGSEIYNV-FLP..RAQ...RLYLTY
DYR_BUCAP/2-161-------------------ISKAL.........L....STTY....DKEIM.VIGGSKIYKQ-MLF..YAT...KLYLTH
A4NZZ8_HAEIF/2-159-------------------FESAV......N.FV....RDF......DEIM.LLGGGELFKQ-YLP..KAD...KLYLTQ
Q7VM78_HAEDU/2-160-------------------LAEAI......E.LA....KKFT....AEEIM.VIGGGELFKQ-ALP..LAQ...RLYLTE
A0PBE3_PASPI/4-169-------------------LEEALVA..ANQWIV....ANQG....PKEIM.VIGGGEIYRQ-ALP..LAQ...RVYRTL
Q3JEI1_NITOC/2-160-------------------VEAGL......Q.AA....GEA......EEVT.VIGGASLYEQ-LLP..QAR...RIYLTL
A1AXR7_RUTMC/2-160-------------------INVAL......N.LV....NGA......NELM.IMGGVSFYEQ-MID..KVD...RIYITE
A8H0U7_SHEPA/2-158-------------------FEEAK......I.AA....GDC......DELV.VMGGGQLYEM-LLS..QAD...ILYLTE
DYR9_ECOLX/3-167-------------------YQIAV......RTASLLVDKPEY....S.QIF.VIGGKSAYEN-LAA..YVD...KLYLTR
A6M379_CLOB8/1-162-------------------FNSVL......QRYS....ECE......DEVF.VIGGAEIYKQ-FLP..YAK...KLYLTK
Q97EV2_CLOAB/1-152-------------------IDEII......E.LK....DTT......EENF.IIGGGEIYRA-LIP..YCS...ILYLTK
A0PY39_CLONN/1-163-------------------ID.ML......KPII....NDK......KEYF.VIGGGEIFSL-LLP..YTE...KIYMTK
Q0SWS9_CLOPS/1-160-------------------LDKLI........SE....YKDS....MEEIF.VIGGGKIYSE-FLK..YAS...KLYITE
Q03F97_PEDPA/1-160-------------------LSELQ........AI....FETH....PNEKFYIIGGSHLYNA-LLS..QAD...ELLITR
A5VJL0_LACRD/3-160-------------------LAALK........EY....LKAN....PNEYF.VIGGATIYQQ-LLP..MAT...KLTRTV
Q6YQS9_ONYPE/1-156-------------------LQSFM..............ASDA....AQDIF.IIGGGKIYQQ-TLP..WVT...TLYITH
SCPA_MYCGA/1-153-------------------LKKAL..............IDFS...IV.DLF.IIGGKKTIEQ-AIK..YAD...QLVISK
A6DQ18_9BACT/1-147-------------------IEDAI..............KACG....ENDIF.VTGGAEVYKL-AMP..HAD...RLYISV
Q47FU1_DECAR/7-169-------------------LHRAL..............ATG.....K.PVF.VIGGASVYAA-AWR..YCH...RFYLTR
A8GUE9_RICB8/5-161-------------------LDEFW.......QVI....EIFA....DKKIF.MVGGAEIATF-FLKQNLLD...EFLLTR
O84618_CHLTR/3-153-------------------FAEY...............GTLS....LNHPF.LIGGAELFES-FFQQNLLK...ACFVTH
A7B732_RUMGN/8-169-------------------LLEEL..............KKYD....EEEIF.VIGGESIYRM-MLP..YCS...KVYVTK
A4E6S4_9ACTN/4-169-------------------IDEAL..............AAVA....DEPVAWVIGGGEVYRQ-FLP..HCV...EAEVTH
Q3F0Y0_BACTI/1-170-------------------LEYIQ.......FMI....EQSK....DKEIV.VIGGQQTYEL-FLP..MAS...RVYLTR
Q5ZYR2_LEGPH/3-160-------------------LGRAI......K.ET....ADA......SEVM.IIGGAKIYSQ-AIS..MAN...RLYITR
Q83AB2_COXBU/2-160-------------------LDDAL......S.AL....TKE......PEVI.IIGGARIFKE-ALP..KAD...KMILTI
A6EGV0_9SPHI/2-160-------------------LTEAI......A.LC....MEE......KEVF.VIGGAELYKH-ALP..LAN...RLYVTQ
A6LIC1_PARD8/3-163-------------------MGAAL......D.LC....EKE......DEIF.IIGGALVYRQ-ALR..IAD...KMYITR
A5ZJU5_9BACE/15-175-------------------LEAAL......Q.SC....KED......EHVY.IIGGASVYQQ-ALP..FAD...ELCLTE

PF01872

Q9XBD7_AMYOR/2-196...................IESAL--------------EQARAAAGDGEVT-ILGGATTINQ.YLAAGLID---EVRLHI
RIB7_ARCFU/3-213...KVAEVAVFG..EERVELSALL--------------EFLHRK.GVRRLM-VEGGGTLISS.LISQNLVD---EIRIYY
O66747_AQUAE/4-215..ELGAEVIVVG..DELVDFDKLL--------------PELYRR.GIKSLM-VEGGASINWE.FVRRRVVD---EIRLIH
Q983M6_RHILO/2-170...................LPEAV--------------RTLKQG.SGGNIY-VHGSLSLAQE.LLRHGLVD---RVRLLS
Q9XBC6_AMYOR/17-198...................SLDEV--------------AELKQT.EGDPIL-VHGSATLNRA.LHEAGLID---RYHLLV
Q98I97_RHILO/10-193...................IVAAL--------------RRLSKQ.DGPDLL-IQRSADLIQT.LLANGLID---EIRLMI
RIBD_BACAM/146-354..ALGIKVFTLE..TDRIHIPEVL--------------SILAEN.GIMSVY-VEGGASVHGS.FVKAGCFD---ELHFYF
Q98JM8_RHILO/2-188...................LPREV--------------NALKAG.EGGDII-VFGGAGFASS.LIAAGLVD---EFQLFV
RIBD_HAEIN/152-365QIIFPKENL..........LKELM--------------RELGKR.QINTLW-VEAGANLSGS.LIDAKLVD---ELIIYI
Q98HZ2_RHILO/2-179...................PAAKL--------------RELKQQ.PGNHMT-ILGSGNLVAQ.LAEENLID---EYQFVI
RIBD_SYNY3/148-353..KLEVETLVLE....QLTPLAVM--------------EELYQR.NCLQVL-WECGGILAAE.AIAMGTVQ---KVHAFL
RIB7_METJA/9-218LEDMGVEVVKCG..RGKVDLKKLM--------------DILYDK.GIKSIL-LEGGGTLNWG.MFKEGLVD---EVSVYI
O05684_MYCLE/49-262..DLAYVVSCSGDDPSKVDETVVL--------------ATLQTR.GLRRVL-TEGGPMLLGS.FIQHGMLD---ELCLTI
Q9L023_STRCO/25-206...................SLDEV--------------AALKEG.EGGPII-VHGSAALNRS.LSDAGLID---RYHLLV
RIBD_BACSU/146-354..AFGVNIFTLE..TERIQIPDVL--------------KILAEE.GIMSVY-VEGGSAVHGS.FVKEGCFQ---EIIFYF
RIBD_MYCTU/154-334...................PMEVL--------------RALSDR...TDVL-LEGGPTLAGA.FLRAGAIN---RILAYV
Q9F3D0_STRCO/2-176...................PVPAV--------------RDMKRH.GTRPLR-TLGSLTLCRS.LLRAGLVD---RFRVVV
Q98LQ3_RHILO/2-178...................AETAV--------------RSLKTK..TDGLV-ILGGADLAAD.LTRAGLID---EYRLYM
RIB7_METTH/3-210...KRAEVVVAG..TRRVDLHLLL--------------ERLHGM.GIERLM-LEGGSTLNYS.MLTGGLVD---EVRVCI
RIBD_AQUAE/150-351..EKGVQVLILK....GFNLKNIL--------------KKLKEL.EIMHLM-VEGGPRTLTS.FLKEGFFD---RIVVFI
RIBD_CORAM/159-333..............EQYATIDEAL--------------AELYAT.GARDVL-VEGGAGLASG.FANQGLVD---WLQVYQ
RIBD_ACTPL/159-368..PLGVDVLVCKARNKRVDLQDLL--------------QKLGEM.QIDSLL-LEGGSSLNFS.ALESGIVN---RVHCYI
RIB7_YEAST/30-237.......ICPINDTTKLVDWKKLF--------------EILKEEFNIRSVM-VEGGANVINQLLLRSDIVN---SLIITI
RIBD_ECOLI/147-362.......TLLIPEHKGHLDLVVLM--------------MQLGKQ.QINSIW-VEAGPTLAGA.LLQAGLVD---ELIVYI
RIB7_SULSO/5-206..RKGVIV......RKFLHLDDLL--------------EDLYDNFNVRRLM-VEGGGHLIWW.FIKDNLYD---EIRITI
RIBD_CHLTR/152-363..DLGVEVWESS..SHQVDLKGLL--------------RYLAER.GCLQVL-VEGGAQLHSA.FWQQKLVN---AGVIYW
P71968_MYCTU/39-252..GLAEVIACSGDDPGTVDEAVLV--------------SQLAAR.GLRRIL-TEGGPTLLGT.FVERDVLD---ELCLTI

PF00186

B7X1J0_COMTE/2-165IG..RDF.E.GDAFAP.ELD..------AQWQAVSRSEHV...SA...NGLPYCFVRFER
A9CIC8_AGRT5/5-170VA..VKL.D.GDTFFP.EIDP.------AVFEKTEEKAAS.AGEK...DNYPVLFTTYVR
B9LR90_HALLT/20-191VP..EQP.D.GDTRFP.DWDD.------EEWVETEREVVG.ADGERGGEADALAFVTYER
C5IKW9_9PSED/7-162VH..QTF.E.GDAFFP.MLNE.------TEFELVSTETIQ........AVIPYTHSVYAR
DYR_STAHA/6-164IH..HEF.E.GDTFFP.VVNF.------DDWKEVSVEKGI.KDEK...NPYDYYFHIYER
Q6A328_PASMD/4-169VH..NTFEE.ADTFFP.FVNW.------GEWEEEDILEQD.KDEK...HLYSFNIKKFTR
A6DH01_9BACT/2-160ID..AEI.V.ADAFFP.EFDH.------SQWKETSRERHK.ADSK...NDYDYSFVTLEK
A7JK21_FRANO/15-176VD..AEMTD.LDAFFP.QWDK.------SKYKRIGHKRFK.KDDK...NEFDFTFSVFEK
A4IUE2_YERRU/27-189VH..ANI.E.GDTQMP.PFDF.------SHATLIFEEKHF.KDEK...NRYDYTFEIWDF
Q4EPM7_LISMN/1-159ID..AEF.E.ADTAFP.EVDW.------ENFSEVAKEFHE.KDEK...NKYNYTFYTYER
A0NJB2_OENOE/1-163VD..ANI.K.GDTFAP.NFSE.------KSFSLVSQCHHA.QDKK...HAYSFDFLTYER
Q03Y56_LEUMM/3-164VDGVID....GDTFVD.EVDL.------TQFQLKSSEPHA.KDDN...HDYAFVVERYER
Q31I54_THICR/13-172VD..AEV.A.GDTTFP.EWLT.------DEWQEISKEWHD.KDER...HAYAFEFVTLIR
Q2FYK6_STAA8/2-157IE..GKF.R.GDTFFP.PYTF.------EDWEVASSVEGK.LDEK...NTIPHTFLHLIR
Q8EQG1_OCEIH/1-161ID..ESF.T.GDTFFP.KFNQ.------EDWIISSKIKGD.KDEK...NPYDYYFIQYDR
Q5KZ26_GEOKA/1-160IF..ASF.P.GDTFYP.PISD.------DEWEIVSYTPGG.KDEK...NPYEHAFIIYER
Q3XZC6_ENTFC/1-161IH..HVF.D.GDAYFP.PVDW.------SDWSLINTSQGE.MDEK...NRYPHQFETYQR
Q3K0J8_STRA1/4-164VH..GKF.K.GDTYFP.DVNL.------SEFKVISRDYFE.KDEQ...NAHAFTVTYFEK
Q6J2S2_STRPN/4-165IH..ARV.E.GDTYFPEELDL.------SLFETVSSKFYA.KDEK...NPYDFTIQYRKR
Q03S94_LACBA/1-162ID..AGF.D.GDTWMP.VIDY.------SQFTLIDQQPGI.RNEK...NPYDFVFEQYQR
Q38WX9_LACSS/1-163IA..EKF.K.GDVYMP.TIDY.------TQFKLISQKAGA.VDER...NQYPHTFEIYQR
DYR_LACCA/1-161LA..GSF.E.GDTKMI.PLNW.------DDFTKVSSRT.V.EDTN...PALTHTYEVWQK
DYR_ENTFC/1-162ID..AEF.E.GDTFIG.EIDF.------TSFELVEEHEGI.VNQE...NQYPHRFQKWQK
Q1GAP1_LACDA/1-160IK..GIF.S.ADTYMP.NLDW.------AAFALVKSEAHR.ADGK...NKYDYVFETYLR
Q74IU4_LACJO/1-166IH..HIF.K.CDTWMP.ELKY.------EDFKLVNSESHH.PNGN...NKFDYDFLEYKR
A4LE85_BURPE/3-163ID..QDF.E.GDASFP.APDP.------AQWEAVSRDAHR.AAQP...NDFTYAFVVYRR
Q1QUE0_CHRSD/18-183VD..IEV.E.GDAWFP.AFDA.------REWQETQRVPGQ.GGE....GKPEYAFVHYTR
Q3SH97_THIDA/8-166VD..AEP.E.GDAWFP.EFDR.------AAFREISRASHV.GEKG...DVLRFDFVVYER
Q82WU4_NITEU/10-168IQ..QDF.A.GDTFFP.EYDR.------DNWREISREMHQ.ATD....SGIEYHFVVLDR
Q168V7_ROSDO/1-156VQ..LQVPD.ADTFFP.HVDL.------AEWHQIDRRSLR........ESDPACFVVEHL
Q5YPL6_NOCFA/9-167VQVSVQ....GDAHAP.VI..G------AQWRLAEAGPER.....TSTTGLKFRINRYVR
Q5F669_NEIG1/3-161VD..LSV.E.GDAFFP.EIDR.------THWREAERTERR.VSSK....GVAYTFVHYLK
A3ZN23_9PLAN/2-161VQ..AMI.EDGDAFFP.ALDQ.------DKWDRIETREFP.ADEK...NDYPTTFEIWRR
Q6FZ92_BARQU/4-168VL..ASI.E.GDSFFP.VFDR.------EMWTIVQTQYIP.EGDK...DSHRTRFVVYER
Q5GWB6_XANOR/2-163VD..TAVDD.ADTHFP.PIDP.------AAWSPVRRQLHP.ADDR...HAYAFSFVDYER
A0Z2N0_9GAMM/12-176VH..GDV.S.GDATFD.LSVL.------ETWQEQRREHFP.KGAR...NSHDFSVVEFVR
A3WEP6_9SPHN/5-164IH..AEY.K.GDVFMK.PLG..------AEWKVEAREDHT.ADGE...MP.AYSFVTYVR
Q0G0R9_9RHIZ/7-171VD..AEP.E.GDAVFP.AIDE.------SEFELLSEEPWI.RGER...DSAATRFKSYQR
A1SJ32_NOCSJ/7-159VDLEPQ....GDAFYP.EFDR.------SEWRETAREQHD...........GYDRVVLVR
A1WYQ0_HALHL/3-160VD..DAP.P.GDTTFP.AIGP.------.EWQETARE....EAEE...DGYRLTFRTLLR
Q6A762_PROAC/2-154VH..QNP.N.GAARFP.AIDP.------EVWVEVRRE...........SRDGFDFVGYRR
Q0C500_HYPNA/6-171VD..AEI.E.GDTLFP.ELDL.------RQWRSDEIATHP.AGEG...NDHAFIIRRLDR
A3UE72_9RHOB/5-169VD..LEP.E.GDAGFP.DLSP.------EEWREVSAETVE.AAEG...DDAGFTLRVLDR
A5EPD1_BRASB/3-168VH..MSP.P.GDTLFP.AVDP.------ARWEQVARERHA.SGPD...DQADFSYVTYRR
A7IF75_XANP2/10-175VH..AAP.D.GDVFFP.AFDE.------AQWREIARDGPI.QGEK...DEAAFTALTLVR
A3HTR7_9BACT/2-163VD..ATP.V.GDTYFP.EIDK.------NTWKIVSKESFP.SDEI...NQHPFSFINYER
A5FJX2_FLAJ1/1-159VH..HTF.E.GDAFFP.KISK.------SEWQLVESEENF.KDEK...HLYDYTYETYIR
Q1H2G1_METFK/3-159ID..AEF.A.GDAFLP.AFDL.------RDWQKVASEEMV...SA...QGLPFRYITYVR
Q9ZIF9_ENTFL/1-155VD..LNIED.GDTFFP.EFDI.------NDFEVLIGETLG........EEVKYTRTFYVR
Q13PE2_BURXL/6-160ID..LRP.P.GDAFFP.EIPE.------.RFSLPDSVDFP.G.......EIRYTFNTYAV
A5GBA2_GEOUR/2-155IH..SRF.D.GDTRFP.EI.P.------ERFVEVGRETVE........NAIPYSFVLYDK
Q4F6N1_ACIBA/2-156ID..IEP.E.GDVYFP.EIP..------SNFRPVFTQDFA........SNINYSYQIWQK
DRTS_PARTE/6-165IGVETK....CDVYLNKNI..F------STFQVNKTSQTK.....S.ENGINYDYQHLIN
Q6FER8_ACIAD/7-169VE..LDV.Q.GDAYYP.AI.P.------SQFNKVSSEKHF..DDK...TGIAFEFVSYQK
Q6MID1_BDEBA/2-168IH..REF.P.GDTYYP.EIDE.------KVFTQTERRDIE........TPIPFSFLTYLR
A5EUV9_DICNV/5-163IH..TEL.L.GDTFFP.PIRP.------QDWQETHRSHFA.ADAK...NAFALDFVDYQR
Q9RR65_DEIRA/16-174IHAELD....GDTFFP.EI..G------PEWELAQETFRP.ADEK...NRYDLTFQTWRR
A1R8Y8_ARTAT/3-172IDADLE....GDTYAP.EL..G------DDWTFDAVAPAD..GWLTAKNGTNYRFTTWRR
Q6D0D5_ERWCT/2-159ID..AEV.E.GDTHFP.DYEP.------DEWQSVFSEFHD.ADER...NSHSYCFEILER
Q8D3H9_WIGBR/2-161IN..AEI.N.GNIFFP.RYNR.------KKWILSFEKYFN.SDTK...NKYSMYFRIFNK
Q494F1_BLOPB/2-160IHNMVEI.D.GDILFP.DYDI.------REWKSIFNSFYK.VRED......CFCYLHFSI
DYR_BUCAP/2-161VD....FNGIGDTYFPQYKSC.------KFWKTIFRKQHF.KDKN...NPYNFCFEILSR
A4NZZ8_HAEIF/2-159IQ..TEL.D.GDTFFP.QLNW.------EEWEIEFDEYRK.ADEQ...NRYDCRFLILTR
Q7VM78_HAEDU/2-160IE..ADI.E.GDTYF..AFNE.------QDWQLIRKESSE.IDEH...NNYVCHFMQFER
A0PBE3_PASPI/4-169IE..LDV.N.GDTFFP.ELKS.------SEWKLVSTQT.T.LQEG...GFPAHHYQVWER
Q3JEI1_NITOC/2-160VR..GHF.Q.GDTWFP.AFDP.------GTWVEVWREDYD.PDPQ...NPYPYSFIRLER
A1AXR7_RUTMC/2-160VN..GKF.D.GDTYFP.EFDR.------TKFSELSRESHQ.PDEK...NLHAHNFVILQK
A8H0U7_SHEPA/2-158IN..LTV.E.GDTYFP.EWDN.------GSWQEVSRDVAK.ND.....KDVEYSFIKLVK
DYR9_ECOLX/3-167VQLNTQ....QDTELDLSL..F------KSWKLVSEVPTI.....T.ENKTKLIFQIWIN
A6M379_CLOB8/1-162VD..EEF.E.GDTYFP.GINY.------SNYNTEYTSEKF.IDEK...NGLHYTFVNLIQ
Q97EV2_CLOAB/1-152VH..SNQ.T.GDAFFP.KFDE.------NDYSIIAT.......EK...HG.DYDFVTFKR
A0PY39_CLONN/1-163IH..HNF.I.GDTFFP.NINR.------YDWNTTKEIQGI.TDEK...NVYNHTFLILNR
Q0SWS9_CLOPS/1-160VL..KEY.K.GDTYFP.KVDY.------SKWIKTYESSIY...EE...NATKFKYVIYEI
Q03F97_PEDPA/1-160IQ..KDY.Q.CEVLAP.DITQ.------NEFKLASSVEHE.STER...NP.AYTFETWIR
A5VJL0_LACRD/3-160IN..KQI.V.GDTKMP.TIDY.------DRWHLVNHNNYE.KDDQ.....LICRFEEWEL
Q6YQS9_ONYPE/1-156IL..QR..HQGNVFFP.KIDL.------SQYQLIQKEIHP...........QLIFAIYQK
SCPA_MYCGA/1-153LNADYG....CDLFVNLNY...------DDFSLVQTKEYD...........QFVVEYWER
A6DQ18_9BACT/1-147IK..GDY.E.GSIYFP.NIDA.------NIWEVQHHEELP...........EYDYYIYRK
Q47FU1_DECAR/7-169IERAFD....GDSRFPESVQL.------SDWKVESETVRQ.LREYKSNTDVTCRFLIYQQ
A8GUE9_RICB8/5-161IN..NDY.E.GDAFFP..LDLL------KGWDSMMIYKTN...........NYQIYKFTK
O84618_CHLTR/3-153IK..KEY.W.GDTFFP..ITRL------SGWKKECICNTE...........DFSIYYYEN
A7B732_RUMGN/8-169IDHAYQ....ADTYFP.NLDQL------ENWEMTEVSEEH.....T.CFDLEYVFSTYER
A4E6S4_9ACTN/4-169NHCVHV....VDTYFP.DLDAD------PAWEIAQRSGVATIAAGEGDEGVDYEFVTYHR
Q3F0Y0_BACTI/1-170IH..HSFPE.ADSYFP.MLDSS------E.WSSKLDAKHA.ESED...NDHPFSIYTFER
Q5ZYR2_LEGPH/3-160IH..HQF.T.ADVFFP.KINE.------LAWCCRSKEYRQ.HDDK...NQYDMTFCVYER
Q83AB2_COXBU/2-160IN..HSF.E.GDVYFP.EWND.------KEWKITSQIKHE.RDEK...NPYPFQFLELRR
A6EGV0_9SPHI/2-160VE..GSY.E.ADTFFP.EFSE.------EEWLETHREAHL.PDEK...NTVAYTFITFER
A6LIC1_PARD8/3-163IH..HEFPD.ATSFFP.VVNW.------DLWEETEREEYP.ADEK...NPYPYTYITYVR
A5ZJU5_9BACE/15-175ID..NTAPE.ADAFFP.EISP.------AVWHEKNREAHP.ADEK...HLCSYAFVDYVK

PF01872

Q9XBD7_AMYOR/2-196VPFTLGA..-GTRLFE-GVPP.......LKLEQVKSRATT--------SVTHV-------
RIB7_ARCFU/3-213GPIFIGGRD-SPTVCD-GESFL......KKCRIEKIERIG--------EGFAV-------
O66747_AQUAE/4-215LPVIVGGEN-VPTLVG-GEGFKKLKNL.LHLRLRSHFVRG--------KQLIT-------
Q983M6_RHILO/2-170YPGAVGQ..-GKPLFP-QGEQVA.......LELISATPFS--------NGVVA-------
Q9XBC6_AMYOR/17-198FPILLGA..-GKPLFS-DADLPA.....TRLKLVEHEVYP--------NGIQK-------
Q98I97_RHILO/10-193FPLLLGK..-GKRLFG-DGAMP......AAFKLVKSQTSS--------TGVII-------
RIBD_BACAM/146-354APILIGGTL-APSLIS-GEGFQSMKDV.PHLQFTQITQIG--------PDIKL-------
Q98JM8_RHILO/2-188NPAVLGA..-GRRIFD-QGGFRN.......LRLLGSKAYA--------CGMVV-------
RIBD_HAEIN/152-365APKLLGD.N-ARGLCQ-LPNLTKLADA.PLWQLNELEQIG--------DDIKL-------
Q98HZ2_RHILO/2-179VPIMLGA..-GRTMFE-GIGNR......LNVKLARSQAFG--------NGNVF-------
RIBD_SYNY3/148-353APKIIGGVA-APTPVG-ELGFQQMTQA.LNLTDLHCQAIG--------PDWLF-------
RIB7_METJA/9-218APKIFGGKE-APTYVD-GEGFKTVDEC.VKLELKNFYRLG--------EGIVL-------
O05684_MYCLE/49-262APLIVGGRA-RRIATG-PEQLL......TRMRCAHVLTDD--------AGYLY-------
Q9L023_STRCO/25-206FPLLLGA..-GKRLFS-DSDKDA.....RKLRLVEHEVYA--------NGIQK-------
RIBD_BACSU/146-354APKLIGGTH-APSLIS-GEGFQSMKDV.PLLQFTDITQIG--------RDIKL-------
RIBD_MYCTU/154-334APILLGG..-PVTAVD-DVGVSNITNA.LRWQFDSVEKVG--------PDLLL-------
Q9F3D0_STRCO/2-176FPVITGATG-RERIFD-QYPDVT.......LDLVGSRTFD--------GRLQL-------
Q98LQ3_RHILO/2-178HPVVLGG..-GKPYFQ-SGLSLA.......LKPLGTESLP--------QGVTL-------
RIB7_METTH/3-210APMIVGGRD-ARTLVD-GEGIDEMADA.IRLELKRSYTLG--------EDLIV-------
RIBD_AQUAE/150-351APKIMGE..-.GLSIG-DLGIRSIEES.LKVRKKKVENLG--------EDLVI-------
RIBD_CORAM/159-333APLLLGE..-......-..GISVLAHP.LTNTLKGASALC--------PRAAS-------
RIBD_ACTPL/159-368APKLVGGKQ-AKTPIG-GEGIQQIDQA.VKLKLKSTELIG--------EDILL-------
RIB7_YEAST/30-237GSTFLGSSG-TEVSPP-QT.........VNLKDMSWWKGI--------TDVVL-------
RIBD_ECOLI/147-362APKLLGS.D-ARGLCT-LPGLEKLADA.PQFKFKEIRHVG--------PDVCL-------
RIB7_SULSO/5-206SPRIFGN..-GVSFTQ-GEGFIGEDSPRLELIDAKICECG--------NEVHL-------
RIBD_CHLTR/152-363GPKFLGDQG-QPMLRD-LQLSLVTAEH.VRITETSLVRDS--------VKTCF-------
P71968_MYCTU/39-252APYVVGGLA-RRIVTG-PGQVL......TRMRCAHVLTDD--------SGYLY-------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window