Sequence alignment for CL0389

PF15965

B7QIX1_IXOSC/11-103HPHCLNCISIVKCNARSE---QRKSC----QIVAC.KL-----------DCGAS----------------FHSCKCQE--
V8N804_OPHHA/12-104HKHCEKCFN.KYCQAPAE---TSVSC----VVISC.HS-----------HCGAV----------------FHMCKEDD--
F6Z597_XENTR/13-105HQHCERCFN.KRCQAPIN---SGFSC----IMINC.RS-----------NCGAT----------------FHLCKEEE--
A7S9N8_NEMVE/9-97HEHCQNCFK.LYCTSN..---..EKC----KVIAC.DS-----------GCCLR----------------MHECKLSE--
I3NGQ0_SPETR/12-104HRHCEGCIN.RHCHVPVE---PNVSC----LVISC.HL-----------LCGAT----------------FHMCKEAE--
H3DSN6_PRIPA/8-93YSHCSFCIA.SACRFS..---...AC----PLTEC.AV-----------.CYAV----------------LHECKRDD--
H3DNZ1_TETNG/7-99HLHCNQCYD.AHCQVSAK---LSDSC----VVIKC.PK-----------NCGAI----------------LHACKQEE--
C3ZBV3_BRAFL/1-93HSHCTQCYR.RSCFVKPE---LDVSC----EMQAC.PA-----------DCGAR----------------FHACKLSE--
J0XL69_LOALO/27-111HIHCAYCFC.VDCQYN..---...RC----ALRSC.PE-----------.CHAI----------------LHGCKLED--
H2LB95_ORYLA/8-100HEHCDKCFS.AHCQVLVQ---TSRSC----MVTKC.PK-----------NCGTV----------------LHACKREE--
T1KF06_TETUR/33-126HSHCDNCIKITKCRYKNA---RDAAC----PIISC.KE-----------GCGFR----------------FHRCKSDE--
T1J1J7_STRMM/101-194HSHCETCIKIKKCSVRPK---IDESC----AIMTC.TA-----------ECGAR----------------FHSCKLPE--
F1Q6V8_DANRE/12-104HRHCESCHS.RRCKTPIE---ISVSC----AIISC.RL-----------LCGAV----------------FHLCKEEE--
H2ZZ11_LATCH/16-108HRHCEKCLN.RHCRMPIE---PTVSC----VMINC.HS-----------HCGAI----------------FHLCKEEE--
W5MDX5_LEPOC/13-105HKHCEKCFS.RRCKAPIQ---ISVSC----MVINC.RL-----------LCGAV----------------FHMCKEQE--
W5K9R8_ASTMX/19-111HRHCETCYS.KRCRAPIE---ISVCC----LTINC.RA-----------LCGAT----------------FHMCKEDE--
E5S5E0_TRISP/811-899DEHCKCCFS.KKCKFS..---...QC----PMLSC.PN-----------RCCFT----------------MHSCKLVD--
H2TYR7_TAKRU/8-100HVHCDSCYS.RRCRARVE---VSVCC----SVIPC.RL-----------HCGAI----------------FHLCKEED--
M3X5C4_FELCA/7-99HSHCVTCVN.RRCMIRPE---PGISC----DLIGC.PL-----------VCGAV----------------FHSCKADE--
H3D3Y5_TETNG/8-100HAHCVCCFN.QRCMVRPQ---PGISC----ELIYC.PT-----------LCGAV----------------FHSCKADE--
H2MGT7_ORYLA/8-100HVHCMSCMN.QRCMVRPE---PGISC----DLMTC.PQ-----------VCGAV----------------FHACKVVE--
G3PEZ9_GASAC/7-99HEHCITCYS.VHCHVPVQ---ISVSC----IVVKC.RH-----------NCGAT----------------FHMCKQEE--
F1QPK7_DANRE/5-97HSHCMSCIN.RRCMLKPE---PGTSC----DLISC.SF-----------VCGAI----------------FHSCKATE--
W4YYV2_STRPU/500-592HGHCGSCYS.RDCQVSPQ---PGNAC----SLVNC.EV-----------DCGAR----------------FHRCKEDE--
E7EZS7_DANRE/12-104HRHCETCYN.RRCKASIE---VSVSC----MVINC.RL-----------LCGAS----------------FHLCKEDE--
H2RU05_TAKRU/8-100HSHCLKCIN.RRCMVRPE---AGVSC----DLIGC.PL-----------VCGAV----------------FHTCKLDE--
U3ICA7_ANAPL/18-110HRHCEKCFS.RHCRAPIE---PSVSC----MVISC.RF-----------HCGAT----------------FHMCKEEE--
U1P041_ASCSU/13-97HIHCRYCYK.INCNYS..---...KC----KMIIC.TE-----------.CSVP----------------LHPCKLDD--
M3ZZZ2_XIPMA/13-105HLHCDSCYS.RRCRARVE---PSASC----ALVPC.RL-----------LCGAV----------------FHLCKEED--
W5KE54_ASTMX/67-159HKHCEKCFN.QHCKVSVE---ISTSC----VVISC.RL-----------QCGAA----------------FHLCKEDE--
I3K6V1_ORENI/5-97HVHCMSCFN.QRCTVKAE---TGLSC----ELITC.PL-----------VCGAV----------------FHSCKVDE--
B3RLD3_TRIAD/13-101HPQCLTCIL.IDCQHK..---..NHC----QMIQCNNS-----------GCNAC----------------FHACKLTE--
E9HAM6_DAPPU/10-103HAHCESCIKISKCTKKTI---EGESC----AIICC.QR-----------KCGAS----------------FHSCKESE--

PF02176

TRAF6_MOUSE/204-261HDQS.CPLA----------------------NIICEY.-----------.CGTI----------------LIREQMPN--
DG17_DICDI/197-255HYKT.CPMV----------------------PIDCSQG-----------CSVK.----------------IERKSIID--
TRAF5_HUMAN/183-241HEENLCPEY----------------------PVFCPNN-----------CA.KI----------------ILKTEVDE--
TRAF2_MOUSE/178-235HYEV.CPKF----------------------PLTC.DG-----------CGKKK----------------IPRETFQD--
TRAF5_MOUSE/128-183HLQH.CSFQ----------------------AVPCPNE-----------SCREA----------------MLRKDVKE--
TRAF2_HUMAN/178-235HHEV.CPKF----------------------PLTC.DG-----------CGKKK----------------IPREKFQD--
TRAF3_HUMAN/136-192HLKNDCHFE----------------------ELPCVRP-----------DCKEK----------------VLRKDLRD--
TRAF4_HUMAN/102-156HLNT.CSFN----------------------VIPCPNR-----------CPMK.----------------LSRRDLPA--
TRAF4_HUMAN/210-269HQYQ.CPRL----------------------PVACPNQ-----------CGVGT----------------VAREDLPG--

PF03145

U3JRJ7_FICAL/62-258----------IRNLAME.---KVASA....VLFPCKYATT.........GCSLT----------------LHHTEKPK--
M0SES1_MUSAM/113-312----------IRCLALE.---KLAVS....LHLPCAYHHL.........GCEEM----------------FPYYSKLQ--
F4JDF6_ARATH/5-209----------INDLQVES---RVHEL....LDFPVHTNQISSAIYEILLQCP..----------------......ND--
E1G988_LOALO/123-320----------VRNLVLE.---KIANT....VMFPCKFAGS.........GCPLT----------------FSHVEKVE--
Q29HR3_DROPS/255-449----------.RSLTVE.---ALCAK....AHFGCSHAAG.........GCQVR----------------MPVALLPW--
W1PHN4_AMBTC/145-342----------IRCLALE.---KVAAS....LELPCKNRNL.........GCPEV----------------LPYHSKLK--
W5NWR0_SHEEP/85-282----------VRNLAME.---RVADL....VLFPCRYASS.........GCGAT----------------MPPTEKVD--
I1NWW3_ORYGL/102-301----------IRCLALE.---KVAES....LQLPCKYQSL.........GCAEI----------------HPYQNKLK--
H0Y018_OTOGA/86-284----------IRNLAME.---KLANS....LPFPCKYASS.........GCGTS----------------LPPVQKAR--
M1C6R4_SOLTU/36-234----------IRCLALE.---KVAES....LELPCRYQNL.........GCHKI----------------LPYHRKLK--
K1RDH5_CRAGI/70-266----------IRNLAME.---KVATT....VMFPCKYSSS.........GCPVT----------------LLHTDKQE--
Q7QF99_ANOGA/180-384----------LRNYTLE.---AIVSK....VQFPCRNAVK.........GCSVR----------------LPLQLLRW--
H0Y1K4_OTOGA/82-279----------.HNLALD.---RVAYS....LSFPCKYTSA.........GCGTI----------------LPPAEKAD--
Q178N6_AEDAE/160-363----------MRNYTLE.---AIAAK....VHFPCTHAAR.........GCTVR----------------LPLELLWW--
I1G062_AMPQE/69-267----------VRNLAMD.---KVAET....VLFPCKYANS.........GCSLR----------------FLHNEKRK--
E4WS61_OIKDI/128-324----------IRNLAME.---KVAAT....VYFPCKYKSN.........GCNQQ----------------MLHTEKPT--
H0XJR4_OTOGA/82-278----------VRNLAME.---KLANS....VLFPCQYAPA.........GCGIT----------------LPPVEKAD--
H0XIX1_OTOGA/145-341----------IRNLAME.---KVASS....VLFPCKYASS.........GCGIT----------------LPPTEKAD--
SINAL_DROME/147-341----------IRSLAME.---KVASK....LIFPCKHSHF.........GCRAR----------------LSYAEKTK--
F7I459_CALJA/77-273----------IRNLAME.---KVANS....VIFPCTYALS.........GCRIT----------------VPYKEKAE--
G3X7V0_BOVIN/80-277----------IRNLAME.---KLANS....VLFPCKYASS.........GCEVT----------------MPPTEKAD--
Q7PZE6_ANOGA/33-226----------.....IE.---KLLHQ....AMCPCRYAPN.........GCTWK----------------FVQSEMDA--
H0Y0B7_OTOGA/82-279----------IRNLVMD.---KVAYS....LTFPCKYAVF.........GCGTT----------------LSPAEKAE--
H0XK85_OTOGA/82-279----------IRNLAME.---KVADS....LSFPCKYAPS.........GCRIT----------------LPPAGKAD--
B4LE73_DROVI/110-304----------IRNLAME.---KVGSK....LIFPCKHACY.........GCRVR----------------LSYADKKS--
B4QNB8_DROSI/191-380----------........---QVASN....VKFPCKHSGY.........GCTAS----------------LVYTEKTE--
H9JRH4_BOMMO/72-263----------IRSAVLE.---SLANK....VLFPCTNA...........GCPKH----------------ATLPLLEK--
H0XTM6_OTOGA/82-280----------IRNLVMD.---KVAYS....LTFPCKYASF.........GCGTS----------------LPPAEKAD--
M1D5F6_SOLTU/101-299----------IRCLALE.---KIAES....LELPCRYQIY.........GCQDI----------------FTYHTRLR--
E3M5Q1_CAERE/208-407----------VRNLGLE.---KIANT....VRFPCKFSNS.........GCPLN----------------FHHIDKMD--
W1NE48_AMBTC/91-290----------IRCLALE.---KLAVS....LHLPCAYHRL.........GCEEM----------------FPYYTKLK--
D6W8F0_TRICA/124-320----------IRNLAME.---KVANN....LMFPCKHKST.........GCRMS----------------LGLNEKAE--
T1KZZ1_TETUR/128-324----------IRNLQME.---KLAMN....LLFPCKYSSQ.........GCLLN----------------LTCSDKTD--
G4LYG6_SCHMA/167-362----------IRNLAME.---KLASS....VLFPCKYSTS.........GCPET----------------FHYTSKSE--
H0XXJ8_OTOGA/83-277----------.CNLAMD.---KVASS....LTFPCKYTSS.........GCGTS----------------LPPEKKAR--
D6WQJ0_TRICA/35-224----------.RNFSLE.---SVCTV....LQYPCSNEMR.........GCSHY----------------MKLEEFAE--
E5S2J1_TRISP/95-295----------VRNLVME.---KIANS....VLFPCKFSSN.........GCPAA----------------MLYQEKVE--
M4CBD9_BRARP/5-207----------INHLQIES---QVHEL....LDYPVCTNQITSTIY....QCS..----------------...NDYTG--
B3RLR7_TRIAD/93-285----------VRNLQME.---KLART....LVFPCKFRQS.........GCQLC----------------FSPDERKI--
E0W112_PEDHC/92-276----------.KNIMLA.---QIAEY....VKYPCPNTIG.........GCEEV----------------YYLRDEET--
B9GYJ4_POPTR/105-304----------IRCLALE.---KIAES....IELPCKYQSM.........GCCDI----------------FPYYSKPK--
M0T9A8_MUSAM/95-294----------IRCLALE.---KVAES....LELPCKYSTL.........GCPEI----------------FPYYSKLK--
D6WZ00_TRICA/55-252----------.RNYQLE.---QIIENMPRDLKCPCFFADK.........GCKYM----------------LSPTEKAD--
G1MN92_AILME/82-278----------IRNLAME.---KVANS....VLFPCKYTAA.........GCEIT----------------LPHTEKAD--
I1H5D3_BRADI/95-294----------IRCLALE.---KVAAS....LELPCKYQNF.........GCVGI----------------YPYYCKMK--
G3S7D8_GORGO/77-272----------IRNLAME.---KVAKF....VLFPCRYACL.........GCEIT----------------LPHTEKVD--

PF00917

A8MQL1_ARATH/74-197----------IPKFSEIT.....KRE----HRSNVFEAG----------GYKWY................ILIYPQGCD.
Q93Z83_ARATH/66-193----------ITSFSVIK...GRGEP----YESSVFEAA----------GYKWR................LVLYVNGNKN
Q940M1_ARATH/102-220----------IRDFSVLK.....QND----CISKTFAMG----------GKNWT................LTVYPKGDS.
DG17_DICDI/327-450----------ISNYSSVAKSKLNCQA----LSSPMLSIL----------SHLFQ................VCVYPKGDE.
O76557_CAEEL/290-402----------VRNISSIN...GGNVY----FT.DIETRF----------NVPWK................LSFVRQSG..
O16553_CAEEL/149-261----------VKNISSIE...EGDDY----YT.EIATRH----------NVPWR................MQIKRNNG..
O16554_CAEEL/23-135----------VKHISSIK...EGDDY----YT.KIEKRY----------NIPWK................LGIHRSNG..
O16557_CAEEL/96-208----------VENVSSIE...EGGHY----YT.KTEKRF----------NIPWR................LLIQRCDG..
O16558_CAEEL/149-261----------VKNVSSIK...EGGNY----FT.NTEKRF----------NIPWR................LQIQRFNE..
O16559_CAEEL/157-269----------VKNVSSIK...EGGNY----FT.KTEKRF----------NIPWK................LNIERKNG..
O16560_CAEEL/140-252----------VKNVSRII...DGSDY----FT.KIENRF----------NIPWQ................LKIQRRNG..
O16562_CAEEL/108-218----------VKNMSSIK...EGEEY----FS.DIQTRF----------NIPWY................LQVKRRDG..
O17191_CAEEL/289-401----------VKNMSRIE...EGEEY----YT.GIQTRF----------NIPWK................LKIKKQSG..
O17190_CAEEL/289-402----------VRNMSSIK...EGGDY----LT.DIQTRF----------NIPWK................LKIQRLNG..
O17288_CAEEL/229-340----------IKNMSSIR...EGEDY----DT.DTQYRF----------NIPWS................LKILNRNE..
O76558_CAEEL/284-397----------VKNMSSIE...EGRII----FS.DTQTRF----------NILWK................LKIRKQDG..
O76641_CAEEL/14-126----------VKNISRFV...NGENY----YT.NLEDRF----------NIPWR................INIKKMSG..
O76642_CAEEL/14-126----------VKNISRFV...DGESY----YN.NLEDRF----------NIPWR................MTLERKNY..
O16551_CAEEL/14-125----------VKNISRFV...DDESY----FT.DTEERF----------NIPWR................IEIKKKDG..
U4PC47_CAEEL/14-126----------VRNISQFL...NGEQY----FT.DVEERF----------NIPWR................IRIWRHNG..
O16555_CAEEL/11-123----------VRNISRFE...DQEQY----ST.DTETHF----------NIPWA................LQIRKNNG..
O17303_CAEEL/12-125----------FKDVSKLD...EGGSY----YS.DIEIRH----------NIPWRL..............S..ISKKDG..
O17192_CAEEL/12-124----------FKDISKLG...EGESY----FS.DKEERY----------NIPWR................LQIFRKGG..
P91300_CAEEL/283-399----------FYDVSRIE...EGESR----FS.AFEKRF----------NIPWR................IELKRVSG..
O16736_CAEEL/14-129----------VKNVSSIA...DGGEH----VT.PSEIHY----------GTEWY................MRIKRDNG..
O17193_CAEEL/11-126----------VKNIAAMK...EGDSQ----ST.TSEQHF----------GLPWY................FKVFCKDK..
O76610_CAEEL/166-276----------KYTFEKFD.....EDC----VG.GYNVQL----------GFLWS................LNIHRKND..
O44817_CAEEL/14-126----------FKNVTKWK...TGEIF----YS.PDEEHF----------NVPWQ................MCIHRENG..
O16567_CAEEL/26-139----------SSGLTPVA...APQPA----YTGRSTENF----------NIPWF................IEILRKTN..
O44815_CAEEL/14-128----------YKNVSKLE...DEGTL----LS.PSEEHF----------NVQWY................MAVSHKKE..
O76568_CAEEL/14-130----------FTDVSKME...KDISV----FS.PGEEHF----------NVSWN................MSISCEGD..
O17297_CAEEL/14-127----------FKNVSKMK...DSDFL----YS.PEENLF----------NVPWF................MLIARKDD..
BAT15_CAEEL/14-125----------FKDVSQLE...DGDFF----KS.PEEIHY----------NAEWF................ILVIRTKD..
O44805_CAEEL/17-135----------FNDVSNMN...DNDMR----FG.TVEEYF----------NVPWI................FQIQRNNG..
O76611_CAEEL/30-142----------IKNISTLN....IGNT----YTSDVEDHF----------GFLWH................LSYIYDGR..
BAT38_CAEEL/86-206----------IPNFSNLR......SK----VSTPFQYIG----------NLPWR................LAAKTEKTKR
O45623_CAEEL/38-168----------IDCFSKFM..SRSDNR----IMSKPIIVR----------GIPWRILAICRNQQGSRHSMNSRVNRSNF..

PF15965

B7QIX1_IXOSC/11-103-----HQL-LCPNVKVPCSNAV---NGC---------PASLLRSQLGSHL.QHCPASILSCT------------------
V8N804_OPHHA/12-104-----HKL-LCPLEQVSCLNSI---YGC---------PFTMARFKVAKHL.QVCPASIVSCS------------------
F6Z597_XENTR/13-105-----HRL-LCPYEWVPCLNSG---FGC---------PFSMSRFKLAKHL.KVCPASVVCCS------------------
A7S9N8_NEMVE/9-97-----HKL-VCLKAKTPCTNSF---YGC---------PAVLPRESIKSHL.SICPASAIFCT------------------
I3NGQ0_SPETR/12-104-----HKL-LCPLEQVPCLNSE---YGC---------PLLMSRHKLAKHL.QMCPASVVCCS------------------
H3DSN6_PRIPA/8-93-----HQE-ICRMEMVPCLNSS---FGC---------PLSIRRSLLSRHL.SVCPASVISCS------------------
H3DNZ1_TETNG/7-99-----HQL-LCPNETVACLNVL---YGC---------PLHVQRRRLAKHL.EVCPASVVCCS------------------
C3ZBV3_BRAFL/1-93-----HGL-ICPNEKAPCINAV---NGC---------PKWMPRGQHARHL.AHCPASVVRCT------------------
J0XL69_LOALO/27-111-----HLL-ICAKAYVPCLCAA---FGC---------PVLLRRDRMSQHL.KHCCASSICCA------------------
H2LB95_ORYLA/8-100-----HVL-LCPNETVPCLNAF---YGC---------PLTMQRQKLAKHL.EVCPASVVCCS------------------
T1KF06_TETUR/33-126-----HQL-LCANEKILCINHN---FGC---------PAFLPRKDLSKHI.SRCPASVIHCY------------------
T1J1J7_STRMM/101-194-----HKL-LCMNEKVPCINSI---NGC---------PLSMPRHQLGRHL.ERCPASVVHCT------------------
F1Q6V8_DANRE/12-104-----HMF-LCPNERVPCFNVE---YGC---------PFTMCRSNLAKHL.VVCPASIVSCS------------------
H2ZZ11_LATCH/16-108-----HRL-LCPLERVPCLNSG---YGC---------PFDMPRFKLARHL.TTCPASVVCCS------------------
W5MDX5_LEPOC/13-105-----HQL-LCPNEKVPCLNAG---YGC---------PFSMARCKLSKHL.EVCPASIVCCS------------------
W5K9R8_ASTMX/19-111-----HIL-LCPNEQVPCLNAH---YGC---------PFTMCRSKLAKHL.ETCPASVVCCS------------------
E5S5E0_TRISP/811-899-----HLF-ICQEQEINCLNAS---IGC---------PFRLKRKQLSKHLADQCPACVVYCS------------------
H2TYR7_TAKRU/8-100-----HML-LCPNVKVPCINAG---YGC---------PLHLPRSMRASHL.RECPASVVCCS------------------
M3X5C4_FELCA/7-99-----HRL-LCPFERVPCLNSD---FGC---------PFTMARNKVAEHL.EMCPASVVCCT------------------
H3D3Y5_TETNG/8-100-----HRL-ICPLVRVPCLNSS---NGC---------PASIVRNQLYAHL.EVCPAGVVSCT------------------
H2MGT7_ORYLA/8-100-----HKH-LCPLMKVPCLNRG---YGC---------PATLTRNQMYAHL.EVCPAGVVCCT------------------
G3PEZ9_GASAC/7-99-----HHL-LCPNETVPCLNVE---YGC---------PLTLVRHRMAKHL.EVCPASVVCCS------------------
F1QPK7_DANRE/5-97-----HKL-LCPLERVPCLNQS---IGC---------PFTLARGQMAEHL.EVCPAGVVCCS------------------
W4YYV2_STRPU/500-592-----HRL-LCPNAKTECVNAI---YGC---------PVDIQRRHICRHL.EVCPASVVNCT------------------
E7EZS7_DANRE/12-104-----HSL-LCPNEKVPCINAH---YGC---------PFTMCRSRLAKHL.EVCPASIVCCS------------------
H2RU05_TAKRU/8-100-----HRE-LCPYERLPCLNRG---FGC---------PFTIARIKMAKHL.ETCPASIVCCT------------------
U3ICA7_ANAPL/18-110-----HQL-LCPLEQVPCLNSD---YGC---------PFSMARFKLAKHL.QVCPASVVCCS------------------
U1P041_ASCSU/13-97-----HLL-LCSKARVPCPNAS---GGC---------PLVLRRERIGAHL.ENCCASVVFCA------------------
M3ZZZ2_XIPMA/13-105-----HLL-LCPNVRVPCLNAE---YGC---------PVQLPRSSRAAHL.QVCPASVVCCS------------------
W5KE54_ASTMX/67-159-----HNL-LCPKVTVPCLNAQ---YGC---------PMSMPRHRLAQHL.ESCPASVVCCS------------------
I3K6V1_ORENI/5-97-----HQL-MCPLMRIPCLNSG---YGC---------PATLVRNQMYAHL.EVCPAGLVCCT------------------
B3RLD3_TRIAD/13-101-----HKL-LCLYENVQCINWY---YGC---------PQTMPRCRLNQHL.TVCPASIVHCS------------------
E9HAM6_DAPPU/10-103-----HIL-LCPNVQEPCINVN---YGC---------PHVLLRKHRGKHL.ESCPASCLPCN------------------

PF02176

TRAF6_MOUSE/204-261-----HYDLDCPTAPIPCTFSV---FGC---------HEKMQRNHLARH-------------------------------
DG17_DICDI/197-255-----HIENDCCNTQIPCKYFE---QGC---------KVEMKRSELQNH-------------------------------
TRAF5_HUMAN/183-241-----HLA.VCPEAEQDCPFKH---YGC---------AVTDKRRNLQQH-------------------------------
TRAF2_MOUSE/178-235-----HVR.ACSKCRVLCRFHT---VGC---------SEMVETENLQDH-------------------------------
TRAF5_MOUSE/128-183-----HLSAYCRFREEKCLY..---..C---------KRDIVVTNLQDH-------------------------------
TRAF2_HUMAN/178-235-----HVK.TCGKCRVPCRFHA---IGC---------LETVEGEKQQEH-------------------------------
TRAF3_HUMAN/136-192-----HVEKACKYREATCSH..---..C---------KSQVPMIALQKH-------------------------------
TRAF4_HUMAN/102-156-----HLQHDCPKRRLKCEF..---..C---------GCDFSGEAYESH-------------------------------
TRAF4_HUMAN/210-269-----HLKDSCNTALVLCPFKD---SGC---------KHRCPKLAMARH-------------------------------

PF03145

U3JRJ7_FICAL/62-258-----HEA-ICEYRPYSCPCPG...TSC---------DWEGSLEAVMSHLMHAH.KSITTLQ....G.EDIIF...LAT.
M0SES1_MUSAM/113-312-----HET-RCTYRPYTCPHPG...SDC---------PFTSDSLALLSHLRERH..KVDLQA....G.CTFNHRY.VKQ.
F4JDF6_ARATH/5-209-----HIE-NPKKKPYNCPHSG...AKC---------DVTGDIQRLLLHLRNDH..NVEMSD....G.RSFSHRY.VHH.
E1G988_LOALO/123-320-----HEE-LCEFRPYCCPCPG...ASC---------KWQGSLSEVMGHLMKVH.KSITTLQ....G.EDIVF...LAT.
Q29HR3_DROPS/255-449-----HEQ-QCIYKPMKCFMGRVW.GEC---------KWQGREVQWKEHLEEQHAEKLFRSS....T.SDLVW.......
W1PHN4_AMBTC/145-342-----HES-QCTYRLLSCPYAG...SEC---------TVVGDVPFLVAHLRDDH..KVDMHN....G.STFNHRY.VKS.
W5NWR0_SHEEP/85-282-----HEE-QCEFRPCRCPCPG...ASC---------GWQGAMDAVVPHVMQHYNNSVITLE....G.EVVVF...LAV.
I1NWW3_ORYGL/102-301-----HEE-LCRFRPYSCPYAG...SEC---------LIAGDVPMLVSHLINDH..KVDLHE....G.CTFNHRY.VKS.
H0Y018_OTOGA/86-284-----HEG-LCDFRPYFCPCPG...VLC---------PWEGSVDAVMPHLMDQHDDRITALQ....G.ETATF...LAM.
M1C6R4_SOLTU/36-234-----HER-RCKFRPYHCPYAG...SEC---------SITGDIPTLMLHLKEDH..KVDMHT....G.CTFNHRY.VKS.
K1RDH5_CRAGI/70-266-----HEE-TCEYRPYCCPCPG...ASC---------KWQGSLEQVMGHLMQQH.KSITTLQ....G.EDIVF...LAT.
Q7QF99_ANOGA/180-384-----HKE-RCGYKLIECFMGKVW.GGC---------GWHGCERDWLAHCLAEHADHVHEDR....C.VELQWAYGAEAA
H0Y1K4_OTOGA/82-279-----HEE-VCDFRPYPCPCPG...VRC---------PWAGFLDAVMPHLMYQHGNRIITLQ....G.ETATY...FAM.
Q178N6_AEDAE/160-363-----HKD-RCGYKQIECFMGKVW.EDC---------SWHGCEKDWIGHCVTEHQDKVYNLP....D.IVLTWNYAADS.
I1G062_AMPQE/69-267-----HEE-TCEFRPYACPCPG...TTC---------RWQGSLDEVLDHLLNAH.KTITTLN....G.EDIVF...LAT.
E4WS61_OIKDI/128-324-----HED-QCEFRPYVCPCPG...ASC---------KWSGNLDEVMEHLLVNH.KSITTLQ....G.EDIVF...LAT.
H0XJR4_OTOGA/82-278-----HEG-LCEFRPYSCPCPG...VSC---------QWQGSLEAVMPHLLQQH.AYLKAIQ....G.EKTVF...LAM.
H0XIX1_OTOGA/145-341-----HEE-LCEFKPYSCPCPG...VSC---------QWQGSLEAVMPHLMDQH.KPLIAPQ....G.ENILF...LAT.
SINAL_DROME/147-341-----HEE-DCECRPYFCPYPD...DKC---------SWQGPLRDVYQHLMSSH.ENVITME....G.NDIIF...LAT.
F7I459_CALJA/77-273-----HEK-VCKFRPCRCPCPG...TLC---------KWHGPLEAIVHHLRNEH.DYIITLK....R.EYIIF...LAT.
G3X7V0_BOVIN/80-277-----HEE-HCEFRPCRCPCPG...TSC---------GWQGSMDAVVPHLMQHYNESIITLQ....G.EVVVF...LAV.
Q7PZE6_ANOGA/33-226-----HLV-ECRFRPYRCVAASLNVIKC---------NWQGLQHEIEDHLAKGH.KEL........G.EVFRFRESTSL.
H0Y0B7_OTOGA/82-279-----HEK-VCDFKPYSCPCPN...VLC---------PWEGSLDAVMPHLRRQH.GSVTALE....G.QIAIF...LAT.
H0XK85_OTOGA/82-279-----HEE-VCDFRPYSCPCPG...VLC---------PWEGSVDAVMPHLMDQH.GSLTALE....G.ETAIF...LAM.
B4LE73_DROVI/110-304-----HEE-DCEFRPYFCPYPD...EKC---------VWQGALKDVYKHFVSTH.QNVITME....G.TDIIF...LAT.
B4QNB8_DROSI/191-380-----HEE-TCECRPYLCPCPG...ASC---------KWQGPLDLVMQHLMMSH.KSITTLQ....G.EDIVF...LAT.
H9JRH4_BOMMO/72-263-----HTP-HCQFRIINCFMARVY.GEC---------TWEGRAGDWMDHCFSEHKQKV..........TDLPFITVKDK.
H0XTM6_OTOGA/82-280-----HEE-VCDFRPYSCPCPG...VRC---------PWAGSLDLVMPHLIHQHDDHITSVE....G.ETAIF...LAV.
M1D5F6_SOLTU/101-299-----HEQ-NCRFRPYNCPYAG...SEC---------AVTGDIQHLVAHLKDDH..KVDMHD....G.CTFNHRY.VKS.
E3M5Q1_CAERE/208-407-----HEE-LCEYRPYSCPCPG...ASC---------KWQGALSDVMDHLKKVH.KSITTLQ....G.EDIVF...LAT.
W1NE48_AMBTC/91-290-----HED-QCVFRPYSCPHPG...SDC---------PVTGDVPTLVAHLREVH..KVDLQT....E.CTFNHRY.VKK.
D6W8F0_TRICA/124-320-----HEE-ICEFRPYSCPCPG...ASC---------SWQGQLDKVMVHLQHSH.KNITTLN....G.EDIVF...LAT.
T1KZZ1_TETUR/128-324-----HED-SCDFKSYSCPCPG...SNC---------KWNGPLKQVMHHLMTQH.KSITTLQ....G.EDIVF...LAT.
G4LYG6_SCHMA/167-362-----HEA-ACEYRPYDCPCPG...ASC---------KWLGELEQVMPHLVHHH.KSITTLQ....G.EDIVF...LAT.
H0XXJ8_OTOGA/83-277-----HEG-VCDFRPYSCPCPG...VLC---------QWEGSVDAVMPHLMDQHDDCVTAQE....G.ETAIF...LAT.
D6WQJ0_TRICA/35-224-----HQE-RCDYRNYRCMFE....KYC---------CWQGTRDKLKKHYVDKHDNNVLIGS..............TSM.
E5S2J1_TRISP/95-295-----HEE-ACEFRPYSCPCPG...ASC---------KWQGNLDAVMPHLVKIH.KSITTLQGINLG.EDIVF...LAT.
M4CBD9_BRARP/5-207-----EVN-NDKENPYNCPYSG...SKC---------TATGDTQWLLQHLRNDH..HVEMHD....G.RSFSHRY.VHH.
B3RLR7_TRIAD/93-285-----HED-SCPFRIYSCPFP....ITC---------RWQGSLDSVVSHIVNSH.KTVPMQD....G.EDVVFSFVITS.
E0W112_PEDHC/92-276-----HLK-KCGYIVHRCKI.....DNC---------DWIGKKDELKSHVENLHQEDIWKKEWNFAGSRKFEH.......
B9GYJ4_POPTR/105-304-----HEK-NCKYRPYNCPYAG...AEC---------SVTGDIPLLVKHLRNEH..KVDMHD....G.CTFNHRY.VKS.
M0T9A8_MUSAM/95-294-----HEA-RCNFRPYNCPYAG...SEC---------SVVGEIPFLVAHLRDDH..KVDMHT....G.CTFNHRY.VKS.
D6WZ00_TRICA/55-252-----HEV-ECKNRKFLCEGRKFAKWKC---------EWFGNYGELEQHFKDVH............R.NSMEYKMQTEM.
G1MN92_AILME/82-278-----HEE-MCEFRPYVCPCPG...AFC---------KWQGSLEAVMPHLMHQH.ESITTLQ....G.EDIVF...LAT.
I1H5D3_BRADI/95-294-----HES-QCQYRPYSCPYAG...SEC---------TVAGDIPYLVNHLKDDH..KVDMHS....G.STFNHRY.VKS.
G3S7D8_GORGO/77-272-----HEE-VCEFRLYSCPCPG...TVC---------KWQGTMDAIMPHLTKMH.EYITTIE....G.EDIIF...LAT.

PF00917

A8MQL1_ARATH/74-197..VCNHLS-----LFLCVANYD---KLLPGSFAILEAGWSQFAQFTISVLSQDLKK...SKF------------------
Q93Z83_ARATH/66-193DGGNDHIS-----LYARIEETN---SLP........LGWEVNVDLKLFVHNGKLHKYLTV..------------------
Q940M1_ARATH/102-220.EADNEFC-----KYLHLADGE---VLS........PGEMISVRAQLRALDPRGSK..HKTV------------------
DG17_DICDI/327-450..NKEYIS-----LYLRVNNIE---EPN.........SLKVEYSFTLVNVLDKSKS...ITK------------------
O76557_CAEEL/290-402.....FIE-----LYLRCEKK.---.QC......LSRTWSIEAEFTLKLVSPHGRS...LSL------------------
O16553_CAEEL/149-261.....FFE-----LYLRCEKE.---.EQ......PEWGWKIELDYDLRLVSLNGQS...LSL------------------
O16554_CAEEL/23-135.....FFG-----LFIYCDKK.---.LS......ETRPWGIKVEDTLKLVSVNGQS...LSF------------------
O16557_CAEEL/96-208.....FFG-----LYLCCQKE.---.QC......NRRNWTIEVDYTLKLVSVNGQS...LSS------------------
O16558_CAEEL/149-261.....FFG-----LYLRCEKE.---.LS......NRRNWTIEVEYDLRLVSLNGQS...LSI------------------
O16559_CAEEL/157-269.....FFG-----LYLHCTKE.---.LS......NKNNWTIEVEFDLRLVSLNGQS...LSI------------------
O16560_CAEEL/140-252.....FFG-----IFLHCNKE.---.MS......NRSNWTIAVDFTLKLVSTNGQC...LTS------------------
O16562_CAEEL/108-218.....FNG-----LFLHCSKH.---.LD......EFRNWSIKTEYQFKLVSTNGRN...VAF------------------
O17191_CAEEL/289-401.....FFG-----LFLHCFKQ.---.LD......EFRKWSIETEYQLKVVSSNGRS...VSF------------------
O17190_CAEEL/289-402.....FIE-----LFLRCAEN.---.MC......ESRKWSIETEYQLKLVSTNGRS..LSLK------------------
O17288_CAEEL/229-340.....FSG-----LFIRCEKQ.---.LC......KSRKWSIETEYQLKIVSPNGRS...ELF------------------
O76558_CAEEL/284-397.....FFE-----LFLLCDKQ.---.LC......KSRKWSIETVFQLKIVSSNGRS..LVLL------------------
O76641_CAEEL/14-126.....NFE-----FYLRCEKEE---CEN........RKWSIETEYTLKLVSHNGKS...LKK------------------
O76642_CAEEL/14-126.....QCG-----FYLRCEKE.---.EC......EARKWSIETEYTLKLVSQNGKS...LMK------------------
O16551_CAEEL/14-125.....NFE-----LFLKCQKE.---.EC......ENRKWSIETEYTLKLVSQNGKC...LMK------------------
U4PC47_CAEEL/14-126.....YLV-----LYLQCDKEQ---CET........RKLTVETEFTLKLVSPYGTS...LAR------------------
O16555_CAEEL/11-123.....YLQ-----FYLLCEKE.---.EC......ETRKWSIEVEFKLKLVSYNGKR...LMT------------------
O17303_CAEEL/12-125.....FLG-----VNLHCENK.---.ECS.....ETKKWSFQTKFTMKLVAVSGKF...FQR------------------
O17192_CAEEL/12-124.....FLG-----LNLKCEKKE---CFG.......ERKWSFQTKFTMKLVAVSGKF...FQR------------------
P91300_CAEEL/283-399.....FLE-----IHLHCGEN.---...A.....TFLYHQIETDCWFNLVSTNGKH...LMR------------------
O16736_CAEEL/14-129.....FMS-----FGLYCPMTG---KTT.........NWSIVADIRVELMPLTGMWK.SVEC------------------
O17193_CAEEL/11-126.....HLQ-----LCVYYGAQL---IAE.........EQSIEVECDFKMITPTGKI..FVEK------------------
O76610_CAEEL/166-276.....HLR-----ISLCCDKPE---PTP.........YWEVRADFQLVLPGQDEAP...VTK------------------
O44817_CAEEL/14-126.....NMC-----VILCCLKVE---EDR........VPWKINFEYQLKIVNISGMS..IVKA------------------
O16567_CAEEL/26-139.....RLA-----VYFHCDKLK---EDE........IDWSIDVEYEITLKSSDGKR..ITKK------------------
O44815_CAEEL/14-128.....DMA-----VYLHCNILG---KAE........ATWCIDAEFEFTLKNSCGKR..STKK------------------
O76568_CAEEL/14-130.....HLG-----VFLHCHKSR---GKE........TMWTIDTEHQFTLKTSSGKA..YRED------------------
O17297_CAEEL/14-127.....HFG-----VFLHCQKIN---EAG........PTWSVDTQNTIRVKTLSASK...VSS------------------
BAT15_CAEEL/14-125.....QLE-----AYLHCDNEK---DDN........VAWTVDAEFSLKIASSSGSY...AMK------------------
O44805_CAEEL/17-135.....NLG-----IYLRCTNLK---DQE.........MWSIFSELELKLVSVYSDT..RDQK------------------
O76611_CAEEL/30-142.....FLR-----TTLNIDVNG---RSA.........LWSVGMKVRHMFVTKNGA....DHF------------------
BAT38_CAEEL/86-206TSDVKFFS-----VYIDCNPES---EST.........LWSCDAVVEFRLVSRNRTIP.PFSR------------------
O45623_CAEEL/38-168.....NFG-----FFLQCNNDE---LLQ......KRGMWRCYGTAVLEVLNADGPS...IQK------------------

PF15965

B7QIX1_IXOSC/11-103----------------------------------------------------------------------------VEWN
V8N804_OPHHA/12-104----------------------------------------------------------------------------MEWN
F6Z597_XENTR/13-105----------------------------------------------------------------------------MEWN
A7S9N8_NEMVE/9-97----------------------------------------------------------------------------MEWN
I3NGQ0_SPETR/12-104----------------------------------------------------------------------------MEWN
H3DSN6_PRIPA/8-93----------------------------------------------------------------------------HERA
H3DNZ1_TETNG/7-99----------------------------------------------------------------------------QEWN
C3ZBV3_BRAFL/1-93----------------------------------------------------------------------------MEWN
J0XL69_LOALO/27-111----------------------------------------------------------------------------VQWN
H2LB95_ORYLA/8-100----------------------------------------------------------------------------QEWN
T1KF06_TETUR/33-126----------------------------------------------------------------------------IEWN
T1J1J7_STRMM/101-194----------------------------------------------------------------------------MEWN
F1Q6V8_DANRE/12-104----------------------------------------------------------------------------MEWN
H2ZZ11_LATCH/16-108----------------------------------------------------------------------------MDWN
W5MDX5_LEPOC/13-105----------------------------------------------------------------------------MDWN
W5K9R8_ASTMX/19-111----------------------------------------------------------------------------MEWI
E5S5E0_TRISP/811-899----------------------------------------------------------------------------AGWN
H2TYR7_TAKRU/8-100----------------------------------------------------------------------------MEWL
M3X5C4_FELCA/7-99----------------------------------------------------------------------------MEWN
H3D3Y5_TETNG/8-100----------------------------------------------------------------------------MEWN
H2MGT7_ORYLA/8-100----------------------------------------------------------------------------MEWN
G3PEZ9_GASAC/7-99----------------------------------------------------------------------------QEWN
F1QPK7_DANRE/5-97----------------------------------------------------------------------------MEWN
W4YYV2_STRPU/500-592----------------------------------------------------------------------------MEWN
E7EZS7_DANRE/12-104----------------------------------------------------------------------------MEWN
H2RU05_TAKRU/8-100----------------------------------------------------------------------------MEWN
U3ICA7_ANAPL/18-110----------------------------------------------------------------------------MEWN
U1P041_ASCSU/13-97----------------------------------------------------------------------------VQWN
M3ZZZ2_XIPMA/13-105----------------------------------------------------------------------------MEWN
W5KE54_ASTMX/67-159----------------------------------------------------------------------------LEWN
I3K6V1_ORENI/5-97----------------------------------------------------------------------------MEWN
B3RLD3_TRIAD/13-101----------------------------------------------------------------------------KKWS
E9HAM6_DAPPU/10-103----------------------------------------------------------------------------AEWN

PF02176

TRAF6_MOUSE/204-261--------------------------------------------------------------------------------
DG17_DICDI/197-255--------------------------------------------------------------------------------
TRAF5_HUMAN/183-241--------------------------------------------------------------------------------
TRAF2_MOUSE/178-235--------------------------------------------------------------------------------
TRAF5_MOUSE/128-183--------------------------------------------------------------------------------
TRAF2_HUMAN/178-235--------------------------------------------------------------------------------
TRAF3_HUMAN/136-192--------------------------------------------------------------------------------
TRAF4_HUMAN/102-156--------------------------------------------------------------------------------
TRAF4_HUMAN/210-269--------------------------------------------------------------------------------

PF03145

U3JRJ7_FICAL/62-258DIN.LPGAVDWVMMQSCFG..HHFMLVLKKQEKC...EGHQQFFATVLLIGTRKQAENFQYRLEL..HGS...CHRLTWE
M0SES1_MUSAM/113-312DPCSVDSCSWTLTLFNCFG..QYFCLHFEAFLL....GCEPVYMAFLRFMGEESEARRYNYCLEV..GGH...GRKLRWQ
F4JDF6_ARATH/5-209DPKHLHHATWMLTLLDCCG..RKFCLYFEAFHL....RKTPMYMAFMQFMGDEEEAMSFSYSLQV..GGN...GRKLTWQ
E1G988_LOALO/123-320DIN.LPGAVDWVMMQSCFG..YHFMLVLEKQEKFQ..DGNQMFYAVVQLIGAKKESENFMYRLEL..ATH...RRRFSWE
Q29HR3_DROPS/255-449NMAARRKPLTGYYVFQAHD..EMFNFYEIYDK.......QRILFTMTCTSNRRESKYNYAYEVTL..LQPDNEALSMTQK
W1PHN4_AMBTC/145-342NPHEVENAIWMLTVFNCFG..HYFCLHFEAFML....GTFPVYIAFLRFMGEDDEAKDFRYVLEV..GHN...GRKLIWQ
W5NWR0_SHEEP/85-282NIN.LAGTLDWVMVQSCFG..SQFLLILEKLEIH...AGYRKFFAAVQLIGTREQAEHFTYRLEL..NGT...RRRLMWE
I1NWW3_ORYGL/102-301NPYEVENATWMLTVFKCFG..QHFCLHFEAFLL....GMAPVYMAFLRFMGEDSEARNFCYSLEV..GGN...GRKLTWQ
H0Y018_OTOGA/86-284DINNVPGTLYWVMMQSCFD..LHFMVVLQRQENH...HGQERFCAMVRLLGTPQQVENFTYRLEM..KRG...RRQLTWE
M1C6R4_SOLTU/36-234NAQQVDNAIWMLTVFDCFG..RQFVLHFEAFSL....GMTPVYIAFLRFMGEDNEAKMFNYSLEV..GGF...GRKLTWQ
K1RDH5_CRAGI/70-266DIN.LPGAVDWVMMQSCFG..HNFMLVLEKQEKL...EGQQMFYAIVQLIGTRKQAENFAYRLEL..NGH...RRRLSWE
Q7QF99_ANOGA/180-384QRAPELQLVVAYHVVRAYG..EAFNLYQVYDQ.....DSRTVLWTVICATKESQVSGRYAFELEL..YSPVNTWQLLVQR
H0Y1K4_OTOGA/82-279NINGVHCPFEWVMIQSCFG..LHFMVVLQKQEND...DGEQRFCAMVRLLGTPQQAKNFTYQLEL..IGD...RQRLTWE
Q178N6_AEDAE/160-363QRCIALQSVIAYYVIRAYG..EYFNVYQIYDQ.....NSRRTIWTVICASKEAKTSHRFAFELEL..YSPIDSSKLLVQR
I1G062_AMPQE/69-267DIN.LPGAVDWVMMQCCFE..HHFMLVLEKQERH...EGHQQFFAVVQIIGTEKQAEQFRYKLELVDSRH...GRKLAWE
E4WS61_OIKDI/128-324DVN.LPGAVDWVMMQSCFN..NHFMLVLEKQEKF...DGHVQFFAVVQLIGTRKQAQQFAYRLEL..NGH...RRRLTWE
H0XJR4_OTOGA/82-278DIN.VSGAFDWAMMQSCFG..FHFMVVLQKQEND...NGEQQFCAIVQLIGTPQQAENFTYRLEL..NGH...KRRLTWE
H0XIX1_OTOGA/145-341DIN.LPGAVDWVMMQSCFG..FHFMVVLEKQENH...YGQEQFFAILQLIGTPKQAENFAYCLEL..NGH...RRRLTWE
SINAL_DROME/147-341NVN.LEGALDWTMVQSCHG..RHFLLSLEKINLG...EDCQQYFTACRMIGSMKDAAEFVYNISL..EAY...NRTLRWQ
F7I459_CALJA/77-273NVN.LVGAFDWVMMQFCYG..FHFMLVLQKQANN...NGDQHFFITVQLIGTCQEAEGFVYRLEL..KGD...RRRLTWE
G3X7V0_BOVIN/80-277NIN.LAGALDWVMIQSCFG..FNFILILEKLESY...DGHQKFFAVVQLIGTREQAEQFTYRLEL..NGN...RRRLIWE
Q7PZE6_ANOGA/33-226.VFKEQISLGGLKLVDAFS..KRFLFYFFSD......VAHKKLSFLMLYFGRREEAAQYCYELEI..SGRPVFSRTVKFV
H0Y0B7_OTOGA/82-279NINNVHGTYQWVMTQSCFD..LHFMVVLQKQENY...NGQEWFCAIVQLLGTSQQAANFTYQLEL..IGD...RRRLAWK
H0XK85_OTOGA/82-279NINNEHGTFYWVMMQSCFD..LHFMVVLQKQENH...HGEERFCAIVQLLGTPQQAQNFTYQLEV..KGD...RRRLTWR
B4LE73_DROVI/110-304NVN.QVGALDWTMIQSCHG..RHFLLSLEKVQLG...EGCQQYFAACRMIGTMRDAADFDYLISL..EAN...NRTLKWK
B4QNB8_DROSI/191-380DIN.LPGAVDWVMMQSCFG..HHFMLVLEKQEKY...DGHQQFFAIVQLIGSRKEAENFVYRLEL..NGN...RRRLTWE
H9JRH4_BOMMO/72-263WDAKRTEPILNYFLLRCFE..KVFNVYQIYDK.....RGGRMMWTVLV...NDDNAEKFYFEIDI..FLPNLPSKRIVYR
H0XTM6_OTOGA/82-280DVNNEHGPFYWVMTQSCFD..LHFMVVLQRQEND...DGHVRFCAIVQLLGTLEQAQNFTYQLEL..NDD...QRRLTWE
M1D5F6_SOLTU/101-299NPQEVENATWMLTVFNCFG..HQFCLHFEAFNL....GLAPVYMAFLRFMGDDDDAKRFSYSLEV..GGF...GRKLTWQ
E3M5Q1_CAERE/208-407DIN.LPGAVDWVMMQSCFD..FNFMLVLEKQEKYDPAQSTQMFYAVVQLIGSKKEADNFVYRLEL..SAN...RRRMSWE
W1NE48_AMBTC/91-290DPCAVDNVSWTLTLFHCFG..HYFCLHFEAFRL....GGEAVYMAFVRFMGEESEARKFSYCLEV..GGN...GRKLTWQ
D6W8F0_TRICA/124-320EIN.LAGAVDWVMMQSCFG..HHFMLVLEKQEKN...DGHTQFFAIVQLIGSRKQAEHFAYRLEL..NGN...RRRLIWE
T1KZZ1_TETUR/128-324DIN.LSGAVDWVMIQSCFN..HHFMLVLEKQERF...QAYQQFFAVVQLIGTPKQAEKFIYRLEL..NGQ...KRRLTWE
G4LYG6_SCHMA/167-362DIS.LPGAVDWVMMQSCFG..HSFMLVLEKQERV....PDQIFFALVQLIGTRKQADQFVYRLEL..NGH...RRRLTWE
H0XXJ8_OTOGA/83-277DINNIRDAFYWVMIQSCFG..LHFMVVLQKKGNN...DGQEQFCAIVQLLGTPQQAKNFTYQLEL..IGV...RRRLAWK
D6WQJ0_TRICA/35-224CLWKEDQPDYTVHLLLAFD..ELFYVHKR........LRDDVMHWAVQYIGRPEDVILYYFEIQI..FTDQFNDRKLEFS
E5S2J1_TRISP/95-295DIN.LPGSVDWVMMQSCFG..YHFMLVLEKQEKC...DGHQMFYAVVQLIGSRQHAENFLYRLEL..SSV...RRRLCWE
M4CBD9_BRARP/5-207NPKHLHHATWMLTLLDCYG..RQFCLYFEAFHL....KKTPMYIAYMQFMGDEEEATSFSYTLEI..SGN...GRKMTWQ
B3RLR7_TRIAD/93-285EVT......VWAMIQKCHD..QHFLVLVRKIEMS...HYIYQLYALVQVIAPKSIARNFAYVLTL..KDE...QRRLALE
E0W112_PEDHC/92-276NDTSSDEFGKLLVIEK.....ELFWMLSNYD......CEKKKLYKSFQYIGPKEAAKRFNYQICLKSSDD...RRQFLFK
B9GYJ4_POPTR/105-304DPREIDNATWMLTVFNCFG..RQFCLHFETFHL....GMSPVYMAFLRFMGTEDEAREFSYSLEV..GGN...GRKLTWQ
M0T9A8_MUSAM/95-294NPREVENATWMLTVFYCFG..QYFCLHFEAFQL....GIAPVYMAFLRFMGDENEARNFSYSLEV..GGN...GRKLTWE
D6WZ00_TRICA/55-252DIR.LDKDFRDVQIISFFNGAQYFWYKFVVD......VALQRVFWVFQFIGPKKQAKNYYYEFEI.SNGP...IRKFKVT
G1MN92_AILME/82-278DIN.LPGAVDWVMTQSCFG..VHFMLVLEKHEKY...NGHQQFFAIVQLIGSHKQAENFVYRLEL..NGH...RRRLTWE
I1H5D3_BRADI/95-294NPHEVENATWMLTVFSCFG..EYFCLHFEAFQL....GMAPVYIAFLRFMGDDTEAKNYSYSLEV..GGG...GRKMIWQ
G3S7D8_GORGO/77-272SIN.LVGAYDWVMIQSCFG..VRFMLVLQKQEDR...NGGQQFFAVVQLLGTSKEAENFAYQLEL..KGN...RRRLTWE

PF00917

A8MQL1_ARATH/74-197SDT..LHRFWKK..EHDWG------------------------------------------------WKK.....FMELP
Q93Z83_ARATH/66-193TDGLVKRYNNAK...KEWG------------------------------------------------FGQ.....LIPRS
Q940M1_ARATH/102-220WLQ..QWIMAAT...KARG------------------------------------------------IPQ.....SLSLA
DG17_DICDI/327-450KED..KKVFISS...EGWG------------------------------------------------WGK.....FLLSD
O76557_CAEEL/290-402RKI...YSFEKS...IGNG------------------------------------------------YSK.....VMRWD
O16553_CAEEL/149-261TDS...GSFSKP...FCEG------------------------------------------------FEK.....FMRWN
O16554_CAEEL/23-135NGT...PTFKEP...TGFG------------------------------------------------FSK.....FIRWD
O16557_CAEEL/96-208KVK...YTFNEP...NAYG------------------------------------------------IGK.....FIRWD
O16558_CAEEL/149-261KGT...STFEKP...ISYG------------------------------------------------YCK.....FIRWD
O16559_CAEEL/157-269KLT...STYKEH...YGYG------------------------------------------------WDK.....FLRWD
O16560_CAEEL/140-252NMT...SVFNEP...DGYG------------------------------------------------LFK.....FIRWD
O16562_CAEEL/108-218YGE...KVFEKP...VGSG------------------------------------------------WGK.....LMRWE
O17191_CAEEL/289-401SFS...YLFDKP...FGYG------------------------------------------------WLK.....LLRWD
O17190_CAEEL/289-402NIK...YVFDKP...FGYG------------------------------------------------WLT.....LLRWD
O17288_CAEEL/229-340GGT...YVFDNP...NIYG------------------------------------------------WH......IIRWS
O76558_CAEEL/284-397KTT...RVFNKA...TGYG------------------------------------------------WLK.....LIRWD
O76641_CAEEL/14-126NSK...DTFEKF...TGHG------------------------------------------------WSK.....CISWK
O76642_CAEEL/14-126NSK...YTFEKP...KSYG------------------------------------------------WIN.....FLSWK
O16551_CAEEL/14-125NNK...YTFENQ...LGRG------------------------------------------------WE......FVSWK
U4PC47_CAEEL/14-126NQV...HTFVEL...KGRG------------------------------------------------WHK.....FISWE
O16555_CAEEL/11-123DCR...RTFEKP...SGLG------------------------------------------------SGD.....FLSWE
O17303_CAEEL/12-125TVQ...HEFQKP...EGHG------------------------------------------------MDK.....LISWE
O17192_CAEEL/12-124AVQ...HEFQQP...KGHG------------------------------------------------MDK.....FISWE
P91300_CAEEL/283-399QMS...AVFCRD...VDME------------------------------------------------SLKKSLKKVIRWD
O16736_CAEEL/14-129ECK...IAKSPS...LISE------------------------------------------------VLRS...TIMPWG
O17193_CAEEL/11-126TGV..R.KYGGETQYIGIG------------------------------------------------FPK.....FMLWE
O76610_CAEEL/166-276GYF...RNIDEE..LKCEE------------------------------------------------LGR.....EIEWE
O44817_CAEEL/14-126G.....NKICTE...KRR.------------------------------------------------FVRR...QFISRN
O16567_CAEEL/26-139TD....HQFTK.....NEG------------------------------------------------YGFP...KLMNWD
O44815_CAEEL/14-128T....AVKFTNS...ENIG------------------------------------------------YGWK...KFISWE
O76568_CAEEL/14-130DNF..NFQFSNA...HSYG------------------------------------------------NGTT...EFISWN
O17297_CAEEL/14-127EIF..KHKFEKN...E..G------------------------------------------------WGYF...KFISWD
BAT15_CAEEL/14-125FQK...GCFDG....FGLG------------------------------------------------WND.....FVSWD
O44805_CAEEL/17-135CKI..DMCFGHD...SGKF------------------------------------------------YSSYGWSEFISWN
O76611_CAEEL/30-142HNS.TDHVFSQE...HNYG------------------------------------------------LTA.....ITFFE
BAT38_CAEEL/86-206QFT...NKFNYN..SNNWG------------------------------------------------FPS.....FMAWE
O45623_CAEEL/38-168KIH...HSFHN....TEVD------------------------------------------------WG......FSNYD

PF15965

B7QIX1_IXOSC/11-103RWI.-------------------------------------------
V8N804_OPHHA/12-104RWPC-------------------------------------------
F6Z597_XENTR/13-105RWPV-------------------------------------------
A7S9N8_NEMVE/9-97RYPV-------------------------------------------
I3NGQ0_SPETR/12-104RWPN-------------------------------------------
H3DSN6_PRIPA/8-93RAP.-------------------------------------------
H3DNZ1_TETNG/7-99RWPV-------------------------------------------
C3ZBV3_BRAFL/1-93RWPV-------------------------------------------
J0XL69_LOALO/27-111RR..-------------------------------------------
H2LB95_ORYLA/8-100RWPV-------------------------------------------
T1KF06_TETUR/33-126RWPI-------------------------------------------
T1J1J7_STRMM/101-194RWPV-------------------------------------------
F1Q6V8_DANRE/12-104RWPV-------------------------------------------
H2ZZ11_LATCH/16-108RWPI-------------------------------------------
W5MDX5_LEPOC/13-105RWPV-------------------------------------------
W5K9R8_ASTMX/19-111RWPI-------------------------------------------
E5S5E0_TRISP/811-899RWPV-------------------------------------------
H2TYR7_TAKRU/8-100RWLN-------------------------------------------
M3X5C4_FELCA/7-99RWPV-------------------------------------------
H3D3Y5_TETNG/8-100RWPV-------------------------------------------
H2MGT7_ORYLA/8-100RWPV-------------------------------------------
G3PEZ9_GASAC/7-99RWPV-------------------------------------------
F1QPK7_DANRE/5-97RWPV-------------------------------------------
W4YYV2_STRPU/500-592RWPV-------------------------------------------
E7EZS7_DANRE/12-104RWPV-------------------------------------------
H2RU05_TAKRU/8-100RWPV-------------------------------------------
U3ICA7_ANAPL/18-110RWPN-------------------------------------------
U1P041_ASCSU/13-97RR..-------------------------------------------
M3ZZZ2_XIPMA/13-105RWPS-------------------------------------------
W5KE54_ASTMX/67-159RWPV-------------------------------------------
I3K6V1_ORENI/5-97RWPV-------------------------------------------
B3RLD3_TRIAD/13-101RCP.-------------------------------------------
E9HAM6_DAPPU/10-103RWPL-------------------------------------------

PF02176

TRAF6_MOUSE/204-261-----------------------------------------------
DG17_DICDI/197-255-----------------------------------------------
TRAF5_HUMAN/183-241-----------------------------------------------
TRAF2_MOUSE/178-235-----------------------------------------------
TRAF5_MOUSE/128-183-----------------------------------------------
TRAF2_HUMAN/178-235-----------------------------------------------
TRAF3_HUMAN/136-192-----------------------------------------------
TRAF4_HUMAN/102-156-----------------------------------------------
TRAF4_HUMAN/210-269-----------------------------------------------

PF03145

U3JRJ7_FICAL/62-258ASPC.SIHEGVPVAIRSSNCLVFDTATAHLFADN.....GNLGINVT
M0SES1_MUSAM/113-312GVPR.SIRTHHRMVRDSHDGLIVHRSLALYFSGGDQ...KELKLRVS
F4JDF6_ARATH/5-209GVPR.SIRDSHKTVRDSQDGLIITRKLALFFSTDNNTTDKELKLKVS
E1G988_LOALO/123-320ASPR.SIHEGVAHAISLSDCMAFDSQTAQLFAEN.....GNLGINVT
Q29HR3_DROPS/255-449FPVH...SEYDRDILMDGTCVSIPLNELSRFVDPE....KVLHYRVS
W1PHN4_AMBTC/145-342GVPR.SIRDSHRKVRDSHDGLIIQRNMALLFS.GDR...KELKLRL.
W5NWR0_SHEEP/85-282ATPL.SIHERIETAFLNCDCLVFHPRVAELFAEN.....GDLSINVT
I1NWW3_ORYGL/102-301GIPR.SIRDSHKKVRDSFDGLIIHRNMALFFSGGNR...QELKLRVT
H0Y018_OTOGA/86-284APPR.SIRESIETATMSSDCLVFDTNTAQLFAEN.....GDLSIAVT
M1C6R4_SOLTU/36-234GVPR.SIRDSHRKIRDCQDGLIIPRTLAFFFSGGNG...EELTLKV.
K1RDH5_CRAGI/70-266ATPR.SIHDGVQSAIVASDCLVFDTNIAQLFADH.....GNLGINVT
Q7QF99_ANOGA/180-384FPCH...SELDPDFLKDGHCAKLALADALRFMADD....KVLHYRVR
H0Y1K4_OTOGA/82-279APPR.SIRERIETAMMSSDCLIFDNKTAQLFADN.....GELTITVT
Q178N6_AEDAE/160-363FPCH...SENDADFLKDGNCAKIPLEEAIRFMTKD....KILYYRIR
I1G062_AMPQE/69-267AKPR.SIHDGISQVISGNDCLIFEPSMAQHFGEN.....GNLAINVT
E4WS61_OIKDI/128-324ATPR.SIHEGVSSAIQNSDCLVFDTAVAQMFSEN.....GNLGINVT
H0XJR4_OTOGA/82-278ATPP.SIREGIVTTIMKSNCLVFDTSLAQLCAGN.....GNLGIIVT
H0XIX1_OTOGA/145-341ATPL.SIQEGIATAIMKSDCLVFDTSIAQLFAEN.....GNLGINVT
SINAL_DROME/147-341SKPR.SIRENFSS.FTNADFLVLNKHTVELFSED.....GNLALNV.
F7I459_CALJA/77-273ATPL.SIHEDIATAIKNRDCLNFNARTAQFFEEN.....DNLSITVT
G3X7V0_BOVIN/80-277ATPL.SIREGIATAFMTSDCLVLDPGVAERFAED.....GNLSIDVT
Q7PZE6_ANOGA/33-226ERCN.SDSENLAELLDEERCVSLSHRQVKNYLHE.....GKLHMRYR
H0Y0B7_OTOGA/82-279ATPR.SLREGIETAMMNGDCLVFDNNTAQLFVEN.....DELRITVT
H0XK85_OTOGA/82-279ATPR.SIREGIETAMMSNDCLVFDTNTAQLFAEN.....NELSITVT
B4LE73_DROVI/110-304SKPR.SIRESFVT.YTNADFLVLNKSTVELFSED.....GNLALNI.
B4QNB8_DROSI/191-380AMPR.SIHEGVASAIHNSDCLVFDTSIAQLFADN.....GNLGINVT
H9JRH4_BOMMO/72-263RPCK...CEKDADFLEHTQNVYIPVENVFSMLDDS....EALNFI..
H0XTM6_OTOGA/82-280STPL.SLREDVETAIMNGDCLVFDNITAQLFAEN.....DELRITVT
M1D5F6_SOLTU/101-299GVPR.SIRDSHKTVRDSLDGLIIQRSMALFFSGGDR...KELKLKV.
E3M5Q1_CAERE/208-407ATPR.SIHEGVAFAIQQSDCLAFDTSAAQLFAEN.....GNLGINVT
W1NE48_AMBTC/91-290GVPR.SIRDGHRKVRDSHDGLILQRSLALYFSGGDR...KELKLRIT
D6W8F0_TRICA/124-320AMPR.SSHEGVASAIMASDCLAFDNSIAQHFADN.....GNLGINVT
T1KZZ1_TETUR/128-324ATPH.SIDEGVQSAINLSDCLVFDTSIANLFADG.....ANLGINVT
G4LYG6_SCHMA/167-362ACPR.SIHDGVQSAIAVSDCLVFDSNTAHSFAEN.....GNLGINVT
H0XXJ8_OTOGA/83-277ATVQ.SIREGIETAMMNSDCLVFDTNTAQLFAEN.....DDLTF...
D6WQJ0_TRICA/35-224EICHDDIMENIDDIIDTGFCVSVRMPILQTYINNE....GVVFYKI.
E5S2J1_TRISP/95-295ATPR.SIHEGVANAISQSDCLAFDTNTAQLFADS.....GNLGINVT
M4CBD9_BRARP/5-207GVPR.SIRDSHKTVRDSQDGLIITRKLALYFSADNSNS.KELKLKIS
B3RLR7_TRIAD/93-285SSPI.SINDCIDDAIAVRDCLSVDFVTAKSFSQD.....GNIRLLV.
E0W112_PEDHC/92-276STMD.DDNRNGSDAFESPNCTVIDFSVLKSFST..............
B9GYJ4_POPTR/105-304GVPR.SIRDSHQKVRDSQDGLIIQRNLALFFSGGER...QELKLKVS
M0T9A8_MUSAM/95-294GTPR.SIRDGHRKVRDSHDGLVIQRNMALFFSGGDR...KELKLRVT
D6WZ00_TRICA/55-252EVCD.NDVVKAEDLFRDEKCVSLSFNSVKSYLNDN....GKLPIK..
G1MN92_AILME/82-278ATPR.SIHQGIATAVMNSDCLVFDTSVAQHFAEN.....GNLGINVT
I1H5D3_BRADI/95-294GVPR.SIRDSHRKVRDSYDGLIIQRNMALFFSGGER...KELKLRVT
G3S7D8_GORGO/77-272ATPL.PIHEDIAKAIKNRDCLIFDANTALLFAEN.....DDLSINV.

PF00917

A8MQL1_ARATH/74-197KLKDGF....IDESGCLTIEAK.------------------------
Q93Z83_ARATH/66-193TFYNANEGYLDQDTGSFGAEIFI------------------------
Q940M1_ARATH/102-220DLQEAY...LDEDTLNVEIECEV------------------------
DG17_DICDI/327-450LINKENGWLSNDDKLIIEIYIKI------------------------
O76557_CAEEL/290-402EMKDKY...VVDNSIIIEAHVKI------------------------
O16553_CAEEL/149-261IMEENY...IVKDSIIIEARGKI------------------------
O16554_CAEEL/23-135DMEEKY...VVNDSIIIEARVKI------------------------
O16557_CAEEL/96-208DMENKY...MVNDSIIIAALVKI------------------------
O16558_CAEEL/149-261DMENKY...MVNDSVIIGALVKI------------------------
O16559_CAEEL/157-269DMLEKY...TVNDSIIIAALVKI------------------------
O16560_CAEEL/140-252DMEEKY...LVNDSIGVEARVKI------------------------
O16562_CAEEL/108-218NWSSR.....CNDNFVFEANVRI------------------------
O17191_CAEEL/289-401NLEEKY...IVNDTLVIEAHVKI------------------------
O17190_CAEEL/289-402SLEEKY...IVNDTLIIEAHVKI------------------------
O17288_CAEEL/229-340SLEDRY...IVNDTLTVEAQVTI------------------------
O76558_CAEEL/284-397SLEEKY...IVDDTLTIEAHVKI------------------------
O76641_CAEEL/14-126DLESDY...LVDDSIVVEAHVKI------------------------
O76642_CAEEL/14-126ELESDY...VVDDSIVVEAHVKI------------------------
O16551_CAEEL/14-125ELESEY...VVDDSIVVEAHVKI------------------------
U4PC47_CAEEL/14-126ELESDY...VIDDSTIIEAHVKI------------------------
O16555_CAEEL/11-123KFEREY...VVDDSIVIEAHVKI------------------------
O17303_CAEEL/12-125NMLRDY...VDEDSIIIEIHADI------------------------
O17192_CAEEL/12-124NMLRDY...VNNDSIIIEIHAD.------------------------
P91300_CAEEL/283-399DMMTDY...VINDSFIIEAHIEI------------------------
O16736_CAEEL/14-129RMMTNY...VVDDALMIEVFVTI------------------------
O17193_CAEEL/11-126KMMKEF...VVEDTVTVEVCLKI------------------------
O76610_CAEEL/166-276EIADKY...PVDGYLTIEARVNV------------------------
O44817_CAEEL/14-126TLKSGY...LVDDIITVEATVKI------------------------
O16567_CAEEL/26-139TLIKDY...LIDDSITIEVTVKI------------------------
O44815_CAEEL/14-128MLAKDY...IIDDIIIAEATVKV------------------------
O76568_CAEEL/14-130KLIKDY...LIDDVITVEAAVKI------------------------
O17297_CAEEL/14-127TLTNDY...LIDDCIIVEITVKI------------------------
BAT15_CAEEL/14-125SLTEDF...LYDNSFTIEACVKI------------------------
O44805_CAEEL/17-135ELETSF...MEAGSITVEARVLI------------------------
O76611_CAEEL/30-142DIKNKI...FDDDMVYVDVEVTI------------------------
BAT38_CAEEL/86-206DVNNSN..YVRNEMVTVTARVVV------------------------
O45623_CAEEL/38-168QYDTLC...NPKDGYVVNDTIKL------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window