Sequence alignment for CL0392

PF03656

TIM16_HUMAN/1-125MAKYLA.QIIVMGVQVVGRAFARALRQEF.....AASRAAADARGRAGH.RSAAASNLS.GLSLQEAQQILNVSK....L
TIM16_YEAST/1-128MAHRAFIQVIITGTQVFGKAFAEAYRQAA......SQSVKQGA.TNASR.RGTGKGEYG.GITLDESCKILNIEESKGDL
TIM16_CAEEL/1-135MPWRTALKVALAAGEAVAKALTRAVRDEIKQTQQAAARHAASTGQSASETRENANSNAKLGISLEESLQILNVKT...PL

PF00226

DNJ50_ARATH/34-95-----------------------------------------------------------------DCYALLGVAQD....
Q22138_CAEEL/24-87-----------------------------------------------------------------DHYKVLGLAQS....
DNJA3_HUMAN/93-155-----------------------------------------------------------------DYYQILGVPRN....
TID_DROVI/80-142-----------------------------------------------------------------DYYATLGVAKN....
MDJ1_YEAST/61-122-----------------------------------------------------------------DPYDTLGLKKS....
MDJ1_SCHPO/86-147-----------------------------------------------------------------DPYKTLGVSKS....
P91189_CAEEL/379-444-----------------------------------------------------------------DYYKILGVKRN....
DNJC3_HUMAN/394-459-----------------------------------------------------------------DYYKILGVKRN....
O77048_PLAFA/35-94-----------------------------------------------------------------DYYKRLGVKRN....
Q9VPQ2_DROME/25-87-----------------------------------------------------------------DFYKILNVKKN....
G1R466_NOMLE/25-87-----------------------------------------------------------------DFYKILGVPRS....
Q49541_MYCHY/5-72-----------------------------------------------------------------DFYKILGVEKS....
DNJ29_ARATH/99-161-----------------------------------------------------------------EPFGILGLEPG....
DNJ21_ARATH/99-161-----------------------------------------------------------------DPFSILGLEPG....
Q9U1V9_CAEEL/107-165-----------------------------------------------------------------DPYQILGLDQG....
F7FPB6_MACMU/104-162-----------------------------------------------------------------NPYEVLNLDPG....
Q9VS57_DROME/105-164-----------------------------------------------------------------DPFEILNVPPT....
O17002_CAEEL/8-71-----------------------------------------------------------------NPYKILHLEKG....
DNJ63_ARATH/27-88-----------------------------------------------------------------DPYKVLGVSKD....
JJJ2_YEAST/13-74-----------------------------------------------------------------TYYSILGLTSN....
DNJ2_CAEEL/36-102-----------------------------------------------------------------NCYDVLEVNRE....
DJC25_DROME/31-96-----------------------------------------------------------------NCYDVLGVTRE....
DNJC1_MOUSE/61-122-----------------------------------------------------------------NFYEFLGVQQD....
Q9VWL4_DROME/40-101-----------------------------------------------------------------NFYEFMGINQT....
Q8SZX1_DROME/100-161-----------------------------------------------------------------YYYKVLGVNRH....
JEM1_YEAST/538-605-----------------------------------------------------------------DYYKILGVSPS....
P72803_SYNY3/24-87-----------------------------------------------------------------SYYGVLELHPA....
Q3MEP6_ANAVT/8-71-----------------------------------------------------------------TYYSLLGLHPS....
DNAJ1_ARATH/48-110-----------------------------------------------------------------NYYDVLGVSPK....
DNJ13_ARATH/15-80-----------------------------------------------------------------ELYALLNLSPE....
Q40868_PICGL/4-70-----------------------------------------------------------------TFYSILGVNKD....
Q9SSJ9_ARATH/8-74-----------------------------------------------------------------TYYEILGVAVD....
DNAJ6_ARATH/29-91-----------------------------------------------------------------SLYEVLGVERR....
Q22751_CAEEL/14-80-----------------------------------------------------------------CLYELLGVKKD....
Y6693_DROME/15-79-----------------------------------------------------------------DVYKLMELARG....
YCJ3_SCHPO/8-72-----------------------------------------------------------------ELYLALGLPKD....
Q06166_PLAFA/1564-1627-----------------------------------------------------------------EFHNILSIHED....
O96122_PLAF7/500-562-----------------------------------------------------------------TYYDILNVYPT....
O96277_PLAF7/195-257-----------------------------------------------------------------TYYDILNINAN....
RESA_PLAFF/523-584-----------------------------------------------------------------LYYDILGVGVN....
Q9VHW5_DROME/27-89-----------------------------------------------------------------SHYDALGIRRQ....
DNJ60_DROME/26-90-----------------------------------------------------------------THYEVLNIRND....
Q9VFY1_DROME/37-98-----------------------------------------------------------------NHYQVLNVPVG....
DNJC4_MOUSE/37-99-----------------------------------------------------------------NYYELLGVHPG....
P91014_CAEEL/28-89-----------------------------------------------------------------THYEVLGVEST....
NDHT_ARATH/106-169-----------------------------------------------------------------SHYQFLGVSTD....
Q9VX95_DROME/329-395-----------------------------------------------------------------NSYKVLGVSAT....
E7KSY1_YEASL/23-85-----------------------------------------------------------------DYYAILEIDKD....
DJC13_HUMAN/1301-1362-----------------------------------------------------------------DAYEVLNLPQG....
O18427_GEOCY/5-64-----------------------------------------------------------------DLYEVLELPKG....
MU185_SCHPO/9-71-----------------------------------------------------------------DCYEILQVNHD....
ERJ5_YEAST/44-105-----------------------------------------------------------------NFYKFLKLPKLQ..N
DJC12_MOUSE/14-76-----------------------------------------------------------------DYYALLGCDEL....
JDP_BOMMO/17-79-----------------------------------------------------------------DYYALLGCDEN....
JDP_DROME/17-79-----------------------------------------------------------------DFYGLLHCDEN....
RSP1_SCHPO/12-75-----------------------------------------------------------------DYYTILGAEST....
MU184_SCHPO/12-75-----------------------------------------------------------------DYYAILKLQKN....
O97211_LEIMA/9-69-----------------------------------------------------------------ELYQVLELDAQ....
Q9S729_VOLCA/114-186-----------------------------------------------------------------DPYSLLGLANE....
YCJD_SCHPO/4-68-----------------------------------------------------------------DYYAILNITPK....
Q9U2L4_CAEEL/27-88-----------------------------------------------------------------DFYKILNVDKK....
Q17438_CAEEL/137-198-----------------------------------------------------------------DYYEILKIDKK....
ZUO1_YEAST/97-165-----------------------------------------------------------------DLYAAMGLSKLR.FR
ZUO1_SCHPO/97-164-----------------------------------------------------------------DHYAVLGLSKYR.YK
Q94216_CAEEL/98-167-----------------------------------------------------------------DHYKVLGLSKLR.WQ
Q9VP77_DROME/76-145-----------------------------------------------------------------DHYAVLGLGKLR.YE
Q9ST16_BRACM/135-199-----------------------------------------------------------------NHYEALGFPRH....
Q9SWW3_9EUGL/11-70-----------------------------------------------------------------CHYTTLGIAKS....
O83136_TREPA/8-70-----------------------------------------------------------------DHYAILGVAAD....
YL39_SCHPO/31-96-----------------------------------------------------------------DPYSVLGVEKD....
Q9XWE1_CAEEL/20-82-----------------------------------------------------------------DYYELLGVERD....
Q22028_CAEEL/17-79-----------------------------------------------------------------DFYQLLGVEKM....
Q9VNW1_DROME/7-66-----------------------------------------------------------------DHYQVLGLPRN....
DNJ72_ARATH/3-70-----------------------------------------------------------------DHYQVLGVTRN....
DNAJ_DEIRA/2-63-----------------------------------------------------------------DYYELLGVSRT....
DNAJ_METMA/6-67-----------------------------------------------------------------DYYEILGLSKD....
O49475_ARATH/66-127-----------------------------------------------------------------DWYRVLGVDPL....
O49476_ARATH/55-115-----------------------------------------------------------------DWYGILGIDPL....
O49477_ARATH/56-117-----------------------------------------------------------------DWYGILGVDPL....
Q9ZU99_ARATH/71-136-----------------------------------------------------------------NWYKILQIEDLTESS
O04648_ARATH/66-127-----------------------------------------------------------------NWYGILQVMHF....
Q9SQT7_ARATH/67-128-----------------------------------------------------------------DWYGILQVEQI....
Q9SLA7_ARATH/66-127-----------------------------------------------------------------DHYGVLGLNPE....
Q9VN28_DROME/708-769-----------------------------------------------------------------DAYSILGVPPD....
P91243_CAEEL/26-91-----------------------------------------------------------------DFYAILNVPKD....
YNF5_SCHPO/113-174-----------------------------------------------------------------QYYEILDLKKT....
Q9VFP0_DROME/106-167-----------------------------------------------------------------DYYEVLGVSKT....
DJB12_MOUSE/111-172-----------------------------------------------------------------DYYEILGVSRS....
O80481_ARATH/70-132-----------------------------------------------------------------THYDILRISNP....
Q55559_SYNY3/6-67-----------------------------------------------------------------DFYRILGIPPQ....
Q9VNE8_DROME/3-72-----------------------------------------------------------------DFYELLNVPST....
E7KQL7_YEASL/8-73-----------------------------------------------------------------THYEILRIPSD....
DPH4_SCHPO/2-66-----------------------------------------------------------------NHYSVLNLKDG...K
O82623_ARATH/11-76-----------------------------------------------------------------TYYEILSVKED....
O96276_PLAF7/660-722-----------------------------------------------------------------TYYDLLNVEPD....
YHXB_SCHPO/9-72-----------------------------------------------------------------DYYDILNISVD....
SPF31_SCHPO/31-93-----------------------------------------------------------------NAYDVLDILPG....
O80799_ARATH/315-376-----------------------------------------------------------------SPYDVLGVNHN....
CWC23_YEAST/15-84-----------------------------------------------------------------NLYDVLELPTP....
Q9VGR0_DROME/10-72-----------------------------------------------------------------NLYDLLGISLE....
DJP1_YEAST/6-68-----------------------------------------------------------------EYYDLLGVSTT....
YAY1_SCHPO/8-71-----------------------------------------------------------------EYYDLLGISTD....
E7QDV5_YEASZ/6-68-----------------------------------------------------------------EYYDILGIKPE....
O49288_ARATH/6-67-----------------------------------------------------------------VYYDVLGVTPS....
DNJ10_ARATH/6-68-----------------------------------------------------------------EYYDVLGVSPT....
Q9SJS8_ARATH/6-68-----------------------------------------------------------------EYYEILGVKTD....
Q9XEM8_ORYSI/285-347-----------------------------------------------------------------AYYDTLGVSVD....
DNJC5_MOUSE/15-77-----------------------------------------------------------------SLYHVLGLDKN....
DNJC5_DROME/17-79-----------------------------------------------------------------SLYEILGLPKT....
Q21162_CAEEL/38-101-----------------------------------------------------------------HLYNVLGIQKN....
Q4D4S6_TRYCC/13-72-----------------------------------------------------------------ALYDVLGVPRT....
DNJ39_ARATH/23-85-----------------------------------------------------------------NPYEVLGIPSN....
DNJ16_ARATH/20-82-----------------------------------------------------------------DPYEVLGVLRN....
DNJ15_ARATH/17-79-----------------------------------------------------------------DPYEVLCVSKD....
APJ1_YEAST/6-68-----------------------------------------------------------------SLYDSLNVTAA....
PSI1_SCHPO/6-65-----------------------------------------------------------------KLYDCLEVRPE....
Q9U4X8_STRER/24-83-----------------------------------------------------------------KLYDILGVKPX....
O16303_CAEEL/13-72-----------------------------------------------------------------TLYTTLNVRPD....
Q9VK35_DROME/5-64-----------------------------------------------------------------NLYDVLKVAPD....
A0A0D9QZR7_CHLSB/8-67-----------------------------------------------------------------KLYDILGVPPG....
O45502_CAEEL/6-65-----------------------------------------------------------------GYYDVLGVKPD....
E2RM09_CANFA/6-65-----------------------------------------------------------------TYYDVLGVKPN....
E7KGU0_YEASA/21-82-----------------------------------------------------------------EFYEILKVDRK....
MAS5_SCHPO/6-65-----------------------------------------------------------------KLYEVLNVDVT....
MAS5_YEAST/6-67-----------------------------------------------------------------KFYDILGVPVT....
Q9U062_GIAIN/6-65-----------------------------------------------------------------EFYDLLGVSPS....
SIS1_YEAST/6-65-----------------------------------------------------------------KLYDLLGVSPS....
O24074_MEDSA/14-72-----------------------------------------------------------------KYYDILGVSKS....
DNJH2_ALLPO/13-71-----------------------------------------------------------------KYYEVLGVSKN....
O43978_BABBO/14-72-----------------------------------------------------------------KFYKVLGLSRD....
O96455_DICDI/5-66-----------------------------------------------------------------KFYDILGVARD....
XDJ1_SCHPO/6-70-----------------------------------------------------------------KLYDILEVHFE....
XDJ1_YEAST/9-74-----------------------------------------------------------------RLYDVLGVTRD....
DNJ20_ARATH/66-130-----------------------------------------------------------------SFYDLLGVTES....
Q9SH08_ARATH/76-144-----------------------------------------------------------------SPYDTLELDRN....
O48828_ARATH/68-132-----------------------------------------------------------------SLYEILEIPVG....
P93499_PHAVU/67-131-----------------------------------------------------------------SLYDILGIPAG....
DNAJL_MYCGE/2-61-----------------------------------------------------------------NLYDLLELPTT....
DNAJL_MYCPN/2-61-----------------------------------------------------------------TLYDLLELPQT....
Q9SZU8_ARATH/56-120-----------------------------------------------------------------NAYDILNVSET....
Q26954_TRYCR/6-68-----------------------------------------------------------------SLYDELGILPS....
Q26952_TRYCR/6-67-----------------------------------------------------------------KFYDSLGVSPD....
Q26953_TRYCR/6-68-----------------------------------------------------------------EYYEILGLEAE....
O13303_CRYCU/6-70-----------------------------------------------------------------EYYKTLGLSKD....
O96123_PLAF7/88-153-----------------------------------------------------------------DYYSILGVSRD....
O96212_PLAF7/4-69-----------------------------------------------------------------DYYSILGVSRD....
O49457_ARATH/4-67-----------------------------------------------------------------DYYKVLQVDRS....
Q9SU57_ARATH/4-68-----------------------------------------------------------------DYYNILKVNHN....
Q9VNW0_DROME/4-65-----------------------------------------------------------------DYYKILGIERN....
H2QJG7_PANTR/3-66-----------------------------------------------------------------SYYEILDVPRS....
DNJB3_MOUSE/3-66-----------------------------------------------------------------DYYEVLGVPRQ....
DNJB6_HUMAN/3-66-----------------------------------------------------------------DYYEVLGVQRH....
O62360_CAEEL/28-91-----------------------------------------------------------------CHYEVLEVERD....
Q9W0X8_DROME/3-66-----------------------------------------------------------------CYYEELELQRN....
JJJ1_YEAST/4-67-----------------------------------------------------------------CYYELLGVETH....
Q9W2U5_DROME/4-65-----------------------------------------------------------------DYYKILGIQRT....
DNAJ1_DROME/4-65-----------------------------------------------------------------DFYKILGLERK....
Q9VPY9_DROME/4-65-----------------------------------------------------------------DYYKILGLPKT....
H2NXT6_PONAB/4-65-----------------------------------------------------------------DYYQTLGLARG....
G1RFD8_NOMLE/4-65-----------------------------------------------------------------DYYCILGIEKG....
F7HQB6_MACMU/4-65-----------------------------------------------------------------DYYKILGIPSG....
Q20774_CAEEL/4-65-----------------------------------------------------------------DYYKVLGISKG....
Q9QZW8_RAT/3-66-----------------------------------------------------------------NYYKVLGVPQD....
Q38AB7_TRYB2/4-67-----------------------------------------------------------------DYYKVLGVSRD....
DNJB9_MOUSE/26-87-----------------------------------------------------------------SYYDILGVPKS....
DNAJ_RHOCA/5-67-----------------------------------------------------------------DFYEVLGVSKG....
DNAJ_RICPR/4-65-----------------------------------------------------------------DYYQVLGVSKT....
DNAJ_MYCGE/7-74-----------------------------------------------------------------DYYEVLGISKN....
C9R3C7_AGGAD/5-67-----------------------------------------------------------------DYYELLGISRS....
DNAJ_BUCAI/5-67-----------------------------------------------------------------DYYQILGIPKS....
DNAJ_ECOLI/5-67-----------------------------------------------------------------DYYEILGVSKT....
DNAJ_HAEDU/5-67-----------------------------------------------------------------DYYEVLGLQKG....
DNAJ_NITEU/5-67-----------------------------------------------------------------DYYEVLGVGRD....
DNAJ_VIBCH/5-67-----------------------------------------------------------------DFYEVLGVGRD....
DNAJ_VIBHA/5-67-----------------------------------------------------------------DFYEVLGVSRD....
DNAJ_COXBU/5-67-----------------------------------------------------------------DYYEVLGVNLN....
DNAJ_LEGPH/5-67-----------------------------------------------------------------DYYELLEVSRN....
DNAJ_METSS/5-67-----------------------------------------------------------------DYYEVLGVNRD....
DNAJ_CAUCR/3-65-----------------------------------------------------------------DYYEILGVTRT....
DNAJ_BRADU/8-70-----------------------------------------------------------------CYYETLEVERD....
DNAJ_RHILE/5-67-----------------------------------------------------------------DFYETLGVAKS....
N8LUN8_BRUOV/4-66-----------------------------------------------------------------DYYEALGVTRT....
DNAJ_DEIPM/5-67-----------------------------------------------------------------DYYEVLGVSRS....
DNAJ_BORBU/4-66-----------------------------------------------------------------DYYEILGLSKG....
O51599_BORBU/4-66-----------------------------------------------------------------DYYNILGIQKN....
DNAJ_CLOAB/5-67-----------------------------------------------------------------DYYEVLGLEKG....
DNAJ_LEPIN/5-67-----------------------------------------------------------------SYYDILGVSKS....
DNAJ_FRATU/5-67-----------------------------------------------------------------CYYEILNISKT....
DNAJ_HELPY/4-66-----------------------------------------------------------------SYYEILEVEKH....
DNAJ_CAMJE/4-66-----------------------------------------------------------------SYYEILEITQN....
DNAJ_CHLTR/2-64-----------------------------------------------------------------DYYTILGVAKT....
DNAJH_SYNY3/8-70-----------------------------------------------------------------DYYQILGVTKT....
DNAJ_PORGI/6-68-----------------------------------------------------------------DYYEVLGVSKN....
O61582_DROHE/8-75-----------------------------------------------------------------DYYKILGVSRR....
DNJC7_MOUSE/381-448-----------------------------------------------------------------DYYKILGVDKN....
O15811_PLAFA/61-122-----------------------------------------------------------------DPYTVLGLSRN....
O97016_LEIMA/86-147-----------------------------------------------------------------DLYSVLGVARN....
Q9SJI1_ARATH/76-138-----------------------------------------------------------------DYYAVLGLLPD....
DNAJ2_STRAL/4-65-----------------------------------------------------------------DYYAVLGVRRD....
DNAJM_MYCGE/7-68-----------------------------------------------------------------DYYEVLGITPD....
CBPA_ECOLI/5-66-----------------------------------------------------------------DYYAIMGVKPT....
DNAJ_METTH/5-66-----------------------------------------------------------------DYYEILGVDRG....
P92424_PEA/71-132-----------------------------------------------------------------DYYATLGVPKS....
Q9SJZ7_ARATH/86-147-----------------------------------------------------------------DYYSVLGVSKN....
DNAJ1_SYNY3/4-65-----------------------------------------------------------------DYYQTLGVTRD....
DNAJ2_THET8/6-67-----------------------------------------------------------------DYYAILGVPRN....
DNAJ2_AQUAE/8-69-----------------------------------------------------------------DYYEILGVPRN....
DNAJ1_AQUAE/7-68-----------------------------------------------------------------DYYEILGVNRD....
DNAJ_HALSA/4-65-----------------------------------------------------------------DFYDVLGVSRD....
DNAJ_LACLA/5-66-----------------------------------------------------------------EYYERLGVDKN....
DNAJ_STAAU/5-66-----------------------------------------------------------------DYYEVLGISKD....
F5WS97_ERYRF/6-67-----------------------------------------------------------------DFYEILGVSKS....
DNAJ_GEOSE/5-66-----------------------------------------------------------------DYYEILGVSKN....
DNAJ_LACSK/6-67-----------------------------------------------------------------DYYDVLGVGRD....
Q9ZEJ5_9NOST/9-71-----------------------------------------------------------------DYYEILGVTKD....
O25668_HELPY/4-65-----------------------------------------------------------------SLYQTLNVSEN....
DNAJ2_SYNY3/6-68-----------------------------------------------------------------NYYQILGVPRN....
DNAJ_THEMA/7-70-----------------------------------------------------------------DYYEILGVPRD....
D0MFD1_RHOM4/7-69-----------------------------------------------------------------DYYEILGVPEN....
DNAJ1_MYCLE/10-71-----------------------------------------------------------------DFYKELGVSSD....
DNAJ1_STRCO/10-72-----------------------------------------------------------------DYYKVLGVPKD....
DNAJ2_MYCTU/4-65-----------------------------------------------------------------DYYGLLGVSKN....
DNAJ_SYNE7/6-68-----------------------------------------------------------------DYYALLGIPQS....

PF03656

TIM16_HUMAN/1-125S-------PEE--VQKNYEHLFKVNDKS--VGGSFYLQSKV---VRAKE----RLDEEL.KIQAQE-DR-EKGQMPHT
TIM16_YEAST/1-128N-------MDK--INNRFNYLFEVNDKE--KGGSFYLQSKV---YRAAE----RLKWEL.AQREKN-AK-AKAGDAST
TIM16_CAEEL/1-135N-------REE--VEKHYEHLFNINDKS--KGGTLYLQSKV---FRAKE----RIDEEFGRIELKE-EK-KKEENAKT

PF00226

DNJ50_ARATH/34-95A.N.....ASD..IKRSYYKLSLQHHPD..KN......PDP....ESRK....LFV.KIATAYEIL.KD.NTTRAQYD
Q22138_CAEEL/24-87A.S.....QKD..IKSAYYKLSKQHHPD..TN.....PTNK...EEAAK....KFH.QVAMAYEIL.SS.EDKRKAYD
DNJA3_HUMAN/93-155A.S.....QKE..IKKAYYQLAKKYHPD..TN.....KDDP....KAKE....KFS.QLAEAYEVL.SD.EVKRKQYD
TID_DROVI/80-142A.N.....AKD..IKKAYYELAKKYHPD..TN.....KDDP....DASK....KFQ.DVSEAYEVL.SD.DQKRREYD
MDJ1_YEAST/61-122A.T.....GAE..IKKAYYKLAKKYHPD..IN......KEP....DAEK....KFH.DLQNAYEIL.SD.ETKRQQYD
MDJ1_SCHPO/86-147A.S.....ASE..IKSAYYKLAKQYHPD..AN.....PDKA.....AQD....KFV.EIKQAYEVL.QD.PKKKKAFD
P91189_CAEEL/379-444A.S.....KRE..ITKAYRKLAQKWHPDNFSD.....EEEK...KKAEK....KFI.DIAAAKEVL.QD.EEKRRQFD
DNJC3_HUMAN/394-459A.K.....KQE..IIKAYRKLALQWHPDNFQN.....EEEK...KKAEK....KFI.DIAAAKEVL.SD.PEMRKKFD
O77048_PLAFA/35-94A.T.....KED..ISKAYRQLAKEYHPD..IA............PDKEK....DFI.EIANAYETL.SD.PEKRKMYD
Q9VPQ2_DROME/25-87A.N.....TNE..VKKAYRRLAKELHPD..KN.....KDDP....DAST....KFQ.DLGAAYEVL.SN.PDKRKTYD
G1R466_NOMLE/25-87A.S.....IKD..IKKAYRKLALQLHPD..RN.....PDDP....QAQE....KFQ.DLGAAYEVL.SD.SEKRKQYD
Q49541_MYCHY/5-72A.S.....LTE..IKKAYRNLVNIYHPD..KNTK.KSAEEQ...KQAEA....KFK.EIQEAYEIL.SD.ETKRKQYD
DNJ29_ARATH/99-161A.S.....DSE..IKKAYRRLSIQYHPD..KN......PDP....EANK....YFVESIAKAYQAL.TD.PLSRENFE
DNJ21_ARATH/99-161V.T.....DSE..IKKAYRRLSIQYHPD..KN......PDP....EANK....YFVEFISKAYQAL.TD.SVSRENFE
Q9U1V9_CAEEL/107-165A.D.....EKA..IKKAWRDMSKIHHPD..RG.............GDAQ....FFD.KIAKAHQAL.TD.KEARENWE
F7FPB6_MACMU/104-162A.T.....VAE..IKKQYRLLSLKYHPD..KG.............GDEV....MFM.RIAKAYAAL.TD.EESRKNWE
Q9VS57_DROME/105-164S.S.....QAE..IKKAYYRLSKVLHPD..KE............TGDEK....SFM.MLSKAYQAL.TD.DVAKENYE
O17002_CAEEL/8-71C.T.....DKE..IQKAYRAQCLKWHPD..KN.....LDNK...EEAER....RFI.EAKEAFDFL.YD.KEKREEYD
DNJ63_ARATH/27-88A.K.....QRE..IQKAFHKQSLKYHPD..KN......KDK....GAQE....KFA.EINNAYEIL.SD.EEKRKNYD
JJJ2_YEAST/13-74A.T.....SSE..VHKSYLKLARLLHPD..KT.....KSDK.....SEE....LFK.AVVHAHSIL.TD.EDQKLRYD
DNJ2_CAEEL/36-102EFD.....KQK..LAKAYRALARKHHPDRVKN.....KEEK...LLAEE....RFR.VIATAYETL.KD.DEAKTNYD
DJC25_DROME/31-96S.S.....KSE..IGKAYRQLARRYHPD..LH....RGAEA..KAAAET....QFK.LVATAYEIL.RD.EESRTDYD
DNJC1_MOUSE/61-122A.S.....SAD..IRKAYRKLSLTLHPD..KN......KDE....NAET....QFR.QLVAIYEVL.KD.DERRQRYD
Q9VWL4_DROME/40-101A.T.....GAE..VKRAFRTLSIVLHPD..KN.....PAED.....ANI....QFR.NLVSIYEVL.KD.PSRREKYD
Q8SZX1_DROME/100-161A.T.....IQQ..IRSAFYALAKRYHPD..ST.......HS...EQKLK....HFQ.ELSNAYNIL.TD.ETKRLEYD
JEM1_YEAST/538-605A.S.....SKE..IRKAYLNLTKKYHPDKIKAN...HNDKQ...ESIHE....TMS.QINEAYETL.SD.DDKRKEYD
P72803_SYNY3/24-87A.S.....PVA..IRRAYRELSKRYHPD..TT.....LLTP...DIATV....KFQ.RLNEAYAVL.SN.PDRRSVYD
Q3MEP6_ANAVT/8-71A.S.....VID..IRRAYRELSKRYHPD..TT......ELP..AALATR....QFQ.QINEAYATL.SN.PDRRLNYD
DNAJ1_ARATH/48-110A.T.....REE..IKKSFHELAKKFHPD..TN.....RNNP....SAKR....KFQ.EIREAYETL.GN.SERREEYD
DNJ13_ARATH/15-80A.S.....DEE..IRKAYRQWAQVYHPD..KI....QSPQM..KEVATE....NFQ.RICEAYEIL.SD.ETKRLIYD
Q40868_PICGL/4-70S.S.....SAE..IRSAYRKLAMKWHPD..KW.....STDP....SSSETAKLRFQ.QIQEAYSVL.SD.DTKRALYD
Q9SSJ9_ARATH/8-74S.S.....AEQ..IRRAYHKLAKIWHPD..RW.....TKDPFRSGEAKR....RFQ.QIQEAYSVL.SD.ERKRSSYD
DNAJ6_ARATH/29-91A.T.....SQE..IRKAYHKLALKLHPD..KN.....QDDK....EAKD....KFQ.QLQKVISIL.GD.EEKRAVYD
Q22751_CAEEL/14-80C.D.....EKA..LKKGYYRQSMRWHPD..KSN...LVEED..MQTYTT....KFQ.LLNKAYQIL.SD.EEKRKIYD
Y6693_DROME/15-79A.G.....EKE..VKKAYHKLSLLVHPD..RV.....PEEQ..KAESTE....KFK.VLSKLYQVL.TD.TQKRALYD
YCJ3_SCHPO/8-72A.T.....SDQ..IKESYYRLSRLFHPD..RH.....TADQ..KAAAEE....KFQ.IIQHAYEVL.SD.PSKKEIYD
Q06166_PLAFA/1564-1627R.D.....LME..LKRILYNLFLEYNPH..MN.....NKQK...AELDK....KFS.EMNVVHQIL.NY.EERIRMYE
O96122_PLAF7/500-562S.E.....LSE..IKSNYYNLALKYNPE..SN.....LGNA....EALT....KFR.DINEAYQIL.SL.DQRRMNYN
O96277_PLAF7/195-257S.K.....LEE..IKEKYYEVASKYHPE..KN.....IGND....KAFK....KFE.LINSAYQIL.SN.EELRRKYN
RESA_PLAFF/523-584A.D.....MNE..ITERYFKLAENYYPY..QR.....SGST.....VFH....NFR.KVNEAYQVL.GD.IDKKRWYN
Q9VHW5_DROME/27-89C.T.....QNE..IKAAYYKLSMLYHPD..RN.....QGSE....NAAK....KFR.EINQAYEIL.GN.YRLRRLYD
DNJ60_DROME/26-90C.S.....TRE..VRNAFVQLSKLYHPDVKSN.....AACP....ERTA....RFV.QISEAYKTL.IK.PERRRDYD
Q9VFY1_DROME/37-98S.S.....DRE..IKRAFIELSKKYHPD..AN......SQT....RDSE....VFM.KICEAYQTL.HR.VNSRQIYD
DNJC4_MOUSE/37-99A.S.....AEE..IKRAFFTKSKELHPD..RD.....PGNP....ALHS....RFV.ELNEAYRVL.SR.EESRRNYD
P91014_CAEEL/28-89A.T.....LSE..IKSAFYAQSKKVHPD..NS......SEE....SATA....SFL.ELKNAYDVL.RR.PADRRLYD
NDHT_ARATH/106-169A.D.....LEE..IKSAYRRLSKEYHPD..TT......SLP..LKTASE....KFM.KLREVYNVL.SD.EETRRFYD
Q9VX95_DROME/329-395A.S.....QAE..ITAAYRKLSKEYHPDKVKD.....EGLR...AQAHQ....RFI.EIQQAYSVL.SKIKSNRRRKN
E7KSY1_YEASL/23-85A.T.....EKE..IKSAYRQLSKKYHPD..KN.....AGSE....EAHQ....KFI.EVGEAYDVL.SD.PEKKKIYD
DJC13_HUMAN/1301-1362QGP.....HDESKIRKAYFRLAQKYHPD..KN............PEGRD....MFE.KVNKAYEFL.CT..KSAKIVD
O18427_GEOCY/5-64A.S.....FSD..IRKAHHRLARQYHPD..RE.....GGND.......E....KFK.EVQTAYEIL.SD.SEKREMYD
MU185_SCHPO/9-71S.D.....LQE..IKANYRKLALQYHPD..RN.....PGIE....DYNE....IFS.QINAAYNIL.SN.DDKRKWHE
ERJ5_YEAST/44-105S.S.....TKE..ITKNLRKLSKKYHPD..KN............PKYRK....LYE.RLNLATQIL.SN.SSNRKIYD
DJC12_MOUSE/14-76S.S.....VEQ..ILAEFKIRALECHPD..KH.....PENS....KAVE....TFQ.KLQKAKEIL.CN.AESRARYD
JDP_BOMMO/17-79S.T.....VEQ..ITAEYKILALQHHPD..KN.....DGEK....EAEM....KFQ.KLKEAKEIL.CD.PSKRALYD
JDP_DROME/17-79S.S.....PEQ..IQAEYKVLALQYHPD..KN.....SGDK....EAEA....KFQ.QLKEAKETL.CD.PEKRAIYD
RSP1_SCHPO/12-75S.S.....YVE..IRQQYLKLVLRYHPD..RN.....PGRE...AEVLP....QFQ.LIQKAHEVL.KD.PKLRELFD
MU184_SCHPO/12-75A.T.....FQQ..IRKQYLFLALQYHPD..RN.....PGDE...ERAVK....RFQ.RLQLAHEVL.SD.ATKRLIYD
O97211_LEIMA/9-69C.T.....TAE..ISQQYRRLALRYHPD..RN.....AGAT......VE....QFQ.RIEEAHRVL.SD.LRQRQLYD
Q9S729_VOLCA/114-186RWT.....ASEAQIRAAYRKTCLENHPD..KALINVTDEAE..RERIVE....HFK.TIQDAYDIL.SD.PAKRREFD
YCJD_SCHPO/4-68A.S.....AEE..IKYAYKKAALETHPD..RV....SPSAR...ARATE....QFQ.LVNEAYYVL.SD.NSRRAQYD
Q9U2L4_CAEEL/27-88A.S.....PDE..IRIAFRKRIREVHPD..KC......KHP....SATE....ASK.VVNNAFSLL.MD.PAKRRQYD
Q17438_CAEEL/137-198A.S.....DDD..IRKEYRKLALKLHPD..KC......RAP....HATE....AFK.ALGNAYAVL.SD.TDKRRQYD
ZUO1_YEAST/97-165A.T.....ESQ..IIKAHRKQVVKYHPDKQSA.....AGGS...LDQDG....FFK.IIQKAFETL.TD.SNKRAQYD
ZUO1_SCHPO/97-164A.D.....TEQ..IKKAHLKKVLKHHPDKKAA.....SGNI....NDDS....FFK.CIQKAYEIL.SD.PVRRRQFD
Q94216_CAEEL/98-167A.T.....SDE..IRFCYRQKVLKHHPDKKKH.....RGIV...MEKEE....YFT.CITKAYEQVGMS.DVKRQAFD
Q9VP77_DROME/76-145A.S.....EDD..VRRAYRRMVLLHHPDKRKA.....KGEE..VIQDDD....YFT.CITKAYEIL.GT.SKPRRSFD
Q9ST16_BRACM/135-199K.R.....IDDAVLKKEYRKKAMLVHPD..KN.....MGCP....LASE....SFK.KLQCAYEVL.SD.IVKKRDYD
Q9SWW3_9EUGL/11-70A.Q.....AKE..IKAAYRRRALECHPD..KN............PNGGK....EFQ.RLHRAYETL.ID.PQLRRDYD
O83136_TREPA/8-70A.S.....EEH..IKKAFRAQALKYHPD..KN.....PGDA....CAED....QFK.RINAAYAVL.SD.RASRARYD
YL39_SCHPO/31-96A.S.....DEL..IRRAYRKKALQHHPD..RI....HDEEK..KVEARI....EFD.KVAIAYGVL.SD.KKRRKHYD
Q9XWE1_CAEEL/20-82A.D.....DRT..IRKAFKKLAIKKHPD..RN.....TDDP....NAHD....EFV.KINKAYEVL.KD.ENLRKKYD
Q22028_CAEEL/17-79A.S.....EAE..IKSAYRKLALKYHPD..RN.....PNDA....HAQE....EFK.KVSIAYSVL.SD.PNKRRQYD
Q9VNW1_DROME/7-66A.T.....DSE..IKDAFRRLSLQYHPD..KN............EDGAK....EFL.RINEAHRVL.ID.HQRRALYD
DNJ72_ARATH/3-70A.T.....KKE..VKDAFRRLAIKYHPD..KHA..QSPEHV..RHNATV....RFK.LVSEAYEVL.ND.DLKRASYN
DNAJ_DEIRA/2-63A.S.....ADE..IKSAYRKLALKLHPD..RN......KEE....GAAE....KFA.QVSEAYSVL.SD.TEKRAHYD
DNAJ_METMA/6-67S.S.....VED..IKKTYRKLALQYHPD..RN......KEP....GAEE....KFK.EISEAYAVL.SD.AEKRAQYD
O49475_ARATH/66-127A.D.....DEA..VKKRYRKLALLLHPD..KN......RFT....GAEG....AFK.LILEAWDLL.SD.KSQRSSYD
O49476_ARATH/55-115A.D.....EEA..VKKQYKKLALLLHPD..KN......RFN....GAEG....AFK.LVRHARDLL.SD..QPCLIYN
O49477_ARATH/56-117A.D.....EEV..VKKQYKRLALLLHPD..KN......NCE....GAEG....AFK.LVLAAWCLL.SD.KVKRIAYD
Q9ZU99_ARATH/71-136T.D.....NDL..IKKQYRRLALLLHPD..KN......RFP....FADQ....AFR.FVLDAWEVL.ST.PTKKSQFD
O04648_ARATH/66-127A.D.....DAT..IKKQVRKLALLLHPD..KN......QFP....GAEA....AFK.LVWDASRFL.AD.KDKRSQYD
Q9SQT7_ARATH/67-128A.N.....DVI..IKKQYKRLALLLHPD..KN......KLP....GAES....AFK.LIGEAQRIL.LD.REKRTLHD
Q9SLA7_ARATH/66-127A.D.....DEI..VRKRYRKLAVMLHPD..RN......KSV....GAEE....AFK.FLSQAWGVF.SD.KAKRADYD
Q9VN28_DROME/708-769S.S.....QEQ..IRKHYKKIAVLVHPD..KN......KQA....GAEE....AFK.VLQRAFELI.GE.PENRLIYD
P91243_CAEEL/26-91A.T.....DDE..IIKAYRKRCLMFHPDRFVD.....NDEK...KDAER....VFV.KLRRAHEVL.LD.PKQRAIYD
YNF5_SCHPO/113-174C.T.....DTE..IKKSYKKLALQLHPD..KN......HAP....SADE....AFK.MVSKAFQVL.SD.PNLRAHYD
Q9VFP0_DROME/106-167A.T.....DSE..IKKAYKKLALQLHPD..KN......KAP....GAVE....AFK.ALGNAAGVL.TD.AEKRKNYD
DJB12_MOUSE/111-172A.S.....DED..LKKAYRKLALKFHPD..KN......HAP....GATE....AFK.AIGTAYAVL.SN.PEKRKQYD
O80481_ARATH/70-132FCS.....HQM..IQRKYRDILVKLYPDTNKS............IAAKS....AFE.IINYAWKIL.SD.PEKRKDYN
Q55559_SYNY3/6-67S.G.....GET..IEQAYQDRLLQL.PR..RE.....FSDA....AVTL....RNQ.LLAIAYETL.RD.PEKRQAYD
Q9VNE8_DROME/3-72A.S.....FDE..IKCSYKQLILQCHPDKLRQ.....LDDP...NPGSEAQNSDFN.AINAAWNTL.KD.PIRRKHYD
E7KQL7_YEASL/8-73A.T.....QDE..IKKAYRNRLLNTHPDKLSK....SIHDT....VSNV....TIN.KIQDAYKIL.SN.IKTRREYD
DPH4_SCHPO/2-66TYT.....DDE..IKEAYRKALLLFHPD..KC.....KEKP....SVVY....TID.QVKEAYQVL.SS.EKDRQQYQ
O82623_ARATH/11-76A.S.....YEE..IRNSYRSAILHSHPDKLNN.....TSRS...SSDDE....KFL.KIQKAWEVL.SD.AELRVVYD
O96276_PLAF7/660-722A.S.....FDE..IKHSYRKLALQYHPD..KN.....INDP....EANE....KFQ.KINEAYQVL.SD.ENRRKMYD
YHXB_SCHPO/9-72A.D.....GDT..IKKSYRRLAILYHPD..KN.....RENP...EAARE....KFQ.KLAEAYQVL.SD.PKLREKYD
SPF31_SCHPO/31-93M.S.....VDD..IRNLYRKKSLMIHPD..KN.....RDNP....KAAD....AFD.ILKKAESDL.VN.DKIRESLD
O80799_ARATH/315-376M.A.....ADN..MKKRYWKLSLLVHPD..KC......SHP....QAQE....AFV.LLNKAFKEL.QD.PEKRKAMD
CWC23_YEAST/15-84L.DVHTIYDDLPQIKRKYRTLALKYHPD..KH.....PDNP....SIIH....KFH.LLSTATNIL.TN.ADVRPHYD
Q9VGR0_DROME/10-72S.D.....QNE..IRKAYRKKALECHPD..KN.....PDNP....KAVE....RFH.ELSKALEIL.TD.ESARAAYD
DJP1_YEAST/6-68A.S.....SIE..IKKAYRKKSIQEHPD..KN.....PNDP....TATE....RFQ.AISEAYQVL.GD.DDLRAKYD
YAY1_SCHPO/8-71A.T.....AVD..IKKAYRKLAVKYHPD..KN.....PDDP...QGASE....KFQ.KISEAYQVL.GD.EKLRSQYD
E7QDV5_YEASZ/6-68A.T.....PTE..IKKAYRRKAMETHPD..KH.....PDDP....DAQA....KFQ.AVGEAYQVL.SD.PGLRSKYD
O49288_ARATH/6-67A.S.....EEE..IRKAYYIKARQVHPD..KN.....QGDP...LAAEK......Q.VLGEAYQVL.SD.PVHREAYD
DNJ10_ARATH/6-68A.T.....ESE..IKKAYYIKARQVHPD..KN.....PNDP....QAAH....NFQ.VLGEAYQVL.SD.SGQRQAYD
Q9SJS8_ARATH/6-68A.S.....DAE..IKKAYYLKARKVHPD..KN.....PGDP....QAAK....NFQ.VLGEAYQVL.SN.PDKRAAYD
Q9XEM8_ORYSI/285-347A.S.....PAE..IKKAYYLKAKQVHPD..KN.....PGNP....DAAQ....KFQ.ELGEAYQVL.SD.PSKREAYD
DNJC5_MOUSE/15-77A.T.....SDD..IKKSYRKLALKYHPD..KN.....PDNP....EAAD....KFK.EINNAHAIL.TD.ATKRNIYD
DNJC5_DROME/17-79A.T.....GDD..IKKTYRKLALKYHPD..KN.....PDNV....DAAD....KFK.EVNRAHSIL.SN.QTKRNIYD
Q21162_CAEEL/38-101A.T.....DDE..IKKAYRKLALRYHPD..KN....LDGDP....EKTE....MFK.EINYANAVL.SN.PNKRRVYD
Q4D4S6_TRYCC/13-72A.S.....DVE..IRRAYYKLAVVYHPD..KN............PDGVE....VFK.EISFANSIL.SD.PARRRLYD
DNJ39_ARATH/23-85S.T.....DQE..IKSAYRRMALRYHPD..KN.....PDDP....VAAE....MFK.EVTFAYEVL.SD.PENRRLYD
DNJ16_ARATH/20-82S.T.....DQE..IKSAYRKLALKYHPD..KT.....ANDP....VAAD....MFK.EVTFSYNIL.SD.PEKRRQFD
DNJ15_ARATH/17-79A.N.....DQE..IKSAYRKLALKYHPD..KN.....ANNP....DASE....LFK.EVAFSYSIL.SD.PEKRRHYD
APJ1_YEAST/6-68A.S.....TSE..IKKAYRNAALKYHPD..KN.....NHTE....ESKR....KFQ.EICQAYEIL.KD.NRLRALYD
PSI1_SCHPO/6-65A.S.....EAE..LKKAYRKLALKYHPD..KN........P....NGEK....KFK.EISLAYEVL.SD.PQRRKLYD
Q9U4X8_STRER/24-83A.X.....DSE..IXKAYRKLARXYHPX..KN............SDHGD....KFK.EISAAYXIL.SD.ENKRKIYD
O16303_CAEEL/13-72A.S.....QAD..IKKSYFKLAKEYHPD..KN........P....DHGD....KFK.EISFAYEVL.SS.PEKRRLYD
Q9VK35_DROME/5-64A.T.....DEE..IKKNYRKLAKEFHPD..KN........P....DAGD....KFK.EISFAYEVL.SD.PEKRRIYD
A0A0D9QZR7_CHLSB/8-67A.S.....ENE..LKKAYRKLAKEYHPD..KN........P....NAGD....KFK.EISFAYEVL.SN.PEKRELYD
O45502_CAEEL/6-65A.S.....DNE..LKKAYRKMALKFHPD..KN........P....DGAE....QFK.QISQAYEVL.SD.EKKRQIYD
E2RM09_CANFA/6-65A.T.....QEE..LKKAYRKLALKYHPD..KN........P....NEGE....KFK.QISQAYEVL.SD.AKKRELYD
E7KGU0_YEASA/21-82A.T.....DSE..IKKAYRKLAIKLHPD..KN......SHP....KAGE....AFK.VINRAFEVL.SN.EEKRSIYD
MAS5_SCHPO/6-65A.S.....QAE..LKKAYRKLALKYHPD..KN........P....NAGD....KFK.EISRAYEIL.AD.EEKRATYD
MAS5_YEAST/6-67A.T.....DVE..IKKAYRKCALKYHPD..KN.....PSEE.....AAE....KFK.EASAAYEIL.SD.PEKRDIYD
Q9U062_GIAIN/6-65A.D.....PQT..IKKRTTKLARKYHPD..KP............TGDEE....LFN.KIGRAYEVL.SD.PTKRENYD
SIS1_YEAST/6-65A.N.....EQE..LKKGYRKAALKYHPD..KP............TGDTE....KFK.EISEAFEIL.ND.PQKREIYD
O24074_MEDSA/14-72A.S.....EDE..IKKAYRKAAMKNHPD..KG......GDP.......E....KFK.ELGQAYEVL.SD.PEKKELYD
DNJH2_ALLPO/13-71A.T.....PED..LKKAYRKAAIKNHPD..KG......GDP.......E....KFK.EIGQAYEVL.ND.PEKREIYD
O43978_BABBO/14-72C.S.....ESE..IKKAYRKLAIKHHPD..KG.............GDSE....MFK.EITRAYEVL.SD.PEKRRIYD
O96455_DICDI/5-66A.S.....ETD..IKKAYRKLAIKYHPD..KN......PDP....AAVE....KFK.ELTVAYEVL.SD.TEKRELYD
XDJ1_SCHPO/6-70A.S.....AEE..IKKSYKRLALLHHPD..KA.....PIHE..KEEAAE....RFR.GVQEAYDIL.KD.PESREMYD
XDJ1_YEAST/9-74A.T.....VQE..IKTAYRKLALKHHPD..KY......VDQ....DSKEVNEIKFK.EITAAYEIL.SD.PEKKSHYD
DNJ20_ARATH/66-130V.T.....LPE..IKQAYKQLARKYHPD..VS.....PPDR..VEEYTD....RFI.RVQEAYETL.SD.PRRRVLYD
Q9SH08_ARATH/76-144A.E.....EEQ..IKVAYRRLAKFYHPD..VYDG.KGTLEE..GETAEA....RFI.KIQAAYELL.MD.SEKKVQYD
O48828_ARATH/68-132S.T.....SQE..IKSAYRRLARICHPDVARN.....SRDN....SSAD....DFM.KIHAAYCTL.SD.PEKRAVYD
P93499_PHAVU/67-131A.S.....SQE..IKAAYRRLARVCHPD..VA.....AIDR..KNSSAD....EFM.KIHAAYSTL.SD.PDKRANYD
DNAJL_MYCGE/2-61A.S.....IKE..IKIAYKRLAKRYHPD..VN............KLGSQ....TFV.EINNAYSIL.SD.PNQKEKYD
DNAJL_MYCPN/2-61A.T.....LQE..IKTAYKRLAKRYHPD..IN............KQGAD....TFV.KINNAYAVL.SD.TTQKAEYD
Q9SZU8_ARATH/56-120S.S.....IAE..IKASFRRLAKETHPDLIES.....KKDP....SNSR....RFV.QILAAYEIL.SD.SEKRAHYD
Q26954_TRYCR/6-68A.A.....TDE..IRTAYRRLALKYHPD..KN.....GGDA....RAAE....KFK.KVAEAYEIL.SD.PTKRRHYD
Q26952_TRYCR/6-67A.S.....VDE..IKRAYRRLALKYHPD..KN......KDP....GSQE....KFK.EVSVAYECL.SD.PEKRTRYD
Q26953_TRYCR/6-68A.T.....EHD..IKRAYRRLGLKYHPD..KN.....PGDQ....EAAE....MFK.RIGHAYEIL.SD.EEKRRIYD
O13303_CRYCU/6-70A.S.....EAD..IKKAYRKESLKWHPD..KN.....PGDK..RATAEE....KFK.KVGEAYEVL.SD.PEKRKIYD
O96123_PLAF7/88-153C.T.....NED..IKKAYKKLAMKWHPD..KHL..NAASKK....EADN....MFK.SISEAYEVL.SD.EEKRDIYD
O96212_PLAF7/4-69C.T.....TND..LKKAYRKLAMMWHPD..KH.....NDEKS.KKEAEE....KFK.NIAEAYDVL.AD.EEKRKIYD
O49457_ARATH/4-67A.N.....DDD..LKKAYRKLAMKWHPD..KN.....PNNK...KDAEA....KFK.QISEAYDVL.SD.PQKRAVYD
Q9SU57_ARATH/4-68A.T.....EDD..LKKAYKRLAMIWHPD..KN.....PSTR..RDEAEA....KFK.RISEAYDVL.SD.PQKRQIYD
Q9VNW0_DROME/4-65A.S.....SED..VKKGYRRMALRYHPD..KN......DHP....QAEE....QFR.EVVAAFEVL.FD.KEKREIYD
H2QJG7_PANTR/3-66A.S.....ADD..IKKAYRRKALQWHPD..KN.....PDNK...EFAEK....KFK.EVAEAYEVL.SD.KHKREIYD
DNJB3_MOUSE/3-66A.S.....AEA..IRKAYRKLALKWHPD..KN.....PEHK...EEAER....RFK.QVAQAYEVL.SD.VRKREVYD
DNJB6_HUMAN/3-66A.S.....PED..IKKAYRKLALKWHPD..KN.....PENK...EEAER....KFK.QVAEAYEVL.SD.AKKRDIYD
O62360_CAEEL/28-91A.D.....DDK..IKKNYRKLALKWHPD..KN.....PDRI...EECTQ....QFR.LLQAAYDVL.SD.PREREFYD
Q9W0X8_DROME/3-66A.N.....DGD..IKSAYRKMALRWHPD..KN.....PDRL...AEAKE....RFQ.LIQQAYEVL.SD.PQERSWYD
JJJ1_YEAST/4-67A.S.....DLE..LKKAYRKKALQYHPD..KN.....PDNV...EEATQ....KFA.VIRAAYEVL.SD.PQERAWYD
Q9W2U5_DROME/4-65A.N.....DGE..IRKAYHKQALRYHPD..KN......KSP....QAEE....IFK.QVAKAYEVL.SD.KKKRGSYD
DNAJ1_DROME/4-65A.S.....DDE..IKKAYRKLALKYHPD..KN......KSP....QAEE....RFK.EIAEAYEVL.SD.KKKRDIFD
Q9VPY9_DROME/4-65A.T.....DDE..IKKAYRKLALRYHPD..KN......KAA....NAED....KFK.EVAEAYEVL.SD.KSKREVYD
H2NXT6_PONAB/4-65A.S.....DEE..IKRAYRRQALRYHPD..KN......KEP....GAEE....KFK.EIAEAYDVL.SD.PRKREIFD
G1RFD8_NOMLE/4-65A.S.....DED..IKKAYRKQALKFHPD..KN......KSP....QAEE....KFK.EVAEAYEVL.SD.PKKREIYD
F7HQB6_MACMU/4-65A.N.....EDE..IKKAYRKMALKYHPD..KN......KEP....NAEE....KFK.EIAEAYDVL.SD.PKKRGLYD
Q20774_CAEEL/4-65A.T.....DDE..IKKAYRKMALKYHPD..KN......KEA....GAEN....KFK.EIAEAYDVL.SD.DKKKKIYD
Q9QZW8_RAT/3-66A.S.....SSD..IKKAFHQLALQVHPD..KN.....PGDR...EAAEE....KFK.QVAEAYQIL.SD.AKKRKDYD
Q38AB7_TRYB2/4-67A.S.....PSD..IKKAYHQLALKYHPD..KA.....SGNR...EEAER....LFK.EVAEAYDVL.SD.EKKKKIYD
DNJB9_MOUSE/26-87A.S.....ERQ..IKKAFHKLAMKYHPD..KN......KSP....DAEA....KFR.EIAEAYETL.SD.ANSRKEYD
DNAJ_RHOCA/5-67A.S.....AEE..IKKAYRSKAKELHPD..RN.....QGQS....AAEA....QFK.EVNGAYDVL.KD.GDKKAAYD
DNAJ_RICPR/4-65A.S.....QAD..IKKAYLKLAKQYHPD..TT......NAN....DAEK....KFK.EINAAYDVL.KD.EQKRAAYD
DNAJ_MYCGE/7-74A.S.....SQD..IKRAFRKLAMQYHPD..RHKAENETTQK....QNEE....KFK.EVNEAYEVL.SD.EEKRKLYD
C9R3C7_AGGAD/5-67A.D.....EKE..IKRAYKKLAMQYHPD..RT.....KGDK....EKEE....KFK.EIQEAYEVL.ND.KEKRAAYD
DNAJ_BUCAI/5-67A.E.....ERE..IKKAYKKLAMKYHPD..RN.....QGDK....TAEG....KFK.EIKEAYEIL.IN.EEKRSAYD
DNAJ_ECOLI/5-67A.E.....ERE..IRKAYKRLAMKYHPD..RN.....QGDK....EAEA....KFK.EIKEAYEVL.TD.SQKRAAYD
DNAJ_HAEDU/5-67A.T.....EKD..IKRAYKRLAAKYHPD..KN.....QGSK....DSEE....KFK.QITEAYEIL.TD.DQKRAAYD
DNAJ_NITEU/5-67A.D.....ENE..LKKAYRKLAMKYHPD..RN.....AGDT....KAEE....RFK.NIKEAYEIL.SD.PNKRAAYD
DNAJ_VIBCH/5-67A.S.....ERD..IKKAYKRLAMKYHPD..RN.....SGDA....GAAE....KFK.EVKEAYEIL.TD.AQKKAAYD
DNAJ_VIBHA/5-67A.S.....ERD..IKKAYKRLAMKYHPD..RN.....QGDE....SAAD....KFK.EVKESYEIL.TD.PQKKAAYD
DNAJ_COXBU/5-67A.T.....EAE..VKKAFRRLAMKYHPD..RN.....PGDK....DAEV....KFK.EAREAYEVL.CD.SRKRASYD
DNAJ_LEGPH/5-67A.S.....DAE..IKKAYRRLAMKYHPD..RN.....PGDT....SAEE....KFK.EIQKAYNIL.SD.KQKRAAYD
DNAJ_METSS/5-67A.S.....DEE..IKKSYRKLAMKYHPD..RN.....PDNP....KAEE....SFK.EAKEAYEVL.SD.EQKRAAYD
DNAJ_CAUCR/3-65I.D.....EAG..LKSAFRKLAMEHHPD..RN.....GGCE....NAAG....RFK.EINEAYSVL.SD.PQKRAAYD
DNAJ_BRADU/8-70A.D.....ESK..LKSSFRKLAMKFHPD..RN.....PGDD....TSEV....KFK.EINEAYEVL.KD.KDKRAAYD
DNAJ_RHILE/5-67A.D.....EKE..LKSAFRKLAMKFHPD..KN.....PDDK....DAER....KFK.EINEAYEML.KD.PQKRAAYD
N8LUN8_BRUOV/4-66A.D.....DKT..LKAAFRKLAMQYHPD..RN.....PDDP....EAER....KFK.EIGEAYETL.KD.PQKRAAYD
DNAJ_DEIPM/5-67A.S.....DSD..IKSAYRKLAKQYHPD..KN.....AGDE....SAAE....KFK.EIGEAYAVL.SD.PQKRQAYD
DNAJ_BORBU/4-66A.S.....KDE..IKKAYRKIAIKYHPD..RN.....QGNE....EAAS....IFK.EATQAYEIL.ID.DNKKAKYD
O51599_BORBU/4-66A.S.....NEE..IKKAYKKLAIKYHPD..KN.....KGNK....IAEE....KFK.EINEAYEIL.SS.PDKKRNYD
DNAJ_CLOAB/5-67A.S.....DDE..IKKAFRKLAIKYHPD..KN.....RGNK....EAEE....KFK.EINEAYQVL.SD.PDKKANYD
DNAJ_LEPIN/5-67A.N.....DEE..IKSAYRKLAIKYHPD..KN.....KGNK....ESEE....KFK.EATEAYEIL.RD.PKKRQAYD
DNAJ_FRATU/5-67A.S.....GVE..IKRAYRKLAMKYHPD..RN.....PGDK....EAEI....KFK.EISEAYEIL.SD.DSKRSRYD
DNAJ_HELPY/4-66S.N.....QET..IKKSYRKLALKYHPD..RN.....AGDK....EAEE....KFK.LINEAYGVL.SD.EKKRALYD
DNAJ_CAMJE/4-66A.D.....KET..IKKAYRKMALKYHPD..RN.....QGDK....EAED....KFK.LVNEAYEVL.SN.DEKRAIYD
DNAJ_CHLTR/2-64A.T.....PEE..IKKAYRKLAVKYHPD..KN.....PGDA....EAER....RFK.EVSEAYEVL.GD.AQKRESYD
DNAJH_SYNY3/8-70A.S.....EAE..IKKQFRKLALKYHPD..KN.....PGDK....AAEE....KFK.EISEAYEVL.SD.PEKRQKYD
DNAJ_PORGI/6-68A.T.....DDE..LKKAYRKKAIQYHPD..KN.....PGDK....EAEE....HFK.EVAEAYDVL.SD.PQKRSQYD
O61582_DROHE/8-75A.T.....EDE..VKKAYRKKAMVHHPD..RH.....TSSS...AEVRKDEELKFK.EVGEAYAIL.SD.AQKKSRYD
DNJC7_MOUSE/381-448A.S.....EDE..IKKAYRKRALMHHPD..RH.....SGAS...AEVQKEEEKKFK.EVGEAFTIL.SD.PKKKTRYD
O15811_PLAFA/61-122A.T.....TND..IKKQFRLLAKKYHPD..IN......PSP....DAKQ....KMA.SITAAYELL.SD.PKKKEFYD
O97016_LEIMA/86-147S.T.....PEQ..IKSAYKKRAKALHPD..VN......PSP....TAAE....DFA.EAKQAYETL.SD.PQKRSMYD
Q9SJI1_ARATH/76-138A.T.....QEE..IKKAYYNCMKSCHPD..LS.....GNDP....ETTN.....FCMFINDIYEIL.SD.PVQRMVYD
DNAJ2_STRAL/4-65A.S.....QDE..IKKAFRRLARELHPD..VN......PDP....KTQE....RFK.EINAAYEVL.SD.PQKKQVYD
DNAJM_MYCGE/7-68A.D.....QSE..IKKAFRKLAKKYHPD..RN......NAP....DAAK....IFA.EINEANDVL.SN.PKKRANYD
CBPA_ECOLI/5-66D.D.....LKT..IKTAYRRLARKYHPD..VS......KEP....DAEA....RFK.EVAEAWEVL.SD.EQRRAEYD
DNAJ_METTH/5-66A.D.....KKE..IKKAYRRLARKYHPD..VS......DDP....DAAE....KFK.EISEAYAVL.SD.DEKRARYD
P92424_PEA/71-132A.T.....VKD..IKAAYRRLARQYHPD..VN......KEP....GATD....KFK.EISNAYEVL.SD.DKKRALYD
Q9SJZ7_ARATH/86-147A.T.....KAE..IKSAYRKLARNYHPD..VN......KDP....GAEE....KFK.EISNAYEVL.SD.DEKKSLYD
DNAJ1_SYNY3/4-65A.D.....KDE..IKRAYRRLARKYHPD..VN......KEP....GAEE....KFK.EINRAYEVL.SE.PEIRQRYD
DNAJ2_THET8/6-67A.T.....QEE..IKRAYKRLARQYHPD..VN......KSP....EAEE....KFK.EINEAYAVL.SD.PEKRRIYD
DNAJ2_AQUAE/8-69A.S.....QEE..IKKAYRRLVRKYHPD..IC......KKP....ECEE....KFK.EINEAYQVL.SD.PEKRKLYD
DNAJ1_AQUAE/7-68A.T.....KEE..IKKAYRKLVRIYHPD..IN......PDP....SAQE....KFK.EINEAYHVL.ID.DERRSEYD
DNAJ_HALSA/4-65A.T.....EDE..IMQAYRDQVSEYHPD..VS......DDP....DAEE....KFK.KIQKAKDVL.TD.EETRQQYD
DNAJ_LACLA/5-66A.S.....QDE..IKKAYRKMSKKYHPD..LN......KEE....GAEE....KYK.EVQEAYETL.SD.EQKRAAYD
DNAJ_STAAU/5-66A.S.....KDE..IKKAYRKLSKKYHPD..IN......KEE....GADE....KFK.EISEAYEVL.SD.DNKRATID
F5WS97_ERYRF/6-67A.T.....DAE..IKKAYRQLAKKYHPD..IN......KED....GAEA....KFK.EVQEAYEVL.SD.SQKRANYD
DNAJ_GEOSE/5-66A.T.....KEE..IKKAYRKLSKKYHPD..VN......KEP....DAAE....KFK.EIKEAYEVL.SD.DQKRAHYD
DNAJ_LACSK/6-67A.S.....DDE..IKKAYRKLSKKYHPD..IN......KAP....DAEA....KFK.EVTEAYEAL.SD.PQKRAAYD
Q9ZEJ5_9NOST/9-71A.T.....NED..IKKNYRRLARQYHPD..LN.....PGNK....DAEE....KFK.IIGEAYEML.SD.ATKRAQYD
O25668_HELPY/4-65A.S.....QDE..IKKSYRRLARQYHPD..LN......KTK....EAEE....KFK.EINAAYEIL.SD.EEKRRQYD
DNAJ2_SYNY3/6-68A.T.....AEE..IKKSFRKLARQYHPD..VN.....PNDK....TAEE....KFK.DINEAYDVL.SD.ETKRRELD
DNAJ_THEMA/7-70A.T.....QEE..IKRAYKRLVKEWHPD..RH.....PENR...KEAEQ....RFK.EIQEAYEVL.SD.PQKRAMYD
D0MFD1_RHOM4/7-69A.T.....EEE..IKKAYRKLAREWHPD..RN.....PDKP....NAEE....RFK.EIQEAYSVL.SD.PEKRRQYD
DNAJ1_MYCLE/10-71A.S.....PEE..IKRAYRKLARYLHPD..AN.....PDNS.....AGE....RFK.VVSEAHNVL.SD.PVKRKEYD
DNAJ1_STRCO/10-72A.T.....EAE..IKKAYRKLARENHPD..AN.....KGNV....KAEE....RFK.EISEANDIL.GD.PKKRKEYD
DNAJ2_MYCTU/4-65A.S.....DAD..IKRAYRKLARELHPD..VN.....PDEA.....AQA....KFK.EISVAYEVL.SD.PDKRRIVD
DNAJ_SYNE7/6-68A.D.....QAA..IKAAFRKLARQCHPD..LN.....PGDR....QAEE....RFK.QISEAYEIL.SD.PDRRAEYQ

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window