Sequence alignment for CL0392

PF03656

TIM16_HUMAN/1-125MAKYLA.QIIVMGVQVVGRAFARALRQEF.....AASRAAADARGRAGH.RSAAASNLS.GLSLQEAQQILNVSK-----
TIM16_YEAST/1-128MAHRAFIQVIITGTQVFGKAFAEAYRQAA......SQSVKQGA.TNASR.RGTGKGEYG.GITLDESCKILNIEE-----
TIM16_CAEEL/1-135MPWRTALKVALAAGEAVAKALTRAVRDEIKQTQQAAARHAASTGQSASETRENANSNAKLGISLEESLQILNVKT-----

PF00226

DNAJ_DEIPM/5-67-----------------------------------------------------------------DYYEVLGVSR.....
DJB12_MOUSE/111-172-----------------------------------------------------------------DYYEILGVSR.....
DJC13_HUMAN/1301-1362-----------------------------------------------------------------DAYEVLNLPQG....
DNJA3_HUMAN/93-155-----------------------------------------------------------------DYYQILGVPR.....
O96123_PLAF7/88-153-----------------------------------------------------------------DYYSILGVSR.....
O96276_PLAF7/660-722-----------------------------------------------------------------TYYDLLNVEP.....
P91243_CAEEL/26-91-----------------------------------------------------------------DFYAILNVPK.....
JJJ2_YEAST/13-74-----------------------------------------------------------------TYYSILGLTS.....
LT_POVBO/10-68-----------------------------------------------------------------ELRGLLGTPD.....
O04648_ARATH/66-127-----------------------------------------------------------------NWYGILQVMH.....
DNAJ_NITEU/5-67-----------------------------------------------------------------DYYEVLGVGR.....
O13303_CRYCU/6-70-----------------------------------------------------------------EYYKTLGLSK.....
RSP1_SCHPO/12-75-----------------------------------------------------------------DYYTILGAES.....
YNF5_SCHPO/113-174-----------------------------------------------------------------QYYEILDLKK.....
MU185_SCHPO/9-71-----------------------------------------------------------------DCYEILQVNH.....
O15811_PLAFA/61-122-----------------------------------------------------------------DPYTVLGLSR.....
O16303_CAEEL/13-72-----------------------------------------------------------------TLYTTLNVRP.....
O17002_CAEEL/8-71-----------------------------------------------------------------NPYKILHLEK.....
O18427_GEOCY/5-64-----------------------------------------------------------------DLYEVLELPK.....
O22214_ARATH/873-953-----------------------------------------------------------------DFFLIMGVKT.....
O22266_ARATH/374-434-----------------------------------------------------------------DYYGLIGVRR.....
O24074_MEDSA/14-72-----------------------------------------------------------------KYYDILGVSK.....
O25668_HELPY/4-65-----------------------------------------------------------------SLYQTLNVSE.....
DNAJ_HELPY/4-66-----------------------------------------------------------------SYYEILEVEK.....
DNAJ_METTH/5-66-----------------------------------------------------------------DYYEILGVDR.....
DNAJ_BUCAI/5-67-----------------------------------------------------------------DYYQILGIPK.....
DNAJ_RHILE/5-67-----------------------------------------------------------------DFYETLGVAK.....
DNAJ_VIBCH/5-67-----------------------------------------------------------------DFYEVLGVGR.....
DNJB3_MOUSE/3-66-----------------------------------------------------------------DYYEVLGVPR.....
O42051_POVJC/12-72-----------------------------------------------------------------ELMDLLGLDRS....
O43978_BABBO/14-72-----------------------------------------------------------------KFYKVLGLSR.....
O45502_CAEEL/6-65-----------------------------------------------------------------GYYDVLGVKP.....
O48828_ARATH/68-132-----------------------------------------------------------------SLYEILEIPV.....
O49288_ARATH/6-67-----------------------------------------------------------------VYYDVLGVTP.....
O49457_ARATH/4-67-----------------------------------------------------------------DYYKVLQVDR.....
O49475_ARATH/66-127-----------------------------------------------------------------DWYRVLGVDP.....
O49476_ARATH/55-115-----------------------------------------------------------------DWYGILGIDP.....
O49477_ARATH/56-117-----------------------------------------------------------------DWYGILGVDP.....
O49559_ARATH/81-165-----------------------------------------------------------------EPFGILGLEP.....
O51599_BORBU/4-66-----------------------------------------------------------------DYYNILGIQK.....
HSCB_BUCAP/2-71-----------------------------------------------------------------DYFALFNLPKK....
DNAJ2_STRAL/4-65-----------------------------------------------------------------DYYAVLGVRR.....
YHXB_SCHPO/9-72-----------------------------------------------------------------DYYDILNISV.....
DNJA2_HUMAN/8-67-----------------------------------------------------------------KLYDILGVPP.....
O61582_DROHE/8-75-----------------------------------------------------------------DYYKILGVSR.....
O62360_CAEEL/28-91-----------------------------------------------------------------CHYEVLEVER.....
O64546_ARATH/294-358-----------------------------------------------------------------NHYEALGVPRH....
DNAJ2_AQUAE/8-69-----------------------------------------------------------------DYYEILGVPR.....
DNAJ1_AQUAE/7-68-----------------------------------------------------------------DYYEILGVNR.....
HSCB_AZOVI/3-72-----------------------------------------------------------------SHFALFDLEPD....
SPF31_SCHPO/31-93-----------------------------------------------------------------NAYDVLDILP.....
MAS5_SCHPO/6-65-----------------------------------------------------------------KLYEVLNVDV.....
DNJB6_HUMAN/3-66-----------------------------------------------------------------DYYEVLGVQR.....
DNJC8_HUMAN/57-120-----------------------------------------------------------------NPFEVLQIDP.....
DNJB5_HUMAN/4-65-----------------------------------------------------------------DYYKILGIPS.....
O76224_9TRYP/4-67-----------------------------------------------------------------DYYKVLGVSR.....
O77048_PLAFA/35-94-----------------------------------------------------------------DYYKRLGVKR.....
O80481_ARATH/70-132-----------------------------------------------------------------THYDILRISN.....
DNJ72_ARATH/3-70-----------------------------------------------------------------DHYQVLGVTR.....
O80799_ARATH/315-376-----------------------------------------------------------------SPYDVLGVNH.....
O82287_ARATH/71-132-----------------------------------------------------------------EWYKVLKVEP.....
O82623_ARATH/11-76-----------------------------------------------------------------TYYEILSVKE.....
O83136_TREPA/8-70-----------------------------------------------------------------DHYAILGVAA.....
O83815_TREPA/22-91-----------------------------------------------------------------DYYRVLGVSH.....
DNAJ_CHLTR/2-64-----------------------------------------------------------------DYYTILGVAK.....
DNAJ_CAMJE/4-66-----------------------------------------------------------------SYYEILEITQ.....
DNAJ_VIBHA/5-67-----------------------------------------------------------------DFYEVLGVSR.....
DNAJ_LACSK/6-67-----------------------------------------------------------------DYYDVLGVGR.....
MU184_SCHPO/12-75-----------------------------------------------------------------DYYAILKLQK.....
XDJ1_SCHPO/6-70-----------------------------------------------------------------KLYDILEVHF.....
O96122_PLAF7/500-562-----------------------------------------------------------------TYYDILNVYP.....
O96212_PLAF7/4-69-----------------------------------------------------------------DYYSILGVSR.....
O96277_PLAF7/195-257-----------------------------------------------------------------TYYDILNINA.....
O96455_DICDI/5-66-----------------------------------------------------------------KFYDILGVAR.....
O97016_LEIMA/86-147-----------------------------------------------------------------DLYSVLGVAR.....
O97211_LEIMA/9-69-----------------------------------------------------------------ELYQVLELDA.....
DNAJ_ECOLI/5-67-----------------------------------------------------------------DYYEILGVSK.....
HSCB_ECOLI/2-71-----------------------------------------------------------------DYFTLFGLPAR....
RESA_PLAFF/523-584-----------------------------------------------------------------LYYDILGVGV.....
SEC63_YEAST/125-193-----------------------------------------------------------------DPYEILGIST.....
DNAJ_CAUCR/3-65-----------------------------------------------------------------DYYEILGVTR.....
SIS1_YEAST/6-65-----------------------------------------------------------------KLYDLLGVSP.....
SCJ1_YEAST/23-85-----------------------------------------------------------------DYYAILEIDK.....
MAS5_YEAST/6-67-----------------------------------------------------------------KFYDILGVPV.....
DNJB1_HUMAN/4-65-----------------------------------------------------------------DYYQTLGLAR.....
DNJB2_HUMAN/3-66-----------------------------------------------------------------SYYEILDVPR.....
DNAJ_BORBU/4-66-----------------------------------------------------------------DYYEILGLSK.....
DNAJ_CLOAB/5-67-----------------------------------------------------------------DYYEVLGLEK.....
DNJA1_HUMAN/6-65-----------------------------------------------------------------TYYDVLGVKP.....
ZUO1_YEAST/97-165-----------------------------------------------------------------DLYAAMGLSKL....
MDJ1_YEAST/61-122-----------------------------------------------------------------DPYDTLGLKK.....
DNAJ_LACLA/5-66-----------------------------------------------------------------EYYERLGVDK.....
DNAJ_METMA/6-67-----------------------------------------------------------------DYYEILGLSK.....
CBPA_ECOLI/5-66-----------------------------------------------------------------DYYAIMGVKP.....
CAJ1_YEAST/6-68-----------------------------------------------------------------EYYDILGIKP.....
XDJ1_YEAST/9-74-----------------------------------------------------------------RLYDVLGVTR.....
DNAJ1_STRCO/10-72-----------------------------------------------------------------DYYKVLGVPK.....
JEM1_YEAST/538-605-----------------------------------------------------------------DYYKILGVSP.....
DJP1_YEAST/6-68-----------------------------------------------------------------EYYDLLGVST.....
DNAJ_COXBU/5-67-----------------------------------------------------------------DYYEVLGVNL.....
DNJH2_ALLPO/13-71-----------------------------------------------------------------KYYEVLGVSK.....
MDJ2_YEAST/85-143-----------------------------------------------------------------EALLILDISARE...
ERJ5_YEAST/44-105-----------------------------------------------------------------NFYKFLKLPKL....
DNAJ_STAAU/5-66-----------------------------------------------------------------DYYEVLGISK.....
DPH4_YEAST/8-73-----------------------------------------------------------------THYEILRIPS.....
DNAJL_MYCGE/2-61-----------------------------------------------------------------NLYDLLELPT.....
DNAJ_MYCGE/7-74-----------------------------------------------------------------DYYEVLGISK.....
DNAJM_MYCGE/7-68-----------------------------------------------------------------DYYEVLGITP.....
DNAJ_FRATU/5-67-----------------------------------------------------------------CYYEILNISK.....
DNAJ_HAEDU/5-67-----------------------------------------------------------------DYYEVLGLQK.....
HLJ1_YEAST/21-82-----------------------------------------------------------------EFYEILKVDR.....
DNAJ_LEGPN/5-67-----------------------------------------------------------------DYYELLEVSR.....
DNAJ_SYNE7/6-68-----------------------------------------------------------------DYYALLGIPQ.....
DNAJH_SYNY3/8-70-----------------------------------------------------------------DYYQILGVTK.....
CWC23_YEAST/15-84-----------------------------------------------------------------NLYDVLELPTPLD..
JAC1_YEAST/13-79-----------------------------------------------------------------TFYELFPKTFPKK..
JJJ1_YEAST/4-67-----------------------------------------------------------------CYYELLGVET.....
APJ1_YEAST/6-68-----------------------------------------------------------------SLYDSLNVTA.....
DNJC5_RAT/15-77-----------------------------------------------------------------SLYHVLGLDK.....
DNAJ_LEPIN/5-67-----------------------------------------------------------------SYYDILGVSK.....
DNAJ2_MYCTU/4-65-----------------------------------------------------------------DYYGLLGVSK.....
P72803_SYNY3/24-87-----------------------------------------------------------------SYYGVLELHP.....
P73013_SYNY3/14-81-----------------------------------------------------------------HYYEILGLEV.....
DNAJ2_SYNY3/6-68-----------------------------------------------------------------NYYQILGVPR.....
P74157_SYNY3/17-85-----------------------------------------------------------------DHHAILGCPL.....
P74322_SYNY3/70-135-----------------------------------------------------------------EYMDYLESSR.....
DJLB_ECOLI/3-56-----------------------------------------------------------------NCWKILDIEE.....
DNAJ_AGGAC/5-67-----------------------------------------------------------------DYYELLGISR.....
MDJ1_SCHPO/86-147-----------------------------------------------------------------DPYKTLGVSK.....
P91014_CAEEL/28-89-----------------------------------------------------------------THYEVLGVES.....
P91189_CAEEL/379-444-----------------------------------------------------------------DYYKILGVKR.....
DNJ60_DROME/26-90-----------------------------------------------------------------THYEVLNIRN.....
P92424_PEA/71-132-----------------------------------------------------------------DYYATLGVPK.....
P93499_PHAVU/67-131-----------------------------------------------------------------SLYDILGIPA.....
DNAJ_BRAJA/8-70-----------------------------------------------------------------CYYETLEVER.....
DNAJ1_MYCLE/10-71-----------------------------------------------------------------DFYKELGVSS.....
CSP_DROME/17-79-----------------------------------------------------------------SLYEILGLPK.....
Q04187_MOUSE/12-72-----------------------------------------------------------------RLLELLKLPRQ....
DNAJ_ERYRH/6-67-----------------------------------------------------------------DFYEILGVSK.....
DNAJ_BRUO2/4-66-----------------------------------------------------------------DYYEALGVTR.....
Q06166_PLAFA/1564-1627-----------------------------------------------------------------EFHNILSIHE.....
DNJ5_CAEEL/660-721-----------------------------------------------------------------DAYSVFGLRS.....
PSI1_SCHPO/6-65-----------------------------------------------------------------KLYDCLEVRP.....
YAY1_SCHPO/8-71-----------------------------------------------------------------EYYDLLGIST.....
YD1J_SCHPO/32-107-----------------------------------------------------------------TPYEILELPR.....
JID1_YEAST/58-147-----------------------------------------------------------------TPYDIFGIPKAGS..
DNJC3_HUMAN/394-459-----------------------------------------------------------------DYYKILGVKR.....
DNJ2_CAEEL/36-102-----------------------------------------------------------------NCYDVLEVNR.....
Q17438_CAEEL/137-198-----------------------------------------------------------------DYYEILKIDK.....
Q20774_CAEEL/4-65-----------------------------------------------------------------DYYKVLGISK.....
Q21162_CAEEL/38-101-----------------------------------------------------------------HLYNVLGIQK.....
Q22028_CAEEL/17-79-----------------------------------------------------------------DFYQLLGVEK.....
Q22138_CAEEL/24-87-----------------------------------------------------------------DHYKVLGLAQ.....
Q22751_CAEEL/14-80-----------------------------------------------------------------CLYELLGVKK.....
DNAJ1_DROME/4-65-----------------------------------------------------------------DFYKILGLER.....
TID_DROVI/80-142-----------------------------------------------------------------DYYATLGVAK.....
Q26951_TRYCR/13-72-----------------------------------------------------------------ALYDVLGVPR.....
Q26952_TRYCR/6-67-----------------------------------------------------------------KFYDSLGVSP.....
Q26953_TRYCR/6-68-----------------------------------------------------------------EYYEILGLEA.....
Q26954_TRYCR/6-68-----------------------------------------------------------------SLYDELGILP.....
DNAJ1_ARATH/48-110-----------------------------------------------------------------NYYDVLGVSP.....
DNJ13_ARATH/15-80-----------------------------------------------------------------ELYALLNLSP.....
Q40868_PICGL/4-70-----------------------------------------------------------------TFYSILGVNK.....
DNAJ_GEOSE/5-66-----------------------------------------------------------------DYYEILGVSK.....
Q49541_MYCHY/5-72-----------------------------------------------------------------DFYKILGVEK.....
DNAJL_MYCPN/2-61-----------------------------------------------------------------TLYDLLELPQ.....
DNAJ_RHOCA/5-67-----------------------------------------------------------------DFYEVLGVSK.....
DNAJ1_SYNY3/4-65-----------------------------------------------------------------DYYQTLGVTR.....
Q55559_SYNY3/6-67-----------------------------------------------------------------DFYRILGIPP.....
DNAJ2_THET8/6-67-----------------------------------------------------------------DYYAILGVPR.....
HSCB_HAEIN/3-72-----------------------------------------------------------------NPFQIFDLPVD....
DNJC1_MOUSE/61-122-----------------------------------------------------------------NFYEFLGVQQ.....
DNJ39_ARATH/23-85-----------------------------------------------------------------NPYEVLGIPS.....
DNJ10_ARATH/6-68-----------------------------------------------------------------EYYDVLGVSP.....
Q8SZX1_DROME/100-161-----------------------------------------------------------------YYYKVLGVNR.....
DNJ16_ARATH/20-82-----------------------------------------------------------------DPYEVLGVLR.....
Q90180_9POLY/12-71-----------------------------------------------------------------ELMDLLQITRA....
Q94216_CAEEL/98-167-----------------------------------------------------------------DHYKVLGLSKL....
Q98184_MCV1/2-61-----------------------------------------------------------------DPHEVLGLPA.....
DNJC4_MOUSE/37-99-----------------------------------------------------------------NYYELLGVHP.....
DNAJ6_ARATH/29-91-----------------------------------------------------------------SLYEVLGVER.....
DNAJ_HALSA/4-65-----------------------------------------------------------------DFYDVLGVSR.....
DNJC7_MOUSE/381-448-----------------------------------------------------------------DYYKILGVDK.....
DNJB9_MOUSE/26-87-----------------------------------------------------------------SYYDILGVPK.....
Q9QZW8_RAT/3-66-----------------------------------------------------------------NYYKVLGVPQ.....
DJC12_MOUSE/14-76-----------------------------------------------------------------DYYALLGCDE.....
DNAJ_DEIRA/2-63-----------------------------------------------------------------DYYELLGVSR.....
Q9S729_VOLCA/114-186-----------------------------------------------------------------DPYSLLGLANE....
Q9S7L6_ARATH/66-127-----------------------------------------------------------------DYYAVLGLKP.....
DNJ20_ARATH/66-130-----------------------------------------------------------------SFYDLLGVTE.....
Q9SH08_ARATH/76-144-----------------------------------------------------------------SPYDTLELDR.....
Q9SJI1_ARATH/76-138-----------------------------------------------------------------DYYAVLGLLP.....
Q9SJS8_ARATH/6-68-----------------------------------------------------------------EYYEILGVKT.....
Q9SJZ7_ARATH/86-147-----------------------------------------------------------------DYYSVLGVSK.....
Q9SLA7_ARATH/66-127-----------------------------------------------------------------DHYGVLGLNP.....
Q9SMS0_ARATH/106-169-----------------------------------------------------------------SHYQFLGVST.....
Q9SQT7_ARATH/67-128-----------------------------------------------------------------DWYGILQVEQ.....
Q9SR96_ARATH/27-88-----------------------------------------------------------------DPYKVLGVSK.....
Q9SSD9_ARATH/99-178-----------------------------------------------------------------DPFSILGLEP.....
Q9SSJ9_ARATH/8-74-----------------------------------------------------------------TYYEILGVAV.....
Q9ST16_BRACM/135-199-----------------------------------------------------------------NHYEALGFPRH....
Q9SU57_ARATH/4-68-----------------------------------------------------------------DYYNILKVNH.....
Q9SWW3_9EUGL/11-70-----------------------------------------------------------------CHYTTLGIAK.....
Q9SYB3_ARATH/34-95-----------------------------------------------------------------DCYALLGVAQ.....
Q9SZU8_ARATH/56-120-----------------------------------------------------------------NAYDILNVSE.....
JDP_DROME/17-79-----------------------------------------------------------------DFYGLLHCDE.....
Q9U062_GIAIN/6-65-----------------------------------------------------------------EFYDLLGVSP.....
Q9U1V9_CAEEL/107-165-----------------------------------------------------------------DPYQILGLDQ.....
Q9U2L4_CAEEL/27-88-----------------------------------------------------------------DFYKILNVDK.....
Q9U4X8_9BILA/24-83-----------------------------------------------------------------KLYDILGVKP.....
JDP_BOMMO/17-79-----------------------------------------------------------------DYYALLGCDE.....
DJB11_HUMAN/25-87-----------------------------------------------------------------DFYKILGVPR.....
DNJB4_HUMAN/4-65-----------------------------------------------------------------DYYCILGIEK.....
SEC63_HUMAN/104-162-----------------------------------------------------------------NPYEVLNLDP.....
TIM14_SCHPO/51-110-----------------------------------------------------------------EAIQILSLNN.....
JAC1_SCHPO/61-134-----------------------------------------------------------------NFYKQFEGDISDPPP
YL39_SCHPO/31-96-----------------------------------------------------------------DPYSVLGVEK.....
DPH4_SCHPO/2-66-----------------------------------------------------------------NHYSVLNLKDG....
Q9VCH9_DROME/54-117-----------------------------------------------------------------NPFEVLQIEP.....
Q9VFP0_DROME/106-167-----------------------------------------------------------------DYYEVLGVSK.....
Q9VFY1_DROME/37-98-----------------------------------------------------------------NHYQVLNVPV.....
Q9VGR0_DROME/10-72-----------------------------------------------------------------NLYDLLGISL.....
Y6693_DROME/15-79-----------------------------------------------------------------DVYKLMELAR.....
Q9VHW5_DROME/27-89-----------------------------------------------------------------SHYDALGIRR.....
Q9VK35_DROME/5-64-----------------------------------------------------------------NLYDVLKVAP.....
Q9VM54_DROME/30-89-----------------------------------------------------------------ECFRILGVHE.....
Q9VN28_DROME/708-769-----------------------------------------------------------------DAYSILGVPP.....
Q9VNE8_DROME/3-72-----------------------------------------------------------------DFYELLNVPS.....
Q9VNW0_DROME/4-65-----------------------------------------------------------------DYYKILGIER.....
Q9VNW1_DROME/7-66-----------------------------------------------------------------DHYQVLGLPR.....
Q9VP77_DROME/76-145-----------------------------------------------------------------DHYAVLGLGKL....
Q9VPQ2_DROME/25-87-----------------------------------------------------------------DFYKILNVKK.....
Q9VPY9_DROME/4-65-----------------------------------------------------------------DYYKILGLPK.....
Q9VS57_DROME/105-164-----------------------------------------------------------------DPFEILNVPP.....
Q9VWL4_DROME/40-101-----------------------------------------------------------------NFYEFMGINQ.....
Q9VX95_DROME/329-395-----------------------------------------------------------------NSYKVLGVSA.....
DJC25_DROME/31-96-----------------------------------------------------------------NCYDVLGVTR.....
Q9W083_DROME/7-87-----------------------------------------------------------------DYYAVLDQPR.....
Q9W0X8_DROME/3-66-----------------------------------------------------------------CYYEELELQR.....
Q9W2U5_DROME/4-65-----------------------------------------------------------------DYYKILGIQR.....
Q9WG03_BFPYV/6-63-----------------------------------------------------------------RLTELLGLPV.....
DNAJ_THEMA/7-70-----------------------------------------------------------------DYYEILGVPR.....
Q9X2C3_THEMA/2-64-----------------------------------------------------------------NPYEVLGVPP.....
DNAJ_PORGI/6-68-----------------------------------------------------------------DYYEVLGVSK.....
Q9XCB2_RHOMR/7-69-----------------------------------------------------------------DYYEILGVPE.....
Q9XEM8_ORYSI/285-347-----------------------------------------------------------------AYYDTLGVSV.....
Q9XWE1_CAEEL/20-82-----------------------------------------------------------------DYYELLGVER.....
YOI1_SCHPO/97-164-----------------------------------------------------------------DHYAVLGLSKY....
YCJ3_SCHPO/8-72-----------------------------------------------------------------ELYLALGLPK.....
YCJD_SCHPO/4-68-----------------------------------------------------------------DYYAILNITP.....
DNAJ_RICPR/4-65-----------------------------------------------------------------DYYQVLGVSK.....
Q9ZEJ5_9NOST/9-71-----------------------------------------------------------------DYYEILGVTK.....
Q9ZEK0_ANAVA/8-71-----------------------------------------------------------------TYYSLLGLHP.....
DNAJ_METSS/5-67-----------------------------------------------------------------DYYEVLGVNR.....
Q9ZFQ3_PSEAI/5-74-----------------------------------------------------------------CHFALFDLQPG....
DNJ15_ARATH/17-79-----------------------------------------------------------------DPYEVLCVSK.....
Q9ZU99_ARATH/71-136-----------------------------------------------------------------NWYKILQIEDLT...

PF03656

TIM16_HUMAN/1-125-....LSPEEVQKNYEHLFKVNDKSVGGSFY----------------LQSKVVRAKERLDEEL.KIQAQEDREKGQMPHT
TIM16_YEAST/1-128-SKGDLNMDKINNRFNYLFEVNDKEKGGSFY----------------LQSKVYRAAERLKWEL.AQREKNAKAKAGDAST
TIM16_CAEEL/1-135-...PLNREEVEKHYEHLFNINDKSKGGTLY----------------LQSKVFRAKERIDEEFGRIELKEEKKKEENAKT

PF00226

DNAJ_DEIPM/5-67....SASDSDIKSAYRKLAKQYHPDKNAGDE......................SAAEKFKEIGEAYAVLSDPQK.RQAYD
DJB12_MOUSE/111-172....SASDEDLKKAYRKLALKFHPDKNHAPG.......................ATEAFKAIGTAYAVLSNPEK.RKQYD
DJC13_HUMAN/1301-1362..QGPHDESKIRKAYFRLAQKYHPDKNPEGR.........................DMFEKVNKAYEFLCTKSA..KIVD
DNJA3_HUMAN/93-155....NASQKEIKKAYYQLAKKYHPDTNKDDP......................KAKEKFSQLAEAYEVLSDEVK.RKQYD
O96123_PLAF7/88-153....DCTNEDIKKAYKKLAMKWHPDKHLNAA........S.K..........KEADNMFKSISEAYEVLSDEEK.RDIYD
O96276_PLAF7/660-722....DASFDEIKHSYRKLALQYHPDKNINDP......................EANEKFQKINEAYQVLSDENR.RKMYD
P91243_CAEEL/26-91....DATDDEIIKAYRKRCLMFHPDRFVDND........E.K..........KDAERVFVKLRRAHEVLLDPKQ.RAIYD
JJJ2_YEAST/13-74....NATSSEVHKSYLKLARLLHPDKTKSDK.......................SEELFKAVVHAHSILTDEDQ.KLRYD
LT_POVBO/10-68....IGNADTLKKAFLKACKVHHPDK.GGNE.........................EAMKRLLYLYNKAKIAAS.ATTSQ
O04648_ARATH/66-127....FADDATIKKQVRKLALLLHPDKNQFPG.......................AEAAFKLVWDASRFLADKDK.RSQYD
DNAJ_NITEU/5-67....DADENELKKAYRKLAMKYHPDRNAGDT......................KAEERFKNIKEAYEILSDPNK.RAAYD
O13303_CRYCU/6-70....DASEADIKKAYRKESLKWHPDKNPGDK..........R..........ATAEEKFKKVGEAYEVLSDPEK.RKIYD
RSP1_SCHPO/12-75....TSSYVEIRQQYLKLVLRYHPDRNPGRE.....................AEVLPQFQLIQKAHEVLKDPKL.RELFD
YNF5_SCHPO/113-174....TCTDTEIKKSYKKLALQLHPDKNHAPS.......................ADEAFKMVSKAFQVLSDPNL.RAHYD
MU185_SCHPO/9-71....DSDLQEIKANYRKLALQYHPDRNPGIE......................DYNEIFSQINAAYNILSNDDK.RKWHE
O15811_PLAFA/61-122....NATTNDIKKQFRLLAKKYHPDINPSPD.......................AKQKMASITAAYELLSDPKK.KEFYD
O16303_CAEEL/13-72....DASQADIKKSYFKLAKEYHPDKNPDHG.........................DKFKEISFAYEVLSSPEK.RRLYD
O17002_CAEEL/8-71....GCTDKEIQKAYRAQCLKWHPDKNLDNK.....................EEAERRFIEAKEAFDFLYDKEK.REEYD
O18427_GEOCY/5-64....GASFSDIRKAHHRLARQYHPDREGGND.........................EKFKEVQTAYEILSDSEK.REMYD
O22214_ARATH/873-953....SDSAADIKKAYRKAALRHHPDKAAQILVRSESEGPW.LKEIL..EEVHKGADRLFKMIGEAYSVLSDPTK..VWFL
O22266_ARATH/374-434....GCTRSELDRAHLLLCLRYKPDRASSFI........E.R..........C...E.FTDQNDVDSV.RDRAK.MSSLL
O24074_MEDSA/14-72....SASEDEIKKAYRKAAMKNHPDK.GGDP.........................EKFKELGQAYEVLSDPEK.KELYD
O25668_HELPY/4-65....NASQDEIKKSYRRLARQYHPDLNKTKE.......................AEEKFKEINAAYEILSDEEK.RRQYD
DNAJ_HELPY/4-66....HSNQETIKKSYRKLALKYHPDRNAGDK......................EAEEKFKLINEAYGVLSDEKK.RALYD
DNAJ_METTH/5-66....GADKKEIKKAYRRLARKYHPDV.SDDP......................DAAEKFKEISEAYAVLSDDEK.RARYD
DNAJ_BUCAI/5-67....SAEEREIKKAYKKLAMKYHPDRNQGDK......................TAEGKFKEIKEAYEILINEEK.RSAYD
DNAJ_RHILE/5-67....SADEKELKSAFRKLAMKFHPDKNPDDK......................DAERKFKEINEAYEMLKDPQK.RAAYD
DNAJ_VIBCH/5-67....DASERDIKKAYKRLAMKYHPDRNSGDA......................GAAEKFKEVKEAYEILTDAQK.KAAYD
DNJB3_MOUSE/3-66....QASAEAIRKAYRKLALKWHPDKNPEHK.....................EEAERRFKQVAQAYEVLSDVRK.REVYD
O42051_POVJC/12-72...AWGNIPVMRKAYLKKCKELHPDK.GGDE.........................DKMKRMNFLYKKMEQGVK.VAHQP
O43978_BABBO/14-72....DCSESEIKKAYRKLAIKHHPDK.GGDS.........................EMFKEITRAYEVLSDPEK.RRIYD
O45502_CAEEL/6-65....DASDNELKKAYRKMALKFHPDKNPDGA.........................EQFKQISQAYEVLSDEKK.RQIYD
O48828_ARATH/68-132....GSTSQEIKSAYRRLARICHPDVARNSR........D.N..........S.SADDFMKIHAAYCTLSDPEK.RAVYD
O49288_ARATH/6-67....SASEEEIRKAYYIKARQVHPDKNQGDP......................LAAEK.QVLGEAYQVLSDPVH.REAYD
O49457_ARATH/4-67....SANDDDLKKAYRKLAMKWHPDKNPNNK.....................KDAEAKFKQISEAYDVLSDPQK.RAVYD
O49475_ARATH/66-127....LADDEAVKKRYRKLALLLHPDKNRFTG.......................AEGAFKLILEAWDLLSDKSQ.RSSYD
O49476_ARATH/55-115....LADEEAVKKQYKKLALLLHPDKNRFNG.......................AEGAFKLVRHARDLLSDQPC..LIYN
O49477_ARATH/56-117....LADEEVVKKQYKRLALLLHPDKNNCEG.......................AEGAFKLVLAAWCLLSDKVK.RIAYD
O49559_ARATH/81-165....GASDSEIKKAYRRLSIQYHPDKNPDPGRNASWSSSLIIYCLFVYCNGTEANKYFVESIAKAYQALTDPLS.RENFE
O51599_BORBU/4-66....NASNEEIKKAYKKLAIKYHPDKNKGNK......................IAEEKFKEINEAYEILSSPDK.KRNYD
HSCB_BUCAP/2-71...YIIDKFLLSKNFYKLQLKFHPDLFIHHSE.......S.K.........KRIVLQKSIEINKGYKILQDSLN.RAIHL
DNAJ2_STRAL/4-65....DASQDEIKKAFRRLARELHPDVNPDPK.......................TQERFKEINAAYEVLSDPQK.KQVYD
YHXB_SCHPO/9-72....DADGDTIKKSYRRLAILYHPDKNRENP.....................EAAREKFQKLAEAYQVLSDPKL.REKYD
DNJA2_HUMAN/8-67....GASENELKKAYRKLAKEYHPDKNPNAG.........................DKFKEISFAYEVLSNPEK.RELYD
O61582_DROHE/8-75....RATEDEVKKAYRKKAMVHHPDRHTSSSA.......E.V.........RKDEELKFKEVGEAYAILSDAQK.KSRYD
O62360_CAEEL/28-91....DADDDKIKKNYRKLALKWHPDKNPDRI.....................EECTQQFRLLQAAYDVLSDPRE.REFYD
O64546_ARATH/294-358...KKIDAAVLKKEYRKKAMLVHPDKNMGSP......................LASESFKKLQSAYEVVELLII.LNLYI
DNAJ2_AQUAE/8-69....NASQEEIKKAYRRLVRKYHPDICKKPE.......................CEEKFKEINEAYQVLSDPEK.RKLYD
DNAJ1_AQUAE/7-68....DATKEEIKKAYRKLVRIYHPDINPDPS.......................AQEKFKEINEAYHVLIDDER.RSEYD
HSCB_AZOVI/3-72...FRLDQDRLAVRYRELVRRVHPDRFAGAPE.......R.E.........QRLALEEAARLNEAYQTLKSPSQ.RARYL
SPF31_SCHPO/31-93....GMSVDDIRNLYRKKSLMIHPDKNRDNP......................KAADAFDILKKAESDLVNDKI.RESLD
MAS5_SCHPO/6-65....TASQAELKKAYRKLALKYHPDKNPNAG.........................DKFKEISRAYEILADEEK.RATYD
DNJB6_HUMAN/3-66....HASPEDIKKAYRKLALKWHPDKNPENK.....................EEAERKFKQVAEAYEVLSDAKK.RDIYD
DNJC8_HUMAN/57-120....EVTDEEIKKRFRQLSILVHPDKNQDDA.....................DRAQKAFEAVDKAYKLLLDQEQ.KKRAL
DNJB5_HUMAN/4-65....GANEDEIKKAYRKMALKYHPDKNKEPN.......................AEEKFKEIAEAYDVLSDPKK.RGLYD
O76224_9TRYP/4-67....DASPSDIKKAYHQLALKYHPDKASGNR.....................EEAERLFKEVAEAYDVLSDEKK.KKIYD
O77048_PLAFA/35-94....NATKEDISKAYRQLAKEYHPDIAPDKE.........................KDFIEIANAYETLSDPEK.RKMYD
O80481_ARATH/70-132...PFCSHQMIQRKYRDILVKLYPDTNKSIA.......................AKSAFEIINYAWKILSDPEK.RKDYN
DNJ72_ARATH/3-70....NATKKEVKDAFRRLAIKYHPDKHAQSPE.......H.V.........RHNATVRFKLVSEAYEVLNDDLK.RASYN
O80799_ARATH/315-376....NMAADNMKKRYWKLSLLVHPDKCSHPQ.......................AQEAFVLLNKAFKELQDPEK.RKAMD
O82287_ARATH/71-132....FSHINTIKQQYRKLALVLHPDKNPYVG.......................CEEGFKLLNEAFRVFSDKGE.MVSGG
O82623_ARATH/11-76....DASYEEIRNSYRSAILHSHPDKLNNTS........R.S..........SSDDEKFLKIQKAWEVLSDAEL.RVVYD
O83136_TREPA/8-70....DASEEHIKKAFRAQALKYHPDKNPGDA......................CAEDQFKRINAAYAVLSDRAS.RARYD
O83815_TREPA/22-91....RASTPEIKCAFRKKAKALHPDLVSHTAEL.....EC.EA.......VAR..ERALRRILTAYEVLSDPGR.RAKFD
DNAJ_CHLTR/2-64....TATPEEIKKAYRKLAVKYHPDKNPGDA......................EAERRFKEVSEAYEVLGDAQK.RESYD
DNAJ_CAMJE/4-66....NADKETIKKAYRKMALKYHPDRNQGDK......................EAEDKFKLVNEAYEVLSNDEK.RAIYD
DNAJ_VIBHA/5-67....DASERDIKKAYKRLAMKYHPDRNQGDE......................SAADKFKEVKESYEILTDPQK.KAAYD
DNAJ_LACSK/6-67....DASDDEIKKAYRKLSKKYHPDINKAPD.......................AEAKFKEVTEAYEALSDPQK.RAAYD
MU184_SCHPO/12-75....NATFQQIRKQYLFLALQYHPDRNPGDE.....................ERAVKRFQRLQLAHEVLSDATK.RLIYD
XDJ1_SCHPO/6-70....EASAEEIKKSYKRLALLHHPDKAPIHE..........K..........EEAAERFRGVQEAYDILKDPES.REMYD
O96122_PLAF7/500-562....TSELSEIKSNYYNLALKYNPESNLGNA......................EALTKFRDINEAYQILSLDQR.RMNYN
O96212_PLAF7/4-69....DCTTNDLKKAYRKLAMMWHPDKHNDEK........S.K..........KEAEEKFKNIAEAYDVLADEEK.RKIYD
O96277_PLAF7/195-257....NSKLEEIKEKYYEVASKYHPEKNIGND......................KAFKKFELINSAYQILSNEEL.RRKYN
O96455_DICDI/5-66....DASETDIKKAYRKLAIKYHPDKNPDPA.......................AVEKFKELTVAYEVLSDTEK.RELYD
O97016_LEIMA/86-147....NSTPEQIKSAYKKRAKALHPDVNPSPT.......................AAEDFAEAKQAYETLSDPQK.RSMYD
O97211_LEIMA/9-69....QCTTAEISQQYRRLALRYHPDRNAGAT........................VEQFQRIEEAHRVLSDLRQ.RQLYD
DNAJ_ECOLI/5-67....TAEEREIRKAYKRLAMKYHPDRNQGDK......................EAEAKFKEIKEAYEVLTDSQK.RAAYD
HSCB_ECOLI/2-71...YQLDTQALSLRFQDLQRQYHPDKFASGSQ.......A.E.........QLAAVQQSATINQAWQTLRHPLM.RAEYL
RESA_PLAFF/523-584....NADMNEITERYFKLAENYYPYQRSGST.......................VFHNFRKVNEAYQVLGDIDK.KRWYN
SEC63_YEAST/125-193....SASDRDIKSAYRKLSVKFHPDKLAKGLT.......P.DE........KSVMEETYVQITKAYESLTDELV.RQNYL
DNAJ_CAUCR/3-65....TIDEAGLKSAFRKLAMEHHPDRNGGCE......................NAAGRFKEINEAYSVLSDPQK.RAAYD
SIS1_YEAST/6-65....SANEQELKKGYRKAALKYHPDK.PTGD........................TEKFKEISEAFEILNDPQK.REIYD
SCJ1_YEAST/23-85....DATEKEIKSAYRQLSKKYHPDKNAGSE......................EAHQKFIEVGEAYDVLSDPEK.KKIYD
MAS5_YEAST/6-67....TATDVEIKKAYRKCALKYHPDKNPSEE.......................AAEKFKEASAAYEILSDPEK.RDIYD
DNJB1_HUMAN/4-65....GASDEEIKRAYRRQALRYHPDKNKEPG.......................AEEKFKEIAEAYDVLSDPRK.REIFD
DNJB2_HUMAN/3-66....SASADDIKKAYRRKALQWHPDKNPDNK.....................EFAEKKFKEVAEAYEVLSDKHK.REIYD
DNAJ_BORBU/4-66....GASKDEIKKAYRKIAIKYHPDRNQGNE......................EAASIFKEATQAYEILIDDNK.KAKYD
DNAJ_CLOAB/5-67....GASDDEIKKAFRKLAIKYHPDKNRGNK......................EAEEKFKEINEAYQVLSDPDK.KANYD
DNJA1_HUMAN/6-65....NATQEELKKAYRKLALKYHPDKNPNEG.........................EKFKQISQAYEVLSDAKK.RELYD
ZUO1_YEAST/97-165..RFRATESQIIKAHRKQVVKYHPDKQSAAG........G.S..........LDQDGFFKIIQKAFETLTDSNK.RAQYD
MDJ1_YEAST/61-122....SATGAEIKKAYYKLAKKYHPDINKEPD.......................AEKKFHDLQNAYEILSDETK.RQQYD
DNAJ_LACLA/5-66....NASQDEIKKAYRKMSKKYHPDLNKEEG.......................AEEKYKEVQEAYETLSDEQK.RAAYD
DNAJ_METMA/6-67....DSSVEDIKKTYRKLALQYHPDRNKEPG.......................AEEKFKEISEAYAVLSDAEK.RAQYD
CBPA_ECOLI/5-66....TDDLKTIKTAYRRLARKYHPDVSKEPD.......................AEARFKEVAEAWEVLSDEQR.RAEYD
CAJ1_YEAST/6-68....EATPTEIKKAYRRKAMETHPDKHPDDP......................DAQAKFQAVGEAYQVLSDPGL.RSKYD
XDJ1_YEAST/9-74....DATVQEIKTAYRKLALKHHPDKYVDQD........S.K..........EVNEIKFKEITAAYEILSDPEK.KSHYD
DNAJ1_STRCO/10-72....DATEAEIKKAYRKLARENHPDANKGNV......................KAEERFKEISEANDILGDPKK.RKEYD
JEM1_YEAST/538-605....SASSKEIRKAYLNLTKKYHPDKIKANHN.......D.K.........QESIHETMSQINEAYETLSDDDK.RKEYD
DJP1_YEAST/6-68....TASSIEIKKAYRKKSIQEHPDKNPNDP......................TATERFQAISEAYQVLGDDDL.RAKYD
DNAJ_COXBU/5-67....NATEAEVKKAFRRLAMKYHPDRNPGDK......................DAEVKFKEAREAYEVLCDSRK.RASYD
DNJH2_ALLPO/13-71....NATPEDLKKAYRKAAIKNHPDK.GGDP.........................EKFKEIGQAYEVLNDPEK.REIYD
MDJ2_YEAST/85-143..INHLDEKLLKKKHRKAMVRNHPDR.GGSP.........................YMAAKINEAKEVLE.....RSVLL
ERJ5_YEAST/44-105...QNSSTKEITKNLRKLSKKYHPDKN..PK.......................YRKLYERLNLATQILSNSSN.RKIYD
DNAJ_STAAU/5-66....DASKDEIKKAYRKLSKKYHPDINKEEG.......................ADEKFKEISEAYEVLSDDNK.RATID
DPH4_YEAST/8-73....DATQDEIKKAYRNRLLNTHPDKLSKSI........H.D..........TVSNVTINKIQDAYKILSNIKT.RREYD
DNAJL_MYCGE/2-61....TASIKEIKIAYKRLAKRYHPDVNKLGS.........................QTFVEINNAYSILSDPNQ.KEKYD
DNAJ_MYCGE/7-74....NASSQDIKRAFRKLAMQYHPDRHKAENE.......T.T.........QKQNEEKFKEVNEAYEVLSDEEK.RKLYD
DNAJM_MYCGE/7-68....DADQSEIKKAFRKLAKKYHPDRNNAPD.......................AAKIFAEINEANDVLSNPKK.RANYD
DNAJ_FRATU/5-67....TASGVEIKRAYRKLAMKYHPDRNPGDK......................EAEIKFKEISEAYEILSDDSK.RSRYD
DNAJ_HAEDU/5-67....GATEKDIKRAYKRLAAKYHPDKNQGSK......................DSEEKFKQITEAYEILTDDQK.RAAYD
HLJ1_YEAST/21-82....KATDSEIKKAYRKLAIKLHPDKNSHPK.......................AGEAFKVINRAFEVLSNEEK.RSIYD
DNAJ_LEGPN/5-67....NASDAEIKKAYRRLAMKYHPDRNPGDT......................SAEEKFKEIQKAYNILSDKQK.RAAYD
DNAJ_SYNE7/6-68....SADQAAIKAAFRKLARQCHPDLNPGDR......................QAEERFKQISEAYEILSDPDR.RAEYQ
DNAJH_SYNY3/8-70....TASEAEIKKQFRKLALKYHPDKNPGDK......................AAEEKFKEISEAYEVLSDPEK.RQKYD
CWC23_YEAST/15-84VHTIYDDLPQIKRKYRTLALKYHPDKHPDNP........S.I..........I...HKFHLLSTATNILTNADV.RPHYD
JAC1_YEAST/13-79LPIWTIDQSRLRKEYRQLQAQHHPDMAQQGS.........................EQSSTLNQAYHTLKDPLR.RSQYM
JJJ1_YEAST/4-67....HASDLELKKAYRKKALQYHPDKNPDNV.....................EEATQKFAVIRAAYEVLSDPQE.RAWYD
APJ1_YEAST/6-68....AASTSEIKKAYRNAALKYHPDKNNHTE......................ESKRKFQEICQAYEILKDNRL.RALYD
DNJC5_RAT/15-77....NATSDDIKKSYRKLALKYHPDKNPDNP......................EAADKFKEINNAHAILTDATK.RNIYD
DNAJ_LEPIN/5-67....SANDEEIKSAYRKLAIKYHPDKNKGNK......................ESEEKFKEATEAYEILRDPKK.RQAYD
DNAJ2_MYCTU/4-65....NASDADIKRAYRKLARELHPDVNPDEA.......................AQAKFKEISVAYEVLSDPDK.RRIVD
P72803_SYNY3/24-87....AASPVAIRRAYRELSKRYHPDTTLLTP.....................DIATVKFQRLNEAYAVLSNPDR.RSVYD
P73013_SYNY3/14-81....GASLEEINEAYRDLAFVWHPDRLPRDNP.......R.L.........LAKAARKLKEINQARDRLKELLE.LELSA
DNAJ2_SYNY3/6-68....NATAEEIKKSFRKLARQYHPDVNPNDK......................TAEEKFKDINEAYDVLSDETK.RRELD
P74157_SYNY3/17-85....DATPEEIRKSYLKIAFQLHPDTSKATNE.......E.EQ........ALAAKLFSKFVNPAYEVLSREND.RKEHL
P74322_SYNY3/70-135...NFKPSDGLKKLYREVAKRVHPDLATDEV........E.R..........AKRQNLMAAANQAYEE.GDEQR.LREIL
DJLB_ECOLI/3-56....TTDVDIIRRAYLALLPSFHPET...DP.........................QGFKQLRQAYEEALR....IAQSP
DNAJ_AGGAC/5-67....SADEKEIKRAYKKLAMQYHPDRTKGDK......................EKEEKFKEIQEAYEVLNDKEK.RAAYD
MDJ1_SCHPO/86-147....SASASEIKSAYYKLAKQYHPDANPDKA.......................AQDKFVEIKQAYEVLQDPKK.KKAFD
P91014_CAEEL/28-89....TATLSEIKSAFYAQSKKVHPDNSSEES.......................ATASFLELKNAYDVLRRPAD.RRLYD
P91189_CAEEL/379-444....NASKREITKAYRKLAQKWHPDNFSDEE........E.K..........KKAEKKFIDIAAAKEVLQDEEK.RRQFD
DNJ60_DROME/26-90....DCSTREVRNAFVQLSKLYHPDV.KSNA........A.C..........PERTARFVQISEAYKTLIKPER.RRDYD
P92424_PEA/71-132....SATVKDIKAAYRRLARQYHPDVNKEPG.......................ATDKFKEISNAYEVLSDDKK.RALYD
P93499_PHAVU/67-131....GASSQEIKAAYRRLARVCHPDVAAIDR........K.N..........SSADE.FMKIHAAYSTLSDPDK.RANYD
DNAJ_BRAJA/8-70....DADESKLKSSFRKLAMKFHPDRNPGDD......................TSEVKFKEINEAYEVLKDKDK.RAAYD
DNAJ1_MYCLE/10-71....DASPEEIKRAYRKLARYLHPDANPDNS.......................AGERFKVVSEAHNVLSDPVK.RKEYD
CSP_DROME/17-79....TATGDDIKKTYRKLALKYHPDKNPDNV......................DAADKFKEVNRAHSILSNQTK.RNIYD
Q04187_MOUSE/12-72...LWGDFGRMQQAYKQQSLLLHPDK.GGSH.........................ALMQELNSLWGTFKTEVY.NLRMN
DNAJ_ERYRH/6-67....SATDAEIKKAYRQLAKKYHPDINKEDG.......................AEAKFKEVQEAYEVLSDSQK.RANYD
DNAJ_BRUO2/4-66....TADDKTLKAAFRKLAMQYHPDRNPDDP......................EAERKFKEIGEAYETLKDPQK.RAAYD
Q06166_PLAFA/1564-1627....DRDLMELKRILYNLFLEYNPHMNNKQK.....................AELDKKFSEMNVVHQILNYEER.IRMYE
DNJ5_CAEEL/660-721....DCSDDDIKRNYKRLAALVSPDKCTIDA.......................ADQVYELVDVAFSAIGYKDS.RSEYT
PSI1_SCHPO/6-65....EASEAELKKAYRKLALKYHPDKNPNGE.........................KKFKEISLAYEVLSDPQR.RKLYD
YAY1_SCHPO/8-71....DATAVDIKKAYRKLAVKYHPDKNPDDP.....................QGASEKFQKISEAYQVLGDEKL.RSQYD
YD1J_SCHPO/32-107....TCTANDIKRKYIELVKKHHPDKMKNASQLA...PTE.SPP.....EINKHNEEYFRLLLAANALLSDKRR.REEYD
JID1_YEAST/58-147.GNPKLDKKSLKKKYHRYVKLYHPDHSDNIQIFSSEKVTNSDSKSP.LLLTSSEKLHRFKVISQAYDILCDPKK.KIVYD
DNJC3_HUMAN/394-459....NAKKQEIIKAYRKLALQWHPDNFQNEE........E.K..........KKAEKKFIDIAAAKEVLSDPEM.RKKFD
DNJ2_CAEEL/36-102...EEFDKQKLAKAYRALARKHHPDRVKNKE........E.K..........LLAEERFRVIATAYETLKDDEA.KTNYD
Q17438_CAEEL/137-198....KASDDDIRKEYRKLALKLHPDKCRAPH.......................ATEAFKALGNAYAVLSDTDK.RRQYD
Q20774_CAEEL/4-65....GATDDEIKKAYRKMALKYHPDKNKEAG.......................AENKFKEIAEAYDVLSDDKK.KKIYD
Q21162_CAEEL/38-101....NATDDEIKKAYRKLALRYHPDKNLDGD.....................PEKTEMFKEINYANAVLSNPNK.RRVYD
Q22028_CAEEL/17-79....MASEAEIKSAYRKLALKYHPDRNPNDA......................HAQEEFKKVSIAYSVLSDPNK.RRQYD
Q22138_CAEEL/24-87....SASQKDIKSAYYKLSKQHHPDTNPTNK.....................EEAAKKFHQVAMAYEILSSEDK.RKAYD
Q22751_CAEEL/14-80....DCDEKALKKGYYRQSMRWHPDKSNLVE........E.D.........MQTYTTKFQLLNKAYQILSDEEK.RKIYD
DNAJ1_DROME/4-65....KASDDEIKKAYRKLALKYHPDKNKSPQ.......................AEERFKEIAEAYEVLSDKKK.RDIFD
TID_DROVI/80-142....NANAKDIKKAYYELAKKYHPDTNKDDP......................DASKKFQDVSEAYEVLSDDQK.RREYD
Q26951_TRYCR/13-72....TASDVEIRRAYYKLAVVYHPDKNPDGV.........................EVFKEISFANSILSDPAR.RRLYD
Q26952_TRYCR/6-67....DASVDEIKRAYRRLALKYHPDKNKDPG.......................SQEKFKEVSVAYECLSDPEK.RTRYD
Q26953_TRYCR/6-68....EATEHDIKRAYRRLGLKYHPDKNPGDQ......................EAAEMFKRIGHAYEILSDEEK.RRIYD
Q26954_TRYCR/6-68....SAATDEIRTAYRRLALKYHPDKNGGDA......................RAAEKFKKVAEAYEILSDPTK.RRHYD
DNAJ1_ARATH/48-110....KATREEIKKSFHELAKKFHPDTNRNNP......................SAKRKFQEIREAYETLGNSER.REEYD
DNJ13_ARATH/15-80....EASDEEIRKAYRQWAQVYHPDKIQSPQ........M.K..........EVATENFQRICEAYEILSDETK.RLIYD
Q40868_PICGL/4-70....DSSSAEIRSAYRKLAMKWHPDKWSTDP........S.S.........SETAKLRFQQIQEAYSVLSDDTK.RALYD
DNAJ_GEOSE/5-66....NATKEEIKKAYRKLSKKYHPDVNKEPD.......................AAEKFKEIKEAYEVLSDDQK.RAHYD
Q49541_MYCHY/5-72....SASLTEIKKAYRNLVNIYHPDKNTKKSA.......E.E.........QKQAEAKFKEIQEAYEILSDETK.RKQYD
DNAJL_MYCPN/2-61....TATLQEIKTAYKRLAKRYHPDINKQGA.........................DTFVKINNAYAVLSDTTQ.KAEYD
DNAJ_RHOCA/5-67....GASAEEIKKAYRSKAKELHPDRNQGQS......................AAEAQFKEVNGAYDVLKDGDK.KAAYD
DNAJ1_SYNY3/4-65....DADKDEIKRAYRRLARKYHPDVNKEPG.......................AEEKFKEINRAYEVLSEPEI.RQRYD
Q55559_SYNY3/6-67....QSGGETIEQAYQDRLLQLPRREFSDAA.......................VTLRNQLLAIAYETLRDPEK.RQAYD
DNAJ2_THET8/6-67....NATQEEIKRAYKRLARQYHPDVNKSPE.......................AEEKFKEINEAYAVLSDPEK.RRIYD
HSCB_HAEIN/3-72...FQLDEKVLNARYLKLQKALHPDNFVSSNA.......L.D.........QRVAMQKSTEVNDALKTLKDPIL.RAEAI
DNJC1_MOUSE/61-122....DASSADIRKAYRKLSLTLHPDKNKDEN.......................AETQFRQLVAIYEVLKDDER.RQRYD
DNJ39_ARATH/23-85....NSTDQEIKSAYRRMALRYHPDKNPDDP......................VAAEMFKEVTFAYEVLSDPEN.RRLYD
DNJ10_ARATH/6-68....TATESEIKKAYYIKARQVHPDKNPNDP......................QAAHNFQVLGEAYQVLSDSGQ.RQAYD
Q8SZX1_DROME/100-161....HATIQQIRSAFYALAKRYHPDSTHSEQ.......................KLKHFQELSNAYNILTDETK.RLEYD
DNJ16_ARATH/20-82....NSTDQEIKSAYRKLALKYHPDKTANDP......................VAADMFKEVTFSYNILSDPEK.RRQFD
Q90180_9POLY/12-71...AWGNLSMMKKAYKNVSKLYHPDK.GGDS.........................AKMQRLNELFQRVQVTLM..EIRS
Q94216_CAEEL/98-167..RWQATSDEIRFCYRQKVLKHHPDKKKHRG........I.V..........MEKEEYFTCITKAYEQVGMSDVKRQAFD
Q98184_MCV1/2-61....GSSPDAVRARYKDLCLRYHPDRNPGTG.........................VDFKAITRAYRQLRAMRR.FCVRL
DNJC4_MOUSE/37-99....GASAEEIKRAFFTKSKELHPDRDPGNP......................ALHSRFVELNEAYRVLSREES.RRNYD
DNAJ6_ARATH/29-91....RATSQEIRKAYHKLALKLHPDKNQDDK......................EAKDKFQQLQKVISILGDEEK.RAVYD
DNAJ_HALSA/4-65....DATEDEIMQAYRDQVSEYHPDV.SDDP......................DAEEKFKKIQKAKDVLTDEET.RQQYD
DNJC7_MOUSE/381-448....NASEDEIKKAYRKRALMHHPDRHSGASA.......E.V.........QKEEEKKFKEVGEAFTILSDPKK.KTRYD
DNJB9_MOUSE/26-87....SASERQIKKAFHKLAMKYHPDKNKSPD.......................AEAKFREIAEAYETLSDANS.RKEYD
Q9QZW8_RAT/3-66....DASSSDIKKAFHQLALQVHPDKNPGDR.....................EAAEEKFKQVAEAYQILSDAKK.RKDYD
DJC12_MOUSE/14-76....LSSVEQILAEFKIRALECHPDKHPENS......................KAVETFQKLQKAKEILCNAES.RARYD
DNAJ_DEIRA/2-63....TASADEIKSAYRKLALKLHPDRNKEEG.......................AAEKFAQVSEAYSVLSDTEK.RAHYD
Q9S729_VOLCA/114-186..RWTASEAQIRAAYRKTCLENHPDKALINVT......DE.AE........RERIVEHFKTIQDAYDILSDPAK.RREFD
Q9S7L6_ARATH/66-127....SAGKREVKKQYKKMAVLLHPDKNKCIG.......................ADGAFHLISEAWSFLSNEFN.KSTFY
DNJ20_ARATH/66-130....SVTLPEIKQAYKQLARKYHPDVSPPDR..........V..........EEYTDRFIRVQEAYETLSDPRR.RVLYD
Q9SH08_ARATH/76-144....NAEEEQIKVAYRRLAKFYHPDVYDGKGT.......L.EE........GETAEARFIKIQAAYELLMDSEK.KVQYD
Q9SJI1_ARATH/76-138....DATQEEIKKAYYNCMKSCHPDLSGNDP......................ETTNFCMFINDIYEILSDPVQ.RMVYD
Q9SJS8_ARATH/6-68....DASDAEIKKAYYLKARKVHPDKNPGDP......................QAAKNFQVLGEAYQVLSNPDK.RAAYD
Q9SJZ7_ARATH/86-147....NATKAEIKSAYRKLARNYHPDVNKDPG.......................AEEKFKEISNAYEVLSDDEK.KSLYD
Q9SLA7_ARATH/66-127....EADDEIVRKRYRKLAVMLHPDRNKSVG.......................AEEAFKFLSQAWGVFSDKAK.RADYD
Q9SMS0_ARATH/106-169....DADLEEIKSAYRRLSKEYHPDTTSLPL.....................KTASEKFMKLREVYNVLSDEET.RRFYD
Q9SQT7_ARATH/67-128....IANDVIIKKQYKRLALLLHPDKNKLPG.......................AESAFKLIGEAQRILLDREK.RTLHD
Q9SR96_ARATH/27-88....DAKQREIQKAFHKQSLKYHPDKNKDKG.......................AQEKFAEINNAYEILSDEEK.RKNYD
Q9SSD9_ARATH/99-178....GVTDSEIKKAYRRLSIQYHPDKNPDPAFDPD.SFFF.YAHL...LISTEANKYFVEFISKAYQALTDSVS.RENFE
Q9SSJ9_ARATH/8-74....DSSAEQIRRAYHKLAKIWHPDRWTKDP........F.R.........SGEAKRRFQQIQEAYSVLSDERK.RSSYD
Q9ST16_BRACM/135-199...KRIDDAVLKKEYRKKAMLVHPDKNMGCP......................LASESFKKLQCAYEVLSDIVK.KRDYD
Q9SU57_ARATH/4-68....NATEDDLKKAYKRLAMIWHPDKNPSTR..........R..........DEAEAKFKRISEAYDVLSDPQK.RQIYD
Q9SWW3_9EUGL/11-70....SAQAKEIKAAYRRRALECHPDKNPNGG.........................KEFQRLHRAYETLIDPQL.RRDYD
Q9SYB3_ARATH/34-95....DANASDIKRSYYKLSLQHHPDKNPDPE.......................SRKLFVKIATAYEILKDNTT.RAQYD
Q9SZU8_ARATH/56-120....TSSIAEIKASFRRLAKETHPDLIESKK........D.P..........S.NSRRFVQILAAYEILSDSEK.RAHYD
JDP_DROME/17-79....NSSPEQIQAEYKVLALQYHPDKNSGDK......................EAEAKFQQLKEAKETLCDPEK.RAIYD
Q9U062_GIAIN/6-65....SADPQTIKKRTTKLARKYHPDK.PTGD........................EELFNKIGRAYEVLSDPTK.RENYD
Q9U1V9_CAEEL/107-165....GADEKAIKKAWRDMSKIHHPDR.GGDA.........................QFFDKIAKAHQALTDKEA.RENWE
Q9U2L4_CAEEL/27-88....KASPDEIRIAFRKRIREVHPDKCKHPS.......................ATEASKVVNNAFSLLMDPAK.RRQYD
Q9U4X8_9BILA/24-83....XAXDSEIXKAYRKLARXYHPXKNSDHG.........................DKFKEISAAYXILSDENK.RKIYD
JDP_BOMMO/17-79....NSTVEQITAEYKILALQHHPDKNDGEK......................EAEMKFQKLKEAKEILCDPSK.RALYD
DJB11_HUMAN/25-87....SASIKDIKKAYRKLALQLHPDRNPDDP......................QAQEKFQDLGAAYEVLSDSEK.RKQYD
DNJB4_HUMAN/4-65....GASDEDIKKAYRKQALKFHPDKNKSPQ.......................AEEKFKEVAEAYEVLSDPKK.REIYD
SEC63_HUMAN/104-162....GATVAEIKKQYRLLSLKYHPDK.GGDE.........................VMFMRIAKAYAALTDEES.RKNWE
TIM14_SCHPO/51-110...RTLTRQKIKEAHRRLMLANHPDR.GGSP.........................YVASKVNEAKSLLDADRS.IRKFS
JAC1_SCHPO/61-134KGPFDIDLGALKSSYLRKMKTLHPDVAQGKD........A.A..........L.AQRDSAELSKAYNTLKAPLT.RAEYI
YL39_SCHPO/31-96....DASDELIRRAYRKKALQHHPDRIHDEE........K.K..........VEARIEFDKVAIAYGVLSDKKR.RKHYD
DPH4_SCHPO/2-66...KTYTDDEIKEAYRKALLLFHPDKCKEKP......................SVVYTIDQVKEAYQVLSSEKD.RQQYQ
Q9VCH9_DROME/54-117....EVELADIKKRYRTLSILVHPDKNPDNQ.....................ERAQMAFDIVSRSWKILENELT.RKRCL
Q9VFP0_DROME/106-167....TATDSEIKKAYKKLALQLHPDKNKAPG.......................AVEAFKALGNAAGVLTDAEK.RKNYD
Q9VFY1_DROME/37-98....GSSDREIKRAFIELSKKYHPDANSQTR.......................DSEVFMKICEAYQTLHRVNS.RQIYD
Q9VGR0_DROME/10-72....ESDQNEIRKAYRKKALECHPDKNPDNP......................KAVERFHELSKALEILTDESA.RAAYD
Y6693_DROME/15-79....GAGEKEVKKAYHKLSLLVHPDRVPEEQ..........K..........AESTEKFKVLSKLYQVLTDTQK.RALYD
Q9VHW5_DROME/27-89....QCTQNEIKAAYYKLSMLYHPDRNQGSE......................NAAKKFREINQAYEILGNYRL.RRLYD
Q9VK35_DROME/5-64....DATDEEIKKNYRKLAKEFHPDKNPDAG.........................DKFKEISFAYEVLSDPEK.RRIYD
Q9VM54_DROME/30-89....SADQNTVRHAYLDLVKRVHPDSGTEEA.......................SAERFQQVDEAFRVLQ..EK.FAKGR
Q9VN28_DROME/708-769....DSSQEQIRKHYKKIAVLVHPDKNKQAG.......................AEEAFKVLQRAFELIGEPEN.RLIYD
Q9VNE8_DROME/3-72....TASFDEIKCSYKQLILQCHPDKL....RQ....LDD.PNP......GSEAQNSDFNAINAAWNTLKDPIR.RKHYD
Q9VNW0_DROME/4-65....NASSEDVKKGYRRMALRYHPDKNDHPQ.......................AEEQFREVVAAFEVLFDKEK.REIYD
Q9VNW1_DROME/7-66....NATDSEIKDAFRRLSLQYHPDKNEDGA.........................KEFLRINEAHRVLIDHQR.RALYD
Q9VP77_DROME/76-145..RYEASEDDVRRAYRRMVLLHHPDKRKAKG........E.E.........VIQDDDYFTCITKAYEILGTSKP.RRSFD
Q9VPQ2_DROME/25-87....NANTNEVKKAYRRLAKELHPDKNKDDP......................DASTKFQDLGAAYEVLSNPDK.RKTYD
Q9VPY9_DROME/4-65....TATDDEIKKAYRKLALRYHPDKNKAAN.......................AEDKFKEVAEAYEVLSDKSK.REVYD
Q9VS57_DROME/105-164....TSSQAEIKKAYYRLSKVLHPDKETGDE.........................KSFMMLSKAYQALTDDVA.KENYE
Q9VWL4_DROME/40-101....TATGAEVKRAFRTLSIVLHPDKNPAED.......................ANIQFRNLVSIYEVLKDPSR.REKYD
Q9VX95_DROME/329-395....TASQAEITAAYRKLSKEYHPDKVKDEG........L.R..........AQAHQRFIEIQQAYSVLSKIKSNRRRKN
DJC25_DROME/31-96....ESSKSEIGKAYRQLARRYHPDLHRGAE........A.K..........AAAETQFKLVATAYEILRDEES.RTDYD
Q9W083_DROME/7-87....GATKEQITLAYRRLAIRLCPHRDKKDEQDFV.PLAQ.EGRLT..HLSPMGEPRQWAYVNMAFDVLGNDLY.RAIYD
Q9W0X8_DROME/3-66....NANDGDIKSAYRKMALRWHPDKNPDRL.....................AEAKERFQLIQQAYEVLSDPQE.RSWYD
Q9W2U5_DROME/4-65....TANDGEIRKAYHKQALRYHPDKNKSPQ.......................AEEIFKQVAKAYEVLSDKKK.RGSYD
Q9WG03_BFPYV/6-63....TATAADIKTAYRRTALKYHPDK.GGDE.........................EKMKELNTLMEEFRETEG..LRAD
DNAJ_THEMA/7-70....DATQEEIKRAYKRLVKEWHPDRHPENR.....................KEAEQRFKEIQEAYEVLSDPQK.RAMYD
Q9X2C3_THEMA/2-64....GASKEEIEKAYRELVKKYHPDRYKDHP........L.K..........DLAEEKMKQINEAYAVLMS....GEFSE
DNAJ_PORGI/6-68....NATDDELKKAYRKKAIQYHPDKNPGDK......................EAEEHFKEVAEAYDVLSDPQK.RSQYD
Q9XCB2_RHOMR/7-69....NATEEEIKKAYRKLAREWHPDRNPDKP......................NAEERFKEIQEAYSVLSDPEK.RRQYD
Q9XEM8_ORYSI/285-347....DASPAEIKKAYYLKAKQVHPDKNPGNP......................DAAQKFQELGEAYQVLSDPSK.REAYD
Q9XWE1_CAEEL/20-82....DADDRTIRKAFKKLAIKKHPDRNTDDP......................NAHDEFVKINKAYEVLKDENL.RKKYD
YOI1_SCHPO/97-164..RYKADTEQIKKAHLKKVLKHHPDK.KAAS........G.N..........INDDSFFKCIQKAYEILSDPVR.RRQFD
YCJ3_SCHPO/8-72....DATSDQIKESYYRLSRLFHPDRHTADQ..........K..........AAAEEKFQIIQHAYEVLSDPSK.KEIYD
YCJD_SCHPO/4-68....KASAEEIKYAYKKAALETHPDR.VSPS........A.R..........ARATEQFQLVNEAYYVLSDNSR.RAQYD
DNAJ_RICPR/4-65....TASQADIKKAYLKLAKQYHPDTTNAND.......................AEKKFKEINAAYDVLKDEQK.RAAYD
Q9ZEJ5_9NOST/9-71....DATNEDIKKNYRRLARQYHPDLNPGNK......................DAEEKFKIIGEAYEMLSDATK.RAQYD
Q9ZEK0_ANAVA/8-71....SASVIDIRRAYRELSKRYHPDTTELPA.....................ALATRQFQQINEAYATLSNPDR.RLNYD
DNAJ_METSS/5-67....DASDEEIKKSYRKLAMKYHPDRNPDNP......................KAEESFKEAKEAYEVLSDEQK.RAAYD
Q9ZFQ3_PSEAI/5-74...FRIDLEALGNRYRELVRTVHPDRFADASE.......R.E.........QRLAQAKAAELNDAYQTLKSVPR.RALYL
DNJ15_ARATH/17-79....DANDQEIKSAYRKLALKYHPDKNANNP......................DASELFKEVAFSYSILSDPEK.RRHYD
Q9ZU99_ARATH/71-136..ESSTDNDLIKKQYRRLALLLHPDKNRFP.......................FADQAFRFVLDAWEVLSTPTK.KSQFD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window