Sequence alignment for CL0392

PF03656

TIM16_HUMAN/1-125MAKYLA.QIIVMGVQVVGRAFARALRQEF.....AASRAAADARGRAGH.RSAAASNLS.GLSLQEAQQILNVSK....L
TIM16_YEAST/1-128MAHRAFIQVIITGTQVFGKAFAEAYRQAA......SQSVKQGA.TNASR.RGTGKGEYG.GITLDESCKILNIEESKGDL
TIM16_CAEEL/1-135MPWRTALKVALAAGEAVAKALTRAVRDEIKQTQQAAARHAASTGQSASETRENANSNAKLGISLEESLQILNVKT...PL

PF00226

Q9S729_VOLCA/114-186-----------------------------------------------------------------DPYSLLGLANE....
N1P9Z9_YEASC/97-165-----------------------------------------------------------------DLYAAMGLSKL.RFR
ZUO1_SCHPO/97-164-----------------------------------------------------------------DHYAVLGLSKY.RYK
Q94216_CAEEL/98-167-----------------------------------------------------------------DHYKVLGLSKL.RWQ
Q9VP77_DROME/76-145-----------------------------------------------------------------DHYAVLGLGKL.RYE
Q8SZX1_DROME/100-161-----------------------------------------------------------------YYYKVLGVNRH....
DNJ13_ARATH/15-80-----------------------------------------------------------------ELYALLNLSPE....
N1P337_YEASC/538-605-----------------------------------------------------------------DYYKILGVSPS....
F7UK88_SYNYG/24-87-----------------------------------------------------------------SYYGVLELHPA....
Q3MEP6_ANAVT/8-71-----------------------------------------------------------------TYYSLLGLHPS....
DNAJ1_ARATH/48-110-----------------------------------------------------------------NYYDVLGVSPK....
Q49541_MYCHY/5-72-----------------------------------------------------------------DFYKILGVEKS....
P91189_CAEEL/379-444-----------------------------------------------------------------DYYKILGVKRN....
A8KA82_HUMAN/394-459-----------------------------------------------------------------DYYKILGVKRN....
O77048_PLAFA/35-94-----------------------------------------------------------------DYYKRLGVKRN....
Q9VPQ2_DROME/25-87-----------------------------------------------------------------DFYKILNVKKN....
G1R466_NOMLE/25-87-----------------------------------------------------------------DFYKILGVPRS....
MDJ1_YEAST/61-122-----------------------------------------------------------------DPYDTLGLKKS....
MDJ1_SCHPO/86-147-----------------------------------------------------------------DPYKTLGVSKS....
Q9SYB3_ARATH/34-95-----------------------------------------------------------------DCYALLGVAQD....
Q22138_CAEEL/24-87-----------------------------------------------------------------DHYKVLGLAQS....
Q53G26_HUMAN/93-155-----------------------------------------------------------------DYYQILGVPRN....
TID_DROVI/80-142-----------------------------------------------------------------DYYATLGVAKN....
Q06166_PLAFA/1564-1627-----------------------------------------------------------------EFHNILSIHED....
A0A024XFB3_PLAFC/500-562-----------------------------------------------------------------TYYDILNVYPT....
O96277_PLAF7/195-257-----------------------------------------------------------------TYYDILNINAN....
RESA_PLAFF/523-584-----------------------------------------------------------------LYYDILGVGVN....
Q9VHW5_DROME/27-89-----------------------------------------------------------------SHYDALGIRRQ....
DNJ60_DROME/26-90-----------------------------------------------------------------THYEVLNIRND....
Q9VFY1_DROME/37-98-----------------------------------------------------------------NHYQVLNVPVG....
DNJC4_MOUSE/37-99-----------------------------------------------------------------NYYELLGVHPG....
P91014_CAEEL/28-89-----------------------------------------------------------------THYEVLGVEST....
Q9SMS0_ARATH/106-169-----------------------------------------------------------------SHYQFLGVSTD....
Q9VX95_DROME/329-395-----------------------------------------------------------------NSYKVLGVSAT....
A0A023ZEM2_YEASX/23-85-----------------------------------------------------------------DYYAILEIDKD....
B2S481_TREPS/22-91-----------------------------------------------------------------DYYRVLGVSHR....
DNAJ_SYNE7/6-68-----------------------------------------------------------------DYYALLGIPQS....
A0A038FCQ2_MYCTX/4-65-----------------------------------------------------------------DYYGLLGVSKN....
A7BIZ8_MYCLR/10-71-----------------------------------------------------------------DFYKELGVSSD....
D6EPF9_STRLI/10-72-----------------------------------------------------------------DYYKVLGVPKD....
G4FCX5_THEMA/7-70-----------------------------------------------------------------DYYEILGVPRD....
D0MFD1_RHOM4/7-69-----------------------------------------------------------------DYYEILGVPEN....
Q9ZEJ5_9NOST/9-71-----------------------------------------------------------------DYYEILGVTKD....
K4NJX9_HELPX/4-65-----------------------------------------------------------------SLYQTLNVSEN....
F7UM08_SYNYG/6-68-----------------------------------------------------------------NYYQILGVPRN....
O15811_PLAFA/61-122-----------------------------------------------------------------DPYTVLGLSRN....
O97016_LEIMA/86-147-----------------------------------------------------------------DLYSVLGVARN....
Q9SJI1_ARATH/76-138-----------------------------------------------------------------DYYAVLGLLPD....
DNAJ2_STRAL/4-65-----------------------------------------------------------------DYYAVLGVRRD....
DNAJM_MYCGE/7-68-----------------------------------------------------------------DYYEVLGITPD....
A0A017ITF1_ECOLX/5-66-----------------------------------------------------------------DYYAIMGVKPT....
DNAJ_METTH/5-66-----------------------------------------------------------------DYYEILGVDRG....
P92424_PEA/71-132-----------------------------------------------------------------DYYATLGVPKS....
Q9SJZ7_ARATH/86-147-----------------------------------------------------------------DYYSVLGVSKN....
F7ULF8_SYNYG/4-65-----------------------------------------------------------------DYYQTLGVTRD....
DNAJ2_THET8/6-67-----------------------------------------------------------------DYYAILGVPRN....
DNAJ2_AQUAE/8-69-----------------------------------------------------------------DYYEILGVPRN....
DNAJ1_AQUAE/7-68-----------------------------------------------------------------DYYEILGVNRD....
DNAJ_HALS3/4-65-----------------------------------------------------------------DFYDVLGVSRD....
D2BNK3_LACLK/5-66-----------------------------------------------------------------EYYERLGVDKN....
DNAJ_STAAU/5-66-----------------------------------------------------------------DYYEVLGISKD....
F5WS97_ERYRF/6-67-----------------------------------------------------------------DFYEILGVSKS....
DNAJ_GEOSE/5-66-----------------------------------------------------------------DYYEILGVSKN....
DNAJ_LACSK/6-67-----------------------------------------------------------------DYYDVLGVGRD....
DNAJ_DEIRA/2-63-----------------------------------------------------------------DYYELLGVSRT....
M1QC89_METMZ/6-67-----------------------------------------------------------------DYYEILGLSKD....
DNAJ_RHOCA/5-67-----------------------------------------------------------------DFYEVLGVSKG....
D5AWA5_RICPP/4-65-----------------------------------------------------------------DYYQVLGVSKT....
DNAJ_MYCGE/7-74-----------------------------------------------------------------DYYEVLGISKN....
C9R3C7_AGGAD/5-67-----------------------------------------------------------------DYYELLGISRS....
DNAJ_BUCA5/5-67-----------------------------------------------------------------DYYQILGIPKS....
A0A017J3R6_ECOLX/5-67-----------------------------------------------------------------DYYEILGVSKT....
DNAJ_HAEDU/5-67-----------------------------------------------------------------DYYEVLGLQKG....
DNAJ_NITEU/5-67-----------------------------------------------------------------DYYEVLGVGRD....
A0A016X8E6_VIBCL/5-67-----------------------------------------------------------------DFYEVLGVGRD....
DNAJ_VIBHA/5-67-----------------------------------------------------------------DFYEVLGVSRD....
DNAJ_COXBU/5-67-----------------------------------------------------------------DYYEVLGVNLN....
DNAJ_LEGPC/5-67-----------------------------------------------------------------DYYELLEVSRN....
DNAJ_METSS/5-67-----------------------------------------------------------------DYYEVLGVNRD....
B8GWW8_CAUCN/3-65-----------------------------------------------------------------DYYEILGVTRT....
A0A038FN25_9BRAD/8-70-----------------------------------------------------------------CYYETLEVERD....
DNAJ_RHILE/5-67-----------------------------------------------------------------DFYETLGVAKS....
N7P8J4_BRUOV/4-66-----------------------------------------------------------------DYYEALGVTRT....
DNAJ_DEIPM/5-67-----------------------------------------------------------------DYYEVLGVSRS....
B7J281_BORBZ/4-66-----------------------------------------------------------------DYYEILGLSKG....
B7J2L0_BORBZ/4-66-----------------------------------------------------------------DYYNILGIQKN....
F0KCP4_CLOAE/5-67-----------------------------------------------------------------DYYEVLGLEKG....
G7QKB2_LEPII/5-67-----------------------------------------------------------------SYYDILGVSKS....
DNAJ_FRATU/5-67-----------------------------------------------------------------CYYEILNISKT....
I0ZK63_HELPX/4-66-----------------------------------------------------------------SYYEILEVEKH....
A0A059GFC1_CAMJU/4-66-----------------------------------------------------------------SYYEILEITQN....
DNAJ_CHLT2/2-64-----------------------------------------------------------------DYYTILGVAKT....
F7UTR7_SYNYG/8-70-----------------------------------------------------------------DYYQILGVTKT....
I9PHD8_PORGN/6-68-----------------------------------------------------------------DYYEVLGVSKN....
O61582_DROHE/8-75-----------------------------------------------------------------DYYKILGVSRR....
DNJC7_MOUSE/381-448-----------------------------------------------------------------DYYKILGVDKN....
Q26953_TRYCR/6-68-----------------------------------------------------------------EYYEILGLEAE....
O13303_CRYCU/6-70-----------------------------------------------------------------EYYKTLGLSKD....
O96123_PLAF7/88-153-----------------------------------------------------------------DYYSILGVSRD....
A0A024XFT1_PLAFC/4-69-----------------------------------------------------------------DYYSILGVSRD....
O49457_ARATH/4-67-----------------------------------------------------------------DYYKVLQVDRS....
Q9SU57_ARATH/4-68-----------------------------------------------------------------DYYNILKVNHN....
Q9VNW0_DROME/4-65-----------------------------------------------------------------DYYKILGIERN....
H2QJG7_PANTR/3-66-----------------------------------------------------------------SYYEILDVPRS....
DNJB3_MOUSE/3-66-----------------------------------------------------------------DYYEVLGVPRQ....
DNJB6_HUMAN/3-66-----------------------------------------------------------------DYYEVLGVQRH....
O62360_CAEEL/28-91-----------------------------------------------------------------CHYEVLEVERD....
Q9W0X8_DROME/3-66-----------------------------------------------------------------CYYEELELQRN....
B3LP69_YEAS1/4-67-----------------------------------------------------------------CYYELLGVETH....
Q9W2U5_DROME/4-65-----------------------------------------------------------------DYYKILGIQRT....
DNAJ1_DROME/4-65-----------------------------------------------------------------DFYKILGLERK....
Q9VPY9_DROME/4-65-----------------------------------------------------------------DYYKILGLPKT....
H2NXT6_PONAB/4-65-----------------------------------------------------------------DYYQTLGLARG....
G1RFD8_NOMLE/4-65-----------------------------------------------------------------DYYCILGIEKG....
F7HQB6_MACMU/4-65-----------------------------------------------------------------DYYKILGIPSG....
Q20774_CAEEL/4-65-----------------------------------------------------------------DYYKVLGISKG....
Q9QZW8_RAT/3-66-----------------------------------------------------------------NYYKVLGVPQD....
D0A3U6_TRYB9/4-67-----------------------------------------------------------------DYYKVLGVSRD....
DNJB9_MOUSE/26-87-----------------------------------------------------------------SYYDILGVPKS....
B2S246_TREPS/8-70-----------------------------------------------------------------DHYAILGVAAD....
YL39_SCHPO/31-96-----------------------------------------------------------------DPYSVLGVEKD....
Q9XWE1_CAEEL/20-82-----------------------------------------------------------------DYYELLGVERD....
Q22028_CAEEL/17-79-----------------------------------------------------------------DFYQLLGVEKM....
Q9VNW1_DROME/7-66-----------------------------------------------------------------DHYQVLGLPRN....
DNJ72_ARATH/3-70-----------------------------------------------------------------DHYQVLGVTRN....
DNJC5_MOUSE/15-77-----------------------------------------------------------------SLYHVLGLDKN....
CSP_DROME/17-79-----------------------------------------------------------------SLYEILGLPKT....
Q21162_CAEEL/38-101-----------------------------------------------------------------HLYNVLGIQKN....
Q26951_TRYCR/13-72-----------------------------------------------------------------ALYDVLGVPRT....
DNJ39_ARATH/23-85-----------------------------------------------------------------NPYEVLGIPSN....
Q1EBT7_ARATH/20-82-----------------------------------------------------------------DPYEVLGVLRN....
Q1H5A8_ARATH/17-79-----------------------------------------------------------------DPYEVLCVSKD....
A0A023ZFL0_YEASX/6-68-----------------------------------------------------------------SLYDSLNVTAA....
PSI1_SCHPO/6-65-----------------------------------------------------------------KLYDCLEVRPE....
Q9U4X8_STRER/24-83-----------------------------------------------------------------KLYDILGVKPX....
O16303_CAEEL/13-72-----------------------------------------------------------------TLYTTLNVRPD....
Q9VK35_DROME/5-64-----------------------------------------------------------------NLYDVLKVAPD....
A0A024R6S1_HUMAN/8-67-----------------------------------------------------------------KLYDILGVPPG....
O45502_CAEEL/6-65-----------------------------------------------------------------GYYDVLGVKPD....
E2RM09_CANFA/6-65-----------------------------------------------------------------TYYDVLGVKPN....
A0A023ZEG7_YEASX/21-82-----------------------------------------------------------------EFYEILKVDRK....
MAS5_SCHPO/6-65-----------------------------------------------------------------KLYEVLNVDVT....
MAS5_YEAST/6-67-----------------------------------------------------------------KFYDILGVPVT....
Q9U062_GIAIN/6-65-----------------------------------------------------------------EFYDLLGVSPS....
N1NY39_YEASC/6-65-----------------------------------------------------------------KLYDLLGVSPS....
O24074_MEDSA/14-72-----------------------------------------------------------------KYYDILGVSKS....
DNJH2_ALLPO/13-71-----------------------------------------------------------------KYYEVLGVSKN....
O43978_BABBO/14-72-----------------------------------------------------------------KFYKVLGLSRD....
O96455_DICDI/5-66-----------------------------------------------------------------KFYDILGVARD....
XDJ1_SCHPO/6-70-----------------------------------------------------------------KLYDILEVHFE....
XDJ1_YEAST/9-74-----------------------------------------------------------------RLYDVLGVTRD....
DNJ20_ARATH/66-130-----------------------------------------------------------------SFYDLLGVTES....
Q9SH08_ARATH/76-144-----------------------------------------------------------------SPYDTLELDRN....
O48828_ARATH/68-132-----------------------------------------------------------------SLYEILEIPVG....
P93499_PHAVU/67-131-----------------------------------------------------------------SLYDILGIPAG....
DNAJL_MYCGE/2-61-----------------------------------------------------------------NLYDLLELPTT....
E1QBD3_MYCPB/2-61-----------------------------------------------------------------TLYDLLELPQT....
Q9SZU8_ARATH/56-120-----------------------------------------------------------------NAYDILNVSET....
Q26954_TRYCR/6-68-----------------------------------------------------------------SLYDELGILPS....
Q26952_TRYCR/6-67-----------------------------------------------------------------KFYDSLGVSPD....
O17002_CAEEL/8-71-----------------------------------------------------------------NPYKILHLEKG....
Q9SR96_ARATH/27-88-----------------------------------------------------------------DPYKVLGVSKD....
Q9U1V9_CAEEL/107-165-----------------------------------------------------------------DPYQILGLDQG....
F7FPB6_MACMU/104-162-----------------------------------------------------------------NPYEVLNLDPG....
Q9VS57_DROME/105-164-----------------------------------------------------------------DPFEILNVPPT....
O49559_ARATH/81-165-----------------------------------------------------------------EPFGILGLEPG....
Q9SSD9_ARATH/99-178-----------------------------------------------------------------DPFSILGLEPG....
C7GRZ0_YEAS2/13-74-----------------------------------------------------------------TYYSILGLTSN....
YD1J_SCHPO/32-107-----------------------------------------------------------------TPYEILELPRT....
DNJ2_CAEEL/36-102-----------------------------------------------------------------NCYDVLEVNRE....
DJC25_DROME/31-96-----------------------------------------------------------------NCYDVLGVTRE....
DNJC1_MOUSE/61-122-----------------------------------------------------------------NFYEFLGVQQD....
Q9VWL4_DROME/40-101-----------------------------------------------------------------NFYEFMGINQT....
Q40868_PICGL/4-70-----------------------------------------------------------------TFYSILGVNKD....
Q9SSJ9_ARATH/8-74-----------------------------------------------------------------TYYEILGVAVD....
Q0WRQ5_ARATH/29-91-----------------------------------------------------------------SLYEVLGVERR....
Q22751_CAEEL/14-80-----------------------------------------------------------------CLYELLGVKKD....
Y6693_DROME/15-79-----------------------------------------------------------------DVYKLMELARG....
YCJ3_SCHPO/8-72-----------------------------------------------------------------ELYLALGLPKD....
O49475_ARATH/66-127-----------------------------------------------------------------DWYRVLGVDPL....
O49476_ARATH/55-115-----------------------------------------------------------------DWYGILGIDPL....
O49477_ARATH/56-117-----------------------------------------------------------------DWYGILGVDPL....
Q9ZU99_ARATH/71-136-----------------------------------------------------------------NWYKILQIEDLTESS
O04648_ARATH/66-127-----------------------------------------------------------------NWYGILQVMHF....
Q9SQT7_ARATH/67-128-----------------------------------------------------------------DWYGILQVEQI....
Q9SLA7_ARATH/66-127-----------------------------------------------------------------DHYGVLGLNPE....
Q9VN28_DROME/708-769-----------------------------------------------------------------DAYSILGVPPD....
Q9W083_DROME/7-87-----------------------------------------------------------------DYYAVLDQPRG....
P91243_CAEEL/26-91-----------------------------------------------------------------DFYAILNVPKD....
DJC13_HUMAN/1301-1362-----------------------------------------------------------------DAYEVLNLPQG....
O18427_GEOCY/5-64-----------------------------------------------------------------DLYEVLELPKG....
MU185_SCHPO/9-71-----------------------------------------------------------------DCYEILQVNHD....
G2WDI2_YEASK/44-105-----------------------------------------------------------------NFYKFLKLPKL..QN
DJC12_MOUSE/14-76-----------------------------------------------------------------DYYALLGCDEL....
C7AR00_BOMMO/17-79-----------------------------------------------------------------DYYALLGCDEN....
JDP_DROME/17-79-----------------------------------------------------------------DFYGLLHCDEN....
RSP1_SCHPO/12-75-----------------------------------------------------------------DYYTILGAEST....
MU184_SCHPO/12-75-----------------------------------------------------------------DYYAILKLQKN....
O97211_LEIMA/9-69-----------------------------------------------------------------ELYQVLELDAQ....
O80481_ARATH/70-132-----------------------------------------------------------------THYDILRISNP....
F7URT3_SYNYG/6-67-----------------------------------------------------------------DFYRILGIPPQ....
Q9VNE8_DROME/3-72-----------------------------------------------------------------DFYELLNVPST....
YCJD_SCHPO/4-68-----------------------------------------------------------------DYYAILNITPK....
Q9U2L4_CAEEL/27-88-----------------------------------------------------------------DFYKILNVDKK....
Q17438_CAEEL/137-198-----------------------------------------------------------------DYYEILKIDKK....
O96276_PLAF7/660-722-----------------------------------------------------------------TYYDLLNVEPD....
A0A023ZLW8_YEASX/8-73-----------------------------------------------------------------THYEILRIPSD....
DPH4_SCHPO/2-66-----------------------------------------------------------------NHYSVLNLKDG...K
O82623_ARATH/11-76-----------------------------------------------------------------TYYEILSVKED....
YNF5_SCHPO/113-174-----------------------------------------------------------------QYYEILDLKKT....
Q9VFP0_DROME/106-167-----------------------------------------------------------------DYYEVLGVSKT....
DJB12_MOUSE/111-172-----------------------------------------------------------------DYYEILGVSRS....
YHXB_SCHPO/9-72-----------------------------------------------------------------DYYDILNISVD....
SPF31_SCHPO/31-93-----------------------------------------------------------------NAYDVLDILPG....
O80799_ARATH/315-376-----------------------------------------------------------------SPYDVLGVNHN....
A0A023ZM90_YEASX/15-84-----------------------------------------------------------------NLYDVLELPTP....
Q9VGR0_DROME/10-72-----------------------------------------------------------------NLYDLLGISLE....
A0A023ZD73_YEASX/6-68-----------------------------------------------------------------EYYDLLGVSTT....
YAY1_SCHPO/8-71-----------------------------------------------------------------EYYDLLGISTD....
A0A023ZBK7_YEASX/6-68-----------------------------------------------------------------EYYDILGIKPE....
O49288_ARATH/6-67-----------------------------------------------------------------VYYDVLGVTPS....
DNJ10_ARATH/6-68-----------------------------------------------------------------EYYDVLGVSPT....
Q9SJS8_ARATH/6-68-----------------------------------------------------------------EYYEILGVKTD....
Q9XEM8_ORYSI/285-347-----------------------------------------------------------------AYYDTLGVSVD....
Q9ST16_BRACM/135-199-----------------------------------------------------------------NHYEALGFPRH....
Q9SWW3_9EUGL/11-70-----------------------------------------------------------------CHYTTLGIAKS....

PF03656

TIM16_HUMAN/1-125S-------PEE--VQKNYEHLFKVNDKS--VGGSFYLQSKV--------------------VRAKE----RLDEEL.KIQ
TIM16_YEAST/1-128N-------MDK--INNRFNYLFEVNDKE--KGGSFYLQSKV--------------------YRAAE----RLKWEL.AQR
TIM16_CAEEL/1-135N-------REE--VEKHYEHLFNINDKS--KGGTLYLQSKV--------------------FRAKE----RIDEEFGRIE

PF00226

Q9S729_VOLCA/114-186RWT.....ASEAQIRAAYRKTCLENHPD..KALINVTDEAE.............R......ERIVE....HFK.TIQDAY
N1P9Z9_YEASC/97-165A.T.....ESQ..IIKAHRKQVVKYHPDKQSA.....AGGS....................LDQDG....FFK.IIQKAF
ZUO1_SCHPO/97-164A.D.....TEQ..IKKAHLKKVLKHHPDKKAA.....SGNI.....................NDDS....FFK.CIQKAY
Q94216_CAEEL/98-167A.T.....SDE..IRFCYRQKVLKHHPDKKKH.....RGIV....................MEKEE....YFT.CITKAY
Q9VP77_DROME/76-145A.S.....EDD..VRRAYRRMVLLHHPDKRKA.....KGEE...................VIQDDD....YFT.CITKAY
Q8SZX1_DROME/100-161A.T.....IQQ..IRSAFYALAKRYHPD..ST.......HS....................EQKLK....HFQ.ELSNAY
DNJ13_ARATH/15-80A.S.....DEE..IRKAYRQWAQVYHPD..KI....QSPQM..............K.....EVATE....NFQ.RICEAY
N1P337_YEASC/538-605A.S.....SKE..IRKAYLNLTKKYHPDKIKA...NHNDKQ....................ESIHE....TMS.QINEAY
F7UK88_SYNYG/24-87A.S.....PVA..IRRAYRELSKRYHPD..TT.....LLTP....................DIATV....KFQ.RLNEAY
Q3MEP6_ANAVT/8-71A.S.....VID..IRRAYRELSKRYHPD..TT......ELP...................AALATR....QFQ.QINEAY
DNAJ1_ARATH/48-110A.T.....REE..IKKSFHELAKKFHPD..TN.....RNNP.....................SAKR....KFQ.EIREAY
Q49541_MYCHY/5-72A.S.....LTE..IKKAYRNLVNIYHPD..KN.TKKSAEEQ....................KQAEA....KFK.EIQEAY
P91189_CAEEL/379-444A.S.....KRE..ITKAYRKLAQKWHPDNFSD.....EEEK....................KKAEK....KFI.DIAAAK
A8KA82_HUMAN/394-459A.K.....KQE..IIKAYRKLALQWHPDNFQN.....EEEK....................KKAEK....KFI.DIAAAK
O77048_PLAFA/35-94A.T.....KED..ISKAYRQLAKEYHPD..IA.............................PDKEK....DFI.EIANAY
Q9VPQ2_DROME/25-87A.N.....TNE..VKKAYRRLAKELHPD..KN.....KDDP.....................DAST....KFQ.DLGAAY
G1R466_NOMLE/25-87A.S.....IKD..IKKAYRKLALQLHPD..RN.....PDDP.....................QAQE....KFQ.DLGAAY
MDJ1_YEAST/61-122A.T.....GAE..IKKAYYKLAKKYHPD..IN......KEP.....................DAEK....KFH.DLQNAY
MDJ1_SCHPO/86-147A.S.....ASE..IKSAYYKLAKQYHPD..AN.....PDKA......................AQD....KFV.EIKQAY
Q9SYB3_ARATH/34-95A.N.....ASD..IKRSYYKLSLQHHPD..KN......PDP.....................ESRK....LFV.KIATAY
Q22138_CAEEL/24-87A.S.....QKD..IKSAYYKLSKQHHPD..TN.....PTNK....................EEAAK....KFH.QVAMAY
Q53G26_HUMAN/93-155A.S.....QKE..IKKAYYQLAKKYHPD..TN.....KDDP.....................KAKE....KFS.QLAEAY
TID_DROVI/80-142A.N.....AKD..IKKAYYELAKKYHPD..TN.....KDDP.....................DASK....KFQ.DVSEAY
Q06166_PLAFA/1564-1627R.D.....LME..LKRILYNLFLEYNPH..MN.....NKQK....................AELDK....KFS.EMNVVH
A0A024XFB3_PLAFC/500-562S.E.....LSE..IKSNYYNLALKYNPE..SN.....LGNA.....................EALT....KFR.DINEAY
O96277_PLAF7/195-257S.K.....LEE..IKEKYYEVASKYHPE..KN.....IGND.....................KAFK....KFE.LINSAY
RESA_PLAFF/523-584A.D.....MNE..ITERYFKLAENYYPY..QR.....SGST......................VFH....NFR.KVNEAY
Q9VHW5_DROME/27-89C.T.....QNE..IKAAYYKLSMLYHPD..RN.....QGSE.....................NAAK....KFR.EINQAY
DNJ60_DROME/26-90C.S.....TRE..VRNAFVQLSKLYHPDVKSN.....AACP.....................ERTA....RFV.QISEAY
Q9VFY1_DROME/37-98S.S.....DRE..IKRAFIELSKKYHPD..AN......SQT.....................RDSE....VFM.KICEAY
DNJC4_MOUSE/37-99A.S.....AEE..IKRAFFTKSKELHPD..RD.....PGNP.....................ALHS....RFV.ELNEAY
P91014_CAEEL/28-89A.T.....LSE..IKSAFYAQSKKVHPD..NS......SEE.....................SATA....SFL.ELKNAY
Q9SMS0_ARATH/106-169A.D.....LEE..IKSAYRRLSKEYHPD..TT......SLP...................LKTASE....KFM.KLREVY
Q9VX95_DROME/329-395A.S.....QAE..ITAAYRKLSKEYHPDKVKD.....EGLR....................AQAHQ....RFI.EIQQAY
A0A023ZEM2_YEASX/23-85A.T.....EKE..IKSAYRQLSKKYHPD..KN.....AGSE.....................EAHQ....KFI.EVGEAY
B2S481_TREPS/22-91A.S.....TPE..IKCAFRKKAKALHPD..LVSHTAELECE............A.......VARER....ALR.RILTAY
DNAJ_SYNE7/6-68A.D.....QAA..IKAAFRKLARQCHPD..LN.....PGDR.....................QAEE....RFK.QISEAY
A0A038FCQ2_MYCTX/4-65A.S.....DAD..IKRAYRKLARELHPD..VN.....PDEA......................AQA....KFK.EISVAY
A7BIZ8_MYCLR/10-71A.S.....PEE..IKRAYRKLARYLHPD..AN.....PDNS......................AGE....RFK.VVSEAH
D6EPF9_STRLI/10-72A.T.....EAE..IKKAYRKLARENHPD..AN.....KGNV.....................KAEE....RFK.EISEAN
G4FCX5_THEMA/7-70A.T.....QEE..IKRAYKRLVKEWHPD..RH.....PENR....................KEAEQ....RFK.EIQEAY
D0MFD1_RHOM4/7-69A.T.....EEE..IKKAYRKLAREWHPD..RN.....PDKP.....................NAEE....RFK.EIQEAY
Q9ZEJ5_9NOST/9-71A.T.....NED..IKKNYRRLARQYHPD..LN.....PGNK.....................DAEE....KFK.IIGEAY
K4NJX9_HELPX/4-65A.S.....QDE..IKKSYRRLARQYHPD..LN......KTK.....................EAEE....KFK.EINAAY
F7UM08_SYNYG/6-68A.T.....AEE..IKKSFRKLARQYHPD..VN.....PNDK.....................TAEE....KFK.DINEAY
O15811_PLAFA/61-122A.T.....TND..IKKQFRLLAKKYHPD..IN......PSP.....................DAKQ....KMA.SITAAY
O97016_LEIMA/86-147S.T.....PEQ..IKSAYKKRAKALHPD..VN......PSP.....................TAAE....DFA.EAKQAY
Q9SJI1_ARATH/76-138A.T.....QEE..IKKAYYNCMKSCHPD..LS.....GNDP.....................ETTN.....FCMFINDIY
DNAJ2_STRAL/4-65A.S.....QDE..IKKAFRRLARELHPD..VN......PDP.....................KTQE....RFK.EINAAY
DNAJM_MYCGE/7-68A.D.....QSE..IKKAFRKLAKKYHPD..RN......NAP.....................DAAK....IFA.EINEAN
A0A017ITF1_ECOLX/5-66D.D.....LKT..IKTAYRRLARKYHPD..VS......KEP.....................DAEA....RFK.EVAEAW
DNAJ_METTH/5-66A.D.....KKE..IKKAYRRLARKYHPD..VS......DDP.....................DAAE....KFK.EISEAY
P92424_PEA/71-132A.T.....VKD..IKAAYRRLARQYHPD..VN......KEP.....................GATD....KFK.EISNAY
Q9SJZ7_ARATH/86-147A.T.....KAE..IKSAYRKLARNYHPD..VN......KDP.....................GAEE....KFK.EISNAY
F7ULF8_SYNYG/4-65A.D.....KDE..IKRAYRRLARKYHPD..VN......KEP.....................GAEE....KFK.EINRAY
DNAJ2_THET8/6-67A.T.....QEE..IKRAYKRLARQYHPD..VN......KSP.....................EAEE....KFK.EINEAY
DNAJ2_AQUAE/8-69A.S.....QEE..IKKAYRRLVRKYHPD..IC......KKP.....................ECEE....KFK.EINEAY
DNAJ1_AQUAE/7-68A.T.....KEE..IKKAYRKLVRIYHPD..IN......PDP.....................SAQE....KFK.EINEAY
DNAJ_HALS3/4-65A.T.....EDE..IMQAYRDQVSEYHPD..VS......DDP.....................DAEE....KFK.KIQKAK
D2BNK3_LACLK/5-66A.S.....QDE..IKKAYRKMSKKYHPD..LN......KEE.....................GAEE....KYK.EVQEAY
DNAJ_STAAU/5-66A.S.....KDE..IKKAYRKLSKKYHPD..IN......KEE.....................GADE....KFK.EISEAY
F5WS97_ERYRF/6-67A.T.....DAE..IKKAYRQLAKKYHPD..IN......KED.....................GAEA....KFK.EVQEAY
DNAJ_GEOSE/5-66A.T.....KEE..IKKAYRKLSKKYHPD..VN......KEP.....................DAAE....KFK.EIKEAY
DNAJ_LACSK/6-67A.S.....DDE..IKKAYRKLSKKYHPD..IN......KAP.....................DAEA....KFK.EVTEAY
DNAJ_DEIRA/2-63A.S.....ADE..IKSAYRKLALKLHPD..RN......KEE.....................GAAE....KFA.QVSEAY
M1QC89_METMZ/6-67S.S.....VED..IKKTYRKLALQYHPD..RN......KEP.....................GAEE....KFK.EISEAY
DNAJ_RHOCA/5-67A.S.....AEE..IKKAYRSKAKELHPD..RN.....QGQS.....................AAEA....QFK.EVNGAY
D5AWA5_RICPP/4-65A.S.....QAD..IKKAYLKLAKQYHPD..TT......NAN.....................DAEK....KFK.EINAAY
DNAJ_MYCGE/7-74A.S.....SQD..IKRAFRKLAMQYHPD..RHKAENETTQK.....................QNEE....KFK.EVNEAY
C9R3C7_AGGAD/5-67A.D.....EKE..IKRAYKKLAMQYHPD..RT.....KGDK.....................EKEE....KFK.EIQEAY
DNAJ_BUCA5/5-67A.E.....ERE..IKKAYKKLAMKYHPD..RN.....QGDK.....................TAEG....KFK.EIKEAY
A0A017J3R6_ECOLX/5-67A.E.....ERE..IRKAYKRLAMKYHPD..RN.....QGDK.....................EAEA....KFK.EIKEAY
DNAJ_HAEDU/5-67A.T.....EKD..IKRAYKRLAAKYHPD..KN.....QGSK.....................DSEE....KFK.QITEAY
DNAJ_NITEU/5-67A.D.....ENE..LKKAYRKLAMKYHPD..RN.....AGDT.....................KAEE....RFK.NIKEAY
A0A016X8E6_VIBCL/5-67A.S.....ERD..IKKAYKRLAMKYHPD..RN.....SGDA.....................GAAE....KFK.EVKEAY
DNAJ_VIBHA/5-67A.S.....ERD..IKKAYKRLAMKYHPD..RN.....QGDE.....................SAAD....KFK.EVKESY
DNAJ_COXBU/5-67A.T.....EAE..VKKAFRRLAMKYHPD..RN.....PGDK.....................DAEV....KFK.EAREAY
DNAJ_LEGPC/5-67A.S.....DAE..IKKAYRRLAMKYHPD..RN.....PGDT.....................SAEE....KFK.EIQKAY
DNAJ_METSS/5-67A.S.....DEE..IKKSYRKLAMKYHPD..RN.....PDNP.....................KAEE....SFK.EAKEAY
B8GWW8_CAUCN/3-65I.D.....EAG..LKSAFRKLAMEHHPD..RN.....GGCE.....................NAAG....RFK.EINEAY
A0A038FN25_9BRAD/8-70A.D.....ESK..LKSSFRKLAMKFHPD..RN.....PGDD.....................TSEV....KFK.EINEAY
DNAJ_RHILE/5-67A.D.....EKE..LKSAFRKLAMKFHPD..KN.....PDDK.....................DAER....KFK.EINEAY
N7P8J4_BRUOV/4-66A.D.....DKT..LKAAFRKLAMQYHPD..RN.....PDDP.....................EAER....KFK.EIGEAY
DNAJ_DEIPM/5-67A.S.....DSD..IKSAYRKLAKQYHPD..KN.....AGDE.....................SAAE....KFK.EIGEAY
B7J281_BORBZ/4-66A.S.....KDE..IKKAYRKIAIKYHPD..RN.....QGNE.....................EAAS....IFK.EATQAY
B7J2L0_BORBZ/4-66A.S.....NEE..IKKAYKKLAIKYHPD..KN.....KGNK.....................IAEE....KFK.EINEAY
F0KCP4_CLOAE/5-67A.S.....DDE..IKKAFRKLAIKYHPD..KN.....RGNK.....................EAEE....KFK.EINEAY
G7QKB2_LEPII/5-67A.N.....DEE..IKSAYRKLAIKYHPD..KN.....KGNK.....................ESEE....KFK.EATEAY
DNAJ_FRATU/5-67A.S.....GVE..IKRAYRKLAMKYHPD..RN.....PGDK.....................EAEI....KFK.EISEAY
I0ZK63_HELPX/4-66S.N.....QET..IKKSYRKLALKYHPD..RN.....AGDK.....................EAEE....KFK.LINEAY
A0A059GFC1_CAMJU/4-66A.D.....KET..IKKAYRKMALKYHPD..RN.....QGDK.....................EAED....KFK.LVNEAY
DNAJ_CHLT2/2-64A.T.....PEE..IKKAYRKLAVKYHPD..KN.....PGDA.....................EAER....RFK.EVSEAY
F7UTR7_SYNYG/8-70A.S.....EAE..IKKQFRKLALKYHPD..KN.....PGDK.....................AAEE....KFK.EISEAY
I9PHD8_PORGN/6-68A.T.....DDE..LKKAYRKKAIQYHPD..KN.....PGDK.....................EAEE....HFK.EVAEAY
O61582_DROHE/8-75A.T.....EDE..VKKAYRKKAMVHHPD..RH.....TSSS....................AEVRKDEELKFK.EVGEAY
DNJC7_MOUSE/381-448A.S.....EDE..IKKAYRKRALMHHPD..RH.....SGAS....................AEVQKEEEKKFK.EVGEAF
Q26953_TRYCR/6-68A.T.....EHD..IKRAYRRLGLKYHPD..KN.....PGDQ.....................EAAE....MFK.RIGHAY
O13303_CRYCU/6-70A.S.....EAD..IKKAYRKESLKWHPD..KN.....PGDK...................RATAEE....KFK.KVGEAY
O96123_PLAF7/88-153C.T.....NED..IKKAYKKLAMKWHPD..KH..LNAASKK.....................EADN....MFK.SISEAY
A0A024XFT1_PLAFC/4-69C.T.....TND..LKKAYRKLAMMWHPD..KH.....NDEK..................SKKEAEE....KFK.NIAEAY
O49457_ARATH/4-67A.N.....DDD..LKKAYRKLAMKWHPD..KN.....PNNK....................KDAEA....KFK.QISEAY
Q9SU57_ARATH/4-68A.T.....EDD..LKKAYKRLAMIWHPD..KN.....PSTR...................RDEAEA....KFK.RISEAY
Q9VNW0_DROME/4-65A.S.....SED..VKKGYRRMALRYHPD..KN......DHP.....................QAEE....QFR.EVVAAF
H2QJG7_PANTR/3-66A.S.....ADD..IKKAYRRKALQWHPD..KN.....PDNK....................EFAEK....KFK.EVAEAY
DNJB3_MOUSE/3-66A.S.....AEA..IRKAYRKLALKWHPD..KN.....PEHK....................EEAER....RFK.QVAQAY
DNJB6_HUMAN/3-66A.S.....PED..IKKAYRKLALKWHPD..KN.....PENK....................EEAER....KFK.QVAEAY
O62360_CAEEL/28-91A.D.....DDK..IKKNYRKLALKWHPD..KN.....PDRI....................EECTQ....QFR.LLQAAY
Q9W0X8_DROME/3-66A.N.....DGD..IKSAYRKMALRWHPD..KN.....PDRL....................AEAKE....RFQ.LIQQAY
B3LP69_YEAS1/4-67A.S.....DLE..LKKAYRKKALQYHPD..KN.....PDNV....................EEATQ....KFA.VIRAAY
Q9W2U5_DROME/4-65A.N.....DGE..IRKAYHKQALRYHPD..KN......KSP.....................QAEE....IFK.QVAKAY
DNAJ1_DROME/4-65A.S.....DDE..IKKAYRKLALKYHPD..KN......KSP.....................QAEE....RFK.EIAEAY
Q9VPY9_DROME/4-65A.T.....DDE..IKKAYRKLALRYHPD..KN......KAA.....................NAED....KFK.EVAEAY
H2NXT6_PONAB/4-65A.S.....DEE..IKRAYRRQALRYHPD..KN......KEP.....................GAEE....KFK.EIAEAY
G1RFD8_NOMLE/4-65A.S.....DED..IKKAYRKQALKFHPD..KN......KSP.....................QAEE....KFK.EVAEAY
F7HQB6_MACMU/4-65A.N.....EDE..IKKAYRKMALKYHPD..KN......KEP.....................NAEE....KFK.EIAEAY
Q20774_CAEEL/4-65A.T.....DDE..IKKAYRKMALKYHPD..KN......KEA.....................GAEN....KFK.EIAEAY
Q9QZW8_RAT/3-66A.S.....SSD..IKKAFHQLALQVHPD..KN.....PGDR....................EAAEE....KFK.QVAEAY
D0A3U6_TRYB9/4-67A.S.....PSD..IKKAYHQLALKYHPD..KA.....SGNR....................EEAER....LFK.EVAEAY
DNJB9_MOUSE/26-87A.S.....ERQ..IKKAFHKLAMKYHPD..KN......KSP.....................DAEA....KFR.EIAEAY
B2S246_TREPS/8-70A.S.....EEH..IKKAFRAQALKYHPD..KN.....PGDA.....................CAED....QFK.RINAAY
YL39_SCHPO/31-96A.S.....DEL..IRRAYRKKALQHHPD..RI....HDEEK...............K....VEARI....EFD.KVAIAY
Q9XWE1_CAEEL/20-82A.D.....DRT..IRKAFKKLAIKKHPD..RN.....TDDP.....................NAHD....EFV.KINKAY
Q22028_CAEEL/17-79A.S.....EAE..IKSAYRKLALKYHPD..RN.....PNDA.....................HAQE....EFK.KVSIAY
Q9VNW1_DROME/7-66A.T.....DSE..IKDAFRRLSLQYHPD..KN.............................EDGAK....EFL.RINEAH
DNJ72_ARATH/3-70A.T.....KKE..VKDAFRRLAIKYHPD..KH..AQSPEHV.................R..HNATV....RFK.LVSEAY
DNJC5_MOUSE/15-77A.T.....SDD..IKKSYRKLALKYHPD..KN.....PDNP.....................EAAD....KFK.EINNAH
CSP_DROME/17-79A.T.....GDD..IKKTYRKLALKYHPD..KN.....PDNV.....................DAAD....KFK.EVNRAH
Q21162_CAEEL/38-101A.T.....DDE..IKKAYRKLALRYHPD..KN....LDGDP.....................EKTE....MFK.EINYAN
Q26951_TRYCR/13-72A.S.....DVE..IRRAYYKLAVVYHPD..KN.............................PDGVE....VFK.EISFAN
DNJ39_ARATH/23-85S.T.....DQE..IKSAYRRMALRYHPD..KN.....PDDP.....................VAAE....MFK.EVTFAY
Q1EBT7_ARATH/20-82S.T.....DQE..IKSAYRKLALKYHPD..KT.....ANDP.....................VAAD....MFK.EVTFSY
Q1H5A8_ARATH/17-79A.N.....DQE..IKSAYRKLALKYHPD..KN.....ANNP.....................DASE....LFK.EVAFSY
A0A023ZFL0_YEASX/6-68A.S.....TSE..IKKAYRNAALKYHPD..KN.....NHTE.....................ESKR....KFQ.EICQAY
PSI1_SCHPO/6-65A.S.....EAE..LKKAYRKLALKYHPD..KN........P.....................NGEK....KFK.EISLAY
Q9U4X8_STRER/24-83A.X.....DSE..IXKAYRKLARXYHPX..KN.............................SDHGD....KFK.EISAAY
O16303_CAEEL/13-72A.S.....QAD..IKKSYFKLAKEYHPD..KN........P.....................DHGD....KFK.EISFAY
Q9VK35_DROME/5-64A.T.....DEE..IKKNYRKLAKEFHPD..KN........P.....................DAGD....KFK.EISFAY
A0A024R6S1_HUMAN/8-67A.S.....ENE..LKKAYRKLAKEYHPD..KN........P.....................NAGD....KFK.EISFAY
O45502_CAEEL/6-65A.S.....DNE..LKKAYRKMALKFHPD..KN........P.....................DGAE....QFK.QISQAY
E2RM09_CANFA/6-65A.T.....QEE..LKKAYRKLALKYHPD..KN........P.....................NEGE....KFK.QISQAY
A0A023ZEG7_YEASX/21-82A.T.....DSE..IKKAYRKLAIKLHPD..KN......SHP.....................KAGE....AFK.VINRAF
MAS5_SCHPO/6-65A.S.....QAE..LKKAYRKLALKYHPD..KN........P.....................NAGD....KFK.EISRAY
MAS5_YEAST/6-67A.T.....DVE..IKKAYRKCALKYHPD..KN.....PSEE......................AAE....KFK.EASAAY
Q9U062_GIAIN/6-65A.D.....PQT..IKKRTTKLARKYHPD..KP.............................TGDEE....LFN.KIGRAY
N1NY39_YEASC/6-65A.N.....EQE..LKKGYRKAALKYHPD..KP.............................TGDTE....KFK.EISEAF
O24074_MEDSA/14-72A.S.....EDE..IKKAYRKAAMKNHPD..KG......GDP........................E....KFK.ELGQAY
DNJH2_ALLPO/13-71A.T.....PED..LKKAYRKAAIKNHPD..KG......GDP........................E....KFK.EIGQAY
O43978_BABBO/14-72C.S.....ESE..IKKAYRKLAIKHHPD..KG..............................GDSE....MFK.EITRAY
O96455_DICDI/5-66A.S.....ETD..IKKAYRKLAIKYHPD..KN......PDP.....................AAVE....KFK.ELTVAY
XDJ1_SCHPO/6-70A.S.....AEE..IKKSYKRLALLHHPD..KA.....PIHE...................KEEAAE....RFR.GVQEAY
XDJ1_YEAST/9-74A.T.....VQE..IKTAYRKLALKHHPD..KY......VDQ.....................DSKEVNEIKFK.EITAAY
DNJ20_ARATH/66-130V.T.....LPE..IKQAYKQLARKYHPD..VS.....PPDR...................VEEYTD....RFI.RVQEAY
Q9SH08_ARATH/76-144A.E.....EEQ..IKVAYRRLAKFYHPD..VY.DGKGTLEE.............G......ETAEA....RFI.KIQAAY
O48828_ARATH/68-132S.T.....SQE..IKSAYRRLARICHPDVARN.....SRDN.....................SSAD....DFM.KIHAAY
P93499_PHAVU/67-131A.S.....SQE..IKAAYRRLARVCHPD..VA.....AIDR...................KNSSAD....EFM.KIHAAY
DNAJL_MYCGE/2-61A.S.....IKE..IKIAYKRLAKRYHPD..VN.............................KLGSQ....TFV.EINNAY
E1QBD3_MYCPB/2-61A.T.....LQE..IKTAYKRLAKRYHPD..IN.............................KQGAD....TFV.KINNAY
Q9SZU8_ARATH/56-120S.S.....IAE..IKASFRRLAKETHPDLIES.....KKDP.....................SNSR....RFV.QILAAY
Q26954_TRYCR/6-68A.A.....TDE..IRTAYRRLALKYHPD..KN.....GGDA.....................RAAE....KFK.KVAEAY
Q26952_TRYCR/6-67A.S.....VDE..IKRAYRRLALKYHPD..KN......KDP.....................GSQE....KFK.EVSVAY
O17002_CAEEL/8-71C.T.....DKE..IQKAYRAQCLKWHPD..KN.....LDNK....................EEAER....RFI.EAKEAF
Q9SR96_ARATH/27-88A.K.....QRE..IQKAFHKQSLKYHPD..KN......KDK.....................GAQE....KFA.EINNAY
Q9U1V9_CAEEL/107-165A.D.....EKA..IKKAWRDMSKIHHPD..RG..............................GDAQ....FFD.KIAKAH
F7FPB6_MACMU/104-162A.T.....VAE..IKKQYRLLSLKYHPD..KG..............................GDEV....MFM.RIAKAY
Q9VS57_DROME/105-164S.S.....QAE..IKKAYYRLSKVLHPD..KE.............................TGDEK....SFM.MLSKAY
O49559_ARATH/81-165A.S.....DSE..IKKAYRRLSIQYHPD..KN.....PDPGRNASWSSSLIIYCLFVYCNGTEANK....YFVESIAKAY
Q9SSD9_ARATH/99-178V.T.....DSE..IKKAYRRLSIQYHPD..KN..PDPAFDP........DSFFFYAHLLISTEANK....YFVEFISKAY
C7GRZ0_YEAS2/13-74A.T.....SSE..VHKSYLKLARLLHPD..KT.....KSDK......................SEE....LFK.AVVHAH
YD1J_SCHPO/32-107C.T.....AND..IKRKYIELVKKHHPDKMKNASQLAPTES...............PPEINKHNEE....YFR.LLLAAN
DNJ2_CAEEL/36-102EFD.....KQK..LAKAYRALARKHHPDRVKN.....KEEK....................LLAEE....RFR.VIATAY
DJC25_DROME/31-96S.S.....KSE..IGKAYRQLARRYHPD..LH....RGAEA...............K....AAAET....QFK.LVATAY
DNJC1_MOUSE/61-122A.S.....SAD..IRKAYRKLSLTLHPD..KN......KDE.....................NAET....QFR.QLVAIY
Q9VWL4_DROME/40-101A.T.....GAE..VKRAFRTLSIVLHPD..KN.....PAED......................ANI....QFR.NLVSIY
Q40868_PICGL/4-70S.S.....SAE..IRSAYRKLAMKWHPD..KW.....STDP.....................SSSETAKLRFQ.QIQEAY
Q9SSJ9_ARATH/8-74S.S.....AEQ..IRRAYHKLAKIWHPD..RW.....TKDP.................FRSGEAKR....RFQ.QIQEAY
Q0WRQ5_ARATH/29-91A.T.....SQE..IRKAYHKLALKLHPD..KN.....QDDK.....................EAKD....KFQ.QLQKVI
Q22751_CAEEL/14-80C.D.....EKA..LKKGYYRQSMRWHPD..KS...NLVEED...........M........QTYTT....KFQ.LLNKAY
Y6693_DROME/15-79A.G.....EKE..VKKAYHKLSLLVHPD..RV.....PEEQ...................KAESTE....KFK.VLSKLY
YCJ3_SCHPO/8-72A.T.....SDQ..IKESYYRLSRLFHPD..RH.....TADQ...................KAAAEE....KFQ.IIQHAY
O49475_ARATH/66-127A.D.....DEA..VKKRYRKLALLLHPD..KN......RFT.....................GAEG....AFK.LILEAW
O49476_ARATH/55-115A.D.....EEA..VKKQYKKLALLLHPD..KN......RFN.....................GAEG....AFK.LVRHAR
O49477_ARATH/56-117A.D.....EEV..VKKQYKRLALLLHPD..KN......NCE.....................GAEG....AFK.LVLAAW
Q9ZU99_ARATH/71-136T.D.....NDL..IKKQYRRLALLLHPD..KN......RFP.....................FADQ....AFR.FVLDAW
O04648_ARATH/66-127A.D.....DAT..IKKQVRKLALLLHPD..KN......QFP.....................GAEA....AFK.LVWDAS
Q9SQT7_ARATH/67-128A.N.....DVI..IKKQYKRLALLLHPD..KN......KLP.....................GAES....AFK.LIGEAQ
Q9SLA7_ARATH/66-127A.D.....DEI..VRKRYRKLAVMLHPD..RN......KSV.....................GAEE....AFK.FLSQAW
Q9VN28_DROME/708-769S.S.....QEQ..IRKHYKKIAVLVHPD..KN......KQA.....................GAEE....AFK.VLQRAF
Q9W083_DROME/7-87A.T.....KEQ..ITLAYRRLAIRLCPH..RD.....KKDE...QDFVPLAQEGRLTHLSPMGEPR....QWA.YVNMAF
P91243_CAEEL/26-91A.T.....DDE..IIKAYRKRCLMFHPDRFVD.....NDEK....................KDAER....VFV.KLRRAH
DJC13_HUMAN/1301-1362QGP.....HDESKIRKAYFRLAQKYHPD..KN.............................PEGRD....MFE.KVNKAY
O18427_GEOCY/5-64A.S.....FSD..IRKAHHRLARQYHPD..RE.....GGND........................E....KFK.EVQTAY
MU185_SCHPO/9-71S.D.....LQE..IKANYRKLALQYHPD..RN.....PGIE.....................DYNE....IFS.QINAAY
G2WDI2_YEASK/44-105S.S.....TKE..ITKNLRKLSKKYHPD..KN.............................PKYRK....LYE.RLNLAT
DJC12_MOUSE/14-76S.S.....VEQ..ILAEFKIRALECHPD..KH.....PENS.....................KAVE....TFQ.KLQKAK
C7AR00_BOMMO/17-79S.T.....VEQ..ITAEYKILALQHHPD..KN.....DGEK.....................EAEM....KFQ.KLKEAK
JDP_DROME/17-79S.S.....PEQ..IQAEYKVLALQYHPD..KN.....SGDK.....................EAEA....KFQ.QLKEAK
RSP1_SCHPO/12-75S.S.....YVE..IRQQYLKLVLRYHPD..RN.....PGRE....................AEVLP....QFQ.LIQKAH
MU184_SCHPO/12-75A.T.....FQQ..IRKQYLFLALQYHPD..RN.....PGDE....................ERAVK....RFQ.RLQLAH
O97211_LEIMA/9-69C.T.....TAE..ISQQYRRLALRYHPD..RN.....AGAT.......................VE....QFQ.RIEEAH
O80481_ARATH/70-132FCS.....HQM..IQRKYRDILVKLYPDTNKS.............................IAAKS....AFE.IINYAW
F7URT3_SYNYG/6-67S.G.....GET..IEQAYQDRLLQL.PR..RE.....FSDA.....................AVTL....RNQ.LLAIAY
Q9VNE8_DROME/3-72A.S.....FDE..IKCSYKQLILQCHPDKLRQ.....LDDP....................NPGSEAQNSDFN.AINAAW
YCJD_SCHPO/4-68A.S.....AEE..IKYAYKKAALETHPD..RV....SPSAR....................ARATE....QFQ.LVNEAY
Q9U2L4_CAEEL/27-88A.S.....PDE..IRIAFRKRIREVHPD..KC......KHP.....................SATE....ASK.VVNNAF
Q17438_CAEEL/137-198A.S.....DDD..IRKEYRKLALKLHPD..KC......RAP.....................HATE....AFK.ALGNAY
O96276_PLAF7/660-722A.S.....FDE..IKHSYRKLALQYHPD..KN.....INDP.....................EANE....KFQ.KINEAY
A0A023ZLW8_YEASX/8-73A.T.....QDE..IKKAYRNRLLNTHPDKLSK....SIHDT.....................VSNV....TIN.KIQDAY
DPH4_SCHPO/2-66TYT.....DDE..IKEAYRKALLLFHPD..KC.....KEKP.....................SVVY....TID.QVKEAY
O82623_ARATH/11-76A.S.....YEE..IRNSYRSAILHSHPDKLNN.....TSRS....................SSDDE....KFL.KIQKAW
YNF5_SCHPO/113-174C.T.....DTE..IKKSYKKLALQLHPD..KN......HAP.....................SADE....AFK.MVSKAF
Q9VFP0_DROME/106-167A.T.....DSE..IKKAYKKLALQLHPD..KN......KAP.....................GAVE....AFK.ALGNAA
DJB12_MOUSE/111-172A.S.....DED..LKKAYRKLALKFHPD..KN......HAP.....................GATE....AFK.AIGTAY
YHXB_SCHPO/9-72A.D.....GDT..IKKSYRRLAILYHPD..KN.....RENP....................EAARE....KFQ.KLAEAY
SPF31_SCHPO/31-93M.S.....VDD..IRNLYRKKSLMIHPD..KN.....RDNP.....................KAAD....AFD.ILKKAE
O80799_ARATH/315-376M.A.....ADN..MKKRYWKLSLLVHPD..KC......SHP.....................QAQE....AFV.LLNKAF
A0A023ZM90_YEASX/15-84L.DVHTIYDDLPQIKRKYRTLALKYHPD..KH.....PDNP.....................SIIH....KFH.LLSTAT
Q9VGR0_DROME/10-72S.D.....QNE..IRKAYRKKALECHPD..KN.....PDNP.....................KAVE....RFH.ELSKAL
A0A023ZD73_YEASX/6-68A.S.....SIE..IKKAYRKKSIQEHPD..KN.....PNDP.....................TATE....RFQ.AISEAY
YAY1_SCHPO/8-71A.T.....AVD..IKKAYRKLAVKYHPD..KN.....PDDP....................QGASE....KFQ.KISEAY
A0A023ZBK7_YEASX/6-68A.T.....PTE..IKKAYRRKAMETHPD..KH.....PDDP.....................DAQA....KFQ.AVGEAY
O49288_ARATH/6-67A.S.....EEE..IRKAYYIKARQVHPD..KN.....QGDP....................LAAEK......Q.VLGEAY
DNJ10_ARATH/6-68A.T.....ESE..IKKAYYIKARQVHPD..KN.....PNDP.....................QAAH....NFQ.VLGEAY
Q9SJS8_ARATH/6-68A.S.....DAE..IKKAYYLKARKVHPD..KN.....PGDP.....................QAAK....NFQ.VLGEAY
Q9XEM8_ORYSI/285-347A.S.....PAE..IKKAYYLKAKQVHPD..KN.....PGNP.....................DAAQ....KFQ.ELGEAY
Q9ST16_BRACM/135-199K.R.....IDDAVLKKEYRKKAMLVHPD..KN.....MGCP.....................LASE....SFK.KLQCAY
Q9SWW3_9EUGL/11-70A.Q.....AKE..IKAAYRRRALECHPD..KN.............................PNGGK....EFQ.RLHRAY

PF03656

TIM16_HUMAN/1-125AQE-DR-EKGQMPHT
TIM16_YEAST/1-128EKN-AK-AKAGDAST
TIM16_CAEEL/1-135LKE-EK-KKEENAKT

PF00226

Q9S729_VOLCA/114-186DIL.SD.PAKRREFD
N1P9Z9_YEASC/97-165ETL.TD.SNKRAQYD
ZUO1_SCHPO/97-164EIL.SD.PVRRRQFD
Q94216_CAEEL/98-167EQVGMS.DVKRQAFD
Q9VP77_DROME/76-145EIL.GT.SKPRRSFD
Q8SZX1_DROME/100-161NIL.TD.ETKRLEYD
DNJ13_ARATH/15-80EIL.SD.ETKRLIYD
N1P337_YEASC/538-605ETL.SD.DDKRKEYD
F7UK88_SYNYG/24-87AVL.SN.PDRRSVYD
Q3MEP6_ANAVT/8-71ATL.SN.PDRRLNYD
DNAJ1_ARATH/48-110ETL.GN.SERREEYD
Q49541_MYCHY/5-72EIL.SD.ETKRKQYD
P91189_CAEEL/379-444EVL.QD.EEKRRQFD
A8KA82_HUMAN/394-459EVL.SD.PEMRKKFD
O77048_PLAFA/35-94ETL.SD.PEKRKMYD
Q9VPQ2_DROME/25-87EVL.SN.PDKRKTYD
G1R466_NOMLE/25-87EVL.SD.SEKRKQYD
MDJ1_YEAST/61-122EIL.SD.ETKRQQYD
MDJ1_SCHPO/86-147EVL.QD.PKKKKAFD
Q9SYB3_ARATH/34-95EIL.KD.NTTRAQYD
Q22138_CAEEL/24-87EIL.SS.EDKRKAYD
Q53G26_HUMAN/93-155EVL.SD.EVKRKQYD
TID_DROVI/80-142EVL.SD.DQKRREYD
Q06166_PLAFA/1564-1627QIL.NY.EERIRMYE
A0A024XFB3_PLAFC/500-562QIL.SL.DQRRMNYN
O96277_PLAF7/195-257QIL.SN.EELRRKYN
RESA_PLAFF/523-584QVL.GD.IDKKRWYN
Q9VHW5_DROME/27-89EIL.GN.YRLRRLYD
DNJ60_DROME/26-90KTL.IK.PERRRDYD
Q9VFY1_DROME/37-98QTL.HR.VNSRQIYD
DNJC4_MOUSE/37-99RVL.SR.EESRRNYD
P91014_CAEEL/28-89DVL.RR.PADRRLYD
Q9SMS0_ARATH/106-169NVL.SD.EETRRFYD
Q9VX95_DROME/329-395SVL.SKIKSNRRRKN
A0A023ZEM2_YEASX/23-85DVL.SD.PEKKKIYD
B2S481_TREPS/22-91EVL.SD.PGRRAKFD
DNAJ_SYNE7/6-68EIL.SD.PDRRAEYQ
A0A038FCQ2_MYCTX/4-65EVL.SD.PDKRRIVD
A7BIZ8_MYCLR/10-71NVL.SD.PVKRKEYD
D6EPF9_STRLI/10-72DIL.GD.PKKRKEYD
G4FCX5_THEMA/7-70EVL.SD.PQKRAMYD
D0MFD1_RHOM4/7-69SVL.SD.PEKRRQYD
Q9ZEJ5_9NOST/9-71EML.SD.ATKRAQYD
K4NJX9_HELPX/4-65EIL.SD.EEKRRQYD
F7UM08_SYNYG/6-68DVL.SD.ETKRRELD
O15811_PLAFA/61-122ELL.SD.PKKKEFYD
O97016_LEIMA/86-147ETL.SD.PQKRSMYD
Q9SJI1_ARATH/76-138EIL.SD.PVQRMVYD
DNAJ2_STRAL/4-65EVL.SD.PQKKQVYD
DNAJM_MYCGE/7-68DVL.SN.PKKRANYD
A0A017ITF1_ECOLX/5-66EVL.SD.EQRRAEYD
DNAJ_METTH/5-66AVL.SD.DEKRARYD
P92424_PEA/71-132EVL.SD.DKKRALYD
Q9SJZ7_ARATH/86-147EVL.SD.DEKKSLYD
F7ULF8_SYNYG/4-65EVL.SE.PEIRQRYD
DNAJ2_THET8/6-67AVL.SD.PEKRRIYD
DNAJ2_AQUAE/8-69QVL.SD.PEKRKLYD
DNAJ1_AQUAE/7-68HVL.ID.DERRSEYD
DNAJ_HALS3/4-65DVL.TD.EETRQQYD
D2BNK3_LACLK/5-66ETL.SD.EQKRAAYD
DNAJ_STAAU/5-66EVL.SD.DNKRATID
F5WS97_ERYRF/6-67EVL.SD.SQKRANYD
DNAJ_GEOSE/5-66EVL.SD.DQKRAHYD
DNAJ_LACSK/6-67EAL.SD.PQKRAAYD
DNAJ_DEIRA/2-63SVL.SD.TEKRAHYD
M1QC89_METMZ/6-67AVL.SD.AEKRAQYD
DNAJ_RHOCA/5-67DVL.KD.GDKKAAYD
D5AWA5_RICPP/4-65DVL.KD.EQKRAAYD
DNAJ_MYCGE/7-74EVL.SD.EEKRKLYD
C9R3C7_AGGAD/5-67EVL.ND.KEKRAAYD
DNAJ_BUCA5/5-67EIL.IN.EEKRSAYD
A0A017J3R6_ECOLX/5-67EVL.TD.SQKRAAYD
DNAJ_HAEDU/5-67EIL.TD.DQKRAAYD
DNAJ_NITEU/5-67EIL.SD.PNKRAAYD
A0A016X8E6_VIBCL/5-67EIL.TD.AQKKAAYD
DNAJ_VIBHA/5-67EIL.TD.PQKKAAYD
DNAJ_COXBU/5-67EVL.CD.SRKRASYD
DNAJ_LEGPC/5-67NIL.SD.KQKRAAYD
DNAJ_METSS/5-67EVL.SD.EQKRAAYD
B8GWW8_CAUCN/3-65SVL.SD.PQKRAAYD
A0A038FN25_9BRAD/8-70EVL.KD.KDKRAAYD
DNAJ_RHILE/5-67EML.KD.PQKRAAYD
N7P8J4_BRUOV/4-66ETL.KD.PQKRAAYD
DNAJ_DEIPM/5-67AVL.SD.PQKRQAYD
B7J281_BORBZ/4-66EIL.ID.DNKKAKYD
B7J2L0_BORBZ/4-66EIL.SS.PDKKRNYD
F0KCP4_CLOAE/5-67QVL.SD.PDKKANYD
G7QKB2_LEPII/5-67EIL.RD.PKKRQAYD
DNAJ_FRATU/5-67EIL.SD.DSKRSRYD
I0ZK63_HELPX/4-66GVL.SD.EKKRALYD
A0A059GFC1_CAMJU/4-66EVL.SN.DEKRAIYD
DNAJ_CHLT2/2-64EVL.GD.AQKRESYD
F7UTR7_SYNYG/8-70EVL.SD.PEKRQKYD
I9PHD8_PORGN/6-68DVL.SD.PQKRSQYD
O61582_DROHE/8-75AIL.SD.AQKKSRYD
DNJC7_MOUSE/381-448TIL.SD.PKKKTRYD
Q26953_TRYCR/6-68EIL.SD.EEKRRIYD
O13303_CRYCU/6-70EVL.SD.PEKRKIYD
O96123_PLAF7/88-153EVL.SD.EEKRDIYD
A0A024XFT1_PLAFC/4-69DVL.AD.EEKRKIYD
O49457_ARATH/4-67DVL.SD.PQKRAVYD
Q9SU57_ARATH/4-68DVL.SD.PQKRQIYD
Q9VNW0_DROME/4-65EVL.FD.KEKREIYD
H2QJG7_PANTR/3-66EVL.SD.KHKREIYD
DNJB3_MOUSE/3-66EVL.SD.VRKREVYD
DNJB6_HUMAN/3-66EVL.SD.AKKRDIYD
O62360_CAEEL/28-91DVL.SD.PREREFYD
Q9W0X8_DROME/3-66EVL.SD.PQERSWYD
B3LP69_YEAS1/4-67EVL.SD.PQERAWYD
Q9W2U5_DROME/4-65EVL.SD.KKKRGSYD
DNAJ1_DROME/4-65EVL.SD.KKKRDIFD
Q9VPY9_DROME/4-65EVL.SD.KSKREVYD
H2NXT6_PONAB/4-65DVL.SD.PRKREIFD
G1RFD8_NOMLE/4-65EVL.SD.PKKREIYD
F7HQB6_MACMU/4-65DVL.SD.PKKRGLYD
Q20774_CAEEL/4-65DVL.SD.DKKKKIYD
Q9QZW8_RAT/3-66QIL.SD.AKKRKDYD
D0A3U6_TRYB9/4-67DVL.SD.EKKKKIYD
DNJB9_MOUSE/26-87ETL.SD.ANSRKEYD
B2S246_TREPS/8-70AVL.SD.RASRARYD
YL39_SCHPO/31-96GVL.SD.KKRRKHYD
Q9XWE1_CAEEL/20-82EVL.KD.ENLRKKYD
Q22028_CAEEL/17-79SVL.SD.PNKRRQYD
Q9VNW1_DROME/7-66RVL.ID.HQRRALYD
DNJ72_ARATH/3-70EVL.ND.DLKRASYN
DNJC5_MOUSE/15-77AIL.TD.ATKRNIYD
CSP_DROME/17-79SIL.SN.QTKRNIYD
Q21162_CAEEL/38-101AVL.SN.PNKRRVYD
Q26951_TRYCR/13-72SIL.SD.PARRRLYD
DNJ39_ARATH/23-85EVL.SD.PENRRLYD
Q1EBT7_ARATH/20-82NIL.SD.PEKRRQFD
Q1H5A8_ARATH/17-79SIL.SD.PEKRRHYD
A0A023ZFL0_YEASX/6-68EIL.KD.NRLRALYD
PSI1_SCHPO/6-65EVL.SD.PQRRKLYD
Q9U4X8_STRER/24-83XIL.SD.ENKRKIYD
O16303_CAEEL/13-72EVL.SS.PEKRRLYD
Q9VK35_DROME/5-64EVL.SD.PEKRRIYD
A0A024R6S1_HUMAN/8-67EVL.SN.PEKRELYD
O45502_CAEEL/6-65EVL.SD.EKKRQIYD
E2RM09_CANFA/6-65EVL.SD.AKKRELYD
A0A023ZEG7_YEASX/21-82EVL.SN.EEKRSIYD
MAS5_SCHPO/6-65EIL.AD.EEKRATYD
MAS5_YEAST/6-67EIL.SD.PEKRDIYD
Q9U062_GIAIN/6-65EVL.SD.PTKRENYD
N1NY39_YEASC/6-65EIL.ND.PQKREIYD
O24074_MEDSA/14-72EVL.SD.PEKKELYD
DNJH2_ALLPO/13-71EVL.ND.PEKREIYD
O43978_BABBO/14-72EVL.SD.PEKRRIYD
O96455_DICDI/5-66EVL.SD.TEKRELYD
XDJ1_SCHPO/6-70DIL.KD.PESREMYD
XDJ1_YEAST/9-74EIL.SD.PEKKSHYD
DNJ20_ARATH/66-130ETL.SD.PRRRVLYD
Q9SH08_ARATH/76-144ELL.MD.SEKKVQYD
O48828_ARATH/68-132CTL.SD.PEKRAVYD
P93499_PHAVU/67-131STL.SD.PDKRANYD
DNAJL_MYCGE/2-61SIL.SD.PNQKEKYD
E1QBD3_MYCPB/2-61AVL.SD.TTQKAEYD
Q9SZU8_ARATH/56-120EIL.SD.SEKRAHYD
Q26954_TRYCR/6-68EIL.SD.PTKRRHYD
Q26952_TRYCR/6-67ECL.SD.PEKRTRYD
O17002_CAEEL/8-71DFL.YD.KEKREEYD
Q9SR96_ARATH/27-88EIL.SD.EEKRKNYD
Q9U1V9_CAEEL/107-165QAL.TD.KEARENWE
F7FPB6_MACMU/104-162AAL.TD.EESRKNWE
Q9VS57_DROME/105-164QAL.TD.DVAKENYE
O49559_ARATH/81-165QAL.TD.PLSRENFE
Q9SSD9_ARATH/99-178QAL.TD.SVSRENFE
C7GRZ0_YEAS2/13-74SIL.TD.EDQKLRYD
YD1J_SCHPO/32-107ALL.SD.KRRREEYD
DNJ2_CAEEL/36-102ETL.KD.DEAKTNYD
DJC25_DROME/31-96EIL.RD.EESRTDYD
DNJC1_MOUSE/61-122EVL.KD.DERRQRYD
Q9VWL4_DROME/40-101EVL.KD.PSRREKYD
Q40868_PICGL/4-70SVL.SD.DTKRALYD
Q9SSJ9_ARATH/8-74SVL.SD.ERKRSSYD
Q0WRQ5_ARATH/29-91SIL.GD.EEKRAVYD
Q22751_CAEEL/14-80QIL.SD.EEKRKIYD
Y6693_DROME/15-79QVL.TD.TQKRALYD
YCJ3_SCHPO/8-72EVL.SD.PSKKEIYD
O49475_ARATH/66-127DLL.SD.KSQRSSYD
O49476_ARATH/55-115DLL.SD..QPCLIYN
O49477_ARATH/56-117CLL.SD.KVKRIAYD
Q9ZU99_ARATH/71-136EVL.ST.PTKKSQFD
O04648_ARATH/66-127RFL.AD.KDKRSQYD
Q9SQT7_ARATH/67-128RIL.LD.REKRTLHD
Q9SLA7_ARATH/66-127GVF.SD.KAKRADYD
Q9VN28_DROME/708-769ELI.GE.PENRLIYD
Q9W083_DROME/7-87DVL.GN.DLYRAIYD
P91243_CAEEL/26-91EVL.LD.PKQRAIYD
DJC13_HUMAN/1301-1362EFL.CT..KSAKIVD
O18427_GEOCY/5-64EIL.SD.SEKREMYD
MU185_SCHPO/9-71NIL.SN.DDKRKWHE
G2WDI2_YEASK/44-105QIL.SN.SSNRKIYD
DJC12_MOUSE/14-76EIL.CN.AESRARYD
C7AR00_BOMMO/17-79EIL.CD.PSKRALYD
JDP_DROME/17-79ETL.CD.PEKRAIYD
RSP1_SCHPO/12-75EVL.KD.PKLRELFD
MU184_SCHPO/12-75EVL.SD.ATKRLIYD
O97211_LEIMA/9-69RVL.SD.LRQRQLYD
O80481_ARATH/70-132KIL.SD.PEKRKDYN
F7URT3_SYNYG/6-67ETL.RD.PEKRQAYD
Q9VNE8_DROME/3-72NTL.KD.PIRRKHYD
YCJD_SCHPO/4-68YVL.SD.NSRRAQYD
Q9U2L4_CAEEL/27-88SLL.MD.PAKRRQYD
Q17438_CAEEL/137-198AVL.SD.TDKRRQYD
O96276_PLAF7/660-722QVL.SD.ENRRKMYD
A0A023ZLW8_YEASX/8-73KIL.SN.IKTRREYD
DPH4_SCHPO/2-66QVL.SS.EKDRQQYQ
O82623_ARATH/11-76EVL.SD.AELRVVYD
YNF5_SCHPO/113-174QVL.SD.PNLRAHYD
Q9VFP0_DROME/106-167GVL.TD.AEKRKNYD
DJB12_MOUSE/111-172AVL.SN.PEKRKQYD
YHXB_SCHPO/9-72QVL.SD.PKLREKYD
SPF31_SCHPO/31-93SDL.VN.DKIRESLD
O80799_ARATH/315-376KEL.QD.PEKRKAMD
A0A023ZM90_YEASX/15-84NIL.TN.ADVRPHYD
Q9VGR0_DROME/10-72EIL.TD.ESARAAYD
A0A023ZD73_YEASX/6-68QVL.GD.DDLRAKYD
YAY1_SCHPO/8-71QVL.GD.EKLRSQYD
A0A023ZBK7_YEASX/6-68QVL.SD.PGLRSKYD
O49288_ARATH/6-67QVL.SD.PVHREAYD
DNJ10_ARATH/6-68QVL.SD.SGQRQAYD
Q9SJS8_ARATH/6-68QVL.SN.PDKRAAYD
Q9XEM8_ORYSI/285-347QVL.SD.PSKREAYD
Q9ST16_BRACM/135-199EVL.SD.IVKKRDYD
Q9SWW3_9EUGL/11-70ETL.ID.PQLRRDYD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window