Sequence alignment for CL0393

PF02952

FUCI_CLOPE/394-557LINSGASALDG...TAAAKDKDGNKTMKEFWNMTNEDVQSCLKATDWCRANYEYFRGG....GFSSHFKTEAELPV-TLI
Q9WYE3_THEMA/335-473LCNSGNHATYF...AARS.................FDPDENMKKVEFYPQTFYFPAGG......AAVKHIAAPGKV-TLG
A8F6V5_THELT/337-465LFHCGNFP.........P.................SLYESV.EIRYADVIGTTVGNQN....AYGACAGKIKSGPF-TFL
A8F356_THELT/333-468LCNSGEHATFF...AAKS.................YDPAVNLAKVELYPESFYFPAGG......ASVRHIAAPGEV-TLA
A9BGR2_PETMO/333-471LANSGQHATYF...AGKS.................NKPEENLKNVIIHPEDFYFPAGG......GAVKHFAAPGRV-TLA
FUCI_BACTN/391-555LINSGATTLDG...SGQSLDAEGNPVMKEPWNLTDADVENCLKATTWYPADRDYFRGG....GFSSNFLSKGGMPV-TMM
B8CWP4_HALOH/403-566LINSGSATLDG...TGQQTKNGRPVM.KPFWEISSEEVEACLEATSWRPAMLDYFRGG....GFSSNYLTKGGMPL-TMI
Q2NWL9_SODGM/391-555LINSGSAALDG...ACRQRDAQGRPTIKPHWEITQQEAATCLAATEWCPAIHEYFRGG....GFSSRFLTLGGVPF-TLS
Q029Q0_SOLUE/342-470CFHCSNLP.........K.................HFFKSV.KMDFQQIIAGTVGREN....TYGTCEGLVKASPM-SYA
A4XJ56_CALS8/403-566LINSGSAALDG...TGQQEIDGKPAI.KPFWEITEEEVRKCLETTRFCYANLGYFRGG....GFSTKFVTRGGMPV-TIS
A6KXB1_BACV8/344-473CTHCGNFP.........K.................SFVMNDLKLGTLGVLGRTLGKVH....TFGAVYGKVKQGDF-TFF
Q1AXS8_RUBXD/331-469LVNSGQHATWF...AERS.................DDPAENLRRVHLYPEGFYFPAGG......ASVHHLAAPGEF-TFA
Q6AA51_PROAC/155-317FRNSGASTLNA...TECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGG....GFSTHFTTVGDTTV-TAV
Q9X048_THEMA/338-466LFHCGNFP.........A.................SIYEEKPEIKYADVIGTTVGKER....AYGACAGKIKTSPF-TFL
A9KRB9_CLOPH/347-477GFHCGNTP...........................SKKLSSCSMKNQKIMARSLEPNQEPNITRGTLEGDIAPGEI-TFF
A4F8A7_SACEN/331-469LCNSGQHATWF...AARS.................DDPAENLAKVNFYPEVFFFPAGG......ASVQHIAAPGQM-TLG
A8F6D0_THELT/342-469MFHCSNFP.........V.................SFFESC.QMSYQDIIAGTVGKEN....TYGTCVGRVSPGPA-TFL
A6T621_KLEP7/334-462LFHCGNFA.........S.................ASLESP.HMGTADIIGTTVGKEN....TCGAVHGRMKSGAL-TYF
A6VKQ1_ACTSZ/343-471MFHCGNYA.........T.................DELINP.FMATADIIGTTVGCEN....TCGAINGRMKAGPL-TYC
H3ZNG4_THELN/348-480IANCGASSLYY...AKLS.................ENPEENLKETTIQGQCQGKSGG........ALTYRTPPTKL-TVA
FUCI_HAEIN/389-553LINSGSAALDG..TGEHQDAQGNPTL.KPAWDVTEEEAKRCLENTRWCPAVHEYFRGG....GLSSQFLTKGGIPF-TIH
FUCI_ECOLI/390-554LINSGSAALDGSCKQRDSEGNPTMK...PHWEISQQEADACLAATEWCPAIHEYFRGG....GYSSRFLTEGGVPF-TMT
FUCI_STRR6/388-551LINSGSCTLDG...TGQATRDGKPVM.KPFWELDESEVQAMLENTDFPPANREYFRGG....GFSTRFLTKGDMPV-TMV
R5UE78_9FIRM/350-476GFHCGNTA...........................SSKLSFCEMKYQMIMARALPEEV....TQGTLEGDIIPGDI-TFF
R6NEA5_9CLOT/335-467FCNCGSQSTYY...AAAS.................DDPRENLKKVTLYPCLDIYAGGG......CHVNLMTKPGKA-TIA
R6P4I7_9CLOT/388-552LINSGAAALDA...TGASTDENGNHVMKKWYDMTDADIDGCLKATDWCHADLGYFRGG....GFSSHFKTQAEMPV-TMV
R7D735_9FIRM/30-158LFHCGSCA.........Q.................SLMTKKGTVTSHKMFDKG.DPGS....GWGTNEGRIHPFKT-TIS
R7EMR5_9BACE/396-559LINSGSCTLDG...TGCQTRDNKPVM.KPFWEITEEEVEACLSVTKWHPASREYMRGG....GYSSQFLTRGEMPV-TMC
W8UNN4_YEREN/319-447LFHCGNFA.........S.................ESLESS.TMGTADIIGTTVGCEN....TCGAVHGRMKSGPL-TYF

PF11762

ARAA_AERHH/362-475-----------------------------------------KPVLDAQHLGIG.KKA.----DPARLLFAAPAGKA.VNA
G8NQI5_GRAMM/357-470-----------------------------------------KPSLEVHPLGIG.GKA.----DPVRLVFTAPSGPA.VVA
I3VUU9_THESW/358-464-----------------------------------------......RELGIG.KLD.----NPPTVVFMAQPGIA.TLA
C6WE68_ACTMD/362-475-----------------------------------------TPSCEIHPLGIG.GRE.----DPVRLVFDAVEGPA.TVI
ARAA2_CLOAB/360-473-----------------------------------------KPKVIVKPLGIG.DKE.----DPARLIFNGSTGKG.VAV
ARAA_NOCSJ/363-476-----------------------------------------RPSLEIHPLSIG.GRE.----DPVRLVFDAAPGPA.VLL
E8NFA8_MICTS/365-477-----------------------------------------KPRLEIHELGIG.GKD.----DPVRLVFTADAGPA.LVV
D1BB87_SANKS/363-476-----------------------------------------RPSLEVHPLGIG.GKE.----DPVRLVFNTDPGPA.VVV
J9W3V5_LACBU/147-259-----------------------------------------KPRVEVHPLGIG.GKD.----DPARLVFDGIDGDA.MDV
ARAA_TOLAT/362-475-----------------------------------------KPVLDVQRLGIG.QKA.----PPARLLFSAPAGKA.VNA
G4KWX5_OSCVS/354-467-----------------------------------------KPRIEVHPLAIG.DRE.----PPARLVFEGAAGKG.CVI
W0F0P7_9SPHI/362-475-----------------------------------------KPSCEIHPLGIG.GKE.----DPVRLVFNVASGNA.LNA
R5CHM2_9BACT/368-481-----------------------------------------KPRLEVHHLGIGVRKA.----PTARLVFTSKVGKG.VTA
F9D4Y7_PREDD/374-487-----------------------------------------KPRLEVHFLGIGVRKT.----PTARLVFTTKQGHG.ITA
K0J806_AMPXN/360-473-----------------------------------------KPKIVVQPLGIG.NRE.----DPARLVFDSKGGEA.INV
ARAA_OPITP/364-476-----------------------------------------KPSLEIHPLGIG.GKE.----DPVRLVFDAPAGPA.LNA
D7CXK8_TRURR/363-475-----------------------------------------RPRLEVHPLSIG.GKA.----DPVRLVFDAPPGRA.VNA
C7MA46_BRAFD/363-476-----------------------------------------KPTLEIHPLGIG.DRE.----DPVRLKFTADPGPA.VVV
R6UBU5_9FIRM/353-466-----------------------------------------RPRIEVHPLGIG.GKN.----PPARLVFEGKEGPG.IVV
ARAA_MYCS2/362-475-----------------------------------------TPSLEVHPLGIG.NRE.----DPVRLRFTAAPGSG.VVL
Q08PR5_STIAD/363-476-----------------------------------------KPSLEIHPLDIG.GKA.----DPCRLVFEAAAGPA.VNA
G8QYG4_SPHPG/358-471-----------------------------------------RARIEVHKLGIG.GKE.----PPARLVFEGHSGNA.VVA
ARAA_VIBPA/361-474-----------------------------------------KPRLEVHRHTIG.CRC.----DIPRLIFSGQSGEA.LNV
R7L0Y8_9FIRM/197-310-----------------------------------------QPKIEVHPLGIG.GKS.----DPARLVFEGVTGEG.IAV
ARAA_ARTAT/372-485-----------------------------------------KPRVEIHPLGIG.GKE.----DPVRMVFDTDAGPG.VVV
F5XQM8_MICPN/360-473-----------------------------------------RPRIEVHPLGIG.NRD.----DPVRLVFDAAPGPA.TIL
C5C1A5_BEUC1/376-489-----------------------------------------KPRVEIHPLGIG.GRE.----DPVRLVFDTDPGPG.IVV
E3D8R2_GARV3/365-479-----------------------------------------KPRLAIYPLGIG.GKS.----DPVRLVFTAAPKKDAVVV
K4IPK0_BIFAP/364-478-----------------------------------------RPRLEIHPLSIG.DRE.----DPVRLVFTATPCSDAVVV
Q3Y1E5_ENTFC/360-473-----------------------------------------KPRIVVSPLSMG.DRE.----DPARLVFDGKAGEG.VVV
B2GE08_LACF3/360-473-----------------------------------------KPRVEVHPLGIG.GKD.----DPARLVFTGAEGKG.YDI
ARAA_FLAJ1/362-475-----------------------------------------KPSCEVHPLGIG.GKE.----DPARLVFNSPAGDA.INV
I0K9C7_9BACT/360-471-----------------------------------------..RAEVHPLGIG.GKA.----DPVRLVFDCPAGPA.LNA
D3ELR3_GEOS4/359-472-----------------------------------------KPTLEVHPLGIG.GKG.----DPARLVFNGQDGPA.VNA
I2BCV0_SHIBC/363-476-----------------------------------------KPLLDVQHLGIG.GKD.----DPARLIFNTRPGAA.LNA
R5ICF8_9FIRM/351-465-----------------------------------------RPRIETHFLGIG.MNEK----DPARLVFEGKAGKG.VVT
F8I0I8_WEIKK/360-473-----------------------------------------KPRVEVHPLDIG.GKD.----DPARLVFTGKAGDA.VDV
F2NAF4_CORGP/368-477-----------------------------------------....RECPLSMG.ERE.----DPARLVFTSKTGPA.IAT
ARAA_KORVE/361-474-----------------------------------------KPSCEIHPLSIG.GKG.----DPVRLVFDSQTGPA.VVA
F7PLJ6_9EURY/368-480-----------------------------------------QPRLEIHPLDIG.GKA.----DPVRAVFDADTGPA.INA
D7AYL1_NOCDD/368-477-----------------------------------------...LVKRPLGIG.GLG.----DPPTIVFRYRPGPA.TLA
ARAA1_CLOAB/360-473-----------------------------------------KPRVVVKPLGIG.DKE.----APARLIFDGVVGDG.VVV
ARAA1_BACLD/355-468-----------------------------------------KPRIEVHPLSMG.AKD.----DPARLVFDGIAGPA.VNV
R5IL32_9FIRM/351-463-----------------------------------------RPYLKNRVLSEG.GLS.----NPPTPIFTPEPGRA.CIL
L7VKE3_CLOSH/358-471-----------------------------------------KPRIEVHPLSIG.GKA.----DPARLVFKGRSGPA.IAA
ARAA_BACSK/353-466-----------------------------------------KPEIVVAPLSMG.NRE.----DPARLVFKGKAGRA.LNA
M9WXH1_PASHA/140-253-----------------------------------------KSTLAIRPLGIG.GKA.----DPVRLIFSSKAGKA.VNA
R5Y2U1_9BACE/283-395-----------------------------------------KPKLEVHPLGIG.GKN.----DPARLVFTSKQGPG.VAA
R6G4Q0_9FIRM/366-477-----------------------------------------..SIKVNPLSMG.DRE.----DPARLVFTSKTGPA.IAT
F0RWU5_SPHGB/358-471-----------------------------------------KAHIEVHELGIG.GKE.----PPARLVFEGHPGKA.LLA
ARAA_BIFAA/365-478-----------------------------------------KPKLAIYPLGIG.GKS.----DPVRLVFSGKPADA.VVV
X2H637_9GAMM/364-477-----------------------------------------KPLLDIQHLGIG.NKA.----DPARLIFPSKPGLA.INA
L0KAW4_HALHC/362-475-----------------------------------------KPVLDVHPLGIG.GKD.----DPARLIFDTASGSA.VNA
E1R2G0_SPISS/362-475-----------------------------------------KPKAEIHPLSIG.GKS.----DPVRLVFSPPAGSA.LNA
I4D2R7_DESAJ/360-473-----------------------------------------RPRIEVHPLSIG.GKA.----DPARLVFDGAAGPA.ICA
L0EBW3_THECK/357-470-----------------------------------------KPRIEVHPLGIG.GKE.----PPARMVFGARAGAA.INA
F0LQV9_VIBFN/361-474-----------------------------------------KPKLEVHLHTIG.LRC.----DVPRLLFSGREGPA.VNV
ARAA_CLAMS/366-479-----------------------------------------RPSLEIHPLGIG.GRE.----DPVRLVFDTDPGPA.VVV
ARAA_MANSM/361-474-----------------------------------------KPILDIKPLGIG.GKE.----DPARLIFTSKSGKA.TAS
X5D7D5_9BACT/365-477-----------------------------------------KPTLDVLPLGIG.GKN.----DPARVIFKSKTGPG.VAA
E8U476_DEIML/375-487-----------------------------------------KPRVEVHPLGIG.GKD.----DPVRLVFDARPGAA.LNA
ARAA_SACD2/361-474-----------------------------------------KPKVVVERHTIG.IKK.----DIARLIFTGTPGPA.INI
F4KX39_HALH1/362-475-----------------------------------------KPSCEVHPLGIG.GKA.----DPVRLVFNCAAGPA.LNA
ARAA_CELJU/361-474-----------------------------------------KPKLEVHLHTIG.CRN.----DIARLIFTGKTGPA.LCI
A5VIS6_LACRD/359-472-----------------------------------------KPRVEVHPLDIG.GKD.----DPARLVFTGREGKA.VDV
D2QL49_SPILD/362-475-----------------------------------------KPTCEIHPLGIG.GKA.----DPVRLVFNAPAGPA.INV
F6EQZ3_AMYSD/363-476-----------------------------------------RPRLEIHPLGIG.GRE.----DPVRLVFDTEPGEG.VVV
E4T864_PALPW/361-473-----------------------------------------KPRVEVHFLGIG.DAG.----VCARLIFQAHEGEG.VAA
ARAA_ERWT9/363-476-----------------------------------------RPLLDVQPLGIG.GKA.----DPARLIFAAKAGRA.VNA
F4GHN4_SPICD/358-471-----------------------------------------RPRIEVHPLGIG.GKG.----DPARLVFEGMPGKG.IVA
W8F6M3_9BACT/360-473-----------------------------------------KVKVQVHPLGIG.GKA.----DPARLVFNCPAGPA.LNA
C7PZQ9_CATAD/358-471-----------------------------------------RPRLELHPLSIG.GRE.----DPVRLVFDAAPGPA.FVT
B8I9D5_CLOCE/358-463-----------------------------------------......RPLDIG.GLG.----NPPTPKFNVEPGTA.TLV
D5DIR9_BACMD/360-473-----------------------------------------KPKLLVSPLGIG.NRE.----DPARLVFDGKQGEG.VVV
T0U7T8_9ENTE/360-473-----------------------------------------KPKIVVSPLSMG.DRE.----DPARLVFDGQGGAG.VVV
ARAA_THEMA/358-471-----------------------------------------KPRIEVHPLSIG.GKA.----DPARLVFDGQEGPA.VNA
R4T8N8_AMYOR/362-475-----------------------------------------KPSCEIHPLGIG.GRE.----DPVRLVFDAAAGDA.VVI
ARAA_ACIC1/363-476-----------------------------------------TPRCEIHPLLMG.GRE.----DPVRLVFTADPAPA.VIV
F8F2D2_TRECH/363-476-----------------------------------------KPRIEVHPLGIG.GKK.----DPARMVFDAASGPA.VCA
W5XCN2_9BACT/352-464-----------------------------------------KPRLEVHPLGIG.GKA.----DPARLVFDAPAGPA.LNA
ARAA_BACSU/359-472-----------------------------------------QPKIEVHSLSIG.GKE.----DPARLVFNGISGSA.IQA
ARAA_SERP5/363-476-----------------------------------------KPLLDIQPLGIG.GKA.----DPARLIFSTPAGPA.VNA
F4CCR5_SPHS2/362-475-----------------------------------------KPRLEVHPLGIG.GKA.----DPARLVFNAAGGKA.LNA
F2JLF2_CELLD/357-470-----------------------------------------KPRIEVHPLGIG.GKE.----APARLVFDSKPGKA.ICV
R7EHA6_9BACE/363-475-----------------------------------------KPKLEVHRLSIG.IDS.----ETARLVFTSKQGEG.VAA
R7A8L4_9CLOT/351-464-----------------------------------------KPEIDVIPLGIG.GKE.----DPARLIFDGVTGDG.IQV
H6NJH3_9BACL/360-473-----------------------------------------RPKLEVHPLGIG.GKA.----DPARMVFDGRSGSA.INA
D5EX27_PRER2/372-485-----------------------------------------KPKLEVHFLGIGIRKQ.----QTARLVFTSKTGAG.IKA
F8I827_SULAT/359-471-----------------------------------------TPRIEVWPLSIG.SKE.----DPARLVFDARPGEA.VVA
ARAA_LEPCP/363-476-----------------------------------------KPLLDVQPLSIG.KKD.----DPARLIFSAKPGRA.IHS
I2F7F6_9THEM/370-483-----------------------------------------TPSLEVHPLSIG.GKE.----PPTRLVFNAKAGPA.VQA
ARAA_LACPL/360-470-----------------------------------------KPRVEVHPLDIG.GKD.----DPARLVFTGSEGEA.IDV
D2S421_GEOOG/362-475-----------------------------------------RPRVEVHPLAIG.GRE.----DPARLVFTAAPGEG.VVV
F4FFB1_VERMA/362-474-----------------------------------------.PNVEIHPLSIG.GRE.----DPVRLVFDAAPGPA.VVL
I3Z536_BELBD/362-475-----------------------------------------KPTCEVHPLGIG.GKE.----DPVRLVFNGKAGAS.LNA
ARAA_BIFA0/365-479-----------------------------------------KPRLEIHPLGIG.GKA.----DPVRLVFTVAPKKDAVVV
F0S519_PEDSD/362-475-----------------------------------------KPSLEVHPLGIG.GKA.----DPARLVFNVRKGAA.LNA
K9ZZZ3_DEIPD/378-490-----------------------------------------TPRVEVHPLGIG.GKE.----DPVRLVFDAQHGPA.VNA
A9GMQ1_SORC5/364-477-----------------------------------------RPSLEIHPLSIG.GKG.----DPCRLVFDAGVGPA.VNV
T0TIM9_9STRE/344-457-----------------------------------------KPKISVNPLGIG.GKE.----DPARLIFDGKAGSG.VVV
K7S5L2_PROA4/364-477-----------------------------------------KPSLEIHPLDIG.GRE.----DPVRLVFDADPADG.LVV
ARAA_BACHD/360-473-----------------------------------------QPEIQVHPLGIG.GKE.----DPARLVFDGADGPA.LNA
ARAA_PEDPA/360-473-----------------------------------------TPRVEVHPLDIG.GKE.----DPARFVFTGMEGDA.VDV
ARAA_CLOB8/354-467-----------------------------------------KPVIEVHPLGIG.GKE.----DPARLVFKGASGPA.VAA
G4L5E1_TETHN/360-473-----------------------------------------KPRVEVHPLDIG.DKD.----DPARLVFQGIDGDA.VDV
G0GF07_SPITZ/358-471-----------------------------------------RPRIEVHPLSIG.GKA.----DPARLVFEAAPGPA.LNA
A8FFH6_BACP2/360-472-----------------------------------------KPVIVVSPLGIG.NRE.----DPARLVFDGKAGEG.VVV
D4KH26_9FIRM/358-471-----------------------------------------TPKIEVHELGIG.GKD.----APARLVFEGKAGSA.IVA
B5I630_9ACTO/366-479-----------------------------------------RPSCEIHPLSIG.GRE.----DPVRLVFNAAEGPA.VVV
W0RQ98_9BACT/362-475-----------------------------------------KPSLEVHPLSIG.GKA.----DPVRLVFDAKTGPA.VNA
G8TPU2_NIAKG/362-475-----------------------------------------KPTVEIHPLGIG.GKA.----DPVRLVFNAGSGPA.LNA
J9W8J2_LACBU/360-469-----------------------------------------KPRVEVHPLDIG.GKA.----DPARLVFSGRAGDA.MDI
ARAA_GEOKA/360-473-----------------------------------------RPRVEVHPLSIG.GKE.----DPARLVFDGGEGAA.VNA
R6W8G7_9BACT/378-489-----------------------------------------..RLEVHHLGIGIRKQ.----QTARLVFNSKVGDG.VTA
E4NJM4_KITSK/362-475-----------------------------------------TPSCEIHPLGIG.GRE.----DPVRLVFDAAPGPA.TVV
C6Y105_PEDHD/362-475-----------------------------------------KARLEVHPLGIG.GKA.----DPARLIFNVAGGHA.LNA
W0J969_9BACT/368-481-----------------------------------------KPSVEVHPLGIG.GKE.----DPVRLVFTAPAGDA.LNA
C7R0A3_JONDD/363-476-----------------------------------------KPRLEIHPLGIG.GKE.----DPVRLVFTADAGPA.VVV
D3Q981_STANL/344-452-----------------------------------------.....KRPLGIG.KLA.----DPPTFLFRYQPGPA.TLA
I0IIQ8_PHYMF/365-478-----------------------------------------RPRCEAHPLGIG.GKD.----DPVRLVFDAAAGEA.TNA
G0IWC3_CYCMS/363-474-----------------------------------------..RCEVHPLGIG.GKD.----DPVRLVFDAAAGPA.LNA
F6FX69_ISOV2/363-477-----------------------------------------KPRVEIHPLGIG.GKE.----DPVRMVFDADATEGAVVV
E6K2X8_PARDN/375-489-----------------------------------------KPSLEIHPLGIG.GRE.----DPVRLVFTATPKKDAVVV
C6W0K9_DYAFD/362-475-----------------------------------------KPSVEIHALGIG.GKE.----DPVRLVFNAPAGPA.LNV
R6QHN9_9FIRM/353-466-----------------------------------------KPKIQVHPLGIG.DRE.----DPARLVFKAQTGNA.IVV
I0GUK3_SELRL/360-473-----------------------------------------KPKVEVHPLDIG.GKD.----DPARLVFSGIDGDA.VDV
D9SUV4_CLOC7/353-466-----------------------------------------KPTIEVHELGIG.DRE.----APARLVFNGGSGSA.IQV
C6CYJ7_PAESJ/361-474-----------------------------------------KPRIEVHPLGIG.GKA.----DPARIIFDGKAGEA.VNA
E3IY19_FRASU/371-484-----------------------------------------RPTVEIHPLSIG.GRE.----DPVRLRFTAAPGPG.VVV
ARAA_KLEP7/363-476-----------------------------------------KPILDVQPLGIG.GKA.----DPARLIFNTQTGPA.IVA
G2TLS2_BACCO/360-473-----------------------------------------KIRVEVHPLGIG.DRE.----DPARLVFDGTDGDA.VNL
D7GCD1_PROFC/367-480-----------------------------------------RARLEIHPLDIG.GKS.----DPVRAVFTADPGPA.VVV
E6TRV5_BACCJ/359-472-----------------------------------------QPEIQVHPLSIG.GKA.----DPARMVFDGMGGEA.VNV
I3ZFQ1_TERRK/357-470-----------------------------------------RPSLEVHPLGIG.GKA.----DPVRLVFTAPAGPA.VVA
U5RY22_9CLOT/360-473-----------------------------------------KPRVVVKPLGIG.DRE.----DPARLIFNGSTGKG.TSM
R6NRX0_9FIRM/356-469-----------------------------------------KPKIQVHPLGIG.GKS.----DPARLVFDSKNGDA.IVA
L0FW63_ECHVK/362-475-----------------------------------------KISCEVHPLGIG.GKE.----DPVRLVFNGAGGNG.LNA
F7YIC2_VIBA7/361-474-----------------------------------------KPKIEIHRHTIG.CKC.----DIARMMFSGKAGPA.VNV
F8EK79_RUNSL/362-473-----------------------------------------..KCEVHPLGIG.GKE.----DPVRLVFNAAAGPA.INV
C8WV64_ALIAD/359-472-----------------------------------------RPSVEVHPLSIG.GKE.----DPARLVFDGASGPA.VQA
I6YRU9_MELRP/362-475-----------------------------------------KPMLEIHPLSIG.GKD.----DPPRLVFDVAPGNA.LNA
G0L5A7_ZOBGA/364-475-----------------------------------------..SCEIHPLGIG.GKE.----DPVRLVFNAGVGRA.LNA
E8X4F6_ACISM/356-469-----------------------------------------KPSLEVHALGIG.GKG.----DPARLVFTAPDGPA.VCA
D6XWP1_BACIE/358-471-----------------------------------------KPEIKVHPLGIG.GKD.----DPARLVFNGQGGKG.VNV

PF02952

FUCI_CLOPE/394-557RVNLIKG-IGPT.LQIAEGYTCVIDED..IHQILDERTDKTWPTTWFAPNL.GECGFETVYDVMNHWGANHGAFVHGHIG
Q9WYE3_THEMA/335-473RLT..RE-DGRYRFTVVPGEFVDFGEE..KNYEIADSIQNNWPHAFLKMETPID.......EFLAKYSSNHIHGVYGDYV
A8F6V5_THELT/337-465RLSTEDI-NGSVKGYVGEGEILSQNPK..TFGSRGIAKISNL.DGLMN.............YICLEGFEHHVAINLSRIA
A8F356_THELT/333-468RLT..RK-NGEYVMTVIKGEFLDFGEQ..KNEEKARNTQIEWPHAFAKLKISAD.......DFLATYSSNHIHGVYGDYV
A9BGR2_PETMO/333-471RLA..RQ-DGNYVMTIVPAEFVELSEE..EKKRLSEQVQIEWPHAYAKLDTDME.......TFLEYYPCNHTHGVYGNYI
FUCI_BACTN/391-555RLNLIKG-LGPV.LQIAEGWTVEIDPE..IHQKLNMRTDPTWPTTWFVPRLCDKSAFKDVYSVMNNWGANHGAISYGHIG
B8CWP4_HALOH/403-566RINIIKG-LGPV.LQIAEGYSVDLPED..VHRILDQRTDPTWPTTWFAPILTGKGAFKDVYSVMNRWGANHAAVSYGHIG
Q2NWL9_SODGM/391-555RINLIRG-LGPV.MQIAEGWSVDLPPA..IHKHLDNRTNATWPTTWFVPRLTDRGPFKNVWSVMAHWGANHGVLTAGHVG
Q029Q0_SOLUE/342-470RFSTNDL-EGTIDGYVGEGEFTDDPLT..TFGGAGVVKIPNL.QRLLR.............FICENGFEHHVAANMSNVA
A4XJ56_CALS8/403-566RLNIVKG-LGPV.LQIAEGWTVELPPN..VHEILDRRTDPTWPTTWFVPKLTGKGAFKSAYSVMENWGANHCAITYGHVG
A6KXB1_BACV8/344-473RISTDDT-KGCIKSYLGKGDLTDDPYG..MDGCIAVTKVDNL.QPLMK.............YICKNGFEHHVAMCRGNVK
Q1AXS8_RUBXD/331-469RLT..RK-GGRYRMHVLKGSFERYDEA..TNEELMRQSTYEWPHAFARFEAAAD.......EVLSRYGSNHIHAVPGDRV
Q6AA51_PROAC/155-317RMNMVAG-VGPT.LQIVEGRT..LPDE..GTDTIVERADPTWPTTFFVSRIPSSGAFSSVYDWMDKWGANHTSTGYSHIG
Q9X048_THEMA/338-466RLTTDDN-EGKVKAYVGEGQILDENPK..TFGSRGVARIEKL.QELMK.............YICENGFEHHVAINLSRVA
A9KRB9_CLOPH/347-477RLQS.TA-DTVLRAYVAEGEVLPVPTQ..SFGSIGVFAIPEMKRFYRH.............VLVEKNYPHHGAVAFGHFG
A4F8A7_SACEN/331-469RLT..RE-DGQYRLQLMLGEFESYDEA..TNKVLMDQSTPEWPHAFARLDAPGE.......VFLSKFGANHIHAIPGDHR
A8F6D0_THELT/342-469RLSTFDN-EGIIAGVIAEGRFTEDNVK..TFGGYGVVEIPNL.QSLLK.............TITQNGFEHHVAVSKSNVG
A6T621_KLEP7/334-462RLSTDDL-TGEIKAYVGEGQSVDDPLD..TVGCRAVIQVPHL.ENLLS.............WICRNGFEHHVAMNHSASA
A6VKQ1_ACTSZ/343-471RISTDEF-TGKVKAYVGEGKFVDDDLD..TVGCRAVIQVKGL.EDLLA.............YICNNGFEHHVAMNHSSTA
H3ZNG4_THELN/348-480RLI..RK-GGEYYLLYFLAEGVEITEE..IESKL..KWGKQWPHTAIRNPLDKE.......KFLNIMGANHLSAVPGDFT
FUCI_HAEIN/389-553RINLIKG-LGPV.LQIAEGWSIDLPQD..VHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATHGHVG
FUCI_ECOLI/390-554RVNIIKG-LGPV.LQIAEGWSVELPKD..VHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVG
FUCI_STRR6/388-551RLNLLKG-VGPV.LQIAEGYTLELPED..VHHTLDNRTDPGWPTTWFAPRLTGKGAFKSVYDVMNNWGANHGAITYGHIG
R5UE78_9FIRM/350-476RLQS.TA-DCKLRAYIAQGEVLPVPTR..SFGSIGIFAIPEMGRFYRH.............VLIEGNYPHHGAVAFGKWG
R6NEA5_9CLOT/335-467RLN..RT-EGKYRMTIIPTEFVELPEK..K....MAETTKEWPHVFAKLPFDHQ.......IFLDRFDANHCHAVYGDHV
R6P4I7_9CLOT/388-552RLNLVEG-LGPV.LQFAEGYTVTLPDE..VHKTLDMRTDPTWPTTWFAPKLTGKGPFTDVYSVMANWGANHGAFVYGHIG
R7D735_9FIRM/30-158NCL..TV-DGKIKIYASEAEFTDDPIEDAYFGCAGVCQIPNM.EDKMI.............RLARGGFKHHTCVGVGHMK
R7EMR5_9BACE/396-559RLNLVKG-QGPV.LQIAEGWTVNLDKD..VFKAINERTDRTWPSTFFAPRLTGKGYFRDVYTVMNNWGANHGAISYGHIG
W8UNN4_YEREN/319-447RLSSDDF-TGQVRAYVGEGRSVSDELD..TVGCRAVVEVPQL.ESLLT.............HICNHGFEHHVAMNHSATA

PF11762

ARAA_AERHH/362-475SLI--DL.GNRFRLVVNQLEVVDLPEAMPKLPVASALWQPMPDLQTSAE------------AWILAGAAHHSVFTQSVDI
G8NQI5_GRAMM/357-470SLI--DL.GDCFRLIVNEVDVIQPEQSLPNLPVARAVWLPKPNLKVAAA------------AWIYAGGAHHTGFSQALTM
I3VUU9_THESW/358-464SLV--SLEGEKYRLVVSKGEILDT.EEAKNIEMPYFHFRPENGVRACLN------------GWLKNGGTHHQCLTLGDAT
C6WE68_ACTMD/362-475GMS--DL.GDRFRLVANDIDVVAPDEPLPALPVARAVWKPAPSLAVSAE------------SWLTAGGPHHTVLTQAVGS
ARAA2_CLOAB/360-473SML--DL.GTHYRLIINGLTAVKPDEDMPNLPVAKMVWKPEPNFIEGVK------------SWIYAGGGHHTVVSLELTV
ARAA_NOCSJ/363-476GLA--DL.GERFRFVGNEVEVVAPTEPLPNLPVARAVWRPAPDLRTSTE------------AWLMAGGPHHTVLSTALGA
E8NFA8_MICTS/365-477AMS--DM.RDRFRLVANVVENVDAP.DLPKLPVGRAVWKPAPDFATSAG------------CWLAAGAAHHTVMTTAVGI
D1BB87_SANKS/363-476AMS--DM.RERFRLTVNVVDVVEPGHELPNLPVARAVWKPQPSFAVSAE------------AWLIAGAAHHTVMSTAVGL
J9W3V5_LACBU/147-259TIS--DF.GTEFRMIGYGVTAHKPTKKTPYLPIAKQYWTPKMGLKHGAT------------EWIQNGGGHHTVLTFTASE
ARAA_TOLAT/362-475SLI--DM.GNRFRLVVNNLDVVDLPQSLPKLPVACALWEPKPNLEVGAE------------AWILAGAAHHSVFSQAVDA
G4KWX5_OSCVS/354-467SLV--DM.GGRMRMIVQDIECIKPILPMPNLPVARVMWKPAPDLLTGVK------------CWILAGGAHHSVLTTQATP
W0F0P7_9SPHI/362-475SLM--DM.GNRFRLLVNEVEAVAPMHSLPKLPVARVLWKPLPDMNTGCA------------AWILAGGAHHTCYSQNLTA
R5CHM2_9BACT/368-481TVV--DM.GNRFRMIVNDVDCIEP.KPLPKLPVASALWIPQPNFEVGAG------------CWIYAGGTHHSCFSYDLTD
F9D4Y7_PREDD/374-487TIV--DM.GNRFRLIANDVNLIKS.KPLPKLPVASALWIPEPTFEVGVG------------CWMEAGGTHHSCFSFSLTD
K0J806_AMPXN/360-473SLV--EM.GGRYRLIVNEVRAEQPEKETPKLPVAKAIWEPKPSLAEGTA------------AWIYAGGAHHTVLSFVVTT
ARAA_OPITP/364-476SLI--DM.GNRFRLLVNEVTAVKTP.KLPKLPVARAVWECQPDFKTACA------------AWIYAGGAHHTGYSYSVTT
D7CXK8_TRURR/363-475SLV--DL.GGRFRLIVSEVEAVAHP.ELPKLPVARAVWRPLPDFKTAAA------------AWIYAGGAHHTAFSYAVTT
C7MA46_BRAFD/363-476ALS--DM.RERFRLVANVVDVVEPDEELPNLPVACAVWEPKPDFATSAE------------CWLTAGAAHHTVMSNAVDL
R6UBU5_9FIRM/353-466SLI--DM.GGRLRMIIQDIEVIKPILEMPNLPVARVMWKPMPDLLTGVK------------CWIQAGGAHHTVLSTAVTA
ARAA_MYCS2/362-475GIC--DM.GSRFRLVANHVTVVEPSAPLPNLPVACAVWEPEPSWSTSTE------------AWLMAGGPHHTVLTTAVSP
Q08PR5_STIAD/363-476TLV--DM.GGRMRMIVNELDVVQPGQTMPHLPVARAIWTPRPSFKESCE------------AWILAGGAHHAGFSRAVPP
G8QYG4_SPHPG/358-471SLV--DM.GGRLRLIVQDIEAVKPKYKMPNLPVARIMWRPEPDLISGAH------------MWILAGGAHHTVLSFDADA
ARAA_VIBPA/361-474SII--DL.GDRFRMIVNVIDTVTPPQSLPHLPVAHALWEPQPNLNIAAA------------AWIHAGGAHHAVYSQAVTL
R7L0Y8_9FIRM/197-310SMI--DL.GDRFRLVCADITLVKQPEPMPKLPVARVMWKLKPDFATGSA------------AWIYAGGAHHAVVSTALTA
ARAA_ARTAT/372-485ALS--DM.RDRFRLVANVVDVVDLDQPLPNLPVARALWEPKPNFATSAA------------AWLTAGAAHHTVLSTQVGL
F5XQM8_MICPN/360-473GIC--DL.GDRFRLVVNEVTVVPPDEPLPKLPVARAVWEPHPDLATSAE------------SWIAAGAPHHTVLSTAVDT
C5C1A5_BEUC1/376-489SLA--DL.RERFRLVANVVDVVGPDAPLPNLPVASAVWVPEPDFATSAQ------------AWLTAGGAHHTVLTTAVGA
E3D8R2_GARV3/365-479SLA--DM.CSRFRLLMNIVDVVEPSGSLKNLPCARAMWKPQPSLSLSAQ------------CWLLAGGSHHTCMTTSIGR
K4IPK0_BIFAP/364-478SLA--DV.RERFRLVMNVVDVVEPGGSLAKLPVARALWKPRPSLKVSAE------------CWLRAGAAHHTCMTTTVGR
Q3Y1E5_ENTFC/360-473SMA--DF.GTHYKLLINEVEAFEPTTEAPNLPVARVLWKTKPNFHEGVH------------SWIQAGGGHHTVVSLNLTT
B2GE08_LACF3/360-473TLS--YF.DDGYKFIGYPVDCKTPEAEMPKLPVAKQMWTPEIGLAEGAK------------QWMKYGGGHHTVLTLALSE
ARAA_FLAJ1/362-475SLV--DM.GTRFRLIVNEVEAVKPMAELPKLPVARVLWDCKPNLEVAAT------------AWILAGGAHHTVYSQSITT
I0K9C7_9BACT/360-471SII--DM.GNRFRLLVNTVEAVKPEHELPNLPVARVLWKANPDLATAAA------------AWIYAGGAHHTGFSQNLSA
D3ELR3_GEOS4/359-472SLI--DL.GHRFRLLVNVVDGVKVEQPMPKLPVARVLWKPQPSLRESAE------------AWILAGGAHHTVLSYAMTA
I2BCV0_SHIBC/363-476SLI--DL.GDRFRLLVNCVDAVATPHDLPKLPVANALWKAQPDLPTASE------------AWILAGGAHHTVFSQSLTL
R5ICF8_9FIRM/351-465SLI--DM.GGRLRLIVQDIEAVKPIMPMPNLPVARVMWRAMPDLTTGVE------------CWITAGGAHHTVLSYDVTA
F8I0I8_WEIKK/360-473TMA--DF.GDEFKLISYEVAGNKPEAETPFLPVAKQLWTPKAGLKAGAE------------GWLTVGGGHHTTLSFNVDT
F2NAF4_CORGP/368-477SLI--DL.GDRFRLIINAVDCKRIEEPMPLLPTGTVFWTPRPNLKVAST------------AWMYAGGAHHTAFSFDLTV
ARAA_KORVE/361-474TIV--DV.GERFRMVINKVNVIPPEVPLPKLPVARAVWIPEPNLAVAAA------------CWIYAGGAHHTGFSLCLTA
F7PLJ6_9EURY/368-480SLV--DM.GDRFRLITNDVESVGPDEPLPELPVARAVWKPEPDFETAIE------------AWIKAGGAHHTGYSQAVTN
D7AYL1_NOCDD/368-477SLV--ALGGEEFRLVVAEGEVIDA.PELPSLEMPYGQFRPETGVRACMD------------AWLRAGGTHHMVMNTGARA
ARAA1_CLOAB/360-473SML--DL.GTHYRLLINEVKAVKPTEDAPNLPVAKLVWQPQPNFKDAVK------------AWIYAGGGHHTVATLELTV
ARAA1_BACLD/355-468SLI--DL.GGRFRLVINKVEAVKVPHDMPNLPVARVLWKPQPSLRTSAE------------AWILAGGAHHTCLSYQLTA
R5IL32_9FIRM/351-463SLT--HLTADRFRLVCAPGEIL.PDADLLHVDMPYLFFRPDSGVRSCVT------------AWLEQGGTHHEALVLGDRL
L7VKE3_CLOSH/358-471SLV--DL.GDRFRLIVNEVEAIEPTKDMPRLPVARVLWKPKPSLRDAAK------------AWILAGGAHHTSFSYSVTT
ARAA_BACSK/353-466ALI--DM.GSRFRLVANEVEAVENPHDMPKLPVASVLWKPLPSFSEATE------------AWIYAGGAHHTVFSYEISK
M9WXH1_PASHA/140-253TVV--DM.GDRFRMVVADLDAIASPNPMPNLPVGHAFWKLQPNFYVGTQ------------AWILAGGAHHSVFSLDIDA
R5Y2U1_9BACE/283-395TIV--DM.GNRFRLIVNEVECVKS.KELPKLPVASALWIPQPDFATGAA------------AWILAGGTHHTSFSYDLTT
R6G4Q0_9FIRM/366-477SLI--DL.GDRFRLIINDVDCKKTEKEMPKLPVATAFWTPQPDLATGAE------------AWILAGGAHHTAFSYDITA
F0RWU5_SPHGB/358-471SLV--DM.GGRVRLIVNEIEVVKPIYRMPNLPVARVMWKPEPDLNQASH------------LWMLSGGAHHAVLSYDATA
ARAA_BIFAA/365-478SMA--DE.RERFRLLMDEVTIVEPQGSLKNLPCARAVWKPKPDLKTAVQ------------CWITAGGSHHTCMTTSVGR
X2H637_9GAMM/364-477SLI--DI.GNRFRLVANELETIKQPYTLPKLPVACAVWRPKPSLNVSAE------------AWILAGAAHHSVYTQALSM
L0KAW4_HALHC/362-475SVV--DM.GNRFRLIINEVDVEEPEEDLPNLPVARVLWKPKPNLQTAAS------------AWIHAGGAHHAGFSQALTV
E1R2G0_SPISS/362-475TLI--DM.GGRFRMIINETDVVKQPHDLPKLPVARALWKPKPDLKTAAA------------AWILGGGAHHSVFTQALTA
I4D2R7_DESAJ/360-473SLI--DL.GGRFRLIVNEVDALKSPHSLPKLPVARVLWKPQPNLRDAAE------------AWIRAGGAHHTCFSLNVTA
L0EBW3_THECK/357-470SIV--DL.GSRFRLLVNEVEAVPVERSMPKLPVARVLWRVLPNLRDGVE------------SWILAGGAHHTGFSYHVTA
F0LQV9_VIBFN/361-474SVI--DL.GNRFRMVVNRVNTVAPPQSMPHLPVAHALWEPMPNLQVAAA------------SWIHAGAAHHSAYSQQVSV
ARAA_CLAMS/366-479AMS--DM.RERFRIVANVVEVVPLDEPLPNLPVARAVWKPAPDLATSAA------------AWLTAGAAHHTVMSTQVGV
ARAA_MANSM/361-474TIV--DL.GNRFRMITADMQAVDKPQDMPNLPVGHAFWKLEPNFDIGTQ------------AWILSGGAHHNVFSLDIDA
X5D7D5_9BACT/365-477TVV--DM.GSRFRMIINAVDCIES.KDLPKLPVASALWIPQPNFEVGAA------------AWILAGGTHHTSFSYDLSV
E8U476_DEIML/375-487SLV--DL.GGRFRLIVNTVQSVEHP.DLPNLPVARAVWEPQPDFKTACA------------AWIYAGGAHHTGYSDVLTP
ARAA_SACD2/361-474STI--DM.GTRFRIIANEVDTVKPPQDLPNLPVAKALWEPRPSLEVAAA------------AWIHAGGAHHSVYTQGINL
F4KX39_HALH1/362-475SIV--DM.GNRFRLIVNEVEAIEPTEDLPKLPVARVLWKVKPDLKTGAA------------AWILAGGAHHTCYSQNLSN
ARAA_CELJU/361-474SVI--DM.GTRFRMIINEVDTVNPPQELPQLPVAKALWEPRPNLEIAAS------------AWIHAGGAHHSAYTQGITV
A5VIS6_LACRD/359-472TLS--YF.NDGYKVIGYSVDCHKPEAETPHLPVAKQLWTPTVGLKEGAE------------RWMHAGGGHHTILSFSLKP
D2QL49_SPILD/362-475SLI--DM.GNRFRILVNEVEAIDVPEALPKLPVARAIWKPMPDMQTGCA------------AWILAGGAHHTVYSQNLTT
F6EQZ3_AMYSD/363-476SMS--DL.RERFRLTANVVDVVPPDEPLPNLPVARAVWRPQPDLPTSAE------------CWLTAGAAHHTVLTTAVGL
E4T864_PALPW/361-473TII--DM.GNRFRMIVNEVKVIKP.QPLPKLPVACALWIPQPNLEVGAG------------AWITAGGTHHSSFSFAVTT
ARAA_ERWT9/363-476SVI--DM.GDRFRLLVNVLDAVEPPRALPKLPVARALWHAQPSLATASE------------AWILGGGAHHTVFSQALTV
F4GHN4_SPICD/358-471SLV--DM.GGRLRLIVQDIEAVKPIYRMPNLPVARIMWKPEPDFKTGAH------------AWILAGGSHHTVLSLSATP
W8F6M3_9BACT/360-473TIV--DL.GHRFRLIVNEVEAVTPEQELPKLPVARVLWKVKPDLKTGVA------------AWIHAGGAHHTGYSQNLTA
C7PZQ9_CATAD/358-471GLA--DL.GDRFRLVANEIDTIAPPEPLPNLPVARAVWSPRPDLRTSAE------------AWLIAGAPHHTVYSSALGT
B8I9D5_CLOCE/358-463SLV--AVEGEKYQLIVSKGTILDT.EDLPDVPMNHAFFRPDSGIKKAMD------------EWLANGGTHHEVLFLGDFR
D5DIR9_BACMD/360-473SMA--DF.GTHYKLLINEVSAFEPEVPAPNLPVARVLWNIKPNFQDGVK------------AWIENGGGHHTVLSLNLTT
T0U7T8_9ENTE/360-473SMA--DF.GTHYKLLINEVDAFEPTEAAPKLPVARVMWTPRPDFHQGVK------------QWIETGGGHHTVVSLALTS
ARAA_THEMA/358-471SIV--DM.GNRFRLVVNKVLSVPIERKMPKLPTARVLWKPLPDFKRATT------------AWILAGGSHHTAFSTAIDV
R4T8N8_AMYOR/362-475GLA--DL.GDRFRLVANEVEVVAPDEPLPNLPVARAVWKPAPSLATSAE------------AWITAGGPHHTVLTQAVGA
ARAA_ACIC1/363-476GLC--DM.GDRLRLVANTADLVAPPEPLPRLPVARAVWQPHPELKTAAT------------AWIAAGGPHHTALSTAVSA
F8F2D2_TRECH/363-476SLI--DL.GDRFRLVVNEVESIKIEKDMPKLPVARVLWKPYPNLQDAAE------------SWILAGGAHHSAFSLAITT
W5XCN2_9BACT/352-464SLV--DL.GHRFRLIVNEVDAVEVP.PMPNLPVARALWEPKPGFKTALT------------AWIYAGGAHHTGYSYAVTT
ARAA_BACSU/359-472SIV--DI.GGRFRLVLNEVNGQEIEKDMPNLPVARVLWKPEPSLKTAAE------------AWILAGGAHHTCLSYELTA
ARAA_SERP5/363-476SLI--DM.GDRFRLLVNQVDTVEQPHPLPKLPVARAIWRAQPTLATAAE------------AWILAGGAHHTVFSQALDA
F4CCR5_SPHS2/362-475SLV--DM.GNRFRLIVNVVEGVDVQNELPKLPVARVLWKPLPDMKTACT------------AWIYAGGAHHTVYSQNLTS
F2JLF2_CELLD/357-470SLI--DM.GGRMRLIIADVDAIELPHQLPQLPVARAYWIPQPSMTEGTE------------AWIYAGGAHHTIFSYELTA
R7EHA6_9BACE/363-475TIV--DL.GNRFRLIVNKVECIKS.KPLPKLPVASALWIPMPNLEVGAA------------AWILAGGTHHTSFSYDLTV
R7A8L4_9CLOT/351-464TMV--DM.GDHFRIICADIELVKQPKPMPKLPVARIMYRHKPNFQIGTA------------AWCYAGGAHHSVVSTALTR
H6NJH3_9BACL/360-473SII--DM.GNRFRLIVNEVDAVQPEKAMPKLPVARVLWKCQPSLRDGVE------------AWIQAGGAHHTGFSYVVKT
D5EX27_PRER2/372-485TVV--DL.GNRFRLISQEVECIEP.QPMPKLPVASALWVPQPTFEIGAA------------AWILAGGTHHSAFSYDITE
F8I827_SULAT/359-471SLV--DL.GSRFRLVVNEVTAVAPP.PMPRLPVARALWRPHPSLKESAA------------AWIYAGGAHHTVFSYGVTS
ARAA_LEPCP/363-476TLL--DM.GNRFRLISHEVDVITPPHDLPQLPVARAVYHPLPDLARGTA------------AWIHAGGAHHTVFSQGVSI
I2F7F6_9THEM/370-483CIV--EF.GDRFRMIVNELDVVKQEVAMPKLPVARALWIPKPDLSTAAT------------AWILAGGAHHSSMSYTVTT
ARAA_LACPL/360-470TVA--DF.RDGFKMISYAVDANKPEAETPNLPVAKQLWTPKMGLKKGAL------------EWMQAGGGHHTMLSFSLTE
D2S421_GEOOG/362-475GWC--DL.GDRFRWVANEVDVVEPDEPLPNLPVARAVWQPRPDFETATE------------GWLTAGGPHHTVLSTAIGA
F4FFB1_VERMA/362-474GLA--DM.GERFRLVANEVDVVAPPQPLPKLPVARAVWQPRPSLAGSAE------------AWITAGAPHHTVLSQGVGV
I3Z536_BELBD/362-475SLV--DM.GNRFRLVVNEVEAVEVPQALPKLPVARVMWKPLPDMNTGCA------------GWIYAGGAHHTCFSQSLTT
ARAA_BIFA0/365-479SLA--DV.RTRFRMLMNVVDVVEPLGSLDKLPCARALWKPEPNLEISAE------------CWLRAGGSHHTCMTTSVGR
F0S519_PEDSD/362-475SLV--DI.GNRFRLVVNEVEAVETENQLPKLPVARVLWKPLPDMRTACT------------AWIYAGGAHHTVFSQNLTP
K9ZZZ3_DEIPD/378-490SLV--DL.GNRFRLIVNEVTAMPHP.DLPKLPVARAVWETKPDFKTASA------------AWIHAGGAHHTGYSSALTT
A9GMQ1_SORC5/364-477AMI--DM.GGRMRIVANELESVAPDRAMPKLPVARAVWVPKPDFRLACE------------AWILAGGAHHCAHSRAVTM
T0TIM9_9STRE/344-457SMA--DF.GTNFKLLINEVEAFEPTEAAPNLPVARVLWEVKPNFHEGVK------------SWIEAGGGHHTVVSLNATS
K7S5L2_PROA4/364-477ALS--DM.RERFRLTANIVKIVGPDEPLPNLPVARAVWEPAPSFQTSTE------------CWLTSGGAHHTVMTTNTDR
ARAA_BACHD/360-473SLI--DL.GHRFRLVVNEVEAIKPERDMPKLPVAKVLWKCKPSLSEATE------------AWIHAGGAHHTVFSFEVTP
ARAA_PEDPA/360-473TMA--DY.GDEFKLMSYDVTGNKTEKETPYLPVAKQLWTPKQGWKQGAE------------GWLTLGGGHHTVLSFAIDA
ARAA_CLOB8/354-467SLI--DM.GNRFRLIVNSVDCVEVTEDMPNLPVASVLWKPQPSLKEGAK------------AWIMAGGAHHTSFSFYVDE
G4L5E1_TETHN/360-473TLS--HS.YDGFKFISYPVEARKPEAQTPNLPVASQLWTPKVGLKEGAT------------KWIQYGGGHHTVLSFALTE
G0GF07_SPITZ/358-471SLI--DL.GNRFRLLINEVESIPIPQPMPKLPVARVLWRPKPDFLTAAG------------AWILAGGAHHTVFSTSITR
A8FFH6_BACP2/360-472SIA--DF.GTHFKWLIQEVEAFEPEEAAPHLPVARVLWKIKPNFQDGVK------------AWIKQGGGHHTVVSLNLSV
D4KH26_9FIRM/358-471TLV--DM.GGRMRLIVNDVECVKPIMPMPNLPVARVMWKPMPSLEEAGE------------AWILAGGAHHSVISYTVTA
B5I630_9ACTO/366-479GLC--DL.GDRFRLTANAVDVIAPSQPLPQLPVARAVWTPRPSLAESAE------------SWLLAGAPHHTVLSSAVDA
W0RQ98_9BACT/362-475SVV--EM.GDRYRMIVNVVDVVPTDEPLPKLPVARALWRPRPDLATSAA------------AWIYAGGAHHTGLSLDLTT
G8TPU2_NIAKG/362-475SIV--DM.GNRFRLIVNEVVAVDPIQSLPKLPVARVLWKPYPDMKTGCA------------AWILAGGAHHTGYSQNLTS
J9W8J2_LACBU/360-469TIS--DF.GNEYRMIGYAVEGNKAPKETPHLPVAKQMWTPKVGLKAGAT------------QWIHDGGGHHTVLTFSASE
ARAA_GEOKA/360-473SLI--DL.GHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAE------------AWILAGGAHHTCFSFAVTT
R6W8G7_9BACT/378-489TVV--DM.GNRFRLIVNDVHCIKP.KPLPKLPVANALWIPQPNFEIGAG------------SWILAGGTHHSCFSYDITP
E4NJM4_KITSK/362-475GLA--DL.GDRFRLVANEIDVVDPVEPLPNLPVARAVWQPRPNLRTSTE------------AWLTAGAPHHTVLTSALGT
C6Y105_PEDHD/362-475SIV--DM.GNRFRLLVNEVEALEPEHELPNLPVAQVLWKPLPDMKTGCA------------AWIYAGGAHHTAYSQNLSP
W0J969_9BACT/368-481SLI--DL.GNHFRLIVNEVTAIRPPKPLPKLPVARAVWKCLPDFRTACA------------AWIHAGGAHHTGFSYAVKT
C7R0A3_JONDD/363-476AMS--DM.RERFRLVVNVVTNVDAPQELPNLPVARAVWQPEPSFKVSTQ------------AWLLTGAAHHTCMDTAASL
D3Q981_STANL/344-452SLV--SLGGNRFRLVVSEGEVLDG.QVLPALEMPYGQFAPTSGLRACMD------------GWLRAGGTHHQVMNLGHRS
I0IIQ8_PHYMF/365-478SMV--DM.GDRFRLVVNTVTCEPPAEPLPRLPVARALWTPHPDLPAAAR------------AWILAGGAHHTAFSLAVTP
G0IWC3_CYCMS/363-474SLI--DL.GNKFRMVVNEVEAVKPPHDLPKLPVARTMWRPLPDFKGACK------------AWILSGGAHHTCFSQNLNA
F6FX69_ISOV2/363-477SLA--DM.RDRFRLTANVVDVVTPPHDLPNLPVARAVWRPRPDFTTSAE------------AWLTAGGAHHTVLSTAVGV
E6K2X8_PARDN/375-489AMS--DV.GERFRMVLNVVDVVLPDHELPLLPTARALWKPQPGLKTSAQ------------CWLLSGAAHHTCLTTTVGR
C6W0K9_DYAFD/362-475SLV--DM.GNRFRLLVNEVEAVEATEQLPKLPVARVLWKPQPDMKTGCA------------AWIHAGGAHHTAFSQNLTT
R6QHN9_9FIRM/353-466TLV--DM.GDRLRMIVNDVECKEQVNDMPKLPVAGVLWKPLPCLQTSAE------------AWIYAGGAHHSVLSYSLTA
I0GUK3_SELRL/360-473TVA--DF.RDGFRMISYPVDCRKAEAETPHLPVAKQLWTPKCGLKKGST------------EWIKAGGGHHTVLSFRLTE
D9SUV4_CLOC7/353-466SLI--DM.GGRFRLIVADVEAVAPLKDMPKLPVARVMWKPMPNLEVGAE------------AWILAGGAHHTVMSYSLTA
C6CYJ7_PAESJ/361-474SLV--DL.GNRFRLIINEVDAVKVEKDMPNLPVARVLWKPRPSLRDSAE------------AWIYAGGAHHTVLSYVVTT
E3IY19_FRASU/371-484GLC--DL.GDRFRMIANAIDVVEPDHELPRLPVACAVWTPRPTLATSAE------------CWLTAGGPHHTVLSTAVDV
ARAA_KLEP7/363-476SLI--DL.GDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASE------------AWIIAGGAHHTVFSHALNL
G2TLS2_BACCO/360-473TVS--DF.GDQFKLVMYEVDGKKPAEAAPKLPVARQLWTPKPGFYEGVQ------------KWIENGGGHHTVLSFAVTA
D7GCD1_PROFC/367-480ALS--DM.RDRFRLTANVVDIVEPEHSLPKLPVGRAFWKPRPNFVTSAK------------SWLASGAAHHTVMSSQVPV
E6TRV5_BACCJ/359-472SLV--DL.GHRFRLIINIVDAVVPTESTPNLPVAKLLWKPQPSLTTGGE------------AWIYAGGAHHTVLSFTSTL
I3ZFQ1_TERRK/357-470TIV--DM.GNRFRMILNDVDVIQPEHDLPHLPVARALWVPRPSLKTAAA------------AWIYAGGAHHTGFSQALNS
U5RY22_9CLOT/360-473TML--DL.GTHYRLIISEVNAVEPAEDTPELPVAKMVWKPEPNFADGVK------------AWIYAGGGHHTVLTLGLTV
R6NRX0_9FIRM/356-469SLV--DM.GGRMRLIVNDIKACNPLKPMPKLPVAGVMWKPLPSLAVSAE------------CWIKAGGAHHSVLSYDITA
L0FW63_ECHVK/362-475SIV--DM.GNRFRLIVNDVEAVKPLKDLPNLPVARVMWKPMPDMKTGCA------------AWILAGGAHHTCFSQNLTS
F7YIC2_VIBA7/361-474SLI--DL.GNRFRMIVNTVETQAPPQSLPKLPVAHALWTPQPNLETAAA------------AWIHAGGAHHTVYSQAVSV
F8EK79_RUNSL/362-473SLI--DM.GNRFRLLVNEVEAVEVTEEFPKLPTARALWKPHPSMEVGLQ------------AWILAGGAHHTAYSQNLTA
C8WV64_ALIAD/359-472TIV--DL.GHRFRMVVNKVEAIQPDRPMPKLPVARVLWKPLPSLASAAE------------SWILAGGAHHTVFSYRVTV
I6YRU9_MELRP/362-475SLI--DM.GNRFRLIVNNVKVVEPEHNLPKLPVARALWKPEPDLHTAAT------------AWIYAGGAHHTCFSQSVTS
G0L5A7_ZOBGA/364-475SIV--DM.GNRFRMLVNSVEAVEIKNDMPKLPVARVLWEAKPDLQTAAA------------AWIYGGGAHHTCYSQNVSA
E8X4F6_ACISM/356-469SIV--EM.SEGYRLIVNEVDVIQPEQALPKLPVARAVWVPRPSLKVAAA------------AWIYAGGAHHTCFSQALTT
D6XWP1_BACIE/358-471SLV--DI.GTRFRLIISEVEAQVPDKETPELPVAKLLWKPEPSLSTATA------------AWVHAGGAHHTVLTFSLTV

PF02952

FUCI_CLOPE/394-557SDLITLA.SMLRIPVT.LH
Q9WYE3_THEMA/335-473EEIKTFC.EIASIDFVLMK
A8F6V5_THELT/337-465KSIKEALERYMDIK.IYLH
A8F356_THELT/333-468EELVHFT.KLLGFN...MR
A9BGR2_PETMO/333-471DELVHFC.KIKNIGYQILD
FUCI_BACTN/391-555QDLITLA.SMLRIPVC.MH
B8CWP4_HALOH/403-566GDLITLA.AMLRIPVA.MH
Q2NWL9_SODGM/391-555ADLMTLA.AMLRIPVC.MH
Q029Q0_SOLUE/342-470SAVQEATDHYLGWN.VAIH
A4XJ56_CALS8/403-566DLFITLA.TMLRIPVC.MH
A6KXB1_BACV8/344-473DILAEAIETYLNWN.IYIH
Q1AXS8_RUBXD/331-469QELRAVC.ELLDIDYDGFG
Q6AA51_PROAC/155-317ADVLTLA.AMLRIPVS.MH
Q9X048_THEMA/338-466DAVKEALEKYLGI..VVHK
A9KRB9_CLOPH/347-477KAIFEVF.KYFDVA..DIE
A4F8A7_SACEN/331-469AALRAVT.EQLGIRLDEWT
A8F6D0_THELT/342-469YIVQEALEKYLGWE..IIS
A6T621_KLEP7/334-462AILHEAFTRYLGVS.TYLH
A6VKQ1_ACTSZ/343-471KVLNEAFNKYLGVE.SYYH
H3ZNG4_THELN/348-480EEIEFVA.RMWGIKAVN..
FUCI_HAEIN/389-553ADLITLA.SMLRIPVC.MH
FUCI_ECOLI/390-554ADFITLA.SMLRIPVC.MH
FUCI_STRR6/388-551ADLITLA.SMLRIPVN.MH
R5UE78_9FIRM/350-476KALFEVF.KYIGVDVSE..
R6NEA5_9CLOT/335-467ESLKMIC.QMLDIDVEI..
R6P4I7_9CLOT/388-552KDLITLA.SMLRIPVS.MH
R7D735_9FIRM/30-158DILKEAFTTYLGYEWVDI.
R7EMR5_9BACE/396-559ADLITLA.SMLRIPVC.MH
W8UNN4_YEREN/319-447KVLQEAFSKYLGVD.CYWH

PF11762

ARAA_AERHH/362-475EQLRTFA-DLMGIEFVVI-
G8NQI5_GRAMM/357-470EHMEDFA-EIAGVELIVI-
I3VUU9_THESW/358-464KRWKLLC-ELLDIEYVE.-
C6WE68_ACTMD/362-475EVLRDFA-QMSETELVLI-
ARAA2_CLOAB/360-473EQVYDWS-RMVGLEAVII-
ARAA_NOCSJ/363-476EHLDDLA-EMTGTELVLV-
E8NFA8_MICTS/365-477EVFRDFA-EIAKTELVVI-
D1BB87_SANKS/363-476EAFQDFS-DMARTELATI-
J9W3V5_LACBU/147-259QQIKDLA-TLFQLPFID.-
ARAA_TOLAT/362-475EYLRTFA-EMMGIEFLLI-
G4KWX5_OSCVS/354-467QMMEDWC-EIMDIEFVHI-
W0F0P7_9SPHI/362-475EHLEDFA-TMAGIEFTLI-
R5CHM2_9BACT/368-481EYWQDYA-EIAGIEAVFI-
F9D4Y7_PREDD/374-487EYWRDFA-EIADIEACII-
K0J806_AMPXN/360-473EQMVDFA-EMADIECVVI-
ARAA_OPITP/364-476EMLEDFA-NIAGIELAVI-
D7CXK8_TRURR/363-475EELEDFA-EIAGVELVVI-
C7MA46_BRAFD/363-476ETWEDLA-TIGDLELAII-
R6UBU5_9FIRM/353-466EMMEDWA-EMMQIECVHI-
ARAA_MYCS2/362-475TTLDDFA-TITGTELLQI-
Q08PR5_STIAD/363-476QVLEDFA-AMVGIEFIHI-
G8QYG4_SPHPG/358-471TMLEDWC-EIMGIEFVHI-
ARAA_VIBPA/361-474PMLADYA-EILGIEMVVI-
R7L0Y8_9FIRM/197-310DDIRLFA-KMTGTELVVI-
ARAA_ARTAT/372-485DVFEDFA-EIAKTELLTI-
F5XQM8_MICPN/360-473DQLIEFA-NQLGIELLVI-
C5C1A5_BEUC1/376-489EAWEDFA-EIARTELVLI-
E3D8R2_GARV3/365-479EVWEDFA-RISGVELAVI-
K4IPK0_BIFAP/364-478EAWEDFA-RMAGVELAVI-
Q3Y1E5_ENTFC/360-473DQIETWA-KLVELETVVI-
B2GE08_LACF3/360-473EQLEQLA-RLFKVDFINI-
ARAA_FLAJ1/362-475EYMEDFA-DIAGIELLVI-
I0K9C7_9BACT/360-471TYMEDFA-EMAGIEYVLI-
D3ELR3_GEOS4/359-472EHLSDWA-EMAGIEAVII-
I2BCV0_SHIBC/363-476DDMRLYA-ELNDLELAVI-
R5ICF8_9FIRM/351-465EQLRDWA-RMMEIEFVHI-
F8I0I8_WEIKK/360-473EQLTDLA-NMFDLTFVNI-
F2NAF4_CORGP/368-477EQMVDWA-AEMGVEAVVI-
ARAA_KORVE/361-474QHLQDYA-EMAGIECVLI-
F7PLJ6_9EURY/368-480EHLEDFA-SMTDIEHLH.-
D7AYL1_NOCDD/368-477QDWRVLC-ELSGIEYVR.-
ARAA1_CLOAB/360-473EQVYDWS-RMVGLETIVI-
ARAA1_BACLD/355-468EQMLDWA-EMSGIEAVLI-
R5IL32_9FIRM/351-463DRIRLFC-RLWNVEFVQ.-
L7VKE3_CLOSH/358-471EHMMDWA-EMAGIEFVLI-
ARAA_BACSK/353-466EQLADWA-SLMGIECIVI-
M9WXH1_PASHA/140-253DMLRMFA-EYFGIEFIHI-
R5Y2U1_9BACE/283-395EYLEDYA-DIAGIEMVVI-
R6G4Q0_9FIRM/366-477EQMGDWA-EAMGIEAVYI-
F0RWU5_SPHGB/358-471EMLEDWC-EIMGIEFVHI-
ARAA_BIFAA/365-478EAWEDFA-RIAGVELAVI-
X2H637_9GAMM/364-477DYFRLYA-QLHNIELLVI-
L0KAW4_HALHC/362-475EHLRDFA-EIADLECLLI-
E1R2G0_SPISS/362-475EYFEDFA-EMADVEFLVI-
I4D2R7_DESAJ/360-473EQLLDWS-EMAGIEYLLI-
L0EBW3_THECK/357-470AQMADFA-EMAGIESVII-
F0LQV9_VIBFN/361-474DTLADYA-DILGMEMVVI-
ARAA_CLAMS/366-479EVFEDFA-EIARTELLVI-
ARAA_MANSM/361-474DMLRTFA-EYFDIEFIHI-
X5D7D5_9BACT/365-477EDLLDYA-EIAGIEAVVI-
E8U476_DEIML/375-487EHLEDFA-AIAGIELVTI-
ARAA_SACD2/361-474DQLNDFA-EMAGVEMVVI-
F4KX39_HALH1/362-475EYLADFA-EIAGIEYVLI-
ARAA_CELJU/361-474DEAVDYA-EMAGIEAVVI-
A5VIS6_LACRD/359-472QQIKDLF-GMLDVKVDFI-
D2QL49_SPILD/362-475DHIEDFA-DIFGVELVVI-
F6EQZ3_AMYSD/363-476EVFEDLA-DIAGIELAVI-
E4T864_PALPW/361-473EMLEDYA-EILDVELLVI-
ARAA_ERWT9/363-476DDLRLYG-EMLGIEVVVI-
F4GHN4_SPICD/358-471EMLEDWA-EIMDMEFVHI-
W8F6M3_9BACT/360-473EYLEDFA-EMAGIEYLII-
C7PZQ9_CATAD/358-471EVLRDLA-EIVGVELLVI-
B8I9D5_CLOCE/358-463RRFELLC-KILDIKYI..-
D5DIR9_BACMD/360-473DQIVSYA-KLVDLEYVII-
T0U7T8_9ENTE/360-473DQIETWA-KLVGLDYVTI-
ARAA_THEMA/358-471EYLIDWA-EALEIEYVVI-
R4T8N8_AMYOR/362-475EAIRDFA-TMLDVELLVI-
ARAA_ACIC1/363-476REIRDFA-RMAGLELVLI-
F8F2D2_TRECH/363-476EYLRDWA-EIMGIELVVI-
W5XCN2_9BACT/352-464EHLRDFA-EIAGVEVVVI-
ARAA_BACSU/359-472EQMLDWA-EMAGIESVLI-
ARAA_SERP5/363-476DMLRLYA-EMHNIEFLLI-
F4CCR5_SPHS2/362-475EYLEDFA-RIAGIEFVKI-
F2JLF2_CELLD/357-470EDLIDWA-EMMDIEYVHI-
R7EHA6_9BACE/363-475EYWEDFA-EMAGIEMVVI-
R7A8L4_9CLOT/351-464DDIAMFA-RLTGTELITI-
H6NJH3_9BACL/360-473EHMLDFA-EMTGIECVVI-
D5EX27_PRER2/372-485EYWEDFA-EMLGIEYVRI-
F8I827_SULAT/359-471QQLKDWA-DALGIECVVI-
ARAA_LEPCP/363-476HQLQTFA-EMFEIEFVHI-
I2F7F6_9THEM/370-483EQLEDLC-EMFGIEIVVI-
ARAA_LACPL/360-470EQMEDYA-TMVGMTK...-
D2S421_GEOOG/362-475DELTDLA-EVFATELVVI-
F4FFB1_VERMA/362-474EELHDLA-EMARTELVVI-
I3Z536_BELBD/362-475EHLTDFA-KIAGLENIII-
ARAA_BIFA0/365-479EAWEDFA-RIAGVELAAI-
F0S519_PEDSD/362-475QYFKDFA-DIAGIEYVVI-
K9ZZZ3_DEIPD/378-490EHLEDFA-VIAGVELAVI-
A9GMQ1_SORC5/364-477AHVEDFA-SIAGVELVRI-
T0TIM9_9STRE/344-457DQVVAWA-KMVGVDYVVI-
K7S5L2_PROA4/364-477EMWEDLA-DIADIELALI-
ARAA_BACHD/360-473EQLYDWA-TLADIEVVFI-
ARAA_PEDPA/360-473EQLQDLS-NMFGLTYVNI-
ARAA_CLOB8/354-467EQLLDWA-DMVGVECVVI-
G4L5E1_TETHN/360-473EQISDLA-SLFGIESVEI-
G0GF07_SPITZ/358-471EYLEDWA-EMMGLEYVLI-
A8FFH6_BACP2/360-472DQIVHFA-KLVSAEYV.V-
D4KH26_9FIRM/358-471EQLRDWA-NMMGIEFVHI-
B5I630_9ACTO/366-479ETLGDFA-AMTGVELLTI-
W0RQ98_9BACT/362-475EHLADFA-EMAGMELLVI-
G8TPU2_NIAKG/362-475EHMEDFA-EMAGVEYVLI-
J9W8J2_LACBU/360-469TQIQDLA-QMFGLP....-
ARAA_GEOKA/360-473EQLQDFA-EMAGIECVVI-
R6W8G7_9BACT/378-489EYWEDYA-EMLDIEYLHI-
E4NJM4_KITSK/362-475EHLDDLA-EMLATELVVI-
C6Y105_PEDHD/362-475AHLLDFA-NIAGIEYVNI-
W0J969_9BACT/368-481EHLEDLA-AIAGIELVVI-
C7R0A3_JONDD/363-476DTWLDFA-QIAQTELVVI-
D3Q981_STANL/344-452RDWEAFA-ELADIDIVHV-
I0IIQ8_PHYMF/365-478EMLDDYA-RIAGVERILI-
G0IWC3_CYCMS/363-474QVLEDFC-EMAQIECVLI-
F6FX69_ISOV2/363-477EAFEVFA-QIARTELLVI-
E6K2X8_PARDN/375-489EAWEDFA-RIAAVELAVI-
C6W0K9_DYAFD/362-475DHIETFA-EMVGVELVVI-
R6QHN9_9FIRM/353-466EHMRDFA-EIMGIEFIHI-
I0GUK3_SELRL/360-473EQIHDLG-VMLGVNLVEI-
D9SUV4_CLOC7/353-466EHMRDFA-DMMGIEFIHI-
C6CYJ7_PAESJ/361-474DQLVDWA-DMLGIEVVVI-
E3IY19_FRASU/371-484DMVEMFA-GMTGTELALI-
ARAA_KLEP7/363-476DDMRQFA-ELHDIELTVI-
G2TLS2_BACCO/360-473EQIEDFA-KMVGLKTVKI-
D7GCD1_PROFC/367-480EVFADFA-RMAGTELAVI-
E6TRV5_BACCJ/359-472DQMLDWA-ALSEIEAVVI-
I3ZFQ1_TERRK/357-470EHLEDFA-VMAGVEVVRI-
U5RY22_9CLOT/360-473EQVYDWA-RMVNLESIII-
R6NRX0_9FIRM/356-469EMMKDWA-EMMGIEFLHI-
L0FW63_ECHVK/362-475EHLNDFA-VMAGIESVNI-
F7YIC2_VIBA7/361-474EMLADYA-EMAGIEMVLI-
F8EK79_RUNSL/362-473EYIEDLA-EMFGVELVVI-
C8WV64_ALIAD/359-472EQLQDLA-DMMGVECVVI-
I6YRU9_MELRP/362-475EYLYDFA-EMAGVEFLLI-
G0L5A7_ZOBGA/364-475ESLEDFA-EIMDIEFLLI-
E8X4F6_ACISM/356-469EHLEDFA-EIAGIEMIVI-
D6XWP1_BACIE/358-471DQMLDWA-EMHGIEAAVI-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window