Sequence alignment for CL0395

PF03803

PLS3_HUMAN/62-284SAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGW-------------------ETCNRYELRSGAGQPLGQAAEE
PLS4_HUMAN/100-322MPGP.TPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCF-------------------ETNNRYDIKNNSDQMVYIVTED
Q9NAE9_CAEEL/48-258MTGFNNLPAH..NVLDMISRTNSMMVVQALEPLEIATGI-------------------ETPNQYVVHDMYCRPIMNCMER
Q21318_CAEEL/74-284MTGFVQLVAN..NILSAIAHTNSVMVVQCIKPLEIFTGF-------------------ETPNRYVVHDMYCRPLLYCMER
Q9VZW1_DROME/42-263MSIPVG.MPNCPQGLEYLTALDQLLVSQKIEKLELLTGF-------------------ETKNRFKVKNSLGQNVYFAYEE
YIP6_SCHPO/58-304ISSTGAIPLNSPAA..PLLSQDVLIVERQLEMMNVFLGY-------------------EQANRYVILNQQGQHLGYIAEQ
PLS1_HUMAN/86-307MPAP.QPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGF-------------------ETNNKYEIKNSFGQRVYFAAED
AIM25_YEAST/59-310NSNSGIIKVHDPIATTILNE.PTVIIERQIEFMNVFLGF-------------------EQANRYAIMDVNGNKIASMMER
Q9SI32_ARATH/150-379MSGLLKPKTSDEAKIATLLARSNLLVTRDIEWANLVLGF-------------------EQENRYIVVDVCYPEAPVGSIR
O45799_CAEEL/51-280MPMP.PAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDW-------------------ETKNKYVLKNANGEQCYYAFEE

PF04525

LOR14_ARATH/16-196---------ISVVSDQFCNPYPMDLLVKRKVQNF-------------------------SKDYYEVFDPSGNLLLQ----
LOR3_ARATH/29-209---------VQDKILPYLTTEQERFTIWMKSLVF-------------------------NSKGCTVFDSKGNLIYR----
LOR7_ARATH/7-145---------PYHPDPEDLRRIPVDLFASKKLPGL-------------------------SSGDLGFADSSEHLVFI----
LURP1_ARATH/5-186---------CVIVGSKYCSPNPVGLAIVRKVMKI-------------------------TDGNFVITSADGKLLFK----
LOR11_ARATH/36-222---------GEETSSPYLTTEQESFTIWMKSLVF-------------------------NTNGCTVFDSKGNIIYR----
Q9XA72_STRCO/2-152---------RFLV.......YDRLLGI.......-------------------------.GDDYWIEDDQGNKVFL----
LOR4_ARATH/7-183---------QAAISSPYMSTERETFTVWMKSLVY-------------------------QTNGLTVYNSNGEITYR----
YXJI_BACSU/1-148---------MIEL...FMKQKMFSF.........-------------------------.KDAFHIYDRDEQETFK----
LOR5_ARATH/4-186---------GLLVDDEFIHGEERSLTVRKTSLFF-------------------------AGDGFTVYDCKGSLVFR----
LOR12_ARATH/18-197---------RIVVDKAYLYQEDKPLTVCKTSLFY-------------------------TGDGFAAYDCRGDIIFR----
Q97Q47_STRPN/1-153---------MEVLMKTFLVKQKFRLGG.......-------------------------..ERFAIKDDRGEIAYQ----
LOR17_ARATH/24-215---------TVSVAAADIGGACTTLTVWRKSLLV-------------------------SCEGFTVIDSNGDLIYR----
LOR15_ARATH/25-206---------GVVVDPKYCAPYPIDMAIVRKMMSL-------------------------TDGNFVITDVNGNLLFK----
LOR8_ARATH/10-188---------STCEESLCDSKAAVVLTVWKKSLLF-------------------------NCDGFTVYNANGELVFR----
LOR6_ARATH/2-180---------KAVVSKLYCSSMEEVMVVRRRPHVV-------------------------NGGGFVVTDYKEKIVFK----
LOR13_ARATH/13-175---------LPLVGSEFVRPQPLDLTI.......-------------------------..TGDTVKDATGNKVFK----

PF01167

TULP2_HUMAN/279-520------PALPGTMMQCYLTRDKHGVDKGLFPLYYLYLET...SDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRD----
TULP1_HUMAN/298-536------PAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDT...EKK..VFLLAGRKRKRSKTANYLISIDPTNLSRG----
TULP2_MOUSE/315-556------PAPRDHMVQCRIVRNKHGMDKGMFPSYYLYLEA...EDGVAHFLLAGRKRKRSKTSNYLISLDPKDMSRN----
TULP3_HUMAN/195-436------PAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEK...EENQKIFLLAARKRKKSKTANYLISIDPVDLSRE----
TLP1_ARATH/121-449------PGPRDATMQCFIKRDKSNLTYHLYLCLSPALLV...ENG..KFLLSAKRIRRTTYTEYVISMHADTISRS----
TUB_RAT/257-499------PAPQGITIKCRITRDKKGMDRGMYPTYFLHLDR...EDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRG----
TLP9_ARATH/98-374------SGPRDSLVQCFIKRNRNTQSYHLYLGLTTSLT....DNG..KFLLAASKLKRATCTDYIISLRSDDISKR----
TULP_DROSI/202-437------PAPQGVLYKCRITRDRKGMDRGLFPIYYLHLER...DYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRN----
Q9SXI3_9ARAE/125-422------PGPREGTIQCFIKRDKSKSRYHLFLGLSPTLPA...ENG..KFLLSQSASRALPARNTSSPWNADDISRS----
TUB1_CAEEL/174-420------PAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKKSTTANYLLSTDPTNLSRE----
Q9ST78_ORYSA/120-456------PGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLD...ETG..KFLLSAKRSRRTTHTDYIISMDSKNISRS----

PF03803

PLS3_HUMAN/62-284.....SNCCARLCCGARRPLRVRLADPGDREVL-------------------------RLLR-------PLHCGC..SC.
PLS4_HUMAN/100-322.....TDDFTRNAYRTLRPFVLRVTDCMGREIM-------------------------TMQR-------PFRCTC...CC
Q9NAE9_CAEEL/48-258.....SNGFARQMQGSHRSFAMMCTDLFGAHVM-------------------------QCHR-------DQPWGS.....
Q21318_CAEEL/74-284.....SNIFARQYEGNDRNFGMQIMDTHGAQVM-------------------------TCFR-------GRPCCS.....
Q9VZW1_DROME/42-263.....SDCCTRNMLGRSRPFEMKILDNFQNEVL-------------------------HLYR-------PFKCDI..LC.
YIP6_SCHPO/58-304GASSILSSLSRQFFHTHRAFKADVMDSNGQLVL-------------------------QLNR-------PFSWIN.....
PLS1_HUMAN/86-307.....TDCCTRNCCGPSRPFTLRIIDNMGQEVI-------------------------TLER-------PLRCSS...C.
AIM25_YEAST/59-310DF.SITKAIMRQFYRLHRPFLVDVFDNWGNVIM-------------------------TIKR-------PFSFINSHIKT
Q9SI32_ARATH/150-379E...QSNLLARQLLRTRRPFVASITDALGNELF-------------------------RVRR-------PFW........
O45799_CAEEL/51-280.....SGCCERQCCGPQRGFVMHIVDNFKREVL-------------------------TIKR-------EFKCCGGGCCG

PF04525

LOR14_ARATH/16-196-----IDG...QAWGFNRKRVM--RDPAGFTIL-------------------------SMRQ.K.....GLALKN-----
LOR3_ARATH/29-209-----VDN..YDSKSWSNEVYF--MDLNGKILF-------------------------TLRQ.K.....KLGFFK-----
LOR7_ARATH/7-145-----LRK...S...SSSLKSL--LDSSGVPLF-------------------------SISR.........LHNG-----
LURP1_ARATH/5-186-----VKD...PLFSLHGKRIL--LDCSGAKVL-------------------------TLRG.K.....MMTMHD-----
LOR11_ARATH/36-222-----VDNY.N..SKSCREVYL--MDLSGHVLF-------------------------TLRR.Q.....KFGLFK-----
Q9XA72_STRCO/2-152-----VDG...KAMRLRDTWEL--KDPQGRVLI-------------------------DIHQ.K.....MFALRD-----
LOR4_ARATH/7-183-----VENY.D...KCSNEVHI--MDLHGNILF-------------------------TIRK.K.....KLWLFG-----
YXJI_BACSU/1-148-----VEG...RFFSLGDSLQM--TDSSGKTLV-------------------------SIEQ.K.....LMSLLP-----
LOR5_ARATH/4-186-----VDSYGGPNTRDTDEVVL--MDAHGRCLL-------------------------TLRR.K.....RPSLRR-----
LOR12_ARATH/18-197-----VDSY.GPDTRDNDEIVL--MDATGKCLL-------------------------TVKR.K.....RPTLHQ-----
Q97Q47_STRPN/1-153-----VEG...SFFKIPKTFTI--YDAAGEQVS-------------------------EISK.E.....ILTLLP-----
LOR17_ARATH/24-215-----VDNY.A..RTRPEELIL--MDKDGNSLL-------------------------LMHRTK.....KITLVD-----
LOR15_ARATH/25-206-----VKE...PVFGLHDKRVL--LDGSGTPVV-------------------------TLRE.K.....MVSMHD-----
LOR8_ARATH/10-188-----VDNY.M..NCPRDNIVL--MDASGFPLL-------------------------SIRR.K.....KLSLGD-----
LOR6_ARATH/2-180-----IDGC.G.VLGTKGELVL--RDSDGNDLL-------------------------LIHK.KGGVVQALSIHN-----
LOR13_ARATH/13-175-----VKT...PLFGLHNKRIL--VDPNDSPIV-------------------------TMKM.K.....VTSKHD-----

PF01167

TULP2_HUMAN/279-520-----GDNFVGKVRSNVFSTKFTIFDNGVNPDR..EHLT...............RNTARIRQELGAVCYEPNVLGYLGPR
TULP1_HUMAN/298-536-----GENFIGKLRSNLLGNRFTVFDNGQNPQR..GY................STNVASLRQELAAVIYETNVLGFRGPR
TULP2_MOUSE/315-556-----GSNFVGKVRSNVLGTKFTIFDNGVNPER..SYWV...............PDSARIREELGVVCYETNVLGFRGPR
TULP3_HUMAN/195-436-----GESYVGKLRSNLMGTKFTVYDRGICPMK..GRGL...............VGAAHTRQELAAISYETNVLGFKGPR
TLP1_ARATH/121-449-----SNTYIGKIRSNFLGTKFIIYDTQPAYNSNIARAVQPVGLSRRFYSKRVSPKVPSGSYKIAQVSYELNVLGTRGPR
TUB_RAT/257-499-----GDSYIGKLRSNLMGTKFTVYDNGVNPQK..ASSS..............TLESGTLRQELAAVCYETNVLGFKGPR
TLP9_ARATH/98-374-----SNAYLGRMRSNFLGTKFTVFDGSQTGA...AK..MQKSRS..SNFIKVSPRVPQGSYPIAHISYELNVLGSRGPR
TULP_DROSI/202-437-----ADGFCGKLRSNVFGTSFTVFDNGNKES........................TESPRLDLAVIIYDTNILGFKGPR
Q9SXI3_9ARAE/125-422-----SSTYIGKLRSNFLGTKFIMFDTQPPTRH..CRPAPSSGRVSRRFYSKVSPKVPSGNYAIAQVTYELNVLGKRGPR
TUB1_CAEEL/174-420-----GEGYCAKVRSNALGTQFTVYDSGQNPKK....................TTNHAAIRQELAAVIYETNVLGFKGPR
Q9ST78_ORYSA/120-456-----SSGYIGKLRSNFLGTKFIIYDTQPPYNA..RTLCSQERTSRRFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPR

PF03803

PLS3_HUMAN/62-284....CPCGLQEMEV....QAPPGT-------------------------------------------TIGHVLQT-----
PLS4_HUMAN/100-322..FCCPSARQELEV....QCPPGV-------------------------------------------TIGFVAEH-----
Q9NAE9_CAEEL/48-258....FTDHLTTQFL........GQ-------------------------------------------NIGIMSRT-----
Q21318_CAEEL/74-284....TDDFLSTQFL........DQ-------------------------------------------QIGMMKK.-----
Q9VZW1_DROME/42-263...CFPSCMNAVEV....SAPPGQ-------------------------------------------VIGSVEQV-----
YIP6_SCHPO/58-304......SRLQIHSID..YSKFSST-------------------------------------------LVGEVLQK-----
PLS1_HUMAN/86-307...CCPCCLQEIEI....QAPPGV-------------------------------------------PIGYVIQT-----
AIM25_YEAST/59-310IIPPSAYVDNGSDSTHYHDGKEGT-------------------------------------------TVGETIQN-----
Q9SI32_ARATH/150-379....WLTSSIYAEI.......DGE-------------------------------------------EIGVVHRR-----
O45799_CAEEL/51-280CLACIGCCQQECII....ETPSMG-------------------------------------------VLGIIRQR-----

PF04525

LOR14_ARATH/16-196---KWEVHGGESKE--R.....ED-------------------------------------------LLFTVQQS...QA
LOR3_ARATH/29-209---SWEGYNSTGTR--........-------------------------------------------..FRLRKI...FK
LOR7_ARATH/7-145---VWELHKGDVEK--R.....KD-------------------------------------------LVLTVKRT.....
LURP1_ARATH/5-186---RWQVFRGGSTE--E.....GA-------------------------------------------LLYTVKRS...SM
LOR11_ARATH/36-222---TWEGYRSSSAT--VESTTKLE-------------------------------------------.YFRVKNN..VFQ
Q9XA72_STRCO/2-152---T.MVIERAGE.--........-------------------------------------------PLARIKRK.....
LOR4_ARATH/7-183---SWYVYRECGS.--........-------------------------------------------..FTSTEE.....
YXJI_BACSU/1-148---RYEISIGGKT.--........-------------------------------------------.VCEVTKK.....
LOR5_ARATH/4-186---RWEGYLGERSD--G.....QK-------------------------------------------PIFGVRRS...SI
LOR12_ARATH/18-197---RWEGFLGERSE--G.....QK-------------------------------------------PIFSVRRS...SI
Q97Q47_STRPN/1-153---RFEIQLRDGSS--........-------------------------------------------..FVIRKK.....
LOR17_ARATH/24-215---SWGIYEANDTK--GETKIPKC-------------------------------------------PTWYMRKNLKMNI
LOR15_ARATH/25-206---RWQVFRGGSTD--Q.....RD-------------------------------------------LLYTVKRS...SM
LOR8_ARATH/10-188---CWMVYDGETE.--......RD-------------------------------------------PIFTARKN.....
LOR6_ARATH/2-180---KWKGYSYDYQG--S.....PK-------------------------------------------PVFTLRD......
LOR13_ARATH/13-175---RWQVYRGSDLD--.......D-------------------------------------------KIFTVKRS...ST

PF01167

TULP2_HUMAN/279-520KMTVILPGTNSQNQ.....RINVQ...........................................PLN.EQESLLSRY
TULP1_HUMAN/298-536RMTVIIPGMSAENE.....RVPIR...........................................PRN.ASDGLLVRW
TULP2_MOUSE/315-556KMTVILPGMDSRKQ.....RMKVQ...........................................PQN.DQDSILSRV
TULP3_HUMAN/195-436KMSVIIPGMTLNHK.....QIPYQ...........................................PQN.NHDSLLSRW
TLP1_ARATH/121-449RMHCAMNSIPASSLAE.GGTVPGQPDIIVPRSILDESFRSITSSSSRKITYDYSNDFSSARFSDILGPLSEDQE.VVLEE
TUB_RAT/257-499KMSVIVPGMNMVHE.....RVCIR...........................................PRN.EHETLLARW
TLP9_ARATH/98-374RMRCIMDTIPMSIVES.RGVVASTSISSFSSRS.........................SPVFRSHSKPLRSNSA.SCSDS
TULP_DROSI/202-437NMTVILPGMTEDDQ.....RVKIS...........................................SADPKQQGILDLW
Q9SXI3_9ARAE/125-422RMHCTMNSIPSSALDA.GGRVPAAPERILSRSLEDSFRSV...........SLSKDLGSSRFSEFGG...EMER.EEEEE
TUB1_CAEEL/174-420KMTIVMPGIEPPTENRPAVRCPVR...........................................PIQ.DKHTLLERY
Q9ST78_ORYSA/120-456RMQCAMHSIPASAVEP.GGIVPGQPKELLPRLFEESFRSMATSFS.KYSITDHSTDFSSSRFSEFGGGALQGQE.QEQDG

PF03803

PLS3_HUMAN/62-284WHPFLPKFSIQDADR.QTVLRVVGPCWTCG.CGTD---TNFEVKTR----------------------------------
PLS4_HUMAN/100-322WNLCRAVYSIQNEKK.ENVMRVRGPCSTYG.CGSD---SVFEVKSL----------------------------------
Q9NAE9_CAEEL/48-258HG..DVNFHLLGAGS.NQSLLIRSPLFAAS..GGT---RSFPVMTY----------------------------------
Q21318_CAEEL/74-284.ECCNPNFELVGSGC.NQPLLIQSP..GCAGCGGT---QKFPVMTF----------------------------------
Q9VZW1_DROME/42-263CTFMRPKFNIKNTCG.DTVLQIEGPVCPCK.CFSD---TNFKVLSA----------------------------------
YIP6_SCHPO/58-304WHLWRRRYELFLAKR.....SMFEQFAKIDERVLS---WEFLLRN.----------------------------------
PLS1_HUMAN/86-307WHPCLPKFTIQNEKR.EDVLKISGPCVVCS.CCGD---VDFEIKSL----------------------------------
AIM25_YEAST/59-310WHLWRRRYELFQKDGVEG..STFDQFGKIDAPFLS---FDFPVTDA----------------------------------
Q9SI32_ARATH/150-379WHLWRRIYDLYLGN..NQFAVVENPGF......WN---WTFTVKDA----------------------------------
O45799_CAEEL/51-280CGCMSSNYDIMDGDG.NVIFQIDGPCCCMLCGCQD---KEFPIKTA----------------------------------

PF04525

LOR14_ARATH/16-196VSLKTSVDVFLPENNNV..KKTNTCDFHASGGYSN---ISFKVF..----------------------------------
LOR3_ARATH/29-209ILPRESSSSYKVVMGSRIVDGDQQSCYKI..VNRG---SVFAIKD.----------------------------------
LOR7_ARATH/7-145......SKRFSKTESEVSFAGESSENLVIKGVPFQ---KSCTIY..----------------------------------
LURP1_ARATH/5-186IQLAPKLEVFLA..NNV...EEKICDFKVKGAWLD---DSCVVYA.----------------------------------
LOR11_ARATH/36-222VPNKDSSSSYRVNAGSCRNDEQYCYKMVTRGS...---.SLAIED.----------------------------------
Q9XA72_STRCO/2-152.......RLSLLRNHYRVVLADGTE.LDVSGKILD---REFAVE..----------------------------------
LOR4_ARATH/7-183VKPCARIKRSSIRDGDWEVRDETNEVFWILRFDPK---FAFQIID.----------------------------------
YXJI_BACSU/1-148.......VTFSKPKFVI.....SGLNWEIDGDLWR---DEFQLTD.----------------------------------
LOR5_ARATH/4-186IG........RNSVTVEVYGDYQCSEYLIEGSFGA---RNCTVVE.----------------------------------
LOR12_ARATH/18-197IGRCTM.........EVEVYDGTGEEYIIDGDFSQ---RSCLIYD.----------------------------------
Q97Q47_STRPN/1-153.......LTFWR...DK..YEFDNLGLRIEGNIWD---LNFKLLD.----------------------------------
LOR17_ARATH/24-215LSTKSDILAYVYSGSF.....DKKNSYIIKGSYRC---KSCKIVH.----------------------------------
LOR15_ARATH/25-206LQLKTKLDVFLG..HNK...DEKRCDFRVKGSWLE---RSCVVYA.----------------------------------
LOR8_ARATH/10-188......VSIISNRKSLAWVSAKKTVLYEIEGSYGQ---RSCKILDE----------------------------------
LOR6_ARATH/2-180....PKHSCFSITSSIRISVGPGNCYFDVKGYFPD---RDCSIVD.----------------------------------
LOR13_ARATH/13-175VQLKTRVEVFLK..HNQ..TRESSCDFTIKGRFMK---RACTIYV.----------------------------------

PF01167

TULP2_HUMAN/279-520QRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDP..................................
TULP1_HUMAN/298-536QNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHA..................................
TULP2_MOUSE/315-556QKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQIVHP..................................
TULP3_HUMAN/195-436QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHK..................................
TLP1_ARATH/121-449GKERNSPPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAANQPQPQPQPQPQ...........PQPLTQPQPSG
TUB_RAT/257-499QNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHG..................................
TLP9_ARATH/98-374GNNLGDPPLVLSNKAPRWHEQLRCWCLNFHGRVTVASVKNFQLVAVSDC..............................E
TULP_DROSI/202-437KMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHD..................................
Q9SXI3_9ARAE/125-422GDRKKSGPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIADGQATA..........................AQA
TUB1_CAEEL/174-420RLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQIIHQ..................................
Q9ST78_ORYSA/120-456DDVNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAAPQPASGAASEPSQAGQAAQQQTQPSQPSSSSSS

PF03803

PLS3_HUMAN/62-284--DESRSVGRISKQWGGLVREALTDADDFGLQFPL...........................DLDVRVKAVLLGATFLID
PLS4_HUMAN/100-322--DGISNIGSIIRKWNGLLS.AMADADHFDIHFPL...........................DLDVKMKAMIFGACFLID
Q9NAE9_CAEEL/48-258--NG.MRVGEIVRLYPGYMQEMYSDADTYIVHFPM...........................DLPPILKLLLISSVFLID
Q21318_CAEEL/74-284--NG.VLVGEIVRLYPGFMQEMFTDADTYIVHFPM...........................DMPPILKLLLVTSVFLID
Q9VZW1_DROME/42-263--NN.EEIGKISKQWSGLGRELFTDADYFSVTFPL...........................NLDVRMKALIFAALFLID
YIP6_SCHPO/58-304--EQDRILGSVSRNFMGLPREFFTDTGNYVLRFTSTSAANGSVNENQLLQAAHGIANDVCARDMSLEERAVMLGSAVTID
PLS1_HUMAN/86-307--DEQCVVGKISKHWTGILREAFTDADNFGIQFPL...........................DLDVKMKAVMIGACFLID
AIM25_YEAST/59-310--DG.KIMASVDRNWVGLGREMFTDTGVYVVRFDSQRCFDNIY...........PTEMLSSQVLTLDQRAVLLANAVSID
Q9SI32_ARATH/150-379--DG.EVLAQIDRDWRGFGFEIFTDAGQYVIRFGKADAAAKTGPA.......TLVEELEVKRPLTLSERAVVLTLAISLD
O45799_CAEEL/51-280--NNGTVVGAITKKWGGCFREAFTDADTFAVNFPG...........................DLDVKLKGVLIGATFLID

PF04525

LOR14_ARATH/16-196--.KADALIAGVG..FT.WGSFCKGKYNFKV.------------------------------RVNPEVDYAFIIALLVM-
LOR3_ARATH/29-209--.GSGRLMAEVKNKLSDISGLDLGDDVLTM.------------------------------MVEPQLDHSLIMGIVIA-
LOR7_ARATH/7-145--.SQDSIVAQTS...................------------------------------...............LM-
LURP1_ARATH/5-186--GDSDTIIAHMCGKQT.MRGFFFGKDHFSV.------------------------------TVDKNVDYAFIASLIVI-
LOR11_ARATH/36-222--.NCGKLLAEVKRKQS.INGLKLGDDVLTM.------------------------------MVESQVDHSFIIGLVLA-
Q9XA72_STRCO/2-152--.YDGELLAVV......SRRWLTLRDTYGVD------------------------------VVRDDADPALLIALTVC-
LOR4_ARATH/7-183--.IHGNIIAQVKPKQS.SNGITLGEDVLTL.------------------------------EVKPRVDHSLVVTLVTV-
YXJI_BACSU/1-148--GENVRMSVSKK........WLSWGDSYHL.------------------------------QIAYEEDVLICTAIAIV-
LOR5_ARATH/4-186--AETRRKVAEIRRKVDASTNVMLGKDVFSL.------------------------------NVKPGFDGAFAMGLVLV-
LOR12_ARATH/18-197--.TKKCTVAEIKRKVDASTNVMLGRDVFTL.------------------------------EIKPGFDGAFAMGLVVV-
Q97Q47_STRPN/1-153--.DRDQLIAEIK......KELFHLTSTYTV.------------------------------TVLEDAYADLVISLCVA-
LOR17_ARATH/24-215--VPLNKTVVEIKRKEVRTKGVRFGSDVFDL.------------------------------VVNPGFDTGLAMALVLL-
LOR15_ARATH/25-206--GESDAIVAQMHRKHT.VQSVFLGKDNFSV.------------------------------TVYPNVDYAFIASLVVI-
LOR8_ARATH/10-188--RRNKKKTAEIKRKETVIGGVAFGKDVYKL.------------------------------IVESEMEPRVAMALTII-
LOR6_ARATH/2-180--.SKGNVIAQVKE.......WIGSRDIYKV.------------------------------VTKPSVDKAFVFGVIAV-
LOR13_ARATH/13-175--ADSTKIIAQV..........YEGHERLVA.------------------------------TIYPNVDYAFIVTLIFI-

PF01167

TULP2_HUMAN/279-520..KHQEHLVLQFGR---------VGPDTFTM-------------------------------DFCFPFSPLQAFSICLSS
TULP1_HUMAN/298-536..DDPDYIVLQFGR---------VAEDAFTL-------------------------------DYRYPLCALQAFAIALSS
TULP2_MOUSE/315-556..DEPDHLVLQFGR---------VAPNIFTM-------------------------------DFRYPLCPLQAFAICLSS
TULP3_HUMAN/195-436..NDPDYIVMQFGR---------VADDVFTL-------------------------------DYNYPLCAVQAFGIGLSS
TLP1_ARATH/121-449QTDGPDKIILQFGK---------VGKDMFTM-------------------------------DFRYPLSAFQAFAICLSS
TUB_RAT/257-499..NDPDYIVMQFGR---------VAEDVFTM-------------------------------DYNYPLCALQAFAIALSS
TLP9_ARATH/98-374AGQTSERIILQFGK---------VGKDMFTM-------------------------------DYGYPISAFQAFAICLSS
TULP_DROSI/202-437..SDPEYIVMQFGR---------TSEDVFTM-------------------------------DYRYPLCAMQAFAIALSS
Q9SXI3_9ARAE/125-422GASEHDKIILQFGK---------VGKDTFTM-------------------------------DNRYPLSAFQAFAICLSS
TUB1_CAEEL/174-420..SSPEYIVMQFGR---------ISDDEFTM-------------------------------DFRYPLSAVQAFGIAMTS
Q9ST78_ORYSA/120-456SSSNHDTVILQFGK---------VAKDMFTM-------------------------------DYRYPLSAFQAFAICLTS

PF03803

PLS3_HUMAN/62-284YMFFEK
PLS4_HUMAN/100-322FMYFER
Q9NAE9_CAEEL/48-258FTFFEN
Q21318_CAEEL/74-284FTYFED
Q9VZW1_DROME/42-263AVYYEQ
YIP6_SCHPO/58-304FDYFSR
PLS1_HUMAN/86-307FMFFES
AIM25_YEAST/59-310FDYFSR
Q9SI32_ARATH/150-379NDYFSR
O45799_CAEEL/51-280FMEFEQ

PF04525

LOR14_ARATH/16-196------
LOR3_ARATH/29-209------
LOR7_ARATH/7-145------
LURP1_ARATH/5-186------
LOR11_ARATH/36-222------
Q9XA72_STRCO/2-152------
LOR4_ARATH/7-183------
YXJI_BACSU/1-148------
LOR5_ARATH/4-186------
LOR12_ARATH/18-197------
Q97Q47_STRPN/1-153------
LOR17_ARATH/24-215------
LOR15_ARATH/25-206------
LOR8_ARATH/10-188------
LOR6_ARATH/2-180------
LOR13_ARATH/13-175------

PF01167

TULP2_HUMAN/279-520FN----
TULP1_HUMAN/298-536FD----
TULP2_MOUSE/315-556FD----
TULP3_HUMAN/195-436FD----
TLP1_ARATH/121-449FD----
TUB_RAT/257-499FD----
TLP9_ARATH/98-374FE----
TULP_DROSI/202-437FD----
Q9SXI3_9ARAE/125-422FD----
TUB1_CAEEL/174-420FH----
Q9ST78_ORYSA/120-456FD----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window