Sequence alignment for CL0395

PF03803

PLS3_HUMAN/62-284SAAPFLPLPGVPSGLEFLVQ---IDQI-----LIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEE.....S-----
PLS4_HUMAN/100-322MPGP.TPMANCPPGLEYLVQ---LDNI-----HVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTED.....T-----
Q9NAE9_CAEEL/48-258MTGFNNLPAH..NVLDMISR---TNSM-----MVVQALEPLEIATGIETPNQYVVHDMYCRPIMNCMER.....S-----
Q21318_CAEEL/74-284MTGFVQLVAN..NILSAIAH---TNSV-----MVVQCIKPLEIFTGFETPNRYVVHDMYCRPLLYCMER.....S-----
Q9VZW1_DROME/42-263MSIPVG.MPNCPQGLEYLTA---LDQL-----LVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEE.....S-----
YIP6_SCHPO/58-304ISSTGAIPLNSPAA..PLLS---QDVL-----IVERQLEMMNVFLGYEQANRYVILNQQGQHLGYIAEQGASSIL-----
PLS1_HUMAN/86-307MPAP.QPPLNCPPGLEYLSQ---IDQI-----LIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAED.....T-----
AIM25_YEAST/59-310NSNSGIIKVHDPIATTILNE---.PTV-----IIERQIEFMNVFLGFEQANRYAIMDVNGNKIASMMERDF.SIT-----
Q9SI32_ARATH/150-379MSGLLKPKTSDEAKIATLLA---RSNL-----LVTRDIEWANLVLGFEQENRYIVVDVCYPEAPVGSIRE...QS-----
O45799_CAEEL/51-280MPMP.PAIQGVPTGLEYLTY---LDTI-----MVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEE.....S-----

PF04525

LOR14_ARATH/16-196---------ISVVSDQFCNP---YPMD-----LLVKRKVQNF------SKDYYEVFDPSGNLLLQ---------I-----
LOR3_ARATH/29-209---------VQDKILPYLTT---EQER-----FTIWMKSLVF------NSKGCTVFDSKGNLIYR---------V-----
LOR7_ARATH/7-145---------PYHPDPEDLRR---IPVD-----LFASKKLPGL------SSGDLGFADSSEHLVFI---------L-----
LURP1_ARATH/5-186---------CVIVGSKYCSP---NPVG-----LAIVRKVMKI------TDGNFVITSADGKLLFK---------V-----
LOR11_ARATH/36-222---------GEETSSPYLTT---EQES-----FTIWMKSLVF------NTNGCTVFDSKGNIIYR---------V-----
D6ENB3_STRLI/2-152---------RFLV.......---YDRL-----LGI.......------.GDDYWIEDDQGNKVFL---------V-----
LOR4_ARATH/7-183---------QAAISSPYMST---ERET-----FTVWMKSLVY------QTNGLTVYNSNGEITYR---------V-----
L8AWG7_BACIU/1-148---------MIEL...FMKQ---KMFS-----F.........------.KDAFHIYDRDEQETFK---------V-----
LOR5_ARATH/4-186---------GLLVDDEFIHG---EERS-----LTVRKTSLFF------AGDGFTVYDCKGSLVFR---------V-----
LOR12_ARATH/18-197---------RIVVDKAYLYQ---EDKP-----LTVCKTSLFY------TGDGFAAYDCRGDIIFR---------V-----
Q97Q47_STRPN/1-153---------MEVLMKTFLVK---QKFR-----LGG.......------..ERFAIKDDRGEIAYQ---------V-----
LOR17_ARATH/24-215---------TVSVAAADIGG---ACTT-----LTVWRKSLLV------SCEGFTVIDSNGDLIYR---------V-----
LOR15_ARATH/25-206---------GVVVDPKYCAP---YPID-----MAIVRKMMSL------TDGNFVITDVNGNLLFK---------V-----
LOR8_ARATH/10-188---------STCEESLCDSK---AAVV-----LTVWKKSLLF------NCDGFTVYNANGELVFR---------V-----
LOR6_ARATH/2-180---------KAVVSKLYCSS---MEEV-----MVVRRRPHVV------NGGGFVVTDYKEKIVFK---------I-----
LOR13_ARATH/13-175---------LPLVGSEFVRP---QPLD-----LTI.......------..TGDTVKDATGNKVFK---------V-----

PF01167

G0QXR5_ICHMG/270-502-----..KKGV..ILQMTIK...RDKT.....GFAR.FYPKYHLCL..........SGDNRYLMT---------G.....
E4XRC9_OIKDI/84-325-----.....E..IVKCRIT...RDRK.....GIEAFGYPTYFLFLDSSTES...ETNMKDMVLC---------A.....
M4BSN8_HYAAE/388-632-----..PQAL..MMQCYI....RTRG...........GGNYELYT..........QDTNTLLCT---------A.....
M0SAD5_MUSAM/110-361-----PGPRDH..PIQCFMR...RERT...........TSTFRVYLGLTP...SLQSQKDKLLLA---------A.....
M4AUK7_XIPMA/179-416-----PAPQGV..TVKCRVT...RDQR.....GVDKSLYPLYYLHL....DN...E..KKTFLLA---------G.....
W1NGY4_AMBTC/30-320-----PGPRDA..PIQCFIK...RERA...........TSTYHLYLGLTP...ALLVQNGKLLLA---------A.....
G7YSE7_CLOSI/527-800-----PAPKGI..TVRCRIT...RDKH.....GVDRGIFPTYYVHL....ER...DD.RKFFLLA---------A.....
S2K614_MUCC1/46-291-----PAALNT..RVTCRIH...RCRD.....GLDK.LYPQYHLFI....EHL..ATGEIQHVMT---------A.....
C1FIJ1_MICSR/334-589-----PGPEDA..PVQCHIV...RRVNKGFLPGSN...YPEYFLYLDGPGAKPGDPTNEAKFLLS---------A.....
A9TE85_PHYPA/123-416-----PGPRED..TVQCFIK...RDRT...........TSTYQLFLGLPP...CKFLANGKFLLA---------A.....
A0EG93_PARTE/216-448-----..IQDK..TLQCSIK...RDKS.....GLAR.LYPVYHVYT..........SEGDVYLFS---------A.....
Q22Y91_TETTS/368-602-----PIPKGM..IIQTQIR...RDKS.....GFAR.FYPKYHVHL..........SSGMRYLLT---------G.....
TLP7_ARATH/108-372-----PGPRDF..SNQCLIK...RNKK...........TSTFYLYLALTP....SFTDKGKFLLA---------A.....
J3M9P3_ORYBR/81-337-----PGPKDF..PIQCVIE...RNKK...........ESMFYLHLGLSN....ATMDKGKFLVA---------A.....
D7KMY6_ARALL/120-422-----PGPRDG..TIQCFIK...RDKS...........NMTYHLYLSLSP...VLTFV..KFV..---------......
J3MPK4_ORYBR/123-441-----PGPRDG..LIQCFIK...RDKS...........KLTYYLYLCLSP...AVLSENGKFLLA---------A.....
I1IN97_BRADI/117-439-----PGPRHG..IIQCFIK...RDRS...........TQTYYLYLSLSS...AVLVENGKFLLS---------A.....
H2ZV03_LATCH/267-506-----..PRDV..TIKCRIT...RDKK.....GMDKGMFPTYYLHL....EK...EDGKRVFLMA---------G.....
H0WAT2_CAVPO/269-510-----PTLKGH..IVQCCIH...RNQQ.....GLEKGLFPVYYLYL....EA...AEGWKRFLLA---------G.....
B3SBY7_TRIAD/1-241-----.APQDT..TIKCRIS...RDKK.....GVDRGIYPTYYLHL....ER...EDGKKIFLMA---------G.....
F1PNR7_CANFA/215-456-----PAPRGI..TVKCRIT...RDKK.....GMDRGLFPTYYMHL....EK...DENRKIFLLA---------G.....
K3Z6B7_SETIT/115-432-----PGPRDG..VIQCFIK...RDKS...........KLTYRLYLCLSS...AVLDENGKFLLA---------A.....
TULP2_MOUSE/315-556-----PAPRDH..MVQCRIV...RNKH.....GMDKGMFPSYYLYL....EA...EDGVAHFLLA---------G.....
B9GRM5_POPTR/121-410-----PGPRDA..PIQCFIK...RERA...........TSTYLLYLGLSP...ALSGDMNKVLLA---------A.....
M0RYY8_MUSAM/119-400-----PGPRDF..PLQCFIR...RNQS...........TQTYHLYLGLTQ....ALAADGKFLLA---------A.....
F4NT32_BATDJ/88-310-----T.......RKLCRIV...RKRD......GLAGGSHTYEVFV........EEHNTVIPVLF---------A.....
M7YZS2_TRIUA/159-501-----PGSRDG..LIQCFIK...RDKS...........KLTYRLYLSLTS...AVLDDNGKFLLS---------A.....
TLP1_ARATH/121-449-----PGPRDA..TMQCFIK...RDKS...........NLTYHLYLCLSP...ALLVENGKFLLS---------A.....
C5X4V0_SORBI/116-393-----PGPRDA..PMKCFIR...RNRA...........TQSYSLCIGITD....ALADDGKFLLA---------A.....
K3WG02_PYTUL/293-540-----.....G..IIRCYVKQVYRGMF..........KQYGYELYL....QGQIGTQEEDRFLLA---------A.....
C1N1L4_MICPC/293-551-----GA......PVQCHIV...RKRKKGWIPG.TKGSHPEYYLWLDGANAKAGSAGEDAKFLLC---------A.....
W1PSZ7_AMBTC/113-431-----PGPRTS..PIQCYIK...RNKA...........SSTYHLYLGLNT.......ENGKFLLA---------A.....
A9TFU9_PHYPA/122-419-----PGPRDS..TMQCFIK...RDRT...........TSTYQLFLGLPP...SLV.ENGKFLLA---------A.....
K4AAU1_SETIT/114-394-----PGPRDG..TLKCFIR...RNRT...........TQTYYLYIGLTE....ALADDGKFLLA---------A.....
B9R7W3_RICCO/118-407-----PGPRDA..PIQCFIR...RERA...........TSTYLLYLGLSP...ALSGDMSKLLLA---------A.....
K4CGS2_SOLLC/123-379-----PGPRDP..PLQCFIK...RDKK...........NATFYLYLALSP....SLMDQGKFLLA---------A.....
G0QPZ2_ICHMG/56-278-----..QKGK..TIQMTIR...RQKG......IFGAFQTIYNLYM.........SYQNQQFLLS---------A.....
D8SG45_SELML/128-419-----PGPRDA..TVQCYLK...RDRT...........TSTYYLYLGITPS..KPSKKNGKFLLA---------A.....
TLP7_ORYSJ/120-456-----PGPRDG..VIQCFIK...RDKS...........KLTYHLYLCLSS...AVLDETGKFLLS---------A.....
TLP1_ORYSJ/99-349-----PGPREF..PMQCFIK...RNKK...........NSTFYLYLGLTN....ATVDKGKFLMA---------A.....
A0BWZ4_PARTE/130-363-----PVPIDK..IVQCTLI...KNRK......GFCNFYPKFELYF..........SESLKFLCA---------A.....
L9L384_TUPCH/349-587-----PAPQDR..TVRCRLT...RDKK.....GMDRGMYPSYFLHL....DT...E..KKVFLLA---------G.....
K3ZU09_SETIT/112-390-----PGPRDA..PVKCFIR...RNRA...........TQSYFLCLGVTD....ALVDDGKFLLA---------A.....
F6TZP0_XENTR/258-499-----PAPNNM..IFQCRIT...RDKK.....GVDKGIYPTYYLHL....ER...DDGKRLFLMA---------G.....
A9SPK2_PHYPA/122-414-----PGPREN..TVQCFIK...RDRT...........TSTYQLFLGLPP....SLIENGKFLLA---------A.....
J3M7K2_ORYBR/123-439-----PGPRDG..MIQCFIK...RDKS...........KSTYHLYLCLST...AVLADSGKFLLS---------A.....
I1J3P3_BRADI/123-449-----PGPRDG..LIQCFIK...RDKS...........KLTYHLYLSLTS...AVLDDNGKFLLS---------A.....
M0SFG0_MUSAM/119-397-----PGPRDF..PLQCFIR...RNRS...........TQTYHLYLGLNE.......DDGKFLLA---------A.....
C5XQM9_SORBI/123-474-----PGPRDGNTMIQCFIK...RNKS...........KSTYYLYLCLSN...VVTSESGKFLLS---------A.....
I1NRS9_ORYGL/1-249-----PGTRDA..PMQCFIK...RNKK...........NSTFFLYLGLTQ....ELTDDGKFLLA---------A.....
A0DNS7_PARTE/64-294-----..PKGI..TLECDVK...IIKG.......WFGLHTLYNFY..........HSKTKQLLLQ---------V.....
I1LHT6_SOYBN/119-408-----PGPRDS..PIQCFIR...RNRE...........TSTYLLYIGLVP...S.ENETDKLLLA---------A.....
M4DW60_BRARP/89-338-----PGPRGS..LVQCFIK...RNRN...........TQSYHLYLGLTN....SLTDNGKFLLA---------A.....
F4HT64_ARATH/132-406-----PGPRDA..PIQCFIK...RERA...........TGIYRLYLGLSP...ALSGDKSKLLLS---------A.....
I1M8B1_SOYBN/124-417-----PGPRDS..PIQCFIR...RERM...........TSTYCLYLGLSP...ALSGDMSKLLLA---------A.....
I1R4B9_ORYGL/123-439-----PGPRDG..AIQCFIK...RDKS...........TQTYNLYLCLSS...AVLVESGKFLLS---------A.....
I1JFG1_SOYBN/112-394-----PGPRDS..LLQCYIK...RNRS...........NQTYYLFLGLNQ....ASTDEGKFLLS---------A.....
F6H054_VITVI/120-410-----PGPRES..QIQCFIK...RERA...........TSTFRLYLGLSP...ALSGDASKLLLA---------A.....
M1B9A0_SOLTU/117-404-----PGPRES..PIHCFIK...RDSD...........NSVYRLYFGLTP...S.EDESDKLLLA---------A.....
K4BFS0_SOLLC/118-400-----PGPRES..PIHCFIK...RDRA...........NSVYRLYFGLTP...S.EDESDKLLLA---------A.....
H3GWQ0_PHYRM/600-881-----...RGQ..IVKCFIE...RNDS......GPNKLAPIYTLLL.......EVNSSSGRPIMY---------A.....
F0YIF3_AURAN/571-870-----....GV..VVRCFIE...RNRS......GRHALFPLYKLYA.......DHEDGTGRLLVA---------A.....
D8R328_SELML/134-424-----PGPRDA..TMQCFIK...RDRA...........TSTYHLCLGLSPNFDAGLQEHGKFLLA---------A.....
K3YSM4_SETIT/134-423-----PGPREQ..PVQCFVK...RDRA...........TSTYLLYLGLSP...SLNVENDKLLLA---------A.....
W1PZG2_AMBTC/117-478-----PGPRDA..TIQCFIK...RDKA...........TLTYHLYLGLSP....VLAENGKFLLS---------A.....
M3XWI0_MUSPF/313-554-----PALRGR..TMQCRIS...RDKR.....GVDKGMFPFYYLYL....DA...AEGQKHFLLA---------G.....
D8UHI1_VOLCA/195-429-----PGPKNG..PVQCVIV...RDRG.......SVKMYPRYSLYL..........EEGRRFLLS---------A.....
M4EBC2_BRARP/149-382-----...........CLIV...KEQS.....PEGLRDGSVYSLYT......HEGRGRKDRKLAV---------A.....
W4XBT8_STRPU/232-473-----PAPQGG..SVRCRIT...RDKK.....GVDRSVYPTYYLHM....ER...DDGRKQFLLA---------A.....
M4FID3_BRARP/111-391-----PGPRDD..PIQCFIK...RERA...........TGIYRLYLGLSP...ALTGDKSKLLLS---------A.....
F6GWV6_VITVI/118-407-----PGPRDS..PIQCFIR...RDRA...........TSTYLLYFGLTP...S.EGQSDKLLLA---------A.....
E1ZRT4_CHLVA/5-242-----PGPADK..PLCCKIV...RCSG.....GLLKG.NPQYTLMM......EQEGGKTGAFLAA---------A.....
W5GHE7_WHEAT/78-314-----..........TCVVV...REKA......TGARGVALYSLYT......NEGQGRQDRKLAV---------A.....
E9HFS8_DAPPU/11-241-----.APKES..QMKCRIT...RDRK.....GMDRGLYPTYFLHL....ER...EDGKKIFLLA---------G.....
K3Z7I3_SETIT/92-345-----PGPKDF..PIQCFIN...RNKK...........NSTFYLYLGFTN.NLTSTTGKGKFLMA---------A.....
G3RQT8_GORGO/194-436-----PAPQGV..TVRCRII...RDKR.....GMDRGLFPTYYMYL....EK...EENQKIFLLA---------A.....
A9SFN2_PHYPA/268-494-----.........IECHIR...RHIH.......AKWLTPSYRLYL..........SDGDRFLLS---------S.....
D8R0N5_SELML/71-351-----PGPRDA..TVQCYIE...RDRT...........TATYRLFLGLTP...TLT.ENGKFLLA---------A.....
D2VAC3_NAEGR/225-455-----..NRNE..WVRCYIL...RDTS.....KMNK.VFPRYYLYA..........ERGSTFLLS---------G.....
U6HW68_ECHMU/466-723-----PAPKGV..TVCCRIS...RDKH.....GLEGGLFPSYFLHL....ERQ..EDGRRFFLLA---------A.....
D7LYF8_ARALL/105-385-----PGPRDS..LVQCFIK...RNRI...........TQSYHLYLGLTN....SLTDDGKFLLA---------A.....
B9S6E9_RICCO/119-408-----PGPRES..PIQCFIR...RETA...........TSTYLLYYGLVP...S.ENESDKLLLA---------A.....
K4BTD6_SOLLC/117-420-----PGFRDG..TIQCFIR...RDKS...........KLTYQLFLCLSP...ALLVENGKFLLS---------A.....
TLP9_ARATH/98-374-----SGPRDS..LVQCFIK...RNRN...........TQSYHLYLGLTT....SLTDNGKFLLA---------A.....
TULP2_HUMAN/279-520-----PALPGT..MMQCYLT...RDKH.....GVDKGLFPLYYLYL....ET...SDSLQRFLLA---------G.....
C5Y569_SORBI/117-450-----PGPRDG..TIQCFIK...RDKS...........TQVYSLYLSFSS...AVPAEDGKFLLS---------A.....
TLP10_ARATH/123-439-----PGPRDA..MIQCFIK...RDKS...........KLTFHLFLCLSP...ALLVENGKFLLS---------A.....
B9HF20_POPTR/119-410-----PGHRES..PIQCFIK...RDTA...........TSTFLLYYGLVP...S.EGENDKLLLA---------A.....
H2UUG1_TAKRU/220-462-----PAPRGV..TIKCRVS...RNKK.....GMDRGLYPTYFMHM....ER...EDGKRVFLLA---------G.....
M7YYC1_TRIUA/164-457-----PGPRDG..MIQCFIK...RNKS...........KSTYQLYLCLTN...VVTAETGKFLLS---------A.....
H9GP51_ANOCA/382-623-----PAPKGN..IIQCRIT...RDRK.....GMDKGIFPFYYLHL....EM...ENGKKHFLMS---------G.....
A0DFE0_PARTE/648-881-----PAPKGG..MIQCTIK...RDRS.....GMSR.FYPKYHLHL..........SNGFLYLMS---------A.....
D7G017_ECTSI/222-546-----..PSED..MVYCSLE...RHRG...........EHVTSFHL........NRDDTGEFLLA---------CSVDAN
M0T5F2_MUSAM/105-356-----PGPRDT..PIQCFIR...RERA...........TSTFLLFLGLSP...SLQGQNDKLLLA---------A.....
K3YHL3_SETIT/122-443-----PGPRDE..MIQCFVK...RDKS...........TSTYYLYLCLSP...AVLSENGKFLLA---------A.....
T1G0S1_HELRO/9-246-----PAPAGT..TIKCRIS...RDKR.....GIDKGFYPTYYLHL....EK...EDGRKIFLLA---------G.....
C3ZNP4_BRAFL/69-310-----PAPQGH..TVKCRIT...RDKK.....GMDRGVFPTYYLHM....ER...DDGKKVFLLA---------G.....
M1APY8_SOLTU/99-381-----PGPRDT..LLQCFIK...RNQT...........TQTYHLYLSLTQ....ALADDGKFLLA---------A.....
I1GRC6_BRADI/110-376-----PGPRDA..PIKCFIR...RNRA...........THTYCLYIGLTN....ALADDGKFLLA---------A.....
A7SD12_NEMVE/2-243-----PAPQGI..PVKCRIT...RDKK.....GMDRGMYPTYFLHM....ER...DDGKKVFLLA---------G.....
D8RN05_SELML/30-264-----.........CRCYIV...REHR.........DGPSVYSLYT......DEGQGRQDRLLAV---------A.....
TUB_RAT/257-499-----PAPQGI..TIKCRIT...RDKK.....GMDRGMYPTYFLHL....DR...EDGKKVFLLA---------G.....
F7FA58_CALJA/208-448-----PALRGI..RMQCYIK...RDNR.....GVDKYLFPLYYLYL....EN...PDGLKRFLLA---------G.....
K7U427_MAIZE/53-379-----PGPRNG..IIQCFIK...RDKS...........TSTYYLYLCLSP...VVLSEDGKFLLA---------A.....
W5KLH5_ASTMX/308-549-----PAPRDT..TIQCRIT...RDRR.....GMEKGIYPTYYLHM....EK...EDGKRVFLMA---------G.....
K3ZLR9_SETIT/117-436-----PGPRDG..TIQCFIK...RDKS...........TQIYYLYLCLSS...TVLVENGKFLLS---------A.....
K1RHW3_CRAGI/170-406-----PAPQGH..VMKCRIT...RDKK.....GVDRGIYPTYFLHL....EK...EDGKKVFLLA---------G.....
K3WRQ8_PYTUL/367-602-----........VLECYIE...RNKS......GANKMFPEYCLYM..........KEGDRFLLT---------A.....
M0RRJ1_MUSAM/117-379-----.GPRDS..TIQCFVKRDNRDKS...........SLTYHLYLCLSS...DVLVENGKFLLS---------A.....
D8TVK7_VOLCA/158-460-----.APSDG..MIRCTMR...RVKN.......FMGQTLAYHLFL..........DNGDTFVLA---------A.....
W1NPG7_AMBTC/119-376-----PGPRDH..PLQCLIK...RDKQ...........TSTFYLYLGPTQ....SFVDKGKFLLA---------A.....
C6T8I4_SOYBN/79-355-----PGPREH..LLQCFIR...RNSA...........SQTYYLFLSLSS...ALVADDGKFLLA---------A.....
G4VQP4_SCHMA/265-505-----PAPQGV..TIRCRIT...RDKR.....GVDRGIFPSYYLHL....EK...ED.CKFFLLA---------A.....
E5SUB8_TRISP/231-466-----PAAKGT..TFKCRIT...RDKH.....GLDRNFYPTYFLHL....EK...EDGKRIFLLA---------A.....
D7T6J6_VITVI/62-344-----PGPRES..LLKCFIK...RNRS...........AQTYYLYLSLTN....ALTEDGKFLLA---------A.....
K3XJ41_SETIT/116-363-----PGPRDA..PMQCFIK...RNKK...........KSTFHLYLSLTQ....ALTGQGKFLLA---------A.....
B9I1T1_POPTR/116-372-----PGPRDL..PHQCLIK...RNKK...........TSTFYLYLALTP....SFMDKGKFLLA---------A.....
J3N6A6_ORYBR/117-435-----PGPRDG..TIQCFIR...RDKS...........TQTYYLYLSLGS...AVLVDNGKFLLS---------A.....
F1P3K2_CHICK/115-352-----PAPQGV..TIKCRVT...RDKR.....GMDRGLYPTYYLHL....DN...D..KKVFLLA---------G.....
D7FIT4_ECTSI/26-286-----G.......VVQCYIR...RNKT......RANKIFPEYSLFL..........KEGDRFLMC---------S.....
A0DMD6_PARTE/263-494-----..PQGT..ILECDVK...IVKG.......WFGCHLAYNFY..........HSKTQKLLLS---------V.....
M1CWX7_SOLTU/117-421-----PGPRDG..TIQCFIK...RDKS...........NLTYHLFLCLSP...ALLVENGKFLLS---------A.....
E4X5I6_OIKDI/256-497-----PAPQDE..QIKCRIS...RDRK.....GIDNRAYPVYYLHL....ER...EGQKKVFLLA---------G.....
B8C979_THAPS/14-256-----G.......MVHCYVQ...RNKG......IKNKLFPEYRVYL..........KGNNAFLMT---------S.....
M4FEU8_BRARP/112-371-----PGPRDL..PIQCFIK...RNRA...........TATYILYYGLMP...S.EMENDKLLLA---------A.....
C4J4R4_MAIZE/117-430-----PGPRDV..TIQCFIK...RDKS...........TQTYYLYLCLST...AVLVESGKFLLC---------A.....
D7FSI7_ECTSI/103-375-----.....G..AIRCRVA...RKEG....GGWNPMASSVYGMHH.........IQGGMVFMMS---------A.....
K3X0N8_PYTUL/565-829-----...RGF..IMKCFIE...RNDS......GPNKLSPIYTLLL.......EVNSSSGRPIMY---------A.....
K0S854_THAOC/488-735-----...RDG..VVQLVIR...RNKG......LKNALSPEYRVYL......RLGSGETETFLMT---------S.....
TLP3_ARATH/116-400-----PGPRGS..LVQCYIM...RNRS...........NQTYYLYLGLNQ...AASNDDGKFLLA---------A.....
M0THC4_MUSAM/33-288-----PGPRDL..PIQCYIK...RNKN...........NNTFCLYLSLTH....TFMDKGKFLLA---------A.....
K4BB27_SOLLC/117-405-----PGPRES..PIQCFIK...RDRA...........NSVYRLYFGMIP...S.EDERDKLLLS---------A.....
U5CU96_AMBTC/119-415-----PGPRDS..LMQCYIK...RNRT...........AQTYHLYMGLTQ....TLSDNGKFLLA---------A.....
H9JIE3_BOMMO/143-380-----PAKHGT..LYKCRIA...RDRK.....GMDRGLYPTYFLHL....EK...DYGKKVFLLA---------A.....
T1JB91_STRMM/42-280-----PAPQGS..LLKCRIT...RDRK.....GMDRGLFPTYYLHL....EK...EDGKRVFLLA---------A.....
D2A282_TRICA/154-394-----PAQQKV..LYKCRIT...RDRK.....GMDRGLYPTYYLHL....ER...DYGKKVFLLA---------A.....
M0SJG0_MUSAM/62-313-----PGPADT..PIQCYIK...RNKK...........NSTFYLYLGLSQ....TFTDKGKFLLV---------A.....
U1M828_ASCSU/3-244-----PAKRNV..TYKCRIT...RDKK.....GVDRGIYPTYFLHL....EK...DDEKRVFLLA---------A.....
I1JCN8_SOYBN/119-408-----PGPRDS..PIQCFIR...RNKE...........TSTYLLYFGLVP...S.ENDSNKLLLA---------A.....
TLP5_ARATH/119-423-----PGPRDG..IIQCYIK...RDKS...........NMTYHLYLSLSP...AILVESGKFLLS---------A.....
F6HQ19_VITVI/117-399-----PGPRGS..LLQCYIK...RNRS...........NQTYHLYLGLNQ....ASTDDGKFLLA---------A.....
A8ISI1_CHLRE/224-484-----.APSDG..IIRCTVR...RVKN.......FLGHTLAYQLFL..........DSGDTFVLA---------A.....
F0XZM0_AURAN/13-250-----RAG.....IVQCYIK...RNRS......GTNKLFPEYSVFM..........KEGDRFMMC---------S.....
TUB1_CAEEL/174-420-----PAVEHC..LYKCSIT...RQKS.....GVDKGMFPTYFLHL....EEFDTDKRQKIFLLA---------A.....
M0TYP5_MUSAM/117-422-----PGPRDG..SIQCFIK...RDKS...........ALTYHLYL.......SVLVENGKFLLS---------A.....
M4E7K8_BRARP/119-432-----PGPRDT..MIQCFIK...RDKS...........KLTFHLYLCLSP...ALVVENGKFLLS---------A.....
TULP_DROSE/202-437-----PAPQGV..LYKCRIT...RDRK.....GMDRGLFPIYYLHL....ER...DYGKKIFLLG---------G.....
M0SK32_MUSAM/62-312-----PGPRDS..PIQCFIR...RNKN...........NSTFYLYLGLTE....SFTDKGKFLLA---------A.....
TLP11_ORYSJ/119-400-----PGPRDA..PMKCFIV...RNRT...........TQTYYLYIGLTD....ALTDDGKFLLA---------A.....
B9H7S3_POPTR/117-417-----PGPRDG..TIQCFIK...RDKS...........KLTYHLFLCLSP...ALLVENGKFLLS---------A.....
W5EQP4_WHEAT/117-434-----PGPRDG..TMQCFIK...RDRS...........TQTYYLYLCLTS...AVLVENGKFLLS---------A.....
D7FYS0_ECTSI/361-593-----NSD.....LVQCVVV...RDRS......GMNRLYPQYRFFF.........EGRGDQLMMV---------A.....
D7FYT0_ECTSI/243-552-----....GT..VLRCFIE...RDRS......GTHKFSPVFSMYA.......DLGDGSGRMLLA---------A.....
F6RL90_CIOIN/49-290-----PAPQGY..TIKCRIS...RDNK.....GIDRHSYPTYYLHY....ER...DDGKKIFILA---------G.....
I1PX84_ORYGL/116-366-----PGPRDA..PMHCFIR...RNKK...........NSTFYLYLSLTQ....ALTDKGKFLLA---------A.....
I1I0A3_BRADI/123-441-----PGPRDG..LIQCFIK...RDKS...........TLTYYLYLCLSP...AVLSENGKFLLA---------A.....
U5G686_POPTR/104-386-----PGPRDF..LLQCFIK...RCRS...........AQTYRLYLGLNN....ALTEDGKFLLA---------A.....

PF03803

PLS3_HUMAN/62-284---------------NCCARLCCGARRPLRVRLA----------DP-----GDRE-----------VLRLLR-------P
PLS4_HUMAN/100-322---------------DDFTRNAYRTLRPFVLRVT----------DC-----MGRE-----------IMTMQR-------P
Q9NAE9_CAEEL/48-258---------------NGFARQMQGSHRSFAMMCT----------DL-----FGAH-----------VMQCHR-------D
Q21318_CAEEL/74-284---------------NIFARQYEGNDRNFGMQIM----------DT-----HGAQ-----------VMTCFR-------G
Q9VZW1_DROME/42-263---------------DCCTRNMLGRSRPFEMKIL----------DN-----FQNE-----------VLHLYR-------P
YIP6_SCHPO/58-304---------------SSLSRQFFHTHRAFKADVM----------DS-----NGQL-----------VLQLNR-------P
PLS1_HUMAN/86-307---------------DCCTRNCCGPSRPFTLRII----------DN-----MGQE-----------VITLER-------P
AIM25_YEAST/59-310---------------KAIMRQFYRLHRPFLVDVF----------DN-----WGNV-----------IMTIKR-------P
Q9SI32_ARATH/150-379---------------NLLARQLLRTRRPFVASIT----------DA-----LGNE-----------LFRVRR-------P
O45799_CAEEL/51-280---------------GCCERQCCGPQRGFVMHIV----------DN-----FKRE-----------VLTIKR-------E

PF04525

LOR14_ARATH/16-196---------------DG...QAWGFNRKRVM--R----------DP-----AGFT-----------ILSMRQ.K.....G
LOR3_ARATH/29-209---------------DN..YDSKSWSNEVYF--M----------DL-----NGKI-----------LFTLRQ.K.....K
LOR7_ARATH/7-145---------------RK...S...SSSLKSL--L----------DS-----SGVP-----------LFSISR........
LURP1_ARATH/5-186---------------KD...PLFSLHGKRIL--L----------DC-----SGAK-----------VLTLRG.K.....M
LOR11_ARATH/36-222---------------DNY.N..SKSCREVYL--M----------DL-----SGHV-----------LFTLRR.Q.....K
D6ENB3_STRLI/2-152---------------DG...KAMRLRDTWEL--K----------DP-----QGRV-----------LIDIHQ.K.....M
LOR4_ARATH/7-183---------------ENY.D...KCSNEVHI--M----------DL-----HGNI-----------LFTIRK.K.....K
L8AWG7_BACIU/1-148---------------EG...RFFSLGDSLQM--T----------DS-----SGKT-----------LVSIEQ.K.....L
LOR5_ARATH/4-186---------------DSYGGPNTRDTDEVVL--M----------DA-----HGRC-----------LLTLRR.K.....R
LOR12_ARATH/18-197---------------DSY.GPDTRDNDEIVL--M----------DA-----TGKC-----------LLTVKR.K.....R
Q97Q47_STRPN/1-153---------------EG...SFFKIPKTFTI--Y----------DA-----AGEQ-----------VSEISK.E.....I
LOR17_ARATH/24-215---------------DNY.A..RTRPEELIL--M----------DK-----DGNS-----------LLLMHRTK.....K
LOR15_ARATH/25-206---------------KE...PVFGLHDKRVL--L----------DG-----SGTP-----------VVTLRE.K.....M
LOR8_ARATH/10-188---------------DNY.M..NCPRDNIVL--M----------DA-----SGFP-----------LLSIRR.K.....K
LOR6_ARATH/2-180---------------DGC.G.VLGTKGELVL--R----------DS-----DGND-----------LLLIHK.KGGVVQA
LOR13_ARATH/13-175---------------KT...PLFGLHNKRIL--V----------DP-----NDSP-----------IVTMKM.K.....V

PF01167

G0QXR5_ICHMG/270-502...............KKRSSN.KTSNYLISMSKD..........NL.....SKKS..PDF......LGKVRS-------.
E4XRC9_OIKDI/84-325...............RKRK.T.GNSSYIIATSVE..........NL.......NS..EIF......VGKLKS-------N
M4BSN8_HYAAE/388-632...............VRRRQYDMSVSFLIFLAAD...MDTTGEETL.....ASDSEAVSSINAAMPVARLDK-------.
M0SAD5_MUSAM/110-361...............RKTRRA.TSTDFVISLASD..........NF.....SRAS..NAY......IGRVR.-------.
M4AUK7_XIPMA/179-416...............RKRKKS.TTSNYLISIDAT..........DL.....SRGG..ENF......VGKLRS-------.
W1NGY4_AMBTC/30-320...............RKIRRA.TSTDFIISLDAD..........DF.....SRAS..NTY......VGKLRS-------.
G7YSE7_CLOSI/527-800...............RRRKRS.ATSNYVISCDAT..........DL.....SRRA..DSF......AGKLRS-------.
S2K614_MUCC1/46-291...............RKKRKS.NTSYYTI....T..........GI.....YREN..TSVPEGYVELGKVRS-------.
C1FIJ1_MICSR/334-589...............RKRKKS.KSSNYVISLDEE..........DM.....ARQS..GNF......FAKLRS-------.
A9TE85_PHYPA/123-416...............QKFRRA.TSTDYIISLNQE..........DM.....SRGS..STY......VGKLRS-------.
A0EG93_PARTE/216-448...............KKVVMN.TTSNYVISMDKR..........EF.....STRK..SCF......LGKVRS-------.
Q22Y91_TETTS/368-602...............KKRSNN.KTSNYLMSMSKT..........EL.....SRKS..PHF......LGKVRS-------.
TLP7_ARATH/108-372...............RRFRTG.AYTEYIISLDAD..........DF.....SQGS..NAY......VGKLRS-------.
J3M9P3_ORYBR/81-337...............RRFRRG.PQLEYIISLDAG..........GL.....SQGN..NAY......MGKLRS-------.
D7KMY6_ARALL/120-422................QPYLT.TYTEYVMSMDAD..........NI.....SRSS..STY......IGKLRS-------.
J3MPK4_ORYBR/123-441...............KRTRRT.TYTEYIISVDSK..........NI.....SRSS..NGY......VGKLRS-------.
I1IN97_BRADI/117-439...............KRICRA.TWTEYIISMNAN..........SI.....SSSS..NTY......LGKMRS-------.
H2ZV03_LATCH/267-506...............RKRKKC.KTANYLISIDPT..........DL.....SRDG..DSY......IGKVRS-------.
H0WAT2_CAVPO/269-510...............RKRKWS.KTANYLISLDPM..........DL.....SRDG..DNF......VGKVRS-------.
B3SBY7_TRIAD/1-241...............RKRKKS.KTSNYLISNDAT..........DL.....SRNG..ESF......VGKLRS-------.
F1PNR7_CANFA/215-456...............RKRKKS.KTSNYLISTDPT..........DL.....SREG..ESY......IGKLRS-------.
K3Z6B7_SETIT/115-432...............KRSRRT.THTDYAISMDSK..........NF.....SRSS..TGY......IGKLRS-------.
TULP2_MOUSE/315-556...............RKRKRS.KTSNYLISLDPK..........DM.....SRNG..SNF......VGKVRS-------.
B9GRM5_POPTR/121-410...............KKIRKA.TSTDFRISFAGS..........DF.....CQTS..NTY......VGKLRS-------.
M0RYY8_MUSAM/119-400...............RKCRRP.TCTEYLISLDAD..........DK.....SRGG..GTY......IGKLRS-------.
F4NT32_BATDJ/88-310...............KKMRSQ..TSCYIITLPSE.................GDRGVRNKS......IARVRS-------.
M7YZS2_TRIUA/159-501...............KRSRRT.TYTDYAISMDPK..........NI.....SRSS..SGY......IGKLRS-------.
TLP1_ARATH/121-449...............KRIRRT.TYTEYVISMHAD..........TI.....SRSS..NTY......IGKIRS-------.
C5X4V0_SORBI/116-393...............RRSRRP.AGTEYLISLDAK..........NT.....SKG....TC......IGKLRS-------.
K3WG02_PYTUL/293-540...............RRQVRSNMTANYVLCTDKE.................CTEA..NR.......IGRMGS-------.
C1N1L4_MICPC/293-551...............RRRKKS.KTSNYIISLDEE..........DT.....ARNS..GNY......FGKVRS-------.
W1PSZ7_AMBTC/113-431...............RKIRRP.THAEYVISLDPE..........DM.....SRTT..GSY......IGKLRS-------.
A9TFU9_PHYPA/122-419...............RKCRRA.TSTDYIVSLNHE..........DM.....SRGS..NTY......VGKLRS-------.
K4AAU1_SETIT/114-394...............RKCRKP.TCTDYLISLDKV..........DM.....SKGS..STY......IGKLRS-------.
B9R7W3_RICCO/118-407...............KKIRRA.ASTDFRISFVGS..........DF.....CRTS..NTY......VGKLKS-------.
K4CGS2_SOLLC/123-379...............RRYRNG.AHIEYIISLDAD..........DL.....SQRS..KAY......VGKLRS-------.
G0QPZ2_ICHMG/56-278...............KKRQKH....YYMIQMNPN..........YF.....SKKS..TDY......IGKIKG-------.
D8SG45_SELML/128-419...............RKFRRA.SGTDYIISTDTD..........DF.....SRGS..NTY......VGKLRS-------.
TLP7_ORYSJ/120-456...............KRSRRT.THTDYIISMDSK..........NI.....SRSS..SGY......IGKLRS-------.
TLP1_ORYSJ/99-349...............RRFRRG.PHTEYIVSLDAD..........DL.....SQGS..NAY......MGKLRS-------.
A0BWZ4_PARTE/130-363...............KRQSTK.RKSNYVISTNAE..........NF....NSNNK..SVC......IGNLKY-------.
L9L384_TUPCH/349-587...............RKRKRS.KTANYLISSDPT..........NL.....SRGG..ENF......IGKLRS-------.
K3ZU09_SETIT/112-390...............RKYRRP.SCTEYLISLD...................SKGN..GTY......LGKLRS-------.
F6TZP0_XENTR/258-499...............RKRKKC.KTSNYLISVDPT..........DL.....SRDG..DSF......IGKVRS-------.
A9SPK2_PHYPA/122-414...............RKFRRA.TSTDYIISLNQE..........DM.....SRGS..NTY......VGKLRS-------.
J3M7K2_ORYBR/123-439...............KRYRKT.TCTEYVISMDAD..........NI.....SRSS..STY......IGKLRS-------.
I1J3P3_BRADI/123-449...............KRSRRT.TYTDYAISMDSK..........NI.....SRSS..SGY......IGKLRS-------.
M0SFG0_MUSAM/119-397...............RKCRRP.TCTDYLISLHAD..........DM.....SRTS..ATY......IGKLRS-------.
C5XQM9_SORBI/123-474...............KRHRKT.TCTEYTISMDSG..........NI.....SRSS..RTY......IGKIRS-------.
I1NRS9_ORYGL/1-249...............RRCRRG.LHKEYAITINSD..........GL.....FHGS..QSC......VGNLKS-------.
A0DNS7_PARTE/64-294...............RKQQCP.GSHKFQLSKSET........ELDL....................VGTLES-------.
I1LHT6_SOYBN/119-408...............KKVRRA.TGTDFIISLVAD..........DF.....SRSS..NTY......VGKLRS-------.
M4DW60_BRARP/89-338...............CKLKRA.TCTDYIISLRSD..........DM.....SRRS..NAY......LGRVRS-------.
F4HT64_ARATH/132-406...............KRVRRA.TGAEFVVSLSGN..........DF.....SRSS..SNY......IGKLRS-------.
I1M8B1_SOYBN/124-417...............KKIRRA.TCTEFIISLVAD..........DF.....SRAC..DTY......VGKLRS-------.
I1R4B9_ORYGL/123-439...............KRYSRA.TCTEYTIFMSAD..........NT.....SRSS..NMY......IGKLRS-------.
I1JFG1_SOYBN/112-394...............RKCRRA.THTDYIISLNCD..........DV.....SRGS..STY......IGKLRS-------.
F6H054_VITVI/120-410...............RKIRRA.TSTEFVISLLGD..........DF.....SRAT..NAY......VGKLKS-------.
M1B9A0_SOLTU/117-404...............RRIRRA.TSTDFVISLVAD..........DF.....SRAS..NTY......LGKLRS-------.
K4BFS0_SOLLC/118-400...............KRIRRA.TSTDFVISLVSD..........DF.....SRAS..STY......VGKLRS-------.
H3GWQ0_PHYRM/600-881...............RKKATSRITSHYVISMNRD..........DLFLSRMMRS...HQY......IGKLRS-------.
F0YIF3_AURAN/571-870...............RKLPGN.GTSHYAFSTSPA..........DLYKARGNRS...RHY......LGKLRA-------.
D8R328_SELML/134-424...............RKVRRA.TTTDYIISLDPE..........DF.....SRGS..TSY......VGKLRS-------.
K3YSM4_SETIT/134-423...............RKVRRA.TRTSFVISLASN..........DF.....SHSS..STY......VGKLKP-------.
W1PZG2_AMBTC/117-478...............KRSRRT.TCTEYVISMDVD..........AI.....NKTS..GSY......VGKMRS-------.
M3XWI0_MUSPF/313-554...............RKRKRS.KTSNYLISLDPT..........DL.....SRDG..DNF......VGKVRS-------.
D8UHI1_VOLCA/195-429...............RKRKKQ.TTSNYVISLKQD..........DL.....SRES..GSF......FGKVRA-------.
M4EBC2_BRARP/149-382...............YHRRRK.GKSVFRIAQNVK..........GL......LCSSDESY......VGSMTA-------.
W4XBT8_STRPU/232-473...............RRRKKS.KTSNYLMTTDPT..........DL.....SRDG..ENF......VGKLRA-------.
M4FID3_BRARP/111-391...............KRVRRA.TGVEFIVSLSGK..........DF.....SRSS..SNY......IGKLRS-------.
F6GWV6_VITVI/118-407...............RRIRRP.TSTDFVISLVAD..........DF.....SRAS..NTY......VGKLRS-------.
E1ZRT4_CHLVA/5-242...............RKRKGGPGGASFVLSVDQH..........DI.....SRRD..ASY......VGKLRS-------.
W5GHE7_WHEAT/78-314...............RHRRRR.GRSEFIVAQNQD..........GV......FCSSDKNF......LGTMGA-------.
E9HFS8_DAPPU/11-241...............RKRKKS.ATSNYIISTDPT..........DL.....SRGG..EAF......AAKLRS-------.
K3Z7I3_SETIT/92-345...............KRVRRG.AHTEYIISLDAD..........DL.....SQGN..SAY......VGKLRS-------.
G3RQT8_GORGO/194-436...............RKRKKS.KTANYLISIDPV..........DL.....SREG..ESY......VGKLRS-------.
A9SFN2_PHYPA/268-494...............KKRKKA..KTNYTISLDEN..........DI.....SKQS..GNY......FGKLRS-------.
D8R0N5_SELML/71-351...............RKSRRA.TSTDYIISIDPE..........DM.....SRGS..SSC......VGKLRS-------.
D2VAC3_NAEGR/225-455...............KKRKAN.KSSNYCLSLSKE..........DI.....SRSS..DSF......IGKLRS-------.
U6HW68_ECHMU/466-723...............RRKRRA.TTCNYLISLDATAPSTTTSSPLDA.....PGDG..RLN......VGHLRS-------.
D7LYF8_ARALL/105-385...............CKLKHT.TCTDYIISLRSD..........DM.....SRRS..QAY......VGKVRS-------.
B9S6E9_RICCO/119-408...............RKIRRA.TCTDFIVSLAAD..........DF.....SRAS..NTY......VGKLRS-------.
K4BTD6_SOLLC/117-420...............KRNRRT.TCTEYIISMNAD..........NI.....SRSN..SSY......IGKLRS-------.
TLP9_ARATH/98-374...............SKLKRA.TCTDYIISLRSD..........DI.....SKRS..NAY......LGRMRS-------.
TULP2_HUMAN/279-520...............RKRRRS.KTSNYLISLDPT..........HL.....SRDG..DNF......VGKVRS-------.
C5Y569_SORBI/117-450...............KRNCRP.TYTEYTISINSG..........DI.....SRSTSNNTY......IGKLRS-------.
TLP10_ARATH/123-439...............KRTRRT.TRTEYIISMDAD..........NI.....SRSS..NSY......LGKLRS-------.
B9HF20_POPTR/119-410...............RKIRRA.TCSDFIVSLVSD..........DF.....SRAS..NTY......VGKLRS-------.
H2UUG1_TAKRU/220-462...............RKRKKS.KTSNYLISVDAT..........DL.....SREG..ESF......IGKLRS-------.
M7YYC1_TRIUA/164-457...............KRNRKT.SCTEYAISMDSA..........NT.....SRSN..RTY......IGKLRS-------.
H9GP51_ANOCA/382-623...............RKRKKS.KTSNYLISLDPI..........DL.....SRDG..DNF......IGKVRS-------.
A0DFE0_PARTE/648-881...............KKRACN.NTSNYIISMSRE..........DL......EKG..NNF......IGKVRS-------.
D7G017_ECTSI/222-546LQGPMLFHTLQDTHLRELK.........................DI.....PTSSDSAVY......LGCMFP-------.
M0T5F2_MUSAM/105-356...............RKIRRA.TSTDFVISLTAD..........DF.....SRAS..SSY......IGKVR.-------.
K3YHL3_SETIT/122-443...............KRNRRT.TYTEYIISMDPK..........NI.....SRSS..NGY......VGKMRS-------.
T1G0S1_HELRO/9-246...............RKRKKS.ATSNYLLSIDPT..........EL.....SRDS..ASF......IGKVRS-------.
C3ZNP4_BRAFL/69-310...............RKRKKS.TTSNYLVSVDAT..........DL.....SRGG..ESY......VGKLRS-------.
M1APY8_SOLTU/99-381...............RKYRKA.TCTDYTISLDAN..........EM.....SKGG..GTC......IGKLRS-------.
I1GRC6_BRADI/110-376...............RKYHRP.TCTEYLISLDRT..........DM.....SKGS..QTC......IGKLRS-------.
A7SD12_NEMVE/2-243...............RKRKKS.TTSNYLISTDAT..........DL.....SRGG..ESF......VGKLRA-------.
D8RN05_SELML/30-264...............RHRRRV.GRSEFLIAQSTI..........GT.....VLQSQDEGY......LGNLGA-------.
TUB_RAT/257-499...............RKRKKS.KTSNYLISVDPT..........DL.....SRGG..DSY......IGKLRS-------.
F7FA58_CALJA/208-448...............RKRRRS.KTSNYLISLDPT..........DL.....SRDG..DNF......VGKVRS-------.
K7U427_MAIZE/53-379...............KRNRRT.TYTEYIISVDPK..........SI.....SRSS..DGC......VGKMRS-------.
W5KLH5_ASTMX/308-549...............RKRKKS.TTSNYLISTDPT..........DL.....SRDT..SSY......IGKLRS-------.
K3ZLR9_SETIT/117-436...............KRNIRP.TCTEYIISMNSG..........NV.....SRSTNTNTY......IGKLRS-------.
K1RHW3_CRAGI/170-406...............RKRKKS.ATSNYLLSTDPT..........DL.....SRGG..EAY......VGKLRA-------.
K3WRQ8_PYTUL/367-602...............KKRPKN.RTSNYLISMQRG..........DL.....SRRGS.DNY......IGKLRA-------.
M0RRJ1_MUSAM/117-379...............KKIRRA.TCTEYIISMDRD..........NI.....TRSS..NTY......IGKVRS-------.
D8TVK7_VOLCA/158-460...............RKRKKS.TNSNYVLSTSQA..........DL.....GRDS..EHR......IAKLRA-------.
W1NPG7_AMBTC/119-376...............RRFRHR.AHTEYIISLTTD..........DF.....SQGS..SAY......MGKLSS-------.
C6T8I4_SOYBN/79-355...............RKFRRP.TCTDYIISLDAD..........DM.....SRES..NAY......VGKLRS-------.
G4VQP4_SCHMA/265-505...............RRRKRS.TTSNYVISCDAT..........NL.....SRDA..ISF......TGKLRS-------.
E5SUB8_TRISP/231-466...............RKRKKS.TTSNYLISIDPT..........DL.....SRYC..AS............S-------.
D7T6J6_VITVI/62-344...............RKYRRT.TCTDYIISLYAD..........DM.....SKGS..STY......IGKLRS-------.
K3XJ41_SETIT/116-363...............RRNRCG.FRMEYIISTQGD...........L.....SHGS..H........VGKLKS-------.
B9I1T1_POPTR/116-372...............RRYRQG.AHTEYIISLDAD..........EL.....SQGS..NAY......VGKLSS-------.
J3N6A6_ORYBR/117-435...............KRNCRA.TCTEYVISMNAN..........NI.....SRST..NTY......IGKLRS-------.
F1P3K2_CHICK/115-352...............RKRKKS.KTSNYLISIDPT..........DL.....SRGG..ENF......IGKLRS-------.
D7FIT4_ECTSI/26-286...............KKRPNN.ATSNYLVSMRAG..........DL.....DRNS..TNF......LGKLRA-------.
A0DMD6_PARTE/263-494...............KKSKCT.GSHRFYLSKSET........ELDV....................VGTLES-------.
M1CWX7_SOLTU/117-421...............KRTRRT.TCTEYVISMDAE..........NI.....SRSS..NTY......IGKLRS-------.
E4X5I6_OIKDI/256-497...............RKRKKT.KTSAYLISTDPT..........EL.....TKKS..ESF......VAKVRS-------.
B8C979_THAPS/14-256...............KKRAGN.KTSNYLISMGRN..........DH....DNRLS..PNI......LGKLRS-------.
M4FEU8_BRARP/112-371...............RRVRRA.TCTDFVISLSAK..........NF.....SRRS..STY......VGKLRS-------.
C4J4R4_MAIZE/117-430...............KRTSRP.TCTEYTIFMNSE..........NL.....SRSS..KMY......IGKLRS-------.
D7FSI7_ECTSI/103-375...............TRQPLS.RTANYYISASPY.........LET.....TKDT..REY......MGKLRA-------R
K3X0N8_PYTUL/565-829...............RKKAASRITSHYVISMNN........................HQY......IGKLRS-------.
K0S854_THAOC/488-735...............KKRTFASKTSSYLISMSRN..........DH.....DKRS..ESV......LGKLRS-------.
TLP3_ARATH/116-400...............KRFRRP.TCTDYIISLNCD..........DV.....SRGS..NTY......IGKLRS-------.
M0THC4_MUSAM/33-288...............QRFRHR.AHVEYIISLNAD..........DM.....SQRS..NAY......VGKLRS-------.
K4BB27_SOLLC/117-405...............KKIRRA.TNTDFVISFVAD..........DF.....SRAS..NMY......AGKLRS-------.
U5CU96_AMBTC/119-415...............RKFRRP.TCTDYIISLDAE..........DM.....SKGS..GTY......IGKLRS-------.
H9JIE3_BOMMO/143-380...............RKRKKS.ATSNYLISTDPT..........EL.....TRQA..DSF......AGKLRS-------.
T1JB91_STRMM/42-280...............RKRKKS.TTSNYLISTDPT..........DL.....SRSG..DSF......MGKLRS-------.
D2A282_TRICA/154-394...............RKRKKS.ATSNYLISTDPT..........DL.....SRSA..ESF......VGKLRS-------.
M0SJG0_MUSAM/62-313...............RRFRHG.ALTEYIISLDVD..........GL.....SQGS..NAY......VGKLRS-------.
U1M828_ASCSU/3-244...............RKRKKS.ATANYLISIDPT..........DL.....SRVG..SSF......VGKVRS-------.
I1JCN8_SOYBN/119-408...............KRIRRA.TGTGFVISLAAD..........DF.....SRAS..NKY......VGKLRS-------.
TLP5_ARATH/119-423...............KRSRRA.TYTEYVISMDAD..........NI.....SRSS..STY......IGKLKS-------.
F6HQ19_VITVI/117-399...............RKCRRP.TCTDYIISLNAD..........DV.....SKGS..TTY......IGKLRS-------.
A8ISI1_CHLRE/224-484...............RKRKKS.KASNFVLSTSQE..........DL.....GKDS..DHC......IAKLRA-------.
F0XZM0_AURAN/13-250...............KKRPNN.KTSNYLISMGEN..........DL.....KRNS..HNY......IGKLRA-------.
TUB1_CAEEL/174-420...............RKRKKS.TTANYLLSTDPT..........NL.....SREG..EGY......CAKVRS-------.
M0TYP5_MUSAM/117-422...............KRIRRA.TCTEYIISTNAC..........KI.....TRSS..NTY......IGKLRS-------.
M4E7K8_BRARP/119-432...............KRTRRT.TKTEYIISMDAD..........NI.....SRSS..NSY......LGKLRS-------.
TULP_DROSE/202-437...............RKRKKS.KTSNYIVSCDPT..........DL.....SRNA..DGF......CGKLRS-------.
M0SK32_MUSAM/62-312...............RRFKHG.AHTQYIISLDAD..........DL.....SQGS..NAY......IGKLRS-------.
TLP11_ORYSJ/119-400...............RKCRRT.TCTEYLISLDMN..........DI.....SKRT..DSY......VGKLRS-------.
B9H7S3_POPTR/117-417...............KRTRRT.TCTEYVISMDAD..........NI.....SRSS..STY......IGKLRS-------.
W5EQP4_WHEAT/117-434...............KRICRA.TCTEYIISMNAN..........SI.....SRST..DTY......IGKMRS-------.
D7FYS0_ECTSI/361-593...............QKCSKNRTSNYHVFDMNRG......GFQTRL.....SKKN..GNY......LGKVRT-------.
D7FYT0_ECTSI/243-552...............RKLLAS.KTAYYTICTRQE..........DLFKDNGKRGG..NSF......LAKLRA-------S
F6RL90_CIOIN/49-290...............RKRKRS.KTSNYLISVDAT..........DL.....SRDG..ESY......IGKLRS-------.
I1PX84_ORYGL/116-366...............RRFRNG.AHTEYIISYDCD..........DL.....FPGS..NSY......VGKLRS-------.
I1I0A3_BRADI/123-441...............KRNRRT.AYTEYVISVDSK..........NI.....SRSS..NGY......VGKMRS-------.
U5G686_POPTR/104-386...............RKCRRP.TCTDYIISLDTD..........DM.....SKGS..NAY......VGKLRS-------.

PF03803

PLS3_HUMAN/62-284LHCGC..SC.....CPCG------LQE-----------------------------------------------------
PLS4_HUMAN/100-322FRCTC...CC..FCCPSA------RQE-----------------------------------------------------
Q9NAE9_CAEEL/48-258QPWGS.........FTDH------LTT-----------------------------------------------------
Q21318_CAEEL/74-284RPCCS.........TDDF------LST-----------------------------------------------------
Q9VZW1_DROME/42-263FKCDI..LC....CFPSC------MNA-----------------------------------------------------
YIP6_SCHPO/58-304FSWIN...........SR------LQI-----------------------------------------------------
PLS1_HUMAN/86-307LRCSS...C....CCPCC------LQE-----------------------------------------------------
AIM25_YEAST/59-310FSFINSHIKTIIPPSAYV------DNG-----------------------------------------------------
Q9SI32_ARATH/150-379FW............WLTS------SIY-----------------------------------------------------
O45799_CAEEL/51-280FKCCGGGCCGCLACIGCC------QQE-----------------------------------------------------

PF04525

LOR14_ARATH/16-196LALKN--------KWEVH------GGE-----------------------------------------------------
LOR3_ARATH/29-209LGFFK--------SWEGY------NST-----------------------------------------------------
LOR7_ARATH/7-145.LHNG--------VWELH------KGD-----------------------------------------------------
LURP1_ARATH/5-186MTMHD--------RWQVF------RGG-----------------------------------------------------
LOR11_ARATH/36-222FGLFK--------TWEGY------RSS-----------------------------------------------------
D6ENB3_STRLI/2-152FALRD--------T.MVI------ERA-----------------------------------------------------
LOR4_ARATH/7-183LWLFG--------SWYVY------REC-----------------------------------------------------
L8AWG7_BACIU/1-148MSLLP--------RYEIS------IGG-----------------------------------------------------
LOR5_ARATH/4-186PSLRR--------RWEGY------LGE-----------------------------------------------------
LOR12_ARATH/18-197PTLHQ--------RWEGF------LGE-----------------------------------------------------
Q97Q47_STRPN/1-153LTLLP--------RFEIQ------LRD-----------------------------------------------------
LOR17_ARATH/24-215ITLVD--------SWGIY------EAN-----------------------------------------------------
LOR15_ARATH/25-206VSMHD--------RWQVF------RGG-----------------------------------------------------
LOR8_ARATH/10-188LSLGD--------CWMVY------DGE-----------------------------------------------------
LOR6_ARATH/2-180LSIHN--------KWKGY------SYD-----------------------------------------------------
LOR13_ARATH/13-175TSKHD--------RWQVY------RGS-----------------------------------------------------

PF01167

G0QXR5_ICHMG/270-502NFLGT--------EFHLF......DIG.....................................EN............P.
E4XRC9_OIKDI/84-325NLIGT--------RFTCY......DHG.....................................RK............P.
M4BSN8_HYAAE/388-632NYMGS--------QYTMY......DMT.....................................................
M0SAD5_MUSAM/110-361.....--------.............Q..CPHD...APVSSS.SIPS....NPR......A.PSKQ.VSP..RL....P.
M4AUK7_XIPMA/179-416NLMGT--------KFTVF......DNA.....................................LN............P.
W1NGY4_AMBTC/30-320NFLGT--------KFTIY......DSQ..PPHS...SAVLS..NRRS....SRR......I.HSKQ.VSP..RV....P.
G7YSE7_CLOSI/527-800NFLGT--------QFVIYGDSAGIGCG.....................................VV............G.
S2K614_MUCC1/46-291NFLGT--------TFVIY......SHG.....................................KN............P.
C1FIJ1_MICSR/334-589NFVGT--------EFTIY......DKG.....................................SK............P.
A9TE85_PHYPA/123-416NFLGT--------KFTIY......DSQ..PPQN...GPVLS...NRS....SRR......L.TSKQ.LSY..RA....H.
A0EG93_PARTE/216-448NFLGT--------EFILW......DEG.....................................KN............L.
Q22Y91_TETTS/368-602NFLGT--------EFHIY......DTG.....................................EN............P.
TLP7_ARATH/108-372DFLGT--------NFTVY......DSQ..PPHN...GAKPSNGKA......SRR......F.ASKQ.ISP..QV....P.
J3M9P3_ORYBR/81-337DFWGA--------NFKIY......DSQ..PPYD...GAKASSTRS......SQRFESSQHF.GSRR.ICP..QV....S.
D7KMY6_ARALL/120-422NFLGT--------KFIVY......DTA..PAYN...SSQILSPPNR.....SPR......F.NSEK.VSP..KV....P.
J3MPK4_ORYBR/123-441NFLGT--------KFVVY......DTQ..PPYN...AGSLASCQHG.....SRR......I.SSRR.VSP..KL....P.
I1IN97_BRADI/117-439NVIGT--------KFIMY......DTQ..PPYN...SSTVSNSGKP.....SQR......F.YSKN.GST..KV....P.
H2ZV03_LATCH/267-506NVLGT--------KFTVF......DNG.....................................MN............P.
H0WAT2_CAVPO/269-510NILGT--------KFVIF......DNG.....................................VN............P.
B3SBY7_TRIAD/1-241NLIGT--------RFTVY......DNG.....................................IN............P.
F1PNR7_CANFA/215-456NLMGT--------KFTVY......DHG.....................................VS............P.
K3Z6B7_SETIT/115-432NFLGT--------KFIIY......DTQ..PPYN...AGRLCSQERAP....SRR......F.SSRK.VSP..KV....P.
TULP2_MOUSE/315-556NVLGT--------KFTIF......DNG.....................................VN............P.
B9GRM5_POPTR/121-410NFLGT--------KFTIY......DGQ..TPC....PAMRS..NCKP....QRK......V.RSIQ.VSP..GV....A.
M0RYY8_MUSAM/119-400NFLGT--------KFTVY......DAQ..PPHA...GATVSRSQL......TRI.......IGPKQ.VSP..RV....P.
F4NT32_BATDJ/88-310NFLGT--------GFTV.......SSS.....................................IQ............P.
M7YZS2_TRIUA/159-501NFLGT--------KFIIY......DTQ..PPYN...ASKLCPQERT.....SRR......F.SSRK.VSP..KV....P.
TLP1_ARATH/121-449NFLGT--------KFIIY......DTQ..PAYNSNIARAVQPVGL......SRR......F.YSKR.VSP..KV....P.
C5X4V0_SORBI/116-393NFLGT--------KFTVY......DAH..PPCT...GAVVSKGPS......AHM.......IGSAQ.VSP..GV....P.
K3WG02_PYTUL/293-540NFLGT--------CFTLY......DNG.....................................RD............PQ
C1N1L4_MICPC/293-551NFVGT--------EFCVY......DKG.....................................TA............P.
W1PSZ7_AMBTC/113-431NFLGT--------KFAVY......DSQ..PPYA...GAIMSSSSSRS....SRR......F.YSRR.VSP..KM....P.
A9TFU9_PHYPA/122-419NFLGT--------KFTIY......DSQ..PPHS...GVVAS...NRG....TRR......L.GSKQ.LTS..RV....H.
K4AAU1_SETIT/114-394NFLGT--------KFTVY......DAH..PPYD...GAVVSKSRS......ARV.......VGLNQ.VSP..RI....P.
B9R7W3_RICCO/118-407NFLGT--------KFTIY......DSQ..PPH....PTMQA..NCKQ....HRK......V.HSIQ.VSP..LV....P.
K4CGS2_SOLLC/123-379DFLGT--------NFTIY......DSQ..APHN...GARPSSSRS......CRR......F.ASKQ.ISP..QL....P.
G0QPZ2_ICHMG/56-278NSSKI--------QYIIY......DNG.....................................EN............PK
D8SG45_SELML/128-419NFMGT--------KFTLY......DSN..PPHD...GAVAS..TNRA....GRR......I.LSKQ.VSP..RV....P.
TLP7_ORYSJ/120-456NFLGT--------KFIIY......DTQ..PPYN...ARTLCSQERT.....SRR......F.SSRK.VSP..KV....P.
TLP1_ORYSJ/99-349DFWGT--------NFKIY......DSK..PPYD...GAKASSSRS......SRR......F.GSRR.ISP..QV....S.
A0BWZ4_PARTE/130-363GTAEN--------SFHLY......DNG.....................................ND............PN
L9L384_TUPCH/349-587NLLGN--------RFTVF......DNG.....................................QN............P.
K3ZU09_SETIT/112-390NFLGT--------KFTVY......DAH..PPCA...GAVVSKGPS......AHM.......IGSAQ.VSP...MKGGPP.
F6TZP0_XENTR/258-499NMLGT--------KFTVF......DNG.....................................VN............P.
A9SPK2_PHYPA/122-414NFLGT--------KFTIY......DSQ..PPHN...RGVAS...NRS....SRR......I.GSKQ.LTS..RV....H.
J3M7K2_ORYBR/123-439NFLGT--------KFIIY......DTQ..PPYN...GAVIPPVGRS.....SCR......F.NSKK.VSP..KV....P.
I1J3P3_BRADI/123-449NFLGT--------KFIIY......DTQ..PPYN...AGKLCSQERA.....SRR......F.SSRK.VSP..KV....P.
M0SFG0_MUSAM/119-397NFLGT--------KFTIY......DAQ..PPHA...GAMISRSHS......TRG.......GGSEQ.ISP..KV....L.
C5XQM9_SORBI/123-474NFLGT--------RFLIY......DTQ..PPYN...GAVVPPSGRT.....SRR......F.NSTK.VSP..KL....P.
I1NRS9_ORYGL/1-249NFTGT--------KFTIR......DWQ..PPYE...GAKAFSSRS......GRW......F.GNKH.RCP..LV....S.
A0DNS7_PARTE/64-294NFIGT--------EFILY......SKG.....................................LS............HK
I1LHT6_SOYBN/119-408NFLGT--------KFTIY......DSQ..PPHG...AAIQP..DSQP....SRR......F.HSKQ.VSP..RV....P.
M4DW60_BRARP/89-338NFIGT--------KFTVF......EGNLMPQTR...SSKMVKSRS......SNP..........MK.VSP..RA....P.
F4HT64_ARATH/132-406NFLGT--------KFTVY......ENQ..PPPF..................NRK......LPPSMQ.VSP..WV....S.
I1M8B1_SOYBN/124-417NFLGT--------KFTIL......DGE..PPHD...SSLPL..NCKL....QQR......V.HLKQ.VLPN.KV....S.
I1R4B9_ORYGL/123-439NLLGT--------KFVIY......DTQ..PPCN...TANVSQSGKT.....SRR......F.YSRK.VSP..KN....P.
I1JFG1_SOYBN/112-394NFLGT--------KFTVY......DAH..PPIY...GAKVTKSRS......TRL.......VSLKQ.VSP..RV....P.
F6H054_VITVI/120-410NFLGT--------KFTIY......DSQ..PPHD...PAVQS..NCQS....NGR......L.HSKQ.GST..RS....P.
M1B9A0_SOLTU/117-404NFLGT--------KFTIY......DSQ..PPSV...ASIQE..RSQR....SRR......F.CTKQ.VSV..TG....P.
K4BFS0_SOLLC/118-400NFLGT--------KFTIY......DNQ..LPSE...AAIPH..RGRL....SRR......F.STKQ.VSP..TV....S.
H3GWQ0_PHYRM/600-881STSMM--------EYSLY......DQG.....................................DN............PE
F0YIF3_AURAN/571-870NGATS--------EYTLF......SAG.....................................DK............PP
D8R328_SELML/134-424NFLGT--------KFTIY......DSQ..PPHV...GAMPS..NSRV....GRR......F.GSKQ.ISP..RV....P.
K3YSM4_SETIT/134-423NFLGT--------KFTIF......DSQ..PPSD...AVVLP..NNKP....SKR........QSKQ.VSP..RL....P.
W1PZG2_AMBTC/117-478NFLGT--------KFIVY......DTQ..PPHGRGRVFSSSPSSKLSGLLHSKR......WTHSSRKVSP..KVMGPTP.
M3XWI0_MUSPF/313-554NVLGT--------KFTIF......DNG.....................................VN............P.
D8UHI1_VOLCA/195-429NFVGT--------EFTIY......DKG.....................................LK............PG
M4EBC2_BRARP/149-382NLMGS--------KYYIW......DKG.....................................................
W4XBT8_STRPU/232-473NFMGT--------QFTIF......DGG.....................................LA............P.
M4FID3_BRARP/111-391NFLGT--------KFTVY......ENQ..PSPV...DSRRS.....F....NKK......LSQTMR.VSP..WV....T.
F6GWV6_VITVI/118-407NFLGT--------KFTIY......DSQ..PPYD...TAVQP..NSRS....SRR......F.HSKQ.VSP..RV....P.
E1ZRT4_CHLVA/5-242NFLGT--------EFALY......DGG.....................................SK............ST
W5GHE7_WHEAT/78-314NLVGS--------KYQIW......GQG.....................................................
E9HFS8_DAPPU/11-241NVFGT--------HFTLY......DDG.....................................HK..............
K3Z7I3_SETIT/92-345DFWGT--------NFKIY......DSQ..PPYD...GAKASSTRS......IRC......F.GSRR.ISP..QV....L.
G3RQT8_GORGO/194-436NLMGT--------KFTVY......DRG.....................................IC............P.
A9SFN2_PHYPA/268-494NFVGS--------EYWFY......DKG.....................................SP............PV
D8R0N5_SELML/71-351NFLGT--------KFAIY......DTQ..PPHS...GAIAS..TNRA....GRR......V.AAKQ.VSP..KV....P.
D2VAC3_NAEGR/225-455NFLGT--------EFQLF......DNG.....................................EK............A.
U6HW68_ECHMU/466-723NFLGT--------QFVLL.SSRSKYAG.....................................LH............T.
D7LYF8_ARALL/105-385NFLGT--------KFTVF......DGNLLPSTG...AAKLRKSRS......SNP..........AK.VSP..KV....P.
B9S6E9_RICCO/119-408NFLGT--------KFTVF......DSQ..PTCE...VPIQP..ASRT....HRR......F.HSRQ.VSP..KL....P.
K4BTD6_SOLLC/117-420NFLGT--------KFIIY......DTQ..PPYN...SSSIPPPGG......SRR......F.YSKK.VSP..KV....P.
TLP9_ARATH/98-374NFLGT--------KFTVF......DGS...QTG...AAKMQKSRS......SNF..........IK.VSP..RV....P.
TULP2_HUMAN/279-520NVFST--------KFTIF......DNG.....................................VN............P.
C5Y569_SORBI/117-450NFLGT--------KFVIY......DTQ..PPYN...ATSPTVAGKT.....NQR......F.YSKKGGST..KG....S.
TLP10_ARATH/123-439NFLGT--------KFLVY......DTQ..PPPNT..SSSALITDRTS....RSR......F.HSRR.VSP..KV....P.
B9HF20_POPTR/119-410NFLGT--------KFTMY......DCE..PTFE...VPTQTQHANRI....SRR......F.HSRQ.VSP..RL....P.
H2UUG1_TAKRU/220-462NIMGT--------KFTVF......DSG.....................................SN............P.
M7YYC1_TRIUA/164-457NFLGT--------KFLIY......DTQ..PPYN...GAVVPPVGRS.....SRR......F.NSTR.VSP..KV....P.
H9GP51_ANOCA/382-623NVLGT--------KFTVF......DNG.....................................IN............P.
A0DFE0_PARTE/648-881NFMGT--------EFVLY......DAG.....................................LN............P.
D7G017_ECTSI/222-546NLLGT--------EFRQL......DHR.....................................VD............PR
M0T5F2_MUSAM/105-356.....--------.............Q..PPHD...AAMSS..SNRS....TRR......I.HSKQ.VSP..RV....P.
K3YHL3_SETIT/122-443NFLGT--------KFVVY......DTQ..PPYN...AGSLVSCGRS.....SRR......I.SSRR.VSP..KV....P.
T1G0S1_HELRO/9-246NLIGT--------QFTIF......DQG.....................................RT............P.
C3ZNP4_BRAFL/69-310NMLGT--------KFTVY......DNG.....................................AN............P.
M1APY8_SOLTU/99-381NFLGT--------KFTAY......DSI..LPYA...GAKLVKSRS......TRL.......VGSKQ.MNP..RV....P.
I1GRC6_BRADI/110-376NFLRT--------KFTVY......DAH..PPHS...GAVVSK..............................RW....S.
A7SD12_NEMVE/2-243NLVGT--------KFSIF......DNG.....................................VN............P.
D8RN05_SELML/30-264NLVGS--------RYQLW......EQG.....................................................
TUB_RAT/257-499NLMGT--------KFTVY......DNG.....................................VN............P.
F7FA58_CALJA/208-448NALGT--------KFSIF......DNG.....................................VN............P.
K7U427_MAIZE/53-379NFLGT--------KFIVH......DTR..APHN...AGSLVSCERG.....SRR......I.SSRR.VSP..KV....P.
W5KLH5_ASTMX/308-549NVLGT--------KFTVY......DNG.....................................EN............P.
K3ZLR9_SETIT/117-436NFLGT--------KFVIY......DTQ..PPYN...AASATQSGKT.....SQR......F.YSKK.AST..KV....S.
K1RHW3_CRAGI/170-406NLLGT--------QFTLF......DNG.....................................DN............P.
K3WRQ8_PYTUL/367-602NFLGT--------EFAIY......DNG.....................................VN............P.
M0RRJ1_MUSAM/117-379NFIET--------KFEIY......DTQ..PPCN...GAASSQLGKI.....SQR......P.YLRK.FST..KV....P.
D8TVK7_VOLCA/158-460NFVGT--------EYSLM......SRGCSAAAAASGSVACRQGSGSGAAHLTNEGASGGAAVRPVS............P.
W1NPG7_AMBTC/119-376DFLGT--------KFTIF......DSQ..PPYN...GAHPTNSRS......SRC......F.ASKQ.ICP..RF....P.
C6T8I4_SOYBN/79-355NFLGT--------KFTIY......D...............RKSCS......TEL......VVNSKQ.VSPRPRV....P.
G4VQP4_SCHMA/265-505NFLGT--------HFTVYGWNKVNDSG.....................................TI............K.
E5SUB8_TRISP/231-466NVLGT--------QFTLY......DNG.....................................EN............P.
D7T6J6_VITVI/62-344NFLGT--------KFTVY......DGQ..PPHS...GAKIMRNRS......TRL.......VGLKQ.VSP..RV....P.
K3XJ41_SETIT/116-363NFTRT--------KFTVY......DWQ..PQYE...GAKVSSSRC......RRW......L.ASKQ.INP..LA....S.
B9I1T1_POPTR/116-372DFLGT--------NFTIF......DSQ..PPHS...GAKPSSSRA......SRR......F.ASKQ.ISP..QV....P.
J3N6A6_ORYBR/117-435NFLGT--------KFVIY......DTH..PPYN...ATSVSQPGKT.....SRR......F.YSNK.GTA..KL....P.
F1P3K2_CHICK/115-352NLMGT--------KFTVF......DNG.....................................AN............P.
D7FIT4_ECTSI/26-286NFVGT--------EFQVF......DDG.....................................YS............P.
A0DMD6_PARTE/263-494NFSGT--------QFILY......SKG.....................................LS............YK
M1CWX7_SOLTU/117-421NFLGT--------KFIIY......DTQ..PPHT...GAHVPPPGRT.....SRR......F.TSKK.VSP..KV....P.
E4X5I6_OIKDI/256-497NMMGT--------RFTSY......DNG.....................................NA............Y.
B8C979_THAPS/14-256NFLGT--------EYMIY......DGG.....................................KN............PS
M4FEU8_BRARP/112-371GFLGT--------KFTIY......DNQ..TGSS...TAQA......................QPKQ.ASP..KL....P.
C4J4R4_MAIZE/117-430NLLGT--------KFAIY......DTQ..PPCN...AA...EPGKT.....SRR......F.YSRK.VSP..KV....S.
D7FSI7_ECTSI/103-375DGSGR--------AYVLY......DDG.....................................VS............PR
K3X0N8_PYTUL/565-829STSMM--------EYCLY......DQG.....................................DN............PE
K0S854_THAOC/488-735NFLGT--------EYVIY......DGG.....................................KN............PE
TLP3_ARATH/116-400NFLGT--------KFTVY......DAQ..PTNP...GTQVTRTRS......SRL.......LSLKQ.VSP..RI....P.
M0THC4_MUSAM/33-288DFLGL--------NFKIY......DSQ..PPFD...GAEPLTNRV......SRR......F.ASKQ.ISP..QV....P.
K4BB27_SOLLC/117-405NFLGT--------KFSIH......DSQ..PPSD...AAIQQ..PGRL....SRR......F.HAKQ.VSP..RV....P.
U5CU96_AMBTC/119-415NFLGT--------KFTVY......DGQ..PPHS...GAVASKSRS......IRR.......VGLKQ.VSP..RV....P.
H9JIE3_BOMMO/143-380NLLGT--------AFTVY......DNG.....................................KA............W.
T1JB91_STRMM/42-280NLLGT--------QFTLF......DCG.....................................AN............P.
D2A282_TRICA/154-394NLLGT--------QFTVY......DNG.....................................IS............P.
M0SJG0_MUSAM/62-313DFLGT--------NFTIY......DSR..PPYG...GAKASSSRA......SRR......F.ASKQ.ISP..QV....P.
U1M828_ASCSU/3-244NALGT--------HFTLY......DNG.....................................EN............P.
I1JCN8_SOYBN/119-408NFLGT--------KFTVY......DSQ..APHD...SAIQS..NCQS....SRR......F.HSKQ.VSP..RV....P.
TLP5_ARATH/119-423NFLGT--------KFIVY......DTA..PAYN...SSQILSPPNR.....SRS......F.NSKK.VSP..KV....P.
F6HQ19_VITVI/117-399NFLGT--------KFTVY......DAQ..PPNA...GARISKSRS......TRR.......LGSRQ.VSP..RV....P.
A8ISI1_CHLRE/224-484NFVGT--------EYGLV......SRT..............GGHISGSMDIDGGAQSGGKLAPPAE............P.
F0XZM0_AURAN/13-250NFAGT--------EFQIF......DAG.....................................WN............P.
TUB1_CAEEL/174-420NALGT--------QFTVY......DSG.....................................QN............P.
M0TYP5_MUSAM/117-422NFLGT--------KFVMY......DTQ..PPYN...GTASSQPGKI.....SQR......F.YSRK.VSP..KV....P.
M4E7K8_BRARP/119-432NFLGT--------KFVVY......DTQ..PPQNTPSSSSALITDQTS....RSM......F.HSKR.VSP..KL....P.
TULP_DROSE/202-437NVFGT--------SFTVF......DNG.....................................NK............E.
M0SK32_MUSAM/62-312NFFGT--------KFKIY......DSR..PPYN...GAKVSSSRA......SRR......V.ASKQ.ISP..QV....P.
TLP11_ORYSJ/119-400NFLGT--------KFTIY......DAH..PPYA...GDVISKGQS......ARV.......IGSNH.LSP..RI....P.
B9H7S3_POPTR/117-417NFLGT--------KFIIY......DTQ..PPYN...NAQLSPPGR......SRR......F.YSKK.VSP..KV....P.
W5EQP4_WHEAT/117-434NFLGT--------KFVMY......DTQ..PPYN...ASSVSHSGTT.....SRR......F.YSKK.GST..KV....P.
D7FYS0_ECTSI/361-593NLKRT--------EATVF....TNDQE.....................................................
D7FYT0_ECTSI/243-552SVAHT--------EYALY......DRG.....................................DN............PA
F6RL90_CIOIN/49-290NIMGT--------KFTVY......DHG.....................................IK............L.
I1PX84_ORYGL/116-366DFLGT--------KFIIY......DSQ..PPYD...GAKPARSQS......SRR......F.ASKQ.INP..NV....S.
I1I0A3_BRADI/123-441NFLGT--------KFIVY......DTQ..APYN...AGSLVSCQRA.....SRR......I.SSSR.VSP..KV....P.
U5G686_POPTR/104-386NFLGT--------KFTVF......DGQ..PPHA...GAKMTKSRS......SRL.......VNLKQ.VSP..RV....P.

PF03803

PLS3_HUMAN/62-284------------------------------------------------------MEV....QAPPGTTIGHVL-------
PLS4_HUMAN/100-322------------------------------------------------------LEV....QCPPGVTIGFVA-------
Q9NAE9_CAEEL/48-258------------------------------------------------------QFL........GQNIGIMS-------
Q21318_CAEEL/74-284------------------------------------------------------QFL........DQQIGMMK-------
Q9VZW1_DROME/42-263------------------------------------------------------VEV....SAPPGQVIGSVE-------
YIP6_SCHPO/58-304------------------------------------------------------HSID..YSKFSSTLVGEVL-------
PLS1_HUMAN/86-307------------------------------------------------------IEI....QAPPGVPIGYVI-------
AIM25_YEAST/59-310------------------------------------------------------SDSTHYHDGKEGTTVGETI-------
Q9SI32_ARATH/150-379------------------------------------------------------AEI.......DGEEIGVVH-------
O45799_CAEEL/51-280------------------------------------------------------CII....ETPSMGVLGIIR-------

PF04525

LOR14_ARATH/16-196------------------------------------------------------SKE--R.....EDLLFTVQ-------
LOR3_ARATH/29-209------------------------------------------------------GTR--..........FRLR-------
LOR7_ARATH/7-145------------------------------------------------------VEK--R.....KDLVLTVK-------
LURP1_ARATH/5-186------------------------------------------------------STE--E.....GALLYTVK-------
LOR11_ARATH/36-222------------------------------------------------------SAT--VESTTKLE.YFRVK-------
D6ENB3_STRLI/2-152------------------------------------------------------GE.--........PLARIK-------
LOR4_ARATH/7-183------------------------------------------------------GS.--..........FTST-------
L8AWG7_BACIU/1-148------------------------------------------------------KT.--.........VCEVT-------
LOR5_ARATH/4-186------------------------------------------------------RSD--G.....QKPIFGVR-------
LOR12_ARATH/18-197------------------------------------------------------RSE--G.....QKPIFSVR-------
Q97Q47_STRPN/1-153------------------------------------------------------GSS--..........FVIR-------
LOR17_ARATH/24-215------------------------------------------------------DTK--GETKIPKCPTWYMR-------
LOR15_ARATH/25-206------------------------------------------------------STD--Q.....RDLLYTVK-------
LOR8_ARATH/10-188------------------------------------------------------TE.--......RDPIFTAR-------
LOR6_ARATH/2-180------------------------------------------------------YQG--S.....PKPVFTLR-------
LOR13_ARATH/13-175------------------------------------------------------DLD--.......DKIFTVK-------

PF01167

G0QXR5_ICHMG/270-502...............................................KKCKFP.DKI--------RKELGLII..YD.SN
E4XRC9_OIKDI/84-325.................EAT.........................DMVRRDKD.ENL--------RSEMVSIL..YD.QN
M4BSN8_HYAAE/388-632......................................................GNV--------PLELGAVQ..YA...
M0SAD5_MUSAM/110-361....................................................A.G..--------NYDVATVS..YE.FN
M4AUK7_XIPMA/179-416.................ERA.............................LPDM.SNA--------RQELAGII..YE.TN
W1NGY4_AMBTC/30-320....................................................A.G..--------SYNIATIA..YE.LN
G7YSE7_CLOSI/527-800.................KRSKRPDLALGNRSRASLRSTESSFEFTDDSSWTGT.TDD--------LRELAAII..YD.TN
S2K614_MUCC1/46-291.................VKR.........................EMTTKKKD.LPI--------REELGAVL..YD.PN
C1FIJ1_MICSR/334-589...........................................GEKPDGKSAG.LAP--------REDLGAVT..YE.YN
A9TE85_PHYPA/123-416....................................................A.G..--------SFNVAHIA..YE.LN
A0EG93_PARTE/216-448...............................................KKCKDT.SLF--------RTQLGIVY..YE.SH
Q22Y91_TETTS/368-602...............................................KKCKNL.ENA--------RKELAGVI..YE.SN
TLP7_ARATH/108-372....................................................A.G..--------NFEVGHVS..YK.FN
J3M9P3_ORYBR/81-337....................................................T.G..--------NFDVGQVT..YK.YN
D7KMY6_ARALL/120-422....................................................S.G..--------SYNIAQVT..YE.LN
J3MPK4_ORYBR/123-441....................................................T.G..--------SYPIARVK..YE.LN
I1IN97_BRADI/117-439....................................................C.S..--------LYSIAQVS..YK.LN
H2ZV03_LATCH/267-506.................EKK...........................PFVPET.ANI--------RQELAAIC..YE.TN
H0WAT2_CAVPO/269-510.................EDS...........................NSLLDR.SHI--------RQELGTVC..YE.TN
B3SBY7_TRIAD/1-241.................AKG...........................SVGIDG.SSN--------REELAAII..YD.TN
F1PNR7_CANFA/215-456.................TKA...........................QGLVEK.AYV--------RQELAAIC..YE.TN
K3Z6B7_SETIT/115-432....................................................I.G..--------SYPIAQVN..YE.LN
TULP2_MOUSE/315-556.................ERS...........................YWVPDS.ARI--------REELGVVC..YE.TN
B9GRM5_POPTR/121-410....................................................A.R..--------NYNVATVS..YE.LN
M0RYY8_MUSAM/119-400....................................................A.G..--------NYPAAHIA..YE.LN
F4NT32_BATDJ/88-310..............................................STNSDNM.AEG--------RRELAAVV..YE.PN
M7YZS2_TRIUA/159-501..................................................AAT.G..--------SYPIAQVN..YE.LN
TLP1_ARATH/121-449....................................................S.G..--------SYKIAQVS..YE.LN
C5X4V0_SORBI/116-393....................................................A.G..--------NYPISHIS..YE.A.
K3WG02_PYTUL/293-540KI..................................AKIQDAVSSDDMVVRNV.LQI--------REELGCVT..YE.PN
C1N1L4_MICPC/293-551.........................................GKAVGGDGGLAA.LNP--------RSELAVIK..YE.TN
W1PSZ7_AMBTC/113-431...................................................TS.G..--------SYGVAHVA..YE.LN
A9TFU9_PHYPA/122-419....................................................C.G..--------SHNVAHIA..YE.LN
K4AAU1_SETIT/114-394....................................................A.G..--------NYPVSHIS..YE.LN
B9R7W3_RICCO/118-407....................................................A.R..--------NYSIATVS..YE.LN
K4CGS2_SOLLC/123-379....................................................A.G..--------NFEVGSVS..YK.LN
G0QPZ2_ICHMG/56-278KC................................................ILQ.EKI--------REEWGIVQQFYDE..
D8SG45_SELML/128-419....................................................A.G..--------SYNIAHIA..YE.LN
TLP7_ORYSJ/120-456....................................................T.G..--------CYPIVQVN..YE.LN
TLP1_ORYSJ/99-349....................................................A.G..--------NYEVGQVS..YK.YN
A0BWZ4_PARTE/130-363KTDQL............ETT.....................................--------RREYAVYF..YK.KS
L9L384_TUPCH/349-587.................QRG............................GSASV.ASL--------RQELAAVI..YE.TN
K3ZU09_SETIT/112-390....................................................A.G..--------NYPVSHIS..YE.VN
F6TZP0_XENTR/258-499.................DTK...........................PFVQER.ESL--------RQELVSIC..YE.TN
A9SPK2_PHYPA/122-414....................................................A.G..--------SYNVAHIA..YE.LN
J3M7K2_ORYBR/123-439....................................................S.G..--------SYNIAQVT..YE.LN
I1J3P3_BRADI/123-449....................................................T.G..--------SYPIAQVN..YE.LN
M0SFG0_MUSAM/119-397....................................................A.G..--------NYPVVHIA..YE.LN
C5XQM9_SORBI/123-474....................................................S.V..--------SYNIAQVS..YE.LN
I1NRS9_ORYGL/1-249....................................................T.G..--------DVEVGEVS..YK.YS
A0DNS7_PARTE/64-294NT................................................NDL.QTL--------RQELAFIQ..YE.YQ
I1LHT6_SOYBN/119-408....................................................A.C..--------NYVVSTIA..YE.LN
M4DW60_BRARP/89-338....................................................S.G..--------SYPVAHIS..YE.LN
F4HT64_ARATH/132-406....................................................S.SSS--------SYNIASIL..YE.LN
I1M8B1_SOYBN/124-417....................................................A.A..--------NYKVATVS..YE.LN
I1R4B9_ORYGL/123-439....................................................S.S..--------TYSIAQVS..YE.LN
I1JFG1_SOYBN/112-394....................................................A.G..--------NYPIAHVS..YD.LN
F6H054_VITVI/120-410....................................................S.G..--------NYNVATIS..YE.LN
M1B9A0_SOLTU/117-404....................................................A.Y..--------NYSIANIS..YE.LN
K4BFS0_SOLLC/118-400....................................................A.C..--------NYSIATVS..YE.LN
H3GWQ0_PHYRM/600-881DL..............DSDCEVDDEIR...........................QSI--------RAELAVVR..YHYSK
F0YIF3_AURAN/571-870AG.....................................AAGAGARPPRGDPP.GDA--------RCEMAAVA..FS.SK
D8R328_SELML/134-424....................................................S.G..--------SYNVAHIA..YE.LN
K3YSM4_SETIT/134-423....................................................L.G..--------NYNVATVT..YE.LT
W1PZG2_AMBTC/117-478..................................................PSA.ASG--------SYEVAEVV..YE.LN
M3XWI0_MUSPF/313-554.................ERK...........................NFIPET.ARI--------REELGAVC..YE.TN
D8UHI1_VOLCA/195-429KK...............................................DASE.GEL--------RQELAAVT..YQ.YN
M4EBC2_BRARP/149-382..............................................VRVGSVG.KIV--------KPLLSVVI..FTPTI
W4XBT8_STRPU/232-473.................GKP...........................GALPDG.GNI--------RNELSVVY..YD.TN
M4FID3_BRARP/111-391....................................................S.STH--------SYSMASIL..YE.LN
F6GWV6_VITVI/118-407....................................................A.C..--------NYSVATIS..YE.LN
E1ZRT4_CHLVA/5-242TGSPIA...................................................--------RCELGTAL..YQ.TN
W5GHE7_WHEAT/78-314..............................................DRVDELK.SQS--------KRLLGVIA..FAPTI
E9HFS8_DAPPU/11-241......................................................YSS--------RQELAAII..YD.TN
K3Z7I3_SETIT/92-345....................................................S.G..--------NFDVGQVS..YK.YN
G3RQT8_GORGO/194-436.................MKG...........................RGLVGA.AHT--------RQELAAIS..YTFTS
A9SFN2_PHYPA/268-494QVTGVCGTMRLPTTKN.........................................--------RVEMGAVK..YN.VN
D8R0N5_SELML/71-351....................................................A.G..--------SYNVAHIS..YE.LN
D2VAC3_NAEGR/225-455...............................................SKLKPG.AHL--------RTNLASVV..YE.TN
U6HW68_ECHMU/466-723.................STG.........................HPDVELAG.GDW--------SKEIATIS..YE.PN
D7LYF8_ARALL/105-385....................................................L.G..--------SYPVAHIT..YE.LN
B9S6E9_RICCO/119-408....................................................A.C..--------NYSIGTIT..YE.LN
K4BTD6_SOLLC/117-420....................................................T.G..--------TYNIAQVS..YE.LN
TLP9_ARATH/98-374....................................................Q.G..--------SYPIAHIS..YE.LN
TULP2_HUMAN/279-520.................DRE...........................HLTRNT.ARI--------RQELGAVC..YE.PN
C5Y569_SORBI/117-450....................................................C.S..--------RYSIGQVS..YE.LN
TLP10_ARATH/123-439....................................................S.G..--------SYNIAQIT..YE.LN
B9HF20_POPTR/119-410....................................................A.C..--------NYSIGTIT..YE.LN
H2UUG1_TAKRU/220-462.................SKN..........................PGALLEE.SNK--------RQELAAIC..YE.TN
M7YYC1_TRIUA/164-457....................................................A.V..--------SYNIAQVT..YE.LN
H9GP51_ANOCA/382-623.................DKK...........................PFVPET.ADL--------RQELVAIC..YE.TN
A0DFE0_PARTE/648-881...............................................DKTKDQ.SKL--------RQQLGIVQ..YE.SN
D7G017_ECTSI/222-546DS.........................................AAMEYVKEKG....--------RNELSAVV..YE.PN
M0T5F2_MUSAM/105-356....................................................A.V..--------NYGIASIS..YE.LN
K3YHL3_SETIT/122-443....................................................T.A..--------SYPIAQVN..YE.LN
T1G0S1_HELRO/9-246.................KDR...............................SV.DEA--------RRELAAVA..YE.TN
C3ZNP4_BRAFL/69-310.................LKS...........................GVMTDG.SNV--------RQEIAAIC..YE.TN
M1APY8_SOLTU/99-381....................................................A.G..--------NYEVAHIS..YE.LN
I1GRC6_BRADI/110-376....................................................S.G..--------NYPVSHIY..YD.VN
A7SD12_NEMVE/2-243.................RKG...........................GVMSDG.SNI--------REELGGII..YD.TN
D8RN05_SELML/30-264.................................................DFLS.ARQ--------KVLQGVVT..FEPTV
TUB_RAT/257-499.................QKA..........................SSSTLES.GTL--------RQELAAVC..YE.TN
F7FA58_CALJA/208-448.................DRE...........................HLIRDT.ARI--------RRELGAVC..YE.TN
K7U427_MAIZE/53-379....................................................T.A..--------SYPIARVN..YE.LN
W5KLH5_ASTMX/308-549.................ERK...........................QFIKES.ESL--------RQELAAIC..YE.KN
K3ZLR9_SETIT/117-436....................................................R.S..--------RYSIAQVS..YE.LN
K1RHW3_CRAGI/170-406.................KTN................................Y.ENA--------RKELVGII..YE.TN
K3WRQ8_PYTUL/367-602.........................................KDADTQTITSNP.AGI--------RQELGISM..YA.AN
M0RRJ1_MUSAM/117-379....................................................T.G..--------NFKIAQVT..YE.IN
D8TVK7_VOLCA/158-460...........................AEETSAGTAEQGNPSASASSRQHQQP.DSF--------GLEEMAVH..FKQTV
W1NPG7_AMBTC/119-376....................................................AIG..--------NYEIGQVS..YK.FN
C6T8I4_SOYBN/79-355....................................................T.G..--------NYPVAHIS..YE.LN
G4VQP4_SCHMA/265-505.................TTSK.................................TQN--------MQELAAII..YD.TN
E5SUB8_TRISP/231-466.................QKS.............................TVID.VGV--------RRELAAII..YD.PN
D7T6J6_VITVI/62-344....................................................A.G..--------SYPVAHIS..YE.VN
K3XJ41_SETIT/116-363....................................................S.G..--------IVDIGEVS..YE.YN
B9I1T1_POPTR/116-372....................................................A.G..--------NFEVGQVS..YK.FN
J3N6A6_ORYBR/117-435....................................................C.S..--------TYNIANIS..YE.LN
F1P3K2_CHICK/115-352.................DRA.............................SADW.SNV--------RQELSAVV..YE.TN
D7FIT4_ECTSI/26-286.........................KELGGGGGWGSGNYGGGSGGSGSGGAKN.MSL--------REELGCVM..YA.SN
A0DMD6_PARTE/263-494NS................................................NEK.NNL--------RKELAFIH..YE.YQ
M1CWX7_SOLTU/117-421....................................................T.G..--------SYIISQIT..YE.LN
E4X5I6_OIKDI/256-497.................SDP...........................GALVDP.SAL--------RRELVSIA..YE.TN
B8C979_THAPS/14-256YE..........................................ESYYEDEDN.GDV--------RCELGAIF..YGSTT
M4FEU8_BRARP/112-371....................................................A.T..--------SYTSGSIT..YE.LN
C4J4R4_MAIZE/117-430....................................................S.S..--------TYNIAQVS..YE.LN
D7FSI7_ECTSI/103-375RS.......................................SKDRRRGIFS......--------RKELARVV..FSATQ
K3X0N8_PYTUL/565-829DL..............DSDCEVDDELR...........................KSI--------RAELAVIR..FHNSK
K0S854_THAOC/488-735FD.........................................DAYYDESNGS.GEV--------RRELGAVL..YAPST
TLP3_ARATH/116-400....................................................S.G..--------NYPVAHIS..YE.LN
M0THC4_MUSAM/33-288....................................................A.G..--------NFEIGQAS..YK.FN
K4BB27_SOLLC/117-405....................................................A.C..--------NYRVATIS..YE.LN
U5CU96_AMBTC/119-415....................................................A.G..--------NYTVAHIA..YE.LN
H9JIE3_BOMMO/143-380.................RKH...............................DH.AKT--------RYELASII..YD.TN
T1JB91_STRMM/42-280.................RKG...........................LAASDR.NNA--------RQELAAVI..YE.TN
D2A282_TRICA/154-394.................RKA............................NFKEG.VTP--------RQELAAVT..YD.TN
M0SJG0_MUSAM/62-313....................................................A.G..--------NFEIGQIS..YK.FN
U1M828_ASCSU/3-244.................KKA.............................AVIG.DGV--------RQELAAVI..YE.TN
I1JCN8_SOYBN/119-408....................................................A.C..--------SYLVSTVS..YE.LN
TLP5_ARATH/119-423....................................................S.G..--------SYNIAQVT..YE.LN
F6HQ19_VITVI/117-399....................................................A.G..--------NYPVAHIS..YE.LN
A8ISI1_CHLRE/224-484........................................................F--------SREEIAVH..YKQTA
F0XZM0_AURAN/13-250..........................................KGFEPDLEEEG.AQM--------RHELGAII..YT.SN
TUB1_CAEEL/174-420.................KKT..............................TNH.AAI--------RQELAAVI..YE.TN
M0TYP5_MUSAM/117-422....................................................T.G..--------SYNVAQVT..YE.LN
M4E7K8_BRARP/119-432....................................................S.G..--------SYNIAQIT..YE.LN
TULP_DROSE/202-437.................STE...................................SP--------RLDLAVII..YD.TN
M0SK32_MUSAM/62-312....................................................A.G..--------NFIIGQVS..YK.FN
TLP11_ORYSJ/119-400....................................................A.G..--------NYPVSHIS..YE.LN
B9H7S3_POPTR/117-417....................................................T.G..--------SYNIAQVT..YE.LN
W5EQP4_WHEAT/117-434....................................................C.S..--------TYSIAQVS..YE.LN
D7FYS0_ECTSI/361-593.........................................................--------VAELGAIS..FEKPG
D7FYT0_ECTSI/243-552VA..............ASETSLDSGAEAKPKSMRNPIDLARSKTLRNQERHGQ.GEV--------RRELGVII..YNFDK
F6RL90_CIOIN/49-290.................GKP...........................GINIDR.DNL--------REELVAVC..YE.TN
I1PX84_ORYGL/116-366....................................................G.G..--------NYEVGQVS..YK.FN
I1I0A3_BRADI/123-441....................................................T.G..--------SYPIAQVN..YE.LN
U5G686_POPTR/104-386....................................................T.G..--------NYPVASIS..YE.LN

PF03803

PLS3_HUMAN/62-284--------QT-----WHP--------------------------------------------------------------
PLS4_HUMAN/100-322--------EH-----WNL--------------------------------------------------------------
Q9NAE9_CAEEL/48-258--------RT-----HG.--------------------------------------------------------------
Q21318_CAEEL/74-284--------K.-----.EC--------------------------------------------------------------
Q9VZW1_DROME/42-263--------QV-----CTF--------------------------------------------------------------
YIP6_SCHPO/58-304--------QK-----WHL--------------------------------------------------------------
PLS1_HUMAN/86-307--------QT-----WHP--------------------------------------------------------------
AIM25_YEAST/59-310--------QN-----WHL--------------------------------------------------------------
Q9SI32_ARATH/150-379--------RR-----WHL--------------------------------------------------------------
O45799_CAEEL/51-280--------QR-----CGC--------------------------------------------------------------

PF04525

LOR14_ARATH/16-196--------QS...QAVSL--------------------------------------------------------------
LOR3_ARATH/29-209--------KI...FKILP--------------------------------------------------------------
LOR7_ARATH/7-145--------RT........--------------------------------------------------------------
LURP1_ARATH/5-186--------RS...SMIQL--------------------------------------------------------------
LOR11_ARATH/36-222--------NN..VFQVPN--------------------------------------------------------------
D6ENB3_STRLI/2-152--------RK........--------------------------------------------------------------
LOR4_ARATH/7-183--------EE.....VKP--------------------------------------------------------------
L8AWG7_BACIU/1-148--------KK........--------------------------------------------------------------
LOR5_ARATH/4-186--------RS...SIIG.--------------------------------------------------------------
LOR12_ARATH/18-197--------RS...SIIGR--------------------------------------------------------------
Q97Q47_STRPN/1-153--------KK........--------------------------------------------------------------
LOR17_ARATH/24-215--------KNLKMNILST--------------------------------------------------------------
LOR15_ARATH/25-206--------RS...SMLQL--------------------------------------------------------------
LOR8_ARATH/10-188--------KN........--------------------------------------------------------------
LOR6_ARATH/2-180--------D.........--------------------------------------------------------------
LOR13_ARATH/13-175--------RS...STVQL--------------------------------------------------------------

PF01167

G0QXR5_ICHMG/270-502LLGS....RGPRKMKIII..............................................................
E4XRC9_OIKDI/84-325VLGF....KGPRKMTVVL..............................................................
M4BSN8_HYAAE/388-632....ATFGKSPRQMRVAL..............................................................
M0SAD5_MUSAM/110-361VLRT....RGPRRIQCTM..............................................................
M4AUK7_XIPMA/179-416VLGM....KGPRRMTVIV..............................................................
W1NGY4_AMBTC/30-320VLGT....RGPRRMQCTM..............................................................
G7YSE7_CLOSI/527-800VLGF....KGPRKMTILI..............................................................
S2K614_MUCC1/46-291ILGF....KGPRKMTILM..............................................................
C1FIJ1_MICSR/334-589VLGT....RGPRKMKGFI..............................................................
A9TE85_PHYPA/123-416VLGT....RGPRRMQCTL..............................................................
A0EG93_PARTE/216-448IMQN....KGPRKMKVLI..............................................................
Q22Y91_TETTS/368-602LLGA....RGPRKMKVLI..............................................................
TLP7_ARATH/108-372LLKS....RGPRRMVSTL..............................................................
J3M9P3_ORYBR/81-337LLKP....RGPRRMFCTI..............................................................
D7KMY6_ARALL/120-422VFGT....RRPRRMNCTM..............................................................
J3MPK4_ORYBR/123-441VLGT....RGPRRMQCTM..............................................................
I1IN97_BRADI/117-439VLGT....RGPRRMHCVM..............................................................
H2ZV03_LATCH/267-506VLGF....RGPRKMTVII..............................................................
H0WAT2_CAVPO/269-510IWGT....RGPRKMTVII..............................................................
B3SBY7_TRIAD/1-241VLGF....KGPRKMTILI..............................................................
F1PNR7_CANFA/215-456VLGF....KGPRKMSVII..............................................................
K3Z6B7_SETIT/115-432VLGT....RGPRRMQCTM..............................................................
TULP2_MOUSE/315-556VLGF....RGPRKMTVIL..............................................................
B9GRM5_POPTR/121-410VLRT....RGPRRMHCTI..............................................................
M0RYY8_MUSAM/119-400VLGS....RGPRRMHCVM..............................................................
F4NT32_BATDJ/88-310FLGH....RGPRRMTIIS..............................................................
M7YZS2_TRIUA/159-501VLGT....RGPRRMQCTM..............................................................
TLP1_ARATH/121-449VLGT....RGPRRMHCAM..............................................................
C5X4V0_SORBI/116-393TFGS....RYPRKMNCVM..............................................................
K3WG02_PYTUL/293-540RTSV.....GPRKMRVVI..............................................................
C1N1L4_MICPC/293-551VLGT....KGPRKMSGAI..............................................................
W1PSZ7_AMBTC/113-431MLGS....RGPRRMRCTM..............................................................
A9TFU9_PHYPA/122-419VLGT....RGPRRMQCTM..............................................................
K4AAU1_SETIT/114-394VLGS....RGPRRMNCVM..............................................................
B9R7W3_RICCO/118-407VLRT....RGPRRMQCTM..............................................................
K4CGS2_SOLLC/123-379LLKS....RGPRRMICSL..............................................................
G0QPZ2_ICHMG/56-278........NKQIQIKFII..............................................................
D8SG45_SELML/128-419VLGT....RGPRRMECTI..............................................................
TLP7_ORYSJ/120-456VLGT....RGPRRMQCAM..............................................................
TLP1_ORYSJ/99-349LLKS....RGPRRMYCAL..............................................................
A0BWZ4_PARTE/130-363SLGL....KS...INVLI..............................................................
L9L384_TUPCH/349-587VLGF....RGPRRMTVII..............................................................
K3ZU09_SETIT/112-390VLGS....RGPRKMNCVM..............................................................
F6TZP0_XENTR/258-499VLGF....RGPRKMTVII..............................................................
A9SPK2_PHYPA/122-414VLGT....RGPRRMQCML..............................................................
J3M7K2_ORYBR/123-439VLGT....RGPRRMHCVM..............................................................
I1J3P3_BRADI/123-449VLGT....RGPRRMQCTM..............................................................
M0SFG0_MUSAM/119-397VSGS....RGPRRMHCVM..............................................................
C5XQM9_SORBI/123-474VLGT....RGPRRMRCIM..............................................................
I1NRS9_ORYGL/1-249LLRP....RGPRRMSCSV..............................................................
A0DNS7_PARTE/64-294ILKT....RR.NLFKVFI..............................................................
I1LHT6_SOYBN/119-408VLRA....RGPRRMHCTM..............................................................
M4DW60_BRARP/89-338VLGS....RGPRRMRCVM..............................................................
F4HT64_ARATH/132-406VLRT....RGPRRMQCIM..............................................................
I1M8B1_SOYBN/124-417VLRT....RGPRRMRCMM..............................................................
I1R4B9_ORYGL/123-439VLGT....RGPRRMNCVM..............................................................
I1JFG1_SOYBN/112-394VLGS....RGPRIMQCVM..............................................................
F6H054_VITVI/120-410VLRT....RGPRRMHCTM..............................................................
M1B9A0_SOLTU/117-404VLRT....RGPRRMHCVM..............................................................
K4BFS0_SOLLC/118-400VLRT....RGPRRMHCAM..............................................................
H3GWQ0_PHYRM/600-881K.......PYPRKMEVVI..............................................................
F0YIF3_AURAN/571-870RSAP....TNPRRMEVAV..............................................................
D8R328_SELML/134-424VLGT....RGPRRMQVTI..............................................................
K3YSM4_SETIT/134-423VLRN....RGPRRMQCTM..............................................................
W1PZG2_AMBTC/117-478VLGT....RGPRRMHCTM..............................................................
M3XWI0_MUSPF/313-554VLGF....RGPRKMTVII..............................................................
D8UHI1_VOLCA/195-429VLGT....RGPRKMMAAI..............................................................
M4EBC2_BRARP/149-382ATWT....GSYRRMRALL..............................................................
W4XBT8_STRPU/232-473VLGF....KGPRKMTVII..............................................................
M4FID3_BRARP/111-391VLRT....RGPRRMQCIM..............................................................
F6GWV6_VITVI/118-407VLRT....RGPRRMQCTM..............................................................
E1ZRT4_CHLVA/5-242VLGT....KGPRKMTVLI..............................................................
W5GHE7_WHEAT/78-314TTLT....GSFRSMRAWI..............................................................
E9HFS8_DAPPU/11-241VLGF....KGPRKMTIII..............................................................
K3Z7I3_SETIT/92-345LLKS....RGPRRMCCTM..............................................................
G3RQT8_GORGO/194-436YPVA....KGYNKLNYLK..............................................................
A9SFN2_PHYPA/268-494VLGI....GGPRKMTAII..............................................................
D8R0N5_SELML/71-351VLGT....RGPRRMQCTL..............................................................
D2VAC3_NAEGR/225-455LFGS....KGPRKFTLVV..............................................................
U6HW68_ECHMU/466-723ILGF....KGPRKMTVLI..............................................................
D7LYF8_ARALL/105-385VLGS....RGPRKMQCVM..............................................................
B9S6E9_RICCO/119-408VLRT....RGPRRMHCVL..............................................................
K4BTD6_SOLLC/117-420VLGT....RGPRRMNCVM..............................................................
TLP9_ARATH/98-374VLGS....RGPRRMRCIM..............................................................
TULP2_HUMAN/279-520VLGY....LGPRKMTVIL..............................................................
C5Y569_SORBI/117-450VLGT....RGPRRMNCVM..............................................................
TLP10_ARATH/123-439VLGT....RGPRRMHCIM..............................................................
B9HF20_POPTR/119-410VLRS....RGPRRMHCMM..............................................................
H2UUG1_TAKRU/220-462VLGF....NGPRKMTVVI..............................................................
M7YYC1_TRIUA/164-457VLGT....RGPRRMRCIM..............................................................
H9GP51_ANOCA/382-623VLGF....RGPRKMTVII..............................................................
A0DFE0_PARTE/648-881ILGS....KGPRKMVVLM..............................................................
D7G017_ECTSI/222-546VMG.....RVPNAMKVLLRRPIASQSSGSDGLTADNDDGGGGGDGEGGGGEGEGGGQWGVSMERGVWDEPIIKRWEDGKN
M0T5F2_MUSAM/105-356VLRT....RGPRRIQCTM..............................................................
K3YHL3_SETIT/122-443VLGT....RGPRRMNCTM..............................................................
T1G0S1_HELRO/9-246VLGF....KGPRKMTIIL..............................................................
C3ZNP4_BRAFL/69-310VLGF....KGPRKMTVII..............................................................
M1APY8_SOLTU/99-381VLGA....RGPRRMHCVM..............................................................
I1GRC6_BRADI/110-376VLGS....RGPRRMRCVM..............................................................
A7SD12_NEMVE/2-243VLGF....KGPRKMTVVL..............................................................
D8RN05_SELML/30-264TTLT....GDSRKLKAFI..............................................................
TUB_RAT/257-499VLGF....KGPRKMSVIV..............................................................
F7FA58_CALJA/208-448ALGF....LGPREMTVVL..............................................................
K7U427_MAIZE/53-379LLGT....RGPRRMNCTM..............................................................
W5KLH5_ASTMX/308-549ILGF....KGPRKMTVII..............................................................
K3ZLR9_SETIT/117-436VLGT....RGPRRMNCVM..............................................................
K1RHW3_CRAGI/170-406VLGF....KGPRKMTIII..............................................................
K3WRQ8_PYTUL/367-602VLGH....RGPRKMKVCV..............................................................
M0RRJ1_MUSAM/117-379VRRS....RSPRRMHCVM..............................................................
D8TVK7_VOLCA/158-460LTTK....GGPRTMLIATPL............................................................
W1NPG7_AMBTC/119-376LLRS....KGPRRMLCDL..............................................................
C6T8I4_SOYBN/79-355VLGS....RGPRRMHCVM..............................................................
G4VQP4_SCHMA/265-505VLGF....KGPRRMTIIL..............................................................
E5SUB8_TRISP/231-466VLGL....KGPRKMTVIL..............................................................
D7T6J6_VITVI/62-344VLGS....RGPRRMQCSM..............................................................
K3XJ41_SETIT/116-363LLKS....RGPRRIHCSI..............................................................
B9I1T1_POPTR/116-372LLKS....RGPRRMVCSL..............................................................
J3N6A6_ORYBR/117-435VFGT....RGPRRMRCLM..............................................................
F1P3K2_CHICK/115-352VLGF....KGPRKMTVII..............................................................
D7FIT4_ECTSI/26-286VLGS....RGPRKMQVAI..............................................................
A0DMD6_PARTE/263-494LLKT....RKGNLFKAYI..............................................................
M1CWX7_SOLTU/117-421VLGT....RGPRRMHCVM..............................................................
E4X5I6_OIKDI/256-497VLGF....KGPRKMTIVI..............................................................
B8C979_THAPS/14-256TLGA....KGPRNMKTCI..............................................................
M4FEU8_BRARP/112-371VLRT....RGPRRMHCVM..............................................................
C4J4R4_MAIZE/117-430VLGT....RGPRRMNCVM..............................................................
D7FSI7_ECTSI/103-375NVA.....DGPRSMEAFV..............................................................
K3X0N8_PYTUL/565-829KQ......QYARKMEVVI..............................................................
K0S854_THAOC/488-735ALGA....KSPRKMTVCI..............................................................
TLP3_ARATH/116-400VLGS....RGPRRMQCVM..............................................................
M0THC4_MUSAM/33-288LLKT....RGPRRMLCTL..............................................................
K4BB27_SOLLC/117-405VLRT....RGPRRMHSAM..............................................................
U5CU96_AMBTC/119-415VLGN....RGPRRMHCVM..............................................................
H9JIE3_BOMMO/143-380VLGF....KGPRKMTVIL..............................................................
T1JB91_STRMM/42-280VLGF....KGPRKMTIVL..............................................................
D2A282_TRICA/154-394VLGF....KGPRKMTVIL..............................................................
M0SJG0_MUSAM/62-313LLKS....RGPRRMHCTL..............................................................
U1M828_ASCSU/3-244VLGF....KGPRKMTVLI..............................................................
I1JCN8_SOYBN/119-408VLCT....RGPRRMHCVM..............................................................
TLP5_ARATH/119-423LLGT....RGPRRMNCIM..............................................................
F6HQ19_VITVI/117-399VLGS....RGPRRMQCVM..............................................................
A8ISI1_CHLRE/224-484LTAK....GGPRTMLVATPL............................................................
F0XZM0_AURAN/13-250VLGS....RGPRKMQVSI..............................................................
TUB1_CAEEL/174-420VLGF....KGPRKMTIVM..............................................................
M0TYP5_MUSAM/117-422VLGT....RGPRRMHCVM..............................................................
M4E7K8_BRARP/119-432VLGT....RGPRRMHCVM..............................................................
TULP_DROSE/202-437ILGF....KGPRNMTVIL..............................................................
M0SK32_MUSAM/62-312LLK.....RGPRRMHCTL..............................................................
TLP11_ORYSJ/119-400VLGS....RGPRRMHCAM..............................................................
B9H7S3_POPTR/117-417VLGT....RGPRRMHCTM..............................................................
W5EQP4_WHEAT/117-434VLGT....RGPRRMRCVM..............................................................
D7FYS0_ECTSI/361-593LVDHLRDGSQPRKFTVLL..............................................................
D7FYT0_ECTSI/243-552KEQR....TGKRRMEVAI..............................................................
F6RL90_CIOIN/49-290VLGF....KGPRKMTVII..............................................................
I1PX84_ORYGL/116-366FLKS....RGPRRMQCNI..............................................................
I1I0A3_BRADI/123-441VLGT....RGPRRMQCTM..............................................................
U5G686_POPTR/104-386VLGS....RGPRRMHCIM..............................................................

PF03803

PLS3_HUMAN/62-284---FLP----------------------------------------------------------------KFSIQDADR.
PLS4_HUMAN/100-322---CRA----------------------------------------------------------------VYSIQNEKK.
Q9NAE9_CAEEL/48-258---.DV----------------------------------------------------------------NFHLLGAGS.
Q21318_CAEEL/74-284---CNP----------------------------------------------------------------NFELVGSGC.
Q9VZW1_DROME/42-263---MRP----------------------------------------------------------------KFNIKNTCG.
YIP6_SCHPO/58-304---WRR----------------------------------------------------------------RYELFLAKR.
PLS1_HUMAN/86-307---CLP----------------------------------------------------------------KFTIQNEKR.
AIM25_YEAST/59-310---WRR----------------------------------------------------------------RYELFQKDGV
Q9SI32_ARATH/150-379---WRR----------------------------------------------------------------IYDLYLGN..
O45799_CAEEL/51-280---MSS----------------------------------------------------------------NYDIMDGDG.

PF04525

LOR14_ARATH/16-196---KTS----------------------------------------------------------------VDVFLPENNN
LOR3_ARATH/29-209---RES----------------------------------------------------------------SSSYKVVMGS
LOR7_ARATH/7-145---...----------------------------------------------------------------SKRFSKTESE
LURP1_ARATH/5-186---APK----------------------------------------------------------------LEVFLA..NN
LOR11_ARATH/36-222---KDS----------------------------------------------------------------SSSYRVNAGS
D6ENB3_STRLI/2-152---...----------------------------------------------------------------.RLSLLRNHY
LOR4_ARATH/7-183---CAR----------------------------------------------------------------IKRSSIRDGD
L8AWG7_BACIU/1-148---...----------------------------------------------------------------.VTFSKPKFV
LOR5_ARATH/4-186---...----------------------------------------------------------------....RNSVTV
LOR12_ARATH/18-197---CTM----------------------------------------------------------------.........E
Q97Q47_STRPN/1-153---...----------------------------------------------------------------.LTFWR...D
LOR17_ARATH/24-215---KSD----------------------------------------------------------------ILAYVYSGSF
LOR15_ARATH/25-206---KTK----------------------------------------------------------------LDVFLG..HN
LOR8_ARATH/10-188---...----------------------------------------------------------------VSIISNRKSL
LOR6_ARATH/2-180---.PK----------------------------------------------------------------HSCFSITSSI
LOR13_ARATH/13-175---KTR----------------------------------------------------------------VEVFLK..HN

PF01167

G0QXR5_ICHMG/270-502...PEV...................MENGQ...QIVIKPMS.NK.........E...GLLA.........MYKSGRKEQ.
E4XRC9_OIKDI/84-325...PKM..................DEESKK...AITIKPAQ.AS.........Q...TLLG.........YFDEADLTH.
M4BSN8_HYAAE/388-632...PLVEPIAGVDSAVDGSPSWAVQ..........SWRPET.KE.........D...TILS.........QVENPDTAR.
M0SAD5_MUSAM/110-361...HSI................................PAS................SLRE...GRG...A.........
M4AUK7_XIPMA/179-416...PGM...................SKDNE...RVPLRPRN.EC.........D...GLLV.........RYQNRRMEN.
W1NGY4_AMBTC/30-320...NSI................................PFS................AVQE...GGT...APTPIEFPNA
G7YSE7_CLOSI/527-800...PQL...................DSNGQ...RRQFGGDP.PS.........K...SLIE.........VWKQHCTHN.
S2K614_MUCC1/46-291...HTL...................TRDGK...RPEYRPVK.ES.........E...MLLS.........KYRDGGARD.
C1FIJ1_MICSR/334-589...PRVDLTSGERARFVATTR................................DGAHGILD.........CHKHGRRDD.
A9TE85_PHYPA/123-416...HGI................................PLS................TMES...VGS...APSPTEVTAD
A0EG93_PARTE/216-448...PRV...................GDRNI...PKVFQPLH.NN.........E...GIQY.........DYQNNKREF.
Q22Y91_TETTS/368-602...PDL...................QPNGD...PITIRPTS.NK.........E...GIFP.........MFKTGRRDG.
TLP7_ARATH/108-372...R..................................................................CPSPSPSSSS
J3M9P3_ORYBR/81-337...E..................................................................CPSTQETWEN
D7KMY6_ARALL/120-422...HSI................................PSL................ALEP...GGT...V..PGQPEFL
J3MPK4_ORYBR/123-441...HSI................................PAS................AVDP...EGV...V..PGQPEQL
I1IN97_BRADI/117-439...HSI................................PAS................SLEA...GGT...V..PCQMDSI
H2ZV03_LATCH/267-506...PSM...................NLDDE...RVCIRPRN.EH.........E...TLLI.........RYQNKNMES.
H0WAT2_CAVPO/269-510...PEI...................NDEHQ...RIRVQPET.EE.........E...SILS.........RFERGIRQG.
B3SBY7_TRIAD/1-241...PGM...................DANQE...RVAVRPRN.AN.........E...TLLE.........RWKSGRMDN.
F1PNR7_CANFA/215-456...PGM...................NMNHE...RIPFQPRN.DH.........E...SLLS.........KWQNKTMEN.
K3Z6B7_SETIT/115-432...QSI................................PES................AVEP...GGV...V..PGQPKEL
TULP2_MOUSE/315-556...PGM...................DSRKQ...RMKVQPQN.DQ.........D...SILS.........RVQKGAGHG.
B9GRM5_POPTR/121-410...HSI................................PIS................AIQE...GGI...APTPSEFNNP
M0RYY8_MUSAM/119-400...DSI................................PAS................AIEP...GGM...APTQTEFLHN
F4NT32_BATDJ/88-310...PPLLPEGTLA......................EIRPLEEKE.............TLLE.........RHKAMSDRD.
M7YZS2_TRIUA/159-501...NSI................................PTS................AVDP...DGV...V..PGQPKEL
TLP1_ARATH/121-449...NSI................................PAS................SLAE...GGT...V..PGQPDII
C5X4V0_SORBI/116-393...DSI................................PLS................AIKE...GGT...APTQTEFPSI
K3WG02_PYTUL/293-540...PDV.DENGVSSK....................VVRPMS.RQ.........D...RLVT.........RLSGGDL...
C1N1L4_MICPC/293-551...PAV...................DENGR...RAQFNPIDKNGT........D...GMMR.........SLKNKEHQD.
W1PSZ7_AMBTC/113-431...HSI................................PAS................ALDP..SVGP...APAPEIASLS
A9TFU9_PHYPA/122-419...HSI................................PAS................AMAS...GGS...APTPTEFTSC
K4AAU1_SETIT/114-394...DSI................................PAS................AVEE...GGK...APTQTEFPLS
B9R7W3_RICCO/118-407...HSI................................PVS................AIHE...GGT...APTPTEFLAC
K4CGS2_SOLLC/123-379...N..................................................................CPCPGEAASD
G0QPZ2_ICHMG/56-278...PGI....................................QNDYQQYNLKKQ...SLIE.........AQNQNKDN..
D8SG45_SELML/128-419...HSI................................PAS................AMEP...GGC...APTPLE.SAT
TLP7_ORYSJ/120-456...HSI................................PAS................AVEP...GGI...V..PGQPKEL
TLP1_ORYSJ/99-349...E..................................................................CPSTQETWEN
A0BWZ4_PARTE/130-363...PSV.INGQPQ......................DFKPIS.QNQ...............G.........ISKAFNQSKN
L9L384_TUPCH/349-587...PGM...................SADNQ...RVPIRPRN.AS.........D...GLLV.........RWQNKTLES.
K3ZU09_SETIT/112-390...DSI................................PAS................AIKE...GGT...APTQTEFPSS
F6TZP0_XENTR/258-499...PSM...................NMEGE...RVSIRPRN.EH.........E...TLLS.........RFQTGNMEN.
A9SPK2_PHYPA/122-414...HTI................................PMS................AMES...GGS...APTPTEFTAS
J3M7K2_ORYBR/123-439...HSI................................PAS................SVEP...GGI...V..PGQPEQI
I1J3P3_BRADI/123-449...HSI................................PRS................AVDP...DGT...V..PGQPKEL
M0SFG0_MUSAM/119-397...DSI................................PAS................AIKP...GGV...APTQIEFLHA
C5XQM9_SORBI/123-474...HSI................................PAS................SVEP...GGI...V..PGQPEQI
I1NRS9_ORYGL/1-249...Q..................................................................CPVLKGTAVD
A0DNS7_PARTE/64-294...PSL.IEGQPY......................RVVPQD.ENTG.......L...KIKR.........RFKNKRNDE.
I1LHT6_SOYBN/119-408...NSI................................PVS................AVQA...GGN...APTPT.FPEI
M4DW60_BRARP/89-338...DTL................................PTS................LMHP...QRA...AASSNSLRDP
F4HT64_ARATH/132-406...HSI................................PIS................AIQE...GGK...IQSPTEFTNQ
I1M8B1_SOYBN/124-417...HLI................................PIS................AIQE...GGN...APTPLKFTNY
I1R4B9_ORYGL/123-439...HSI................................PAS................SLEA...GGT...V..PCQPDSV
I1JFG1_SOYBN/112-394...DAI................................PAS................AVEP...GGV...APTQTQFLHS
F6H054_VITVI/120-410...HWI................................PIS................AIQE...GGT...APTPMTFAKC
M1B9A0_SOLTU/117-404...HSV................................PFS................SIQ....GGS...APTPTSFPRS
K4BFS0_SOLLC/118-400...HSI................................PFS................SIQE...GGS...APTPTSFPQH
H3GWQ0_PHYRM/600-881...PSI.LENGAGY....................LEWRPLS.RD.........Q...MMEE.........HVRNIAAAGG
F0YIF3_AURAN/571-870...PQT.RWRPRNADDGPRHDDDLDDGVVA...VASFRPAR.DQ.........D...SLCH.........TLNLAQGQGA
D8R328_SELML/134-424...HSI................................PAS................AMDP...GGV...APTPTVF.AN
K3YSM4_SETIT/134-423...HSI................................PAQ................CIQE...GGK...CPTPTGTIHS
W1PZG2_AMBTC/117-478...HSI................................PAS................AVEP...GGF...VPLGPWTSQG
M3XWI0_MUSPF/313-554...PEI...................NAQNQ...RIRIQPQN.EQ.........E...SLLS.........RLQRGARQG.
D8UHI1_VOLCA/195-429...PSV...DGTGRR....................LYHPTS.EA.........D...CILE.........RIRHRKGLEE
M4EBC2_BRARP/149-382...PKQ...............................QPVQ..KNNSKQVQQAS...KLPL.........DWLENKDQ..
W4XBT8_STRPU/232-473...PGM...................SLDHQ...RVEHKPRN.ER.........E...CMLE.........RFKRKDMEN.
M4FID3_BRARP/111-391...NTI................................PVS................SIQE...GGQ...IHTPTELSNL
F6GWV6_VITVI/118-407...HSI................................PIS................SIQE...GGT...APTPTSFPQP
E1ZRT4_CHLVA/5-242...PKL.DMDGQRAL....................PLRPKG.EH.........D...TLLG.........QYKLYNLSG.
W5GHE7_WHEAT/78-314...PKN...............................QSMQLRTNSSAQIQHVS...GLPK.........DWQEKRSR..
E9HFS8_DAPPU/11-241...PAM...................SIEQQ...RVDICPSV.EH.........E...GIID.........RWKRKMSDD.
K3Z7I3_SETIT/92-345...E..................................................................CPSVQETWEN
G3RQT8_GORGO/194-436...SHL...................RLKRK...AAPPKPQD.NH.........D...SLLS.........RWQNRTMEN.
A9SFN2_PHYPA/268-494...PSL.QEDGKPY.....................VFHAAA.DGG........P...VLMD.........DHKSGHHRDK
D8R0N5_SELML/71-351...HAV................................GAV................SMDSDSEGMA...VPASTELAAA
D2VAC3_NAEGR/225-455...PDA...................NEDGE...QYQFP..D.NG.........T...SLIS.........KFKTGDWHH.
U6HW68_ECHMU/466-723...PPV..............MDAVDP.......KAANEP...SK.........C...AIGG.........SESRSALSG.
D7LYF8_ARALL/105-385...DTI................................PTN................AMES...QGV...ASEPSEFPFL
B9S6E9_RICCO/119-408...HSI................................PVS................SIEE...GGT...APTPTSFSET
K4BTD6_SOLLC/117-420...HSI................................PVS................SLEP...GGT...V..PGQPE.L
TLP9_ARATH/98-374...DTI................................PMS................IVES...RGV...VASTSISSFS
TULP2_HUMAN/279-520...PGT...................NSQNQ...RINVQPLN.EQ.........E...SLLS.........RYQRGDKQG.
C5Y569_SORBI/117-450...HSI................................PAS................CLEA...GGS...V..PCQPDSI
TLP10_ARATH/123-439...NSI................................PIS................SLEP...GGS...V..PNQPEKL
B9HF20_POPTR/119-410...HSI................................PMS................SIEE...GGT...VPTLTSLTET
H2UUG1_TAKRU/220-462...PGM...................NMNFE...RVPVRPQN.EQ.........E...SILS.........RWHSHSLDN.
M7YYC1_TRIUA/164-457...HSI................................PAS................SVEP...GGV...V..PGQPEQI
H9GP51_ANOCA/382-623...PGI...................NTDNE...RICIRPKN.EH.........E...TLLT.........RYQNRNMQN.
A0DFE0_PARTE/648-881...PNL...................DAEDQ...LYVFKPTN.SK.........D...GILK.........EFQNNNRDH.
D7G017_ECTSI/222-546RHKPAFRPSSPLKTF......................................R...NIFK.........NFESSDDPEE
M0T5F2_MUSAM/105-356...RSI................................PIS................SIQE...GGS...QP........
K3YHL3_SETIT/122-443...HSI................................PAS................AMEP...EGM...V..PCQPKQL
T1G0S1_HELRO/9-246...PGM...................NLEHE...RVEIRPKT.ES.........D...GLLE.........RWKQKRMTG.
C3ZNP4_BRAFL/69-310...PGM...................TLDHE...RVAIKPRN.DS.........E...SLLS.........RWQHRNMDS.
M1APY8_SOLTU/99-381...DAI................................PAS................AIKP...GGI...APTQVDFPMD
I1GRC6_BRADI/110-376...DSI................................PVS................AIK....GGT...APTQTGFPSS
A7SD12_NEMVE/2-243...PGM...................GLDQQ...RVPVRPRL.ES.........E...TILE.........RHRNRQLEN.
D8RN05_SELML/30-264...PKY...............................QSIQTNGSSIQVKRSLSFNFGLGK.........DWEENMSN..
TUB_RAT/257-499...PGM...................NMVHE...RVCIRPRN.EH.........E...TLLA.........RWQNKNTES.
F7FA58_CALJA/208-448...PET...................DSENQ...IITVQPLT.EQ.........E...LLLS.........RIQRGDNQG.
K7U427_MAIZE/53-379...HSI................................PAS................TLDP...QGM...VPEPGQPKQI
W5KLH5_ASTMX/308-549...PGM...................HENDE...RVSIRPKS.DI.........E...SLLT.........RYENGNKEN.
K3ZLR9_SETIT/117-436...HSI................................PAS................CLEA...GGS...V..PCQPDSI
K1RHW3_CRAGI/170-406...PGM...................NLDHE...RVDIKPRS.DN.........D...GLID.........RWKKKNMEN.
K3WRQ8_PYTUL/367-602...PRV...................REDGT...RVVWRPLTKED.............EMVN.........KCKEQDHTN.
M0RRJ1_MUSAM/117-379...HSI................................PAS................ALDA...GGT...V.........
D8TVK7_VOLCA/158-460...PDA.............................NWTPSA.PDGS.......D...SLAS.........CLEAARRREL
W1NPG7_AMBTC/119-376...H..................................................................CSVSTDATTN
C6T8I4_SOYBN/79-355...DTI................................PAS................AIEP...GGVAVAAPSQTDFSVS
G4VQP4_SCHMA/265-505...PRL...................SATCQ...HFSCPGN..DT.........T...WLID.........SWRRKDMQS.
E5SUB8_TRISP/231-466...PVI.................RDFPTIK...RVDLKPIT.ER.........D...SMIE.........RWKSDRCDD.
D7T6J6_VITVI/62-344...DSI................................PAS................AIEP...GGV...TPTQTEIRLS
K3XJ41_SETIT/116-363...Q..................................................................CPADEGTAID
B9I1T1_POPTR/116-372...K..................................................................CPVLQETIND
J3N6A6_ORYBR/117-435...HSI................................PSS................SLDA...GGS...V..PCQPDGV
F1P3K2_CHICK/115-352...PGM...................NSDNE...RVPIRPRN.DN.........D...GLLM.........RWQNKNMDN.
D7FIT4_ECTSI/26-286...PAV...................NEAGE...VCKWSGLE.GGRGSQTAGGGS...KAIE.........RVKNRDYDG.
A0DMD6_PARTE/263-494...PSL.KDGQPT......................QIIPTD.ENTG.......L...KIKS.........RFINKRNQE.
M1CWX7_SOLTU/117-421...HSI................................PDS................ALEA...GGS...V..PGQPK.L
E4X5I6_OIKDI/256-497...PGM...................DLDCE...RLECQPTN.EK.........E...TLTS.........KYDSKTKDN.
B8C979_THAPS/14-256...SKV.DADGKPVR....................VWQPMN.KND........D...RMAD.........CYKNQEPSQI
M4FEU8_BRARP/112-371...DSI................................PLS................SVIS.........EPS.......
C4J4R4_MAIZE/117-430...HSI................................PTS................CLEA...GGT...V..PSQLDSI
D7FSI7_ECTSI/103-375...PGP.....................................................AE.........QYQAGDVETY
K3X0N8_PYTUL/565-829...PSI.VENGTSY....................LDWRPIS.RD.........Q...MMEE.........H.......GG
K0S854_THAOC/488-735...SRVDDESGEPLR....................VWQPRT.NGSDE......D...RLIP.........AVKEAREEDK
TLP3_ARATH/116-400...DAI................................PAS................AVEP...GGT...APTQTELVHS
M0THC4_MUSAM/33-288...Q..................................................................CPAENSRKVH
K4BB27_SOLLC/117-405...HSI................................PLS................SIQE...GGS...APTPKSFPQS
U5CU96_AMBTC/119-415...DAI................................PAS................SLEL...GGV...APTQSEFPLS
H9JIE3_BOMMO/143-380...PGM...................TPDRQ...RVAIVPQD.DS.........E...TLLE.........RLKSQNYDD.
T1JB91_STRMM/42-280...PGM...................TVDNH...RVDMQIDA.DG.........D...GLLE.........RWKVNNMEH.
D2A282_TRICA/154-394...PGM...................TLDQQ...RVAIYPQD.ES.........E...SLIE.........CWKSKNMDN.
M0SJG0_MUSAM/62-313...Q..................................................................CPTALD....
U1M828_ASCSU/3-244...PGI.................YDTENYR...RKQIRPIS.EK.........D...AILE.........RWKSRRTDE.
I1JCN8_SOYBN/119-408...NSI................................PVS................AIQE...GGN...APTPTSFPQI
TLP5_ARATH/119-423...HSI................................PSL................ALEP...GGT...V..PSQPEFL
F6HQ19_VITVI/117-399...DAI................................PAN................AIEP...GGV...APTQTEFVLS
A8ISI1_CHLRE/224-484...PEV.............................SWAPSA.ADGS.......D...SLAN.........CLEAARRREL
F0XZM0_AURAN/13-250...PAV.....................................DEAADGADKPRGMGDILS.........KMKAHEYGAG
TUB1_CAEEL/174-420...PGI.................EPPTENRPAVRCPVRPIQ.DK.........H...TLLE.........RYRLNDLDS.
M0TYP5_MUSAM/117-422...HSI................................PAS................ALDA...GGT...V..PGQPENL
M4E7K8_BRARP/119-432...NSI................................PTS................SLEP...GGS...V..PNQPDKL
TULP_DROSE/202-437...PGM...................TEDDQ...RVKISSADPKQ.........Q...GILD.........LWKMKNMDN.
M0SK32_MUSAM/62-312...Q..................................................................CPSAAQ...D
TLP11_ORYSJ/119-400...DSI................................PVS................AIEQ...GGT...APTQTEFPLS
B9H7S3_POPTR/117-417...HSI................................PAS................SLEP...GGS...V..PGQAE.L
W5EQP4_WHEAT/117-434...HSI................................PAS................SLEA...GGS...V..PCQPDII
D7FYS0_ECTSI/361-593...PALDCDGSPVAH....................KVDPYD.AD.........S...DMLS.........RMKQGRHGN.
D7FYT0_ECTSI/243-552...PQL.EQEGDSWKPV..................SWQPSD.TK.........E...SMIN.........NFGRLRYQGA
F6RL90_CIOIN/49-290...PGM...................NISHE...RVKFKPNH.ER.........E...TILS.........RWQNRNMEN.
I1PX84_ORYGL/116-366...Q..................................................................CPVGQSTASD
I1I0A3_BRADI/123-441...HSI................................PAS................AVDP...EGV...V..PGQPKQL
U5G686_POPTR/104-386...DAI................................PAS................AIEP...GGI...APTQTEFSHH

PF03803

PLS3_HUMAN/62-284--------------------------------------------------------------------------------
PLS4_HUMAN/100-322--------------------------------------------------------------------------------
Q9NAE9_CAEEL/48-258--------------------------------------------------------------------------------
Q21318_CAEEL/74-284--------------------------------------------------------------------------------
Q9VZW1_DROME/42-263--------------------------------------------------------------------------------
YIP6_SCHPO/58-304--------------------------------------------------------------------------------
PLS1_HUMAN/86-307--------------------------------------------------------------------------------
AIM25_YEAST/59-310--------------------------------------------------------------------------------
Q9SI32_ARATH/150-379--------------------------------------------------------------------------------
O45799_CAEEL/51-280--------------------------------------------------------------------------------

PF04525

LOR14_ARATH/16-196--------------------------------------------------------------------------------
LOR3_ARATH/29-209--------------------------------------------------------------------------------
LOR7_ARATH/7-145--------------------------------------------------------------------------------
LURP1_ARATH/5-186--------------------------------------------------------------------------------
LOR11_ARATH/36-222--------------------------------------------------------------------------------
D6ENB3_STRLI/2-152--------------------------------------------------------------------------------
LOR4_ARATH/7-183--------------------------------------------------------------------------------
L8AWG7_BACIU/1-148--------------------------------------------------------------------------------
LOR5_ARATH/4-186--------------------------------------------------------------------------------
LOR12_ARATH/18-197--------------------------------------------------------------------------------
Q97Q47_STRPN/1-153--------------------------------------------------------------------------------
LOR17_ARATH/24-215--------------------------------------------------------------------------------
LOR15_ARATH/25-206--------------------------------------------------------------------------------
LOR8_ARATH/10-188--------------------------------------------------------------------------------
LOR6_ARATH/2-180--------------------------------------------------------------------------------
LOR13_ARATH/13-175--------------------------------------------------------------------------------

PF01167

G0QXR5_ICHMG/270-502................................................................................
E4XRC9_OIKDI/84-325................................................................................
M4BSN8_HYAAE/388-632................................................................................
M0SAD5_MUSAM/110-361.........................................AKDEES.ARGFP.SDGPTG....................
M4AUK7_XIPMA/179-416................................................................................
W1NGY4_AMBTC/30-320.......LDEPFSLLS.........................ATKSKDPIIDFS.STSLSE.LPIS...............
G7YSE7_CLOSI/527-800................................................................................
S2K614_MUCC1/46-291................................................................................
C1FIJ1_MICSR/334-589................................................................................
A9TE85_PHYPA/123-416.......SLERAHVPH....................SGVMSSSRSKAAVVDIS.TLDYD..FASG...............
A0EG93_PARTE/216-448................................................................................
Q22Y91_TETTS/368-602................................................................................
TLP7_ARATH/108-372AGLSSDQKPCDVTKIM......................................KKPNKDGSSL................
J3M9P3_ORYBR/81-337.......SLKTKSLRR......................................TRT.......................
D7KMY6_ARALL/120-422...QR..SLDE.SFRS....IGS.............SKIVDDSG......DFT.SARFSD.VVGP...............
J3MPK4_ORYBR/123-441.LP.G..PFEE.SFRS...TNTS.SRF.........SSFMDRSL......DFS.SSRFSE.ISGL...............
I1IN97_BRADI/117-439.LARR..SLDE.SFSR....I.SISKS.........S.IMDHSV......HFS.SARFSD.SSIR...............
H2ZV03_LATCH/267-506................................................................................
H0WAT2_CAVPO/269-510................................................................................
B3SBY7_TRIAD/1-241................................................................................
F1PNR7_CANFA/215-456................................................................................
K3Z6B7_SETIT/115-432.LP.R..LFDE.SFRS...TATSLSKY.........S.IADSSM......DLS.SCRYSE.FGGG...............
TULP2_MOUSE/315-556................................................................................
B9GRM5_POPTR/121-410.......SNEQSSPLS.........................ASKLKQPPIDFS.SNSLAE.SSDS...............
M0RYY8_MUSAM/119-400.......SLD..SFPS......................VPFFRSKSYRTGSL..SGSVS.....................
F4NT32_BATDJ/88-310................................................................................
M7YZS2_TRIUA/159-501.LP.R..LFEE.SFRT...TASS.................RYST......DFS.SCRFSE.FGGG...............
TLP1_ARATH/121-449.VPRS..ILDE.SFRS....ITSSSSR.........KITYDYSN......DFS.SARFSD.ILGP...............
C5X4V0_SORBI/116-393.......NSN..SFAS......................VPFFR.KSGRLD.SSGVQLAT.....................
K3WG02_PYTUL/293-540KD..............................................................................
C1N1L4_MICPC/293-551................................................................................
W1PSZ7_AMBTC/113-431.......SLDE.SFSTLSFSH...............SMDRDLRLLSKRTDSFSGSARFSDITSFRAMSGP..........
A9TFU9_PHYPA/122-419.......GLEEAHVPY....................SSILLSPRSKAAVVDSS.ALESSE.LVSG...............
K4AAU1_SETIT/114-394.......SLD..SFPS......................IPFFRSKSARIDTT..SQS.S.....................
B9R7W3_RICCO/118-407.......NDEQIPPSS.........................ISKRKEPLIEFS.TTSVAE.SIEP...............
K4CGS2_SOLLC/123-379.......KSQDALKKK......................................LVGSAEANS.................
G0QPZ2_ICHMG/56-278................................................................................
D8SG45_SELML/128-419.......SMDEASMLP....................PLLLPVGAKSSKVAALD.GLEGLE.VAS................
TLP7_ORYSJ/120-456.LP.R..LFEE.SFRS...MATSFSKY.........S.ITDHST......DFS.SSRFSE.FGGG...............
TLP1_ORYSJ/99-349.......CLKTKFRKP......................................TGN.......................
A0BWZ4_PARTE/130-363EN..............................................................................
L9L384_TUPCH/349-587................................................................................
K3ZU09_SETIT/112-390.......NSS..SFAS......................VPFFRSKSGQLDSS............................
F6TZP0_XENTR/258-499................................................................................
A9SPK2_PHYPA/122-414.......TLEDTHVAY....................SGILSSPRSRAAVVDSS.TLDCD..FVSG...............
J3M7K2_ORYBR/123-439.VP.R..ALEE.SFRT....TTSFSKS.........S.IMDRSMDFSSSRDFS.SARFSD.IAGG...............
I1J3P3_BRADI/123-449.LP.R..LFDE.SFRT...TTSSFSKY.........S.VADHST......DFG.SSRFSE.YGGG...............
M0SFG0_MUSAM/119-397.......SLD..SFPS......................VPFFRSKSSRIECL..SGSFS.....................
C5XQM9_SORBI/123-474.VP.R..ALED.SFRS....TASFSQSFRSTTSLSKS.IMDSSM......DFN.SARFSD.IGGSSARFTGIPGSSARFT
I1NRS9_ORYGL/1-249.......PQDGKRLSN......................................SIPSS.....................
A0DNS7_PARTE/64-294................................................................................
I1LHT6_SOYBN/119-408.......IDEPFSPSP.........................ALKGKGPIRDLD.NASLPELLPVE...............
M4DW60_BRARP/89-338................................................................................
F4HT64_ARATH/132-406.........................................GKKKKKPLMDFC.SGNLGGESVI................
I1M8B1_SOYBN/124-417.......LNDYASTTI.......................PDTKGKKPEVVEFD.STGTDN.TPES...............
I1R4B9_ORYGL/123-439.LA.R..SLDE.SFGS....I.SFSKS.........S.IMDRAI......RFS.SSRYSD.ISVG...............
I1JFG1_SOYBN/112-394.......RID..TSPS......................IPFFRSKSTRMDNLP.TVPLT.....................
F6H054_VITVI/120-410.......QKDQFPQSA.........................DPKGKNPLIEFS.SNSLAE.TPES...............
M1B9A0_SOLTU/117-404.......FGEKASPPS.........................VSDSKETAKDAS.SPSI.S.SSAV...............
K4BFS0_SOLLC/118-400.......FDEKSSPAL.........................VSKAKE........PSVNS.SSTV...............
H3GWQ0_PHYRM/600-881QNVMDASN........................................................................
F0YIF3_AURAN/571-870QNVLHADR........................................................................
D8R328_SELML/134-424.......PLEDAQLPF....................PV......SKSKVSDCS.TAPVVV.PYSG...............
K3YSM4_SETIT/134-423.......LDEPSTLPS..........................TKGKEPAVEFS.STSLSADLSGP...............
W1PZG2_AMBTC/117-478SSSPMAPFGDSFSALS.........................ISSMDHRSIDFG.SSRFSE.VSGF...............
M3XWI0_MUSPF/313-554................................................................................
D8UHI1_VOLCA/195-429................................................................................
M4EBC2_BRARP/149-382................................................................................
W4XBT8_STRPU/232-473................................................................................
M4FID3_BRARP/111-391.........................................GSKKKRGLIDFW.SGNLGGESVV................
F6GWV6_VITVI/118-407.......FDEQFSPSP.........................CLRKKDPVTDIC.STSLSE.PLVP...............
E1ZRT4_CHLVA/5-242................................................................................
W5GHE7_WHEAT/78-314................................................................................
E9HFS8_DAPPU/11-241................................................................................
K3Z7I3_SETIT/92-345.......SLEVKSLRR......................................TGT.......................
G3RQT8_GORGO/194-436................................................................................
A9SFN2_PHYPA/268-494................................................................................
D8R0N5_SELML/71-351.......PVADDAVGE....................PGLSSSGGDR..................................
D2VAC3_NAEGR/225-455................................................................................
U6HW68_ECHMU/466-723................................................................................
D7LYF8_ARALL/105-385.......GTR............................STFSRSQSKPLRCSS...........................
B9S6E9_RICCO/119-408.......FDDWLSFSS.........................GSKGKESVFDVS.SASPSE.SPVI...............
K4BTD6_SOLLC/117-420.LP.P..NLED.SFRS....M.SFSKS............IDAST......EFN.SARFSD.IGGP...............
TLP9_ARATH/98-374.......SRS............................SPVFRSHSKPLRSNSASCSDSG....................
TULP2_HUMAN/279-520................................................................................
C5Y569_SORBI/117-450.VA.H..SVGE.MFSS....I.PLSKS.........S.TMDHSM......HFS.SSRFSD.AITA...............
TLP10_ARATH/123-439.VP.APYSLDD.SFRS....NISFSKS.........S.FDHRSL......DFS.SSRFSE.MGI................
B9HF20_POPTR/119-410.......FGGQFPHLS.........................TSKGKESVSDIS.SPSPSQ.SPVL...............
H2UUG1_TAKRU/220-462................................................................................
M7YYC1_TRIUA/164-457.VP.R..ALGD.SFRS....ITSFSQSFRSSATFSRS.IMDQSM......DFN.SARFSE.ISGG...............
H9GP51_ANOCA/382-623................................................................................
A0DFE0_PARTE/648-881................................................................................
D7G017_ECTSI/222-546QRAQQHYATLGSEGSD................................................................
M0T5F2_MUSAM/105-356...............................................AIDDVS.STPAS..APVR...............
K3YHL3_SETIT/122-443FLP.ASSSYEE.SFRSA.NTSSS.SRF.........S.VTDRSL......DFS.SSRFSE.VSGV...............
T1G0S1_HELRO/9-246................................................................................
C3ZNP4_BRAFL/69-310................................................................................
M1APY8_SOLTU/99-381.......NSGS.SLP.......................MRFLRSKSSRLEKSL.SGPIE.....................
I1GRC6_BRADI/110-376.......SHD..SFAS......................IPFFKSKSSRRDSS..TTQLS.....................
A7SD12_NEMVE/2-243................................................................................
D8RN05_SELML/30-264................................................................................
TUB_RAT/257-499................................................................................
F7FA58_CALJA/208-448................................................................................
K7U427_MAIZE/53-379FVP.GSSSFED.SFRSANNTPSS.SRF.........S.VADRSL......DWS.SSRFSE.TSGL...............
W5KLH5_ASTMX/308-549................................................................................
K3ZLR9_SETIT/117-436.VA.H..SLGG.SFSS....V.SLSKS.........S.VMDHSM......HFS.SARFSD.VATG...............
K1RHW3_CRAGI/170-406................................................................................
K3WRQ8_PYTUL/367-602................................................................................
M0RRJ1_MUSAM/117-379............PFRV................................................................
D8TVK7_VOLCA/158-460SPRLERH.........................................................................
W1NPG7_AMBTC/119-376.......SSKFTTGSD......................................IGEPNSCAT.................
C6T8I4_SOYBN/79-355.......NRD....TS......................FPFFQTNSTSLE.NSISGDQS.....................
G4VQP4_SCHMA/265-505................................................................................
E5SUB8_TRISP/231-466................................................................................
D7T6J6_VITVI/62-344.......NPD..VFPS......................FSFFRSKSHSVENSL.SEPLA.....................
K3XJ41_SETIT/116-363.......PEEANQPSS........................................PSS.....................
B9I1T1_POPTR/116-372.......KILDNSKMN......................................GLESASSGC.................
J3N6A6_ORYBR/117-435.LA.H..SLNESSFRS....V.SFLKS.........S.IMDHSM......HFS.SARFSD.FSVG...............
F1P3K2_CHICK/115-352................................................................................
D7FIT4_ECTSI/26-286................................................................................
A0DMD6_PARTE/263-494................................................................................
M1CWX7_SOLTU/117-421.LS.R..PLED.SFRS....I.SFSKS............LDHST......EFS.SARFSD.IAGG...............
E4X5I6_OIKDI/256-497................................................................................
B8C979_THAPS/14-256GK..............................................................................
M4FEU8_BRARP/112-371.........................................LVKEEVSSGETS.STDKENISPSL...............
C4J4R4_MAIZE/117-430.LA.R..STDE.SFGS....I.SFSKS.........S.VVDRSM......RFS.SSRFSD.ISMS...............
D7FSI7_ECTSI/103-375NHPWDD..........................................................................
K3X0N8_PYTUL/565-829QNVLDMSN........................................................................
K0S854_THAOC/488-735................................................................................
TLP3_ARATH/116-400.......NLD..SFPS......................FSFFRSKSIRAESLP.SGPSS.....................
M0THC4_MUSAM/33-288QKIPRADASGSDAGS.................................................................
K4BB27_SOLLC/117-405.......FDEKSFSAP.........................LAIAKESAMDIS.SSGI.S.RSAV...............
U5CU96_AMBTC/119-415.......TLDS.SFQA......................LPFFRSKSVRSNASF.SGPLDG....................
H9JIE3_BOMMO/143-380................................................................................
T1JB91_STRMM/42-280................................................................................
D2A282_TRICA/154-394................................................................................
M0SJG0_MUSAM/62-313.......STEENPLKS......................................KAHSAGAS..................
U1M828_ASCSU/3-244................................................................................
I1JCN8_SOYBN/119-408.......FDEPFSPSP.........................ALKEKAQVTDLN.SASLSE.PPVL...............
TLP5_ARATH/119-423...QR..SLDE.SFRS....IGS.............SKIVNHSG......DFT.RPK.......................
F6HQ19_VITVI/117-399.......NVD..SFPS......................FPFFRSKSNRTESLH.SGPLSG....................
A8ISI1_CHLRE/224-484SPRMERQ.........................................................................
F0XZM0_AURAN/13-250TS..............................................................................
TUB1_CAEEL/174-420................................................................................
M0TYP5_MUSAM/117-422.LP.R..SLED.SFRS....I.SFAKS.........S.IMDQSM......DVS.SSHFSD.ITGG...............
M4E7K8_BRARP/119-432.LP.GP..LDE.SFRS....NISFSKS.........S.LDYRSV......DFS.SSRFSE.LGVV...............
TULP_DROSE/202-437................................................................................
M0SK32_MUSAM/62-312.......TTEEDSSKP......................................KAHNPGV...................
TLP11_ORYSJ/119-400.......YHE..SFTS......................IPFFKSKSVRANNS..TASLL.....................
B9H7S3_POPTR/117-417.LP.R..SLED.SFRS....I.SFSKS............IDNST......EFS.SSRFSD.IVGP...............
W5EQP4_WHEAT/117-434.FS.R..SLDE.SFSS....M.PVSKS.........S.VMDHSM......RFS.SARFSD.VSIG...............
D7FYS0_ECTSI/361-593................................................................................
D7FYT0_ECTSI/243-552QNFLQDDR........................................................................
F6RL90_CIOIN/49-290................................................................................
I1PX84_ORYGL/116-366.......PLKEKLIST......................................SSP.......................
I1I0A3_BRADI/123-441.LP.G..PFEE.SFRS...TNTS.SRF.........S.....VT......DFS.SSRFSE.ISGA...............
U5G686_POPTR/104-386.......NVD..FLPS......................LPFFRSKSNRVESFQ.SGSLS.....................

PF03803

PLS3_HUMAN/62-284----------------------------------QTVLRVVGPCWTCG.CGTDTNFEVKTRDESRSVGRISKQW------
PLS4_HUMAN/100-322----------------------------------ENVMRVRGPCSTYG.CGSDSVFEVKSLDGISNIGSIIRKW------
Q9NAE9_CAEEL/48-258----------------------------------NQSLLIRSPLFAAS..GGTRSFPVMTYNG.MRVGEIVRLY------
Q21318_CAEEL/74-284----------------------------------NQPLLIQSP..GCAGCGGTQKFPVMTFNG.VLVGEIVRLY------
Q9VZW1_DROME/42-263----------------------------------DTVLQIEGPVCPCK.CFSDTNFKVLSANN.EEIGKISKQW------
YIP6_SCHPO/58-304----------------------------------....SMFEQFAKIDERVLSWEFLLRN.EQDRILGSVSRNF------
PLS1_HUMAN/86-307----------------------------------EDVLKISGPCVVCS.CCGDVDFEIKSLDEQCVVGKISKHW------
AIM25_YEAST/59-310----------------------------------EG..STFDQFGKIDAPFLSFDFPVTDADG.KIMASVDRNW------
Q9SI32_ARATH/150-379----------------------------------NQFAVVENPGF......WNWTFTVKDADG.EVLAQIDRDW------
O45799_CAEEL/51-280----------------------------------NVIFQIDGPCCCMLCGCQDKEFPIKTANNGTVVGAITKKW------

PF04525

LOR14_ARATH/16-196----------------------------------V..KKTNTCDFHASGGYSNISFKVF...KADALIAGVG..------
LOR3_ARATH/29-209----------------------------------RIVDGDQQSCYKI..VNRGSVFAIKD..GSGRLMAEVKNK------
LOR7_ARATH/7-145----------------------------------VSFAGESSENLVIKGVPFQKSCTIY...SQDSIVAQTS..------
LURP1_ARATH/5-186----------------------------------V...EEKICDFKVKGAWLDDSCVVYA.GDSDTIIAHMCGK------
LOR11_ARATH/36-222----------------------------------CRNDEQYCYKMVTRGS....SLAIED..NCGKLLAEVKRK------
D6ENB3_STRLI/2-152----------------------------------RVVLADGTE.LDVSGKILDREFAVE...YDGELLAVV...------
LOR4_ARATH/7-183----------------------------------WEVRDETNEVFWILRFDPKFAFQIID..IHGNIIAQVKPK------
L8AWG7_BACIU/1-148----------------------------------I.....SGLNWEIDGDLWRDEFQLTD.GENVRMSVSKK..------
LOR5_ARATH/4-186----------------------------------EVYGDYQCSEYLIEGSFGARNCTVVE.AETRRKVAEIRRK------
LOR12_ARATH/18-197----------------------------------VEVYDGTGEEYIIDGDFSQRSCLIYD..TKKCTVAEIKRK------
Q97Q47_STRPN/1-153----------------------------------K..YEFDNLGLRIEGNIWDLNFKLLD..DRDQLIAEIK..------
LOR17_ARATH/24-215----------------------------------.....DKKNSYIIKGSYRCKSCKIVH.VPLNKTVVEIKRK------
LOR15_ARATH/25-206----------------------------------K...DEKRCDFRVKGSWLERSCVVYA.GESDAIVAQMHRK------
LOR8_ARATH/10-188----------------------------------AWVSAKKTVLYEIEGSYGQRSCKILDERRNKKKTAEIKRK------
LOR6_ARATH/2-180----------------------------------RISVGPGNCYFDVKGYFPDRDCSIVD..SKGNVIAQVKE.------
LOR13_ARATH/13-175----------------------------------Q..TRESSCDFTIKGRFMKRACTIYV.ADSTKIIAQV...------

PF01167

G0QXR5_ICHMG/270-502..................................QLHYFNKPPKWNDSVQAFVLNFNGR......VDKPSVKNF......
E4XRC9_OIKDI/84-325..................................ITVHHNRQPNWNDKTQSYVLNFNGR......VTQASVKNF......
M4BSN8_HYAAE/388-632..................................ALQLINKPPVWIESLEAYCLDFGGR......VAAASVKNF......
M0SAD5_MUSAM/110-361.............................SV...PLILKNKSPRWHEQLQCWCLDFKGR......VTVASVKNF......
M4AUK7_XIPMA/179-416..................................VIELHNKTPVWNEDTASHVLNFNGR......VTQASVKNF......
W1NGY4_AMBTC/30-320.........................FHSKEE...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
G7YSE7_CLOSI/527-800..................................LLELHNKNPVWNEDTQSYVLNFYGR......VTQASVKNF......
S2K614_MUCC1/46-291..................................LLVLHNKSPQWNEETQSFVLNFNGR......VTQASVKNF......
C1FIJ1_MICSR/334-589..................................LIVLTNKSPRWNEQMQAYCLNFNGR......VTHASVKNF......
A9TE85_PHYPA/123-416.........................LLAKDE...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
A0EG93_PARTE/216-448..................................IEEFINKPPRWDAKMKAHVLNFFGR......VDKPSVKNF......
Q22Y91_TETTS/368-602..................................LLLFQNKPPKWNDSVQAFVLNFNGR......VDRPSVKNF......
TLP7_ARATH/108-372...................................TILKNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
J3M9P3_ORYBR/81-337...................................ILLKNKAPQWHEHLQLWCLNFHGR......VTVASVKNF......
D7KMY6_ARALL/120-422..................QGEE...DKGKER...PLVLKNKPPRWHQKLQCWCLNFRGR......VTVASVKNF......
J3MPK4_ORYBR/123-441........T.....NQQGEDDG....EAKER...PLVLRNKVPRWHEQLQCWCLNFRGR......VTVASVKNF......
I1IN97_BRADI/117-439.......GGPGISRQSL..SDE...DQCKDV...PLILRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
H2ZV03_LATCH/267-506..................................IIELQNKPPSWNQDTQSYVLNFHGR......VTQASVKNF......
H0WAT2_CAVPO/269-510..................................LLLLQNKTPVWSDENDAFVLNFHGR......VTQASVKNF......
B3SBY7_TRIAD/1-241..................................LLELHNKAPEWNDNTQSYVLNFHGR......VTQASVKNF......
F1PNR7_CANFA/215-456..................................LIELHNKAPVWNDDTQSYVLNFHGR......VTQASVKNF......
K3Z6B7_SETIT/115-432...............NQQGDDN...DADKER...PLVLRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
TULP2_MOUSE/315-556..................................LLLLQNKAPSWSDESGAYVLNFHGR......VTRASVKNF......
B9GRM5_POPTR/121-410.........................LCSKND...PLILKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
M0RYY8_MUSAM/119-400.........................G.LKEE...MLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
F4NT32_BATDJ/88-310..................................LVVMYNKSPKWSD.......DFNQR......VTIASVKNF......
M7YZS2_TRIUA/159-501........PL....REEGGDEN...VGDKES...PLVLKNKSPRWHEQLQCWCLNFRGR......VTVASVKNF......
TLP1_ARATH/121-449................LSEDQEVVLEEGKERNSPPLVLKNKPPRWHEQLQCWCLNFRGR......VTVASVKNF......
C5X4V0_SORBI/116-393...........................QNEA...KMVLKNKSPNWHEPLQCWCLNFHGR......VTVASVKNF......
K3WG02_PYTUL/293-540..................................LMKFSNREPVFREDLGAYCLDFGGR......VSMASVKNF......
C1N1L4_MICPC/293-551..................................MIVLMNKSPKWNESMGAYCLNFNGR......VTAASVKNF......
W1PSZ7_AMBTC/113-431.........................LEGKEWERGPLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
A9TFU9_PHYPA/122-419.........................VLCKEE...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
K4AAU1_SETIT/114-394.........................T.QKED...RLVLKNKSPRWHEQLQCWCLNFRGR......VTVASVKNF......
B9R7W3_RICCO/118-407.........................NCGRKD...PLVLKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
K4CGS2_SOLLC/123-379...................................TVLKNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
G0QPZ2_ICHMG/56-278..................................FIQLFKKKQPWYDNFQNFVKDYNGR......ASIGSVKNM......
D8SG45_SELML/128-419............................KGK...PLVLKNKPPRWHDQLQCWCLNFRGR......VTVASVKNF......
TLP7_ORYSJ/120-456........ALQGQEQEQDGDD.....VNKER...PLVLRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
TLP1_ORYSJ/99-349...................................TVLRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
A0BWZ4_PARTE/130-363..................................VMQLVSRPPTFSEEKNAYQLKFTQR......VRSASNKNF......
L9L384_TUPCH/349-587..................................LIELHNKPPVWNEDSGSYTLNFQGR......VTQASVKNF......
K3ZU09_SETIT/112-390.........................GAQNES...KVALKNKSPSWHQQLQCWCLNFHGR......VTVASVKNF......
F6TZP0_XENTR/258-499..................................IIALQNKAPSWNEETQSFVLNFHGR......VTQASVKNF......
A9SPK2_PHYPA/122-414.........................PLTKDA...PLILKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
J3M7K2_ORYBR/123-439...............TINGDEE...GQNKER...PLVLRNKAPRWHEQLQCWCLNFRGR......VTIASVKNF......
I1J3P3_BRADI/123-449........AL......QDGDA.....ADKET...PLVLRNKVPRWHEQLQCWCLNFRGR......VTVASVKNF......
M0SFG0_MUSAM/119-397.........................G.LNEE...KLVLKNKNPRWHAQLQCWCLNFRGR......VTVASVKNF......
C5XQM9_SORBI/123-474GIPGSSARFSGIAEGRLDNDEE...SETKER...PLVLRNKPPRWHEQLQCWCLNFRGR......VTIASVKNF......
I1NRS9_ORYGL/1-249...................................LVLNSKVPSWHEHLQCWCLNFHGR......VMVASVKNF......
A0DNS7_PARTE/64-294..................................YFEFQTQEPVWSSKLQSFILPFNSR......VNSASIHNF......
I1LHT6_SOYBN/119-408.........................SQGSAE...PLVLKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
M4DW60_BRARP/89-338..................................PLVLSNKTPRWHEQLRCWCLNFHGR......VTVASVKNF......
F4HT64_ARATH/132-406.............................KE...PLILKNKSPRWHEQLQCWCLNFKGR......VTVASVKNF......
I1M8B1_SOYBN/124-417.........................IQRARE...PLILKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
I1R4B9_ORYGL/123-439........GPMVGGQAL..GDS...DESKER...PLILRNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
I1JFG1_SOYBN/112-394.........................C.QNEG...TLVLRNKSPRWHEHLQCWCLNFNGR......VTVASVKNF......
F6H054_VITVI/120-410.........................IQDTRN...PLVLKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
M1B9A0_SOLTU/117-404.........................PLPLQE...SLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
K4BFS0_SOLLC/118-400.........................SVLSRE...PLVLKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
H3GWQ0_PHYRM/600-881..................................FVFLHKRETKY.DPLSSCIVDFRSR......ATCVSVKNF......
F0YIF3_AURAN/571-870..................................IAVLHMRESKY.DPLSSCLVDFKAR......ANMASVKNF......
D8R328_SELML/134-424.........................VMSKDG...PLVLKNKAPRWHDQLQCWCLNFRGR......VTVASVKNF......
K3YSM4_SETIT/134-423.........................ACTSEA...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
W1PZG2_AMBTC/117-478..GGPDVGFNGSEVATDDTQMGLGFDVGLKK...PLVLRNKTPRWHEQLQCWCLNFRGR......VTVASVKNF......
M3XWI0_MUSPF/313-554..................................LVLLQNKAPSWSNESGAYVLNFHGR......VTRASVKNF......
D8UHI1_VOLCA/195-429..................................LVVMGNKPPRWNDELNAYCLNFNGR......VTEASVKNF......
M4EBC2_BRARP/149-382..................................VQELCSRIPHYNKISKQHELDFRDR.GRTSLKIQSSVKNF......
W4XBT8_STRPU/232-473..................................LLELHNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
M4FID3_BRARP/111-391.............................KE...PLVLKNKLPRWHEQLQCWCLNFKGR......VTVASVKNF......
F6GWV6_VITVI/118-407.........................VQGSGD...PLILKNKAPRWHEHLQCWCLNFRGR......VTVASVKNF......
E1ZRT4_CHLVA/5-242..................................CVVLRNKPPRWNQSMGAYCLNFGGR......VTQASVKNF......
W5GHE7_WHEAT/78-314..................................AEQLCSRSPFYNNMTKRYELDFRERVGRMGYKVQTSVKNF......
E9HFS8_DAPPU/11-241..................................LLQLHNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
K3Z7I3_SETIT/92-345...................................TVLRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
G3RQT8_GORGO/194-436..................................LVELHNKAPVWNSDTQSYVLNFRGR......VTQASVKNF......
A9SFN2_PHYPA/268-494..................................MIVMHNKQPHFNKQLAAYCLNFNGR......VTKPSVKNF......
D8R0N5_SELML/71-351..........................YVKGD...PLVLKNKSPRWHDQLQCWCLNFRGR......VTVASVKNF......
D2VAC3_NAEGR/225-455..................................LKVLKNKFPVWNERLKAYVLNFNGR......VTMASVKNF......
U6HW68_ECHMU/466-723..................................IIELHNKKPMWNEETQSYVLNFHGR......VTQASVKNF......
D7LYF8_ARALL/105-385.........................SHLKET...PLVLSNKTPRWHEQLRCWCLNFHGR......VTVASVKNF......
B9S6E9_RICCO/119-408.........................IHGSGE...PLILKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
K4BTD6_SOLLC/117-420.................SEVDE....EGKSS...LLVLRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
TLP9_ARATH/98-374.........................NNLGDP...PLVLSNKAPRWHEQLRCWCLNFHGR......VTVASVKNF......
TULP2_HUMAN/279-520..................................LLLLHNKTPSWDKENGVYTLNFHGR......VTRASVKNF......
C5Y569_SORBI/117-450.......DAIVSGGQALSNADD...EESTDT...PLVLRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
TLP10_ARATH/123-439................SCDDNE...EEASFR...PLILKNKQPRWHEQLQCWCLNFRGR......VTVASVKNF......
B9HF20_POPTR/119-410.........................TQGSEE...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
H2UUG1_TAKRU/220-462..................................LIELHNKAPVWNEDTQSYVLNFHGR......VTQASVKNF......
M7YYC1_TRIUA/164-457..............GVTDGDGE...GEVKER...PLVLRNKPPRWHEQLQCWCLNFRGR.....................
H9GP51_ANOCA/382-623..................................LIKLQNKMPAWNEETQSYVLNFHGR......VTQASVKNF......
A0DFE0_PARTE/648-881..................................IATYVNRPPQWNSKHKAFVLNFYQR......VDKPSVKNF......
D7G017_ECTSI/222-546..................................IITFETLSPSWNEVLHAWTLNFNGR......VKIPSKKNFLVSPEK
M0T5F2_MUSAM/105-356.........................TNG..E...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
K3YHL3_SETIT/122-443........I......QQNEDDG....QAKER...PLVLRNKEPRWHEQLQCWCLNFRGR......VTVASVKNF......
T1G0S1_HELRO/9-246..................................LLELHNKSPVWNDETQSYVLNFHGR......VTQASVKNF......
C3ZNP4_BRAFL/69-310..................................ILELHNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
M1APY8_SOLTU/99-381.........................T.QREG...SLVLKNKAPRWHEQLQCWCLNFHGR......VTVASVKNF......
I1GRC6_BRADI/110-376.........................T.QEES...KLVLKNKSPRWQEHLQCWCLNFHGR......VTVASVKNF......
A7SD12_NEMVE/2-243..................................LVELHNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
D8RN05_SELML/30-264..................................VKELVSKTPRYNNLLKRYELDFRES.SKMGAKIKTSVKNF......
TUB_RAT/257-499..................................IIELQNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
F7FA58_CALJA/208-448..................................LLVLHNKTPLWNHEKGVFMLNFHDR......VTMTSVKNF......
K7U427_MAIZE/53-379........A......QQDDDDS...DQAKER...PLVLCNKEPRWHEQLQCWCLNFHGR......VTVASVKNF......
W5KLH5_ASTMX/308-549..................................LVCLVNKSPSWNEQTQSYVLNFHGR......VTQASVKNF......
K3ZLR9_SETIT/117-436.......LGLGSEGRAL..FDD...EECNDR...PLILRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
K1RHW3_CRAGI/170-406..................................ILELHNKTPVWNDETQSYVLNFHGR......VTQASVKNF......
K3WRQ8_PYTUL/367-602..................................LTYLINKPPRWNDQVCAYVLNFNGR......VTMASVKNF......
M0RRJ1_MUSAM/117-379.................GNEED...DKATEM...PLVLRNKAPRWVEQLQCWCLDFGGR......VTMASVKNF......
D8TVK7_VOLCA/158-460..................................LCMLATRPPEWDSTLKAYTLDFHGR......VRASSVKNF......
W1NPG7_AMBTC/119-376...................................TSLRNKAPKWHQQLQCWCLNFHGR......VTVASVKNF......
C6T8I4_SOYBN/79-355.........................N.KKDD...VLVLRNKAARWHEQLQCWCLNFHGR......VTIASVKNF......
G4VQP4_SCHMA/265-505..................................VLQLQNKNPVWNEETQSYVLNFHGR......VTQASVKNF......
E5SUB8_TRISP/231-466..................................LIELTNKSPIWNEDAQSYILNFHGR......VTQASVKNF......
D7T6J6_VITVI/62-344.........................D.KKDG...ALVLKNKAPRWHEQLQCWCLNFHGR......VTVASVKNF......
K3XJ41_SETIT/116-363...................................LVLYNKLPRWHEHLQCWCLNFHGR......VMVASVKNF......
B9I1T1_POPTR/116-372...................................TVLRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
J3N6A6_ORYBR/117-435.......DGPRIGGREL..CND...EECKET...PLILHNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
F1P3K2_CHICK/115-352..................................IIELHNKAPVWNDETQSYVLNFHGR......VTHASVKNF......
D7FIT4_ECTSI/26-286..................................SLYMVNKPPRWNDQVGAYVLNFYGR......VTMASVKNF......
A0DMD6_PARTE/263-494..................................YFEFRTQEPIWNQKYQSFTLPFNSR......VNSASVHNF......
M1CWX7_SOLTU/117-421.................STNEE...DDNKGK...PLVLKNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
E4X5I6_OIKDI/256-497..................................ITVLQNKSPVWNEDSQSYVLNFHGR......VTQASVKNF......
B8C979_THAPS/14-256..................................LMSLVNNPPSWNEEVRAFVLNFNGR......VTMASIKNF......
M4FEU8_BRARP/112-371.........................L...DQ...PLVLKNKSPRWHEQLQCWCLNFKGR......VTVASVKNF......
C4J4R4_MAIZE/117-430.......SSRRIGDTAS..GDN...DECKER...PLILRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
D7FSI7_ECTSI/103-375..................................VMHLRDRKPRYDRTVGAYVLDFPNS......TSKLSIKNV......
K3X0N8_PYTUL/565-829..................................FVFMHKRETKY.DPLSSCIVDFRSR......ATCVSVKNF......
K0S854_THAOC/488-735..................................IFCFRNKPPTWSDEAGAYVLNFNGR......VTMASVKNF......
TLP3_ARATH/116-400.........................AAQKEG...LLVLKNKAPRWHEQLQCWCLNFNGR......VTVASVKNF......
M0THC4_MUSAM/33-288...................................VVLKNKVPRWHDHLKCWCLNFHGR......VTVASVKNF......
K4BB27_SOLLC/117-405.........................TATSQD...ILVLKNKAPRWHEQLQCWCLNFKGR......VTVASVKNF......
U5CU96_AMBTC/119-415.........................GPQKDG...MLVLRNKAPRWHDQLQCWCLNFRGR......VTVASVKNF......
H9JIE3_BOMMO/143-380..................................IVVLHNKTPVWNEETQSYVLNFHGR......VTQASVKNF......
T1JB91_STRMM/42-280..................................LIQLHNKTPVWNEETQSYVLNFGGR......VTHASVKNF......
D2A282_TRICA/154-394..................................LIELHNKTPVWNDDTQSYVLNFHGR......VTQASVKNF......
M0SJG0_MUSAM/62-313...................................VVLRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
U1M828_ASCSU/3-244..................................LIAMHNKNPVWNEDTQSYVLNFHGR......VTQASVKNF......
I1JCN8_SOYBN/119-408.........................SQGSTE...QLALKNKAPRWHEQLQCWCLNFKGR......VSVASVKNF......
TLP5_ARATH/119-423.....................E...EEGKVR...PLVLKTKPPRWLQPLRCWCLNFKGR......VTVASVKNF......
F6HQ19_VITVI/117-399...........................PKDE...MLVLKNKAPRWHEQLQCWCLNFNGR......VTVASVKNF......
A8ISI1_CHLRE/224-484..................................LCMLATRPPEWDPSLKAYTLDFHGR......IRASSVKNF......
F0XZM0_AURAN/13-250..................................LVYMINKPPRWNDQVGAYVLNFNGR......VTMASVKNF......
TUB1_CAEEL/174-420..................................LKILSNKSPQWNDETQSYVLNFHGR......VTQASVKNF......
M0TYP5_MUSAM/117-422..............ARVADAED...DEAKER...PLILRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
M4E7K8_BRARP/119-432...............APCEEEQ...EETSFR...PLVLKNKQPRWHEQLQCWCLNFRGR......VTVASVKNF......
TULP_DROSE/202-437..................................IVELHNKTPVWNDETQSYVLNFHGR......VTQASVKNF......
M0SK32_MUSAM/62-312...................................TILRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
TLP11_ORYSJ/119-400.........................T.QNGS...KLVLKNKSPRWHEHLQCWCLNFHGR......VTVASVKNF......
B9H7S3_POPTR/117-417...................RED...EEGKER...PLVLRNKAPRWHEQLQCWCLNFRGR......VTVASVKNF......
W5EQP4_WHEAT/117-434.......GGPAIRGQAL..SDG...EDSKDT...PLILRNKVPRWHEQLQCWCLNFRGR......VTVASVKNF......
D7FYS0_ECTSI/361-593..................................MFLLQSREPTYTK..GNYRLNFHGR......VTVPSVKNF......
D7FYT0_ECTSI/243-552..................................LLIFHQRESRY.DPLSSCLVDYRGR......ATAPSVKNF......
F6RL90_CIOIN/49-290..................................LIELSNKTPVWNEETQSYVLNFRGR......VTQASVKNF......
I1PX84_ORYGL/116-366...................................LALRNKAPRWHEHLQCWCLNFHGR......VTVASVKNF......
I1I0A3_BRADI/123-441........V......QQDEEDG....EAKEK...PLVLRNKVPRWHEQLQCWCLNFRGR......VTVASVKNF......
U5G686_POPTR/104-386.........................S.QREG...ALVLKNKAPRWHEQLQCWCLNFHGR......VTVASVKNF......

PF03803

PLS3_HUMAN/62-284--------------------------------------------------------------------------------
PLS4_HUMAN/100-322--------------------------------------------------------------------------------
Q9NAE9_CAEEL/48-258--------------------------------------------------------------------------------
Q21318_CAEEL/74-284--------------------------------------------------------------------------------
Q9VZW1_DROME/42-263--------------------------------------------------------------------------------
YIP6_SCHPO/58-304--------------------------------------------------------------------------------
PLS1_HUMAN/86-307--------------------------------------------------------------------------------
AIM25_YEAST/59-310--------------------------------------------------------------------------------
Q9SI32_ARATH/150-379--------------------------------------------------------------------------------
O45799_CAEEL/51-280--------------------------------------------------------------------------------

PF04525

LOR14_ARATH/16-196--------------------------------------------------------------------------------
LOR3_ARATH/29-209--------------------------------------------------------------------------------
LOR7_ARATH/7-145--------------------------------------------------------------------------------
LURP1_ARATH/5-186--------------------------------------------------------------------------------
LOR11_ARATH/36-222--------------------------------------------------------------------------------
D6ENB3_STRLI/2-152--------------------------------------------------------------------------------
LOR4_ARATH/7-183--------------------------------------------------------------------------------
L8AWG7_BACIU/1-148--------------------------------------------------------------------------------
LOR5_ARATH/4-186--------------------------------------------------------------------------------
LOR12_ARATH/18-197--------------------------------------------------------------------------------
Q97Q47_STRPN/1-153--------------------------------------------------------------------------------
LOR17_ARATH/24-215--------------------------------------------------------------------------------
LOR15_ARATH/25-206--------------------------------------------------------------------------------
LOR8_ARATH/10-188--------------------------------------------------------------------------------
LOR6_ARATH/2-180--------------------------------------------------------------------------------
LOR13_ARATH/13-175--------------------------------------------------------------------------------

PF01167

G0QXR5_ICHMG/270-502.QLI.....DEN.............................................................ND.....
E4XRC9_OIKDI/84-325.QIT.....ESD.............................................................NP.....
M4BSN8_HYAAE/388-632.LLS.....HPH.............................................................DM.....
M0SAD5_MUSAM/110-361.QLVA....AVD.......PSFGVSLA..............................................EQ.....
M4AUK7_XIPMA/179-416.QIV.....HNK.............................................................DL.....
W1NGY4_AMBTC/30-320.QLVA....AVE.......PSHPISMA..............................................EQ.....
G7YSE7_CLOSI/527-800.QII.....HES.............................................................DL.....
S2K614_MUCC1/46-291.QIV.....HDN.............................................................DL.....
C1FIJ1_MICSR/334-589.QLVD....ECD.............................................................ED.....
A9TE85_PHYPA/123-416.QLVA....SME.......SLPTSSQS..............................................DR.....
A0EG93_PARTE/216-448.QLV.....KPN.............................................................NH.....
Q22Y91_TETTS/368-602.QLI.....DDQ.............................................................ND.....
TLP7_ARATH/108-372.QLVA...........TVDQSQPSGKG..............................................DE.....
J3M9P3_ORYBR/81-337.QLVA...........AADPSHPDSVG..............................................DE.....
D7KMY6_ARALL/120-422.QLVS....A.AT..VQPGA....GAL.........TT..SVSSQKQGQP.......................DH.....
J3MPK4_ORYBR/123-441.QLIA.......A..PPPAAASAESSQ........PE.....QQQQQNQP......................SDH.....
I1IN97_BRADI/117-439.QLTA....A..A..ALPAAGALTPPHPAE.....PA............P..................PPP.PEH.....
H2ZV03_LATCH/267-506.QII.....HPN.............................................................DP.....
H0WAT2_CAVPO/269-510.QII.....YPN.............................................................KP.....
B3SBY7_TRIAD/1-241.QVV.....HDN.............................................................DV.....
F1PNR7_CANFA/215-456.QIV.....HDN.............................................................DP.....
K3Z6B7_SETIT/115-432.QLIACVAQAAAA..RASAPPGQTQPQ...........................................ASSSH.....
TULP2_MOUSE/315-556.QIV.....HPD.............................................................EP.....
B9GRM5_POPTR/121-410.QLVA....AVE.......PCQNVPVE..............................................EQ.....
M0RYY8_MUSAM/119-400.QLVA....SEEN..GSSN.......Q..............................................EE.....
F4NT32_BATDJ/88-310.QIV.....HDH.............................................................DL.....
M7YZS2_TRIUA/159-501.QLIA....APAP..PPPASGGEAAPE........PSLQPQPP...QQQPTSATAQPQPAGSSLSASSSSSSSHH.....
TLP1_ARATH/121-449.QLIA....ANQP..QPQPQPQPQPQPLTQ.....PQ............P..................SGQTDGP.....
C5X4V0_SORBI/116-393.QLVA....SGES..DLNN.......Q..............................................GD.....
K3WG02_PYTUL/293-540.QLIN....TED.............................................................PS.....
C1N1L4_MICPC/293-551.QLCDVNAGDGE.............................................................DD.....
W1PSZ7_AMBTC/113-431.QLIA....AVEP..PTTSEPAPPPAT..........................................TGSSDH.....
A9TFU9_PHYPA/122-419.QLVA....ATTS..STTTTPTS.SGS..............................................DH.....
K4AAU1_SETIT/114-394.QLVA....SEDN..GSGN.......Q..............................................EN.....
B9R7W3_RICCO/118-407.QLVA....AID.......PSQNVPAE..............................................EQ.....
K4CGS2_SOLLC/123-379.QLVA...........TMDQSQPDGKG..............................................DE.....
G0QPZ2_ICHMG/56-278.QIY.....MEN.............................................................DL.....
D8SG45_SELML/128-419.QLVA....ATE.......IGQPPQPS..............................................DP.....
TLP7_ORYSJ/120-456.QLIA......AA..PQPSSGAASEPS...........QAGQAAQQQTQP...........SQPSSSSSSSSSNH.....
TLP1_ORYSJ/99-349.QLVA...........AADPNDPASSK..............................................DE.....
A0BWZ4_PARTE/130-363.ILIS....NNQQ............................................................ND.....
L9L384_TUPCH/349-587.QIV.....HAD.............................................................DP.....
K3ZU09_SETIT/112-390.QLVA....SGESAPTPSN.......Q..............................................ED.....
F6TZP0_XENTR/258-499.QII.....SPE.............................................................DP.....
A9SPK2_PHYPA/122-414.QLVA....ATD.......LPPTNSQN..............................................DH.....
J3M7K2_ORYBR/123-439.QLIA....A..S..AQPPAGAPTPSQ........PA............P....................S..EQ.....
I1J3P3_BRADI/123-449.QLIA......GA..PLPAPVASSEPS...........QPAPA....QQP...........AQPQPSSSSSSSSH.....
M0SFG0_MUSAM/119-397.QLVA....SDEI..GSVS.......Q..............................................EQ.....
C5XQM9_SORBI/123-474.QLIA....A..T..TPPPAGAPTPSQ........PA............P....................S..DP.....
I1NRS9_ORYGL/1-249.QLIA...........PVEPGEP..................................................SD.....
A0DNS7_PARTE/64-294.LLNQL...................................................................KEDDRLS
I1LHT6_SOYBN/119-408.QLVS....AVD.......PSHNVSAA..............................................EQ.....
M4DW60_BRARP/89-338.QLVA....V.........GDRETEQA..............................................TS.....
F4HT64_ARATH/132-406.QLVA....AAA....EAGKNMNIPEE..............................................EQ.....
I1M8B1_SOYBN/124-417.QLVA....AAE.......PCQNVSAA..............................................EQ.....
I1R4B9_ORYGL/123-439.QLVA....A..T..Q.PAAGAPTPSQ........PA............P..................PPP.PDH.....
I1JFG1_SOYBN/112-394.QLVA....SPKN..GVSE.......Q..............................................AQ.....
F6H054_VITVI/120-410.QLVA....AVE.......PCQNVSVA..............................................EQ.....
M1B9A0_SOLTU/117-404.QLVA....AVA.......PPHNIPAA..............................................EQ.....
K4BFS0_SOLLC/118-400.QLVA....AVD.......PSHNIPAA..............................................VQ.....
H3GWQ0_PHYRM/600-881.QLVHSEPTNEQMREQYRKNYPDFLYEDQ............................................GTVSLPQ
F0YIF3_AURAN/571-870.QLVKSSPVEDHMKKEYFAPGGEGARE..............................................NPNPDAA
D8R328_SELML/134-424.QLVA....ALE........PGQQAHA..............................................DH.....
K3YSM4_SETIT/134-423.QLVA....SVD.......PSLNVPAA..............................................EQ.....
W1PZG2_AMBTC/117-478.QLIA....ATDA..VPTGGLGPVQPI............................AVGSTMGTTGPLPVQPPNEQ.....
M3XWI0_MUSPF/313-554.QIV.....HPD.............................................................DP.....
D8UHI1_VOLCA/195-429.QLV.....SDD.............................................................NH.....
M4EBC2_BRARP/149-382.QLT.....LTE.............................................................NS.....
W4XBT8_STRPU/232-473.QIV.....HDN.............................................................DL.....
M4FID3_BRARP/111-391.QLMA....AAA....EAGKDMNIPEE..............................................EQ.....
F6GWV6_VITVI/118-407.QLVA....SVE.......PSHNVSAV..............................................EQ.....
E1ZRT4_CHLVA/5-242.QLV.....SVD.............................................................NM.....
W5GHE7_WHEAT/78-314.QMT.....LEE.............................................................NG.....
E9HFS8_DAPPU/11-241.QLV.....HED.............................................................DA.....
K3Z7I3_SETIT/92-345.QLVA...........TADPTHPDSAG..............................................DD.....
G3RQT8_GORGO/194-436.QIV.....HKN.............................................................DP.....
A9SFN2_PHYPA/268-494.QLV.....PDL.............................................................DK.....
D8R0N5_SELML/71-351.QLVA....AAD......QPPAPVCQG..............................................EQ.....
D2VAC3_NAEGR/225-455.QLV.....EPN.............................................................NP.....
U6HW68_ECHMU/466-723.QLI.....DNG.............................................................DE.....
D7LYF8_ARALL/105-385.QLVA....AAAA..SGGGGTGLSPER..............................................QN.....
B9S6E9_RICCO/119-408.QLVA....AVG.......PSHNVPAA..............................................EQ.....
K4BTD6_SOLLC/117-420.QLIA....A..T...QRAASAPTPAQ........PA............Q..................SSS..DQ.....
TLP9_ARATH/98-374.QLVA....VSDC..EAG........Q..............................................TS.....
TULP2_HUMAN/279-520.QIV.....DPK.............................................................HQ.....
C5Y569_SORBI/117-450.QLVA....AVMT..Q.PAVGAPTPSQAAPLPLPAPA............P..................GPPLPDQ.....
TLP10_ARATH/123-439.QLVA....ARQP..QPQGTGAAAAPT........SA............P....................AHPEQ.....
B9HF20_POPTR/119-410.QLVA....AVE.......SFHNVSSA..............................................DQ.....
H2UUG1_TAKRU/220-462.QIV.....HDN.............................................................DP.....
M7YYC1_TRIUA/164-457...................................PG............P....................V..DP.....
H9GP51_ANOCA/382-623.QII.....AED.............................................................NP.....
A0DFE0_PARTE/648-881.QLI.....VDN.............................................................KE.....
D7G017_ECTSI/222-546GNLV.....................................................................MEQDFGE
M0T5F2_MUSAM/105-356.QLVA....AVV.......PSYGVSPE..............................................EQ.....
K3YHL3_SETIT/122-443.QLIA.......A..PQLDAVPSESSQ...................QAQP................SSSSSASDH.....
T1G0S1_HELRO/9-246.QIV.....HDN.............................................................DV.....
C3ZNP4_BRAFL/69-310.QIV.....HDN.............................................................DP.....
M1APY8_SOLTU/99-381.QLVA....SPEN..GAAG.......P..............................................EH.....
I1GRC6_BRADI/110-376.QLVP....SDES..APTN.......H..............................................EL.....
A7SD12_NEMVE/2-243.QIV.....HDS.............................................................DV.....
D8RN05_SELML/30-264.QLT.....VED.............................................................QG.....
TUB_RAT/257-499.QII.....HGN.............................................................DP.....
F7FA58_CALJA/208-448.QIM.....HPK.............................................................DP.....
K7U427_MAIZE/53-379.QLIA.......A..PQLDSEPSQQAQ..................QQTQP................SNSSSASDH.....
W5KLH5_ASTMX/308-549.QIV.....HPD.............................................................NE.....
K3ZLR9_SETIT/117-436.QLVA....A..T..Q.PAAGAPTPSQ........PA............P..................APAL.DQ.....
K1RHW3_CRAGI/170-406.QIV.....HDN.............................................................DV.....
K3WRQ8_PYTUL/367-602.QLV.....TPE.............................................................DQ.....
M0RRJ1_MUSAM/117-379.QLIE....A.....TQPAASHPSPL...............................................EQ.....
D8TVK7_VOLCA/158-460.QLVHWDHNTDR.............................................................KG.....
W1NPG7_AMBTC/119-376.QLVA...........SVDPSQPGARG..............................................DD.....
C6T8I4_SOYBN/79-355.QLAV....SPEN..GHAG.......L..............................................QE.....
G4VQP4_SCHMA/265-505.QIV.....HRS.............................................................DD.....
E5SUB8_TRISP/231-466.QII.....HAN.............................................................NP.....
D7T6J6_VITVI/62-344.QLVA....SPED..GPAG.......Q..............................................QH.....
K3XJ41_SETIT/116-363.QLIA...........PAGTGEPWGVQ..............................................DD.....
B9I1T1_POPTR/116-372.QLVA...........TMDQSQPGGRG..............................................DE.....
J3N6A6_ORYBR/117-435.QLIA....A..T..Q.PAAGAPTPSQ........PV............P..................PPP.PEH.....
F1P3K2_CHICK/115-352.QIV.....HGS.............................................................DP.....
D7FIT4_ECTSI/26-286.QLV.....STE.............................................................DF.....
A0DMD6_PARTE/263-494.LLKQS...................................................................NDDGKLN
M1CWX7_SOLTU/117-421.QLIA....A..T...QQPAAAPTTSQ........PT............S...................QS..DH.....
E4X5I6_OIKDI/256-497.QII.....HEK.............................................................EP.....
B8C979_THAPS/14-256.QMV.....EES.............................................................NP.....
M4FEU8_BRARP/112-371.QLVA....DID.......PSLDALPE..............................................EH.....
C4J4R4_MAIZE/117-430.QLVA....A..T..Q.PAAGAPTPSQ.........A............T..................PVP.PEH.....
D7FSI7_ECTSI/103-375.QLVV....ADDHARGYIGGDNNQRNVVWEDRRPGNISQRRRGWDVDGREQRGEWW.................AQ.....
K3X0N8_PYTUL/565-829.QLVHSEPTNEQMKDKYKKLHPEFVYEDQ............................................GTVSLPQ
K0S854_THAOC/488-735.QLL.....................................................................NG.....
TLP3_ARATH/116-400.QLVA....APEN..GPAG.......P..............................................EH.....
M0THC4_MUSAM/33-288.QLVA..............SSNPNRAG..............................................DGAVDVY
K4BB27_SOLLC/117-405.QLVA....AVD.......PSHNIPVA..............................................EQ.....
U5CU96_AMBTC/119-415.QLVAATSSSSEN..GNGNGNGNTNSH..............................................DS.....
H9JIE3_BOMMO/143-380.QIV.....HDS.............................................................DP.....
T1JB91_STRMM/42-280.QVV.....HDN.............................................................DV.....
D2A282_TRICA/154-394.QIV.....HDS.............................................................DV.....
M0SJG0_MUSAM/62-313.QLVA...........TADANHPSGIG..............................................DG.....
U1M828_ASCSU/3-244.QIV.....HDA.............................................................DP.....
I1JCN8_SOYBN/119-408.QLVA....AVD.......PSHNISAE..............................................EQ.....
TLP5_ARATH/119-423.QLMS....A.AT..VQPGSGSDGGAL.........ATRPSLSPQQPEQS.......................NH.....
F6HQ19_VITVI/117-399.QLVA....SAEN..GVAG.......Q..............................................EH.....
A8ISI1_CHLRE/224-484.QLVHWDHNTDR.............................................................KG.....
F0XZM0_AURAN/13-250.QLV.....QPD.............................................................DQ.....
TUB1_CAEEL/174-420.QII.....HQS.............................................................SP.....
M0TYP5_MUSAM/117-422.QLIA....A..I...QPSAGVPTPSQ........SV............P....................P..EH.....
M4E7K8_BRARP/119-432.QLVA....ARQP..PTQGAAAAAPSH.............................................PEQ.....
TULP_DROSE/202-437.QLV.....HDS.............................................................DP.....
M0SK32_MUSAM/62-312.QLVA...........TADASQPSGIG..............................................DE.....
TLP11_ORYSJ/119-400.QLVA....SDES..NPTN.......Q..............................................EH.....
B9H7S3_POPTR/117-417.QLIA....A..T...QPAAGAPTPSQ........PV............Q....................S..DH.....
W5EQP4_WHEAT/117-434.QLTA....A..V..Q.PAAGAPTPPH........PA............P..................APP.PEH.....
D7FYS0_ECTSI/361-593.QLV.....SPD.............................................................DA.....
D7FYT0_ECTSI/243-552.QLLKSPPEDNVKRARYFSEGGGKND...............................................VESDDIP
F6RL90_CIOIN/49-290.QIV.....HQS.............................................................DP.....
I1PX84_ORYGL/116-366.QLVA...........PAGTSDPWGIA..............................................DE.....
I1I0A3_BRADI/123-441.QLTS.......A..LQPSVASSESSQ........P......PQQQQTQP...............SSSSSSTSDH.....
U5G686_POPTR/104-386.QLVV....SPEN..GPAG.......P..............................................EH.....

PF03803

PLS3_HUMAN/62-284GGLVREALT---DADDFGLQFPL...........................DLDVRVKAVLLGATFLIDYMFFEK
PLS4_HUMAN/100-322NGLLS.AMA---DADHFDIHFPL...........................DLDVKMKAMIFGACFLIDFMYFER
Q9NAE9_CAEEL/48-258PGYMQEMYS---DADTYIVHFPM...........................DLPPILKLLLISSVFLIDFTFFEN
Q21318_CAEEL/74-284PGFMQEMFT---DADTYIVHFPM...........................DMPPILKLLLVTSVFLIDFTYFED
Q9VZW1_DROME/42-263SGLGRELFT---DADYFSVTFPL...........................NLDVRMKALIFAALFLIDAVYYEQ
YIP6_SCHPO/58-304MGLPREFFT---DTGNYVLRFTSTSAANGSVNENQLLQAAHGIANDVCARDMSLEERAVMLGSAVTIDFDYFSR
PLS1_HUMAN/86-307TGILREAFT---DADNFGIQFPL...........................DLDVKMKAVMIGACFLIDFMFFES
AIM25_YEAST/59-310VGLGREMFT---DTGVYVVRFDSQRCFDNIY...........PTEMLSSQVLTLDQRAVLLANAVSIDFDYFSR
Q9SI32_ARATH/150-379RGFGFEIFT---DAGQYVIRFGKADAAAKTGPA.......TLVEELEVKRPLTLSERAVVLTLAISLDNDYFSR
O45799_CAEEL/51-280GGCFREAFT---DADTFAVNFPG...........................DLDVKLKGVLIGATFLIDFMEFEQ

PF04525

LOR14_ARATH/16-196FT.WGSFCK---GKYNFKV.------------------------------RVNPEVDYAFIIALLVM-------
LOR3_ARATH/29-209LSDISGLDL---GDDVLTM.------------------------------MVEPQLDHSLIMGIVIA-------
LOR7_ARATH/7-145.........---........------------------------------...............LM-------
LURP1_ARATH/5-186QT.MRGFFF---GKDHFSV.------------------------------TVDKNVDYAFIASLIVI-------
LOR11_ARATH/36-222QS.INGLKL---GDDVLTM.------------------------------MVESQVDHSFIIGLVLA-------
D6ENB3_STRLI/2-152...SRRWLT---LRDTYGVD------------------------------VVRDDADPALLIALTVC-------
LOR4_ARATH/7-183QS.SNGITL---GEDVLTL.------------------------------EVKPRVDHSLVVTLVTV-------
L8AWG7_BACIU/1-148......WLS---WGDSYHL.------------------------------QIAYEEDVLICTAIAIV-------
LOR5_ARATH/4-186VDASTNVML---GKDVFSL.------------------------------NVKPGFDGAFAMGLVLV-------
LOR12_ARATH/18-197VDASTNVML---GRDVFTL.------------------------------EIKPGFDGAFAMGLVVV-------
Q97Q47_STRPN/1-153....KELFH---LTSTYTV.------------------------------TVLEDAYADLVISLCVA-------
LOR17_ARATH/24-215EVRTKGVRF---GSDVFDL.------------------------------VVNPGFDTGLAMALVLL-------
LOR15_ARATH/25-206HT.VQSVFL---GKDNFSV.------------------------------TVYPNVDYAFIASLVVI-------
LOR8_ARATH/10-188ETVIGGVAF---GKDVYKL.------------------------------IVESEMEPRVAMALTII-------
LOR6_ARATH/2-180......WIG---SRDIYKV.------------------------------VTKPSVDKAFVFGVIAV-------
LOR13_ARATH/13-175.......YE---GHERLVA.------------------------------TIYPNVDYAFIVTLIFI-------

PF01167

G0QXR5_ICHMG/270-502ENIFLQFGRI..GEDAFNL-------------------------------DVQYPFSILQAFGICLSSFD----
E4XRC9_OIKDI/84-325QSTIMQFGRI..RNDNFTM-------------------------------DYRYPLSAVQAFGIALSSFD----
M4BSN8_HYAAE/388-632DKTLMLFGRT.EDCQVYSM-------------------------------DYAHPFTPVQAFAIALSSMD----
M0SAD5_MUSAM/110-361EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLTTFD----
M4AUK7_XIPMA/179-416DYIVMQFGRI..ADDIFTL-------------------------------DYNYPMCAVQAFAIALSSFD----
W1NGY4_AMBTC/30-320DKVILQFGKI..GRDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
G7YSE7_CLOSI/527-800NYIIMQFGRV..AEDEFTM-------------------------------DYSYPMCALQAFGIALSSFD----
S2K614_MUCC1/46-291DYIVMQFGRV..ERDSFTM-------------------------------DYKYPMCLLQAFSIALTSFD----
C1FIJ1_MICSR/334-589ERVVLQFGKV..GKDMFTM-------------------------------DFQWPMSALQAFAICLTSFD----
A9TE85_PHYPA/123-416DKVLLQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
A0EG93_PARTE/216-448QFIHLQFGRV..DDLLFNL-------------------------------DFCYPLSPLQAFQICVTSFD----
Q22Y91_TETTS/368-602EMILLQFGRV..GDDAFNM-------------------------------DVMHPLSLVQAFGICLSSFD----
TLP7_ARATH/108-372ETVLLQFGKV..GDDTFTM-------------------------------DYRQPLSAFQAFAICLTSF.----
J3M9P3_ORYBR/81-337ETVVLQFGKV..DNDIFTM-------------------------------DYLQPLSAFQAFAICLSSF.----
D7KMY6_ARALL/120-422DEMILQFGKV..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
J3MPK4_ORYBR/123-441DKVILQFGKV..AKDMFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
I1IN97_BRADI/117-439DKVILQFGKV..AKDMFTM-------------------------------DYRYPLSAFQAFAISLSCFN----
H2ZV03_LATCH/267-506EYIVMQFGRV..ADDVFTM-------------------------------DYKYPLCTLQAFAITLSSFD----
H0WAT2_CAVPO/269-510DKVVLQFGRM..GPDTFTM-------------------------------DFCFPLSPLQAFAICLSSFD----
B3SBY7_TRIAD/1-241DYIIMQFGRV..SEDAFTM-------------------------------DYKYPLSALQAFAISLSSFD----
F1PNR7_CANFA/215-456DYIVMQFGRV..ADDVFTL-------------------------------DYNYPLCALQAFAIGLSSFD----
K3Z6B7_SETIT/115-432DTVILQFGKV..ARDMFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
TULP2_MOUSE/315-556DHLVLQFGRV..APNIFTM-------------------------------DFRYPLCPLQAFAICLSSFD----
B9GRM5_POPTR/121-410EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
M0RYY8_MUSAM/119-400EKVILQFGKV..GKDLFTM-------------------------------DYCYPISAFQAFAICLSSFD----
F4NT32_BATDJ/88-310EYIVIQFGKV..SDDTFTM-------------------------------DVQYPFSLVAAFGVVLTRF.----
M7YZS2_TRIUA/159-501DTVLLQFGKV..SKDTFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
TLP1_ARATH/121-449DKIILQFGKV..GKDMFTM-------------------------------DFRYPLSAFQAFAICLSSFD----
C5X4V0_SORBI/116-393DDVILQFGKV..GKDLFTM-------------------------------DYRYPISAFQAFAICLSSFD----
K3WG02_PYTUL/293-540MGNILQFGRV..ADDMFTM-------------------------------DFQWPLSPFQAFAICLSSCD----
C1N1L4_MICPC/293-551GPTILQFGKV..GKDVFTM-------------------------------DYAYPMSALQAFGICMTSFD----
W1PSZ7_AMBTC/113-431DKILLQFGKI..GKDLFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
A9TFU9_PHYPA/122-419DKVLLQFGKI..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
K4AAU1_SETIT/114-394DKVILQFGKI..GKDLFTM-------------------------------DYRYPISAFQAFAICLSSFD----
B9R7W3_RICCO/118-407EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
K4CGS2_SOLLC/123-379DTVILQFGKV..GDDVFTM-------------------------------DYRKPLSAFQAFAICLTSF.----
G0QPZ2_ICHMG/56-278NNIVLQIGKD..KENEFNI-------------------------------DVKYPFSIFQAYAIALYQFD----
D8SG45_SELML/128-419DNVILQFGKI..GKDTFTM-------------------------------DYRYPLSAFQAFAISLSSFD----
TLP7_ORYSJ/120-456DTVILQFGKV..AKDMFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
TLP1_ORYSJ/99-349ETVLLQFGKV..DDNIFTM-------------------------------DYRQPLSAFQAFAISLSSF.----
A0BWZ4_PARTE/130-363EEFLIQFGKC..GEEYYNL-------------------------------DICHPLSILQAFALCITQFE----
L9L384_TUPCH/349-587DYIVLQFGRV..AEDAFTL-------------------------------DYRYPLCALQAFAIALSSFD----
K3ZU09_SETIT/112-390DDVILQFGKV..GKDLFTM-------------------------------DYRYPISAFQAFAICLSSFD----
F6TZP0_XENTR/258-499EYIIMQFGRV..AEDVFTM-------------------------------DFQYPLCALQAFSICLSSFD----
A9SPK2_PHYPA/122-414DKVLLQFGKI..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
J3M7K2_ORYBR/123-439DKIILQFGKV..AKDMFTM-------------------------------DYRYPLTAFQAFAICLSSFD----
I1J3P3_BRADI/123-449DTVLLQFGKV..SKDTFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
M0SFG0_MUSAM/119-397EKVILQFGKV..GKDLFTM-------------------------------DYSYPISAFQAFAICLSSFD----
C5XQM9_SORBI/123-474DKVILQFGKV..ARDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
I1NRS9_ORYGL/1-249ETVVLQFGKI..DDDVFTM-------------------------------DYRQPLSAFQAFAICLSNF.----
A0DNS7_PARTE/64-294KDIAIQFGKC..DNKLLNI-------------------------------DIAYPFTPLQAFSIIISQLD----
I1LHT6_SOYBN/119-408EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
M4DW60_BRARP/89-338ERIILQFGKV..GKDMFTM-------------------------------DYGYPISAFQAFAICLSSFE----
F4HT64_ARATH/132-406DRVILQFGKI..GKDIFTM-------------------------------DYRYPISAFQAFAICLSSFD----
I1M8B1_SOYBN/124-417EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
I1R4B9_ORYGL/123-439DKVILQFGKV..AKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
I1JFG1_SOYBN/112-394ENVILQFGKV..GKDVFTM-------------------------------DYQYPISAFQAFAICLSSFD----
F6H054_VITVI/120-410EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
M1B9A0_SOLTU/117-404EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAYQAFAICLSSFD----
K4BFS0_SOLLC/118-400ETTILQFGKI..GKDIFTM-------------------------------DYCYPLSAFQAFAICLSSFD----
H3GWQ0_PHYRM/600-881EHVLLQLGKV..GKDCFNM-------------------------------DFQYPLSMLQAFAISLSRFD----
F0YIF3_AURAN/571-870QPIILQMGKV..GKNCFNM-------------------------------DYQFPMSMLQAFATCIARFD----
D8R328_SELML/134-424DKVLLQFGKI..GKDMFTM-------------------------------DYRYPLSAFQAFGICLSSFD----
K3YSM4_SETIT/134-423EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
W1PZG2_AMBTC/117-478ERITLQFGKV..GKDLFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
M3XWI0_MUSPF/313-554DYLVLQFGRV..APDTFTM-------------------------------DFRFPLCPLQAFAICLSSFD----
D8UHI1_VOLCA/195-429NHIILQFGKV..GKDSFTM-------------------------------DYQWPISAFQAFAICMSSFD----
M4EBC2_BRARP/149-382RQTILQMGRV..DKAKYVI-------------------------------DFRYPFSGYQAFCICLASID----
W4XBT8_STRPU/232-473DYIIMQFGRV..GEEVFTM-------------------------------DYSYPLCAVQAFGITLSSFD----
M4FID3_BRARP/111-391ERVILQFGKI..GKDTFTM-------------------------------DYRYPISAFQAFAICLSSFD----
F6GWV6_VITVI/118-407DKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
E1ZRT4_CHLVA/5-242ERTILQFGKV..ADDVFTM-------------------------------DYSYPMTALQAFGICLSSF.----
W5GHE7_WHEAT/78-314RQTILQLGRV..GKSKYIM-------------------------------DFRYPLTGYQAFCICLASMD----
E9HFS8_DAPPU/11-241DYIVMQFGRV..AEDVFTM-------------------------------DFRYPMCAVQAFAVALSSFD----
K3Z7I3_SETIT/92-345ETVLLQFGKV..DTDIFTM-------------------------------DYWRPLSAFQAFAICLSSF.----
G3RQT8_GORGO/194-436DYIVMQFGRV..ADDVFTL-------------------------------DYNYPLCAVQAFGIGLSSFD----
A9SFN2_PHYPA/268-494ETVILQFGKS..GRNLFTM-------------------------------DYQHPMSALQS.........----
D8R0N5_SELML/71-351DKVLLQFGKI..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
D2VAC3_NAEGR/225-455NKVFLQFGKV..DEDRFNI-------------------------------DFKYPLTALQAFSIAISSFD----
U6HW68_ECHMU/466-723STILMQFGRV..ASDIFTM-------------------------------DYTYPLTALQAFGIAISSL.----
D7LYF8_ARALL/105-385ERIILQFGKV..GKDMFTM-------------------------------DYGYPISAFQAFAICLSSFE----
B9S6E9_RICCO/119-408EKVILQFGKI..GKDIFTM-------------------------------DYCYPLSAFQAFAICLSSFD----
K4BTD6_SOLLC/117-420DKIILQFGKV..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
TLP9_ARATH/98-374ERIILQFGKV..GKDMFTM-------------------------------DYGYPISAFQAFAICLSSFE----
TULP2_HUMAN/279-520EHLVLQFGRV..GPDTFTM-------------------------------DFCFPFSPLQAFSICLSSFN----
C5Y569_SORBI/117-450EKVLLQFGKV..GKDIFTM-------------------------------DYCYPLSAFQAFAICLSSFD----
TLP10_ARATH/123-439DKVILQFGKV..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
B9HF20_POPTR/119-410ERVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
H2UUG1_TAKRU/220-462DYIVMQFGRV..AEDIFTL-------------------------------DYNYPMCALQAFAIGLSSFD----
M7YYC1_TRIUA/164-457EKVILQFGKV..ARDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
H9GP51_ANOCA/382-623DYIVLQFGRV..ASNVFTM-------------------------------DYQFPLCALQAFAICLSSFD----
A0DFE0_PARTE/648-881DNILLQFGRV..GDDLFNL-------------------------------DFQYPITPLQAFQIALTSFD----
D7G017_ECTSI/222-546GKVHIRHGKM..SKSRFSV-------------------------------DFRHPVSPIVALGVCCSTF.----
M0T5F2_MUSAM/105-356EKVILQFGKI..GKDIFTM-------------------------------DYRYPLSAFQAFAICLTSFD----
K3YHL3_SETIT/122-443DKVILQFGKV..AKDMFTM-------------------------------DYRYPLSAFQAFTICLTSFD----
T1G0S1_HELRO/9-246DYIVMQFGRV..SDETFTM-------------------------------DYAYPMCALQAFGIALSSFD----
C3ZNP4_BRAFL/69-310EYIVMQFGRV..AEDVFTC-------------------------------DYNYPLCAVQAFSVALSSFD----
M1APY8_SOLTU/99-381EKVILQFGKV..GKDMFTM-------------------------------DYRYPLSAFQAFAICLSSFD----
I1GRC6_BRADI/110-376DDATLQFGKI..GKDMFSM-------------------------------DYRYPLSAFQAFAICLSSFD----
A7SD12_NEMVE/2-243DYIIMQFGRV..AEDVFTM-------------------------------DYNYPMCAVQAFAIALSSFD----