Sequence alignment for CL0396

PF04535

CSPL4_VITVI/42-189HKLFLGAHICLRILT---VTAT--LTAAWMMITSK------------------------------QTVEVY.........
A2XND4_ORYSI/2-138EPAAARARLLLRAVA---WLFS--LLALVVMASNK------------------------------H..............
CSPL6_ORYSI/22-174KDKLITLQPVVRACV---FLAT--AVAAVIMGLNK------------------------------QSYTTVVAIV....G
CSPL8_VITVI/27-183RSVGSSSEFVLRILG---LLLT--LIAAVVAGVDK------------------------------QTKIIPLTLIK...T
CSPL3_VITVI/15-155IPTLKLIDCSLRLCV---IPLS--VATIWLTVTNQ------------------------------QDNSIY.........
CSPL9_ORYSJ/22-162AAPFRLAELGLRVCA---VPLA--VASVWEMATNK------------------------------QVDETY.........
CSPL3_ORYSI/14-150STADIAVDVSLRLLA---AATS--LASAVVVAANH------------------------------QQ.............
CSPLO_ARATH/21-177SGSRKGLELTMRVLA---LVLT--MVAATVLGVAK------------------------------QTKVVPIKLIP...T
CASP1_STRAF/38-187KRGVSIFDLILRISA---ATAA--LAATIVMGTTE------------------------------QTLPFFT........
A2YQ71_ORYSI/48-177DDGLDGIVLVLRAAA---ALLA--LVAMALVASCR------------------------------HG.............
CSPL7_ARATH/24-174DRKVRVTELILRCLV---CVLA--LVAAILIATDV------------------------------QVREIF.........
CSPLV_ARATH/116-252ASLIRKALLGFRVIA---FVSC--LVSFSVMVSDR------------------------------D..............
CSPLX_ARATH/26-166PMSLKIIDSCLRLSV---VPLS--VATIWLTVTNH------------------------------ESNPDY.........
CSPLS_ARATH/1-147MVKLRETEVILRLCI---VFFL--LLTSCLIGLDS------------------------------QTKEIA.........
CSPL1_VITVI/23-179KAKHDQIVLVLRVVA---FLAT--ASATIVMGLNQ------------------------------ETKTLLVGTI....G
CSPL3_ARATH/27-169SLGIRTAETMLRLAP---VGLC--VAALVVMLKDS------------------------------ETNEF..........
CSPLM_ARATH/23-176TKSCSMTQVVLRFVL---FAAT--LTSIVVMVTSK------------------------------QTKNIFLP.......
CSPLY_ARATH/143-279DDLVSLTALGFRITE---VILC--VISFSIMAADK------------------------------T..............
A2ZVW2_ORYSJ/198-313VGERRTTSVALRVAT---AVLS--LVSFALMVSAR------------------------------T..............
CASP1_ORYSI/21-170NRAVAVVDTFLRFIA---IIGT--IGSAIAMGTTN------------------------------ETLPFFT........
Q38HU1_SOLTU/29-159GMPGTLGSLFLRLCQ---FVFA--VISICVMVTTS------------------------------D..............
A5BVF2_VITVI/6-137GALGTSASLSLRMGQ---TIFS--SAALLFMCLDV------------------------------E..............
CASP3_ARATH/56-205KRGVAIFDFVLRLIA---AITA--MAAAAKMATTE------------------------------ETLPFFT........
CSPL6_VITVI/25-170QMGFFIAQVVLRFFT---LAFT--GAAIAVMVTAK------------------------------ETVEVF.........
CSPLL_ARATH/49-190RASVHVIGLVLRFIT---MVLC--FVSALSLAVNV------------------------------QRPSKR.........
CASP2_ARATH/40-189NRGLAIFDFLLRLAA---IVAA--LAAAATMGTSD------------------------------ETLPFFT........
A5C3N9_VITVI/6-139GISLARAEAFLRLFA---ILVL--VLTACLLGFDT------------------------------QTKLLF.........
CASP1_VITVI/37-186KRGLAIFDFILRLSA---IGAA--LAATTTMGTTD------------------------------QTLPFFT........
CASP1_ARATH/42-191KRGLAIFDFLLRLAA---IAVT--IGAASVMYTAE------------------------------ETLPFFT........
CSPLR_ARATH/11-155PLLNLGVQVSMRVLT---IGAA--MASMWVMITNR------------------------------EVASVY.........
CSPLP_ARATH/5-155DRRMRLTELLLRCSI---SVFA--LLALILVVTDT------------------------------EVKLIF.........
CSPL1_SOLDE/21-170NRGISVFDLVLRIVA---LVGT--LASAVAMGTAD------------------------------QALSFST........
CSPL5_ARATH/17-172KGIKELVQVALRGGC---LAAS--ATAMAVMLTAT------------------------------EEGVADIY.......
CASP2_VITVI/45-194KKGLAIFDFLLRLAA---IAAT--LAAATTMGTTD------------------------------ETLPFFT........
CSPL5_VITVI/24-179GGKLRPFDLVLRVVA---LALT--LVAAVLLGVDK------------------------------QTKVVSLQLLP...T
A2Y3F2_ORYSI/54-186QDLLEKSGSALRVAA---WAFS--LLAFVVMGAND------------------------------HG.............
A2ZLT7_ORYSI/23-151GRRLAGVMLLLRLAS---LCFA--VAAAAFAATDG------------------------------AALRAA.........
CSPL8_ORYSI/4-146AKARWIVAVVLRVAA---AGAA--AVAAVLMAMSH------------------------------DEVIVY.........
CSPL4_ARATH/6-136GSVGTTASLSLRLGQ---MVLA--FGSLLFMTIGV------------------------------R..............
CSPL6_ARATH/34-164GMPGTLLGLALRFFQ---FLFA--AAALCVMASTS------------------------------D..............
CSPLK_ARATH/3-143KLTKRIGGLVLRLAA---FGAA--LAALIVMITSR------------------------------ERASFL.........
CSPLW_ARATH/12-168SGKSCKILLGLRLLA---FSAT--LSAAIVMGLNK------------------------------ETKTFIVGKV....G
Q259U2_ORYSA/7-126PPPPSLLLLLLRPPR---LPRW--RHAR.......------------------------------...............
CSPL1_ORYSI/65-214RRCLGLIDFVLRVAA---FGPT--LAAAISIGTSD------------------------------ERLSVFT........
CSPLD_ORYSJ/12-165RAAEAKTEGLLRGAC---ALLA--AAAALLVGLNT------------------------------QTETVL.........
CSPL2_ORYSI/36-185SLVLSVADLVLRFVA---IGGT--AGSAIAMATTS------------------------------ETLPFAA........
CSPLJ_ARATH/30-168LRRFNSLILLLRLAS---FSFS--LASAVFMLTNS------------------------------...............
A5C0X4_VITVI/7-154STPSPVISLVLRLLT---FISI--LISLIILTNNS------------------------------ATIVVN.........
A2ZF82_ORYSI/6-157RTALPSAVLALRLLT---LALL--AASLAVIAADK------------------------------LTLDFGG........
CSPLI_ORYSJ/2-153DGAARAVSLFFRIAV---VGLS--VAAAVVMATAS------------------------------QAFPF..........
A2XFN2_ORYSI/55-188EDMLDKSPLALHAAA---AAFA--FVALVLVASNQ------------------------------HG.............
CSPLC_VITVI/25-175DRRVRLAELVLRCVI---CGLG--ILAAVLVGTDT------------------------------QVKVIF.........
CSPLV_ORYSJ/33-163GMPGTAGGLGLRLAQ---FAFA--AVALAVMASTN------------------------------D..............
CSPLS_ORYSI/7-140WRPGTWGGLAMRVGQ---VAFA--GASIGVMASGA------------------------------G..............
CASP3_ORYSI/20-169SKGVSILDVILRFVA---IIGT--LASAIAMGTTN------------------------------QTLPFFT........
CSPL1_MUSAC/29-185TSSTQLPGIILRIVA---IVLT--FISAVVMGAAR------------------------------QTTTVTGIDAE...T
Q0JKN7_ORYSJ/252-388RSELRRAELGFRVLA---AVFC--LVSLSVMAADT------------------------------T..............
CSPLC_ORYSI/34-189WPRLGVVMVATRAVA---LVMA--VLSMALMISAK------------------------------QRGSLKIF.......
CASP3_VITVI/22-171NRGISILDFILRLIT---IIGT--LGSAIAMGTTN------------------------------ETLPFFT........
CSPLR_ORYSI/6-138GSPGTWSGLSLRVGQ---LVFA--AASVCATASAL------------------------------G..............
CSPLG_ARATH/6-137GTPGTLTGLVLRISQ---CVFA--AGSISYMVTSG------------------------------G..............
CSPL2_GOSHI/2-154ELSIQKIEALIRLST---IVML--VLTACLIGLDS------------------------------QTKVIF.........
CSPLQ_ORYSI/6-139GSPGTWSGMSLRVSQ---CVFA--GASVVAMASAY------------------------------G..............
CASP5_ARATH/22-171SRRIAILEFILRIVA---FFNT--IGSAILMGTTH------------------------------ETLPFFT........
CSPL8_ARATH/129-265EEVVKFSALGFRLSE---VVLA--LISFSIMAADK------------------------------T..............
CSPLI_ARATH/6-139GGPGTVCGLLLRIGQ---CASA--AASIGVMVSAK------------------------------E..............
CSPLD_ARATH/31-185FLDCRKIDIITRVLL---FSAT--LTALIVMVTSD------------------------------QTEMTQLPG......
CSPLA_ARATH/41-170EDLIKKASPITRGIC---LLFS--LIAFLIMVSNK------------------------------HG.............
BLE3_ORYSI/2-142AKVHRLMNAVLRLAA---AAAA--ATAAVVMVTSR------------------------------ETTSFF.........
A2X1J8_ORYSI/10-159APGVVRAERLLRGGC---VVMA--ATAALLLGFSA------------------------------ETKTVL.........
CSPLA_VITVI/30-171KSSMRTVETLLRLVP---VALC--TVSLVVMLKNS------------------------------QTNDF..........
CSPL1_GOSHI/32-173NTSMRTAETMLRLVP---MALG--VAALVVMLKNS------------------------------QSNDF..........
A5AM50_VITVI/551-679ERAVERAALGFRVCG---FLFC--LVSFSIMASDK------------------------------N..............
CSPLQ_ARATH/12-168TTKSWKLLLGLRIFA---FMAT--LAAAIVMSLNK------------------------------ETKTLVVATI....G
CSPL2_ARATH/45-194NKGISVLGFVLRLFA---VFGT--IGSALAMGTTH------------------------------ESVVSLS........
N24_MEDTR/61-218EVKWYVALLVIRVFA---FVFC--LIAFSVLGASE------------------------------QRVLVSENLTNWYSS
CSPL7_ORYSJ/33-190PAKCSGANLALRALL---FAVS--LSALVVLVTAK------------------------------QTVMVPFVIR....P
CSPLD_VITVI/40-195RRGTDVAHVVLRFVC---LLTS--VIALSLMATAK------------------------------EAASISIY.......
CSPL2_VITVI/3-143KNTDRICFLVLRLLA---FGAT--LSAAIVMATSH------------------------------ERTTYL.........
CSPLF_ARATH/41-196GKRNDVAMFVLRAMC---MAVS--TVAVTLMVTAR------------------------------ETSMTTLY.......
CSPLU_ARATH/6-139GSPGTMSGLILRLGQ---CATA--AASIGVMVSSY------------------------------D..............
CSPL9_ARATH/36-165GMPGTTGGLILRLSQ---FVPA--LISVSVMVTTS------------------------------D..............
CSPLE_ARATH/17-159NRTEKSAEAVLRVAS---MALS--ITGLVIMIKNS------------------------------ISNEF..........
CSPLT_ARATH/6-134ASFGTSSSFVLRLGQ---TLFS--SASLLFMCFND------------------------------D..............

PF01284

A5DEX7_PICGU/3-141--AIG..DSILRIIN...FVFL..VIALGLTGSLA.............................................
Q6BHB0_DEBHA/4-133--LII..GGAIRGLQ...FIWT..IINLGLAAGLI.............................................
Q0V4R6_PHANO/7-197--LLS..SSVLRGLQ...MLFG..IVILGLSITLIKSQSK........................................
SYPL2_RABIT/30-232--RLEEPLGFIKVLQ...WLFA..IFAFGSCGSYSGETGAMVRCNNEAKDVSSIIVLF.....GYPFRLHRIEYEMPLCD
SYPH_RAT/15-216--VVKEPLGFVKVLQ...WVFA..IFAFATCGSYTGELRLSVECANKTESALNIEVEF.....EYPFRLHQVYFDAPSCV
O57343_XENLA/15-218--VVKEPLGFIKVLQ...WLFS..IFAFATCGGYSGQFSLSIECKNKNESKPNIKVD......FEYPFRLHQEYFDAPTC
SYPL1_MOUSE/28-233--PLKEPLGFIKILE...WFAS..IFAFATCGGFKGKTEIQVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCD
O44511_CAEEL/12-210--AFKFPLGFIRIIQ...FVFI..IIAIAAINSWGLELNYHCVDGTGNITRNSTQ..........KVYTFSLSKVKLTGC
SNG1_HUMAN/20-167--LVRQPHTILRVVS...WLFS..IVVFGSIVNEGYLNS.........................................
SNG3_HUMAN/20-166--FARRPQTLLRVAS...WVFS..IAVFGPIVNEGYVNT.........................................
A0A024R8T9_HUMAN/20-165--FLTQPQVVARAVC...LVFA..LIVFSCIYGEGYSNA.........................................
SNG4_MOUSE/18-163--FLRRPKSISRIFG...GVFS..LVIFSSLLTDGYQNR.........................................
SNG4_HUMAN/18-163--FLRRPKTITRVFE...GVFS..LIVFSSLLTDGYQNK.........................................
SNG1_CAEEL/21-169--FFKKPTVLFRCAA...LLFG..LILWYSVSKGGWHKP.........................................
CKLF8_MOUSE/36-162--FLRTPPGLLIVAE...IVLG..LLVWTLIAGTE.............................................
A0A024R6T3_HUMAN/32-160--FVRSRLGALMLLQ...LVLG..LLVWALIADTP.............................................
A0A024R9E4_HUMAN/31-169--ILRTYSGAFVCLE...ILFG..GLVWILVASSN.............................................
MALL_HUMAN/22-149--LFLTIPFAFFLPE...LIFG..FLVWTMVAATH.............................................
A0A024RE19_HUMAN/18-145--VFTTLPDLLFIFE...FIFG..GLVWILVASSL.............................................
Q21228_CAEEL/44-191--YCLGPLGLLRIAE...IFLC..VVIVCLITSVF.............................................
P83386_CAEEL/118-240--YIRTLGGIMKIVC...IVLCLLTFIFVMMGPAY.............................................
Q95ZR6_CAEEL/49-177--YLATLAGVLKIAE...IVLSFIAFILAICADRR.............................................
Q9VZ71_DROME/43-166--YFRTIPGIIKIVE...FVLG..IICMALAAPPL.............................................
Q9VYX8_DROME/26-152--YLKTFPGILKLFE...LIIG..ASIVGILAFNY.............................................
B3NVK8_DROER/30-167--FVLSRIGLLKLMQ...LGLA..MLCEGLLIRYG.............................................
MYADM_MOUSE/25-151--ALTQPLGLLRLLQ...LIST..CVAFSLVASVG.............................................
H2Q2D6_PANTR/26-160--FLRSPLGVLRLLQ...LLAG..AAFWITIATSK.............................................
CKLF6_HUMAN/33-154--RLPLLRRVLKGLQ...LLLS..LLAFICEEVVS.............................................
MALD3_MOUSE/168-355--YLCTGRACWQMLK...ALLN..LLILACSSVSYNSTGGYTGITSLGGIY..................YYQYGGAYSGF
OCLN_XENLA/38-244--RWSSPPGIIKIMSILIVVMC..VGIFACVASTLPWDLDITGQSMGYGMGSGSYS........GGYTGYGFGGSQMGLG
OCLN_POTTR/42-242--QWRSPPGIVRILQGSVVILC..LVIFACVASTLAWEYYGSGGLLGYGG....................GLGSYYNGYY
OCLN_CHICK/48-247--KWTSPPGAVRGLQAGVLVLC..IAIFACVASTLAWDYGYGLGGAYGTGLGGF.............YGSNYYGSGLSYS
A0A023ZMC9_YEASX/3-140--SAA..DNLVRIIN...AVFL..IISIGLISGLIG............................................
Q6FKV0_CANGA/3-140--AVT..DNLLRIVN...FVFM..VICIGLISDLIA............................................
Q6FPZ8_CANGA/3-141--SVA..DNLLRIVN...AVFL..IICIGLASSLIN............................................
A0A023ZJA9_YEASX/3-140--ALA..DNILRIIN...FLFL..VISIGLISSLLN............................................
A7TRD3_VANPO/3-141--SLA..DNIMRAIN...FCFF..VICMGLIGSLLA............................................
M9N748_ASHG1/3-140--SIL..DNSLRAVN...FVFL..IIVLGLTGSLIH............................................
Q6CQL1_KLULA/3-140--SIL..DNSLRGVN...FVFL..IIVLGLVGNLIA............................................
A3LZS1_PICST/3-141--AIG..DVILRSVN...FVFL..VVALGLTGSLAA............................................
A5DZR5_LODEL/3-141--AIG..DVILRAFN...FVFL..AIALGLTGSLAA............................................
Q6BW56_DEBHA/3-141--ALG..DSILRLTN...FVLL..VIALGLTASLAA............................................
Q6CC67_YARLI/3-142--KVA..DLILRGLI...FMFA..AIIMGLAGSLAS............................................
NCE2_SCHPO/8-147--GVF..TWVFRTFQ...LAID..TIVLALASALVN............................................
Q0UPR7_PHANO/4-144--RAL..ITGLRAWQ...LICA..ILVVAFMANNID............................................
A2QGX8_ASPNC/4-145--KAI..QLGLRIWE...FIWT..LLIMALIGNMIA............................................
A1CYK1_NEOFI/4-145--RGI..QLGLRVWE...FVFS..LLVMALIGNIIA............................................
Q0CDN4_ASPTN/4-145--RAV..QIGLRVWE...FVFT..LLIMALVGNMID............................................
A7EYJ0_SCLS1/3-139--SIA..QIGLRSAQ...FVTV..LISLALIAAAID............................................
Q1K6H5_NEUCR/2-147--EVI..PLILRFIQ...LIFL..IILTGLIGNVIA............................................
A7EEJ3_SCLS1/3-132--IGL..LLPIRIAQ...AVFA..IVVLGLSGYVSH............................................
Q2GNW8_CHAGB/8-120--FPL..MPLIRISQ...GVFA..LLVIILSGFVAN............................................
A6R6A8_AJECN/9-127--KAL..NYALRALQ...LIFS..IIIKGTDGY...............................................
Q5KIU4_CRYNJ/9-146--RRGHPAFMGALLL...FAIIEGCITAYLVAQFND............................................
Q0UHA4_PHANO/4-136--PII..VLGLRGVQ...ALFS..IIVLGLTAYLVD............................................
A1C4R1_ASPCL/5-129--FPW..IYPVRVAQ...AIFA..IIVLGLTGYAV.............................................
Q0CE97_ASPTN/5-131--FPW..IYPVRAIQ...VVFA..IIVLGLTAYII.............................................
A6QXF9_AJECN/2-128--QNI..VVGLRGVQ...VVLA..IIILGLTGWAV.............................................
A1DBK3_NEOFI/5-157--AII..PSALLGVA...FVFA..VIELGLGGHIASVSTGSRKIP..............................VYDSS
A7TL81_VANPO/6-167--SIL.PFSIIRFFQ...FASA..TLVMSLIAFAT.............................................
A0A024XRE8_YEASX/6-151--GVF..LTLLRFSQ...FASS..VLVMSLLAYAI.............................................
Q6FT38_CANGA/8-169--KNF.GLFSLRFFE...FGSA..VVVLGTLGYTV.............................................
Q6CRJ1_KLULA/73-213--SLF..HNIVRGLQ...SMFT..SLVLSLTATSI.............................................
Q5AKB8_CANAL/5-134--PIV..TYIIRGAQ...SVFC..IVVLGLSAGFL.............................................
A3LNT7_PICST/7-132--KIV..VYAIRGLQ...LLFS..ILVLGLSAGFL.............................................
A3LNT6_PICST/7-132--KAV..VYILRGAQ...LFFS..ILVLGLAAGLL.............................................
A5DIF4_PICGU/10-137--GLL..ALIVRGIQ...LVFS..IIGLGVSAGAV.............................................
A5E332_LODEL/6-143--PLI..STLLRGFQ...FLFA..IISLALAGSVL.............................................
Q6CD20_YARLI/9-145--PRY..TVLTRYVQ...TGLS..LLCWCLAISAV.............................................
Q5B418_EMENI/6-137--RVL..SVILRIAE...IGFG..AVVAGIIGWFLH............................................
A1CAJ4_ASPCL/6-137--RLV..SIVLRVAE...IAFA..AVVAGLIGYYLH............................................
Q0CKJ8_ASPTN/6-137--RLV..SIVLRVVE...IICA..AIVAGIIGYYLD............................................
A7UWP7_NEUCR/5-136--DII..SIILRVAE...LAFA..SIVAALNGRFLH............................................
A7EHU9_SCLS1/5-136--DIF..NLLLRLGQ...LAFS..TIVLGITSAHLS............................................
A1C9J0_ASPCL/11-136--RPL..QLITRVMQ...WSSA..VIVMGITSYFI.............................................
Q5BAE2_EMENI/8-133--RPV..MLLIRALQ...WASA..VIVMGITSYFI.............................................
Q5ATF8_EMENI/2-165--QIV..NSIVRIFQ...AISA..IIVLGISVDLAR............................................
A1C5S2_ASPCL/2-156--QIV..TAVVRAFQ...FLFA..IVVLGLSVTLA.............................................
Q2H380_CHAGB/3-168--KPI..TLGLRGLY...FVMA..LTILALAAAMI.............................................
Q7S8H8_NEUCR/3-169--AGL..CIGLRGLQ...ILFG..AVIVGLSAQFI.............................................
A0A024R4N0_HUMAN/168-313--YMATVPGLLKVLE...TFVA..CIIFAFISDPN.............................................
Q96M12_HUMAN/91-236--YMASELGLLKVLE...TFVA..CLIFVFINSPY.............................................
CKLF5_HUMAN/29-152--FLTSHKGILLETE...LALT..LIIFICFTASI.............................................
Q0VEW4_MOUSE/19-132--FSRTKKGILLFAE...IILC..LVILICFSAST.............................................
A0A024QYW3_HUMAN/19-131--FSRTRKGILLFAE...IILC..LVILICFSAST.............................................
A0A024R2L3_HUMAN/40-160--YPRTHAALLKVAQ...MVTL..LIAFICVRSSL.............................................
CKLF2_HUMAN/82-198--FWLLGHAEIKIRSLGCLIAA..MILLSSLTVHP.............................................
CLF2B_MOUSE/35-151--FWAQGHAECKSLIMILLIAA..MVCFQRVATHP.............................................
CKLF_RAT/13-127--FCLSLKCFVKTLR...LVVTVASMIFFIVAQAP.............................................

PF04535

CSPL4_VITVI/42-189....GIQVEAKYSYSSAFKFFSYANAIACGC-SVLTLFPAFSLFYR......GSTPMKFFFLFLHDLCMMSLVLAGCAAA
A2XND4_ORYSI/2-138....GHGGAQDFDNYPEYTYCLGISIIAVLY-TTAQVTRDVHRLSWGRD.VIAGRKAAAVVDFAGDQVVAYLLMSALSAA
CSPL6_ORYSI/22-174TRPVTQTFTAKFKDTPAFVFFVIANAIASGY-NLMVLVTRRI..........LQRRAQSLSVHLLDMVILTLLATGSATA
CSPL8_VITVI/27-183LPSLHVPVTAKWSDMSAFVYLVVSNAIACSY-AAISLVLVTMLGRR.......GKGGRVLAVIVLDLHMVGLLFSANGAA
CSPL3_VITVI/15-155.......GKLEFSNLTGLKYMVCISGISAGY-ALVAVVASWV..........RCLVNKAWLFFVSDQIMAYLMVTSGAAV
CSPL9_ORYSJ/22-162.......GEVRFSDLSGFRYLVWINAITAAY-SVASILLSSC..........RFITRFDWLIFLLDQASAYLLLTSASAA
CSPL3_ORYSI/14-150....RWGVRVDFTLFQVWIGFVAVNLVCTVY-AAATAAA.............ARKAMGRWWLHHADAVVVNLEAAATAGA
CSPLO_ARATH/21-177LPPLNVSTTAKASYLSAFVYNISANAIACGY-TAISIVIVMISKG.......KRSKSLLMAVLIGDLMMVALLFSSTGAA
CASP1_STRAF/38-187...QFFQFRAQYDDLPTFTFFVVGMAIVTGY-LILSVPLSIVCIAR......PVAIGPRFLLIVCDTVTAVLATSAAGSS
A2YQ71_ORYSI/48-177.......DWMEFTRYQEYRYLLGVAVVASLY-SALQAARTFRRMRAGTAYAAT......FLDFAGDQAVGYLLITASSAA
CSPL7_ARATH/24-174....MIQKKAKFTDMKALVLLVVVNGIAAGY-SLVQAVRCVVGLMKGR...VLFSKPLAWAIFFGDQAVAYLCVAGVAAA
CSPLV_ARATH/116-252....KGWAHDSFYNYKEFRFCLAANVIGFVY-SGFMICDLVYLLSTSIRRSRHNL..RHFLEFGLDQMLAYLLASASTSA
CSPLX_ARATH/26-166.......GNLEYNSIMGLKYMVGVSAISAIY-ALLSTVSSWV..........TCLVSKAWLFFIPDQVLAYVMTTSVAGA
CSPLS_ARATH/1-147....YIHKNVSFRYLLALEAELYIDVVVAAY-NLVQLGLGWYNVE.......QKTSNPKWFSYLLDQTAAYVVFAGTSAA
CSPL1_VITVI/23-179TTPIRATLKAKFQHTPAFVFFVVANGLASVY-NLVMLGVDVFGRKL......DCKGLRLVIISILDMVIVAVVAAGASSA
CSPL3_ARATH/27-169.......GSISYSNLTAFRYLVHANGICAGY-SLLSAAIAAMPRS.......SSTMPRVWTFFCLDQLLTYLVLAAGAVS
CSPLM_ARATH/23-176.GTPIRIPAAEFTNSPALIYFVVALSVACFY-SIVSTFVTVSAFKKH.....SCSAVLLLNLAIMDAVMVGIVASATGAG
CSPLY_ARATH/143-279....QGWSGDSYDRYKEYRYCLAVNVIAFVY-SAFEACDAACYIAKESYMINCGF..HDLFVFSMDQLLAYLLMSASSCA
A2ZVW2_ORYSJ/198-313....SGWAGDHYGRYEQYRYAVGVNIVVCIY-SIAQAFGEIRRL.......................VLAYLLMSASSAA
CASP1_ORYSI/21-170...QFIQFEAKYSDLPSFTFFVAANAVVCTY-LVLSIPLSIVHILR......PRARYSRLFLVFFDTAMLALLTAGASAA
Q38HU1_SOLTU/29-159...........FPSVTAFSYLVAAVGLQIIW-SLVLAIADVYAILVKR...SYRNVAIVSLFAIGDGITSTLTFAAACAS
A5BVF2_VITVI/6-137...........FYSYTAFCFLVTVMGLVIPW-SLTLSLVDAYSVFVKC...PLHQPGIMLVVIIGDWVLSFLSLAAACST
CASP3_ARATH/56-205...QFLQFQADYTDLPTMSSFVIVNSIVGGY-LTLSLPFSIVCILR......PLAVPPRLFLILCDTVMMGLTLMAASAS
CSPL6_VITVI/25-170....SISFTVRYSYLSAFKFLVGADAVVCGF-SMLSLIFVSIFN........KGKSNHYFFLYFHDLILMVLSMSACAAA
CSPLL_ARATH/49-190...HLTQNSSSFASYPELLYCFGVAVIGFVY-TSLQTFKGVCDITHRGVLISEPL..SDYISFIFDQVICYLLVSSSSVA
CASP2_ARATH/40-189...QFLQFEASYDDLPTFQFFVIAMALVGGY-LVLSLPISVVTILR......PLATAPRLLLLVLDTGVLALNTAAASSA
A5C3N9_VITVI/6-139...STIKKTATFRDLGALQVVVYVDSVAAGY-NLLQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAA
CASP1_VITVI/37-186...QFFQFQASYDDLPAFSFFVIANAIASGY-LFLSLPFSIVCIVR......PHAMGARLLLVICDTVMVALTIAAAAAA
CASP1_ARATH/42-191...QFLQFQAGYDDLPAFQYFVIAVAVVASY-LVLSLPFSIVSIVR......PHAVAPRLILLICDTLVVTLNTSAAAAA
CSPLR_ARATH/11-155....GIAFEAKYSYSSAFRYLVYAQIAVCAA-TLFTLVWACLAV.........RRRGLVFALFFFDLLTTLTAISAFSAA
CSPLP_ARATH/5-155....TIKKTAKYTDMKAVVFLVVANGIAAVY-SLLQSVRCVVGTMKGK...VLFSKPLAWAFFSGDQAMAYLNVAAIAAT
CSPL1_SOLDE/21-170...QIVNFEAQYDDIDAFKFFVVSNSITCVY-LALSIPISIFHIIR......SRAGKSRVLLIVLDAIMLVFLTSGASAA
CSPL5_ARATH/17-172..GFKLTLSSNWSFSPSYQYVVGACAGTVLY-SLLQLCLGVYRLVTGSPITPSRF..QAWLCFTSDQLFCYLMMSAGSAG
CASP2_VITVI/45-194...QFFQFQASFDDLPAFMFFVVATAIASGY-LALSLPFSLVSIFR......PHAQGIRLLLIISDTVMLALTTAGAASA
CSPL5_VITVI/24-179LPPMDVPVTAKWRYLSAFVYFVVSNAIACSY-AALSLLLSVGNS........KGNKGLGLAITVMDLVMVALLFSSNGAA
A2Y3F2_ORYSI/54-186.......DWRQFEHYEEYRYVVAIGVLAFIY-TTLQLVRHGVRLTGGQDLQGKVA...VLVDFAGDQVTAYLLMSAVSAA
A2ZLT7_ORYSI/23-151...P.............FRFLLAANAIVAVY-SAFEVAAAAWEVAGGATLLPEAM..QLWFDFGHDQGFGYMALAAAAAA
CSPL8_ORYSI/4-146....GMEVQAKFRYTPSLVFFVAANAAVSAC-SLVVLLVPS...........STSKLAARLLLMADVVLGMVLAGALAAA
CSPL4_ARATH/6-136...........FYQFTAFCYLVTIMSLAIPW-NLTLAMVDIYCVILQQ...PFQKPRILLAISIGDWVVSVLALASASSA
CSPL6_ARATH/34-164...........FPSVTAFCYLVAATGLQSLW-SLALAMVDVYAIMVKR...SLQNRRLVSLFAIGDGVTSTLTFAAACAS
CSPLK_ARATH/3-143....AISLEAKYTDMAAFKYFVIANAVVSVY-SFLVLFLPK.............ESLLWKFVVVLDLVMTMLLTSSLSAA
CSPLW_ARATH/12-168NTPIQATFTAKFDHTPAFVFFVVANAMVSFH-NLLMIALQIFGGKM......EFTGFRLLSVAILDMLNVTLISAAANAA
Q259U2_ORYSA/7-126...................FFLVANAIVAGY-LVLSLPFSAVLVIR......PQTIGLRLLLLVCDMIMAAMLTAAASAA
CSPL1_ORYSI/65-214...NYFQFRARFDDFPAFEFFIVANAIAAGY-MVLSLPFSAATIMS......SKATGVKLLLLICDTIMVGLLTAAASAA
CSPLD_ORYSJ/12-165....FIRKKATVKDVQALWVLAMAAAAAAGY-HLLQLLRCFYLSRFADGKPCRHRRAIAWLCFLLDKGCAYITFATTVAA
CSPL2_ORYSI/36-185...PFVRFRAEYSDLPTLMFFVVASSVVCAY-LVLSLPASVVHVVR......PGARSSRAILAFLDTVMLALLTASASAA
CSPLJ_ARATH/30-168....RGSASPHWYDFDAFRFVFVANAIVALY-SVFEMGTCVWEFSRETTLWPEAF..QVWFDFGHDQVFSYLLLSAGSAA
A5C0X4_VITVI/7-154....STELKLRFKDVHAYRYMLFALVVGLPY-ILLQIVFGIYHVSMGKR.ISSSGESLLQFDFYADKVMSYILXTGTGAX
A2ZF82_ORYSI/6-157...GLPPKKITFKDVYAYRYVLAIAVIGCAY-TLLQIPFVAVSIAKRKR.MIGGSENVALFLIFADVIFALLVATGAGAG
CSPLI_ORYSJ/2-153....NYGGAVSYTKYPAFVYFVVAAVVSAVC-SAAALYLSV...........VREAAAGWAVALLDVVTMGLLFSAAGAV
A2XFN2_ORYSI/55-188.......DWMEFDRYQEYRYLLAIAALAFAY-SLAQALRHALRMRRGVDPVPTAS..GRLLDFASDQVVAYLLMSALSAA
CSPLC_VITVI/25-175....TIQKKAKFTDMKALVFLVIANGIAAAY-SLIQGLRCVVSMVRGS...VLFSKPLAWAIFSGDQVIAYLTLAAVAAA
CSPLV_ORYSJ/33-163...........FPSVTSFCFLVAAAILQCLW-SFSLAIVDIYALLVKR...CLRNRRAVCLFAIGDGITAALTFSAACAS
CSPLS_ORYSI/7-140...........FANYTAFCYLIASMGLQSLW-SLGLACLDVYALTVKR...DLNNALLVSLFVIGDWVTALLSFAASCSA
CASP3_ORYSI/20-169...QFIRFKAQYSDLPTLTFFVVANSIVSAY-LILSLPLSIVHVIR......SRAKYSRLILIFFDAAMLALVTAGASAA
CSPL1_MUSAC/29-185ALLTSITVTVKSTYSAAYVYFVVANVLVFFY-SVVSLVLSMVNK........ARLTSMSLPFSIADLLMVVLLFSSNGAA
Q0JKN7_ORYSJ/252-388....PGWSGDSFRRYNEYRYTLSASVLAFTY-SGFQLVVEVHYFVTGRRIIRDPS..GKYFNLAMDQILAYLLLSASSAA
CSPLC_ORYSI/34-189..GIEIPLYANWSFSDSLEYLVGMSAVSAAY-CLAQLLLTAHKAVKNAPVVQSRN..YAWLLFTGDQIFAYAMMSAGSAA
CASP3_VITVI/22-171...QFTQFRAEYDDLPTFTFFVIANSIVSGY-LVLSLPMSILHIVR......SGARASRIVLIFFDTAMLALLTAAASAA
CSPLR_ORYSI/6-138...........FAAYTAFCYLIASMGLQALW-SLGLACLDCYALKFKK...DLHSAVLLSLFVVGDWVTAILSFAASCSA
CSPLG_ARATH/6-137...........FFSFTAFCYLIAAMGLQVIW-SFGLAILDTFALVRKK...TLLSPVLVSLFVVGDWVTSTLSLAGASSS
CSPL2_GOSHI/2-154....YVQKKASFKDLRALVGLLYITSLAAAY-NLLQLCCSSFSASYKGT.SLQSYAYLAWLRYILDQAVVYAVFAGNLAA
CSPLQ_ORYSI/6-139...........FSNYTAFCYLIASMGLQLLW-SFGLACLDIYSLQTKR...DLHNPVLVSLFVVGDWVTAILSFAAASAS
CASP5_ARATH/22-171...QFIRFQAEYNDLPALTFFVVANAVVSGY-LILSLTLAFVHIVK......RKTQNTRILLIILDVAMLGLLTSGASSA
CSPL8_ARATH/129-265....KGWSGDSFDRYKEYRFCLSVNVVAFVY-SSFQACDLAYHLVKEKHLISHHL..RPLFEFIIDQVLAYLLMSASTAA
CSPLI_ARATH/6-139...........FSVHTAFCYLIASMGLQLLW-SFGLACLDVYALRGKK...DLQNPILVSLFVVGDWVTAMLSLAAACSS
CSPLD_ARATH/31-185.VSSPAPVSAEFNDSPAFIYFVVALVVASFY-ALISTLVSISLLLKP.....EFTAQFSIYLASLDMVMLGILASATGTA
CSPLA_ARATH/41-170.......YGRNFNDYEEYRYVLAISIISTLY-TAWQTFAHF....SKREIFDRRT..SILVDFSGDQIVAYLLISAASSA
BLE3_ORYSI/2-142....GIQMEAKYSYTPSFIFFVVAYAVAAAY-SLLVLAVPA.............GSALSRLALTTDVVLGMVLAGAVASA
A2X1J8_ORYSI/10-159....FVRKTAVAKDVQALWVLTVAAAAAAGY-HFAQLVRCMYCSSSGD....AGAMAVAWTSFLLDKGCAYVVFASTAAA
CSPLA_VITVI/30-171.......GSLSYSDLGAFRYLVHANGICAGY-SLLSAIFTAMPR........PPTMSRAWTFFLLDQVLTYLILAAGAVS
CSPL1_GOSHI/32-173.......GSVSYSDLGAFRYLVHANGICAGY-SLLSAIIAAVPS........PSTMPRAWTFFLLDQILTYVILGAAAVS
A5AM50_VITVI/551-679....QGWTLDSFDRYKEFRCILSGS......-....ECDRVCVLRPARMRLSLPFXYRTACSPAPPPVLTYLLISASSSA
CSPLQ_ARATH/12-168TVPIKATLTAKFQHTPAFVFFVIANVMVSFH-NLLMIVVQIFSRKL......EYKGLRLLSIAILDMLNATLVSAAANAA
CSPL2_ARATH/45-194...QLVLLKVKYSDLPTLMFFVVANAISGGY-LVLSLPVSIFHIFS......TQAKTSRIILLVVDTVMLALVSSGASAA
N24_MEDTR/61-218GFTIQTPYEFHWYKWDEFRYSFAANVIGFVY-SGLQICHLVMYLITKKHTINPKL..QGYFNVAIDQTLAYILMSASSSA
CSPL7_ORYSJ/33-190PQFILAPVPAKYTHSPALIYLLAALCATCFY-SLITAISSVRLLSSS.....ACSAKTLFYLILLDVFYAAVMASATGTA
CSPLD_VITVI/40-195..GFLLPVSSKWSFSDSFEYLVGVSAAVAAH-ALLQLIISVSRLLRKSPVIPSRN..HAWLIFAGDQAFAYAMLSAGSAA
CSPL2_VITVI/3-143....SLSIEAKYSHTPAFKYFVIANAIGSAY-SLLLLFLPS.............HGSLWPLVIASDVVITMFLTSSISAA
CSPLF_ARATH/41-196..GFEFQLHAVWSLSDSLIYLVVVSSATVLY-SLIQLIISGTRLMRKSPVIPTRT..QAWFCFVADQIIGYAMVSGGSAA
CSPLU_ARATH/6-139...........FSNYTAFCFLVASMGLQLIW-SFGLACLDVYAIRRKS...DLRSPILLSLFTVGDWVTALLALAAACSS
CSPL9_ARATH/36-165...........FRSATAFCCLVLAVSLQSLW-SLSLFIIDAYALLVRR...SLRNHSVVQCFTIGDGVTSTLTFAAASAS
CSPLE_ARATH/17-159.......GSVSYSNIGAFMYLVSANGVCAAY-SLLSALAILALPC.......PISKVQVRTLFLLDQVVTYVVLAAGAVS
CSPLT_ARATH/6-134.........EDFYAYTTFCYLVTVMGLVTPW-SVTLALMEAYSILVKK...LPMQATVISVIVAGDFVLSFLSLGGACST

PF01284

A5DEX7_PICGU/3-141.......ATTVFQSNPQINFGVFAAAFAILTSSFYGVLAYL.........--FDGFAWPLVLAIFDFLNFVFTFAAATAI
Q6BHB0_DEBHA/4-133........ADLDYGYSRVVYSLVISVFTIIY.LVVVMLP..........I--CFRLASPLVILVCECIFMIFWLASFAAM
Q0V4R6_PHANO/7-197AWEGSALDIIAPAPPTILPLAAAIGAISLAA.AVFSLVI..........A--WTDILREYIEMLVDVVVIMLNVVGGVII
SYPL2_RABIT/30-232DDSSSKTMHLMGDFSAPAEFFVTLGIFSFFY.TMAALVVYLRFH...KLY--TENKRFPLVDFCVTVSFTFFWLVAAAAW
SYPH_RAT/15-216KGGTTKIF.LVGDYSSSAEFFVTVAVFAFLY.SMGALATYIFLQ...NKY--RENNKGPMMDFLATAVFAFMWLVSSSAW
O57343_XENLA/15-218RGATRKVF.LVGDYSSSAEFFVTIAVFSFLY.SLAAMAVYMFLQ...NKY--RENNKGPMIDCIATAIFTFLWLVSSSAW
SYPL1_MOUSE/28-233VNWEKHV..LIGDYSSSAQFYVTFAVFVFLY.CIAALLLYVGYT...NLY--RDSRKLPMIDFIVTLVATFLWLVSSSAW
O44511_CAEEL/12-210DNQTRTFWSGDDSASGSAGFFYFVNVTALIY.VIFICFVYVIFW...NIY--QTEKRIPLVDLGATALLFILFFFCSSIW
SNG1_HUMAN/20-167.ASEGEEFCIYNRNPNACSYGVAVGVLAFLT.CLLYLALDVYFPQ.ISSV--KDRKKAVLSDIGVSAFWAFLWFVGFCYL
SNG3_HUMAN/20-166.DSGPELRCVFNGNAGACRFGVALGLGAFLA.CAAFLLLDVRFQQ.ISSV--RDRRRAVLLDLGFSGLWSFLWFVGFCFL
A0A024R8T9_HUMAN/20-165.HESKQMYCVFNRNEDACRYGSAIGVLAFLA.SAFFLVVDAYFPQ.ISNA--TDRKYLVIGDLLFSALWTFLWFVGFCFL
SNG4_MOUSE/18-163.TESPQLRCVLNSNHMACSFAVGAGFLSFLS.CLVFLAIDAYERR.LVGT--RFKIAFQLLDFILAVLWAGVWFVAFCFL
SNG4_HUMAN/18-163.MESPQLHCILNSNSVACSFAVGAGFLAFLS.CLAFLVLDTQETR.IAGT--RFKTAFQLLDFILAVLWAVVWFMGFCFL
SNG1_CAEEL/21-169.SDAIHPVCLYGRSSSTCSFATAVGFFAVCG.AIVLIVLDAKMDQ.ISSV--PTRRRAVLADLVVSAIFTAIFLIGFFTF
CKLF8_MOUSE/36-162...........YFRVPAFGWVMFVAVFYWVL.TVFFLIVYITLT...YTR--IPQVPWTTVGLCFNGSAFVLYFSAAIVD
A0A024R6T3_HUMAN/32-160...........YHLYPAYGWVMFVAVFLWLV.TIVLFNLYLFQL...HMK--LYMVPWPLVLMIFNISATVLYITAFIAC
A0A024R9E4_HUMAN/31-169...........VPLPLLQGWVMFVSVTAFFF.SLLFLGMFLSG....MVA--QIDANWNFLDFAYHFTVFVFYFGAFLLE
MALL_HUMAN/22-149...........IVYPLLQGWVMYVSLTSFLI.SLMFLLSYLFG.....FY--KRFESWRVLDSLYHGTTGILYMSAAVLQ
A0A024RE19_HUMAN/18-145...........VPWPLVQGWVMFVSVFCFVA.TTTLIILYIIG.....AH--GGETSWVTLDAAYHCTAALFYLSASVLE
Q21228_CAEEL/44-191......GPGPFKGILFGQTILLTVASVAMLL.TFIFLIAYFFTL..HLSH--LDFFCWREADLLFNVICAVLFIVLSIVE
P83386_CAEEL/118-240..............YTGVGWATFVSSVGIFV.TTSLLTLYLFRV...VDT--LPSINWIVCEMVYCFAWTVFFFIAACVL
Q95ZR6_CAEEL/49-177..............TTTAAWTEHISFETLLIVSALLLGYVVFPHLTIKDE--ATREGLIVVELIFYGVNTLLYFISIWLM
Q9VZ71_DROME/43-166..............ASATSFFMFVIVISFII.NILLIAAYFLGI..REAL--NVAVNWIFSELITTAVLTLLYFIGFIVQ
Q9VYX8_DROME/26-152.......QDYHRYFYGQQDLFHYLMAVTFMIGTFCLLLACLTS....LST--GGIIAKTIYELIYHSVAAILILVSSTIL
B3NVK8_DROER/30-167.......VPYADSIGQALTSFLATTGHCFTT.TGILLLCYAFS....DKS--YSLIRQSLFETLFNGLASCMYFSSSSYM
MYADM_MOUSE/25-151...........AWTGPMGNWAMFTWCFCFAV.TLIILIVELGG....LQA--HFPLSWRNFPITFACYAALFCLSSSIIY
H2Q2D6_PANTR/26-160.............YQGPVHFALFVSVLFWLL.TLGLYFLTLLGKH.ELVP--VLGSRWLMVNVAHDVLAAALYGAATGIM
CKLF6_HUMAN/33-154..........QCTLCGGLYFFEFVSCSAFLL.SLLILIVYCTPF...YER--VDTTKVKSSDFYITLGTGCVFLLASIIF
MALD3_MOUSE/168-355DGADGERAQQLDVQFYQLKLPTVTAAMAYSG.ALMTFSCLTLLAGALRVP--WHCPLWLVIEGLMDALIAGAYVPGLYFF
OCLN_XENLA/38-244FAYGGNY....TDPRAAKGFILAMAAFCFII.GLVIFVMLVTR....TPL--STSRKFYLIVIIVSAIIGGLVFIATIVY
OCLN_POTTR/42-242GGYNGYYYGGLTNPRAANGFMIAMAVLCFLV.TLGLVIAGLSK....ASG--ARSRRFYLLVAVLSGLLAFVMLIASIVY
OCLN_CHICK/48-247YGYGGYY..GGVNQRTANGFMIAMAVLCFLA.QLGLLVAALSK....SGA--TRSRRFYLAVLVLSAVLAFVMLIASIVY
A0A023ZMC9_YEASX/3-140.....TQ...TKH.SSRVNFCMFAAVYGLVTDSLYGFLANF........W--.TSLTYPAILLVLDFLNFIFTFVAATAL
Q6FKV0_CANGA/3-140.....TR...DRH.SSRVNYCMFAAAYGIATDSLYGVFANF........F--.EILAWPLILFTLDFLNFAFMLTAGCVL
Q6FPZ8_CANGA/3-141.....TR...KRH.SSRVNFCLFAAAYGIATDSLYGIFANF........F--.EPLAWPLVLFVLDFLNFVFTFTAGTVL
A0A023ZJA9_YEASX/3-140.....TQ...HRH.SSRVNYCMFACAYGIFTDSLYGVFANF........I--.EPLAWPLVLFTLDFLNFVFTFTAGTVL
A7TRD3_VANPO/3-141.....TE...KGH.SSRVNYCMFVPPFAVVTDSFYGILANI........W--TTPFAWPIILFAFDFLNFAFTFTAGTVL
M9N748_ASHG1/3-140.....GQ...RNS.HSRVNFGLFTAVFALVTDSFYSIVANF........I--.SAFAWPIITIALDVLNLIFTFAAATAL
Q6CQL1_KLULA/3-140.....TQ...DHS.SSRVNFAIFAAVFGIVFDSLYALIANF........I--.SALAWPIILVSLDFLNWVFTFSAATAL
A3LZS1_PICST/3-141.....TTV..YQG.NPQVNFAVFAAAFGLLTSSIYGVFAYF........V--.AAFAWPIVLATFDFLNLVFTFAAATAV
A5DZR5_LODEL/3-141.....TTI..TQH.NPQVNFAVFAAAFGLLTSSFYGIFAFF........I--.DAFAWPVILFIFDFLNFVFTFAAATAI
Q6BW56_DEBHA/3-141.....STV..TQS.NPQINFGVFAAAFAILTSSFYGILAYF........I--.AAFAWPIVLAALDILNLIFTFAAATAI
Q6CC67_YARLI/3-142.....THK..KGHYNPQVSYAVFCGAWSALFGVFYPVLANF........I--.EAIAFPIVILIIDFISWVLTLAGGAAL
NCE2_SCHPO/8-147.....QQT..SGGSPGKINFSVAVGSFAILT.FFLTAVGRF........L--PTILGNPWLIAFYDFVNWVFALTGGCCI
Q0UPR7_PHANO/4-144.....RA...DNGTHSIVNYSLFVGLWWLLS.LIYFIPTSF........I--.DKFSIPIVDVAMDALSVLFSFCAAVAL
A2QGX8_ASPNC/4-145.....EAF..AGN.PATINYTMFVAAFSMFT.LFYLVPASI........N--IDWAIHPIFLIAIDTLNAILFLTAGIAL
A1CYK1_NEOFI/4-145.....MAF..AGN.PATINYSMFTATFSIIS.LFYLIPASI........N--LNWAIHPIIMIVLDVLNNIFFLTCAIAL
Q0CDN4_ASPTN/4-145.....ESF..AGN.PAVVNYTMFAAAFSMFT.LFYLFPSSM........N--IDWAGHPIIVIIVDLLNMLIFLTAGIAL
A7EYJ0_SCLS1/3-139.....IQR..FGN..KSVNFAMFTTVVSMIV.VLYGLAAAF.........--VESLAHTLILAIMDGAALLFNLLSGIIL
Q1K6H5_NEUCR/2-147.....LDVDASTTARAAINFTMFVIALSWVV.ALFGLVAA.........I--FQSVAIPLVMLIFDAAATLFTVVAGIVL
A7EEJ3_SCLS1/3-132....WYNTDTLTASPSQINFLVFVPVFTLI..SIVYLEVAPR.......F--MSKASHPYIHLGVELLNVLFYFAGFIAL
Q2GNW8_CHAGB/8-120....WYTSTTPLPSPSQVTFLLFSEGLS......................--....PNPYITAPFDLTNALFHLAGFSAH
A6R6A8_AJECN/9-127..............ASYPCVSVILIIWTVLI.IIFHLIAEIS.......F--ADRALIGYIRVAVEAVAVLSWLAGFITM
Q5KIU4_CRYNJ/9-146.....DDTYPSHSYRDRLKFLVFTSWWTVVF.AAAYMAAFLA......AA--GSFVSSIASHLAIWTVTWIFWLAAAASY
Q0UHA4_PHANO/4-136....AYNGPGYNWSPHSVNFMLFCSIWTLL..AVAYLLLAPT.......R--FPKAAHKFAIGAVEFITMIFWFAAFVAV
A1C4R1_ASPCL/5-129.........SWIRWSDTINFMLFNSAWTAFI.AVPYLALAPV.......F--FPRLAHRFVIPAVEAVTMIFWFSGFVAL
Q0CE97_ASPTN/5-131.......SVATGGYSDTVNFMLFNSIWTAFV.ATPYLAAGPM.......L--VPNFPHRWIVPAVEIITAIFWFAGFIAL
A6QXF9_AJECN/2-128........NRTQGYSDETNFLLFDAIWTFLV.AVPFLVLSPL.......Y--LQQFAHKYALIAVEAITLLFWFAGFIAV
A1DBK3_NEOFI/5-157SSWGYSYKTIKFSVPGIVAFQIFTAVWTMLVSVAAFLLPWFFRVKAAPGT--RLNTIITGALGGVYFVTMVFWLACFADI
A7TL81_VANPO/6-167.......RDFHHHSNPKINLGLSVGVISEFY.MLCVMIGTL........L--FPSLVFAGLLFISEAIVMCLYISGFITV
A0A024XRE8_YEASX/6-151.......HAYGNRGNKKTNFTLATGVISVFY.LIALGILCL........A--LPTLIYIGMYFCAELIVCMLWLAAFVVL
Q6FT38_CANGA/8-169.......HGYHFHGSKRTNFVLAQAAISTFY.SLCTCLLTL........A--VPQLIFVGLYWFWELIMTMLWLAAFIVD
Q6CRJ1_KLULA/73-213........AKASWGDSKTNFGLAVSVMTFVYFLAGGIFWGFAS.....AS--ARSAVPVSVFFGLEAFFVLMWFCAFVVL
Q5AKB8_CANAL/5-134........ADVGYNYDRVTFALVVSILNLIY.FSYILLLMPT.......I--LKNFSPSVIILVAEFIFFVFYLSAMGAI
A3LNT7_PICST/7-132........SDIESNFGRVSYNLVVSLFTIVY.IVFLGVLSV........T--LQNTTLPIIILVIESLLTLFWLIAFALT
A3LNT6_PICST/7-132........ADIGTNWNRVTYSLVIAIFTLIY.AAFIGLIMHA.......S--MAHTILPIIILIIESLFTLFWLVAFALV
A5DIF4_PICGU/10-137.........HQYGSWDRGNFAVAASVISFVY.LLVTI............F--AFQFISPLVSLVAEIILMIFWLAAFAAV
A5E332_LODEL/6-143........SDLGFNWDRMSYVVAVGVLNIVY.FFYILIVVPF.......G--LNGQSPSLVILIGESIFMIFYLAAWAAT
Q6CD20_YARLI/9-145.......ALIDGGYWSTDAYGIAVGILTFIWLAYVMFVPA.........R--YPKYANGLAAVVGEVLINIFWFTSFIAS
Q5B418_EMENI/6-137.....RFGDLDIWPEARWIYTEVVAGISILF.GIIWLIP...........--...FSSGFFTWPLDLLLSMAWFAAFGVQ
A1CAJ4_ASPCL/6-137.....QFRHVDAWPQARWIYTEVVAGLSMLL.GLIWLIP...........--...FSSGFFSWPFDVIISLAWFAAFGLL
Q0CKJ8_ASPTN/6-137.....TLGDFDAWPQARWIYTEVVAGLSILL.GLIWLIP...........--...FSSGFFNWPFDVIISFAWFAAFGIL
A7UWP7_NEUCR/5-136.....AARGNSPWDLGRHIYTEVVAGLSILF.AIVWLFP...........--...FSSSFIHWPMDLVISVMWFVSFGLL
A7EHU9_SCLS1/5-136.....RARSESGWTRKRFIYTEVTAALGLFF.SLFFLLP...........--...HTWNFIHWPIDFLMFVMFMIAFGLL
A1C9J0_ASPCL/11-136.........HRGPRGQHIIYQEVIATLSVVF.FLPAFIS..........P--FMPSALSRFVLAIDVIFSYLWLTAFIFA
Q5BAE2_EMENI/8-133.........SKGPRGQHIIYQEVISVLSVVF.FLPAFLS..........P--FMPNMLSRFVFFIDVVFSYLWLTAFIFA
Q5ATF8_EMENI/2-165.....GQDTRLQSVPPATGYAAFCGGFGTLV.SFIGIIS..........L--FISSLEGLITLSLDALSGVTMLASGIAY
A1C5S2_ASPCL/2-156......KGQRYGTAPAATGYAAFTGGLGIVA.ALVGCAA..........F--FVDALNGIVTWVLDGLASLALLAGGITF
Q2H380_CHAGB/3-168......ANQVYDTPPVTTRYSTFTGGFGMIV.AGVGVLC..........T--FVSFVPELVPLVLDGLAALFFLGGGIAW
Q7S8H8_NEUCR/3-169......TAQKVGSAATTTQYSVFTGTYAILE.GFLGIVA..........L--FLSSFPDIVVLGADAIGALVLLAGGIAW
A0A024R4N0_HUMAN/168-313..........LYQHQPALEWCVAVYAICFIL.AAIAILLNLGE....CTN--VLPIPFPSFLSGLALLSVLLYATALVLW
Q96M12_HUMAN/91-236..........VYHNRPALEWCVAVYALCFVL.AALTVLLSLGH....CTN--MLPIRFPSFLLGLALLSVLLYATALVLW
CKLF5_HUMAN/29-152..................SAYMAAALLEFFI.TLAFLFLYATQY...YQR--FDRINWPCLLQGHGQSGGPHPLDLLSHS
Q0VEW4_MOUSE/19-132.................TSAYSSLSVIEMIC.AAVLLVFYTCDL...HSK--ISFINWPWTDFFRSLIATILYLITSIVV
A0A024QYW3_HUMAN/19-131..................PGYSSLSVIEMIL.AAIFFVVYMCDL...HTK--IPFINWPWSDFFRTLIAAILYLITSIVV
A0A024R2L3_HUMAN/40-160...........WTNYSAYSYFEVVTICDLIM.ILAFYLVHLFRF...YRV--LTCISWPLSELLHYLIGTLLLLIASIVA
CKLF2_HUMAN/82-198...................ILRLIITMEISF.FSFFILLYSFAI...HRY--IPFILWPISDLFNDLIACAFLVGAVVFA
CLF2B_MOUSE/35-151...................IVILLLTMELSI.CAFFFFLYSLAI...NRY--IPFVFWPMMDLMNDLACSTFLIGGIFFA
CKLF_RAT/13-127..................EPYIVITGFEVTI.ILFLIALYMCSL...DKT--MRSFFWPLLDVINSVVTTLFMLIVSVSA

PF04535

CSPL4_VITVI/42-189TAIGYVG......RYGNNHAG.WM---------------------------------------------------A..IC
A2XND4_ORYSI/2-138APVTDYM......RQA........---------------------------------------------------.....
CSPL6_ORYSI/22-174ASMAQLG......KNGNLHAR.WN---------------------------------------------------P..IC
CSPL8_VITVI/27-183TAVGVLG......QYGNSHVE.WK---------------------------------------------------K..VC
CSPL3_VITVI/15-155LEILYLA......YKGDRGVS.WS---------------------------------------------------E..AC
CSPL9_ORYSJ/22-162AEVVYLA......REGDREVS.WG---------------------------------------------------E..VC
CSPL3_ORYSI/14-150GAIGSIA......MWGNEASG.WY---------------------------------------------------A..VC
CSPLO_ARATH/21-177GAIGLMG......RHGNKHVM.WK---------------------------------------------------K..VC
CASP1_STRAF/38-187AAIVYLA......HNGNSDAN.WL---------------------------------------------------A..IC
A2YQ71_ORYSI/48-177LPITIRM......RSA........---------------------------------------------------.....
CSPL7_ARATH/24-174AQSAAFA......KLGEPELQ.WM---------------------------------------------------K..IC
CSPLV_ARATH/116-252SIRVDDW......QSN........---------------------------------------------------.....
CSPLX_ARATH/26-166TEIVYLL......NKGDKIVT.WS---------------------------------------------------E..MC
CSPLS_ARATH/1-147AQHSLLV......VTGSRELQ.WM---------------------------------------------------K..WC
CSPL1_VITVI/23-179AFMAELG......KNGNSHAK.WN---------------------------------------------------K..IC
CSPL3_ARATH/27-169AEVLYLA......YNGDSAIT.WS---------------------------------------------------D..AC
CSPLM_ARATH/23-176GGVAYLG......LKGNKEVR.WG---------------------------------------------------K..IC
CSPLY_ARATH/143-279ATRVDDW......VSN........---------------------------------------------------.....
A2ZVW2_ORYSJ/198-313ASRNDLW......MSS........---------------------------------------------------.....
CASP1_ORYSI/21-170AAIVYLA......HKGNVRAN.WF---------------------------------------------------S..IC
Q38HU1_SOLTU/29-159AGIT.VL......ISNDLE.....---------------------------------------------------...KC
A5BVF2_VITVI/6-137AGVTDLL......LNVNGS.....---------------------------------------------------...HC
CASP3_ARATH/56-205AAIVYLA......HNGNSSSN.WL---------------------------------------------------P..VC
CSPL6_VITVI/25-170TAVGYVG......RYGQDKAA.WM---------------------------------------------------A..VC
CSPLL_ARATH/49-190IAWIQHI.................---------------------------------------------------...NE
CASP2_ARATH/40-189AAISYLA......HSGNQNTN.WL---------------------------------------------------P..IC
A5C3N9_VITVI/6-139LQASIIA......VTGESSLQ.WM---------------------------------------------------K....
CASP1_VITVI/37-186AAIVYLA......HNGNSNAN.WV---------------------------------------------------A..IC
CASP1_ARATH/42-191ASITYLA......HNGNQSTN.WL---------------------------------------------------P..IC
CSPLR_ARATH/11-155FAEGYVG......KYGNKQAG.WL---------------------------------------------------P..IC
CSPLP_ARATH/5-155AESGVIA......REGEEDLQ.WM---------------------------------------------------R..VC
CSPL1_SOLDE/21-170AAIVYLA......HNGNTSTN.WF---------------------------------------------------S..IC
CSPL5_ARATH/17-172SGVTNLN......KTGIRHTP.LP---------------------------------------------------D..FC
CASP2_VITVI/45-194TAIVYLA......HNGDSSAN.WI---------------------------------------------------A..IC
CSPL5_VITVI/24-179GAIGLMG......YEGNSRVR.WG---------------------------------------------------K..VC
A2Y3F2_ORYSI/54-186IPITNRM......REG........---------------------------------------------------.....
A2ZLT7_ORYSI/23-151AREAATC.................---------------------------------------------------...GS
CSPL8_ORYSI/4-146GAMAELG......KNGNSHAG.WI---------------------------------------------------A..IC
CSPL4_ARATH/6-136ASVVDIL......RSNESS.....---------------------------------------------------....C
CSPL6_ARATH/34-164AGIT.VL......IDNDLN.....---------------------------------------------------...SC
CSPLK_ARATH/3-143LAVAQVG......KKGNANAG.WL---------------------------------------------------P..IC
CSPLW_ARATH/12-168AFMAEVG......KNGNKHAR.WD---------------------------------------------------K..IC
Q259U2_ORYSA/7-126AAIVDLA......HNGNLRAN.WV---------------------------------------------------A..IC
CSPL1_ORYSI/65-214AAMVYVA......HEGNLRAN.WV---------------------------------------------------P..IC
CSPLD_ORYSJ/12-165AQACVVA......LYGTHALQ.WT---------------------------------------------------K..LC
CSPL2_ORYSI/36-185AAIVYLA......HRGSARAN.WL---------------------------------------------------G..IC
CSPLJ_ARATH/30-168AALARTM......RGGD.......---------------------------------------------------...TC
A5C0X4_VITVI/7-154FGATLDL......KEVFSE.....---------------------------------------------------...LG
A2ZF82_ORYSI/6-157FGLTYDA......KSAFGGSK...---------------------------------------------------...LP
CSPLI_ORYSJ/2-153FAVRRMAPLYLGVAGADTVAGRWV---------------------------------------------------NGEFC
A2XFN2_ORYSI/55-188TPITNRM......RSA........---------------------------------------------------.....
CSPLC_VITVI/25-175AQSSVFG......EFGQPELQ.WM---------------------------------------------------K..IC
CSPLV_ORYSJ/33-163SGIT.VL......IDNDLD.....---------------------------------------------------...LC
CSPLS_ORYSI/7-140GGVM.VL......FKRDVL.....---------------------------------------------------...FC
CASP3_ORYSI/20-169AAIVYLA......HKGNARAN.WL---------------------------------------------------A..IC
CSPL1_MUSAC/29-185AAISVVA......EKGQQNLAGWD---------------------------------------------------K..IC
Q0JKN7_ORYSJ/252-388LSRNDVW......VSR........---------------------------------------------------.....
CSPLC_ORYSI/34-189AAVANLN......RTGIRHTA.LP---------------------------------------------------N..FC
CASP3_VITVI/22-171SAIVYLA......HKGNAQAN.WF---------------------------------------------------A..IC
CSPLR_ORYSI/6-138AGVV.VL......FDRDIY.....---------------------------------------------------...AC
CSPLG_ARATH/6-137AGIT.VL......YFGDLG.....---------------------------------------------------...SC
CSPL2_GOSHI/2-154LEHSFLV......LTGEENFQ.WL---------------------------------------------------K..WC
CSPLQ_ORYSI/6-139AGVT.IL......FERDVH.....---------------------------------------------------...FC
CASP5_ARATH/22-171AAIVYLA......HNGNNKTN.WF---------------------------------------------------A..IC
CSPL8_ARATH/129-265VTRVDDW......VSN........---------------------------------------------------.....
CSPLI_ARATH/6-139AGVV.VL......YEKDIK.....---------------------------------------------------...YC
CSPLD_ARATH/31-185GGVAYIA......LKGNEEVG.WN---------------------------------------------------K..IC
CSPLA_ARATH/41-170IPLTNIF......REG........---------------------------------------------------.....
BLE3_ORYSI/2-142GAISDIA......KNGNSHAG.WL---------------------------------------------------P..VC
A2X1J8_ORYSI/10-159LQACMVG......LIGVEALQ.WS---------------------------------------------------K..LC
CSPLA_VITVI/30-171TEVVYLA......YKGDEAVT.WS---------------------------------------------------D..AC
CSPL1_GOSHI/32-173TEVLYLA......NKGDSAIT.WS---------------------------------------------------A..AC
A5AM50_VITVI/551-679ATRVEDW......QSN........---------------------------------------------------.....
CSPLQ_ARATH/12-168VFVAELG......KNGNKHAK.WN---------------------------------------------------K..VC
CSPL2_ARATH/45-194TATVYLA......HEGNTTAN.WP---------------------------------------------------P..IC
N24_MEDTR/61-218ATAAHLL......KDY........---------------------------------------------------W..LE
CSPL7_ORYSJ/33-190GAVAWVG......LKGNSHTR.WN---------------------------------------------------K..IC
CSPLD_VITVI/40-195SGVTNLN......RTGIRHSP.LP---------------------------------------------------N..FC
CSPL2_VITVI/3-143LSIAYVG......KKGNSYAG.WL---------------------------------------------------P..IC
CSPLF_ARATH/41-196LGVTNMN......RTGIRHMP.LP---------------------------------------------------N..FC
CSPLU_ARATH/6-139AGVT.VL......FTKDTE.....---------------------------------------------------...FC
CSPL9_ARATH/36-165AGIT.VL......I.NDLG.....---------------------------------------------------...QC
CSPLE_ARATH/17-159AETVYLA......YYGNIPIT.WS---------------------------------------------------S..AC
CSPLT_ARATH/6-134ASVAVLL......MDAGEKQ....---------------------------------------------------.....

PF01284

A5DEX7_PICGU/3-141AAGIRCH------SCSNES.......................................YLKDNN............ITQG
Q6BHB0_DEBHA/4-133ANAFGDV------DC................................................T............YFNR
Q0V4R6_PHANO/7-197AIKLQGM------NCGDTSFKNRLGNGYYPFKGSLGGIDILNGGCYEDDVPYGDERVASCAFTS............SNED
SYPL2_RABIT/30-232GKGLTDV------KGATRPSSLTA.............................AMSVCHGEEA...............VC
SYPH_RAT/15-216AKGLSDV------KMATDPENIIK.............................EMPMCRQTGN...............TC
O57343_XENLA/15-218AKGLADI------KLATDPELVIET...........................QIPECMKSENE..............MNC
SYPL1_MOUSE/28-233AKALTDI------KVATGHRIVEE..............................LEICNPESG..............VSC
O44511_CAEEL/12-210WAGANTI------GNATSDERLTE.............................LFGQGSWKGQ..............NAQ
SNG1_HUMAN/20-167ANQWQV.------...............................................................SKPK
SNG3_HUMAN/20-166TNQWQR.------................................................................TAP
A0A024R8T9_HUMAN/20-165TNQWAV.------.................................................................TN
SNG4_MOUSE/18-163ASQWQH.------.................................................................SK
SNG4_HUMAN/18-163ANQWQH.------.................................................................SP
SNG1_CAEEL/21-169WSKLSA.------..............................................................FEVDE
CKLF8_MOUSE/36-162ASSVSP.------...................................................................
A0A024R6T3_HUMAN/32-160SAAVDL.------..................................................................T
A0A024R9E4_HUMAN/31-169AAATSL.------...................................................HDLH....CNTTITGQ
MALL_HUMAN/22-149VHATIV.------.................................................................SE
A0A024RE19_HUMAN/18-145ALATIT.------.................................................................MQ
Q21228_CAEEL/44-191AYYSTG.------...................................................SWSNN..CNDIGSDGI
P83386_CAEEL/118-240AVASSQ.------...................................................................
Q95ZR6_CAEEL/49-177VHLSAS.------...................................................................
Q9VZ71_DROME/43-166LARWSD.------...................................................................
Q9VYX8_DROME/26-152LLKLRD.------...................................................................
B3NVK8_DROER/30-167GFACVV.------.................................................W.L..........HPQFL
MYADM_MOUSE/25-151PTTYVQ.------...................................................................
H2Q2D6_PANTR/26-160SDQMQR.------...................................................H.........SYCNLK
CKLF6_HUMAN/33-154VSTHDR.------...................................................................
MALD3_MOUSE/168-355FQHLSA.------..A..............................................YSSDVCKERETLYQSKGY
OCLN_XENLA/38-244TVGVNPV------AQASGSAFYTQIVSI.....................CNQFYSPVQTGVFV..............NQY
OCLN_POTTR/42-242VVGVNPR------AGLGASSGSLYYNQML...................MLCNQMMSPVAGGIM..............NQY
OCLN_CHICK/48-247IMGVNPQ------AQMSSGYYYSPLL.........................AMCSQAYGSTYL..............NQY
A0A023ZMC9_YEASX/3-140AVGIRCH------SCKNKT........................................YLEQ.N..........KIIQG
Q6FKV0_CANGA/3-140AVGIRAH------SCNNAH........................................YREN.N..........KIIQG
Q6FPZ8_CANGA/3-141AVGIRAH------SCNNKR.......................................YLERE.T..........KIVQG
A0A023ZJA9_YEASX/3-140AVGIRAH------SCNNSS........................................YVDS.N..........KITQG
A7TRD3_VANPO/3-141SVGIRTH------SCKNRN........................................YIDN.N..........KIIQG
M9N748_ASHG1/3-140GQSIGAH------SCSNRG........................................FLDG.N..........TISEQ
Q6CQL1_KLULA/3-140AVGIRGG------SCTNDS........................................FTSG.N..........KIAEG
A3LZS1_PICST/3-141AAGIKVH------SCTNQS........................................YLKD.N..........NIVQG
A5DZR5_LODEL/3-141AAGIRAH------SCGNQD........................................YLDN.N..........NINQG
Q6BW56_DEBHA/3-141AAGIRCH------SCSNKD........................................YVDD.N..........NITQG
Q6CC67_YARLI/3-142ATAIRCH------SCGNMN........................................YVNS.N..........KVTQG
NCE2_SCHPO/8-147AVAIRVH------ACDNQK........................................YLDR.N..........HYTQG
Q0UPR7_PHANO/4-144AAYLGAH------SCSNRA........................................YTTS.N..........GVCNS
A2QGX8_ASPNC/4-145AAKLECH------SCSNDS........................................YTLN.N..........EITNG
A1CYK1_NEOFI/4-145AARLECH------SCSNDD........................................YTLH.N..........EITNG
Q0CDN4_ASPTN/4-145AAKLEAH------DCSNLD........................................YTLN.N..........SVTNG
A7EYJ0_SCLS1/3-139ASYLHVH------SCSNRR........................................YVLT.N..........QLTQG
Q1K6H5_NEUCR/2-147AAKLGTP------NCGNLAN......................................DHYGH.K..........WIAYG
A7EEJ3_SCLS1/3-132SVFIGR.------..................................................................L
Q2GNW8_CHAGB/8-120AAFLNG.------..................................................................L
A6R6A8_AJECN/9-127AVQIAT.------.................................................................DT
Q5KIU4_CRYNJ/9-146TAALGG.------...............................................................GMRC
Q0UHA4_PHANO/4-136AVRWNN.------...............................................................SWWG
A1C4R1_ASPCL/5-129GVWLPP.------..................................................................S
Q0CE97_ASPTN/5-131AAMLPP.------..................................................................P
A6QXF9_AJECN/2-128AAILPP.------.................................................................SA
A1DBK3_NEOFI/5-157AAKLDG.------...................................................................
A7TL81_VANPO/6-167AYQVGKH------HCRDRVTDTYNPKYG.....................SLADFNEYGGRYNE.F..........TNKYT
A0A024XRE8_YEASX/6-151AKAQGER------SCSNTNAD....................................GLYYNP.Y..........SGQYT
Q6FT38_CANGA/8-169AKVQGDD------GCHNRRSTTYEPHRG.....................SQEEFQATNGEYNP.F..........TGKYT
Q6CRJ1_KLULA/73-213ADNFSH.------...................................................SCNY...GSFFWTSSS
Q5AKB8_CANAL/5-134AAVIPSG------SC...............................................................GD
A3LNT7_PICST/7-132ADTFGSI------DC.................................................................
A3LNT6_PICST/7-132ADTFGSF------TC.................................................................
A5DIF4_PICGU/10-137ADVFGSA------SC.................................................N..........YTVYS
A5E332_LODEL/6-143ADGFPT.------HC.................................................GRY.....SAFDYYNY
Q6CD20_YARLI/9-145AAQRGPE------SCN.............................................FR.G..........WGNRY
Q5B418_EMENI/6-137VDANDRL------NCG.............................................SI.W..........RWGSI
A1CAJ4_ASPCL/6-137VDAIHKL------NCG.............................................SI.W..........QWHFV
Q0CKJ8_ASPTN/6-137VDALHKL------PCG.............................................GI.W..........SWHNV
A7UWP7_NEUCR/5-136VNWLHG.------VCG.............................................YV.F..........DWDNV
A7EHU9_SCLS1/5-136VDFIAPS------HCG.............................................SA.F..........RWFGR
A1C9J0_ASPCL/11-136AQDYSWH------AC...............................................................FW
Q5BAE2_EMENI/8-133AQDYNWH------NC...............................................................YL
Q5ATF8_EMENI/2-165AVLLRHT------DCSNAYYSEATWRNEL...................LSGGCVEIGDGIGCR.Y..........GGREE
A1C5S2_ASPCL/2-156AILLRGT------SCSKIETTWDNVI..........................LSGGCTTIDNQ.K..........TCMSS
Q2H380_CHAGB/3-168AYGLKDT------SNCSNYETMLYSPLLNQG...............SIKFGDKTGYGVAAGED.A..........TPESI
Q7S8H8_NEUCR/3-169AVETRGF------SCTDPTKAKKILDNNLLNQ..............GKRKYKGDWYYGILYGD.P..........SAETA
A0A024R4N0_HUMAN/168-313PLYQFD.------.................................................EKYGGQPRRSRDVSCSRS
Q96M12_HUMAN/91-236PLYQFN.------.................................................EKYGVQPWQTRDVSCSDR
CKLF5_HUMAN/29-152AKVQPQ.------...................................................P.........WPGLTP
Q0VEW4_MOUSE/19-132LVEGRG.------...................................................................
A0A024QYW3_HUMAN/19-131LVERGN.------...................................................................
A0A024R2L3_HUMAN/40-160ASKSYN.------...................................................................
CKLF2_HUMAN/82-198VRSRRS.------...................................................................
CLF2B_MOUSE/35-151LEARRE.------...................................................................
CKLF_RAT/13-127LIPETS.------...................................................................

PF04535

CSPL4_VITVI/42-189DQFDEY.CNRI.RLSLMFSYLAFVF-------
A2XND4_ORYSI/2-138.ADNLF.TDSA.AAAISMAFLAFLA-------
CSPL6_ORYSI/22-174DKFGSF.CNHG.GIALVSSFIGVAL-------
CSPL8_VITVI/27-183NVFDSF.CHHL.VASLALSFLGSLS-------
CSPL3_VITVI/15-155SSYGRF.CSRV.NLALALHALALCC-------
CSPL9_ORYSJ/22-162SYFGRF.CGAA.TVSVALNAAALLC-------
CSPL3_ORYSI/14-150RLYRRY.CNAG.AAALALSLAAVLL-------
CSPLO_ARATH/21-177GVFGKF.CNQA.AVSVAITLIASVV-------
CASP1_STRAF/38-187QQFNDF.CQRV.SGAVVAAFVAVVC-------
A2YQ71_ORYSI/48-177.VVNTF.TDVV.AASISFAFLAFAA-------
CSPL7_ARATH/24-174NMYGKF.CNQV.GEGIASALFACIG-------
CSPLV_ARATH/116-252WGADKF.PDLA.RASVALSYVSFVA-------
CSPLX_ARATH/26-166SSYPHY.CSKL.TIALGLHVFVLFF-------
CSPLS_ARATH/1-147YKFTRF.CFQM.GSAIILNYIAAAL-------
CSPL1_VITVI/23-179DKFESF.CHQG.GGALIPSFIALLL-------
CSPL3_ARATH/27-169SSYGGF.CHRA.TASVIITFFVVCF-------
CSPLM_ARATH/23-176HIYDKF.CRHV.GGAIAVSLFASVV-------
CSPLY_ARATH/143-279WGKDEF.TQMA.TASIAVSFLAFGA-------
A2ZVW2_ORYSJ/198-313FGKDPF.NKKI.NSAVWFSFIAFIG-------
CASP1_ORYSI/21-170QQFDSF.CERI.SGSLIGSFAAMVL-------
Q38HU1_SOLTU/29-159KVNH...CARF.MSATAMAFLSWFA-------
A5BVF2_VITVI/6-137PARL...CEKC.SSMRGLKLLHAQI-------
CASP3_ARATH/56-205QQFGDF.CQGT.SGAVVASFIAATL-------
CSPL6_VITVI/25-170GNVKMF.CDKA.LASILLSLIGFIC-------
CSPLL_ARATH/49-190DAIKTL.RNNS.IVSVSMSFSAFLV-------
CASP2_ARATH/40-189QQFGDF.CQKS.SGAVVSAFVSVVF-------
A5C3N9_VITVI/6-139.....................DWLV-------
CASP1_VITVI/37-186QQFDDF.CQSV.SGAVVASFIAAVL-------
CASP1_ARATH/42-191QQFGDF.CQNV.STAVVADSIAILF-------
CSPLR_ARATH/11-155GYVHGY.CSRV.TISLAMSFASFIL-------
CSPLP_ARATH/5-155TMYGKF.CNQM.AIGVSSALLASIA-------
CSPL1_SOLDE/21-170QQYTDF.CQRS.AGSLIGSFGAMAL-------
CSPL5_ARATH/17-172KTLSSF.CNHV.ALSLLLVFLSFIF-------
CASP2_VITVI/45-194QQFTDF.CQSV.SGAVVASFIAVVI-------
CSPL5_VITVI/24-179NVFGKF.CNQV.AVALGLSFFGGLA-------
A2Y3F2_ORYSI/54-186.ADNVF.TDSS.AASISMAFFAFLC-------
A2ZLT7_ORYSI/23-151HGGGTA.CVQG.DIAVGLGFAGFAA-------
CSPL8_ORYSI/4-146VQVPLF.CDRV.RSALVAGSATIVL-------
CSPL4_ARATH/6-136PPTI...CNRY.QFAATLAFLTWFL-------
CSPL6_ARATH/34-164AQNH...CVQF.ETSTALAFISWFA-------
CSPLK_ARATH/3-143GQVPKF.CDQI.TGALIAGFVALVL-------
CSPLW_ARATH/12-168DRFATY.CDHG.AGALIAAFAGVIL-------
Q259U2_ORYSA/7-126MQFHGF.CQRT.SGSVVASFLTVVI-------
CSPL1_ORYSI/65-214LQFHGF.CQRT.SGAVIASFLAVFV-------
CSPLD_ORYSJ/12-165NIYTRF.CEQV.AGSLVCAMLAAVG-------
CSPL2_ORYSI/36-185QQFTSF.CQRI.TASLVGSFAAAVV-------
CSPLJ_ARATH/30-168TANKAF.CLQS.DVAIGLGFAAFLF-------
A5C0X4_VITVI/7-154SNYNKF.FNKG.SAAASFILFAFLF-------
A2ZF82_ORYSI/6-157GEVVRF.FNMA.YAAAGLMLLAAAA-------
CSPLI_ORYSJ/2-153HAAGAF.CWRVTTSAIICAFAAAAV-------
A2XFN2_ORYSI/55-188.VINRF.TDTT.AAAISMAFLAFVS-------
CSPLC_VITVI/25-175NMYGKF.CNQV.GEGIVSAVGVSLS-------
CSPLV_ORYSJ/33-163SENH...CASF.ESATAMAFLSWFA-------
CSPLS_ORYSI/7-140RRYPQLPCGRF.ELAVALAFLSWAL-------
CASP3_ORYSI/20-169QQFDSF.CERI.SGSLIGSFAAMVV-------
CSPL1_MUSAC/29-185NLFGGL.CARV.NAAIVLSMLASVA-------
Q0JKN7_ORYSJ/252-388FGVDQF.AKLI.NASASMAFLAFVA-------
CSPLC_ORYSI/34-189KPLPRF.CDLS.AASIACAFLSCIF-------
CASP3_VITVI/22-171QQFKSF.CERI.SGSLIGSFGGIIL-------
CSPLR_ORYSI/6-138R.NPQLPCGRF.ELAIACAFLSWAF-------
CSPLG_ARATH/6-137SFEAE..CWKY.QLSVALAFLCWIT-------
CSPL2_GOSHI/2-154NKYTRF.CTQI.GGSLLCGFVASLL-------
CSPLQ_ORYSI/6-139RMYPQLSCGRY.ELSVILAFITWSF-------
CASP5_ARATH/22-171QQFNSF.CERI.SGSLIGSFIAIVL-------
CSPL8_ARATH/129-265WGKDEF.TEMA.SASIAMSFLAFLA-------
CSPLI_ARATH/6-139NTQSQYPCLRY.EVAVALSFVTWIQ-------
CSPLD_ARATH/31-185NVYDKF.CRYI.ATSLALSLFASLL-------
CSPLA_ARATH/41-170.QDNIF.TDSA.ASAISMAIFAFIA-------
BLE3_ORYSI/2-142GQIHAY.CNHV.MAALIAGFVALAV-------
A2X1J8_ORYSI/10-159NIYTRF.CEQA.AAGMLCSFLAAAG-------
CSPLA_VITVI/30-171SSFGGF.CQKT.TASISITFVTVLC-------
CSPL1_GOSHI/32-173GTFAGF.CHKA.TIAVVITFVAVIC-------
A5AM50_VITVI/551-679WGKDKF.PEMA.RASVWMSFLAFVA-------
CSPLQ_ARATH/12-168DRFTTY.CDHG.AGAIIAAFAGVIL-------
CSPL2_ARATH/45-194QQFDGF.CERI.SGSLIGSFCAVIL-------
N24_MEDTR/61-218HGADTF.IEMA.NASVSMSFLAFGA-------
CSPL7_ORYSJ/33-190NVYGKF.CRHI.GSSTFLALIAAIV-------
CSPLD_VITVI/40-195KPLRSF.CDHV.AASIAFTFFSCFL-------
CSPL2_VITVI/3-143DQVPNY.CNHV.TGALAAGFIGVVL-------
CSPLF_ARATH/41-196KSLGFF.CDHL.AGSIVFALFAFLL-------
CSPLU_ARATH/6-139RQQPALSCDRF.QISVGLSFFNWFL-------
CSPL9_ARATH/36-165NVNH...CTRF.ETATAMAFISWFA-------
CSPLE_ARATH/17-159DSYGSF.CHNA.LISVVFTFVVSLL-------
CSPLT_ARATH/6-134.......CDRY.KLSATMAFLSSFL-------

PF01284

A5DEX7_PICGU/3-141K...SGRCRKA-QASVAFLYFSVFIFLASLVF
Q6BHB0_DEBHA/4-133YYDTNRWCSLG-KAMIAFGLFNWVSFCVSLIL
Q0V4R6_PHANO/7-197VPQLNVRCKQS-QTDSIFMFLTVAICFATMLL
SYPL2_RABIT/30-232SAGATPSMGLA-NISVLFGFINFFLWAGNCWF
SYPH_RAT/15-216KELRDPVTSGL-NTSVVFGFLNLVLWVGNLWF
O57343_XENLA/15-218SELRDPVMSGL-NTSVAFGFLNCILWLGNVWF
SYPL1_MOUSE/28-233YFVSVTSMGSL-NVSVIFGFLNMILWGGNAWF
O44511_CAEEL/12-210FLSRDVNNGKL-AISVLANWVCVLCFAFNCWF
SNG1_HUMAN/20-167DNPLNEGTDAA-RAAIAFSFFSIFTWAGQAVL
SNG3_HUMAN/20-166GPATTQAGDAA-RAAIAFSFFSILSWVALTVK
A0A024R8T9_HUMAN/20-165PKDVLVGADSV-RAAITFSFFSIFSWGVLASL
SNG4_MOUSE/18-163SKHFLLGNSSA-KAAIALSFFSVPVWILQAYL
SNG4_HUMAN/18-163PKEFLLGSSSA-QAAIAFTFFSILVWIFQAYL
SNG1_CAEEL/21-169DDENPIKTNNA-KFGILSALLSFLAWGGAAFF
CKLF8_MOUSE/36-162.EKEGHNFNSW-AASSFFAFLVTICYAGNTYF
A0A024R6T3_HUMAN/32-160SLRGTRPYNQR-AAASFFACLVMIAYGVSAFF
A0A024R9E4_HUMAN/31-169PLLSDNQYNIN-VAASIFAFMTTACYGCSLGL
MALL_HUMAN/22-149KLLDPRIYYIN-SAASFFAFIATLLYILHAFS
A0A024RE19_HUMAN/18-145DGFTYRHYHEN-IAAVVFSYIATLLYVVHAVF
Q21228_CAEEL/44-191IHNGCRIIYEW-AFASFLTFILGIFYALTAFL
P83386_CAEEL/118-240....FRGTFAW-AIAAFFAFGAMCAYGFDCYL
Q95ZR6_CAEEL/49-177..WGTDGRGAA-IMTAVICVALTVLFAIETVV
Q9VZ71_DROME/43-166..ATGKGSGSN-TAAGVFGLFNFLAYAAGTYF
Q9VYX8_DROME/26-152.....VKHDAY-MAAGVLGLVNAVLYFISAFL
B3NVK8_DROER/30-167VRPGFWAYPAM-TACYYMGYAAGILHALDAYL
MYADM_MOUSE/25-151FLAHGRTRDHA-IAATTFSCVACLAYATEVAW
H2Q2D6_PANTR/26-160DYPLPCAYHAF-LAAAVCGGVCHGLYLLSALY
CKLF6_HUMAN/33-154.......TSAE-IAAIVFGFIASFMFLLDFIT
MALD3_MOUSE/168-355SGFNCGVHGGD-IGAGVFAAMAIGVFAVGAVL
OCLN_XENLA/38-244LYHYCVVEPQE-AIAIVLGFLIVVAFAIIIFF
OCLN_POTTR/42-242LYHYCMVDPQE-AVAIVCGFLTVILLCVICYF
OCLN_CHICK/48-247IYHYCTVDPQE-AVAAVCGFLIVILLCLICFF
A0A023ZMC9_YEASX/3-140S...SSRCHQS-QAAVAFFYFSCFLFLIKVTV
Q6FKV0_CANGA/3-140S...ERRCRES-QAAVAFFFFSMAIFLAKMIM
Q6FPZ8_CANGA/3-141S...GTRCRQA-QALVAFFYFSMAIFLAKMIM
A0A023ZJA9_YEASX/3-140S...GTRCRQA-QAAVAFLYFSCAIFLAKTLM
A7TRD3_VANPO/3-141S...TDRCRKA-QASIAFFYFSFFIFFVKVVM
M9N748_ASHG1/3-140S...TDRCRKV-QASSTFLFFSFFIFLAKAVF
Q6CQL1_KLULA/3-140S...KDRCRKA-QASTVFLYFSFAIFLVKFIL
A3LZS1_PICST/3-141K...ENRCRKA-QASVAFLYFSFFIFLASAVF
A5DZR5_LODEL/3-141S...TGRCRKA-QASTAFLYFSAFIFIFSGVF
Q6BW56_DEBHA/3-141S...SGRCRKA-QASVAFLYISFFIFVFSTVF
Q6CC67_YARLI/3-142S...KGRCRKA-QATVAFLFFANFSFLATMIL
NCE2_SCHPO/8-147S...MRRCQEL-KALCFFLWFMFGLYVASFIV
Q0UPR7_PHANO/4-144SANTEQNCRQA-QATCAFLWFGFAAFVATLAI
A2QGX8_ASPNC/4-145AHNRTKRCREA-QASTAFLWFAWAGYTASMIL
A1CYK1_NEOFI/4-145AHNRQKRCREA-QASVAFLWFAWAGYMASTII
Q0CDN4_ASPTN/4-145SVDPEKRCREA-QASTAFLWFTWAGYTASLVF
A7EYJ0_SCLS1/3-139S...TGRCREL-QAATAFIWFSFALFTASLAV
Q1K6H5_NEUCR/2-147SADDAKRCREI-QAGTVFMWLLLAAFSAALTL
A7EEJ3_SCLS1/3-132LFCRGSVCGAA-RADAVFGAFSWLLWMGSSAI
Q2GNW8_CHAGB/8-120LFCRGDVCHAA-QASVAFAAFSFAVWSASAAL
A6R6A8_AJECN/9-127CSTGISSCGLL-KVATVYGAFEWLLFMITAAQ
Q5KIU4_CRYNJ/9-146SVSDVAHCSSL-VAAEAFAWIEWIIMTIFFIF
Q0UHA4_PHANO/4-136YVGDNTFYSCG-VAAIVFSAFLWLTFVATTIL
A1C4R1_ASPCL/5-129EACHWGRCRAL-QAATVFGAFEWALFLATTVV
Q0CE97_ASPTN/5-131KYCHSGPCNAG-QAAVAFGAFEWALFLATSVY
A6QXF9_AJECN/2-128ACSRSSVCKGL-QAATVFGAFEWLLFVATTVL
A1DBK3_NEOFI/5-157...LGATSDYY-NAVIAFAVLSWLLFVALFVI
A7TL81_VANPO/6-167DKSFGRACNSL-KAATAFAGLNTVLFMVTCTL
A0A024XRE8_YEASX/6-151ADSHRRACNSS-QAAIAFSGLCFVLFLISVIL
Q6FT38_CANGA/8-169TNDYKRPCHTG-KASIAFAGLCFVLYLTSTII
Q6CRJ1_KLULA/73-213SDDWSVSCKAG-KAAAAFAAFAWLFFVVSFII
Q5AKB8_CANAL/5-134YGSYSSACSIS-KALIPFTLFNWLLFATSFGL
A3LNT7_PICST/7-132.FFLSDWCKIG-KALIPFGLFNWLLFAASLIL
A3LNT6_PICST/7-132..YSATWCKLG-KALIPFTLFNWLLFTATLIL
A5DIF4_PICGU/10-137YSFHSTGCRLS-KTFIAFGVLNWVLFLISLGL
A5E332_LODEL/6-143NGFDSSTCRAY-QAVLPFTLFNWFLFIASLVL
Q6CD20_YARLI/9-145LKDWGSSCKVA-KAYIAFAAITWLFFIFSTFF
Q5B418_EMENI/6-137TDDTY..CGRW-KAAQAFSFLSAIVWIVSALV
A1CAJ4_ASPCL/6-137GDHTT..CGRW-KAAEAFSFLSAIVWMASALV
Q0CKJ8_ASPTN/6-137VDNNE..CGRW-KAAEAFSFISAVVWLVSALV
A7UWP7_NEUCR/5-136GFNGVG.CGEW-KATVAFAFLSAICWLVSALV
A7EHU9_SCLS1/5-136YGGSS..CSRW-KADVAFAFLASLFFLASFLL
A1C9J0_ASPCL/11-136NAPPGLACSRK-RANEAFIFLAFFFTLLGMLL
Q5BAE2_EMENI/8-133NAPPYMNCSRK-KANESFIFLAFIFTFFGMLL
Q5ATF8_EMENI/2-165EGKLKSRCASA-KADTAFMFTSFVACIGIVGY
A1C5S2_ASPCL/2-156PSRLKSRCTSA-KADAAFMFIDFVVCIAVIAC
Q2H380_CHAGB/3-168MSALKGNCQRA-QADEILQFLCFGLGTALVGL
Q7S8H8_NEUCR/3-169WSRLQSSCKKG-LADEVFQFLAFAVLVVLLVV
A0A024R4N0_HUMAN/168-313HAYYVCAWDRR-LAVAILTAINLLAYVADLVH
Q96M12_HUMAN/91-236NPYLVCIWDRR-LAVTNLTAVNLLAYVGDLVY
CKLF5_HUMAN/29-152PGWHTPAAVPW-VPAPAPGFWSWLLW....FI
Q0VEW4_MOUSE/19-132........SSR-VVAGILGLLATLLFGYDAYI
A0A024QYW3_HUMAN/19-131........HSK-IVAGVLGLIATCLFGYDAYV
A0A024R2L3_HUMAN/40-160.......QSGL-VAGAIFGFMATFLCMASIWL
CKLF2_HUMAN/82-198......MNLHY-LLAVILIGAAGVFAFIDVCL
CLF2B_MOUSE/35-151......LPVPY-LTGMILMGVTAFISIIDLCL
CKLF_RAT/13-127........TMI-MVGGVFGFLTVICTVADCAL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window