Sequence alignment for CL0398

PF07522

Q296G1_DROPS/557-655PDLQSRLNDDPYQANLHVI.GMG......KVT....YLVLAEYFKQFEDQ......YDMLLAIRPSG..WEKNSK.....
Q9VND2_DROME/481-579PDLDSVLTEDRSGANLHVI.AMG......KIS....YPSLVDYFTEFEDQ......YDMLLGIRPSG..WEKNS......
Q16PI6_AEDAE/575-673PLQQQWLVEDPKFADIHVL.SMN......KLS....YDELVSYVEQFPDR......YDLLIALRPSG..WEKNS......
Q8RZQ7_ORYSJ/227-334SLIAPEIITEDPSCRFQIL.GFQ......NLY....DKACTKIEEARASL......QPEPLFIRPSTQWYAHCAQS....
Q7QDQ3_ANOGA/486-584SQQLSVLVADPNKANIHVL.AMN......KLS....YDELNEYMNQFPDR......YESVIAIRPSG..WEKNS......
A2EC29_TRIVA/231-334FAKPELFSEDPYLTRIHLL.PIQ......ECG....KEKVSLYAASMG........FDSVTAIRPSG..WNGRPFWRCPT
DCR1C_CHICK/239-345PEILYHITTD.RYTQIHAC.RHP......KDDDYVRGNRLPCGITCQNGT......PLHVISIKPSTMWFGERIKKTNVI
PSO2_SCHPO/403-529QDLIDLLTDDPTQASVHMV.TMM......GIH....PNSLLDYLEQYNSS......FDKIIGYKVTG..WTFQPL..ENR
DCR1A_CHICK/844-950AAVNSLITMNWDGTLLHIL.PMM......QIN....FKGLQDHLNKFSEN......FDQVLAFKPTG..WTYSDSCLSVM
Q4PDE9_USTMA/699-829PELHSMLTRSPL.ASVHVT.NLH......AIN....GEALRDVVAALRTHG...HDFTHAVAFRPTG..WTYKPP..AGM
Q6ZD68_ORYSJ/209-321SLVAPEILTDDSSSRFQVI.GFP......RLS....ERATEMLALARAKH......QPEPLIIRASSQWYAYYEPPEGST
Q4Q2L8_LEIMA/388-491EHLLSVFLVPMASVGYRAVAALA......HADG.PAVMDMEDGLALNLDR......YDQVLMVEPTG..WSKRCVAREVS
SNM1_ARATH/360-467DDISKNLSTDGKATCLHVL.PMS......SLK....VERLDEHLKIYREQ......YGAVLAFRPTG..WTYSEKIGEHL
DCR1A_MOUSE/900-1006PEVSSLITTDMCDSLVHLL.PMM......QIN....FKGLQSHLKKCGGK......YDQILAFRPTG..WTHSNNITSTA
A6RF66_AJECN/673-802SELSALITNNPVEAQVHMV.TMM......DVH....TGTLLDYLHSLKPH......FSRVVGFRPTG..WSYRPPAGRMT
Q8IK95_PLAF7/674-779KHILNKITDNKLEAQIHIV.DINYSYIFPKID....KRKFLNLIDEEIEK.....EFDSFYYIIPTG..WVKKFS.....
Q8LQQ4_ORYSJ/223-351DDNQEIFTTQTSLTRIRAV.PRY......SLT....IESLDALNT...........VCPTIGIMPSGIPWLWKNSKGKAK
A2GFK2_TRIVA/225-328YCSESCFTNDPTKTRVYLV.PIM......DCN....SVSASVWAKQNG........YSSVCAIAATG..WSGKAGWKNPQ
A7E8T1_SCLS1/835-964PELTSRLTSDPREAQIHMQ.MLM......ELR....PETLQDYLTGYKPH......FTRVVGFRPSG..WSYKPPNSRFV
DCR1C_DANRE/239-345PEILCHVTTN.RATQIHAC.RHP......KDEEFFRANRLPCGSTAPDGI......PLNIISIKPSTIWFGERTRKTSVV
A4S4B7_OSTLU/228-334PEERSAMTHDDSKTNLHVV.PMG......STS....FMKMASILKYYKSR......FDTVIAFRPTG..WTFSAQKKTAR
Q4YJX0_PLABA/192-297KDMLNRITGNKLEAEIHIV.DINYSYIFPKIE....KNKLRSLIDAEMED.....EFDSFYYIIPTG..WVKNYY.....
A7RZG8_NEMVE/216-320DFIQSVITTDKSEGRIHVL.PMG......KLN....HQHLSSYMDQFKGK......FTRVVAFKPTG..WEHKS...GPL
DCR1C_HUMAN/239-345PEILHHLTTD.RNTQIHAC.RHP......KAEEYFQWSKLPCGITSRNRI......PLHIISIKPSTMWFGERSRKTNVI
DCR1_DICDI/481-582CLDINKFTTNELITPFRAV.TMS......MLS....YHNMLSLLDSSNNK......YKRVIGFRPTG..WTQAKKSITYL
Q6C9D1_YARLI/448-581PVISELLTSDPLEAQVHLV.PLG......QTR....KDQLFEHLKSFKPH......FSKIVAFAPTG..WSYRPPKSAIQ
Q6CJP1_KLULA/366-495WFPEGLLTTDHKSSNVHLV.AMH..............TDLDKYLSQLSNM......FDSIVVFRPTG..WTFSNQYDKSY
Q6FR52_CANGA/556-712CFDNSLLTDDPSESQIHLV.SLK......VLR...DFNAIDNYLKTIKELTGNKIKYDNVFGFIPTG..WTFGNRYKKDF
C8VBT0_EMENI/673-800.ELSALLTDDPLQAQVHMQ.TLF......EIR....AETLCDYLDSMKPH......FTRVIGFRPTG..WTYRPPAGRTL
F1QNK4_DANRE/779-881..IGQRITTNWQSAQVHVL.PMM......QIN....FKNLQTHLKKFSKK......YDQLVAFKPTG..WTFNQTV..GV
F4IDZ7_ARATH/235-347.....EIVSEDPSSRFHIFSGFP......KLY....ERTSAKLAEARSKL......QSEPLIIRPSAQWYVCDDEDDWKS
Q5KDG6_CRYNJ/644-773PELHSMLTSDPIEAQVHLL.PLG......NIQ....LDRLQSYLTLLHPH......FDRVLGFRPTG..WSYSPPAGTDM
Q7XV88_ORYSJ/357-463.DLSKMICSDSQSSSLHVL.PLS......SLR....HENLQKYLETLKQR......FLAVLAFRPTG..WTFSEETGNQL

PF07521

A3HWA3_9BACT/389-434---------REVPVKAKIY----------QID------------------------------------------------
Q6YPU2_ONYPE/364-402---------THGPLI....----------NTH------------------------------------------------
A3DMW0_STAMF/351-395---------LDEPIKARLE----------WFD------------------------------------------------
B9LMH6_HALLT/567-612---------DTLTLQMGTE----------VVD------------------------------------------------
A9A2U6_NITMS/572-617---------EVVTINCGVE----------KLD------------------------------------------------
Q6AQL6_DESPS/454-499---------KDYPLRAHVV----------SLG------------------------------------------------
A6Q9T8_SULNB/394-438---------EDIRIKASMY----------TIN------------------------------------------------
Q5QU60_IDILO/378-424---------QWLPVKARIR----------SLE------------------------------------------------
RNJ2_STAA8/357-396---------HIIPNN...K----------KIH------------------------------------------------
Q3SMJ7_THIDA/400-445---------EDIKVRADIY----------TLG------------------------------------------------
A0Q181_CLONN/390-435---------EPIAVNAKIY----------NLE------------------------------------------------
Q6MLH4_BDEBA/379-424---------LYVEINCKVI----------PSD------------------------------------------------
A3CWJ1_METMJ/372-413---------KMAGVR.IFD----------ELH------------------------------------------------
Q5CRW9_CRYPI/395-437---------TCIEVRCNVK----------YLS------------------------------------------------
A8MJC1_ALKOO/394-439---------ENIAVLAEIH----------SIE------------------------------------------------
Q92Z81_RHIME/391-436---------DDIRVRARIR----------KLD------------------------------------------------
A4YH53_METS5/350-393---------SSPLLKARLQ----------MFD------------------------------------------------
A8ZWQ7_DESOH/348-388---------DVVYEK..IS----------DIH------------------------------------------------
Q6L180_PICTO/564-609---------VKIDINMSVE----------TAE------------------------------------------------
Q1J225_DEIGD/388-431---------EEVIVRAQVH----------TIG------------------------------------------------
Q8ZYD9_PYRAE/560-605---------SKINMRMEVV----------SIP------------------------------------------------
A4CGY6_ROBBH/384-429---------KTVSFKMQVA----------EIE------------------------------------------------
Q15V20_PSEA6/395-439---------DDYVVKAQIE----------TLG------------------------------------------------
Q2GQR7_CHAGB/705-747---------QTVSVQLRIA----------FVD------------------------------------------------
A6VTF2_MARMS/411-456---------ERYTIKAKVQ----------QIS------------------------------------------------
Q1IJR0_KORVE/403-448---------QIVPVRAQVA----------TLE------------------------------------------------
CPSF2_HUMAN/527-569---------ESIEIKARVT----------YID------------------------------------------------
Q7QC68_ANOGA/527-569---------KPIEVNAQVQ----------FID------------------------------------------------
A8ZYV1_DESOH/453-498---------KEYPLKARVE----------NIG------------------------------------------------
A1U408_MARAV/380-425---------EYWPVKAEIH----------NLD------------------------------------------------
INT11_DANRE/376-418---------ATLDVKLQVE----------YMS------------------------------------------------
A2FCF8_TRIVA/382-424---------KIIPRKISID----------YVS------------------------------------------------
Q11PK2_CYTH3/377-423---------RSIPVAAKII----------YTD------------------------------------------------
Q72BD6_DESVH/352-392---------DDPRVS..FH----------EIH------------------------------------------------
A4RR19_OSTLU/495-537---------REINIRATII----------TVD------------------------------------------------
A8A8E1_IGNH4/572-617---------YQLEVRSHVF----------SVE------------------------------------------------
A1RXC5_THEPD/356-399---------KRGPVKARIE----------WFD------------------------------------------------
A0RY50_CENSY/346-389---------KEMSVAAEVK----------QFQ------------------------------------------------
A1SFD7_NOCSJ/386-431---------RYVPVRAEIV----------DVP------------------------------------------------
A2SLK7_METPP/395-440---------EYVAVKATVS----------HLE------------------------------------------------
Q6L0H4_PICTO/338-380---------ATIKPSMKID----------FFD------------------------------------------------
A2BK26_HYPBU/354-396---------TEEPVRARVE----------WLD------------------------------------------------
Q4JB02_SULAC/554-599---------ENIKVNMEIG----------VVE------------------------------------------------
Q21X11_ALBFT/381-426---------HDVELQAEVV----------QLQ------------------------------------------------
Q2G602_NOVAD/352-392---------RIVTDR..QS----------MIH------------------------------------------------
A4CMY8_ROBBH/382-427---------KYIRVAAGIH----------HYE------------------------------------------------
A0CN06_PARTE/362-404---------KDYDIKMQIN----------NMS------------------------------------------------
Q2S180_SALRD/393-435---------GPQPVYCTVE----------RFR------------------------------------------------
Q5FUV1_GLUOX/357-397---------TVLTDK..DA----------KVH------------------------------------------------
CPSF2_DICDI/549-591---------LRLPINCKIQ----------TID------------------------------------------------
B4SF65_PELPB/390-434---------RRYPVRATVH----------TIG------------------------------------------------
A7H6H0_ANADF/351-391---------QVAYEG..LR----------PLH------------------------------------------------
Q8SUC3_ENCCU/370-412---------ESREIRLEVK----------NLA------------------------------------------------
Q7UMQ3_RHOBA/426-471---------RRYDVRAKTH----------QLT------------------------------------------------
Q0W8H2_UNCMA/361-406---------EIVKLRCQLE----------QYS------------------------------------------------
O29718_ARCFU/336-381---------RVVKLKMGVE----------QYD------------------------------------------------
A0JWK6_ARTS2/384-429---------EDVRIRAEVI----------QME------------------------------------------------
A2SRA0_METLZ/372-414---------LMRQGARIFD----------GLH------------------------------------------------
A4X4Q7_SALTO/365-404---------V...VHKDVA----------KVH------------------------------------------------
A4XI93_CALS8/375-417---------KEYEVKCKVE----------KYG------------------------------------------------
Q74HX7_LACJO/271-311---------EKRGIE..LI----------TLR------------------------------------------------
Q88M01_PSEPK/406-451---------QMYEIRAKVV----------TVG------------------------------------------------
A8BNK1_GIAIC/411-453---------GYADAKMRIE----------ELS------------------------------------------------
CPSF2_CAEEL/561-603---------NRVEVSCRIE----------FIE------------------------------------------------
A8AB05_IGNH4/307-346---------VVRPPELHLQ----------...------------------------------------------------
Q73MR4_TREDE/395-441---------EWHQVRAEIL----------QIN------------------------------------------------
A2D958_TRIVA/390-432---------VDIIIKCKVE----------RIS------------------------------------------------
Q8TW11_METKA/576-622---------ETLRIELRVE----------TVS------------------------------------------------
B3E8Q6_GEOLS/356-396---------VRPGVR..YV----------YAH------------------------------------------------
Q0ABE3_ALKEH/391-435---------ETVRVGAQIH----------TVG------------------------------------------------
Q0W2D5_UNCMA/562-607---------EIMKINLQVT----------TVD------------------------------------------------
Q8ZTD5_PYRAE/353-396---------TTIKVEARLE----------WFD------------------------------------------------
Q18IP5_HALWD/407-449---------IHVPTE.WIH----------EIG------------------------------------------------
Q4AAN8_MYCHJ/355-394---------KENGPD...G----------YLH------------------------------------------------
Q5NZR0_AROAE/397-442---------ERHPIRAQIH----------QVG------------------------------------------------
Q9CF63_LACLA/351-391---------GVMKML..AS----------DLK------------------------------------------------
A8AA34_IGNH4/357-398---------PR..VEARTQ----------WFD------------------------------------------------
Q74MJ3_NANEQ/562-605---------QLIKINLEVR----------SFE------------------------------------------------
A8MC21_CALMQ/353-396---------EEIRVNAKVY----------WFD------------------------------------------------
Q9HMJ7_HALSA/343-385---------RVLPVSAQVE----------QYD------------------------------------------------
Q8IL83_PLAF7/430-472---------KVVKRKCRFE----------QIS------------------------------------------------
A4S2Z0_OSTLU/356-394---------AMGRED....----------CLH------------------------------------------------
A5IZC2_MYCAP/356-395---------KVMELN....----------NFE------------------------------------------------
A5N1D0_CLOK5/381-423---------KVIPVNCKVK----------NVG------------------------------------------------
A6TST8_ALKMQ/367-409---------YAKNNNMDII----------DLH------------------------------------------------
C4YZ38_9RICK/359-397---------.VITER..DH----------FVH------------------------------------------------
E4XDJ0_OIKDI/543-582---------EQVSIRCSIE----------FIN------------------------------------------------
E7LXW1_YEASV/359-399---------.TIPRRCQVE----------EIS------------------------------------------------
J9ZAT5_LEPFM/395-437---------..KDVRLALH----------SIN------------------------------------------------
M3ZV83_XIPMA/104-144---------.KLPLKMSVD----------YIS------------------------------------------------
Q04EG7_OENOB/361-399---------.VVSIK...D----------NLR------------------------------------------------
Q24X11_DESHY/399-444---------EKVAVRANIR----------RME------------------------------------------------
Q3AAG6_CARHZ/389-433---------EEIAVKAEVY----------HYD------------------------------------------------
Q63J01_BURPS/378-422---------EYVRVRAQVQ----------MIS------------------------------------------------
Q6LXH0_METMP/351-391---------..IPVNGKVV----------KIE------------------------------------------------
Q6LZD5_METMP/563-604---------..VKVNLSVH----------TLE------------------------------------------------
Q81SC3_BACAN/349-388---------ERIGKECRVK----------RVP------------------------------------------------
Q8TGX4_METAC/348-389---------...ALKPKIE----------QYD------------------------------------------------
Q8U1V4_PYRFU/370-408---------...GVR.MIK----------NLH------------------------------------------------
R7D7I2_9FIRM/391-435---------ETVAVGAEIR----------QMP------------------------------------------------

PF07522

Q296G1_DROPS/557-655....PS..........................................YGRRISIIGIEYSEHSSYKELERFVRFI-KPR
Q9VND2_DROME/481-579...KPS..........................................YGKRISTIGIEYSEHSSYKELERFVRFL-KPK
Q16PI6_AEDAE/575-673...RPQ..........................................YRGRINIVGVEYSEHSSFNELKRFVRYL-RPQ
Q8RZQ7_ORYSJ/227-334......QKPS..................................LTEAVLDGCGVWHICFSIHSSRDELEQALELL-QPQ
Q7QDQ3_ANOGA/486-584...KPQ..........................................YRGRINIVGIEYSEHSSFDELKRFVQFL-RPH
A2EC29_TRIVA/231-334FDIYNE............................................IKVTSYDVPYSDHSSPMELTEFVKAV-KPA
DCR1C_CHICK/239-345VRTGES................................................TYRACFSFHSSYSEIMDFLSYI-RPV
PSO2_SCHPO/403-529AQLSSSLDSIISRPPK.....................FVEYDLRAIRGSTDKVAAFVAPYSEHSSFYDLTMFCLSM-NIG
DCR1A_CHICK/844-950D.IKPQ..........................................TRGNITIYGIPYSEHSSYLEMKRFVQWL-KPQ
Q4PDE9_USTMA/699-829DTVSPSLDRLIQWNQSR...................SFTFHNLLPTRDSTPDYMIYGVPYSEHSSFFELTAFALST-RYD
Q6ZD68_ORYSJ/209-321K.....RKPA..................................LTEPMRDEFGVWHVCFSMHSSREELEQALRFI-QPK
Q4Q2L8_LEIMA/388-491E..................................................KYTLLRVPYSEHCAFHELLEFVAFV-NPA
SNM1_ARATH/360-467DLIKPT..........................................SRGKITIYGVPYSEHSSFTELREFVQFL-RPD
DCR1A_MOUSE/900-1006D.IIPQ..........................................TRGNISIYGIPYSEHSSYLEMKRFVQWL-KPQ
A6RF66_AJECN/673-802D..SPTVSSVLYSDSWKP..................RFATKDLIPQRGSNQISSCYSVPYSEHSSFRELTMFCCAL-RIT
Q8IK95_PLAF7/674-779......F........................................YERNNISIFLIPYSEHSNLDELKNFVKSI-KPC
Q8LQQ4_ORYSJ/223-351SGVKSPAKSIRCKGLDEG..................AIEMDYDPLSPPKLFEKDSYSLPYSEHACFAELENFMLIV-RPS
A2GFK2_TRIVA/225-328ITYQGP............................................IKVTLYEVPYSDHSSPQELLNFVKVV-KPK
A7E8T1_SCLS1/835-964D..SPPIHTILNASNWRS..................EYDMGELIPQRGSTKEAQCFGVPYSEHSSFRELTMFVMGL-RIE
DCR1C_DANRE/239-345VKMGSS................................................SYRACFSFHSSYLEVKDFLSYI-CPV
A4S4B7_OSTLU/228-334ATSRRQ...........................................RGRLIQYGLPYSEHSSLNELREFVRFM-NPK
Q4YJX0_PLABA/192-297......F........................................YEKNNMSVFLIPYSEHSNLDELKDFVKSI-KPC
A7RZG8_NEMVE/216-320SATRPV..........................................TKGPISIYGVPYSEHSSYEEMKRFVQFT-RPT
DCR1C_HUMAN/239-345VRTGES................................................SYRACFSFHSSYSEIKDFLSYL-CPV
DCR1_DICDI/481-582N................................................RGPTTFYSVAYSEHSSFNELRDCIDHF-RPT
Q6C9D1_YARLI/448-581ANEQATDLRPSYYDFGDLE................YNVENLDRNLERSAIEPVQKYNVPYSEHSSFVELRAFCLNM-AAT
Q6CJP1_KLULA/366-495TLWDEFERKNWVKDTLSGE................TPFAIDYFTKQKRSQGKIYHFNVPYSEHSSFKDLCLFSTKL-KWD
Q6FR52_CANGA/556-712QYDGELSYDDNFKLRVKYCMDLLKQDEARPTQNFADVSSLEWLRMQYKPRERYQIFRVPYSEHSSFRELLKFCISV-PSK
C8VBT0_EMENI/673-800E..NPPVSTVLYSSHWKT..................PFSVRDLTPQRGSTRESACFGVPYSEHSSFRELTMFCCAL-RIG
F1QNK4_DANRE/779-881DDILPQ..........................................TQGNISIYGIPYSEHSSFLELKRFVQWL-RPK
F4IDZ7_ARATH/235-347GSIQKQRKVR..................................FSEAVKDEFGLWHVCYSMHSSRAELESAMQLL-SPK
Q5KDG6_CRYNJ/644-773LP...DVNTIIRRDQAR...................RFGEGDLKTMRGSSRNFMMYGVPYSEHSSFFELTCFALSL-PGA
Q7XV88_ORYSJ/357-463DLIKPS..........................................SRGKITIYGVPYSEHSSFSELREFVMFL-RPQ

PF07521

A3HWA3_9BACT/389-434----------------------------------------------------------GLSAHADQEELMDWAEGFTDR.
Q6YPU2_ONYPE/364-402----------------------------------------------------------.VSGHGNQNDLKLMLSLT.KP.
A3DMW0_STAMF/351-395----------------------------------------------------------.LSSHAGKDGLISIIQRY.KNT
B9LMH6_HALLT/567-612----------------------------------------------------------GFSGHADRQGLENFVKTMNPR.
A9A2U6_NITMS/572-617----------------------------------------------------------GFSGHSDYNQLMSFVQRLRPK.
Q6AQL6_DESPS/454-499----------------------------------------------------------GLSGHGDRDEMTRVLKDSNLN.
A6Q9T8_SULNB/394-438----------------------------------------------------------GFSAHADQNGIIKWVKDIEDL.
Q5QU60_IDILO/378-424----------------------------------------------------------GLSGHADYQEIADWLEQSSLKP
RNJ2_STAA8/357-396----------------------------------------------------------.ASSHGCMEELKMMINIM.KP.
Q3SMJ7_THIDA/400-445----------------------------------------------------------GLSAHADRSALLGWLGHFTNK.
A0Q181_CLONN/390-435----------------------------------------------------------GLSGHADRNGLVDWIDKLMVR.
Q6MLH4_BDEBA/379-424----------------------------------------------------------SFSAHADRSDLMTWLKQAPEI.
A3CWJ1_METMJ/372-413----------------------------------------------------------.VSGHAYREDHYEFLHLL.NP.
Q5CRW9_CRYPI/395-437----------------------------------------------------------.FSSHADSIGIQSLISHS.EP.
A8MJC1_ALKOO/394-439----------------------------------------------------------GFSGHIDQPGILDWLQGFKKK.
Q92Z81_RHIME/391-436----------------------------------------------------------IYSGHADGSELADWVRARQPI.
A4YH53_METS5/350-393----------------------------------------------------------.FSSHAGKNQLLDIVKTSEAL.
A8ZWQ7_DESOH/348-388----------------------------------------------------------.VSGHAFREELIEMMQMV.NP.
Q6L180_PICTO/564-609----------------------------------------------------------GFSGHSNKAQLLNYIATMQPK.
Q1J225_DEIGD/388-431----------------------------------------------------------GFSAHADQDDLLTFLADTGNP.
Q8ZYD9_PYRAE/560-605----------------------------------------------------------GFSGHSDRRELMKYVEHMEPK.
A4CGY6_ROBBH/384-429----------------------------------------------------------GLSAHADHAELLDWLSDIKIQ.
Q15V20_PSEA6/395-439----------------------------------------------------------GFSAHAGQNELVEWVSHFENN.
Q2GQR7_CHAGB/705-747----------------------------------------------------------.FSGLHDKRSLNMLIPLI.QP.
A6VTF2_MARMS/411-456----------------------------------------------------------GYSAHAGQRDLLNFIKRMRVK.
Q1IJR0_KORVE/403-448----------------------------------------------------------QFSDHADTSELLEWLHTFKKA.
CPSF2_HUMAN/527-569----------------------------------------------------------.YEGRSDGDSIKKIINQM.KP.
Q7QC68_ANOGA/527-569----------------------------------------------------------.FEGRSDGESLLKILSQL.RP.
A8ZYV1_DESOH/453-498----------------------------------------------------------GFSAHADKHELMRFVKKSNLD.
A1U408_MARAV/380-425----------------------------------------------------------SMSAHGDYQEILQWLEQGSLK.
INT11_DANRE/376-418----------------------------------------------------------.FSAHADAKGIMQLIRMA.EP.
A2FCF8_TRIVA/382-424----------------------------------------------------------.FSGHADFNQTSRFITEL.KP.
Q11PK2_CYTH3/377-423----------------------------------------------------------IFSGHTDVNGLIKYLGHQDKAK
Q72BD6_DESVH/352-392----------------------------------------------------------.TSGHAFRQDLKRYANAI.NP.
A4RR19_OSTLU/495-537----------------------------------------------------------.FEGKADGKSVRTLITQA.AP.
A8A8E1_IGNH4/572-617----------------------------------------------------------GFSGHSSRSELINWVKSVTPR.
A1RXC5_THEPD/356-399----------------------------------------------------------.FSAHCGHSELVKTLDSAKKG.
A0RY50_CENSY/346-389----------------------------------------------------------.FSGHSDRTELFEMIKSIKGD.
A1SFD7_NOCSJ/386-431----------------------------------------------------------YFSVHADADDIVGWLGRAPEP.
A2SLK7_METPP/395-440----------------------------------------------------------GFSGHADADGLMEWLRGFETP.
Q6L0H4_PICTO/338-380----------------------------------------------------------.LSAHAGHSDLVKFIKDI.DP.
A2BK26_HYPBU/354-396----------------------------------------------------------.FSSHADRNGLLDVVRTT.KP.
Q4JB02_SULAC/554-599----------------------------------------------------------GFSGHSDRRQLLAFLRNLNVK.
Q21X11_ALBFT/381-426----------------------------------------------------------SASAHADASQLLAWLRTMPQA.
Q2G602_NOVAD/352-392----------------------------------------------------------.VSGHPGRPELMALYEWL.RP.
A4CMY8_ROBBH/382-427----------------------------------------------------------SLSAHADQEEILWWTAGMENQ.
A0CN06_PARTE/362-404----------------------------------------------------------.FSAHADSRGIIQLVNHL.QP.
Q2S180_SALRD/393-435----------------------------------------------------------.FSGHSDRRELLSLVERM.TP.
Q5FUV1_GLUOX/357-397----------------------------------------------------------.TSGHATSEDIRTLYRIV.RP.
CPSF2_DICDI/549-591----------------------------------------------------------.YEGCSDGRSIKAIIQQI.AP.
B4SF65_PELPB/390-434----------------------------------------------------------GLSAHGDQNDLLRWMGGFTNK.
A7H6H0_ANADF/351-391----------------------------------------------------------.VSGHAQEAEQRRLIALA.RP.
Q8SUC3_ENCCU/370-412----------------------------------------------------------.FSAHADAPGILNVVEQC.SP.
Q7UMQ3_RHOBA/426-471----------------------------------------------------------GYSAHGDQEDLIALVEGMTDA.
Q0W8H2_UNCMA/361-406----------------------------------------------------------.FSAHSGESELKAIVKHMVDRG
O29718_ARCFU/336-381----------------------------------------------------------.FSAHADDRQLKEYVKRVVDRG
A0JWK6_ARTS2/384-429----------------------------------------------------------SLSAHADSDGLIEWMRAAARE.
A2SRA0_METLZ/372-414----------------------------------------------------------.VTGHAYYQEHYDLLSML.NP.
A4X4Q7_SALTO/365-404----------------------------------------------------------.VSGHAPAGELLYLLNIV.RP.
A4XI93_CALS8/375-417----------------------------------------------------------.LSAHADRDSILGFLAML.KP.
Q74HX7_LACJO/271-311----------------------------------------------------------.CSGHADVAELKEIIAGF.EP.
Q88M01_PSEPK/406-451----------------------------------------------------------GFSGHADQAGLVGFVNAMSRV.
A8BNK1_GIAIC/411-453----------------------------------------------------------.FSAHSDYNQTLDVLRKT.RP.
CPSF2_CAEEL/561-603----------------------------------------------------------.YEGISDGESTKKLLAGL.LP.
A8AB05_IGNH4/307-346----------------------------------------------------------.ISRHATRQELLQFISLT.KA.
Q73MR4_TREDE/395-441----------------------------------------------------------AFSAHADYFESREWLDSLKNPK
A2D958_TRIVA/390-432----------------------------------------------------------.FSAHADQFEIISLCDRV.RP.
Q8TW11_METKA/576-622----------------------------------------------------------GFSGHGDKIELTKYVRSIRPSP
B3E8Q6_GEOLS/356-396----------------------------------------------------------.TSGHAPVEDLQRLVKAV.KP.
Q0ABE3_ALKEH/391-435----------------------------------------------------------GLSAHADQRELMAWYEGFRDH.
Q0W2D5_UNCMA/562-607----------------------------------------------------------GFSGHSDRRQLMEYVKRMDPR.
Q8ZTD5_PYRAE/353-396----------------------------------------------------------.FSAHAGRRELEEFVKRFTPE.
Q18IP5_HALWD/407-449----------------------------------------------------------GMSAHAGANDLLSFARQV.NP.
Q4AAN8_MYCHJ/355-394----------------------------------------------------------.TSGHAYKAEHEKIFQLT.KP.
Q5NZR0_AROAE/397-442----------------------------------------------------------GYSAHAGQADLLRFVAGIPEM.
Q9CF63_LACLA/351-391----------------------------------------------------------.ISGHANARDLQFLLDIF.RP.
A8AA34_IGNH4/357-398----------------------------------------------------------.FSSHAGASELLEIIKSVNKL.
Q74MJ3_NANEQ/562-605----------------------------------------------------------GFSGHADKGEIESFLRRVRPG.
A8MC21_CALMQ/353-396----------------------------------------------------------.FSAHSGLEELINFISYFKDE.
Q9HMJ7_HALSA/343-385----------------------------------------------------------.FSAHADHAGLRAFLDDYRDA.
Q8IL83_PLAF7/430-472----------------------------------------------------------.FSAHSDFNQTKTFIEKL.KC.
A4S2Z0_OSTLU/356-394----------------------------------------------------------.SSGHGYKDELDEVIKLL.KP.
A5IZC2_MYCAP/356-395----------------------------------------------------------FFHHHPAREDLAKLINIL.KP.
A5N1D0_CLOK5/381-423----------------------------------------------------------.LSAHSDKSEIKSLINFL.SP.
A6TST8_ALKMQ/367-409----------------------------------------------------------.TSGHAHIDSLKKVIRSS.GA.
C4YZ38_9RICK/359-397----------------------------------------------------------.VSGHPSIDELQKMYSLI.RP.
E4XDJ0_OIKDI/543-582----------------------------------------------------------.FEGRVDGESQLQLLSTI.KP.
E7LXW1_YEASV/359-399----------------------------------------------------------.FAAHVDFQENLEFIEKI.SA.
J9ZAT5_LEPFM/395-437----------------------------------------------------------GFSAHADQADLLKWCGSMKIP.
M3ZV83_XIPMA/104-144----------------------------------------------------------.FSAHTDYQQTSEFIRAL.KP.
Q04EG7_OENOB/361-399----------------------------------------------------------.SSGHASQNDLQFMLNFI.KP.
Q24X11_DESHY/399-444----------------------------------------------------------GLSAHADQPQLLEWLSCLGED.
Q3AAG6_CARHZ/389-433----------------------------------------------------------GLSAHADQRELLAFIGRFSQK.
Q63J01_BURPS/378-422----------------------------------------------------------SLSAHADYGEILGWLGAQSSA.
Q6LXH0_METMP/351-391----------------------------------------------------------.FSAHADYNSLLRFMKKIPQP.
Q6LZD5_METMP/563-604----------------------------------------------------------GFSGHSDRKQLIKYLRKL.KPI
Q81SC3_BACAN/349-388----------------------------------------------------------.YKVHQSIRDVKEMLNTL.LP.
Q8TGX4_METAC/348-389----------------------------------------------------------.FSAHSGDSELKKLVKDFCKKG
Q8U1V4_PYRFU/370-408----------------------------------------------------------.VSGHASKEDHRYLIRML.NP.
R7D7I2_9FIRM/391-435----------------------------------------------------------GISGHADVNGLMTWIKAFKEK.

PF07522

Q296G1_DROPS/557-655..RIISTVPVGR
Q9VND2_DROME/481-579..RVISTVPVGR
Q16PI6_AEDAE/575-673..EVISTVPYGN
Q8RZQ7_ORYSJ/227-334..WVISTTPPCF
Q7QDQ3_ANOGA/486-584..EVISTVPYGN
A2EC29_TRIVA/231-334..KVIPTTTKNK
DCR1C_CHICK/239-345..NVYPNVLPVG
PSO2_SCHPO/403-529..HIIPTVNVGS
DCR1A_CHICK/844-950..KIIPTVNVGD
Q4PDE9_USTMA/699-829..RIIATVNVGS
Q6ZD68_ORYSJ/209-321..WVISTTPPCM
Q4Q2L8_LEIMA/388-491..RVVPTVSEEG
SNM1_ARATH/360-467..KIIPTVNNGN
DCR1A_MOUSE/900-1006..KIIPTVNVGS
A6RF66_AJECN/673-802..KVIPTVNVGS
Q8IK95_PLAF7/674-779..NILPTVFYNE
Q8LQQ4_ORYSJ/223-351..TVIGIVSTSF
A2GFK2_TRIVA/225-328..KLVSTTSRSQ
A7E8T1_SCLS1/835-964..KVVPTVNVGT
DCR1C_DANRE/239-345..NIYPNVIPLG
A4S4B7_OSTLU/228-334..FIFPHVNNDG
Q4YJX0_PLABA/192-297..SICPTVFSNI
A7RZG8_NEMVE/216-320..KIVPTVNVHS
DCR1C_HUMAN/239-345..NAYPNVIPVG
DCR1_DICDI/481-582..QIIPTVDCDS
Q6C9D1_YARLI/448-581..TIIPTVNMSA
Q6CJP1_KLULA/366-495..KIIPTVNLSQ
Q6FR52_CANGA/556-712..NIISTVNVDN
C8VBT0_EMENI/673-800..RIIPTVNVG.
F1QNK4_DANRE/779-881..KIIPTVNVG.
F4IDZ7_ARATH/235-347..WVVSTVPSC.
Q5KDG6_CRYNJ/644-773DLKMIATVNVGN
Q7XV88_ORYSJ/357-463..KVIPTVNVGN

PF07521

A3HWA3_9BACT/389-434PKITFIIHGEEQ
Q6YPU2_ONYPE/364-402.KYFIPVHGEHR
A3DMW0_STAMF/351-395LKNIIIVHGEPD
B9LMH6_HALLT/567-612PEKVLCVHGDES
A9A2U6_NITMS/572-617LRRVLVNHGERK
Q6AQL6_DESPS/454-499VKSIALVHGEVE
A6Q9T8_SULNB/394-438.QRIFLIHGEEE
Q5QU60_IDILO/378-424NTPIQLVHGELD
RNJ2_STAA8/357-396.EYFIPVQGEFK
Q3SMJ7_THIDA/400-445PRRVFVVHGEED
A0Q181_CLONN/390-435PKEILLVHGDTK
Q6MLH4_BDEBA/379-424PKRMFLVHGEPV
A3CWJ1_METMJ/372-413.QHVIPSHGDIG
Q5CRW9_CRYPI/395-437.QSIAFVHGERH
A8MJC1_ALKOO/394-439PKKIFLVHGEED
Q92Z81_RHIME/391-436SAGVFLVHGEDE
A4YH53_METS5/350-393.EKIVVVHASPD
A8ZWQ7_DESOH/348-388.TYFIPVHGERR
Q6L180_PICTO/564-609PQRILVNHGDGD
Q1J225_DEIGD/388-431..RVWLIHGEVP
Q8ZYD9_PYRAE/560-605PKKIVLIHGEPS
A4CGY6_ROBBH/384-429PEKIFIVHGERE
Q15V20_PSEA6/395-439.PKVVLVHGEPK
Q2GQR7_CHAGB/705-747.RKLILVAGAEE
A6VTF2_MARMS/411-456PQKIHLVHGDNN
Q1IJR0_KORVE/403-448PSQTWLVHGEPD
CPSF2_HUMAN/527-569.RQLIIVHGPPE
Q7QC68_ANOGA/527-569.RRVVVVRGSPA
A8ZYV1_DESOH/453-498IRRAVVVHGEKE
A1U408_MARAV/380-425PEKVYVTHGEAV
INT11_DANRE/376-418.RNMLLVHGEAK
A2FCF8_TRIVA/382-424.KRIVLIHGVCG
Q11PK2_CYTH3/377-423LKKIFLVHGEHQ
Q72BD6_DESVH/352-392.KLLVPIHTEKK
A4RR19_OSTLU/495-537.RRVVLVHGDAK
A8A8E1_IGNH4/572-617PKNIILNHGEPS
A1RXC5_THEPD/356-399.SKVVLVHGEEE
A0RY50_CENSY/346-389.PEVLTVHGDRE
A1SFD7_NOCSJ/386-431PEIVYVVHGEPA
A2SLK7_METPP/395-440PERCFVVHGEPV
Q6L0H4_PICTO/338-380.GTVVLCHGDQR
A2BK26_HYPBU/354-396.RYIVVVHSEAD
Q4JB02_SULAC/554-599PKNLVLNHGEPS
Q21X11_ALBFT/381-426PDQVYVTHGEWG
Q2G602_NOVAD/352-392.EILVPVHGEIR
A4CMY8_ROBBH/382-427PGHIFLVHGEPT
A0CN06_PARTE/362-404.KSIAFVHGEYH
Q2S180_SALRD/393-435.ETVLLIHGDPD
Q5FUV1_GLUOX/357-397.KYSIPTHGEWR
CPSF2_DICDI/549-591.TKLVLIRGSEQ
B4SF65_PELPB/390-434PE.VFVVHGDQP
A7H6H0_ANADF/351-391.EHFVPIHGEYR
Q8SUC3_ENCCU/370-412.RNVMLVHGEKS
Q7UMQ3_RHOBA/426-471PKEIRLVHGDYA
Q0W8H2_UNCMA/361-406TTDVFCVHGDRT
O29718_ARCFU/336-381AEVVFTIHGEET
A0JWK6_ARTS2/384-429PRMTYITHGEPE
A2SRA0_METLZ/372-414.EHIIPSHGPFA
A4X4Q7_SALTO/365-404.SNLMPVHGEWR
A4XI93_CALS8/375-417.KTVVFAHGSEE
Q74HX7_LACJO/271-311.KILAPVHTLHP
Q88M01_PSEPK/406-451PGRVVLVHGEQR
A8BNK1_GIAIC/411-453.RNVAFIHGSEK
CPSF2_CAEEL/561-603.RQIIVVHGSRD
A8AB05_IGNH4/307-346.KEVYLVHGDEE
Q73MR4_TREDE/395-441LKTIFLVHGEPK
A2D958_TRIVA/390-432.SKVVTIHGDKP
Q8TW11_METKA/576-622PSKVFTNHGEPR
B3E8Q6_GEOLS/356-396.RQLVPVHTEFP
Q0ABE3_ALKEH/391-435.PPIALVHGESG
Q0W2D5_UNCMA/562-607PERIITNHGDEN
Q8ZTD5_PYRAE/353-396.TKIILVHTDPL
Q18IP5_HALWD/407-449.QGISLIHGPPN
Q4AAN8_MYCHJ/355-394.KYFFPYHGEYR
Q5NZR0_AROAE/397-442PAEIRIVHGDDE
Q9CF63_LACLA/351-391.KNLIPIQGEYR
A8AA34_IGNH4/357-398.KKVIIVHSEES
Q74MJ3_NANEQ/562-605..RVVINHGERS
A8MC21_CALMQ/353-396.TNILIVHSSPR
Q9HMJ7_HALSA/343-385..TVLVNHGDDC
Q8IL83_PLAF7/430-472.PNVVLVHGDKN
A4S2Z0_OSTLU/356-394.EHFLPVHGEYA
A5IZC2_MYCAP/356-395.EYVIPVQGLYR
A5N1D0_CLOK5/381-423.RNIFIVHGNED
A6TST8_ALKMQ/367-409.KKIIPIHTERS
C4YZ38_9RICK/359-397.NICIPVHGEP.
E4XDJ0_OIKDI/543-582.KELILIRT...
E7LXW1_YEASV/359-399.PNIILVHGEA.
J9ZAT5_LEPFM/395-437.DRVFLVHGEHR
M3ZV83_XIPMA/104-144.PHVILVHGEQ.
Q04EG7_OENOB/361-399.DYFFPVSGEYR
Q24X11_DESHY/399-444AENIILVHGEPD
Q3AAG6_CARHZ/389-433PAQIYLVHGED.
Q63J01_BURPS/378-422PARTFVTHGEP.
Q6LXH0_METMP/351-391.DKAIVMHGER.
Q6LZD5_METMP/563-604PDRILTVHGE..
Q81SC3_BACAN/349-388.EHTVLVHA...
Q8TGX4_METAC/348-389TERVFVMHGDK.
Q8U1V4_PYRFU/370-408.ENIVPAHGEFR
R7D7I2_9FIRM/391-435PEKVFVTHGDD.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window