Sequence alignment for CL0398

PF07522

DCR1B_DANRE/215-303LQLPDVFTTDSGAGRIRVV.NQS......MIS....ASNLMAWNK...........LQSTIAILPTS.....RPMVSCHP
Q296G1_DROPS/456-554PDLQSRLNDDPYQANLHVI.GMG......KVT....YLVLAEYFKQFEDQ......YDMLLAIRPSG..WEKNS......
Q4RG77_TETNG/134-232VGKEKVFF....ELSISF...........SSD....SQKLEQHLARFSSQ......YDQLVAFKPTG..WTFSQQVESVG
Q9VND2_DROME/481-579PDLDSVLTEDRSGANLHVI.AMG......KIS....YPSLVDYFTEFEDQ......YDMLLGIRPSG..WEKNS......
Q16PI6_AEDAE/575-673PLQQQWLVEDPKFADIHVL.SMN......KLS....YDELVSYVEQFPDR......YDLLIALRPSG..WEKNS......
DCR1B_MOUSE/214-302LGLADVFTVEEEAGRIHAV.DHT......EIC....HSAMLQWNQ...........SHPTIAIFPTS.....RKVRSPHP
Q4RVU7_TETNG/241-329LELPDVFTTDPGAGRIRVV.EQS......EIR....AAAFHQWNK...........EEPTLAILPTS.....RPLVSFHP
Q8RZQ7_ORYSJ/227-334SLIAPEIITEDPSCRFQIL.GFQ......NLY....DKACTKIEEARASL......QPEPLFIRPSTQWYAHCAQS....
Q7QDQ3_ANOGA/486-584SQQLSVLVADPNKANIHVL.AMN......KLS....YDELNEYMNQFPDR......YESVIAIRPSG..WEKNS......
DCR1B_CHICK/207-295LELPEVFTTEEGAGRIHAV.DVA......EIR....WDTLVSWNV...........LHPTIAILPTG.....RPVKVTHP
A2EC29_TRIVA/231-334FAKPELFSEDPYLTRIHLL.PIQ......ECG....KEKVSLYAASMG........FDSVTAIRPSG..WNGRPFWRCPT
DCR1C_CHICK/239-345PEILYHITTD.RYTQIHAC.RHP......KDDDYVRGNRLPCGITCQNGT......PLHVISIKPSTMWFGERIKKTNVI
PSO2_SCHPO/403-529QDLIDLLTDDPTQASVHMV.TMM......GIH....PNSLLDYLEQYNSS......FDKIIGYKVTG..WTFQPL..ENR
Q4DNU5_TRYCC/457-536SPRGEVF.............PLW......GDE....GIDLKQ..............FDGVLCVEPSG..WTRKARRQILS
DCR1A_CHICK/844-950AAVNSLITMNWDGTLLHIL.PMM......QIN....FKGLQDHLNKFSEN......FDQVLAFKPTG..WTYSDSCLSVM
Q4PDE9_USTMA/699-829PELHSMLTRSPL.ASVHVT.NLH......AIN....GEALRDVVAALRTHG...HDFTHAVAFRPTG..WTYKPP..AGM
Q6ZD68_ORYSJ/209-321SLVAPEILTDDSSSRFQVI.GFP......RLS....ERATEMLALARAKH......QPEPLIIRASSQWYAYYEPPEGST
Q5AVU1_EMENI/1699-1828PELSALLTDDPLQAQVHMQ.TLF......EIR....AETLCDYLDSMKPH......FTRVIGFRPTG..WTYRPPAGRTL
Q4Q2L8_LEIMA/388-491EHLLSVFLVPMASVGYRAVAALA......HADG.PAVMDMEDGLALNLDR......YDQVLMVEPTG..WSKRCVAREVS
SNM1_ARATH/360-467DDISKNLSTDGKATCLHVL.PMS......SLK....VERLDEHLKIYREQ......YGAVLAFRPTG..WTYSEKIGEHL
Q4V7N1_XENLA/398-504EDIRSLVTTDWHSTALHVL.PMM......QVN....FKGLNVHLGKFPGK......YDRVLAFKPTG..WTYSDSSVLVA
A1L2E1_DANRE/289-394EDIGQRITTNWQSAQVHVL.PMM......QIN....FKNLQTHLKKFSKK......YDQLVAFKPTG..WTFNQTV.GVD
DCR1A_MOUSE/900-1006PEVSSLITTDMCDSLVHLL.PMM......QIN....FKGLQSHLKKCGGK......YDQILAFRPTG..WTHSNNITSTA
A6RF66_AJECN/673-802SELSALITNNPVEAQVHMV.TMM......DVH....TGTLLDYLHSLKPH......FSRVVGFRPTG..WSYRPPAGRMT
Q55PZ9_CRYNB/644-773PELHSMLTSDPIEAQVHLL.PLG......NIQ....LDRLQSYLTLLHPH......FDRVLGFRPTG..WSYSPP...AG
Q8IK95_PLAF7/674-779KHILNKITDNKLEAQIHIV.DINYSYIFPKID....KRKFLNLIDEEIEK.....EFDSFYYIIPTG..WVKKFS.....
Q8LQQ4_ORYSJ/223-351DDNQEIFTTQTSLTRIRAV.PRY......SLT....IESLDALNT...........VCPTIGIMPSGIPWLWKNSKGKAK
Q9Y9J3_AERPE/230-303DYSAVVF........LHMT.RLN......SIR........................RFPGVHVRLTG..WEMRAPAAWSG
A2GFK2_TRIVA/225-328YCSESCFTNDPTKTRVYLV.PIM......DCN....SVSASVWAKQNG........YSSVCAIAATG..WSGKAGWKNPQ
A7E8T1_SCLS1/835-964PELTSRLTSDPREAQIHMQ.MLM......ELR....PETLQDYLTGYKPH......FTRVVGFRPSG..WSYKPPNSRFV
Q5NSW7_ORYSJ/356-463SDLSKMICSDSQSSSLHVL.PLS......SLR....HENLQKYLETLKQR......FLAVLAFRPTG..WTFSEETGNQL
Q2HRV5_MEDTR/387-494PDYSDRLCTNGNNTLLHVL.PMS......SLR....IETLKEYLKTYKEQ......FTSVLAFRPTG..WTFSEKIGNDL
DCR1C_DANRE/239-345PEILCHVTTN.RATQIHAC.RHP......KDEEFFRANRLPCGSTAPDGI......PLNIISIKPSTIWFGERTRKTSVV
A4S4B7_OSTLU/228-334PEERSAMTHDDSKTNLHVV.PMG......STS....FMKMASILKYYKSR......FDTVIAFRPTG..WTFSAQKKTAR
Q4YJX0_PLABA/192-297KDMLNRITGNKLEAEIHIV.DINYSYIFPKIE....KNKLRSLIDAEMED.....EFDSFYYIIPTG..WVKNYY.....
A7RZG8_NEMVE/216-320DFIQSVITTDKSEGRIHVL.PMG......KLN....HQHLSSYMDQFKGK......FTRVVAFKPTG..WEHKS...GPL
DCR1C_HUMAN/239-345PEILHHLTTD.RNTQIHAC.RHP......KAEEYFQWSKLPCGITSRNRI......PLHIISIKPSTMWFGERSRKTNVI
DCR1_DICDI/481-582CLDINKFTTNELITPFRAV.TMS......MLS....YHNMLSLLDSSNNK......YKRVIGFRPTG..WTQAKKSITYL
Q8LCG8_ARATH/226-344MVIVPEIVSEDPSSKFHIFSGFP......KLY....ERTSAKLAEARSKL......QSEPLIIRPSAQWYVCDDEDDWKS
Q8T3E0_CAEEL/438-521SSNCGVL...KQYRDIKVI.KKG..................SYCEI..........SQNSVIIDISMLYYTFGNGVNDDE
Q6C9D1_YARLI/448-581PVISELLTSDPLEAQVHLV.PLG......QTR....KDQLFEHLKSFKPH......FSKIVAFAPTG..WSYRPPKSAIQ
Q6CJP1_KLULA/366-495WFPEGLLTTDHKSSNVHLV.AMH..............TDLDKYLSQLSNM......FDSIVVFRPTG..WTFSNQYDKSY
Q6FR52_CANGA/556-712CFDNSLLTDDPSESQIHLV.SLK......VLR...DFNAIDNYLKTIKELTGNKIKYDNVFGFIPTG..WTFGNRYKKDF

PF07521

A3HWA3_9BACT/389-434---------REVPVKAKIY-QID---------------------------------------------------------
Q6YPU2_ONYPE/364-402---------THGPLI....-NTH---------------------------------------------------------
A3DMW0_STAMF/351-395---------LDEPIKARLE-WFD---------------------------------------------------------
A6E886_9SPHI/388-433---------RDLMVYATIQ-QTD---------------------------------------------------------
B9LMH6_HALLT/567-612---------DTLTLQMGTE-VVD---------------------------------------------------------
A9A2U6_NITMS/572-617---------EVVTINCGVE-KLD---------------------------------------------------------
A4BH85_9GAMM/10-55---------GINDLKAQVH-TVS---------------------------------------------------------
Q6AQL6_DESPS/454-499---------KDYPLRAHVV-SLG---------------------------------------------------------
Q1YN80_MOBAS/352-393---------VQILED.GEK-LVH---------------------------------------------------------
A6Q9T8_SULNB/394-438---------EDIRIKASMY-TIN---------------------------------------------------------
Q1NUX3_9DELT/455-498---------KKRRVRAQVA-RTG---------------------------------------------------------
A5W7F3_PSEP1/406-451---------DMHDVRAKVI-SMH---------------------------------------------------------
Q6I0K7_BACAN/366-408---------ERIGKECRVK-RVP---------------------------------------------------------
Q5QU60_IDILO/378-424---------QWLPVKARIR-SLE---------------------------------------------------------
Q1NNX1_9DELT/356-394---------HSIPKH....-NIH---------------------------------------------------------
RNJ2_STAA8/357-396---------HIIPNN...K-KIH---------------------------------------------------------
Q5R428_PONAB/343-385---------QKLPLKMSVD-YIS---------------------------------------------------------
Q3ZY44_DEHSC/394-439---------QYYPVHARIE-ELR---------------------------------------------------------
Q3SMJ7_THIDA/400-445---------EDIKVRADIY-TLG---------------------------------------------------------
A0Q181_CLONN/390-435---------EPIAVNAKIY-NLE---------------------------------------------------------
Q6MLH4_BDEBA/379-424---------LYVEINCKVI-PSD---------------------------------------------------------
B7WQB7_COMTE/379-424---------RWMPIKAEVA-ELA---------------------------------------------------------
A3CWJ1_METMJ/372-413---------KMAGVR.IFD-ELH---------------------------------------------------------
A8GNH1_RICAH/358-398---------EVITER..DH-FVH---------------------------------------------------------
Q5CRW9_CRYPI/395-437---------TCIEVRCNVK-YLS---------------------------------------------------------
A8MJC1_ALKOO/394-439---------ENIAVLAEIH-SIE---------------------------------------------------------
Q92Z81_RHIME/391-436---------DDIRVRARIR-KLD---------------------------------------------------------
A4YH53_METS5/350-393---------SSPLLKARLQ-MFD---------------------------------------------------------
A8ZWQ7_DESOH/348-388---------DVVYEK..IS-DIH---------------------------------------------------------
Q3LW64_BIGNA/423-463---------KIIYGN..QA-KIH---------------------------------------------------------
A5ZRP6_9FIRM/391-436---------ETVAVGAEIR-QMP---------------------------------------------------------
A5D155_PELTS/389-434---------DEIAVKADIR-SID---------------------------------------------------------
Q1NVJ9_9DELT/395-440---------EEFPLKARVE-MIT---------------------------------------------------------
Q6L180_PICTO/564-609---------VKIDINMSVE-TAE---------------------------------------------------------
Q3JJT2_BURP1/522-567---------EYVRVRAQVQ-MIS---------------------------------------------------------
Q1J225_DEIGD/388-431---------EEVIVRAQVH-TIG---------------------------------------------------------
Q8WPK6_OIKDI/544-586---------EQVSIRCSIE-FIN---------------------------------------------------------
Q8ZYD9_PYRAE/560-605---------SKINMRMEVV-SIP---------------------------------------------------------
A4CGY6_ROBBH/384-429---------KTVSFKMQVA-EIE---------------------------------------------------------
Q15V20_PSEA6/395-439---------DDYVVKAQIE-TLG---------------------------------------------------------
Q2GQR7_CHAGB/705-747---------QTVSVQLRIA-FVD---------------------------------------------------------
A6VTF2_MARMS/411-456---------ERYTIKAKVQ-QIS---------------------------------------------------------
Q469C4_METBF/326-371---------DVLALKPRVE-QYD---------------------------------------------------------
O58209_PYRHO/454-492---------KPIFEK....-GFH---------------------------------------------------------
Q1IJR0_KORVE/403-448---------QIVPVRAQVA-TLE---------------------------------------------------------
CPSF2_HUMAN/527-569---------ESIEIKARVT-YID---------------------------------------------------------
Q7QC68_ANOGA/527-569---------KPIEVNAQVQ-FID---------------------------------------------------------
A8ZYV1_DESOH/453-498---------KEYPLKARVE-NIG---------------------------------------------------------
A1U408_MARAV/380-425---------EYWPVKAEIH-NLD---------------------------------------------------------
A5TRV9_FUSNP/339-379---------EEKGVK..II-SLH---------------------------------------------------------
A1VBR4_DESVV/354-393---------SFGAPS...A-HLH---------------------------------------------------------
A5L6K6_9GAMM/384-429---------KQVEVNAQIH-GMS---------------------------------------------------------
INT11_DANRE/376-418---------ATLDVKLQVE-YMS---------------------------------------------------------
Q1QVT3_CHRSD/361-398---------ERSHPE....-.LH---------------------------------------------------------
A9A9T2_METM6/349-392---------RAIPVNGKVV-KIE---------------------------------------------------------
A2FCF8_TRIVA/382-424---------KIIPRKISID-YVS---------------------------------------------------------
Q11PK2_CYTH3/377-423---------RSIPVAAKII-YTD---------------------------------------------------------
Q72BD6_DESVH/352-392---------DDPRVS..FH-EIH---------------------------------------------------------
Q64AS7_9ARCH/482-524---------NCTKLRKRIV-RSH---------------------------------------------------------
A6USJ2_METVS/561-606---------KAVKVNLSVH-TLE---------------------------------------------------------
Q9F8I9_CARHY/4-49---------EEIAVKAEVY-HYD---------------------------------------------------------
A4BBE2_9GAMM/361-402---------VVMAAD.CET-PIH---------------------------------------------------------
A4RR19_OSTLU/495-537---------REINIRATII-TVD---------------------------------------------------------
A8A8E1_IGNH4/572-617---------YQLEVRSHVF-SVE---------------------------------------------------------
A1RXC5_THEPD/356-399---------KRGPVKARIE-WFD---------------------------------------------------------
A0RY50_CENSY/346-389---------KEMSVAAEVK-QFQ---------------------------------------------------------
A7A1G1_YEAS7/392-434---------ITIPRRCQVE-EIS---------------------------------------------------------
A1SFD7_NOCSJ/386-431---------RYVPVRAEIV-DVP---------------------------------------------------------
A5KS50_9BACT/457-496---------THLTGI...G-PLH---------------------------------------------------------
A7NRB4_ROSCS/358-396---------DNPSGL....-AVH---------------------------------------------------------
A2SLK7_METPP/395-440---------EYVAVKATVS-HLE---------------------------------------------------------
Q6L0H4_PICTO/338-380---------ATIKPSMKID-FFD---------------------------------------------------------
Q5X2M7_LEGPA/396-441---------SFIPIQAKVV-VMS---------------------------------------------------------
A2BK26_HYPBU/354-396---------TEEPVRARVE-WLD---------------------------------------------------------
Q1JH65_STRPD/354-391---------KLITQN....-.LR---------------------------------------------------------
Q4JB02_SULAC/554-599---------ENIKVNMEIG-VVE---------------------------------------------------------
A6US40_METVS/356-398---------LDVTPEFEVM-AFQ---------------------------------------------------------
A6C193_9PLAN/389-436---------RYYEVKAKVV-QLS---------------------------------------------------------
Q21X11_RHOFD/381-426---------HDVELQAEVV-QLQ---------------------------------------------------------
Q2G602_NOVAD/352-392---------RIVTDR..QS-MIH---------------------------------------------------------
A4CMY8_ROBBH/382-427---------KYIRVAAGIH-HYE---------------------------------------------------------
A0CN06_PARTE/362-404---------KDYDIKMQIN-NMS---------------------------------------------------------
A3WJ92_9GAMM/341-381---------VHAEQS..DR-ILH---------------------------------------------------------
Q2S180_SALRD/393-435---------GPQPVYCTVE-RFR---------------------------------------------------------
Q2YZG4_9GAMM/352-398---------EEHRVKARVK-ILQ---------------------------------------------------------
Q5FUV1_GLUOX/357-397---------TVLTDK..DA-KVH---------------------------------------------------------
CPSF2_DICDI/549-591---------LRLPINCKIQ-TID---------------------------------------------------------
A4AC52_9GAMM/355-397---------TVIDSDGAVE-TVH---------------------------------------------------------
B4SF65_PELPB/390-434---------RRYPVRATVH-TIG---------------------------------------------------------
A7H6H0_ANADF/351-391---------QVAYEG..LR-PLH---------------------------------------------------------
RNJ_MYCPN/366-403---------NSPNMK....-.LH---------------------------------------------------------
Q9V076_PYRAB/373-414---------RMKGVR.MIK-NLH---------------------------------------------------------
Q1PVS7_9BACT/393-440---------VMRRLEAEVV-VLN---------------------------------------------------------
Q8SUC3_ENCCU/370-412---------ESREIRLEVK-NLA---------------------------------------------------------
Q7UMQ3_RHOBA/426-471---------RRYDVRAKTH-QLT---------------------------------------------------------
Q0W8H2_UNCMA/361-406---------EIVKLRCQLE-QYS---------------------------------------------------------
A3SBF4_9RHOB/356-396---------DIVDDS..SG-LYH---------------------------------------------------------
O29718_ARCFU/336-381---------RVVKLKMGVE-QYD---------------------------------------------------------
Q2SRM2_MYCCT/410-448---------ENTSDN....-KIH---------------------------------------------------------
A0JWK6_ARTS2/384-429---------EDVRIRAEVI-QME---------------------------------------------------------
A2SRA0_METLZ/372-414---------LMRQGARIFD-GLH---------------------------------------------------------
A6D0G5_9VIBR/385-430---------TSIEMNAMVH-TVS---------------------------------------------------------
A4X4Q7_SALTO/365-404---------V...VHKDVA-KVH---------------------------------------------------------
A4XI93_CALS8/375-417---------KEYEVKCKVE-KYG---------------------------------------------------------
Q74HX7_LACJO/271-311---------EKRGIE..LI-TLR---------------------------------------------------------
Q88M01_PSEPK/406-451---------QMYEIRAKVV-TVG---------------------------------------------------------
A8BNK1_GIAIC/411-453---------GYADAKMRIE-ELS---------------------------------------------------------
CPSF2_CAEEL/561-603---------NRVEVSCRIE-FIE---------------------------------------------------------
Q09CS6_STIAD/268-307---------VYAQVE...P-DIH---------------------------------------------------------
A6EB60_9SPHI/302-348---------EDYDVTAKIS-SLK---------------------------------------------------------
A8AB05_IGNH4/307-346---------VVRPPELHLQ-...---------------------------------------------------------
Q73MR4_TREDE/395-441---------EWHQVRAEIL-QIN---------------------------------------------------------
A2D958_TRIVA/390-432---------VDIIIKCKVE-RIS---------------------------------------------------------
Q72JJ7_THET2/381-420---------VLYPPT...Y-KVH---------------------------------------------------------
Q8TW11_METKA/576-622---------ETLRIELRVE-TVS---------------------------------------------------------
C0A4F5_9BACT/381-423---------VKAKIKARIE-RFE---------------------------------------------------------
B3E8Q6_GEOLS/356-396---------VRPGVR..YV-YAH---------------------------------------------------------
Q0ABE3_ALHEH/391-435---------ETVRVGAQIH-TVG---------------------------------------------------------
Q0W2D5_UNCMA/562-607---------EIMKINLQVT-TVD---------------------------------------------------------
Q8ZTD5_PYRAE/353-396---------TTIKVEARLE-WFD---------------------------------------------------------
B8FX93_DESHD/390-435---------EKVAVRANIR-RME---------------------------------------------------------
Q18IP5_HALWD/407-449---------IHVPTE.WIH-EIG---------------------------------------------------------
A3ERC5_9BACT/393-437---------VMKDVRLSLH-SIN---------------------------------------------------------
Q4AAN8_MYCHJ/355-394---------KENGPD...G-YLH---------------------------------------------------------
Q5NZR0_AROAE/397-442---------ERHPIRAQIH-QVG---------------------------------------------------------
Q9CF63_LACLA/351-391---------GVMKML..AS-DLK---------------------------------------------------------
Q2Q0D8_9ZZZZ/366-408---------KLASIELDVD-QYS---------------------------------------------------------
A0NIV8_OENOE/360-399---------NVVSIK...D-NLR---------------------------------------------------------
A8AA34_IGNH4/357-398---------PR..VEARTQ-WFD---------------------------------------------------------
Q74MJ3_NANEQ/562-605---------QLIKINLEVR-SFE---------------------------------------------------------
A8MC21_CALMQ/353-396---------EEIRVNAKVY-WFD---------------------------------------------------------
Q9HMJ7_HALSA/343-385---------RVLPVSAQVE-QYD---------------------------------------------------------
Q8IL83_PLAF7/430-472---------KVVKRKCRFE-QIS---------------------------------------------------------
A4S2Z0_OSTLU/356-394---------AMGRED....-CLH---------------------------------------------------------
A5IZC2_MYCAP/356-395---------KVMELN....-NFE---------------------------------------------------------
A3WMD7_9GAMM/389-434---------QKRKVNAQVY-SLT---------------------------------------------------------
A5N1D0_CLOK5/381-423---------KVIPVNCKVK-NVG---------------------------------------------------------
A6TST8_ALKMQ/367-409---------YAKNNNMDII-DLH---------------------------------------------------------

PF07522

DCR1B_DANRE/215-303N.....................................................VYVVPYSDHSSYQELEDFVSAL-SP-
Q296G1_DROPS/456-554...KPS..........................................YGRRISIIGIEYSEHSSYKELERFVRFI-KP-
Q4RG77_TETNG/134-232D.VQPD..........................................VSGNISIYGIPYSEHSSFMELKRFVQWL-QP-
Q9VND2_DROME/481-579...KPS..........................................YGKRISTIGIEYSEHSSYKELERFVRFL-KP-
Q16PI6_AEDAE/575-673...RPQ..........................................YRGRINIVGVEYSEHSSFNELKRFVRYL-RP-
DCR1B_MOUSE/214-302S.....................................................IYTVPYSDHSSYSELRAFVAAL-RP-
Q4RVU7_TETNG/241-329N.....................................................IYVVPYSDHSSYQELEDFVSAL-QP-
Q8RZQ7_ORYSJ/227-334......QKPS..................................LTEAVLDGCGVWHICFSIHSSRDELEQALELL-QP-
Q7QDQ3_ANOGA/486-584...KPQ..........................................YRGRINIVGIEYSEHSSFDELKRFVQFL-RP-
DCR1B_CHICK/207-295Q.....................................................IHLIPYSDHSSFSELCEFVKWL-KP-
A2EC29_TRIVA/231-334FDIYNE............................................IKVTSYDVPYSDHSSPMELTEFVKAV-KP-
DCR1C_CHICK/239-345VRTGES................................................TYRACFSFHSSYSEIMDFLSYI-RP-
PSO2_SCHPO/403-529AQLSSSLDSIISRPPK.....................FVEYDLRAIRGSTDKVAAFVAPYSEHSSFYDLTMFCLSM-NI-
Q4DNU5_TRYCC/457-536K..................................................RVTLLHVPYSEHSSFTELVDFVGFM-NP-
DCR1A_CHICK/844-950D.IKPQ..........................................TRGNITIYGIPYSEHSSYLEMKRFVQWL-KP-
Q4PDE9_USTMA/699-829DTVSPSLDRLIQWNQSR...................SFTFHNLLPTRDSTPDYMIYGVPYSEHSSFFELTAFALST-RY-
Q6ZD68_ORYSJ/209-321K.....RKPA..................................LTEPMRDEFGVWHVCFSMHSSREELEQALRFI-QP-
Q5AVU1_EMENI/1699-1828E..NPPVSTVLYSSHWKT..................PFSVRDLTPQRGSTRESACFGVPYSEHSSFRELTMFCCAL-RI-
Q4Q2L8_LEIMA/388-491E..................................................KYTLLRVPYSEHCAFHELLEFVAFV-NP-
SNM1_ARATH/360-467DLIKPT..........................................SRGKITIYGVPYSEHSSFTELREFVQFL-RP-
Q4V7N1_XENLA/398-504D.IKPE..........................................IRGKVTVYGIPYSEHSSYSELKRFVQWL-KP-
A1L2E1_DANRE/289-394D.ILPQ..........................................TQGNISIYGIPYSEHSSFLELKRFVQWL-RP-
DCR1A_MOUSE/900-1006D.IIPQ..........................................TRGNISIYGIPYSEHSSYLEMKRFVQWL-KP-
A6RF66_AJECN/673-802D..SPTVSSVLYSDSWKP..................RFATKDLIPQRGSNQISSCYSVPYSEHSSFRELTMFCCAL-RI-
Q55PZ9_CRYNB/644-773TDMLPDVNTIIRRDQAR...................RFGEGDLKTMRGSSRNFMMYGVPYSEHSSFFELTCFALSL-PG-
Q8IK95_PLAF7/674-779......F........................................YERNNISIFLIPYSEHSNLDELKNFVKSI-KP-
Q8LQQ4_ORYSJ/223-351SGVKSPAKSIRCKGLDEG..................AIEMDYDPLSPPKLFEKDSYSLPYSEHACFAELENFMLIV-RP-
Q9Y9J3_AERPE/230-303DR....................................................MINVSFSDHATFREIIDYVREA-RP-
A2GFK2_TRIVA/225-328ITYQGP............................................IKVTLYEVPYSDHSSPQELLNFVKVV-KP-
A7E8T1_SCLS1/835-964D..SPPIHTILNASNWRS..................EYDMGELIPQRGSTKEAQCFGVPYSEHSSFRELTMFVMGL-RI-
Q5NSW7_ORYSJ/356-463DLIKPS..........................................SRGKITIYGVPYSEHSSFSELREFVMFL-RP-
Q2HRV5_MEDTR/387-494ALIKPV..........................................SNGNITTYGVPYSEHSSFTELRDFVQFL-RP-
DCR1C_DANRE/239-345VKMGSS................................................SYRACFSFHSSYLEVKDFLSYI-CP-
A4S4B7_OSTLU/228-334ATSRRQ...........................................RGRLIQYGLPYSEHSSLNELREFVRFM-NP-
Q4YJX0_PLABA/192-297......F........................................YEKNNMSVFLIPYSEHSNLDELKDFVKSI-KP-
A7RZG8_NEMVE/216-320SATRPV..........................................TKGPISIYGVPYSEHSSYEEMKRFVQFT-RP-
DCR1C_HUMAN/239-345VRTGES................................................SYRACFSFHSSYSEIKDFLSYL-CP-
DCR1_DICDI/481-582N................................................RGPTTFYSVAYSEHSSFNELRDCIDHF-RP-
Q8LCG8_ARATH/226-344GSIQKQRKVR..................................FSEAVKDEFGLWHVCYSMHSSRAELESAMQLL-SP-
Q8T3E0_CAEEL/438-521G.....................................................IIRIPYSDHSSRSEILKFLSHF-HF-
Q6C9D1_YARLI/448-581ANEQATDLRPSYYDFGDLE................YNVENLDRNLERSAIEPVQKYNVPYSEHSSFVELRAFCLNM-AA-
Q6CJP1_KLULA/366-495TLWDEFERKNWVKDTLSGE................TPFAIDYFTKQKRSQGKIYHFNVPYSEHSSFKDLCLFSTKL-KW-
Q6FR52_CANGA/556-712QYDGELSYDDNFKLRVKYCMDLLKQDEARPTQNFADVSSLEWLRMQYKPRERYQIFRVPYSEHSSFRELLKFCISV-PS-

PF07521

A3HWA3_9BACT/389-434----------------------------------------------------------GLSAHADQEELMDWAEGFTDR.
Q6YPU2_ONYPE/364-402----------------------------------------------------------.VSGHGNQNDLKLMLSLT.KP.
A3DMW0_STAMF/351-395----------------------------------------------------------.LSSHAGKDGLISIIQRY.KNT
A6E886_9SPHI/388-433----------------------------------------------------------LLSGHGDHEDLMNTVQQQKVE.
B9LMH6_HALLT/567-612----------------------------------------------------------GFSGHADRQGLENFVKTMNPR.
A9A2U6_NITMS/572-617----------------------------------------------------------GFSGHSDYNQLMSFVQRLRPK.
A4BH85_9GAMM/10-55----------------------------------------------------------GFSALVDQEDLLAFVAGIESK.
Q6AQL6_DESPS/454-499----------------------------------------------------------GLSGHGDRDEMTRVLKDSNLN.
Q1YN80_MOBAS/352-393----------------------------------------------------------.VSGHPRRSEMRQMYEWV.RP.
A6Q9T8_SULNB/394-438----------------------------------------------------------GFSAHADQNGIIKWVKDIEDL.
Q1NUX3_9DELT/455-498----------------------------------------------------------AFSGHAAASELQRLLAAT.EP.
A5W7F3_PSEP1/406-451----------------------------------------------------------GYSGHADQGGLVRFAMGGRTP.
Q6I0K7_BACAN/366-408----------------------------------------------------------.YKVHQSIRDVKEMLNTL.LP.
Q5QU60_IDILO/378-424----------------------------------------------------------GLSGHADYQEIADWLEQSSLKP
Q1NNX1_9DELT/356-394----------------------------------------------------------.TSGHASPRELKKLVKAL.RP.
RNJ2_STAA8/357-396----------------------------------------------------------.ASSHGCMEELKMMINIM.KP.
Q5R428_PONAB/343-385----------------------------------------------------------.FSAHTDYQQTSEFIRAL.KP.
Q3ZY44_DEHSC/394-439----------------------------------------------------------AFSAHADQPTLLRWLKGFKNR.
Q3SMJ7_THIDA/400-445----------------------------------------------------------GLSAHADRSALLGWLGHFTNK.
A0Q181_CLONN/390-435----------------------------------------------------------GLSGHADRNGLVDWIDKLMVR.
Q6MLH4_BDEBA/379-424----------------------------------------------------------SFSAHADRSDLMTWLKQAPEI.
B7WQB7_COMTE/379-424----------------------------------------------------------MLSAHADSDELMRWLRSFTKA.
A3CWJ1_METMJ/372-413----------------------------------------------------------.VSGHAYREDHYEFLHLL.NP.
A8GNH1_RICAH/358-398----------------------------------------------------------.VSGHPSIDELHKMYSLI.RP.
Q5CRW9_CRYPI/395-437----------------------------------------------------------.FSSHADSIGIQSLISHS.EP.
A8MJC1_ALKOO/394-439----------------------------------------------------------GFSGHIDQPGILDWLQGFKKK.
Q92Z81_RHIME/391-436----------------------------------------------------------IYSGHADGSELADWVRARQPI.
A4YH53_METS5/350-393----------------------------------------------------------.FSSHAGKNQLLDIVKTSEAL.
A8ZWQ7_DESOH/348-388----------------------------------------------------------.VSGHAFREELIEMMQMV.NP.
Q3LW64_BIGNA/423-463----------------------------------------------------------.TSGHAYEDELKEILKIV.KP.
A5ZRP6_9FIRM/391-436----------------------------------------------------------GISGHADVNGLMTWIKAFKEK.
A5D155_PELTS/389-434----------------------------------------------------------CYSAHADQVGLVNWVKKIKKP.
Q1NVJ9_9DELT/395-440----------------------------------------------------------GFSGHADRDGLLAWAGAMEQK.
Q6L180_PICTO/564-609----------------------------------------------------------GFSGHSNKAQLLNYIATMQPK.
Q3JJT2_BURP1/522-567----------------------------------------------------------SLSAHADYGEILGWLGAQSSA.
Q1J225_DEIGD/388-431----------------------------------------------------------GFSAHADQDDLLTFLADTGNP.
Q8WPK6_OIKDI/544-586----------------------------------------------------------.FEGRVDGESQLQLLSTI.KP.
Q8ZYD9_PYRAE/560-605----------------------------------------------------------GFSGHSDRRELMKYVEHMEPK.
A4CGY6_ROBBH/384-429----------------------------------------------------------GLSAHADHAELLDWLSDIKIQ.
Q15V20_PSEA6/395-439----------------------------------------------------------GFSAHAGQNELVEWVSHFENN.
Q2GQR7_CHAGB/705-747----------------------------------------------------------.FSGLHDKRSLNMLIPLI.QP.
A6VTF2_MARMS/411-456----------------------------------------------------------GYSAHAGQRDLLNFIKRMRVK.
Q469C4_METBF/326-371----------------------------------------------------------.FSAHSGDSELKKLVKDFCRKG
O58209_PYRHO/454-492----------------------------------------------------------.ASGHISREELRKVIDEI.DP.
Q1IJR0_KORVE/403-448----------------------------------------------------------QFSDHADTSELLEWLHTFKKA.
CPSF2_HUMAN/527-569----------------------------------------------------------.YEGRSDGDSIKKIINQM.KP.
Q7QC68_ANOGA/527-569----------------------------------------------------------.FEGRSDGESLLKILSQL.RP.
A8ZYV1_DESOH/453-498----------------------------------------------------------GFSAHADKHELMRFVKKSNLD.
A1U408_MARAV/380-425----------------------------------------------------------SMSAHGDYQEILQWLEQGSLK.
A5TRV9_FUSNP/339-379----------------------------------------------------------.TSGHADEKDFDKLIKKI.EP.
A1VBR4_DESVV/354-393----------------------------------------------------------.TSGHASTADLKEFAQKM.NP.
A5L6K6_9GAMM/384-429----------------------------------------------------------GYSAHADQEDLKRFIAGIPVA.
INT11_DANRE/376-418----------------------------------------------------------.FSAHADAKGIMQLIRMA.EP.
Q1QVT3_CHRSD/361-398----------------------------------------------------------.ASGHPAQAELRRFYEWV.KP.
A9A9T2_METM6/349-392----------------------------------------------------------.FSAHADYNSLLRFMKKIPQP.
A2FCF8_TRIVA/382-424----------------------------------------------------------.FSGHADFNQTSRFITEL.KP.
Q11PK2_CYTH3/377-423----------------------------------------------------------IFSGHTDVNGLIKYLGHQDKAK
Q72BD6_DESVH/352-392----------------------------------------------------------.TSGHAFRQDLKRYANAI.NP.
Q64AS7_9ARCH/482-524----------------------------------------------------------.VSGHASRPELKELIGKI.NP.
A6USJ2_METVS/561-606----------------------------------------------------------GFSGHSDRKQLIKYLRKLKPI.
Q9F8I9_CARHY/4-49----------------------------------------------------------GLSAHADQRELLAFIGRFSQK.
A4BBE2_9GAMM/361-402----------------------------------------------------------.ASGHPSADDVADLYRWV.QP.
A4RR19_OSTLU/495-537----------------------------------------------------------.FEGKADGKSVRTLITQA.AP.
A8A8E1_IGNH4/572-617----------------------------------------------------------GFSGHSSRSELINWVKSVTPR.
A1RXC5_THEPD/356-399----------------------------------------------------------.FSAHCGHSELVKTLDSAKKG.
A0RY50_CENSY/346-389----------------------------------------------------------.FSGHSDRTELFEMIKSIKGD.
A7A1G1_YEAS7/392-434----------------------------------------------------------.FAAHVDFQENLEFIEKI.SA.
A1SFD7_NOCSJ/386-431----------------------------------------------------------YFSVHADADDIVGWLGRAPEP.
A5KS50_9BACT/457-496----------------------------------------------------------.LSGHGYYDDHVRLITAL.NP.
A7NRB4_ROSCS/358-396----------------------------------------------------------.VSGHAAQEELKMVLAIL.RP.
A2SLK7_METPP/395-440----------------------------------------------------------GFSGHADADGLMEWLRGFETP.
Q6L0H4_PICTO/338-380----------------------------------------------------------.LSAHAGHSDLVKFIKDI.DP.
Q5X2M7_LEGPA/396-441----------------------------------------------------------STSAHADYPELLEWLTHLTNP.
A2BK26_HYPBU/354-396----------------------------------------------------------.FSSHADRNGLLDVVRTT.KP.
Q1JH65_STRPD/354-391----------------------------------------------------------.VSGHANGRDLQLLMNLL.KP.
Q4JB02_SULAC/554-599----------------------------------------------------------GFSGHSDRRQLLAFLRNLNVK.
A6US40_METVS/356-398----------------------------------------------------------.FSAHGEMGELRHIVKKV.NP.
A6C193_9PLAN/389-436----------------------------------------------------------GLSGHADVEDFKWWYEESAKRG
Q21X11_RHOFD/381-426----------------------------------------------------------SASAHADASQLLAWLRTMPQA.
Q2G602_NOVAD/352-392----------------------------------------------------------.VSGHPGRPELMALYEWL.RP.
A4CMY8_ROBBH/382-427----------------------------------------------------------SLSAHADQEEILWWTAGMENQ.
A0CN06_PARTE/362-404----------------------------------------------------------.FSAHADSRGIIQLVNHL.QP.
A3WJ92_9GAMM/341-381----------------------------------------------------------.ASGHPNQEELKQLYQWV.KP.
Q2S180_SALRD/393-435----------------------------------------------------------.FSGHSDRRELLSLVERM.TP.
Q2YZG4_9GAMM/352-398----------------------------------------------------------NFSAHGDRRDIIEYVKMSSPAK
Q5FUV1_GLUOX/357-397----------------------------------------------------------.TSGHATSEDIRTLYRIV.RP.
CPSF2_DICDI/549-591----------------------------------------------------------.YEGCSDGRSIKAIIQQI.AP.
A4AC52_9GAMM/355-397----------------------------------------------------------.ASGHPCADELASMYQWA.RP.
B4SF65_PELPB/390-434----------------------------------------------------------GLSAHGDQNDLLRWMGGFTNK.
A7H6H0_ANADF/351-391----------------------------------------------------------.VSGHAQEAEQRRLIALA.RP.
RNJ_MYCPN/366-403----------------------------------------------------------.ASGHATQQELQLMLNLV.FP.
Q9V076_PYRAB/373-414----------------------------------------------------------.VSGHASKEDHRYLIRML.NP.
Q1PVS7_9BACT/393-440----------------------------------------------------------GFSGHADQNGLLRFADALRSKG
Q8SUC3_ENCCU/370-412----------------------------------------------------------.FSAHADAPGILNVVEQC.SP.
Q7UMQ3_RHOBA/426-471----------------------------------------------------------GYSAHGDQEDLIALVEGMTDA.
Q0W8H2_UNCMA/361-406----------------------------------------------------------.FSAHSGESELKAIVKHMVDRG
A3SBF4_9RHOB/356-396----------------------------------------------------------.VSGHANRPDLETLHDVV.KP.
O29718_ARCFU/336-381----------------------------------------------------------.FSAHADDRQLKEYVKRVVDRG
Q2SRM2_MYCCT/410-448----------------------------------------------------------.TSGHASQEEQKLLFSLI.RP.
A0JWK6_ARTS2/384-429----------------------------------------------------------SLSAHADSDGLIEWMRAAARE.
A2SRA0_METLZ/372-414----------------------------------------------------------.VTGHAYYQEHYDLLSML.NP.
A6D0G5_9VIBR/385-430----------------------------------------------------------GYSAHADRDDLIMFVKGCREY.
A4X4Q7_SALTO/365-404----------------------------------------------------------.VSGHAPAGELLYLLNIV.RP.
A4XI93_CALS8/375-417----------------------------------------------------------.LSAHADRDSILGFLAML.KP.
Q74HX7_LACJO/271-311----------------------------------------------------------.CSGHADVAELKEIIAGF.EP.
Q88M01_PSEPK/406-451----------------------------------------------------------GFSGHADQAGLVGFVNAMSRV.
A8BNK1_GIAIC/411-453----------------------------------------------------------.FSAHSDYNQTLDVLRKT.RP.
CPSF2_CAEEL/561-603----------------------------------------------------------.YEGISDGESTKKLLAGL.LP.
Q09CS6_STIAD/268-307----------------------------------------------------------.VSGHASQPQQRRVLDLV.RP.
A6EB60_9SPHI/302-348----------------------------------------------------------SMSAHGDYEDLLQFISGQDPER
A8AB05_IGNH4/307-346----------------------------------------------------------.ISRHATRQELLQFISLT.KA.
Q73MR4_TREDE/395-441----------------------------------------------------------AFSAHADYFESREWLDSLKNPK
A2D958_TRIVA/390-432----------------------------------------------------------.FSAHADQFEIISLCDRV.RP.
Q72JJ7_THET2/381-420----------------------------------------------------------.ASGHASQEELKLILNLT.TP.
Q8TW11_METKA/576-622----------------------------------------------------------GFSGHGDKIELTKYVRSIRPSP
C0A4F5_9BACT/381-423----------------------------------------------------------.LSGHADRDELLQFAVQT.SA.
B3E8Q6_GEOLS/356-396----------------------------------------------------------.TSGHAPVEDLQRLVKAV.KP.
Q0ABE3_ALHEH/391-435----------------------------------------------------------GLSAHADQRELMAWYEGFRDH.
Q0W2D5_UNCMA/562-607----------------------------------------------------------GFSGHSDRRQLMEYVKRMDPR.
Q8ZTD5_PYRAE/353-396----------------------------------------------------------.FSAHAGRRELEEFVKRFTPE.
B8FX93_DESHD/390-435----------------------------------------------------------GLSAHADQPQLLEWLSCLGED.
Q18IP5_HALWD/407-449----------------------------------------------------------GMSAHAGANDLLSFARQV.NP.
A3ERC5_9BACT/393-437----------------------------------------------------------GFSAHADQADLLKWCGSMKIP.
Q4AAN8_MYCHJ/355-394----------------------------------------------------------.TSGHAYKAEHEKIFQLT.KP.
Q5NZR0_AROAE/397-442----------------------------------------------------------GYSAHAGQADLLRFVAGIPEM.
Q9CF63_LACLA/351-391----------------------------------------------------------.ISGHANARDLQFLLDIF.RP.
Q2Q0D8_9ZZZZ/366-408----------------------------------------------------------.FSTHAGHQEIVQFAEEC.QA.
A0NIV8_OENOE/360-399----------------------------------------------------------.SSGHASQNDLQFMLNFI.KP.
A8AA34_IGNH4/357-398----------------------------------------------------------.FSSHAGASELLEIIKSVNKL.
Q74MJ3_NANEQ/562-605----------------------------------------------------------GFSGHADKGEIESFLRRVRPG.
A8MC21_CALMQ/353-396----------------------------------------------------------.FSAHSGLEELINFISYFKDE.
Q9HMJ7_HALSA/343-385----------------------------------------------------------.FSAHADHAGLRAFLDDYRDA.
Q8IL83_PLAF7/430-472----------------------------------------------------------.FSAHSDFNQTKTFIEKL.KC.
A4S2Z0_OSTLU/356-394----------------------------------------------------------.SSGHGYKDELDEVIKLL.KP.
A5IZC2_MYCAP/356-395----------------------------------------------------------FFHHHPAREDLAKLINIL.KP.
A3WMD7_9GAMM/389-434----------------------------------------------------------GYSAHADQDELLAFIGNAEFP.
A5N1D0_CLOK5/381-423----------------------------------------------------------.LSAHSDKSEIKSLINFL.SP.
A6TST8_ALKMQ/367-409----------------------------------------------------------.TSGHAHIDSLKKVIRSS.GA.

PF07522

DCR1B_DANRE/215-303--I..SLVPIVGNCL
Q296G1_DROPS/456-554--R..RIISTVPVGR
Q4RG77_TETNG/134-232--L..KIIPTVNNGS
Q9VND2_DROME/481-579--K..RVISTVPVGR
Q16PI6_AEDAE/575-673--Q..EVISTVPYGN
DCR1B_MOUSE/214-302--C..QVVPIVHQKP
Q4RVU7_TETNG/241-329--T..DVVPIVGNHI
Q8RZQ7_ORYSJ/227-334--Q..WVISTTPPCF
Q7QDQ3_ANOGA/486-584--H..EVISTVPYGN
DCR1B_CHICK/207-295--C..SVIPIVKGDM
A2EC29_TRIVA/231-334--A..KVIPTTTKNK
DCR1C_CHICK/239-345--V..NVYPNVLPVG
PSO2_SCHPO/403-529--G..HIIPTVNVGS
Q4DNU5_TRYCC/457-536--T..RIVPTVSLEL
DCR1A_CHICK/844-950--Q..KIIPTVNVGD
Q4PDE9_USTMA/699-829--D..RIIATVNVGS
Q6ZD68_ORYSJ/209-321--K..WVISTTPPCM
Q5AVU1_EMENI/1699-1828--G..RIIPTVNVGS
Q4Q2L8_LEIMA/388-491--A..RVVPTVSEEG
SNM1_ARATH/360-467--D..KIIPTVNNGN
Q4V7N1_XENLA/398-504--Q..KIIPTVNVGN
A1L2E1_DANRE/289-394--K..KIIPTVNVGS
DCR1A_MOUSE/900-1006--Q..KIIPTVNVGS
A6RF66_AJECN/673-802--T..KVIPTVNVGS
Q55PZ9_CRYNB/644-773--ADLKMIATVNVGN
Q8IK95_PLAF7/674-779--C..NILPTVFYNE
Q8LQQ4_ORYSJ/223-351--S..TVIGIVSTSF
Q9Y9J3_AERPE/230-303--K..RVI..VDAYR
A2GFK2_TRIVA/225-328--K..KLVSTTSRSQ
A7E8T1_SCLS1/835-964--E..KVVPTVNVGT
Q5NSW7_ORYSJ/356-463--Q..KVIPTVNVGN
Q2HRV5_MEDTR/387-494--D..KIIPTVNVGN
DCR1C_DANRE/239-345--V..NIYPNVIPLG
A4S4B7_OSTLU/228-334--K..FIFPHVNNDG
Q4YJX0_PLABA/192-297--C..SICPTVFSNI
A7RZG8_NEMVE/216-320--T..KIVPTVNVHS
DCR1C_HUMAN/239-345--V..NAYPNVIPVG
DCR1_DICDI/481-582--T..QIIPTVDCDS
Q8LCG8_ARATH/226-344--K..WVVSTVPSCR
Q8T3E0_CAEEL/438-521--K..TITPCTKKYS
Q6C9D1_YARLI/448-581--T..TIIPTVNMSA
Q6CJP1_KLULA/366-495--D..KIIPTVNLSQ
Q6FR52_CANGA/556-712--K..NIISTVNVDN

PF07521

A3HWA3_9BACT/389-434.PK--ITFIIHGEEQ
Q6YPU2_ONYPE/364-402..K--YFIPVHGEHR
A3DMW0_STAMF/351-395.LK--NIIIVHGEPD
A6E886_9SPHI/388-433.NT--RIFLVHGEPK
B9LMH6_HALLT/567-612.PE--KVLCVHGDES
A9A2U6_NITMS/572-617.LR--RVLVNHGERK
A4BH85_9GAMM/10-55.PG--EVRLVHGDAS
Q6AQL6_DESPS/454-499.VK--SIALVHGEVE
Q1YN80_MOBAS/352-393..T--IAVPAHGEAA
A6Q9T8_SULNB/394-438..Q--RIFLIHGEEE
Q1NUX3_9DELT/455-498..E--RVLLVHLNAG
A5W7F3_PSEP1/406-451.AG--RVLLVHGDSS
Q6I0K7_BACAN/366-408..E--HTVLVHALKE
Q5QU60_IDILO/378-424.NT--PIQLVHGELD
Q1NNX1_9DELT/356-394..R--KVVPIHSFFP
RNJ2_STAA8/357-396..E--YFIPVQGEFK
Q5R428_PONAB/343-385..P--HVILVHGEQN
Q3ZY44_DEHSC/394-439.PE--QVFVTHGEPK
Q3SMJ7_THIDA/400-445.PR--RVFVVHGEED
A0Q181_CLONN/390-435.PK--EILLVHGDTK
Q6MLH4_BDEBA/379-424.PK--RMFLVHGEPV
B7WQB7_COMTE/379-424.PE--RVFIVHGESD
A3CWJ1_METMJ/372-413..Q--HVIPSHGDIG
A8GNH1_RICAH/358-398..N--ICIPVHGEPI
Q5CRW9_CRYPI/395-437..Q--SIAFVHGERH
A8MJC1_ALKOO/394-439.PK--KIFLVHGEED
Q92Z81_RHIME/391-436.SA--GVFLVHGEDE
A4YH53_METS5/350-393..E--KIVVVHASPD
A8ZWQ7_DESOH/348-388..T--YFIPVHGERR
Q3LW64_BIGNA/423-463..S--YFLPVHGELI
A5ZRP6_9FIRM/391-436.PE--KVFVTHGDDE
A5D155_PELTS/389-434.PQ--EVFVVHGEPE
Q1NVJ9_9DELT/395-440.PA--HTFLVHGESA
Q6L180_PICTO/564-609.PQ--RILVNHGDGD
Q3JJT2_BURP1/522-567.PA--RTFVTHGEPA
Q1J225_DEIGD/388-431...--RVWLIHGEVP
Q8WPK6_OIKDI/544-586..K--ELILIRTKEK
Q8ZYD9_PYRAE/560-605.PK--KIVLIHGEPS
A4CGY6_ROBBH/384-429.PE--KIFIVHGERE
Q15V20_PSEA6/395-439..P--KVVLVHGEPK
Q2GQR7_CHAGB/705-747..R--KLILVAGAEE
A6VTF2_MARMS/411-456.PQ--KIHLVHGDNN
Q469C4_METBF/326-371.TE--RIFVMHGDKT
O58209_PYRHO/454-492..D--YVIPVHTEKP
Q1IJR0_KORVE/403-448.PS--QTWLVHGEPD
CPSF2_HUMAN/527-569..R--QLIIVHGPPE
Q7QC68_ANOGA/527-569..R--RVVVVRGSPA
A8ZYV1_DESOH/453-498.IR--RAVVVHGEKE
A1U408_MARAV/380-425.PE--KVYVTHGEAV
A5TRV9_FUSNP/339-379..K--IIIPVHTENS
A1VBR4_DESVV/354-393..K--VLLPVHGTAW
A5L6K6_9GAMM/384-429.PK--EVHLIHGEPD
INT11_DANRE/376-418..R--NMLLVHGEAK
Q1QVT3_CHRSD/361-398..R--RLLPVHGEQQ
A9A9T2_METM6/349-392..S--KAIVMHGERY
A2FCF8_TRIVA/382-424..K--RIVLIHGVCG
Q11PK2_CYTH3/377-423.LK--KIFLVHGEHQ
Q72BD6_DESVH/352-392..K--LLVPIHTEKK
Q64AS7_9ARCH/482-524..E--LLFPVHTERP
A6USJ2_METVS/561-606.PD--RILTVHGEAS
Q9F8I9_CARHY/4-49.PA--QIYLVHGEDE
A4BBE2_9GAMM/361-402..R--IAIPVHGEAE
A4RR19_OSTLU/495-537..R--RVVLVHGDAK
A8A8E1_IGNH4/572-617.PK--NIILNHGEPS
A1RXC5_THEPD/356-399..S--KVVLVHGEEE
A0RY50_CENSY/346-389..P--EVLTVHGDRE
A7A1G1_YEAS7/392-434..P--NIILVHGEAN
A1SFD7_NOCSJ/386-431.PE--IVYVVHGEPA
A5KS50_9BACT/457-496..K--YYLPIHGEFH
A7NRB4_ROSCS/358-396..E--FVVPFHGDYR
A2SLK7_METPP/395-440.PE--RCFVVHGEPV
Q6L0H4_PICTO/338-380..G--TVVLCHGDQR
Q5X2M7_LEGPA/396-441.PK--KVFITHGEPH
A2BK26_HYPBU/354-396..R--YIVVVHSEAD
Q1JH65_STRPD/354-391..Q--YLFPVQGEYR
Q4JB02_SULAC/554-599.PK--NLVLNHGEPS
A6US40_METVS/356-398..E--TLIIQHGEAS
A6C193_9PLAN/389-436NIG--QVFLVHGEPE
Q21X11_RHOFD/381-426.PD--QVYVTHGEWG
Q2G602_NOVAD/352-392..E--ILVPVHGEIR
A4CMY8_ROBBH/382-427.PG--HIFLVHGEPT
A0CN06_PARTE/362-404..K--SIAFVHGEYH
A3WJ92_9GAMM/341-381..R--MVIPTHGEPD
Q2S180_SALRD/393-435..E--TVLLIHGDPD
Q2YZG4_9GAMM/352-398.LK--NLFLVHGEPD
Q5FUV1_GLUOX/357-397..K--YSIPTHGEWR
CPSF2_DICDI/549-591..T--KLVLIRGSEQ
A4AC52_9GAMM/355-397..R--LAVPVHGEQR
B4SF65_PELPB/390-434.PE--.VFVVHGDQP
A7H6H0_ANADF/351-391..E--HFVPIHGEYR
RNJ_MYCPN/366-403..R--YLIPIHGEYK
Q9V076_PYRAB/373-414..E--YIVPAHGEFR
Q1PVS7_9BACT/393-440HLE--KVILVHGEPK
Q8SUC3_ENCCU/370-412..R--NVMLVHGEKS
Q7UMQ3_RHOBA/426-471.PK--EIRLVHGDYA
Q0W8H2_UNCMA/361-406.TT--DVFCVHGDRT
A3SBF4_9RHOB/356-396..Q--ILIPMHGEHR
O29718_ARCFU/336-381.AE--VVFTIHGEET
Q2SRM2_MYCCT/410-448..K--YFMPMHGEYR
A0JWK6_ARTS2/384-429.PR--MTYITHGEPE
A2SRA0_METLZ/372-414..E--HIIPSHGPFA
A6D0G5_9VIBR/385-430.LK--QLHLIHGDSE
A4X4Q7_SALTO/365-404..S--NLMPVHGEWR
A4XI93_CALS8/375-417..K--TVVFAHGSEE
Q74HX7_LACJO/271-311..K--ILAPVHTLHP
Q88M01_PSEPK/406-451.PG--RVVLVHGEQR
A8BNK1_GIAIC/411-453..R--NVAFIHGSEK
CPSF2_CAEEL/561-603..R--QIIVVHGSRD
Q09CS6_STIAD/268-307..Q--HFIPVHGEMR
A6EB60_9SPHI/302-348.VK--RIFLVHGEYD
A8AB05_IGNH4/307-346..K--EVYLVHGDEE
Q73MR4_TREDE/395-441.LK--TIFLVHGEPK
A2D958_TRIVA/390-432..S--KVVTIHGDKP
Q72JJ7_THET2/381-420..R--FFLPWHGEVR
Q8TW11_METKA/576-622.PS--KVFTNHGEPR
C0A4F5_9BACT/381-423..R--SLVLTHGDPE
B3E8Q6_GEOLS/356-396..R--QLVPVHTEFP
Q0ABE3_ALHEH/391-435..P--PIALVHGESG
Q0W2D5_UNCMA/562-607.PE--RIITNHGDEN
Q8ZTD5_PYRAE/353-396..T--KIILVHTDPL
B8FX93_DESHD/390-435.AE--NIILVHGEPD
Q18IP5_HALWD/407-449..Q--GISLIHGPPN
A3ERC5_9BACT/393-437..D--RVFLIHGEHR
Q4AAN8_MYCHJ/355-394..K--YFFPYHGEYR
Q5NZR0_AROAE/397-442.PA--EIRIVHGDDE
Q9CF63_LACLA/351-391..K--NLIPIQGEYR
Q2Q0D8_9ZZZZ/366-408..E--DVVIYHSDPN
A0NIV8_OENOE/360-399..D--YFFPVSGEYR
A8AA34_IGNH4/357-398..K--KVIIVHSEES
Q74MJ3_NANEQ/562-605...--RVVINHGERS
A8MC21_CALMQ/353-396..T--NILIVHSSPR
Q9HMJ7_HALSA/343-385...--TVLVNHGDDC
Q8IL83_PLAF7/430-472..P--NVVLVHGDKN
A4S2Z0_OSTLU/356-394..E--HFLPVHGEYA
A5IZC2_MYCAP/356-395..E--YVIPVQGLYR
A3WMD7_9GAMM/389-434.VQ--AVRLVHGSAP
A5N1D0_CLOK5/381-423..R--NIFIVHGNED
A6TST8_ALKMQ/367-409..K--KIIPIHTERS

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window