Sequence alignment for CL0401

PF13109

A0RPG5_CAMFF/433-647--------------------------------------------------------------------------------
A6Q385_NITSB/623-836--------------------------------------------------------------------------------
A6QAC9_SULNB/640-854--------------------------------------------------------------------------------
B9L5J2_NAUPA/583-798--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1U479_MARHV/979-1225--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
A3Q9Y2_SHELP/1046-1289--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FJ68_FLAJ1/564-791--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRFC/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B2FP42_STRMK/1008-1250--------------------------------------------------------------------------------
B4S7D6_PROA2/551-781--------------------------------------------------------------------------------
B7VIB8_VIBTL/1027-1268--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
E6WGF8_PANSA/1014-1257--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
D3SBX9_THISK/1040-1287--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
Q11YL6_CYTH3/532-755--------------------------------------------------------------------------------
Q11YT8_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_BURXL/1154-1409--------------------------------------------------------------------------------
Q15ZG8_PSEA6/1002-1243--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q2NWP0_SODGM/1012-1255--------------------------------------------------------------------------------
Q3IFH7_PSEHT/1008-1245--------------------------------------------------------------------------------
Q47VG9_COLP3/1038-1280--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7MHE2_VIBVY/1031-1272--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
A8GK60_SERP5/1034-1277--------------------------------------------------------------------------------
C5BC15_EDWI9/1004-1246--------------------------------------------------------------------------------
D3HJX5_LEGLN/1065-1312--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_DOKS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
N0B6U7_9RHIZ/961-1176--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q2K6G4_RHIEC/885-1104--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570MKTARRILILLLVVLIVLP....ATIIALLTTSYANSTWQW.VSPYLGLPIQAERV..............HYDFPY.HLS
Q9KNJ9_VIBCH/1-570MRKILAIGVAGIALLLILV....LAGFGIMHTRYFTPSAQWIVQQLWPETLRFAKI..............EYLYPF.KLR
Q9HU38_PSEAE/1-636MKAFGKVLGLFFLGLLLLVVALGFALTHLFDPNDYKDEIRQIARDKANLELDLKGDIG............WSLFPWLGLE
Q9KT66_VIBCH/1-595MKK....LFISLLGLVVLIVGALLALVLLVNPNQFKPLIVEQAKKQTGLDLVIEGDIG............WQFFPSIGFE
Q9JY87_NEIMB/8-615HKYRLKYAVAVLTILLLAAVGLHASVYRTFTPENIRSRLQQSIA.HTHRKISFDADIQ............RRLLPRPTVI
Q9ZDI1_RICPR/1-711MPKALKYSLIIFITIILLL....IIIPFFIPLNNYKGVLIDKVKEATNRNLTINGDIK............LSLLPTPTIS
Q9HUT4_PSEAE/1-577MTRGRKILTWSLASLVLLLA.ALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFS
YHJG_ECOLI/1-582MSKAGKITAAISGAFLLLIV.VAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVH
Q7MQ04_VIBVY/1-571MKKALISVALLLIVIALIP....ISILVSLQTRYASQVFNQ.LNQFSGLGMQAESV..............HYQYPD.HFS

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q1D0C2_MYXXD/935-1291--------------------------------------------------------------------------------
A5FB26_FLAJ1/992-1420--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
A0M1P1_GRAFK/1180-1639--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_RHOFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
A5FIP0_FLAJ1/1183-1626--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
Q11VR9_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q6MAC5_PARUW/935-1288--------------------------------------------------------------------------------
Q1QWE2_CHRSD/954-1312--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
B4E8E1_BURCJ/988-1340--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_DOKS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------------------------
Q4K5X6_PSEF5/360-511--------------------------------------------------------------------------------
B2JQ93_PARP8/874-1021--------------------------------------------------------------------------------
A0RMT1_CAMFF/653-798--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
Q484B1_COLP3/382-534--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
A3QD21_SHELP/699-846--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
Q47FN3_DECAR/732-879--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_VIBF1/399-549--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_PARP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q47VC1_COLP3/500-655--------------------------------------------------------------------------------
Q15PY6_PSEA6/662-809--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_BURXL/640-791--------------------------------------------------------------------------------
Q47FN3_DECAR/504-656--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
C1DFK3_AZOVD/367-518--------------------------------------------------------------------------------
Q484B1_COLP3/604-751--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_PARP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLSQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
A1TWZ4_MARHV/597-744--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------------------------
Q11NN1_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
A1TWZ4_MARHV/166-321--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_RHOFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_RHOFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q484B1_COLP3/152-304--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
Q5DZ89_VIBF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
C1DFK3_AZOVD/141-292--------------------------------------------------------------------------------
Q1LGA7_CUPMC/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
A3QD21_SHELP/453-602--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_CUPMC/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_RHOFT/710-857--------------------------------------------------------------------------------
C1DFK3_AZOVD/584-731--------------------------------------------------------------------------------
B2U875_RALPJ/869-1016--------------------------------------------------------------------------------
B4EKU9_BURCJ/620-772--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_THICR/496-774--------------------------------------------------------------------------------
Q2NWP0_SODGM/504-789--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
A0RPG5_CAMFF/10-294--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
Q15ZG8_PSEA6/490-776--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
A8GK60_SERP5/523-808--------------------------------------------------------------------------------
Q3IFH7_PSEHT/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
A7MJB2_CROS8/518-803--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A3Q9Y2_SHELP/509-796--------------------------------------------------------------------------------
A6QAC9_SULNB/206-494--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
Q47VG9_COLP3/504-793--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3V5J7_XENBS/502-797--------------------------------------------------------------------------------
E6WGF8_PANSA/504-789--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B4EX35_PROMH/501-782--------------------------------------------------------------------------------
B7VIB8_VIBTL/505-791--------------------------------------------------------------------------------
D3HJX5_LEGLN/559-845--------------------------------------------------------------------------------
F0LWR2_VIBFN/505-791--------------------------------------------------------------------------------
Q5E7X4_VIBF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
Q74PM2_YERPE/511-794--------------------------------------------------------------------------------
Q7MHE2_VIBVY/508-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A0RPG5_CAMFF/433-647------------------------NELNFDGLF----D--NG--------------E-VKLNK-----------------
A6Q385_NITSB/623-836------------------------ETIHFSGNY----G--PT--------------R-YVFMY-----------------
A6QAC9_SULNB/640-854------------------------NTITAVGNL----G--SD--------------K-VTFRK-----------------
B9L5J2_NAUPA/583-798------------------------DNFNFHSIY----K--DS--------------S-LNGYT-----------------
C5ZX33_9HELI/638-852------------------------DELKATLKH----K--NG--------------Q-AQIYK-----------------
D3UGW6_HELM1/730-943------------------------QRTLASLTY----K--NG--------------I-ANVDF-----------------
Q30RQ8_SULDN/697-907------------------------DIFSAELKY----K--AG--------------K-ATFLS-----------------
Q7MRT1_WOLSU/616-829------------------------ENISATLSY----K--NG--------------T-LKANL-----------------
Q7VFV2_HELHP/731-944------------------------GIIRADVTY----G--NG--------------V-ANVDM-----------------
O25308_HELPY/745-958------------------------DRVKIDGNY----K--NA--------------M-IMADL-----------------
Q0PAY6_CAMJE/635-848------------------------.ALDLKGSR----G--NA--------------K-FDLYY-----------------

PF13502

A0KFB2_AERHH/999-1241-----------------------LGEVKGELIP....G..AD.........KLSLKG-LEMRL-----------------
A1S2S6_SHEAM/1130-1371-----------------------LGHLVLQGQP....E..PG.........RYNFQT-LSLSS-----------------
A1STZ9_PSYIN/1024-1262-----------------------LSPMRLHIFP....N..KK.........NLNINY-IKIGN-----------------
A1TW53_ACIAC/1117-1369-----------------------LGRIEVEAQN....R..GGAG....APREWRLSK-LNLTV-----------------
A1U479_MARHV/979-1225-----------------------AGSWRFKLRP....E..PY.........RLRVQE-VEGRL-----------------
A1WCZ7_ACISJ/1139-1390-----------------------LGRIEIEARN....R..GTEG....GQREWRLSK-FNLTA-----------------
A1WSB5_VEREI/1101-1362-----------------------LGQLEMQARN....Q..GTDGGDAGLQREWRLTR-FNLLT-----------------
A1WYY8_HALHL/891-1129-----------------------AGVGRVRLRP....R..GE.........VLYLDE-ASIRG-----------------
A2U2U5_9FLAO/567-793-----------------------LKNVSGIIYV....K..DE.........TINLQN-LNSDV-----------------
A3HUH0_9BACT/675-900-----------------------LKEMKGEMLL....K..DG.........ILTFRD-ASMST-----------------
A3Q9Y2_SHELP/1046-1289-----------------------LGHLVLQATP....K..NG.........DYQIQT-IAITT-----------------
E0TB83_PARBH/837-1047-----------------------LHDLTVSGLF....D..GE.........RVERLI-ADGRL-----------------
A4AMF6_MARSH/560-785-----------------------LKNVRGNLRI....V..DE.........KAVLTD-VTSSL-----------------
A4CG41_ROBBH/574-799-----------------------LRNVSGNLQI....R..DQ.........ELQLRD-VRSDA-----------------
A4VIB7_PSEU5/1014-1255-----------------------LGAWALKLRP....V..GT.........GVEFHD-LALQL-----------------
A5CF63_ORITB/620-836-----------------------IQDFISKFSV....Q..DS.........IIQVKD-INCRI-----------------
A5FJ68_FLAJ1/564-791-----------------------LKDVSGKLII....K..DE.........KALLEN-FKTSI-----------------
A5FUN1_ACICJ/745-973-----------------------ARHASFSLAL....D..QGKL.....APRIAVTL-NRAEV-----------------
A6GWN8_FLAPJ/560-787-----------------------LKAVSGKMII....R..DE.........AVTLQN-IKTNI-----------------
A7HEC2_ANADF/581-801-----------------------ARNVAVRVRV....K..GD.........EVTFEQ-ARLEA-----------------
A9CIC7_AGRFC/884-1105-----------------------VTGVSAKLTH....D..AG.........SLSLDD-VAGTF-----------------
A9H3V6_GLUDA/474-684-----------------------LTGVHA..HL....E..DN.........GVRLTR-MRFAM-----------------
B2FP42_STRMK/1008-1250-----------------------LGQAVLRTRP....L..AN.........GLNVDE-LRFRA-----------------
B4S7D6_PROA2/551-781-----------------------FTDASGGLTL....K..DE.........TLSFTN-VKASS-----------------
B7VIB8_VIBTL/1027-1268-----------------------VGKVDVEMTR....Q..ED.........RIEWNK-IQVRS-----------------
C1D9M5_LARHH/1015-1258-----------------------MGKLTLMSTR....Q..KN.........EWKLDR-FQLSN-----------------
C3L4A9_AMOA5/534-754-----------------------GNKIRGRFKI....V..EQ.........QLIADA-IELIF-----------------
C4L8L8_TOLAT/989-1232-----------------------LGQFRGHLYP....V..KQ.........GGEIRD-LHWQV-----------------
E8RSC3_ASTEC/1136-1358-----------------------LVDISAVRTS....Q..DG.........VFSEVE-LKAGW-----------------
D9SHW3_GALCS/1021-1263-----------------------LGRFELIGTP....E..GQ.........NWRLRR-LHITN-----------------
D5CU11_SIDLE/1024-1263-----------------------LGKLEMNMSE....S..DG.........DVLLDN-LQLVN-----------------
C6WWM2_METML/1053-1294-----------------------LGSLELIAYP....E..ND.........NWDIQK-IKFNT-----------------
C6XD69_METGS/1043-1284-----------------------LGRLELQASE....Q..ND.........DWSIEK-LKIIN-----------------
C6XK02_HIRBI/884-1092-----------------------LLNSKIVLDM....N..PE.........TLERGL-VSGTI-----------------
C7PC84_CHIPD/564-796-----------------------MSNLSGNLLL....K..DE.........TVSMQQ-IKANA-----------------
E6WGF8_PANSA/1014-1257-----------------------FGHMQALLQP....R..GD.........TLALTN-GSVDT-----------------
D2UF54_XANAP/1023-1265-----------------------FGAASLRTRK....L..AD.........GMQVDQ-LHLRS-----------------
D3SBX9_THISK/1040-1287-----------------------LADVHLALGP....V..NQ.........GLRVDS-LRARG-----------------
Q0ABM3_ALKEH/1048-1290-----------------------LGRLDLRVTP....E..GD.........SARFES-IRLDT-----------------
Q0AQ38_MARMM/879-1092-----------------------LDQFNLIWRS....E..AA.........GIRAVS-VSGNA-----------------
Q11YL6_CYTH3/532-755-----------------------ASKITSKIEW....N..FP.........YLNFTN-SNLIF-----------------
Q11YT8_CYTH3/698-925-----------------------MTNMKGAIIV....R..NG.........IVKMDK-LNFNS-----------------
Q145G0_BURXL/1154-1409-----------------------VGRLEVDAHN....F..DEDG.....VPVWQLDK-LDITN-----------------
Q15ZG8_PSEA6/1002-1243-----------------------LGRVDFKLSR....A..AN.........GMHIDS-LRLNN-----------------
Q211X0_RHOPB/871-1087-----------------------LRPVSGLLRS....D..GG.........SLIIDK-LTGKI-----------------
Q28TM9_JANSC/371-572-----------------------LSEIDLRSTL....T..RG.........RLVFDI-ASIRT-----------------
Q2KY05_BORA1/936-1183-----------------------LGELQLLGTN....TEVGH.........RWRLDK-LQIRN-----------------
Q2NWP0_SODGM/1012-1255-----------------------LGQISATIQP....Q..QD.........TLMLTG-GVIDT-----------------
Q3IFH7_PSEHT/1008-1245-----------------------LGKVSASLLG....D..GK.........RLVISE-LVVDK-----------------
Q47VG9_COLP3/1038-1280-----------------------LGEVDVNIKR...ID..QQ.........TIEFKN-FTAKR-----------------
Q5R0H7_IDILO/1003-1244-----------------------LGEVELVLAP....L..ED.........GFSIEK-MALKK-----------------
Q7MHE2_VIBVY/1031-1272-----------------------VGKVNIDLQR....Q..GK.........ALVWKN-ISLVS-----------------
Q7UYB4_RHOBA/752-985-----------------------AGNAHSALVA....T..ANFQS...SKWSVNFPS-VRSRV-----------------
Q8EA16_SHEON/1025-1268-----------------------FGKLVVQASP....Q..AS.........GYRIQT-LSLTT-----------------
Q9ZDH9_RICPR/624-849-----------------------FRNVKFYLAN....H..NN.........LLQFNN-IEAEL-----------------
A8GK60_SERP5/1034-1277-----------------------LGKVEADLAN....Q..GD.........TLTLEH-GLVDT-----------------
C5BC15_EDWI9/1004-1246-----------------------LGKVAADMRV....E..GD.........TLQLTD-GLLDS-----------------
D3HJX5_LEGLN/1065-1312-----------------------IGNITLKSQS....S..VG.........KWSINY-CRIDS-----------------
E0SHA8_DICD3/1031-1273-----------------------.GQVKGTLQP....E..PN.........KLVLAN-GLVDN-----------------
F4AYZ2_DOKS4/566-791-----------------------LSNTKGSVTI....A..NE.........QASLSN-LNSGI-----------------
G2J3B5_PSEUL/1018-1258-----------------------.GKLELHAVQ....S..GK.........DWLLDR-FVLRS-----------------
M1FEQ6_9ALTE/970-1216-----------------------LGQWSFLLRP....Q..AG.........GVSIES-IEGKL-----------------
N0B6U7_9RHIZ/961-1176-----------------------LRNVKMQIET....R..GG.........NLTALN-VKGTL-----------------
Q0KCK4_CUPNH/1119-1370-----------------------..KLEVKAHTGTSSA..DP.........VWTLEK-LQIEQ-----------------
Q0VS66_ALCBS/1022-1263-----------------------FGQWQAELRP....T..EQ.........GLRIND-LQGRW-----------------
Q2K6G4_RHIEC/885-1104-----------------------.SDFTSNVAY....K..GD.........ELQLND-MAGNW-----------------
Q32B94_SHIDS/1009-1252-----------------------FGRIDSDITI....S..GN.........TLTLTN-GLIDT-----------------
Q5ZUN8_LEGPH/1014-1261-----------------------IGNITLKSHS....T..SE.........QWKIDY-CRIDS-----------------
Q63R38_BURPS/1120-1377-----------------------IGRLEVDARN....V..DENG.....IPVWQLDK-LELAN-----------------
Q6LMA6_PHOPR/1035-1276-----------------------LGKVSGKLRK....D..NN.........TLVLQN-LQVKS-----------------
Q8P7K3_XANCP/1032-1273-----------------------.GAATLRSSR....L..TD.........GMQVDQ-LQLRS-----------------
Q9KUU5_VIBCH/1028-1269-----------------------IGQANVDFQR....Q..GD.........TLLWKS-IDFTS-----------------
Q9PEA2_XYLFA/983-1225-----------------------FGRMELRTRH....M..SD.........GMQVDQ-LQTNS-----------------

PF05170

Q87TE2_VIBPA/1-570LQNVRSQDAQ..........LPYIEQVDVWLNP---DIRRDG---------KWIIDS-LLIDG-----------------
Q9KNJ9_VIBCH/1-570LSGVQIASEP..........TIELQQMDLWLNP---YGLLEQ---------QLEIDS-VLIDG-----------------
Q9HU38_PSEAE/1-636LHDTSIASAATPTKP.....FADLQMLGLSVRV---LPLLRK---------DVQMSA-IRVEG-----------------
Q9KT66_VIBCH/1-595LGKTELKNPQGFASP....NLFKVESVGIDVSV---MPLLDK---------QLKIGN-IRLDG-----------------
Q9JY87_NEIMB/8-615LKNLTITEPGGDQT......AVSVQETKIGLSW---KNLWSD---------QIQIEK-WVVSS-----------------
Q9ZDI1_RICPR/1-711LSEIKLSSINGAKVP....HLVSVEAVKASLRL---FPLFRG---------VIEVAL-IELQK-----------------
Q9HUT4_PSEAE/1-577AEDITLGNPEWTAGKTKASEFASLERIEFRLAP---LPLLWQ---------TIRIPQ-IKLTQ-----------------
YHJG_ECOLI/1-582AEDIILGNPPDIPEV....TMVHLPRVEATLAP---LALLTK---------TVWLPW-IKLEK-----------------
Q7MQ04_VIBVY/1-571FKNVSFTHNE..........VSYIEQLEIWLSP---ELYANG---------RVQIAS-VLLDG-----------------

PF04357

A2U1I0_9FLAO/1175-1633------------------------SK..FTILD...AN--RN---------SLVLSG-.KILT.....ESFINPE.....
Q83EW1_COXBU/570-928------------------------EG.Y........SQ--NQ---------PIQITG-.QTRL......DAPGRP.....
Q1D0C2_MYXXD/935-1291------------------------EH..LQGQL....N--DG---------RVSARG-.DVRL.....ERFLPQR.....
A5FB26_FLAJ1/992-1420------------------------RNNQLTDT....KY--KT---------KGLLNG-.TIEH.....HNFGDWK.....
Q8YZJ8_NOSS1/1412-1829------------------------QG..IQATY....N--QG---------LVSASG-.NLPIF..ATG..ETVT.....
A4CK93_ROBBH/998-1431------------------------QNIRLTDR....AE--GT---------TAVLDG-.TISH.....QFFSDWR.....
A3U6I2_CROAH/1185-1647------------------------DNFKIAD.....EK--KN---------TFTVDG-.DVFT.....ESLINPA.....
A0LGH5_SYNFM/889-1254------------------------DRAGMK......VL--GG---------HVELTG-.RLDY.......PSFQT.....
A3HZ37_9BACT/1160-1620------------------------SQFTVKD.....AD--NN---------TFIVDG-.SILT.....NDFTNPE.....
A5GSG8_SYNR3/973-1387------------------------ER..FSARS...GE--.G---------SIDGQG-.NLA.F..RQE..GGE......
A6L590_BACV8/1012-1461------------------------GSLDFRNVKVYDRE--GH---------DGLVNG-.YLHH.....TKLKNLM.....
A0M1P1_GRAFK/1180-1639------------------------DNFNIED.....AN--DN---------SIVVNG-.KIIT.....ENLLNPG.....
Q2S2D2_SALRD/1057-1516------------------------RTLRVQD......E--EG---------TATVDG-.SILF.....NDYQYFS.....
Q21Y28_RHOFT/928-1291------------------------QG..AG..G...AS--GG---------QLSITG-.SVLWL...PPTGPDAKVAARL
Q6MKB2_BDEBA/958-1321------------------------NS..INGQI....A--GG---------TLTGDG-.GIQI.....NGIKDIP.....
Q39RU7_GEOMG/1016-1376------------------------ES..L.RAK...SG--AG---------TLTATA-.VIGL......DRWRVA.....
Q7VBL9_PROMA/867-1309------------------------QT..LTARI...GD--KG---------VVKANG-.GMYIF..RDD..KEIS.....
A5FIP0_FLAJ1/1183-1626------------------------DKFSLFD.....EN--DN---------ELYVNG-.NIKS.....PDFRKYN.....
Q8KFW2_CHLTE/1034-1479------------------------GR..LEVKD...AE--NG---------TGAVSG-.MIGL.....DGLKPVT.....
A6H009_FLAPJ/1018-1446------------------------RNIKITDS....KY--ST---------KGILSG-.GIKH.....HNFGDWF.....
B5E9K2_GEOBB/1121-1484------------------------ER..L.RAR...SG--EG---------ELVGNL-.LVQL......NGREIA.....
Q11I59_CHESB/1185-1538------------------------RS..ASAAL...AA--GG---------LLSLSG-.TIST.....SAAAGFP.....
Q11VR9_CYTH3/1167-1624------------------------KSFNILD.....SL--NN---------EAIING-.TVGI.....EKFDNAT.....
A7HQ23_PARL1/1042-1395------------------------T...MSARD...SG--DG---------RLTGEG-.TVSL.....AADASPA.....
Q7MT86_PORGI/1036-1486------------------------TRMRFENMLVSDPD--GH---------TARLNA-.HISH.....RAFDDIK.....
Q3AQ57_CHLCH/1053-1500------------------------RN..ITLSD...NN--NG---------KGSIRG-.FVHL.....EKLQPSR.....
A1BDC7_CHLPD/1048-1494------------------------RD..LRIAD...LQ--NG---------TGSLNG-.LLKI.....ENLKPKT.....
Q6MAC5_PARUW/935-1288------------------------KH..FSAEN...SK--HG---------SITAKG-.KISL.....DKKQHFP.....
Q1QWE2_CHRSD/954-1312------------------------EG..FVAG....EE--.G---------RLDLVG-.DADW.......QDPAAW....
Q2RSJ7_RHORT/1146-1500------------------------D...LDARD...GG--KG---------RVSLKG-.RVLL.....VDLTRPI.....
Q2S346_SALRD/1311-1689------------------------EQARLRT.....PN--GG---------SLRADG-.TISL.....PELTVGE.....
Q2INP6_ANADE/946-1304------------------------ED..LGALL....N--GG---------HARFTG-.EVEL.....ARLAPSR.....
Q9RUC9_DEIRA/223-627------------------------DA..RSRSTNPVTG--AG---------TLTLSG-.ALTP...........R.....
Q1LSN0_BAUCH/634-981------------------------QG..FIG.....TT--HG---------QIYLNG-.YADW.....CNLHTWH.....
B3ELK5_CHLPB/1036-1483------------------------RD..IQIKD...VR--GG---------TGRING-.SATL.....ENLEAST.....
Q8YUC2_NOSS1/1659-2048------------------------EG..LEGKF....S--RG---------QVQASG-.AIPVFD.NSS..VAIE.....
Q1MQI4_LAWIP/1025-1382------------------------SHIQATASD...GK--QG---------SIQLIG-.NIGS......SKEHFP.....
Q7VQN5_BLOFL/933-1286------------------------DG..VVNV....MN--GG---------RLYLDG-RIINF.....NVIQNFK.....
Q31MA1_SYNE7/1177-1568------------------------ET..LSSNF....N--GG---------TLTAQG-.ILPIAQLLPASDPDRE.....
B4E8E1_BURCJ/988-1340------------------------.....EFH....GG--DG---------TLRALG-.RVRL......DGEAPD.....
E3G0N9_STIAD/1177-1560------------------------.E..LFAR....AG--AG---------ELKLTA-.DAKA......TRGVFE.....
F4B3D6_DOKS4/1021-1426------------------------............KY--KT---------LGALNG-.SISH.....KSFSDWK.....
Q46LW1_PROMT/887-1319------------------------.D..LKANM...GA--NG---------IISSQG-.GISL....FDSQLSES.....
TAMB_HAEIN/952-1298------------------------..............--DS---------HLNLTG-.RANW.....ANIEHWT.....
Q5NNB3_ZYMMO/1036-1389------------------------.K..MTGK....AG--KG---------TLTAKG-.YASF.....DAASDYD.....

PF05359

Q4K5X6_PSEF5/140-291----------------------------FPVRI----E-------------RIKLAG.GYLHF-----------------
Q4K5X6_PSEF5/360-511----------------------------WQVLL----K-------------DVQLRN.YQVHL-----------------
B2JQ93_PARP8/874-1021----------------------------VRLHF----G-------------QLVLQN.GRVNY-----------------
A0RMT1_CAMFF/653-798----------------------------FKLSL----K-------------NLTLKN.GSLEF-----------------
Q72DG8_DESVH/963-1109----------------------------DRFTL----G-------------EVTVRG.GKIAF-----------------
A9BMN7_DELAS/883-1036----------------------------PVIKI----G-------------PIVLTG.GRVQF-----------------
Q2LUD1_SYNAS/534-687----------------------------WQYGV----K-------------KVALND.IGVHW-----------------
A8ZWF7_DESOH/636-783----------------------------TPIQI----G-------------RFLMNN.TELKF-----------------
Q3A6W6_PELCD/375-529----------------------------LPLHL----K-------------RFELRD.ARLLW-----------------
Q5NYY7_AROAE/382-536----------------------------PVFLL----D-------------EAKISG.ATVRF-----------------
Q2KWF8_BORA1/759-906----------------------------PDMSV----N-------------SVTLKR.GRMSF-----------------
Q484B1_COLP3/382-534----------------------------WDLEI----K-------------AISTSN.NNIVI-----------------
A2SI01_METPP/870-1017----------------------------PQLRW----R-------------EIRLAG.GTVDF-----------------
Q8Y0Z7_RALSO/615-766----------------------------WAVTV----Q-------------ALRLDN.GAIGF-----------------
Q5QWM2_IDILO/380-527----------------------------FGITI----E-------------GVELSD.GDVQF-----------------
Q0VP61_ALCBS/592-737----------------------------WQVTV----D-------------KLRLVG.SQVRH-----------------
A3QD21_SHELP/699-846----------------------------MALSI----N-------------KIVFKD.GSTFF-----------------
Q63NS2_BURPS/645-797----------------------------WRYRI----D-------------ELNVKD.AKANF-----------------
Q47FN3_DECAR/732-879----------------------------VPIKI----A-------------KITLQN.GTVNF-----------------
A0KK00_AERHH/368-522----------------------------WRWSL----K-------------QTRIEQ.GQLKL-----------------
Q0JZH1_CUPNH/670-829----------------------------WKADI----G-------------KVTVEG.GSARL-----------------
Q2LUD1_SYNAS/785-932----------------------------VPIKI----N-------------RVTLQG.GRVNF-----------------
A1ARF1_PELPD/790-937----------------------------HQISI----G-------------AVTIQD.GTIAF-----------------
Q39RS7_GEOMG/568-719----------------------------FRYRI----A-------------SVAASG.LGLTF-----------------
B9M3X2_GEODF/795-942----------------------------PEIRI----D-------------TVTLQE.GTVSF-----------------
Q8Y0Z7_RALSO/185-339----------------------------ARFVF----A-------------NLQLNN.GAIQF-----------------
Q3JBN6_NITOC/584-731----------------------------LPIAI----N-------------SIRIKK.GSANF-----------------
Q5DZ89_VIBF1/399-549----------------------------WLVTL----D-------------GIEIKD.YQLNV-----------------
Q1QTZ9_CHRSD/145-295----------------------------APLRI----D-------------RLTVSD.GRLDW-----------------
A9BMN7_DELAS/165-317----------------------------VGFAL----Y-------------NIALRD.GRVEL-----------------
A9BMN7_DELAS/379-538----------------------------WKVSL----D-------------RLSVAH.ATVHW-----------------
Q87WR1_PSESM/386-537----------------------------WQVLL----R-------------DVQLRN.YTVHL-----------------
B2JQ93_PARP8/616-770----------------------------WHYSI----A-------------ELNLKN.GAATF-----------------
A1K6C3_AZOSB/734-881----------------------------FPLRV----E-------------RVELRD.GIVEF-----------------
Q603H4_METCA/718-865----------------------------WLVTV----E-------------AVRVEK.GDIDF-----------------
Q47VC1_COLP3/500-655----------------------------V.FSF----K-------------ELRFINENSFAF-----------------
Q15PY6_PSEA6/662-809----------------------------MAINI----G-------------EIRLLG.GSAYF-----------------
Q88DW4_PSEPK/365-516----------------------------WQVLL----K-------------DVQLRN.YLVHL-----------------
A0KK00_AERHH/578-725----------------------------PRVSI----A-------------QVRTEQ.GNLRF-----------------
B5ECC6_GEOBB/569-721----------------------------FAYRV----Q-------------RLQLDG.FKLAF-----------------
Q2LUD1_SYNAS/159-313----------------------------MRFSL----N-------------NIRITQ.GRIEF-----------------
A4VPN2_PSEU5/551-698----------------------------LAIRI----G-------------GINIAD.GSANF-----------------
Q0VP61_ALCBS/382-530----------------------------WVTRL----D-------------NLAIEG.NTLRL-----------------
A1K7K6_AZOSB/583-736----------------------------WSVGV----Q-------------KLALSD.ASLRL-----------------
Q3JBN6_NITOC/369-521----------------------------WRAAI----K-------------KIKVEN.VSASL-----------------
Q5NYY7_AROAE/832-979----------------------------PPISI----G-------------KILIKQ.GNIAF-----------------
Q13S79_BURXL/640-791----------------------------WHYKI----G-------------ELVLKD.ATANF-----------------
Q47FN3_DECAR/504-656----------------------------WIGKV----G-------------KLAVED.LAFRF-----------------
Q316X0_DESAG/862-1008----------------------------SDVRL----G-------------GAFISD.GTVHF-----------------
Q602F3_METCA/416-565----------------------------WAFSL----G-------------EGVIRN.YRLNL-----------------
Q2Y5K5_NITMU/673-818----------------------------LPISI----G-------------RIVMQG.GHVNF-----------------
B3E4B8_GEOLS/816-963----------------------------GQIKI----D-------------TLTVQD.GTIAF-----------------
A4VPN2_PSEU5/341-492----------------------------WQVLL----H-------------DAQLRD.YRMHL-----------------
Q5NYY7_AROAE/153-307----------------------------ARFSL----N-------------NIRVID.GKLLV-----------------
Q30NX8_SULDN/563-715----------------------------YNVKL----D-------------SFDMNG.AKLLF-----------------
C1DFK3_AZOVD/367-518----------------------------WQIVL----A-------------DVRLRG.SRLYL-----------------
Q484B1_COLP3/604-751----------------------------FTADI----N-------------EINITN.GKLDF-----------------
Q5NYY7_AROAE/604-757----------------------------WSFAL----E-------------RLAFDD.WAVRF-----------------
Q602F3_METCA/623-770----------------------------FAVTV----G-------------SLLVRD.GSADF-----------------
Q316X0_DESAG/389-538----------------------------FSIQL----D-------------AASVTG.GSVAL-----------------
A5G9K9_GEOUR/137-293----------------------------PRFSL----N-------------NIAVTN.GSIDF-----------------
B2JHK1_PARP8/152-309----------------------------AEKLI----D-------------HIAFAD.GRFVF-----------------
A5G9K9_GEOUR/551-702----------------------------LSYRI----G-------------RVSGAG.MNIVF-----------------
A0KK00_AERHH/151-307----------------------------LLVQI----N-------------QLAAEQ.GHITY-----------------
Q1H1L3_METFK/780-927----------------------------FPVAI----E-------------RIRIDN.ANLEF-----------------
B9M7L7_GEODF/383-534----------------------------LRYGI----G-------------RISGTG.VNVVF-----------------
A4SXW3_POLSQ/414-561----------------------------FGLDI----K-------------TLGMKN.GEVFF-----------------
B9M3X2_GEODF/564-715----------------------------FHYTV----S-------------SVVGKG.IDVSF-----------------
A4G9D7_HERAR/154-308----------------------------ARFSV----F-------------NIELDK.GRIEF-----------------
Q21F55_SACD2/584-731----------------------------MALTI----G-------------KIEILQ.SAGHF-----------------
Q7NY28_CHRVO/704-851----------------------------PQVDV----H-------------SIHVQN.GAVEF-----------------
Q0JZH1_CUPNH/164-317----------------------------ARFSV----N-------------NIAVTG.SSFGY-----------------
A1TWZ4_MARHV/597-744----------------------------FIFRI----G-------------ELVVEQ.GSMAY-----------------
B3E4B8_GEOLS/367-514----------------------------LQLMV----E-------------NLALTD.GAVSF-----------------
Q2IFA1_ANADE/563-710----------------------------WRTAI----G-------------SVEVVG.GRVAL-----------------
Q1QTZ9_CHRSD/348-494----------------------------MHVAI----G-------------TLAIER.GAVAF-----------------
Q11NN1_CYTH3/142-298----------------------------LPIEI----N-------------RFEIHN.GKIKY-----------------
Q9HV64_PSEAE/140-291----------------------------FPLRI----D-------------RIQLAE.GSLHF-----------------
Q3SGZ4_THIDA/733-880----------------------------FPLSV----G-------------RLRITG.ANAEF-----------------
Q3A6W6_PELCD/162-316----------------------------FGVML----T-------------DLEITG.GLIHF-----------------
Q316X0_DESAG/600-751----------------------------WSFTV----Q-------------KAALQN.SECVL-----------------
A1TWZ4_MARHV/166-321----------------------------PRLYF----Q-------------QVTIDG.GELLF-----------------
B9M7L7_GEODF/592-739----------------------------GMIRI----G-------------TITMQS.GTLSF-----------------
Q222N5_RHOFT/496-646----------------------------WVAVA----K-------------TVELSK.FGADV-----------------
Q3A6W6_PELCD/805-951----------------------------VTLGI----G-------------GLQISD.ANLVM-----------------
A5G9K9_GEOUR/769-916----------------------------RLVRI----D-------------TVTMQD.GTLAF-----------------
A2SI01_METPP/623-775----------------------------WQ..V----G-------------ELSCSN.CRVTL-----------------
Q083W9_SHEFN/492-642----------------------------WLVTL----D-------------KISIAQ.YQVKL-----------------
Q083W9_SHEFN/725-872----------------------------MKLNI----N-------------KIGFTD.SSAFF-----------------
Q12MK5_SHEDO/654-801----------------------------LSFEI----E-------------RIRFDK.SSAFF-----------------
Q3SGZ4_THIDA/517-669----------------------------MALHL----G-------------RLGLND.IAVEV-----------------
A1ARF1_PELPD/573-725----------------------------FSYRL----R-------------RFQTDR.LNLAF-----------------
Q39RS7_GEOMG/801-948----------------------------RQIAI----D-------------TVILQE.GTLAF-----------------
Q603H4_METCA/502-653----------------------------WRYAV----Q-------------QFVLED.FGLAL-----------------
Q222N5_RHOFT/149-300----------------------------PRVIV----E-------------QLALEQ.GTVDM-----------------
A8ZWF7_DESOH/412-569----------------------------FVVDV----D-------------RFVLTG.GTARF-----------------
A4XYD1_PSEMY/354-505----------------------------WQVLL----Q-------------DVQLRD.YKAHL-----------------
Q484B1_COLP3/152-304----------------------------WILSI----D-------------KFRHNE.GIINF-----------------
Q21F55_SACD2/154-306----------------------------PRIRI----S-------------DIQFSI.ARIDL-----------------
Q3SGZ4_THIDA/147-307----------------------------VRLLV----D-------------HIRIAD.GRVAY-----------------
A7I315_CAMHC/662-807----------------------------FDFTL----K-------------NIKLLG.GEIDF-----------------
Q74FC9_GEOSL/787-934----------------------------RAITI----G-------------AVTMQA.GTLDF-----------------
A7H8M2_ANADF/367-518----------------------------WRWSV----G-------------ALAVTG.LAVEL-----------------
Q5DZ89_VIBF1/610-757----------------------------FALSV----R-------------KIAFNN.GSAFF-----------------
A4XYD1_PSEMY/562-709----------------------------LAIRI----G-------------GVAIND.GSANF-----------------
B3E4B8_GEOLS/583-736----------------------------LSWQV----K-------------KINVTG.LSTTF-----------------
C1DFK3_AZOVD/141-292----------------------------FPVHL----D-------------RFLLSA.GQIHF-----------------
Q1LGA7_CUPMC/681-840----------------------------WKVRV----G-------------KMAVDG.GSARL-----------------
B5ECC6_GEOBB/807-954----------------------------RQVSV----G-------------SVTIQN.GTLSF-----------------
Q2IFA1_ANADE/358-509----------------------------WRWSV----G-------------ALAVSG.LAVDV-----------------
A4XYD1_PSEMY/140-291----------------------------FPLRI----D-------------NLHLRE.KALHF-----------------
A7H8M2_ANADF/165-318----------------------------PRVSI----G-------------RLAVEE.ASVTF-----------------
A3QD21_SHELP/453-602----------------------------WHAKL----E-------------KISLSN.YQLNL-----------------
Q3A6W6_PELCD/588-738----------------------------WQTQL----A-------------ELKLVD.GQISI-----------------
A7H8M2_ANADF/579-726----------------------------WRTAI----G-------------AVQVVR.GRASF-----------------
A8ETY5_ARCB4/612-759----------------------------TKLNI----G-------------PVNIKN.AVLDF-----------------
Q30NX8_SULDN/772-919----------------------------LSYKL----L-------------NLKVTN.GSANF-----------------
A4VPN2_PSEU5/125-276----------------------------FPLRI----D-------------QLQLVR.GHLAF-----------------
Q1LGA7_CUPMC/173-326----------------------------ARFSV----S-------------NIAVTN.TSFVY-----------------
Q1H1L3_METFK/561-712----------------------------WAFDL----K-------------RFAIED.AGLHF-----------------
Q222N5_RHOFT/710-857----------------------------FPVRI----R-------------RLRLQN.AKLDF-----------------
C1DFK3_AZOVD/584-731----------------------------LGIRI----G-------------AVEIKN.GSANF-----------------
B2U875_RALPJ/869-1016----------------------------.DLRV----D-------------AITLQD.GNIRF-----------------
B4EKU9_BURCJ/620-772----------------------------WHYRI----D-------------ALNVKE.ASANF-----------------
D0J281_COMT2/165-316----------------------------.SFAL----Y-------------NIALRD.GRIEL-----------------
M1FB64_9ALTE/585-727----------------------------.IFRI----G-------------ELQLDN.ADVDY-----------------
Q63NS2_BURPS/160-304----------------------------.RFSV----S-------------NIQVND.GRIEF-----------------
Q7VVF7_BORPE/156-309----------------------------.RFSL----N-------------NMVLEG.GEITL-----------------
Q7VVF7_BORPE/538-685----------------------------.....----E-------------GAALRL.SDLSL-----------------
Q87WR1_PSESM/155-306----------------------------FPLRI----G-------------EIKLAD.GYVHF-----------------
Q88DW4_PSEPK/140-291----------------------------FPLRI----G-------------SIKLID.GYLHF-----------------
Q88DW4_PSEPK/581-725----------------------------..IHI----G-------------QIDIND.GSANF-----------------
Q8EDF6_SHEON/666-811----------------------------..LDI----Q-------------KISFNQ.GSAFF-----------------
Q9HV64_PSEAE/476-627----------------------------WNIVL----R-------------DAQLRG.YKAHL-----------------
Q9HV64_PSEAE/692-837----------------------------..IHI----G-------------GVRINN.GSANF-----------------

PF13116

C6XK02_HIRBI/457-744-----------------------KASPQQIIS.YWP..-------------.VKLGS-GARDW-----------------
Q7NW94_CHRVO/514-796-----------------------QIKAARVAA.YLP..-------------.RHVGE-HTSSW-----------------
Q7N037_PHOLL/501-786-----------------------VYDAGDAWR.YFPE.-------------.PLMGT-PLTDY-----------------
A4XQL3_PSEMY/513-798-----------------------DGDAAYTEK.YLPSR-------------SPGMSA-ELDKW-----------------
Q3J7T7_NITOC/517-810-----------------------KIDLAALPQ.YLPS.-------------.PAMKP-GLVRW-----------------
D5CU11_SIDLE/524-805-----------------------RVAVQRTGR.YTPL.-------------.PAVNK-ATHDW-----------------
A1AVR0_RUTMC/242-525-----------------------RMNVINISD.YLPM.-------------.VLIGD-INHQW-----------------
Q31FH6_THICR/496-774-----------------------PDKLSFVKQ.YLPY.-------------.GLMSS-KLENW-----------------
Q2NWP0_SODGM/504-789-----------------------LDNAADAWR.YFPE.-------------.PLMGT-RLVDY-----------------
B8GV04_THISH/540-825-----------------------DGDGSRTAA.YLPV.-------------.GIMPQ-NTSRW-----------------
A0RPG5_CAMFF/10-294-----------------------ANSIEKFIDNLAEK.-------------.TDLHT-EIKNW-----------------
Q07WQ4_SHEFN/504-791-----------------------INDVSHLGR.YFPL.-------------.MAMSP-NLTTY-----------------
Q5ZUN8_LEGPH/507-795-----------------------GKNLQKWMP.YLPK.-------------.KHMKA-KLFAW-----------------
Q7VFV2_HELHP/222-511-----------------------LYNLESIKP.YILK.-------------..LNNP-TLNNW-----------------
Q12IX1_SHEDO/530-817-----------------------VKQAQHLGD.YFPL.-------------.AAMSP-ELVEY-----------------
Q15ZG8_PSEA6/490-776-----------------------GLDVAQVNQ.LLPG.-------------.VVMGK-DTKAY-----------------
A6Q385_NITSB/202-483-----------------------NRQLQNLFV.QIPI.-------------....NE-EIKSW-----------------
A8GK60_SERP5/523-808-----------------------LYDAADAWR.YFPE.-------------.PLMGK-HLVDY-----------------
Q3IFH7_PSEHT/493-781-----------------------APDASIAGH.YFPL.-------------.KAMSP-ELVSY-----------------
D9SHW3_GALCS/523-805-----------------------HGEIGHAAR.YIPL.-------------.VALDK-KDSDW-----------------
Q21FT5_SACD2/542-827-----------------------ASNASSHRR.YVP..-------------.KVVPQ-ALYRW-----------------
A7MJB2_CROS8/518-803-----------------------TSDAAQAWR.YFPE.-------------.NLMGK-DLVDY-----------------
C6XD69_METGS/519-799-----------------------QADAQYARF.YYP..-------------.KILGE-HTLAW-----------------
A7I2E8_CAMHC/213-497-----------------------AKSIKNFMDEIALK.-------------.TDMSR-TTKNW-----------------
Q6LMA6_PHOPR/509-794-----------------------ISNAGEAWR.YLPT.-------------.LALGH-DLTDY-----------------
D0L1I5_HALNC/561-853-----------------------DIHVARVPA.YLPR.-------------.NLLGK-NVLHW-----------------
A3Q9Y2_SHELP/509-796-----------------------VKNAARAKY.YFPK.-------------.HAMSE-SLVDY-----------------
A6QAC9_SULNB/206-494-----------------------FGDLKTFID....R.-------------.LPMNE-KVNAW-----------------
A8EUE5_ARCB4/193-478-----------------------FENLKFLKEH.....-------------.LDLPQ-EANEW-----------------
C5ZX33_9HELI/208-498-----------------------FKNINFLLP.LLPP.-------------..FKNQ-LLKEW-----------------
Q1H0H5_METFK/520-800-----------------------RVDGQYARF.YYP..-------------.VMLGE-HTLSW-----------------
Q7MRT1_WOLSU/187-475-----------------------FDSLRFLKD.VVEI.-------------...ENP-NIRAW-----------------
Q47VG9_COLP3/504-793-----------------------NGNAGLVGR.YLPL.-------------.PIMSE-NLVNY-----------------
A4G3G0_HERAR/587-887-----------------------GLELNKIGN.YLP..-------------.LGMNA-QFRTW-----------------
D1B1Z5_SULD5/203-493-----------------------NVELSNFMDFLAPK.-------------.VELEQ-IVKDW-----------------
D3V5J7_XENBS/502-797-----------------------VDDAGEAWR.YFPR.-------------.SLMGA-SLADY-----------------
E6WGF8_PANSA/504-789-----------------------VTDAGDAWR.YFPE.-------------.PLMGH-GLTHY-----------------
D3VKA4_XENNA/501-791-----------------------LDDSGEAWR.YFPK.-------------.PLMGE-SLTNY-----------------
Q0ABM3_ALKEH/531-818-----------------------DGDASRTAR.YLPL.-------------.RHLPP-AAREW-----------------
A0KFB2_AERHH/486-771-----------------------.KNAANADR.YYPL.-------------.QVMDK-SLVDY-----------------
A6TER2_KLEP7/497-781-----------------------.NDGGQAWR.YFPE.-------------.NLMGK-ALVDY-----------------
B4EX35_PROMH/501-782-----------------------.TDAGETWR.YLPE.-------------.KYVGK-DLTQY-----------------
B7VIB8_VIBTL/505-791-----------------------.YNVGETWR.YLPT.-------------.LALGQ-DLTDY-----------------
D3HJX5_LEGLN/559-845-----------------------.KNWQQWVA.FLPK.-------------.EYLKP-KLYLW-----------------
F0LWR2_VIBFN/505-791-----------------------.YNAGETWR.YLPT.-------------.LALGH-DLTDY-----------------
Q5E7X4_VIBF1/495-780-----------------------.FNADQTWR.YLPT.-------------.LALGQ-DLTDY-----------------
Q6DAI1_PECAS/504-784-----------------------.TDAADAWR.YYPE.-------------.LFMGT-DLVDY-----------------
Q74PM2_YERPE/511-794-----------------------.YDATDAWR.YFPV.-------------.SLMGE-KLADY-----------------
Q7MHE2_VIBVY/508-794-----------------------.YNVGETWR.YLPT.-------------.LALGR-ELTDY-----------------
Q83BN5_COXBU/480-760-----------------------.KNINAIKN.YLPS.-------------.RGLSP-HLRAW-----------------
Q8ZLP4_SALTY/504-786-----------------------.DDGSQAWR.YFPE.-------------.NLMGK-ALVDY-----------------
Q9KUU5_VIBCH/504-791-----------------------.FNAGETWR.YLPT.-------------.LALGR-ELTDY-----------------

PF13109

A0RPG5_CAMFF/433-647-QK-----NSV--------K-I---------------------------EGD---GLD----------------------
A6Q385_NITSB/623-836-QN-----NNV--------N-I---------------------------SMK---NMH----------------------
A6QAC9_SULNB/640-854-TG-----AKI--------A-I---------------------------EAL---RIH----------------------
B9L5J2_NAUPA/583-798-KQ-----GYL--------L-L---------------------------EGK---NFS----------------------
C5ZX33_9HELI/638-852-KG-----DYI--------T-L---------------------------DAK---EFG----------------------
D3UGW6_HELM1/730-943-LD-----GSI--------Y-I---------------------------KAS---NFS----------------------
Q30RQ8_SULDN/697-907-KN-----NDF--------H-L---------------------------HGE---KFN----------------------
Q7MRT1_WOLSU/616-829-QN-----KRL--------K-I---------------------------EAR---HFN----------------------
Q7VFV2_HELHP/731-944-AY-----SRA--------V-L---------------------------RLS---NFS----------------------
O25308_HELPY/745-958-VH-----GAL--------Y-L---------------------------KAH---NFS----------------------
Q0PAY6_CAMJE/635-848-SS-----NDL--------N-L---------------------------NVS---NID----------------------

PF13502

A0KFB2_AERHH/999-1241-AG-----SQL.-------N-G...------------------------SAE...WLA..G.......------------
A1S2S6_SHEAM/1130-1371-GA-----ATL.-------K-G...------------------------QGG...WLM..D.......------------
A1STZ9_PSYIN/1024-1262-EK-----EFT.-------E-I...------------------------SGV...WDQ..........------------
A1TW53_ACIAC/1117-1369-PE-----ATF.-------T-S...------------------------SGN...WVL.LG.......------------
A1U479_MARHV/979-1225-GS-----LVL.-------S-G...------------------------DMT...WSI..V.......------------
A1WCZ7_ACISJ/1139-1390-PE-----AVL.-------T-S...------------------------QGH...WAL.VGS......------------
A1WSB5_VEREI/1101-1362-PE-----ASL.-------S-A...------------------------QGNWARLNA..TG......------------
A1WYY8_HALHL/891-1129-PT-----LHL.-------V-T...------------------------SGE...WRS..T.......------------
A2U2U5_9FLAO/567-793-FG-----GKI.-------G-F...------------------------NGN...VST..K.......------------
A3HUH0_9BACT/675-900-MG-----GRI.-------A-L...------------------------TGS...YDS..RD......------------
A3Q9Y2_SHELP/1046-1289-PG-----ITL.-------K-G...------------------------KGA...WSN..S.......------------
E0TB83_PARBH/837-1047-GE-----GTF.-------A-S...------------------------RLA...PAG..E.......------------
A4AMF6_MARSH/560-785-FN-----GNV.-------S-F...------------------------DGE...VST..K.......------------
A4CG41_ROBBH/574-799-LD-----GKL.-------A-L...------------------------NGT...VAT..G.......------------
A4VIB7_PSEU5/1014-1255-KG-----LRI.-------S-G...------------------------NGG...WGA..G.......------------
A5CF63_ORITB/620-836-DN-----GEF.-------Q-A...------------------------KGS...ILM..........------------
A5FJ68_FLAJ1/564-791-FG-----GTI.-------G-L...------------------------TGA...VST..K.......------------
A5FUN1_ACICJ/745-973-VG-----GRL.-------S-G...------------------------RAI...LTG..AA......------------
A6GWN8_FLAPJ/560-787-FD-----GQI.-------G-L...------------------------SGL...VST..K.......------------
A7HEC2_ANADF/581-801-FG-----GAV.-------S-A...------------------------AGTH.LAVA..R.......------------
A9CIC7_AGRFC/884-1105-MG-----GKL.-------A-G...------------------------RLA...MST..G.......------------
A9H3V6_GLUDA/474-684-AG-----PSP.-------A-SAIL------------------------TPE...SDG..R.......------------
B2FP42_STRMK/1008-1250-PD-----QEI.-------D-I...------------------------SGR...WLG..R.......------------
B4S7D6_PROA2/551-781-LG-----GTV.-------T-L...------------------------KGY...YST..K.......------------
B7VIB8_VIBTL/1027-1268-GG-----NKA.-------D-I...------------------------SGW...WEL..Q.......------------
C1D9M5_LARHH/1015-1258-GD-----GQI.-------N-L...------------------------RGV...QRT..Q.......------------
C3L4A9_AMOA5/534-754-AG-----GKA.-------R-L...------------------------AGS...IST..K.......------------
C4L8L8_TOLAT/989-1232-AN-----SHF.-------D-G...------------------------QAG...WSI..K.......------------
E8RSC3_ASTEC/1136-1358-DG-----RNLI-------A-G...------------------------EGS...ALT..R.......------------
D9SHW3_GALCS/1021-1263-PD-----GTL.-------T-G...------------------------DGL...WRS..E.......------------
D5CU11_SIDLE/1024-1263-PD-----GVL.-------S-M...------------------------SGK...WQA..........------------
C6WWM2_METML/1053-1294-PE-----GTI.-------S-A...------------------------EGQ...WNN.WV.......------------
C6XD69_METGS/1043-1284-PD-----STL.-------T-A...------------------------EGE...WHN..W.......------------
C6XK02_HIRBI/884-1092-SR-----GKGV-------E-A...------------------------TFE...RDG..G.......------------
C7PC84_CHIPD/564-796-LQ-----GNM.-------E-V...------------------------NGS...YST..KN......------------
E6WGF8_PANSA/1014-1257-GS-----SKL.-------S-I...------------------------NGE...WVN..K.......------------
D2UF54_XANAP/1023-1265-DQ-----QQI.-------D-I...------------------------SGD...WRG..K.......------------
D3SBX9_THISK/1040-1287-PD-----GDL.-------Q-VQ.G------------------------SGH...WHVLAD.......------------
Q0ABM3_ALKEH/1048-1290-PS-----FAL.-------Q-G...------------------------DMA...WHY..R.......------------
Q0AQ38_MARMM/879-1092-FD-----GPF.-------Q-A...------------------------SFG...ASE..T.......------------
Q11YL6_CYTH3/532-755-CN-----GFY.-------S-G...------------------------KTA...LRILNE.......------------
Q11YT8_CYTH3/698-925-LG-----GSF.-------L-F...------------------------SGD...YNT..QD......------------
Q145G0_BURXL/1154-1409-PA-----ATL.-------S-A...------------------------TAN...WRT..STDL....------------
Q15ZG8_PSEA6/1002-1243-DH-----GLF.-------Y-A...------------------------SGD...WLF..T.......------------
Q211X0_RHOPB/871-1087-GG-----GDA.-------V-G...------------------------DIA...VRR..S.......------------
Q28TM9_JANSC/371-572-YE-----GQL.-------A-G...------------------------QFV...ING..R.......------------
Q2KY05_BORA1/936-1183-DD-----ATL.-------N-A...------------------------TGE...WRL..A.......------------
Q2NWP0_SODGM/1012-1255-GN-----ARL.-------T-A...------------------------EGS...WLH..N.......------------
Q3IFH7_PSEHT/1008-1245-ND-----HIL.-------R-T...------------------------HGQ...WQN..G.......------------
Q47VG9_COLP3/1038-1280-NK-----TSL.-------N-L...------------------------DGS...WLH..N.......------------
Q5R0H7_IDILO/1003-1244-GS-----DEL.-------A-V...------------------------TGY...WRY..T.......------------
Q7MHE2_VIBVY/1031-1272-GS-----NRV.-------D-V...------------------------NGD...WTL..D.......------------
Q7UYB4_RHOBA/752-985-GG-----GQL.-------E-G...------------------------GLL...LSS..G.......------------
Q8EA16_SHEON/1025-1268-PE-----VSL.-------Q-G...------------------------NGI...WQQ..Q.......------------
Q9ZDH9_RICPR/624-849-LG-----GKF.-------Q-G...------------------------SGN...ILL..........------------
A8GK60_SERP5/1034-1277-GK-----GRM.-------T-A...------------------------SGL...WKQ..N.......------------
C5BC15_EDWI9/1004-1246-GN-----TRL.-------T-L...------------------------SGR...WQQ..Q.......------------
D3HJX5_LEGLN/1065-1312-PV-----YQF.-------D-I...------------------------QGE...WTE..K.......------------
E0SHA8_DICD3/1031-1273-GK-----AKL.-------T-L...------------------------DGS...WQE..S.......------------
F4AYZ2_DOKS4/566-791-FG-----GAA.-------G-L...------------------------SGS...VTT..R.......------------
G2J3B5_PSEUL/1018-1258-DS-----GLL.-------Q-G...------------------------AAR...ASD..G.......------------
M1FEQ6_9ALTE/970-1216-ES-----LAL.-------A-G...------------------------EFN...WLL..Q.......------------
N0B6U7_9RHIZ/961-1176-DG-----GA..-------P-L...------------------------AAE...VDK..S.......------------
Q0KCK4_CUPNH/1119-1370-PG-----ATL.-------T-G...------------------------SGS...WRV..PRQL...R------------
Q0VS66_ALCBS/1022-1263-RA-----SRI.-------L-G...------------------------TVD...WTE..D.......------------
Q2K6G4_RHIEC/885-1104-DG-----GKL.-------S-G...------------------------NLL...FIN..A.......------------
Q32B94_SHIDS/1009-1252-GF-----SRL.-------T-A...------------------------DGE...WIN..N.......------------
Q5ZUN8_LEGPH/1014-1261-PY-----YQA.-------N-F...------------------------EGE...WLQ..K.......------------
Q63R38_BURPS/1120-1377-PA-----AKL.-------T-A...------------------------TAN...WRT..SRRALAHG------------
Q6LMA6_PHOPR/1035-1276-GA-----TAL.-------N-L...------------------------DAH...WTL..D.......------------
Q8P7K3_XANCP/1032-1273-DD-----QNI.-------G-L...------------------------TGA...WRG..K.......------------
Q9KUU5_VIBCH/1028-1269-GT-----NQL.-------H-V...------------------------NGT...WTL..T.......------------
Q9PEA2_XYLFA/983-1225-PS-----QRL.-------S-M...------------------------FAT...WRG..K.......------------

PF05170

Q87TE2_VIBPA/1-570-VS-----LKKG-------I-PTQP------------------------NL.---..ESIQFHQIALKNIDYAGP.....
Q9KNJ9_VIBCH/1-570-AN-----LAHG-------L-...P------------------------NFT---LPESVHLNQLALHNIDWADQ.....
Q9HU38_PSEAE/1-636-LS-----LDLV-------R-DKQG------------------------KGN---WENIGKPAQPQAPAAPSETPPAADG
Q9KT66_VIBCH/1-595-AE-----FHLE-------T-LKDG------------------------RSN---LDALTQAQSKPASAPAT........
Q9JY87_NEIMB/8-615-AE-----LALT-------R-DGKG------------------------VWN---IQDLIDSQKRQASV...........
Q9ZDI1_RICPR/1-711-PT-----ISLE-------V-LDNG------------------------QKS---WQLYISNNNNTINN...........
Q9HUT4_PSEAE/1-577-PR-----AELL-------R-LADG------------------------RAN---WDFDLPASDSDEPS...........
YHJG_ECOLI/1-582-PD-----ARLI-------R-LSEK------------------------NNN---WTFNLANDDNKDAN...........
Q7MQ04_VIBVY/1-571-LS-----LQTG-------L-SRSP------------------------KTF---IPNTVQIHQLAISNLDYADN.....

PF04357

A2U1I0_9FLAO/1175-1633.FD-----LQL.-------R-A.KD..FRLLNAKKEDNPSLYGLAT.F.NAN...ADL----------------------
Q83EW1_COXBU/570-928.TT-----LTV.-------H-G.EN..LLIVNTHQYI.......IY.G.SGE...LKI----------------------
Q1D0C2_MYXXD/935-1291.LG-----LTI.-------Q-L.DE..VPYRLTEDLP.......AT.F.SGL...LQV----------------------
A5FB26_FLAJ1/992-1420.LD-----LTI.-------T-S.KR..LLALDTKDSEDA..AYFGTAFINGT...ASI----------------------
Q8YZJ8_NOSS1/1412-1829.NP-----LTV.-------A-IQNQ..LNFQVAGLYT.......GD.V.SGN...AVI----------------------
A4CK93_ROBBH/998-1431.LN-----LDV.-------D-T.QGERFLLLNTEYDEEE..LYYGTAFAEGT...GRI----------------------
A3U6I2_CROAH/1185-1647.FN-----LSF.-------K-A.KD..FKVLNSTKEDND..LYYGTAIFDLD...ATL----------------------
A0LGH5_SYNFM/889-1254.AK-----LSA.-------S-G.RD..LRVSKVYGIE.......GK.I.SGK...ADL----------------------
A3HZ37_9BACT/1160-1620.FD-----LTL.-------L-A.KN..FMVVNSTDKDNE..LVYGRGTIDAD...VSI----------------------
A5GSG8_SYNR3/973-1387.PG-----LNF.-------T-I.KA..FPIRRPDA.R.......LQ.V.DGS...LKL----------------------
A6L590_BACV8/1012-1461.YH-----FNI.-------R-G.NN..LLMYNTYEAGNM..PFYGKVYGTGN...VVL----------------------
A0M1P1_GRAFK/1180-1639.FD-----LDV.-------Q-A.DG..FRLLNSTEEDND..LFYGTAVVDVD...GTV----------------------
Q2S2D2_SALRD/1057-1516.FD-----LSA.-------S-L.DG..ITVIDVSQAEDL..PFYGRIRGSGP...LHL----------------------
Q21Y28_RHOFT/928-1291RME-----LDA.-------T-L.AA..LRVSARADRR.......LV.V.SGQ...LSA----------------------
Q6MKB2_BDEBA/958-1321.TT-----IRA.-------R-L.EG..VTFNVPDKVR.......SS.G.SAD...LLF----------------------
Q39RU7_GEOMG/1016-1376SYR-----GTV.-------T-G.DR..FQTVNIPEVQ.......ML.A.TPK...LTF----------------------
Q7VBL9_PROMA/867-1309.KE-----LNL.-------V-I.KS..IEFDQNNF.D.......FK.V.SSN...LNV----------------------
A5FIP0_FLAJ1/1183-1626.FD-----LVV.-------E-A.DD..FRAINSKAKDND..LFYGDLFLDTK...LNI----------------------
Q8KFW2_CHLTE/1034-1479.VN-----LSG.-------S-F.SN..LLLYNKKDMKDD..TSFGT.I.RGTTGNLRF----------------------
A6H009_FLAPJ/1018-1446.LD-----LNL.-------A-S.NR..LLALDTKDAEEV..LYYGTAFIDGD...ATI----------------------
B5E9K2_GEOBB/1121-1484GYT-----GTL.-------S-G.QG..FQTVYLPELR.......MT.T.SPQ...LTF----------------------
Q11I59_CHESB/1185-1538.AD-----LML.-------R-L.NE..ARYADGEMVT.......AT.V.SGG...LQL----------------------
Q11VR9_CYTH3/1167-1624.FN-----LTV.-------T-T.ND..FMILNTTAVNNK..LYYGRVFLDSK...ISI----------------------
A7HQ23_PARL1/1042-1395.VD-----IRT.-------Q-F.SD..MQVVRRQDLV.......LA.V.NGA...LAL----------------------
Q7MT86_PORGI/1036-1486.VD-----LKVS-------E-A.RN..ILAYNVPERDNP..NIHGRVYVSGAAYLRDV----------------------
Q3AQ57_CHLCH/1053-1500.LE-----LAA.-------S-C.NN..LLFYNKKDQQDD..TSFGS.I.VGSTRNFTL----------------------
A1BDC7_CHLPD/1048-1494.IT-----LGA.-------N-L.SK..LLLFHKKDTRDE..KPFGT.I.IGSTRNLLL----------------------
Q6MAC5_PARUW/935-1288.FD-----IKL.-------E-P.KQ..IAIMESDYAD.......IE.A.SGS...LQL----------------------
Q1QWE2_CHRSD/954-1312RAH-----LEI.-------D-G.QDDPLLVSLPQFGR.......LR.V.APD...LSV----------------------
Q2RSJ7_RHORT/1146-1500.GR-----IDL.-------D-I.TQ..AVVVRRDDAV.......AE.I.SAD...LAM----------------------
Q2S346_SALRD/1311-1689.YD-----LTL.-------N-A.SE..FLAINTAAYR.......RA.VIDGD...MTL----------------------
Q2INP6_ANADE/946-1304.LR-----VEG.-------A-L.DE..VPVALPSYLP.......AT.L.SGR...IEA----------------------
Q9RUC9_DEIRA/223-627.WD-----LNL.-------S-A.RNYNLPVSAIYARE.......SA.L.TGD...FRL----------------------
Q1LSN0_BAUCH/634-981.IY-----VTL.-------K-G.NK..IRIYMPSMRF.......DV...SPN...IIF----------------------
B3ELK5_CHLPB/1036-1483.ID-----LTA.-------S-F.EN..LLLFNKQDKKDE..TSFGT.I.TGTSDRIRY----------------------
Q8YUC2_NOSS1/1659-2048.NP-----LTV.-------N-L.EQ..LQLNLKGLYQ.......GG.A.NGN...IQV----------------------
Q1MQI4_LAWIP/1025-1382.LS-----ING.-------S-F.TN..LAPLQRKDLS.......LT.L.SGA...ATL----------------------
Q7VQN5_BLOFL/933-1286.IL-----LNI.-------Q-G.NQ..VDFYLSPTMY.......VK.I.FPK...LTC----------------------
Q31MA1_SYNE7/1177-1568.QP-----LTI.-------A-L.RD..ATIALPNLFT.......GK.T.EAD...LQI----------------------
B4E8E1_BURCJ/988-1340.LT-----ASI.-------V-A.DK..LELFAAPDRK.......LS.L.SGK...ATV----------------------
E3G0N9_STIAD/1177-1560.LT-----GKT.-------H-L.KD..FPIISDDQLL.......AV.V.SLD...STL----------------------
F4B3D6_DOKS4/1021-1426.LD-----LGI.-------S-A.TR..IAVLDTEEDLES..LYYGTAFLEGE...AFI----------------------
Q46LW1_PROMT/887-1319.EP-----LAL.-------S-I.EK..TRIKTAFT.D.......IR.A.SSS...LVV----------------------
TAMB_HAEIN/952-1298.TE-----LNA.-------Q-A.NN..FNVDIPSMAK.......LR.F.SPN...ITI----------------------
Q5NNB3_ZYMMO/1036-1389.SA-----LNI.-------T-L.DK..ATLARADEMK.......ST.V.SGN...LDI----------------------

PF05359

Q4K5X6_PSEF5/140-291-KD.....LRP--------S-E---------------------------.PIE..FLY----------------------
Q4K5X6_PSEF5/360-511-AD.....RKA--------K-P---------------------------.AVA..LEL----------------------
B2JQ93_PARP8/874-1021-TD.....NFI--------K-P---------------------------.NYS..ANL----------------------
A0RMT1_CAMFF/653-798-KD.....DSL--------A-L---------------------------.PFD..TNI----------------------
Q72DG8_DESVH/963-1109-RD.....ERF--------S-P---------------------------.AFD..TSL----------------------
A9BMN7_DELAS/883-1036-SD.....YFI--------Q-P---------------------------.NYS..ADL----------------------
Q2LUD1_SYNAS/534-687-ED.....QMP--------S-A---------------------------GTAE..IGI----------------------
A8ZWF7_DESOH/636-783-AD.....RSV--------D-P---------------------------.HYA..TRL----------------------
Q3A6W6_PELCD/375-529-QD.....QKV--------K-G---------------------------.GFK..AEA----------------------
Q5NYY7_AROAE/382-536-ED.....RAA--------S-A---------------------------.PFR..TEL----------------------
Q2KWF8_BORA1/759-906-TD.....RFV--------Q-P---------------------------.NYT..AEL----------------------
Q484B1_COLP3/382-534-ND.....SSV--------S-P---------------------------.IAI..HDV----------------------
A2SI01_METPP/870-1017-TD.....NFI--------R-P---------------------------.NYS..AKL----------------------
Q8Y0Z7_RALSO/615-766-ED.....QTN--------S-R---------------------------.PVK..VRV----------------------
Q5QWM2_IDILO/380-527-AD.....KSL--------P-L---------------------------.PFS..TSI----------------------
Q0VP61_ALCBS/592-737-ED.....LSL--------S-P---------------------------.HFR..IGL----------------------
A3QD21_SHELP/699-846-AD.....NSL--------T-P---------------------------.NFA..ASI----------------------
Q63NS2_BURPS/645-797-TD.....RST--------P-R---------------------------.PVK..LAI----------------------
Q47FN3_DECAR/732-879-SD.....FFV--------K-P---------------------------.NYT..VNL----------------------
A0KK00_AERHH/368-522-TE.....SSS--------G-K---------------------------PLL...REL----------------------
Q0JZH1_CUPNH/670-829-ADYQPAGANR--------G-R---------------------------.PVI..HQF----------------------
Q2LUD1_SYNAS/785-932-SD.....RFI--------K-P---------------------------.NYN..ANL----------------------
A1ARF1_PELPD/790-937-SD.....HHL--------R-Q---------------------------.QFT..STF----------------------
Q39RS7_GEOMG/568-719-TD.....RKA--------V-G---------------------------.NPR..FDL----------------------
B9M3X2_GEODF/795-942-LD.....QHT--------P-Q---------------------------.QFG..TTM----------------------
Q8Y0Z7_RALSO/185-339-VD.....Q..--------P-L---------------------------.GAQ..HTV----------------------
Q3JBN6_NITOC/584-731-AD.....LSV--------S-P---------------------------.KFS..MGI----------------------
Q5DZ89_VIBF1/399-549-EE.....KVI--------T-K---------------------------KANL..WQI----------------------
Q1QTZ9_CHRSD/145-295-IN.....RRP--------D-A---------------------------.PLT..LSL----------------------
A9BMN7_DELAS/165-317-QD.....E..--------V-Q---------------------------.RRQ..HML----------------------
A9BMN7_DELAS/379-538-RD.....AAP--------D-A---------------------------GKSGAALQA----------------------
Q87WR1_PSESM/386-537-TD.....RVP--------K-E---------------------------.PVA..LDV----------------------
B2JQ93_PARP8/616-770-TD.....NTT--------A-R---------------------------.PVK..VAV----------------------
A1K6C3_AZOSB/734-881-AD.....FSL--------V-L---------------------------.PFS..TRV----------------------
Q603H4_METCA/718-865-SD.....GSL--------V-L---------------------------.PFA..THI----------------------
Q47VC1_COLP3/500-655-TD.....FSV--------D-P---------------------------.IYQRTLFL----------------------
Q15PY6_PSEA6/662-809-ED.....NSL--------R-P---------------------------.RFA..SSI----------------------
Q88DW4_PSEPK/365-516-AD.....RSQ--------K-E---------------------------.PVA..LDI----------------------
A0KK00_AERHH/578-725-AD.....RSL--------S-P---------------------------.EFV..VDI----------------------
B5ECC6_GEOBB/569-721-TD.....KTY--------E-E---------------------------.PPR..FTL----------------------
Q2LUD1_SYNAS/159-313-DD.....R..--------P-K---------------------------.YRR..HEI----------------------
A4VPN2_PSEU5/551-698-AD.....FSL--------R-P---------------------------.PFV..TAI----------------------
Q0VP61_ALCBS/382-530-TD.....RTL--------N-P---------------------------AQT...MTL----------------------
A1K7K6_AZOSB/583-736-ED.....RMQ--------A-K---------------------------.PVT..LAV----------------------
Q3JBN6_NITOC/369-521-QD.....RTI--------E-P---------------------------.PAT..LNI----------------------
Q5NYY7_AROAE/832-979-SD.....RFI--------R-P---------------------------.NYD..ANL----------------------
Q13S79_BURXL/640-791-TD.....NTT--------P-Q---------------------------.PVK..LNI----------------------
Q47FN3_DECAR/504-656-ED.....QSM--------N-P---------------------------.VAV..QEI----------------------
Q316X0_DESAG/862-1008-RD.....VSV--------S-P---------------------------.PFE..LTL----------------------
Q602F3_METCA/416-565-AD.....HGV--------D-P---------------------------.PAR..IGL----------------------
Q2Y5K5_NITMU/673-818-QD.....QFI--------Q-P---------------------------.NYR..AYL----------------------
B3E4B8_GEOLS/816-963-SD.....VHL--------P-Q---------------------------.QFR..STF----------------------
A4VPN2_PSEU5/341-492-AD.....RVP--------D-D---------------------------.EVQ..LEL----------------------
Q5NYY7_AROAE/153-307-ED.....RPV--------G-L---------------------------...E..HEL----------------------
Q30NX8_SULDN/563-715-DD.....KSI--------Q-D---------------------------.NSK..TII----------------------
C1DFK3_AZOVD/367-518-AD.....RVP--------K-Q---------------------------.DVE..LLV----------------------
Q484B1_COLP3/604-751-SD.....SSL--------T-P---------------------------.KFS..AGI----------------------
Q5NYY7_AROAE/604-757-ED.....RTQ--------G-A---------------------------.PIV..LQA----------------------
Q602F3_METCA/623-770-SD.....LSL--------Q-P---------------------------.SVS..VDI----------------------
Q316X0_DESAG/389-538-HD.....NMV--------E-G---------------------------.GFN..HTF----------------------
A5G9K9_GEOUR/137-293-ID.....RGL--------P-V---------------------------.EKL..HAL----------------------
B2JHK1_PARP8/152-309-YD.....ETI--------S-K---------------------------PPYK..VVV----------------------
A5G9K9_GEOUR/551-702-TD.....GLL--------E-E---------------------------.RPS..FVL----------------------
A0KK00_AERHH/151-307-QD....SRKQ--------S-S---------------------------PGWVPSLTL----------------------
Q1H1L3_METFK/780-927-AD.....LSL--------T-P---------------------------.QFG..THI----------------------
B9M7L7_GEODF/383-534-TD.....EML--------A-G---------------------------.RPS..FTF----------------------
A4SXW3_POLSQ/414-561-TD.....LAM--------R-P---------------------------.NFK..VDI----------------------
B9M3X2_GEODF/564-715-RD.....EAR--------S-S---------------------------.APR..FDL----------------------
A4G9D7_HERAR/154-308-DD.....R..--------P-A---------------------------.QTV..HKI----------------------
Q21F55_SACD2/584-731-AD.....LSL--------P-L---------------------------.PFD..THI----------------------
Q7NY28_CHRVO/704-851-AD.....HGM--------T-P---------------------------.DFA..TRM----------------------
Q0JZH1_CUPNH/164-317-DD.....K..--------Q-L---------------------------.GSS..LRV----------------------
A1TWZ4_MARHV/597-744-TD.....RTL--------E-P---------------------------.PFS..TAF----------------------
B3E4B8_GEOLS/367-514-HD.....RQP--------A-G---------------------------.GFK..SRL----------------------
Q2IFA1_ANADE/563-710-VD.....RSV--------T-P---------------------------.AAV..VNL----------------------
Q1QTZ9_CHRSD/348-494-TD.....RHL--------P-R---------------------------.PFA..LDF----------------------
Q11NN1_CYTH3/142-298-ND.....FHA--------S-P---------------------------.KVD..IFV----------------------
Q9HV64_PSEAE/140-291-QD.....LRP--------S-E---------------------------.PVD..FSF----------------------
Q3SGZ4_THIDA/733-880-AD.....LSL--------T-P---------------------------.QFG..TVM----------------------
Q3A6W6_PELCD/162-316-RD.....DIR--------V-.---------------------------..TE..HTV----------------------
Q316X0_DESAG/600-751-LD.....ETL--------P-R---------------------------.AAR..LTV----------------------
A1TWZ4_MARHV/166-321-RD.....FSQ--------G-G---------------------------DPAE..FRV----------------------
B9M7L7_GEODF/592-739-TD.....RHV--------A-G---------------------------.GYT..TTF----------------------
Q222N5_RHOFT/496-646-AD.....EGA--------G-.---------------------------..VK..VQV----------------------
Q3A6W6_PELCD/805-951-RD.....ERY--------Q-P---------------------------.AVI..NRL----------------------
A5G9K9_GEOUR/769-916-TD.....RYV--------P-R---------------------------.EYS..TIL----------------------
A2SI01_METPP/623-775-SD.....RSV--------K-P---------------------------.VAV..FGV----------------------
Q083W9_SHEFN/492-642-GE.....GIA--------S-D---------------------------KIIL..WQI----------------------
Q083W9_SHEFN/725-872-AD.....NSL--------T-P---------------------------.NFA..SGI----------------------
Q12MK5_SHEDO/654-801-AD.....NSL--------N-P---------------------------.NFS..SGI----------------------
Q3SGZ4_THIDA/517-669-VD.....RSP--------P-T---------------------------.PVR..LDV----------------------
A1ARF1_PELPD/573-725-TD.....KSR--------E-E---------------------------.KPR..FTL----------------------
Q39RS7_GEOMG/801-948-SD.....HHM--------S-R---------------------------.EYD..TTF----------------------
Q603H4_METCA/502-653-AD.....RTF--------A-P---------------------------.AIA..YDL----------------------
Q222N5_RHOFT/149-300-HD.....RRA--------G-Y---------------------------...D..NTF----------------------
A8ZWF7_DESOH/412-569-VDFAVAGPED--------G-P---------------------------VEN....AI----------------------
A4XYD1_PSEMY/354-505-AD.....RVP--------Q-Q---------------------------.EVA..VDV----------------------
Q484B1_COLP3/152-304-SD.....QNR--------E-T---------------------------.AYH..HTI----------------------
Q21F55_SACD2/154-306-LD.....QVP--------A-T---------------------------.PFA..TQL----------------------
Q3SGZ4_THIDA/147-307-RD.....ANR--------A-G---------------------------EPFT..ALL----------------------
A7I315_CAMHC/662-807-ID.....HSL--------M-I---------------------------.PFD..IKI----------------------
Q74FC9_GEOSL/787-934-SD.....RHM--------P-K---------------------------.PYA..TTF----------------------
A7H8M2_ANADF/367-518-ED.....RTP--------A-R---------------------------.PVV..LPL----------------------
Q5DZ89_VIBF1/610-757-AD.....NSL--------T-P---------------------------.NFS..SGI----------------------
A4XYD1_PSEMY/562-709-AD.....FSL--------T-P---------------------------.SFA..TAI----------------------
B3E4B8_GEOLS/583-736-AD.....KQF--------S-E---------------------------.PPV..FTL----------------------
C1DFK3_AZOVD/141-292-QD.....QQP--------S-E---------------------------.PVE..VRY----------------------
Q1LGA7_CUPMC/681-840-ADYEPAEANR--------G-R---------------------------.PVI..HQF----------------------
B5ECC6_GEOBB/807-954-TD.....NHL--------P-Q---------------------------.TFN..STF----------------------
Q2IFA1_ANADE/358-509-ED.....RST--------A-R---------------------------.PVR..LPL----------------------
A4XYD1_PSEMY/140-291-QD.....LRP--------S-E---------------------------.PVE..FAY----------------------
A7H8M2_ANADF/165-318-RD.....ATR--------R-P---------------------------.AFD..TLL----------------------
A3QD21_SHELP/453-602-TE.....QLF--------K-E---------------------------.ENL..WQI----------------------
Q3A6W6_PELCD/588-738-GL.....EGP--------R-Q---------------------------.TST..AVF----------------------
A7H8M2_ANADF/579-726-VD.....RSV--------S-P---------------------------.PAL..VNV----------------------
A8ETY5_ARCB4/612-759-ED.....KNL--------P-I---------------------------.PFK..TTV----------------------
Q30NX8_SULDN/772-919-AD.....YSL--------P-L---------------------------.DFK..TAI----------------------
A4VPN2_PSEU5/125-276-RD.....RRP--------S-E---------------------------.PIE..LVY----------------------
Q1LGA7_CUPMC/173-326-ED.....K..--------L-L---------------------------.NTV..QRV----------------------
Q1H1L3_METFK/561-712-RD.....QSA--------N-S---------------------------.PVA..LDI----------------------
Q222N5_RHOFT/710-857-TD.....LSL--------R-P---------------------------.QFS..AKI----------------------
C1DFK3_AZOVD/584-731-AD.....FSL--------R-P---------------------------.NFA..TAI----------------------
B2U875_RALPJ/869-1016-TD.....NFV--------K-P---------------------------.NYT..ANL----------------------
B4EKU9_BURCJ/620-772-TD.....LST--------P-R---------------------------.PVK..LAI----------------------
D0J281_COMT2/165-316-ND.....EFV--------Q-R---------------------------...K..HEL----------------------
M1FB64_9ALTE/585-727-TD.....RTL--------K-P---------------------------.ELT..TRF----------------------
Q63NS2_BURPS/160-304-DD.....R..--------L-L---------------------------.NAR..HVV----------------------
Q7VVF7_BORPE/156-309-DD.....KVS--------G-.---------------------------..RQ..QRI----------------------
Q7VVF7_BORPE/538-685-RD.....ESV--------K-P---------------------------.AVP..VSV----------------------
Q87WR1_PSESM/155-306-QD.....VRP--------S-E---------------------------.PIE..FLY----------------------
Q88DW4_PSEPK/140-291-ED.....LRP--------S-E---------------------------.PIE..FLY----------------------
Q88DW4_PSEPK/581-725-AD.....LSL--------T-P---------------------------.NFA..TAI----------------------
Q8EDF6_SHEON/666-811-AD.....NSL--------T-P---------------------------.NFA..SGI----------------------
Q9HV64_PSEAE/476-627-VD.....RQP--------A-T---------------------------.EVP..LEV----------------------
Q9HV64_PSEAE/692-837-AD.....LTL--------M-P---------------------------.PFG..TAI----------------------

PF13116

C6XK02_HIRBI/457-744-AK-----RNIK.......D.G---------------------------RATKLNFFM----------------------
Q7NW94_CHRVO/514-796-LR-----QGLQ.......D.G---------------------------IARNVRMKL----------------------
Q7N037_PHOLL/501-786-LT-----ASII.......K.G---------------------------QIENATFVF----------------------
A4XQL3_PSEMY/513-798-LK-----TAIR.......S.G---------------------------RVEEGYFQY----------------------
Q3J7T7_NITOC/517-810-LK-----QAFP.......Q.G---------------------------GAAEGSLVF----------------------
D5CU11_SIDLE/524-805-LQ-----AALQ.......G.G---------------------------QADKFRVRL----------------------
A1AVR0_RUTMC/242-525-IK-----HAFQ.......S.G---------------------------ELDNINISI----------------------
Q31FH6_THICR/496-774-LK-----AALV.......K.G---------------------------DGIKGRLRV----------------------
Q2NWP0_SODGM/504-789-MT-----GALK.......G.G---------------------------QVDNATLVF----------------------
B8GV04_THISH/540-825-LR-----ESIK.......A.G---------------------------RVTEGTVVY----------------------
A0RPG5_CAMFF/10-294-IY-----GYII.......A.K---------------------------EYTLYSLHG----------------------
Q07WQ4_SHEFN/504-791-LN-----DGLV.......A.G---------------------------QINDAQVVW----------------------
Q5ZUN8_LEGPH/507-795-LN-----NDIK.......R.L---------------------------GQATGKITI----------------------
Q7VFV2_HELHP/222-511-LF-----KNVH.......Y.D---------------------------VLKLHSLRF----------------------
Q12IX1_SHEDO/530-817-LN-----GAII.......K.G---------------------------QIPDASVVW----------------------
Q15ZG8_PSEA6/490-776-LQ-----RALK.......A.G---------------------------YVNGAKILW----------------------
A6Q385_NITSB/202-483-SC-----KKIR.......A.K---------------------------KYRLQFFEG----------------------
A8GK60_SERP5/523-808-LS-----GAIQ.......G.G---------------------------QVDNATLLY----------------------
Q3IFH7_PSEHT/493-781-LN-----GAIK.......G.G---------------------------EVSKAQVLF----------------------
D9SHW3_GALCS/523-805-LN-----DALL.......S.G---------------------------KTEDFRLRL----------------------
Q21FT5_SACD2/542-827-LD-----KSIQ.......G.G---------------------------DIKNVGFLY----------------------
A7MJB2_CROS8/518-803-LS-----GAIQ.......G.G---------------------------QVENATLVY----------------------
C6XD69_METGS/519-799-LD-----SAIL.......K.G---------------------------RGQDINVTV----------------------
A7I2E8_CAMHC/213-497-IY-----GNII.......A.D---------------------------NYEIKKFVA----------------------
Q6LMA6_PHOPR/509-794-LS-----AAIR.......G.G---------------------------KADAAQLLW----------------------
D0L1I5_HALNC/561-853-LD-----TNLELPEQGGGQPG---------------------------RVDRGHFVF----------------------
A3Q9Y2_SHELP/509-796-LS-----GAIK.......A.G---------------------------QSQDAKVVW----------------------
A6QAC9_SULNB/206-494-IT-----RKIE.......A.K---------------------------SYRLYMLTG----------------------
A8EUE5_ARCB4/193-478-MY-----NNVT.........G---------------------------DFKLDWLYG----------------------
C5ZX33_9HELI/208-498-IF-----NNYQ.......I.T---------------------------SAQIKEFSL----------------------
Q1H0H5_METFK/520-800-LD-----NAIL.......A.G---------------------------KSEDVSIIV----------------------
Q7MRT1_WOLSU/187-475-LY-----DNIH.......S.P---------------------------GMELASFSF----------------------
Q47VG9_COLP3/504-793-LN-----AAVV.......S.G---------------------------RVEDAQVLI----------------------
A4G3G0_HERAR/587-887-LS-----DALI.......A.G---------------------------TLNDGYIRL----------------------
D1B1Z5_SULD5/203-493-IH-----TNIV.......G.K---------------------------NYVLHFLEG----------------------
D3V5J7_XENBS/502-797-LT-----HSLI.......K.G---------------------------KIENATLLF----------------------
E6WGF8_PANSA/504-789-LS-----DAIK.......G.G---------------------------KVDNATLLF----------------------
D3VKA4_XENNA/501-791-LT-----TSLI.......K.G---------------------------KVDNATLIF----------------------
Q0ABM3_ALKEH/531-818-VA-----AAVI.......G.G---------------------------EVTEARVHW----------------------
A0KFB2_AERHH/486-771-LS-----GAIK.......G.G---------------------------KAKGADLLW----------------------
A6TER2_KLEP7/497-781-LS-----GAIK.......A.G---------------------------QASDATLVY----------------------
B4EX35_PROMH/501-782-LS-----DAII.......A.G---------------------------NVKNGTFIF----------------------
B7VIB8_VIBTL/505-791-LS-----TAIQ.......A.G---------------------------KADTVKLLW----------------------
D3HJX5_LEGLN/559-845-LK-----NDLK.......R.I---------------------------AEASGRIRL----------------------
F0LWR2_VIBFN/505-791-LS-----TAIQ.......G.G---------------------------KVTTAKLVW----------------------
Q5E7X4_VIBF1/495-780-LS-----AAVQ.......G.G---------------------------NAKTVQLLW----------------------
Q6DAI1_PECAS/504-784-LS-----GALK.......G.G---------------------------RVDNATLIF----------------------
Q74PM2_YERPE/511-794-LT-----EALQ.......G.G---------------------------QVDNATLVY----------------------
Q7MHE2_VIBVY/508-794-LS-----TAIQ.......G.G---------------------------KVNTAKLLW----------------------
Q83BN5_COXBU/480-760-LN-----QAFS.......T.G---------------------------EITSGTVNF----------------------
Q8ZLP4_SALTY/504-786-LS-----GAIQ.......G.G---------------------------EADNATLVY----------------------
Q9KUU5_VIBCH/504-791-LS-----TAIQ.......A.G---------------------------QVNTAKLIW----------------------

PF13109

A0RPG5_CAMFF/433-647--------------------------------------------------------------------------------
A6Q385_NITSB/623-836--------------------------------------------------------------------------------
A6QAC9_SULNB/640-854--------------------------------------------------------------------------------
B9L5J2_NAUPA/583-798--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1U479_MARHV/979-1225--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
A3Q9Y2_SHELP/1046-1289--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FJ68_FLAJ1/564-791--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRFC/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B2FP42_STRMK/1008-1250--------------------------------------------------------------------------------
B4S7D6_PROA2/551-781--------------------------------------------------------------------------------
B7VIB8_VIBTL/1027-1268--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
E6WGF8_PANSA/1014-1257--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
D3SBX9_THISK/1040-1287--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
Q11YL6_CYTH3/532-755--------------------------------------------------------------------------------
Q11YT8_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_BURXL/1154-1409--------------------------------------------------------------------------------
Q15ZG8_PSEA6/1002-1243--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q2NWP0_SODGM/1012-1255--------------------------------------------------------------------------------
Q3IFH7_PSEHT/1008-1245--------------------------------------------------------------------------------
Q47VG9_COLP3/1038-1280--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7MHE2_VIBVY/1031-1272--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
A8GK60_SERP5/1034-1277--------------------------------------------------------------------------------
C5BC15_EDWI9/1004-1246--------------------------------------------------------------------------------
D3HJX5_LEGLN/1065-1312--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_DOKS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
N0B6U7_9RHIZ/961-1176--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q2K6G4_RHIEC/885-1104--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570RFSVTGLSIQIQDPTWLNAQQLWPYGAIQASAEQMYWHGEAIQKVLVDVDYQAQNSTLYGTS..................
Q9KNJ9_VIBCH/1-570GIIARGVSLQIKQPVWDSPQQQLPYGKIQLAADQITIDGEAFNQVLVDANYQAQDSTVYGFS..................
Q9HU38_PSEAE/1-636KGAQAQAPEQAPQNDSPRTPIKLDIDSLNVNNARVTYTDEASGKQYNVEGIELSTGAIREGSSIPLKLN...........
Q9KT66_VIBCH/1-595...TDSAPASQPSSSEPAAAWSIELGGVSVSNAVLEITDKKAGSHTKLYDVQLSVAEFVP....................
Q9JY87_NEIMB/8-615.........................NRIIVENSTVRLNFLQEQLILKEINLNLQSPDSSGQP..................
Q9ZDI1_RICPR/1-711......NNTVQSNYTQTVLELPILISHLKIKGGKVIYIEKNNEKIFNDINLETKMKSIKGPIDFTIALNALQQQIHIDGH
Q9HUT4_PSEAE/1-577...................AWQLDIREIGFDKGSVSLDDQRLKT.....RLEVLVDPLGKP...................
YHJG_ECOLI/1-582...............AKPSAWSFRLDNILFDQGRIAIDDKVSKA.....DLEIFVDPLGKP...................
Q7MQ04_VIBVY/1-571QLSARGIKFQVKQPQWQRSDQFIPFGEIQFSAQQLYWQGEAFNQPLLDIDYKPQDSALYGLS..................

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q1D0C2_MYXXD/935-1291--------------------------------------------------------------------------------
A5FB26_FLAJ1/992-1420--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
A0M1P1_GRAFK/1180-1639--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_RHOFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
A5FIP0_FLAJ1/1183-1626--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
Q11VR9_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q6MAC5_PARUW/935-1288--------------------------------------------------------------------------------
Q1QWE2_CHRSD/954-1312--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
B4E8E1_BURCJ/988-1340--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_DOKS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------------------------
Q4K5X6_PSEF5/360-511--------------------------------------------------------------------------------
B2JQ93_PARP8/874-1021--------------------------------------------------------------------------------
A0RMT1_CAMFF/653-798--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
Q484B1_COLP3/382-534--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
A3QD21_SHELP/699-846--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
Q47FN3_DECAR/732-879--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_VIBF1/399-549--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_PARP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q47VC1_COLP3/500-655--------------------------------------------------------------------------------
Q15PY6_PSEA6/662-809--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_BURXL/640-791--------------------------------------------------------------------------------
Q47FN3_DECAR/504-656--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
C1DFK3_AZOVD/367-518--------------------------------------------------------------------------------
Q484B1_COLP3/604-751--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_PARP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLSQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
A1TWZ4_MARHV/597-744--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------------------------
Q11NN1_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
A1TWZ4_MARHV/166-321--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_RHOFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_RHOFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q484B1_COLP3/152-304--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
Q5DZ89_VIBF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
C1DFK3_AZOVD/141-292--------------------------------------------------------------------------------
Q1LGA7_CUPMC/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
A3QD21_SHELP/453-602--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_CUPMC/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_RHOFT/710-857--------------------------------------------------------------------------------
C1DFK3_AZOVD/584-731--------------------------------------------------------------------------------
B2U875_RALPJ/869-1016--------------------------------------------------------------------------------
B4EKU9_BURCJ/620-772--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_THICR/496-774--------------------------------------------------------------------------------
Q2NWP0_SODGM/504-789--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
A0RPG5_CAMFF/10-294--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
Q15ZG8_PSEA6/490-776--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
A8GK60_SERP5/523-808--------------------------------------------------------------------------------
Q3IFH7_PSEHT/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
A7MJB2_CROS8/518-803--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A3Q9Y2_SHELP/509-796--------------------------------------------------------------------------------
A6QAC9_SULNB/206-494--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
Q47VG9_COLP3/504-793--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3V5J7_XENBS/502-797--------------------------------------------------------------------------------
E6WGF8_PANSA/504-789--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B4EX35_PROMH/501-782--------------------------------------------------------------------------------
B7VIB8_VIBTL/505-791--------------------------------------------------------------------------------
D3HJX5_LEGLN/559-845--------------------------------------------------------------------------------
F0LWR2_VIBFN/505-791--------------------------------------------------------------------------------
Q5E7X4_VIBF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
Q74PM2_YERPE/511-794--------------------------------------------------------------------------------
Q7MHE2_VIBVY/508-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A0RPG5_CAMFF/433-647------------------AS----------FV---------NDFLGL.-DGFK---------------------------
A6Q385_NITSB/623-836------------------DE----------VL---------HKLFKM.-NFLS---------------------------
A6QAC9_SULNB/640-854------------------DR----------ML---------HPLINF.-DGLQ---------------------------
B9L5J2_NAUPA/583-798------------------NE----------EF---------KAFLPKF-DFFS---------------------------
C5ZX33_9HELI/638-852------------------DT----------FV---------NALANK.-NIVT---------------------------
D3UGW6_HELM1/730-943------------------AD----------FI---------NMVAKK.-ELLH---------------------------
Q30RQ8_SULDN/697-907------------------DE----------FM---------EKIFSL.-SKFK---------------------------
Q7MRT1_WOLSU/616-829------------------DE----------FV---------NTFFNK.-EIAS---------------------------
Q7VFV2_HELHP/731-944------------------DK----------FL---------NRVWQR.-DIFR---------------------------
O25308_HELPY/745-958------------------GD----------YI---------NTILQK.-DFVE---------------------------
Q0PAY6_CAMJE/635-848------------------DN----------YL---------NEFLQK.-QAVQ---------------------------

PF13502

A0KFB2_AERHH/999-1241---------------...AD----------GM.Q.......TRARAHI-SSNN---------------------------
A1S2S6_SHEAM/1130-1371---------------....V----------.N.Q.......TRMEFSL-KADK---------------------------
A1STZ9_PSYIN/1024-1262---------------.....----------.Y.K.......TNLIVKS-VGNE---------------------------
A1TW53_ACIAC/1117-1369---------------...GG----------.A.TAP..RRRTSMDFRL-DIRD---------------------------
A1U479_MARHV/979-1225---------------...DD----------RE.T.......TRFTGKL-EGGA---------------------------
A1WCZ7_ACISJ/1139-1390---------------.GAQA----------QR.R.......TVMDFEL-DIRD---------------------------
A1WSB5_VEREI/1101-1362---------------.PGA.----------...GPRPAERRTALSFEL-DIRD---------------------------
A1WYY8_HALHL/891-1129---------------.....----------...G.......TALRGRL-RSGD---------------------------
A2U2U5_9FLAO/567-793---------------...NN----------AS.T.......FKVDLDL-KELN---------------------------
A3HUH0_9BACT/675-900---------------..LST----------.P.K.......FNFDLNV-SDLS---------------------------
A3Q9Y2_SHELP/1046-1289---------------...EG----------QN.L.......TEFQVDL-KAKQ---------------------------
E0TB83_PARBH/837-1047---------------.....----------...G.......QDAKLMV-ETSD---------------------------
A4AMF6_MARSH/560-785---------------...NQ----------LP.N.......FRMKLNM-DQLG---------------------------
A4CG41_ROBBH/574-799---------------...EG----------LP.R.......FNMDLGI-DGFR---------------------------
A4VIB7_PSEU5/1014-1255---------------...QS----------...........W.YKGRL-EGGN---------------------------
A5CF63_ORITB/620-836---------------...SP----------.L.A.......MTLVYAY-NSFY---------------------------
A5FJ68_FLAJ1/564-791---------------...SK----------VP.T.......FDMNLGF-NQVD---------------------------
A5FUN1_ACICJ/745-973---------------..GST----------PA.T.......LSLQASL-TGAR---------------------------
A6GWN8_FLAPJ/560-787---------------...GK----------VP.T.......FSMNLDL-NKVD---------------------------
A7HEC2_ANADF/581-801---------------...PD----------.A.P.......FEVALDL-KGVA---------------------------
A9CIC7_AGRFC/884-1105---------------...EG----------.AGI.......FRSKIAV-TDAN---------------------------
A9H3V6_GLUDA/474-684---------------...HL----------WASV.......QDLGLML-RGLD---------------------------
B2FP42_STRMK/1008-1250---------------...TG----------GA.R.......TELTAQV-RSED---------------------------
B4S7D6_PROA2/551-781---------------...GG----------KA.D.......TEFSAEA-AEVN---------------------------
B7VIB8_VIBTL/1027-1268---------------...GD----------KS.H.......SSLTLDV-EGEN---------------------------
C1D9M5_LARHH/1015-1258---------------...DG----------QM.R.......SQLNVQL-DSAS---------------------------
C3L4A9_AMOA5/534-754---------------...AD----------SL.E.......IYTYANL-QNVQ---------------------------
C4L8L8_TOLAT/989-1232---------------...NY----------QP.L.......STLKGKF-VSNN---------------------------
E8RSC3_ASTEC/1136-1358---------------...LG----------.S.L.......VTLDFKP-QN.D---------------------------
D9SHW3_GALCS/1021-1263---------------...QT----------SM.Q.......TQVNLLL-TISN---------------------------
D5CU11_SIDLE/1024-1263---------------...KP----------.E.Q.......TQVKLRV-DISD---------------------------
C6WWM2_METML/1053-1294---------------...RN----------.A.N.......TSLNVRW-DIKD---------------------------
C6XD69_METGS/1043-1284---------------...KR----------NP.N.......TRITLNW-DIKD---------------------------
C6XK02_HIRBI/884-1092---------------.....----------............DIAFQL-RSDD---------------------------
C7PC84_CHIPD/564-796---------------..SKT----------NP.D.......INMAYSV-QNVD---------------------------
E6WGF8_PANSA/1014-1257---------------...PG----------EQ.R.......TSLKGTL-SGNN---------------------------
D2UF54_XANAP/1023-1265---------------...GA----------AA.H.......TQLSARV-ESQD---------------------------
D3SBX9_THISK/1040-1287---------------...GR----------.P.D.......TRLDIRL-SGDD---------------------------
Q0ABM3_ALKEH/1048-1290---------------...DG----------GH.R.......TELKSRL-QGER---------------------------
Q0AQ38_MARMM/879-1092---------------...GG----------.Q.........RD..FRI-EAQS---------------------------
Q11YL6_CYTH3/532-755---------------...KT----------.V.E.......INADARI-RAMN---------------------------
Q11YT8_CYTH3/698-925---------------..ITK----------.P.S.......FAMDMLM-KDVA---------------------------
Q145G0_BURXL/1154-1409---------------GSSA.----------...DEAT.ARRTVFDFKL-DIKD---------------------------
Q15ZG8_PSEA6/1002-1243---------------...PR----------GN.Q.......TKIEGEF-SSSD---------------------------
Q211X0_RHOPB/871-1087---------------...AD----------GV.A.......LDARLKW-SGVD---------------------------
Q28TM9_JANSC/371-572---------------...GG----------.L.S.......VGGDLIL-ANVA---------------------------
Q2KY05_BORA1/936-1183---------------...GE----------QR.G.......LTVQAKA-EFKD---------------------------
Q2NWP0_SODGM/1012-1255---------------...RR----------EN.R.......TSLKGTL-AGKD---------------------------
Q3IFH7_PSEHT/1008-1245---------------.....----------...Q.......TQLSGEL-KSED---------------------------
Q47VG9_COLP3/1038-1280---------------...EQ----------AS.I.......TTLVGNL-SVDD---------------------------
Q5R0H7_IDILO/1003-1244---------------...DE----------QA.L.......SALSGRL-EAGD---------------------------
Q7MHE2_VIBVY/1031-1272---------------...GE----------TS.Q.......SRMNLKV-KSDN---------------------------
Q7UYB4_RHOBA/752-985---------------..RSG----------GV.D.......MTSHWKT-RRMD---------------------------
Q8EA16_SHEON/1025-1268---------------...NG----------QN.Q.......TELSVSL-NASQ---------------------------
Q9ZDH9_RICPR/624-849---------------...EP----------.Y.S.......INFVYAV-NTID---------------------------
A8GK60_SERP5/1034-1277---------------...AQ----------EE.R.......SSLKGKL-LGGK---------------------------
C5BC15_EDWI9/1004-1246---------------...DG----------IS.R.......TQISGVL-QGAN---------------------------
D3HJX5_LEGLN/1065-1312---------------...NK----------VN.Q.......TKLDVKL-NMTQ---------------------------
E0SHA8_DICD3/1031-1273---------------...GE----------GT.R.......TAIKGQL-SGGS---------------------------
F4AYZ2_DOKS4/566-791---------------...DG----------AP.T.......FNMTVDL-SSID---------------------------
G2J3B5_PSEUL/1018-1258---------------...VT----------.P.R.......VDVDFKL-ESAN---------------------------
M1FEQ6_9ALTE/970-1216---------------...GQ----------NQ.V.......SRFKGSV-TGGQ---------------------------
N0B6U7_9RHIZ/961-1176---------------...SG----------............TRRLLV-DSPD---------------------------
Q0KCK4_CUPNH/1119-1370---------------ADANA----------ER.R.......TLLSFSI-DVRD---------------------------
Q0VS66_ALCBS/1022-1263---------------...DG----------AQ.Y.......TRFNGSL-TSDN---------------------------
Q2K6G4_RHIEC/885-1104---------------...DG----------TG.F.......LQTKLAL-ADSD---------------------------
Q32B94_SHIDS/1009-1252---------------...PG----------NE.R.......TSLKGKL-RGQK---------------------------
Q5ZUN8_LEGPH/1014-1261---------------...GK----------FN.Q.......TKLQSKM-YLKD---------------------------
Q63R38_BURPS/1120-1377---------------ADEED----------APRR.......TVFDFTL-AIDD---------------------------
Q6LMA6_PHOPR/1035-1276---------------...GD----------QN.E.......TQLAFDV-EGEN---------------------------
Q8P7K3_XANCP/1032-1273---------------...GE----------AA.S.......TRLSARV-DSRN---------------------------
Q9KUU5_VIBCH/1028-1269---------------...DT----------QS.R.......TQMNLDM-KGDN---------------------------
Q9PEA2_XYLFA/983-1225---------------...GE----------AA.S.......IRLSARV-DSRD---------------------------

PF05170

Q87TE2_VIBPA/1-570...............FKWRN----------SQISGQGEQYPQGW.SLV-NVTI.DKLAITNAQRQSLLS...........
Q9KNJ9_VIBCH/1-570...............FNWRN----------SPISGQAEQYPQGW.SLI-NVTL.SRLNLNLDEWRHH.............
Q9HU38_PSEAE/1-636.......AYLGTNQPVVRVK----------TELTGNLRFDTALRRYQL-EDAR.LSGEASGEPLQGKTATFSAQ......
Q9KT66_VIBCH/1-595...............DNWTK----------ATFAAKGDKDQQKFAAQG-EAEVRLSADFKQYALRNI.............
Q9JY87_NEIMB/8-615...............FESSG----------ILVWGKLSVPWKSRGLFL-SNGI.GPPEISPFHFEASTSLDGH.......
Q9ZDI1_RICPR/1-711VKEIGKIIPLSTNINLAGAK----------IKIDGKFDSKNNSFIGNA-NIKG.NTKTLGMPYDLNNDYTLTMSISACSK
Q9HUT4_PSEAE/1-577...............VPFGQ----------LAGKALATGDAANAQDYV-FGWK.VKGTYKGQALAGSGKVGGM.......
YHJG_ECOLI/1-582...............LPFSE----------VTGS.KGKADKEKVGDYV-FGLK.AQGRYNGEPLTGTGKIGGM.......
Q7MQ04_VIBVY/1-571...............LSWRG----------AKVSGQAEQYPQGW.SLV-NVTV.EGLDLSQQQLTSILA...........

PF04357

A2U1I0_9FLAO/1175-1633------------------TG..DL.....QIPKLSANV.TLGSDTNVT-YVLP.TAYASVE.NRD........DVVVFVN
Q83EW1_COXBU/570-928------------------DI..VD....R.NIDITGTL.TVPRAILKP-TTFS.RAAALTG.............DVVFIG
Q1D0C2_MYXXD/935-1291------------------IG..PP....K.GFTVTGGM.DIVKMRYQK-ALDV.DALLKTM.QKR.......TT......
A5FB26_FLAJ1/992-1420------------------KG..PT....E.SLFIKVDA.KSEKGTEVK-IPIN.NVQSVGE.SS..........WIHFVT
Q8YZJ8_NOSS1/1412-1829------------------RG..TA....L.RPRIGGEI.TLSNGQVTI-GNTT.ANSKQTT..TTETNTRATTIELNSNI
A4CK93_ROBBH/998-1431------------------FG..PT....N.ALNINFEG.STARGTSLK-IPIS.DVASLGD.YS..........FINFIE
A3U6I2_CROAH/1185-1647------------------NG..DL....E.LPKLNATL.NVGSETNVT-YVLP.PSQVAVESRD.........GVVIFVN
A0LGH5_SYNFM/889-1254------------------SR..TP.....QGIELSGNL.LLSDAEMNL-GRLE.SDLARSI.............TVVEGD
A3HZ37_9BACT/1160-1620------------------KG..DL....N.LPIVRAKL.NVRESTDLS-LLIP.ESQLDIVERD.........GVVLFVN
A5GSG8_SYNR3/973-1387------------------QG..SL....R.QPALGGEV.KLSQGSITV-SPSE.LSSA......GG.....PSVPVDQAV
A6L590_BACV8/1012-1461------------------DGGNN.......AMTVDASL.TTGNNTSFT-YITG.VTTEAASNQ...........FITFVD
A0M1P1_GRAFK/1180-1639------------------TG..DL....T.LPVVNMDI.DIKESTDFT-YVVP.ETELQMQERD.........GIVIFVN
Q2S2D2_SALRD/1057-1516------------------NG..PL....P.DATLESNAARTTPDSELY-IPVS.GRTVEED.AG..........FIVFAD
Q21Y28_RHOFT/928-1291------------------RL..NE....S.KLALRGTL.KADSALFIL-PEDT.APQL.GG.............DVLVRR
Q6MKB2_BDEBA/958-1321------------------SGRWFP.......FTLSGTY.HVTSAMVEK-EFTE.DGGGVTG.VR..........QSLYLP
Q39RU7_GEOMG/1016-1376------------------EG..TP....A.KVAVRGEI.TVPELLVTA-AGTG.GPVKSSP.............DVVLEG
Q7VBL9_PROMA/867-1309------------------KG..SI....L.QPLLGGDI.TIEQGSIST-KRSR.VDKKNST..STQKISTNSTQRYFNQL
A5FIP0_FLAJ1/1183-1626------------------KG..NL....D.SPVVDGTL.KINKETKFT-VVLP.QSDPSIADRE.........GIVEFVN
Q8KFW2_CHLTE/1034-1479------------------YG..EL....S.APVAEGDL.VLNSVNFSL-YRKG.SNESAKY.IGV.......EKFIKFVP
A6H009_FLAPJ/1018-1446------------------KG..PT....N.GLVITVNA.KSEKGTSVK-IPIT.DSEVSSE.ND..........YIKFKS
B5E9K2_GEOBB/1121-1484------------------KG..EG....D.RVTLQGEI.GVPEMLILG-SPAH.QAETASS.............DVILEG
Q11I59_CHESB/1185-1538------------------TG..PI....TRDPLLSGNI.EVSRAEILV-PDGF.G.GSAA...S.........ID..VQH
Q11VR9_CYTH3/1167-1624------------------RG..DQ....N.LPVINATI.DIEKGSHFT-FAIP.DSKISVDRGD.........GIVIFTT
A7HQ23_PARL1/1042-1395------------------TA.PALPPSLDQPMLLEGEL.TTTTARFHV-PEQL.PGGVAH.............IDVILVR
Q7MT86_PORGI/1036-1486------------------PG..........GMRCDVNL.ISEKGTHIV-LNFT.QPTTAEEYR...........FLRFVD
Q3AQ57_CHLCH/1053-1500------------------TG..SL....R.SPIVEGEV.QIDRADYSL-YSAG.ANESAQY.VGI.......DNTISFVA
A1BDC7_CHLPD/1048-1494------------------NG..DI....S.SPVVEGDI.TINSADFTM-YRPG.ANESAKY.IGV.......EKFIEFVP
Q6MAC5_PARUW/935-1288------------------VG..NL.....KKSKLRGDL.TVDNAVIHM-EEAL.P.KQIK...S.........VAVIFIN
Q1QWE2_CHRSD/954-1312------------------DA..RP....T.RLRVRGDV.DIPWGRLEV-GQIPPSAVAPSS.............DEVIIT
Q2RSJ7_RHORT/1146-1500------------------VL..AA.....DQMTVSGTV.TTGPVEIRL-VGGG.GPSIAE.............LDVVEIG
Q2S346_SALRD/1311-1689------------------RG..TV....R.RPVLSGGL.QVQSASVYY-AEAL.AEGAAAM.GAVEL....TAQDQLTLE
Q2INP6_ANADE/946-1304------------------RG..TP....E.ATDVTGRL.HVVRARYTA-DVDL.EGSLLEL.RR................
Q9RUC9_DEIRA/223-627------------------RD..SG....D.FVRVSGEG.DFARLVLGR-VDAP.TTLPAAP.GSTGN....GAKDTFVSP
Q1LSN0_BAUCH/634-981------------------EAKPNL.......LTLNGQV.NIPWMRIKV-KEWQ.QTTADIS.LD..........DAILLD
B3ELK5_CHLPB/1036-1483------------------YG..DT....A.QPVLTGNL.LITNADFTL-YRTG.SNESTKY.VGA.......ERFITFVP
Q8YUC2_NOSS1/1659-2048------------------TG..SA....L.NPRIGGKV.DLYSGQILL-AESS.DPNQPAN..NVS......AI......
Q1MQI4_LAWIP/1025-1382------------------EG..TL.....KQSEVKGDI.VINQGEFQL-TEGL.TSNIPTL.NV.........VDSTQQQ
Q7VQN5_BLOFL/933-1286------------------TI..TV....N.TIDIQGDI.NVPYGYIKI-KDFQ.RNIMGVS.S...........EEIVLN
Q31MA1_SYNE7/1177-1568------------------LG..SA....L.EPAIAGDI.RVNQANIQL-PGPD.RLT.......................
B4E8E1_BURCJ/988-1340------------------ANDGPR....G.ALSIDGKF.VVDRALFDL-PEQS.APHL.SD.............DVVIVQ
E3G0N9_STIAD/1177-1560------------------AG..TL....SAQSVNIRDL.HIPEAHIEL-PEVK.RKDLQAL.ERP........GDIVLVR
F4B3D6_DOKS4/1021-1426------------------KG..PT....D.NLVIDVFG.ETARGTTFK-IPID.DSEALGD.NS..........YIKFLS
Q46LW1_PROMT/887-1319------------------KG..SI....L.KPQLSGEV.FISEGSIFA-KRAK.NPSKTSS.EKSDRY.QDSKVRIIRRL
TAMB_HAEIN/952-1298------------------KA..NP....K.ELNLSGTV.DIPWARIKI-DSLPDTAEPVSE.............DEVILN
Q5NNB3_ZYMMO/1036-1389------------------TS..NR....KDGGSIKGKL.KLPETRYRF-IMDN.K.ETVHD.LS..........GVKRK.

PF05359

Q4K5X6_PSEF5/140-291-----------------------------------------NKLDFEL.KNLS---------------------------
Q4K5X6_PSEF5/360-511-----------------------------------------GPLNLDL.QNFD---------------------------
B2JQ93_PARP8/874-1021-----------------------------------------IAIQGTV.GAFG---------------------------
A0RMT1_CAMFF/653-798-----------------------------------------TKISTTI.NELS---------------------------
Q72DG8_DESVH/963-1109-----------------------------------------DKVDAAV.TGFT---------------------------
A9BMN7_DELAS/883-1036-----------------------------------------SELAGRL.SAFS---------------------------
Q2LUD1_SYNAS/534-687-----------------------------------------EKIQGRI.DNIS---------------------------
A8ZWF7_DESOH/636-783-----------------------------------------TLTDLKV.TGLT---------------------------
Q3A6W6_PELCD/375-529-----------------------------------------EHIAVTL.TDL.---------------------------
Q5NYY7_AROAE/382-536-----------------------------------------KDLVLEA.KNVG---------------------------
Q2KWF8_BORA1/759-906-----------------------------------------SAIEGSI.SAVS---------------------------
Q484B1_COLP3/382-534-----------------------------------------TIKSLTI.EHLK---------------------------
A2SI01_METPP/870-1017-----------------------------------------TDIGGEV.SALA---------------------------
Q8Y0Z7_RALSO/615-766-----------------------------------------EPLNVLV.QNAS---------------------------
Q5QWM2_IDILO/380-527-----------------------------------------HTLSGEV.STLS---------------------------
Q0VP61_ALCBS/592-737-----------------------------------------YQLAGTV.SNLD---------------------------
A3QD21_SHELP/699-846-----------------------------------------EQLEGNI.ANLS---------------------------
Q63NS2_BURPS/645-797-----------------------------------------APLALNV.RQIS---------------------------
Q47FN3_DECAR/732-879-----------------------------------------TKLGGRV.SGLS---------------------------
A0KK00_AERHH/368-522-----------------------------------------SALALAL.GPL.---------------------------
Q0JZH1_CUPNH/670-829-----------------------------------------RNIALST.GSVA---------------------------
Q2LUD1_SYNAS/785-932-----------------------------------------VQIGGRI.SGLS---------------------------
A1ARF1_PELPD/790-937-----------------------------------------HNLGGRV.SGMS---------------------------
Q39RS7_GEOMG/568-719-----------------------------------------RRIGFNA.SNIT---------------------------
B9M3X2_GEODF/795-942-----------------------------------------YNLGGRI.SGLS---------------------------
Q8Y0Z7_RALSO/185-339-----------------------------------------DGLQIGV.PFLA---------------------------
Q3JBN6_NITOC/584-731-----------------------------------------HSLQSEI.QNLS---------------------------
Q5DZ89_VIBF1/399-549-----------------------------------------SPINLTT.SQIV---------------------------
Q1QTZ9_CHRSD/145-295-----------------------------------------KNLDLEA.RHYD---------------------------
A9BMN7_DELAS/165-317-----------------------------------------EQLQLRL.PFIS---------------------------
A9BMN7_DELAS/379-538-----------------------------------------RELSLQV.RDI.---------------------------
Q87WR1_PSESM/386-537-----------------------------------------GPLNLDM.QNFD---------------------------
B2JQ93_PARP8/616-770-----------------------------------------TPLNLKV.QKIS---------------------------
A1K6C3_AZOSB/734-881-----------------------------------------EQLAGQM.LGID---------------------------
Q603H4_METCA/718-865-----------------------------------------HDFFGTA.AGLS---------------------------
Q47VC1_COLP3/500-655-----------------------------------------DTLDVGALSNR.---------------------------
Q15PY6_PSEA6/662-809-----------------------------------------EALNGSI.AGLS---------------------------
Q88DW4_PSEPK/365-516-----------------------------------------GPLNADL.QGFD---------------------------
A0KK00_AERHH/578-725-----------------------------------------AALSGQS.RHIS---------------------------
B5ECC6_GEOBB/569-721-----------------------------------------KNTSLTL.SNLQ---------------------------
Q2LUD1_SYNAS/159-313-----------------------------------------HDLSLAI.PFLS---------------------------
A4VPN2_PSEU5/551-698-----------------------------------------QSLNGDI.GVLS---------------------------
Q0VP61_ALCBS/382-530-----------------------------------------TDGGLTL.SNLI---------------------------
A1K7K6_AZOSB/583-736-----------------------------------------DGLSVKA.DNLS---------------------------
Q3JBN6_NITOC/369-521-----------------------------------------SDLGLQL.IDVT---------------------------
Q5NYY7_AROAE/832-979-----------------------------------------TGMEGEV.VGLS---------------------------
Q13S79_BURXL/640-791-----------------------------------------TPLQLKV.QNIS---------------------------
Q47FN3_DECAR/504-656-----------------------------------------EAFSLHG.EGLT---------------------------
Q316X0_DESAG/862-1008-----------------------------------------AGLNATL.SSVS---------------------------
Q602F3_METCA/416-565-----------------------------------------DDLEIRL.QGVD---------------------------
Q2Y5K5_NITMU/673-818-----------------------------------------TDLAGRI.GPLN---------------------------
B3E4B8_GEOLS/816-963-----------------------------------------HNLGGMV.SGLS---------------------------
A4VPN2_PSEU5/341-492-----------------------------------------GPLNLDI.SDFD---------------------------
Q5NYY7_AROAE/153-307-----------------------------------------SAINIGL.PFLS---------------------------
Q30NX8_SULDN/563-715-----------------------------------------DNINISA.KNID---------------------------
C1DFK3_AZOVD/367-518-----------------------------------------GPLDLSL.RDFD---------------------------
Q484B1_COLP3/604-751-----------------------------------------YSLNGDI.TGLS---------------------------
Q5NYY7_AROAE/604-757-----------------------------------------AGIKLKA.DGLS---------------------------
Q602F3_METCA/623-770-----------------------------------------RGLTGVV.QSLS---------------------------
Q316X0_DESAG/389-538-----------------------------------------GPLDITL.NNLS---------------------------
A5G9K9_GEOUR/137-293-----------------------------------------RKVELTI.PFVT---------------------------
B2JHK1_PARP8/152-309-----------------------------------------SDASASV.DHIH---------------------------
A5G9K9_GEOUR/551-702-----------------------------------------KKMAFTL.DKLT---------------------------
A0KK00_AERHH/151-307-----------------------------------------SGLDLQL.PTFS---------------------------
Q1H1L3_METFK/780-927-----------------------------------------NSLSGVI.NGMS---------------------------
B9M7L7_GEODF/383-534-----------------------------------------KKTSFSL.EQLT---------------------------
A4SXW3_POLSQ/414-561-----------------------------------------KKFNATL.IGVS---------------------------
B9M3X2_GEODF/564-715-----------------------------------------KSIDVSA.TGIT---------------------------
A4G9D7_HERAR/154-308-----------------------------------------ADLKIGV.PFVS---------------------------
Q21F55_SACD2/584-731-----------------------------------------TKLHGEL.STLA---------------------------
Q7NY28_CHRVO/704-851-----------------------------------------HHLRGSI.QNLS---------------------------
Q0JZH1_CUPNH/164-317-----------------------------------------DNLTLTL.PFLS---------------------------
A1TWZ4_MARHV/597-744-----------------------------------------QELTGSV.TGFS---------------------------
B3E4B8_GEOLS/367-514-----------------------------------------QAINVKL.SNLS---------------------------
Q2IFA1_ANADE/563-710-----------------------------------------TGAQATV.TRLS---------------------------
Q1QTZ9_CHRSD/348-494-----------------------------------------AELNGEW.RQIG---------------------------
Q11NN1_CYTH3/142-298-----------------------------------------NQFELLL.TNIT---------------------------
Q9HV64_PSEAE/140-291-----------------------------------------DPLGFEL.HNLS---------------------------
Q3SGZ4_THIDA/733-880-----------------------------------------HDLGGVV.TGLS---------------------------
Q3A6W6_PELCD/162-316-----------------------------------------ADLGFYV.PFTS---------------------------
Q316X0_DESAG/600-751-----------------------------------------TGINLDV.TGAG---------------------------
A1TWZ4_MARHV/166-321-----------------------------------------APLDLTL.NDLA---------------------------
B9M7L7_GEODF/592-739-----------------------------------------FNLGGRI.SGLS---------------------------
Q222N5_RHOFT/496-646-----------------------------------------TDLALKL.EGAS---------------------------
Q3A6W6_PELCD/805-951-----------------------------------------DKLAVTV.EAVE---------------------------
A5G9K9_GEOUR/769-916-----------------------------------------YNLGGRI.SGLS---------------------------
A2SI01_METPP/623-775-----------------------------------------TRTDLKL.RQLD---------------------------
Q083W9_SHEFN/492-642-----------------------------------------GPIDFTT.GVIK---------------------------
Q083W9_SHEFN/725-872-----------------------------------------EMLNGQI.TNLS---------------------------
Q12MK5_SHEDO/654-801-----------------------------------------EELKGEI.TNLS---------------------------
Q3SGZ4_THIDA/517-669-----------------------------------------AEGFVTF.EDLS---------------------------
A1ARF1_PELPD/573-725-----------------------------------------RNTAFSL.ADLS---------------------------
Q39RS7_GEOMG/801-948-----------------------------------------YNLGGRI.SGLS---------------------------
Q603H4_METCA/502-653-----------------------------------------ENLRLSL.GPIA---------------------------
Q222N5_RHOFT/149-300-----------------------------------------APIDFSL.SNFS---------------------------
A8ZWF7_DESOH/412-569-----------------------------------------SDLNVTV.APF.---------------------------
A4XYD1_PSEMY/354-505-----------------------------------------GPLNLDL.KNFD---------------------------
Q484B1_COLP3/152-304-----------------------------------------KEINVAL.DNFS---------------------------
Q21F55_SACD2/154-306-----------------------------------------GPIHFGV.SDFS---------------------------
Q3SGZ4_THIDA/147-307-----------------------------------------EPLGIEL.DGLS---------------------------
A7I315_CAMHC/662-807-----------------------------------------SKVRTAV.NKVA---------------------------
Q74FC9_GEOSL/787-934-----------------------------------------YNLGGRV.SGLT---------------------------
A7H8M2_ANADF/367-518-----------------------------------------TEVQLRL.EQLR---------------------------
Q5DZ89_VIBF1/610-757-----------------------------------------EQLKGNI.GHVS---------------------------
A4XYD1_PSEMY/562-709-----------------------------------------QQMNGRI.GVLD---------------------------
B3E4B8_GEOLS/583-736-----------------------------------------SNIRLST.GNLT---------------------------
C1DFK3_AZOVD/141-292-----------------------------------------DALQLEV.RNLG---------------------------
Q1LGA7_CUPMC/681-840-----------------------------------------RNIGFTS.GTVT---------------------------
B5ECC6_GEOBB/807-954-----------------------------------------YNLGGRV.SGLS---------------------------
Q2IFA1_ANADE/358-509-----------------------------------------TDVAVTL.EGIR---------------------------
A4XYD1_PSEMY/140-291-----------------------------------------DSLDVEL.HNLS---------------------------
A7H8M2_ANADF/165-318-----------------------------------------GPLTVRL.ESFR---------------------------
A3QD21_SHELP/453-602-----------------------------------------GQLQLTT.GAVD---------------------------
Q3A6W6_PELCD/588-738-----------------------------------------HKLTGSI.TGYD---------------------------
A7H8M2_ANADF/579-726-----------------------------------------TGADASV.TRLS---------------------------
A8ETY5_ARCB4/612-759-----------------------------------------TKLNGKI.SEIK---------------------------
Q30NX8_SULDN/772-919-----------------------------------------HGLNGNV.YAIS---------------------------
A4VPN2_PSEU5/125-276-----------------------------------------DSLDLEL.HNLA---------------------------
Q1LGA7_CUPMC/173-326-----------------------------------------ENFTLTL.PFLS---------------------------
Q1H1L3_METFK/561-712-----------------------------------------ENANLEV.KDVS---------------------------
Q222N5_RHOFT/710-857-----------------------------------------YELNGVI.NGLS---------------------------
C1DFK3_AZOVD/584-731-----------------------------------------QQLNGRI.GSLD---------------------------
B2U875_RALPJ/869-1016-----------------------------------------TAIGGSI.GTIS---------------------------
B4EKU9_BURCJ/620-772-----------------------------------------KPLELSV.QKVS---------------------------
D0J281_COMT2/165-316-----------------------------------------KDLQLSI.PFIS---------------------------
M1FB64_9ALTE/585-727-----------------------------------------GQLYGNL.SGLS---------------------------
Q63NS2_BURPS/160-304-----------------------------------------DQWTVGI.PFIA---------------------------
Q7VVF7_BORPE/156-309-----------------------------------------DEIALGV.PFIS---------------------------
Q7VVF7_BORPE/538-685-----------------------------------------KQFEARF.DRLA---------------------------
Q87WR1_PSESM/155-306-----------------------------------------DALNFEL.KNLS---------------------------
Q88DW4_PSEPK/140-291-----------------------------------------DNMNLEL.KNLS---------------------------
Q88DW4_PSEPK/581-725-----------------------------------------QQLNGQI.GTID---------------------------
Q8EDF6_SHEON/666-811-----------------------------------------EQLEGHI.SHLS---------------------------
Q9HV64_PSEAE/476-627-----------------------------------------GPLDLDL.QNVD---------------------------
Q9HV64_PSEAE/692-837-----------------------------------------QQLSGEV.GTLD---------------------------

PF13116

C6XK02_HIRBI/457-744------------------DFPPGTNSKPI.....VPD..KALTLDFRV-EDAE---------------------------
Q7NW94_CHRVO/514-796------------------AGNLDQ.FPFP.....GGK.DGEFLVEADI-EKAR---------------------------
Q7N037_PHOLL/501-786------------------QGNPKD.FPFA.....KNN..GQFQVFAPL-RHAT---------------------------
A4XQL3_PSEMY/513-798------------------QGSLNK.GASL.....GARSLSLF...FQV-KDAE---------------------------
Q3J7T7_NITOC/517-810------------------QGPWSH.FPSS.....RDG..SQLTVELDI-RGAK---------------------------
D5CU11_SIDLE/524-805------------------RGDLRD.FPFV.....GNK.RGIFKLEARA-KDVE---------------------------
A1AVR0_RUTMC/242-525------------------KKNLSTQLP............AKIKFDAHL-SNTE---------------------------
Q31FH6_THICR/496-774------------------KGDLND.FPFR.....HQE..GLFEATADI-HKAE---------------------------
Q2NWP0_SODGM/504-789------------------AGSPSR.FPFK.....HND..GQFEVWVPL-KQAE---------------------------
B8GV04_THISH/540-825------------------RGPFTR.LPFE.....EGE..GEFEVRARV-EEGL---------------------------
A0RPG5_CAMFF/10-294------------------KLNLKNFDFYP..........NELYAKAVA-KDLS---------------------------
Q07WQ4_SHEFN/504-791------------------HGALGD.YPYQ.....DSS..GVFQADFTL-DKGI---------------------------
Q5ZUN8_LEGPH/507-795------------------NGMAKD.FPFD.....NGN..GEFSIVSHV-VGGD---------------------------
Q7VFV2_HELHP/222-511------------------QSTLNKHFFAQ........LQKTLALDLAI-ESPK---------------------------
Q12IX1_SHEDO/530-817------------------HGALSH.YPYE.....DNS..GVFQAGFTL-ENAV---------------------------
Q15ZG8_PSEA6/490-776------------------NGELSQ.FPYA.....NNQ..GVFQITVGV-EDAS---------------------------
A6Q385_NITSB/202-483------------------KIDLKKGFDP...........NLFKGRAVA-YDGT---------------------------
A8GK60_SERP5/523-808------------------NGDPQH.FPYR.....KHE..GQFEVFVPL-RHST---------------------------
Q3IFH7_PSEHT/493-781------------------AGPLTG.FPFS.....DGS..GQFDVLAQI-DNAT---------------------------
D9SHW3_GALCS/523-805------------------KGNLSD.FPLN.....GST.PSLFEIGARA-HDVS---------------------------
Q21FT5_SACD2/542-827------------------SGSVMK..........DPEVRPTIQVFGDV-ENAT---------------------------
A7MJB2_CROS8/518-803------------------VGNPQH.FPYK.....QND..GQFEVYVPL-HNAT---------------------------
C6XD69_METGS/519-799------------------KGNLHD.FPYP.....NNK.TGLFRVTAKI-NDGE---------------------------
A7I2E8_CAMHC/213-497------------------KINLKSGEIFK..........DDFLADGIL-QNVS---------------------------
Q6LMA6_PHOPR/509-794------------------YGELSD.FPYQ.....NNE..GIFQAKVPL-KKAK---------------------------
D0L1I5_HALNC/561-853------------------NGDPAR.FPFI.....KGG..GWFSVVFDF-KHLV---------------------------
A3Q9Y2_SHELP/509-796------------------NGPLKH.FPYD.....DNS..GVFQAGFSL-NQAR---------------------------
A6QAC9_SULNB/206-494------------------KGIVHGTDFKL.....DWNSLKG...NALL-EDVQ---------------------------
A8EUE5_ARCB4/193-478------------------EYDLKKNELVQ..........NSIEGKAHI-KDGK---------------------------
C5ZX33_9HELI/208-498------------------TLPLDSKNLIK.......DSLDSLYVVGEI-RDAK---------------------------
Q1H0H5_METFK/520-800------------------KGNMRE.FPFA.....DNK.NSLFQVKAKI-HDGE---------------------------
Q7MRT1_WOLSU/187-475------------------DSELNEKAILE.......SIEKRLKARLEI-ASPE---------------------------
Q47VG9_COLP3/504-793------------------NGPISR.FPFT.....DGS..GIFVVDAEL-SKSE---------------------------
A4G3G0_HERAR/587-887------------------KGDLNQ.FPFHTQKAAEKS.KGEFIFGGKI-DNGG---------------------------
D1B1Z5_SULD5/203-493------------------ILDIQTGEYFP..........MQMRGHATV-QEAT---------------------------
D3V5J7_XENBS/502-797------------------QGNPHD.FPFK.....QNN..GQFQVWVPL-RHAT---------------------------
E6WGF8_PANSA/504-789------------------AGDPTL.FPFR.....HND..GMFEVWVPL-RQAT---------------------------
D3VKA4_XENNA/501-791------------------QGNPHD.FPFK.....QNN..GQFQVFVPL-RDAI---------------------------
Q0ABM3_ALKEH/531-818------------------DGPLSG.ERFR.....QGE..VAFQAGGRV-IDGE---------------------------
A0KFB2_AERHH/486-771------------------YGEFRD.FPYR.....KGE..GIFQVAVPL-QQAS---------------------------
A6TER2_KLEP7/497-781------------------GGNPHL.FPYP.....HNE..GQFQVYVPL-KNAT---------------------------
B4EX35_PROMH/501-782------------------HGDPRD.FPFE.....QHN..GWFQVYAPV-KQAT---------------------------
B7VIB8_VIBTL/505-791------------------HGELAQ.YPYT.....NHD..GIFQVWVGL-EDAK---------------------------
D3HJX5_LEGLN/559-845------------------NGLAKD.FPFD.....DNT..GEFTIDSFA-SGGE---------------------------
F0LWR2_VIBFN/505-791------------------YGELDH.FPYQ.....HHN..GIFQAWVGL-KEGK---------------------------
Q5E7X4_VIBF1/495-780------------------YGELND.FPYT.....KYD..GIFQVKVGL-KDAQ---------------------------
Q6DAI1_PECAS/504-784------------------AGNPQH.FPYT.....HSE..GQFEVWVPV-KDAT---------------------------
Q74PM2_YERPE/511-794------------------NGNPHD.FPYK.....NKE..GQFQVYVPL-RNAV---------------------------
Q7MHE2_VIBVY/508-794------------------YGELAD.FPYT.....KND..GMFQAWVGL-KQGK---------------------------
Q83BN5_COXBU/480-760------------------KGPLDR.FPFL.....HQE..GSFDAIANV-DRVT---------------------------
Q8ZLP4_SALTY/504-786------------------GGNPHL.FPYK.....HNE..GQFEVLVPL-RNAT---------------------------
Q9KUU5_VIBCH/504-791------------------YGALDQ.FPYR.....MHN..GVFQAWVGL-KEAK---------------------------

PF13109

A0RPG5_CAMFF/433-647-------------------------------------DGNF-----------T-------V..R--.----LNG-.E---
A6Q385_NITSB/623-836-------------------------------------KGEY-----------E-------L..V--.----LHG-.P---
A6QAC9_SULNB/640-854-------------------------------------KGRY-----------T-------F..R--I----SGT-.P---
B9L5J2_NAUPA/583-798-------------------------------------LINL-----------D-------F..V--.----MVK-SP---
C5ZX33_9HELI/638-852-------------------------------------QGRF-----------S-------I..N--.----ANT-.N---
D3UGW6_HELM1/730-943-------------------------------------GGLF-----------T-------L..I--.----GAY-.K---
Q30RQ8_SULDN/697-907-------------------------------------GGKM-----------E-------FYIS--.----GQL-.D---
Q7MRT1_WOLSU/616-829-------------------------------------GGRF-----------D-------L..I--.----GEY-.G---
Q7VFV2_HELHP/731-944-------------------------------------GGLF-----------N-------F..K--.----GIY-.D---
O25308_HELPY/745-958-------------------------------------GGLF-----------T-------L..I--.----GAL-.E---
Q0PAY6_CAMJE/635-848-------------------------------------DGVF-----------N-------L..S--.----IKG-.S---

PF13502

A0KFB2_AERHH/999-1241-------------------------------------SELL-----------L.......K--R--L----G.Y-TS...
A1S2S6_SHEAM/1130-1371-------------------------------------FDAL-----------A.......Q--Q--L----G.I-TP...
A1STZ9_PSYIN/1024-1262-------------------------------------VNDI-----------V.......K--R--L----GYS-SP...
A1TW53_ACIAC/1117-1369-------------------------------------SGQL-----------L.......A--R--F----G.M-EG...
A1U479_MARHV/979-1225-------------------------------------LKDL-----------E.......A--L--T----GST-IP...
A1WCZ7_ACISJ/1139-1390-------------------------------------CGAL-----------L.......A--R--F----G.M-DG...
A1WSB5_VEREI/1101-1362-------------------------------------AGAL-----------L.......E--R--L----G.L-AH...
A1WYY8_HALHL/891-1129-------------------------------------AGDL-----------F.......G--L--L----Q.A-PR...
A2U2U5_9FLAO/567-793-------------------------------------IKES-----------F.......S--S--L----E.M-LESIA
A3HUH0_9BACT/675-900-------------------------------------ISEA-----------FSTL.NTVK--A--F----API-AQ...
A3Q9Y2_SHELP/1046-1289-------------------------------------FDEV-----------S.......E--R--L----G.I-DP...
E0TB83_PARBH/837-1047-------------------------------------FGQL-----------L.......R--G--L----F.G-IE...
A4AMF6_MARSH/560-785-------------------------------------IGES-----------F.......K--S--L----E.L-FKFLA
A4CG41_ROBBH/574-799-------------------------------------IRET-----------L.......E--S--I----E.L-FETLA
A4VIB7_PSEU5/1014-1255-------------------------------------LADV-----------L.......L--A--W----GFA-PS...
A5CF63_ORITB/620-836-------------------------------------IPTF-----------S.......F--I--L----Q.D-KE...
A5FJ68_FLAJ1/564-791-------------------------------------IAQT-----------F.......T--Q--L----D.M-MKKIA
A5FUN1_ACICJ/745-973-------------------------------------ASAV-----------A.......S--I--A----A.T-HGLA.
A6GWN8_FLAPJ/560-787-------------------------------------IAKT-----------F.......T--Q--L----D.M-LKKIA
A7HEC2_ANADF/581-801-------------------------------------GEEA-----------L.......K--L--L----G.D-RK...
A9CIC7_AGRFC/884-1105-------------------------------------PEPI-----------L.......W--A--N----A.N-GP...
A9H3V6_GLUDA/474-684-------------------------------------VTTQ-----------F.......E--.--.----G.G-RT...
B2FP42_STRMK/1008-1250-------------------------------------LGAL-----------M.......Q--N--L----DYG-GQ...
B4S7D6_PROA2/551-781-------------------------------------IVES-----------YKSV.SLLK--T--L----APV-AE...
B7VIB8_VIBTL/1027-1268-------------------------------------NSEL-----------M.......E--R--F----G.I-TS...
C1D9M5_LARHH/1015-1258-------------------------------------LGKL-----------L.......A--R--I----G.E-AD...
C3L4A9_AMOA5/534-754-------------------------------------LPAL-----------FYTFENFNQ--R--F----L.E-DR...
C4L8L8_TOLAT/989-1232-------------------------------------TEVF-----------L.......G--H--F----G.F-DP...
E8RSC3_ASTEC/1136-1358-------------------------------------YTAF-----------T.......F--E--A----D.D-LG...
D9SHW3_GALCS/1021-1263-------------------------------------AGKI-----------L.......S--R--S----G.Y-PN...
D5CU11_SIDLE/1024-1263-------------------------------------AGKI-----------L.......S--R--S----G.Y-PE...
C6WWM2_METML/1053-1294-------------------------------------LGQT-----------L.......A--R--L----G.Y-AD...
C6XD69_METGS/1043-1284-------------------------------------LGKT-----------L.......E--R--F----G.Y-PG...
C6XK02_HIRBI/884-1092-------------------------------------AGYI-----------L.......K--T--L----F.K-TD...
C7PC84_CHIPD/564-796-------------------------------------VQQT-----------F.......N--A--F----N.T-VQALM
E6WGF8_PANSA/1014-1257-------------------------------------INDA-----------T.......N--W--F----G.V-NT...
D2UF54_XANAP/1023-1265-------------------------------------LGAL-----------M.......Q--S--L----DFG-GQ...
D3SBX9_THISK/1040-1287-------------------------------------WGGA-----------L.......T--S--A----RLS-RA...
Q0ABM3_ALKEH/1048-1290-------------------------------------AGDI-----------L.......A--T--L----GYL-PS...
Q0AQ38_MARMM/879-1092-------------------------------------LQRI-----------S.......A--L--L----G.M-EG...
Q11YL6_CYTH3/532-755-------------------------------------IDSL-----------FYVFENFSQ--N--F----I.T-NK...
Q11YT8_CYTH3/698-925-------------------------------------AKEA-----------Y.......K--T--F----N.S-VKKMA
Q145G0_BURXL/1154-1409-------------------------------------AGAL-----------L.......E--R--F----G.Q-PR...
Q15ZG8_PSEA6/1002-1243-------------------------------------FGLF-----------L.......K--G--F----EFD-SG...
Q211X0_RHOPB/871-1087-------------------------------------GAAL-----------R.......Y--R--A----L.A-MP...
Q28TM9_JANSC/371-572-------------------------------------LQPL-----------L.......G--A--M----A.D-YE...
Q2KY05_BORA1/936-1183-------------------------------------AGKF-----------L.......D--R--V----G.L-KQ...
Q2NWP0_SODGM/1012-1255-------------------------------------IGAA-----------A.......D--Y--I----G.M-DL...
Q3IFH7_PSEHT/1008-1245-------------------------------------IGAL-----------F.......N--E--F----D.L-TT...
Q47VG9_COLP3/1038-1280-------------------------------------VEAE-----------L.......K--A--A----G.Y-ES...
Q5R0H7_IDILO/1003-1244-------------------------------------LGDL-----------L.......R--D--Y----G.L-ET...
Q7MHE2_VIBVY/1031-1272-------------------------------------NSDL-----------M.......E--R--F----G.I-TS...
Q7UYB4_RHOBA/752-985-------------------------------------FVRL-----------T.......D--Q--L----G.R-SS...
Q8EA16_SHEON/1025-1268-------------------------------------FHHL-----------S.......D--Q--L----G.I-NP...
Q9ZDH9_RICPR/624-849-------------------------------------LNKI-----------L.......A--L--M----HNI-FT...
A8GK60_SERP5/1034-1277-------------------------------------IDET-----------A.......A--F--F----G.I-TT...
C5BC15_EDWI9/1004-1246-------------------------------------LTDS-----------A.......D--F--F----G.L-TL...
D3HJX5_LEGLN/1065-1312-------------------------------------LSKT-----------L.......E--R--W----N.I-TP...
E0SHA8_DICD3/1031-1273-------------------------------------LSDN-----------A.......D--W--L----G.L-AT...
F4AYZ2_DOKS4/566-791-------------------------------------IDRS-----------F.......K--E--L----D.M-LQGLA
G2J3B5_PSEUL/1018-1258-------------------------------------LGEL-----------L.......G--R--F----G.Y-GD...
M1FEQ6_9ALTE/970-1216-------------------------------------LAEL-----------G.......G--L--F----G.A-DV...
N0B6U7_9RHIZ/961-1176-------------------------------------AGQV-----------M.......K--L--V----N.F-YP...
Q0KCK4_CUPNH/1119-1370-------------------------------------AGAT-----------L.......E--R--L----G.L-AH...
Q0VS66_ALCBS/1022-1263-------------------------------------LGRS-----------L.......R--A--W----G.L-PE...
Q2K6G4_RHIEC/885-1104-------------------------------------LAGV-----------I.......W--L--R----D.G-AP...
Q32B94_SHIDS/1009-1252-------------------------------------IDAA-----------A.......E--F--F----G.V-TT...
Q5ZUN8_LEGPH/1014-1261-------------------------------------LAKS-----------L.......D--R--W----A.I-NP...
Q63R38_BURPS/1120-1377-------------------------------------AGAL-----------L.......E--R--V----G.L-PR...
Q6LMA6_PHOPR/1035-1276-------------------------------------SSDL-----------M.......G--R--F----G.I-SS...
Q8P7K3_XANCP/1032-1273-------------------------------------LGNL-----------L.......Q--N--L----T.L-GG...
Q9KUU5_VIBCH/1028-1269-------------------------------------NSDL-----------M.......A--R--F----G.I-NS...
Q9PEA2_XYLFA/983-1225-------------------------------------LGEL-----------A.......Q--A--I----G.Y-GE...

PF05170

Q87TE2_VIBPA/1-570...........KPWQELPFTINHINSLDLLNADIEW.GEWH-----------WQNL..ELSIED--A----SLP-ASLWN
Q9KNJ9_VIBCH/1-570...........SLWQTIAPSIYHINSLDLLNSQLTL.NGVA-----------WENL..NLSVED--Y----DLR-HSLWQ
Q9HU38_PSEAE/1-636..........GQLLLDQSAQIAEWNGLKLSVNQLRA.LGEL-----------......KARELD--K----DTK-FSGGL
Q9KT66_VIBCH/1-595...........NLDASFSDPSNQIDSAKLKLDTFEF.DKAN-----------ALTFSVAGKAAD--M----KLN-AQGSA
Q9JY87_NEIMB/8-615..........GITISTTGSPSVRFNAGGADAAGLGLRADTS-----------FRNLHLTAQIPA--L----ALR-NNSIK
Q9ZDI1_RICPR/1-711NINIRDARLHYPNIELLANTNYDMERNNLESNIIVN.PGNL-----------ITKIQSNLDKTN--I----LLQ-ADSLK
Q9HUT4_PSEAE/1-577...........LALQDASKPFPLQAEVSAGSTRAAV.VGTL-----------TDPL..NLGALD--L----RLK-LSG..
YHJG_ECOLI/1-582...........LALRGEGTPFPVQADFRSGNTRVAF.DGVV-----------NDPM..KMGGVD--L----RLK-FSG..
Q7MQ04_VIBVY/1-571...........KPWDRFGSQITHINSLDILRSSLAL.EDYR-----------LINF..ELSSEN--L----TLP-FSLWQ

PF04357

A2U1I0_9FLAO/1175-1633RE.............NPDAILTQ............TEEKSA-----------VITGFDIFAKLN--V----NKE-ASV..
Q83EW1_COXBU/570-928AD.......................................-----------...EKQTPWRTN--I----NIK-IIL.G
Q1D0C2_MYXXD/935-1291......................H............LAAGSL-----------SSSGEPPKPWVI--W----DVN-VHF.G
A5FB26_FLAJ1/992-1420PKEKYN.....LQKGIVERTRN...................-----------.YNGLELEFDFD--I----TPD-AEV..
Q8YZJ8_NOSS1/1412-1829PE....................A..........TVTQQPPT-----------RPNL..PVE..F--A----DLR-LNL.G
A4CK93_ROBBH/998-1431KDERRT.....IEAQRTLRE.....................-----------.YEGLELEFDLD--V----TPE-AEV..
A3U6I2_CROAH/1185-1647KDNPDS.....ILTQTQEEESA.............I.....-----------.ISGFDIKTNIK--V----GKE-AVV..
A0LGH5_SYNFM/889-1254AE....................S..........DFVEIGSS-----------DKTHDRYYSSLK--T----DVV-LDLPA
A3HZ37_9BACT/1160-1620KENPDD.....ILTGQTEETTT.............A.....-----------.FSGYDIQAQLT--A----DPK-AKF..
A5GSG8_SYNR3/973-1387PEASWD.....FQQPVVVRGPRVES.......ADGAAVRRR-----------VPT.FGPLS..F--R----NLR-VAL.G
A6L590_BACV8/1012-1461KTPKRI.....HDNVETNLYHHSN........VRKTKEDDG-----------PPMDLRINMLIE--A----TPS-ATM..
A0M1P1_GRAFK/1180-1639KENPED.....ILSQT.EEESY.............V.....-----------.ISGYDIFMKIG--V----DEG-ATF..
Q2S2D2_SALRD/1057-1516STGRTP.....SVSQLTRRPNILA.........DRPAGVPS-----------FVEGLNLDLNVI--A----PDE-STV..
Q21Y28_RHOFT/928-1291PG.............PSQAGTAA..........PTAPTAST-----------AAAQ..ERVTPD--V----AIT-LDL.G
Q6MKB2_BDEBA/958-1321KL.......................................-----------..LREGQFEAIL--L----DLQ-ILL.S
Q39RU7_GEOMG/1016-1376...............APPHEET.............E.....-----------......FPLALD--I----RIG-VTL.G
Q7VBL9_PROMA/867-1309PEQNWD.....YKDPLVLFIEDKNS.......PANKLLRSG-----------LPKGLSFIG..F--D----SLK-LRL.G
A5FIP0_FLAJ1/1183-1626EDNMYL.....KQTVDLQNKLDQ...........SE.....-----------.LKGMDVNVAIS--I----DKE-AEL..
Q8KFW2_CHLTE/1034-1479RR..................PAPKP......VEAAAPPEKL-----------EFHYNLLDILQI--K----NLR-LSN.S
A6H009_FLAPJ/1018-1446RKDDFV.....NKTKNKKQKT....................-----------.YKGVELNFELD--I----TKD-AEI..
B5E9K2_GEOBB/1121-1484...............APAESARK............P.....-----------......FPLVLD--G----RVK-VVL.G
Q11I59_CHESB/1185-1538LNP..........PPAVERTLEKA........RVADDGTPM-----------..PSQRPSVM.R--L----NVN-INA.P
Q11VR9_CYTH3/1167-1624DSSSLD.....PIMLRQNEEVIA...........EK.....-----------.ITGLDLSAKIH--I----DRN-STL..
A7HQ23_PARL1/1042-1395GP.................................GEADIV-----------EEPEEAPPLPLM--L----DVR-LAI.G
Q7MT86_PORGI/1036-1486PKSSRE.....RARQETSPDRPSL.........LLPATGGD-----------PETDFHLVMNVG--V----TPD-AEV..
Q3AQ57_CHLCH/1053-1500RN................PKPKAPK......AKELKSGGSK-----------EFYYSLIDILTI--H----NLR-ISS.P
A1BDC7_CHLPD/1048-1494RY................PSQQSMV......AQTDLDSDPV-----------GFNYSLIDILQL--K----DLK-IRS.A
Q6MAC5_PARUW/935-1288QNP..........DH.....KSKRS......SEVSNSSPL.-----------...........A--F----DIK-LQI.P
Q1QWE2_CHRSD/954-1312RE.............QDAAQQGEKA......SGEQGEATAQ-----------ALSE..AGMALD--V----SVM-LSL.G
Q2RSJ7_RHORT/1146-1500GK..................GQATS......ATQAVADREA-----------LRMAAQTPIPVL--L----DIT-VSL.P
Q2S346_SALRD/1311-1689ER....................F...........GLRLTSA-----------DTTTFDAYEALA--L----DLA-VQI.Q
Q2INP6_ANADE/946-1304....................................RPPPP-----------PKPYDKSGEWLR--F----DLQ-LVV.D
Q9RUC9_DEIRA/223-627LPEEY......TTFPKPAAGSGQGK......GTTGTGSSTS-----------PATTPLLERFLF--E----DVQ-LRA.S
Q1LSN0_BAUCH/634-981EQ....................L............NLIPML-----------TNYKRIIALPIV--T----NLL-LHL.N
B3ELK5_CHLPB/1036-1483RY...............PEKIDPDQ......PENPEKPVNP-----------EFYYTLIDIITI--K----NLR-LTS.A
Q8YUC2_NOSS1/1659-2048......................S..........LTKFNKQD-----------TPT.TASANTSF--N----NLE-LEL.G
Q1MQI4_LAWIP/1025-1382NT.......................................-----------.KTKKATYQQPT--L----SIA-LSI.P
Q7VQN5_BLOFL/933-1286DK...................................FKPI-----------TNKPKNVGMLTI--S----NLI-IHI.G
Q31MA1_SYNE7/1177-1568......................N...........LASGDLG-----------APTL..PVR..F--Q----QLK-IAL.E
B4E8E1_BURCJ/988-1340PDG..........TVR...GETPTG.......TAV.AKPKA-----------VEDKPAPSLAPR--A----NID-VGL.G
E3G0N9_STIAD/1177-1560NGLLM.......NKRR...KPATAPAGTGGTGNAGTAEENA-----------.SEEEKPAVQRT--Y----ELH-VRA.P
F4B3D6_DOKS4/1021-1426PE.............EKEARIN............GVQVITE-----------AVKGLSVNFDLD--I----DPD-AEV..
Q46LW1_PROMT/887-1319PEQNWNQKEPLVLFIQD.....EDA.......PASRIVSAG-----------LPNG..FESLTF--D----NLK-LAL.G
TAMB_HAEIN/952-1298GP............HKSKEE................LIKRE-----------FAAKTKSGMEIR--S----DLR-INI.G
Q5NNB3_ZYMMO/1036-1389.G.............QVEDTAAH...........QTKESSA-----------SASM..LASAWK--L----DIR-ISA.P

PF05359

Q4K5X6_PSEF5/140-291-------------------------------------.TLP.----------DDS.....ADMT..L....VAT.GP---
Q4K5X6_PSEF5/360-511-------------------------------------.SLN.----------QSP.....FTLK..L....DTG.LG---
B2JQ93_PARP8/874-1021-------------------------------------.TES.----------KQS.....APVD..V....SAK.LA---
A0RMT1_CAMFF/653-798-------------------------------------.NDK.----------..I.....SNIA..L....HGV.VA---
Q72DG8_DESVH/963-1109-------------------------------------.MAP.----------ESR.....AEVS..A....GGT.LE---
A9BMN7_DELAS/883-1036-------------------------------------.SEQP----------ASQQAPQLADVE..L....RGR.AQ---
Q2LUD1_SYNAS/534-687-------------------------------------.SVP.----------NSA.....ANLF..L....KAR.VS---
A8ZWF7_DESOH/636-783-------------------------------------.SED.----------FKA.....ADVM..A....KGT.ID---
Q3A6W6_PELCD/375-529-------------------------------------.DLPG----------SDP.....AELQ..A....DLT.LN---
Q5NYY7_AROAE/382-536-------------------------------------.SAP.----------DAI.....AEVA..L....DFV.TD---
Q2KWF8_BORA1/759-906-------------------------------------.SRN.----------PKP.....ATVK..V....GGR.VY---
Q484B1_COLP3/382-534-------------------------------------.PFT.----------DEL.....ALLS..S....TIG.LN---
A2SI01_METPP/870-1017-------------------------------------.WDS.----------PQP.....ATVK..I....SGK.VD---
Q8Y0Z7_RALSO/615-766-------------------------------------.TDL.----------GKP.....VDVQ..I....GAG.LG---
Q5QWM2_IDILO/380-527-------------------------------------.SDS.----------SEP.....ARVK..F....EGE.VA---
Q0VP61_ALCBS/592-737-------------------------------------.TRS.----------GRT.....ANVN..L....SAQ.VD---
A3QD21_SHELP/699-846-------------------------------------.SSS.----------EKA.....AKVD..I....KGK.ID---
Q63NS2_BURPS/645-797-------------------------------------.EDL.----------SKP.....LPVR..L....TAT.LN---
Q47FN3_DECAR/732-879-------------------------------------.SAA.----------DTV.....ADME..V....RGK.YA---
A0KK00_AERHH/368-522-------------------------------------.GSQS----------GQR.....SPLT..L....SWA.LN---
Q0JZH1_CUPNH/670-829-------------------------------------WPLT.----------PAA.....VPLK..L....HAE.SG---
Q2LUD1_SYNAS/785-932-------------------------------------.SNL.----------ATT.....ADLE..I....RGK.VD---
A1ARF1_PELPD/790-937-------------------------------------.SDD.----------SKF.....ADVD..L....RGN.LE---
Q39RS7_GEOMG/568-719-------------------------------------.GPR.----------MET.....IPYR..F....SAG.YG---
B9M3X2_GEODF/795-942-------------------------------------.SED.----------FRY.....ADVD..L....RGD.LD---
Q8Y0Z7_RALSO/185-339-------------------------------------.SLP.----------AD......VDIF..V....QPL.LA---
Q3JBN6_NITOC/584-731-------------------------------------.SMD.----------QGR.....SSIS..L....EGT.VE---
Q5DZ89_VIBF1/399-549-------------------------------------.SDL.----------SKP.....IDFD..F....FAS.VN---
Q1QTZ9_CHRSD/145-295-------------------------------------NSDD.----------........RPFA..L....QGQ.AD---
A9BMN7_DELAS/165-317-------------------------------------.NLE.----------SK......REIK..V....LPH.LS---
A9BMN7_DELAS/379-538-------------------------------------.RWPL----------EQPLQ.LAASMQ..VQPESAGE.GA---
Q87WR1_PSESM/386-537-------------------------------------.SLN.----------KSP.....FTLK..L....DTG.LG---
B2JQ93_PARP8/616-770-------------------------------------.DDL.----------SRA.....LPVD..L....QAT.VN---
A1K6C3_AZOSB/734-881-------------------------------------.NRP.----------GSE.....AVVD..A....RGR.IQ---
Q603H4_METCA/718-865-------------------------------------.TRS.----------EAR.....ALLQ..F....HGQ.VD---
Q47VC1_COLP3/500-655-------------------------------------.KEKK----------QQQ.....TPYT..L....VGR.SN---
Q15PY6_PSEA6/662-809-------------------------------------.SSA.----------DNP.....AEVD..I....AGK.ID---
Q88DW4_PSEPK/365-516-------------------------------------.SLN.----------QSP.....FTLK..L....DTG.VG---
A0KK00_AERHH/578-725-------------------------------------.NIP.----------GQR.....SELA..F....NGK.VD---
B5ECC6_GEOBB/569-721-------------------------------------.GPK.----------FAP.....MPMT..F....AST.YG---
Q2LUD1_SYNAS/159-313-------------------------------------.NLF.----------YR......VDKY..I....EPE.FS---
A4VPN2_PSEU5/551-698-------------------------------------.NRE.----------QKA.....ASVN..I....AGK.VD---
Q0VP61_ALCBS/382-530-------------------------------------IGE..----------EAT.....FTWQ..G....KAT.LQ---
A1K7K6_AZOSB/583-736-------------------------------------.TAK.----------GAN.....ARLS..V....GAR.IN---
Q3JBN6_NITOC/369-521-------------------------------------.SVP.----------GLA.....STFN..L....QFH.LN---
Q5NYY7_AROAE/832-979-------------------------------------.SDP.----------ATL.....ARLD..L....QGK.VD---
Q13S79_BURXL/640-791-------------------------------------.DDL.----------SRP.....LPVD..L....QAT.LN---
Q47FN3_DECAR/504-656-------------------------------------.NEA.----------NQK.....GKIA..L....QGK.IN---
Q316X0_DESAG/862-1008-------------------------------------.LSA.----------ASR.....PDLR..V....DGR.LN---
Q602F3_METCA/416-565-------------------------------------.....----------TRQ.....GKFALRL....ESV.VD---
Q2Y5K5_NITMU/673-818-------------------------------------...P.----------RKT.....GEVD..I....RGA.VD---
B3E4B8_GEOLS/816-963-------------------------------------.SDM.----------NTR.....AEVD..L....RGN.LE---
A4VPN2_PSEU5/341-492-------------------------------------.SLA.----------NRP.....FSLK..L....DTG.VG---
Q5NYY7_AROAE/153-307-------------------------------------...NL----------PSK.....VELF..VEPELSAL.VN---
Q30NX8_SULDN/563-715-------------------------------------.SKE.----------KSW.....FDYA..L....GLR.VN---
C1DFK3_AZOVD/367-518-------------------------------------.SLG.----------RSP.....FRLE..L....DSG.IG---
Q484B1_COLP3/604-751-------------------------------------.SNE.----------DSR.....AKID..L....KGK.VD---
Q5NYY7_AROAE/604-757-------------------------------------.TAK.----------GAA.....TKFE..L....GAR.VN---
Q602F3_METCA/623-770-------------------------------------.SRP.----------DAE.....AEVS..I....KGS.IS---
Q316X0_DESAG/389-538-------------------------------------TTG..----------........GKGS..V....GIS.MQ---
A5G9K9_GEOUR/137-293-------------------------------------.TIP.----------YL......ADRY..I....TPR.FS---
B2JHK1_PARP8/152-309-------------------------------------LPDL.----------SEP.....TGIS..M....KGA.IK---
A5G9K9_GEOUR/551-702-------------------------------------.GPT.----------FGP.....IPFR..M....SAA.YA---
A0KK00_AERHH/151-307-------------------------------------.TAP.----------GRA.....NPFV..L....AAT.LN---
Q1H1L3_METFK/780-927-------------------------------------.TNP.----------STT.....AQVE..L....DGK.VD---
B9M7L7_GEODF/383-534-------------------------------------.GPP.----------FGM.....IPFM..V....TGA.YG---
A4SXW3_POLSQ/414-561-------------------------------------.NAP.----------GHF.....ATVA..M....DGV.VA---
B9M3X2_GEODF/564-715-------------------------------------.DIL.----------RIP.....IPVR..F....NAS.YG---
A4G9D7_HERAR/154-308-------------------------------------.SLP.----------SQ......VDVY..V....EPL.LS---
Q21F55_SACD2/584-731-------------------------------------.SAS.----------TQP.....SQLS..L....EGQ.VD---
Q7NY28_CHRVO/704-851-------------------------------------.TRA.----------GGR.....GRIT..L....DGA.VD---
Q0JZH1_CUPNH/164-317-------------------------------------.NLP.----------HD......VEIV..T....RPT.LS---
A1TWZ4_MARHV/597-744-------------------------------------.NVP.----------PQQ.....GRVA..I....SGQ.LA---
B3E4B8_GEOLS/367-514-------------------------------------.TTA.----------NTQ.....SAYE..I....SFN.GD---
Q2IFA1_ANADE/563-710-------------------------------------.SDP.----------KVR.....SSVD..V....RLQ.VE---
Q1QTZ9_CHRSD/348-494-------------------------------------.AEQ.----------ASA.....AQLT..L....EGQ.VA---
Q11NN1_CYTH3/142-298-------------------------------------.NVED----------KEKA..LPSDLT..V....SGS.SI---
Q9HV64_PSEAE/140-291-------------------------------------.TLP.----------DDG.....AKMT..L....VAT.GP---
Q3SGZ4_THIDA/733-880-------------------------------------.NDP.----------ATT.....AQVE..L....DGK.VD---
Q3A6W6_PELCD/162-316-------------------------------------.TLK.----------RHR.....ERAITPY....LEA.VI---
Q316X0_DESAG/600-751-------------------------------------.SDA.----------AAP.....VEFS..F....SGN.WL---
A1TWZ4_MARHV/166-321-------------------------------------.TWPR----------DGS....DSQYS..V....MAA.LG---
B9M7L7_GEODF/592-739-------------------------------------.SED.----------NRF.....ADVD..L....RGN.LE---
Q222N5_RHOFT/496-646-------------------------------------.SDL.----------KQT.....VKFN..T....DLK.LR---
Q3A6W6_PELCD/805-951-------------------------------------.NTP.----------DSL.....AKIS..F....AGE.LD---
A5G9K9_GEOUR/769-916-------------------------------------.SEE.----------NRF.....ADVD..L....RGN.LE---
A2SI01_METPP/623-775-------------------------------------.SDL.----------TKP.....LSFE..L....ATA.LQ---
Q083W9_SHEFN/492-642-------------------------------------.SDL.----------SSP.....IDYQ..F....SAG.IN---
Q083W9_SHEFN/725-872-------------------------------------.SNP.----------ETT.....ASVD..L....AGK.ID---
Q12MK5_SHEDO/654-801-------------------------------------.SKL.----------DSR.....ATVL..L....DGK.ID---
Q3SGZ4_THIDA/517-669-------------------------------------.LDM.----------DKA.....VPLE..A....GFA.LR---
A1ARF1_PELPD/573-725-------------------------------------.GPK.----------FTP.....AQLR..C....STT.YG---
Q39RS7_GEOMG/801-948-------------------------------------.SEA.----------SRF.....ADVD..L....RGN.LQ---
Q603H4_METCA/502-653-------------------------------------.SDE.----------GRP.....MSFD..A....AFV.VG---
Q222N5_RHOFT/149-300-------------------------------------.TLP.----------EQN.....DAHT..F....TAQ.SA---
A8ZWF7_DESOH/412-569-------------------------------------.TTAP----------EKE.....SRFD..V....SAL.IN---
A4XYD1_PSEMY/354-505-------------------------------------.SLG.----------DKP.....FELR..L....DSG.LG---
Q484B1_COLP3/152-304-------------------------------------.TKAG----------DNN.....MHLV.......KAK.TS---
Q21F55_SACD2/154-306-------------------------------------.TLP.----------NKT.....GKQE..F....SFA.TE---
Q3SGZ4_THIDA/147-307-------------------------------------.TLP.----------EDR.....GAYLLAA.....RL.PA---
A7I315_CAMHC/662-807-------------------------------------.SKG.----------..L.....TKLD..F....NGL.VG---
Q74FC9_GEOSL/787-934-------------------------------------.SEE.----------SKF.....ADVD..L....RGN.LE---
A7H8M2_ANADF/367-518-------------------------------------.PDV.----------DAT.....WPLA..L....SLV.WN---
Q5DZ89_VIBF1/610-757-------------------------------------.SIP.----------GTK.....ATVD..I....SGN.IE---
A4XYD1_PSEMY/562-709-------------------------------------.NQK.----------PQA.....ASVD..I....QGK.VD---
B3E4B8_GEOLS/583-736-------------------------------------.GPT.----------FSA.....MPLQ..F....SSV.FN---
C1DFK3_AZOVD/141-292-------------------------------------.TLP.----------NDT.....AELT..L....QAS.GP---
Q1LGA7_CUPMC/681-840-------------------------------------WPLS.----------PGA.....VPMK..L....HAE.SG---
B5ECC6_GEOBB/807-954-------------------------------------.SEE.----------SKF.....ADVD..L....RGN.LE---
Q2IFA1_ANADE/358-509-------------------------------------.PGP.----------ETA.....CPLT..A....SLA.WN---
A4XYD1_PSEMY/140-291-------------------------------------.TLA.----------GDN.....ARMT..L....TAR.GP---
A7H8M2_ANADF/165-318-------------------------------------.TRG.----------GGD.....SPYA..F....AGT.TE---
A3QD21_SHELP/453-602-------------------------------------.ESL.----------SQP.....IDYQ..L....ALA.IN---
Q3A6W6_PELCD/588-738-------------------------------------.SAT.----------NPP.....LDIA..L....SGR.EK---
A7H8M2_ANADF/579-726-------------------------------------.SDP.----------RVR.....STVD..V....KLQ.VE---
A8ETY5_ARCB4/612-759-------------------------------------.NTK.----------LGK.....TNLE..I....NGV.VD---
Q30NX8_SULDN/772-919-------------------------------------.SAK.----------EEV.....SYVE..I....DGG.VD---
A4VPN2_PSEU5/125-276-------------------------------------.TRT.----------DGS.....ADAR..L....TAT.GA---
Q1LGA7_CUPMC/173-326-------------------------------------.NLP.----------HD......VTLN..T....APS.LF---
Q1H1L3_METFK/561-712-------------------------------------.LDT.----------KRA.....LPVS..L....AFR.AK---
Q222N5_RHOFT/710-857-------------------------------------.SNR.----------EAR.....SQIE..L....DGR.VD---
C1DFK3_AZOVD/584-731-------------------------------------.NRR.----------PKP.....ASVD..I....KGK.VD---
B2U875_RALPJ/869-1016-------------------------------------.TAAN----------QTP.....ADVT..L....RGS.VD---
B4EKU9_BURCJ/620-772-------------------------------------.DDL.----------TKP.....LPVQ..L....KAT.LN---
D0J281_COMT2/165-316-------------------------------------.NLAS----------KRE.....IKVLPHL....AFD.LN---
M1FB64_9ALTE/585-727-------------------------------------.NIP.----------PQQ.....GRVS..L....KGK.VN---
Q63NS2_BURPS/160-304-------------------------------------.TLP.----------SK......TDIF..V....EPK.LR---
Q7VVF7_BORPE/156-309-------------------------------------.TFG.----------YA......TDID..V....QPR.VH---
Q7VVF7_BORPE/538-685-------------------------------------..LD.----------AQP.....SPFT..L....KADGVQ---
Q87WR1_PSESM/155-306-------------------------------------.TLP.----------EDN.....ADMT..L....VAA.GP---
Q88DW4_PSEPK/140-291-------------------------------------.TLP.----------NDN.....ADMT..L....VAS.GP---
Q88DW4_PSEPK/581-725-------------------------------------.NRK.----------PQP.....AKVD..V....KGK.VD---
Q8EDF6_SHEON/666-811-------------------------------------.SKP.----------NTK.....ASVD..I....KGK.ID---
Q9HV64_PSEAE/476-627-------------------------------------.SLG.----------KTP.....FDLK..L....KTG.LG---
Q9HV64_PSEAE/692-837-------------------------------------.TRN.----------SQP.....AKVD..I....KGK.VD---

PF13116

C6XK02_HIRBI/457-744------------------------------------VKFLED..........LPPITEASGVGR--L----RGNSMK---
Q7NW94_CHRVO/514-796------------------------------------LSYQQG..........WPTIDDIDARLR--F----HNEGMQ---
Q7N037_PHOLL/501-786------------------------------------FQYQPN..........WPALLDFNIDLN--F----QNNGLW---
A4XQL3_PSEMY/513-798------------------------------------LAFQPD..........WPSLREGNGEVL--I----EDDAVR---
Q3J7T7_NITOC/517-810------------------------------------LNYARG..........WPVLERVAAHLH--S----DGQYMT---
D5CU11_SIDLE/524-805------------------------------------MEFAKG..........WPRIEDAQTDLL--I----EGNKLE---
A1AVR0_RUTMC/242-525------------------------------------LLFNTD..........WQSLKQLDANIA--I----DGRKIT---
Q31FH6_THICR/496-774------------------------------------LKFQPD..........WPALDDFSAKLK--F----TPYNLQ---
Q2NWP0_SODGM/504-789------------------------------------YEFEPG..........WPPLTQLDIDLD--F----VNDGLF---
B8GV04_THISH/540-825------------------------------------LDYQRG..........WPAIDALAGELI--F----TDRGMR---
A0RPG5_CAMFF/10-294------------------------------------IKFHEN..........ITPVKSNLAYAE--L----KNDSLF---
Q07WQ4_SHEFN/504-791------------------------------------FKFQPD..........WPAVSSLTLSAL--F----ENDMMD---
Q5ZUN8_LEGPH/507-795------------------------------------ILITPE..........WRLIKDLEGYIK--L----KNRNLD---
Q7VFV2_HELHP/222-511------------------------------------VYLAPH..........LKPIEATRAILY--M----RDEKLT---
Q12IX1_SHEDO/530-817------------------------------------YRFEPD..........WPVITELRLDAL--F----ENAAMD---
Q15ZG8_PSEA6/490-776------------------------------------FEFAED..........WPQLNDLNIDLL--F----ENKGLF---
A6Q385_NITSB/202-483------------------------------------IDFQKG..........IAPVVVKQIILD--Y----KSNNLY---
A8GK60_SERP5/523-808------------------------------------FQFQPD..........WPALTDLAIDLD--F----ANEGLW---
Q3IFH7_PSEHT/493-781------------------------------------YQFDPD..........WPAVTNASAQLH--F----ANERMD---
D9SHW3_GALCS/523-805------------------------------------MQFAPD..........WPKIENLSGEFQ--I----HNNKLQ---
Q21FT5_SACD2/542-827------------------------------------LKFDPE..........WPALEKINAHLF--V----DNADLT---
A7MJB2_CROS8/518-803------------------------------------YAFQPD..........WPALKDFAINLD--F----RNDGLW---
C6XD69_METGS/519-799------------------------------------LDYAPG..........WPKILGIKLDML--F----EGNRME---
A7I2E8_CAMHC/213-497------------------------------------VKFDKK..........LPAVMIGEANVS--L----RNQSLK---
Q6LMA6_PHOPR/509-794------------------------------------FSFDTA..........WPILTDLQLDLL--F----ENDFMY---
D0L1I5_HALNC/561-853------------------------------------LPFLPD..........WPALKDADGNIA--F----VNQQFH---
A3Q9Y2_SHELP/509-796------------------------------------YRFQPD..........WPEVTELSLNAL--F----ENAAMD---
A6QAC9_SULNB/206-494------------------------------------IHYKEG..........LPPVKSEKVVLN--Y----KQNSLF---
A8EUE5_ARCB4/193-478------------------------------------IRFHKD..........VDEIFTKSIDVT--Y----KDDNLH---
C5ZX33_9HELI/208-498------------------------------------VTFQKG..........LSPILSPNVKLI--F----QNNTLE---
Q1H0H5_METFK/520-800------------------------------------LRFSPE..........WPKIENIALDML--F----ESNRME---
Q7MRT1_WOLSU/187-475------------------------------------VTFHPD..........LPPLHGRGVSVI--Y----DERGVS---
Q47VG9_COLP3/504-793------------------------------------FKFVDN..........WPAITDFVANLN--F----TNNSML---
A4G3G0_HERAR/587-887------------------------------------LNYAPDMFGRDGKAPLWPLLENVKGTIL--F----DRTRME---
D1B1Z5_SULD5/203-493------------------------------------IIFEKS..........VPPAYAKEIGIT--L----TEDKLL---
D3V5J7_XENBS/502-797------------------------------------FQYQPD..........WPALFDFDIDLN--F----QNNGLW---
E6WGF8_PANSA/504-789------------------------------------YQFQPG..........WPAINNLDIDLD--F----VNDGLW---
D3VKA4_XENNA/501-791------------------------------------FQYQPD..........WPALFDLDIDLN--F----QNNGLR---
Q0ABM3_ALKEH/531-818------------------------------------LAYQPD..........WPRLTGAEAELD--F----RGRSMH---
A0KFB2_AERHH/486-771------------------------------------YEFFPG..........WQPLTDLQIDLL--F----QNASLD---
A6TER2_KLEP7/497-781------------------------------------FAFQPD..........WPALTGLNIDLN--F----INNGLW---
B4EX35_PROMH/501-782------------------------------------FKYDSE..........WPALFDLNVNLN--F----KNNGLW---
B7VIB8_VIBTL/505-791------------------------------------FSFDTA..........WPLITDLQLDLL--F----ENDAMY---
D3HJX5_LEGLN/559-845------------------------------------LAINSK..........WQVIKDIDGYIH--L----NKRNLN---
F0LWR2_VIBFN/505-791------------------------------------FSFDTA..........WPAITDMQLDLL--F----ENDAMY---
Q5E7X4_VIBF1/495-780------------------------------------FAFDTA..........WPPLTNLQLDLM--F----QNASMF---
Q6DAI1_PECAS/504-784------------------------------------FEFQPG..........WPALTPLDINLD--F----ANNGLW---
Q74PM2_YERPE/511-794------------------------------------FQFQPD..........WPALDNLAIDLN--F----LNEGLW---
Q7MHE2_VIBVY/508-794------------------------------------FSFDTA..........WPPITDLQLDLL--F----QNDAMY---
Q83BN5_COXBU/480-760------------------------------------LNYHSG..........WPALQNIKAKVM--F----HNNQLR---
Q8ZLP4_SALTY/504-786------------------------------------FAFQPD..........WPALKNLNIELD--F----LNDGLW---
Q9KUU5_VIBCH/504-791------------------------------------FAFDTA..........WPPITDLQLDLL--F----ENDAMY---

PF13109

A0RPG5_CAMFF/433-647----.---------------------G----F-TK---FKS-E-IK--V-S-NTY-LS--NY---KFYQQFLSFLDSI-P
A6Q385_NITSB/623-836----.---------------------V----.-GK---MRG-R-FS--V-Q-RAY-IK--NL---QAFNNLFAFINSV-P
A6QAC9_SULNB/640-854----.---------------------G----.-KL---MKG-E-IL--L-D-GGV-LK--SF---KAYSKTRDFIRKD-K
B9L5J2_NAUPA/583-798----.---------------------D----.-DF---YSG-K-IY--I-N-RAI-VR--EL---KSLNNVIAFINTI-P
C5ZX33_9HELI/638-852----P---------------------K----.-GA---LIG-K-LG--I-L-NTN-IN--QL---SILQNLMAFIDTI-P
D3UGW6_HELM1/730-943----.---------------------D----.-SI---FSG-E-LK--M-Q-NTL-FK--NF---VVLQNLISLIDTI-P
Q30RQ8_SULDN/697-907----.---------------------E----.-..---YSG-T-VN--I-V-DTT-IQ--DY---KILNNILAFVNTV-P
Q7MRT1_WOLSU/616-829----.---------------------G----.-GV---FKG-K-SF--I-W-DTT-LK--NL---NTLQNVIALIDSI-P
Q7VFV2_HELHP/731-944----.---------------------E----.-GI---LKG-E-IS--M-Q-NTI-YQ--DL---AIVQNVLALIDTI-P
O25308_HELPY/745-958----.---------------------D----.-QV---FNG-E-LK--F-Q-NTS-LK--NF---ALMQNMINLINTI-P
Q0PAY6_CAMJE/635-848----.---------------------G----L-EY---FDG-Q-ID--F-K-NTY-VK--DL---KGINQLISFIDTV-P

PF13502

A0KFB2_AERHH/999-1241....P.---------------.IGD.A.---P.GK...MAL-D-LS--W.R.DVP.YR..PN.V.PTLSGTADYQLEG-G
A1S2S6_SHEAM/1130-1371....G.---------------.IKD.S.---P.LD...ISA-E-LF--W.Q.GAP.HE..FD.L.GSLSGGLKFALGK-G
A1STZ9_PSYIN/1024-1262....M.---------------.I.Y.S.---K.AE...LSG-A-LN--W.I.GAP.WS..FN.L.DSLKGTFSAKLTD-G
A1TW53_ACIAC/1117-1369....V.---------------.LRR.G.---K.GR...MEG-Q-VA--W.M.GAP.LN..PD.Y.RSMAGQINVNVES-G
A1U479_MARHV/979-1225....M.---------------.T.N.E.---E.TA...VEL-D-LD--W.P.GSP.NN..IA.L.SKISGTVSARLDD-G
A1WCZ7_ACISJ/1139-1390....V.---------------.VRH.G.---K.GR...IGG-Q-VG--W.L.GSP.LS..PD.Y.RTMSGQMNVNVEA-G
A1WSB5_VEREI/1101-1362....V.---------------.VRH.G.---K.GL...LQG-R-VA--W.L.GAP.FN..PD.Y.RSMTGQTHLNIES-G
A1WYY8_HALHL/891-1129....A.---------------.V.TVA.---D.VD...ISA-E-LG--W.P.QAP.WG..VE.L.ADLVGAVRVRMND-G
A2U2U5_9FLAO/567-793PIANT.---------------.I.G.G.---K.MN...SKV-N-VS--G.V.LDENMA..PS.L.KTITGNLFGKLIN-P
A3HUH0_9BACT/675-900....N.---------------.L.T.G.---T.FN...SNL-N-FS--GVL.GQD.MM..PL.L.ASLDGNGLLKVAE-T
A3Q9Y2_SHELP/1046-1289....G.---------------.LKE.A.---P.LD...LQA-E-LS--W.Q.GAP.YA..FS.L.ETLNGQISYKLGK-G
E0TB83_PARBH/837-1047....S.---------------.V.W.GA---A.AA...FEA-T-LP--A.E.GGL.YG..EF.R....TGDLILRRAP-T
A4AMF6_MARSH/560-785PVASA.---------------.L.Q.G.---R.MN...SDI-E-LS--G.S.LKD.DF.TPD.L.KTITGKVLAELLS-P
A4CG41_ROBBH/574-799PIASI.---------------.V.E.G.---K.LN...SRV-Q-LS--G.L.LNSDFS..PD.L.MSLAGNVVAEVLA-S
A4VIB7_PSEU5/1014-1255....V.---------------.T.S.E.---S.FR...LDA-D-GR--W.P.GSP.AW..FA.M.ARYSGSMQPRLRK-G
A5CF63_ORITB/620-836....SF---------------LP.K.G.---F.AS...MQG-T-IT--T.N.GEN.LA..DI.M.NNFNVTAKFVAKD-V
A5FJ68_FLAJ1/564-791PIAGI.---------------.I.N.G.---K.LN...STI-K-LN--G.N.LDA.KELTPD.L.KSISGDLLGQLLS-T
A5FUN1_ACICJ/745-973..LPL.---------------.S.G.G.---T.VD...LGA-N-LM--A.Q.GDS.GR..AW.Q.RSLAGSLTASSHG-I
A6GWN8_FLAPJ/560-787PIAGI.---------------.I.N.G.---K.LN...SNI-K-LS--G.N.LNA.IEMTPD.L.NTISGDLLGQLLS-T
A7HEC2_ANADF/581-801....V.---------------.I.G.G.---T.LD...AVL-K-LG--G.T.GWN.AG..LL.T.KSVTGGVDGTLRN-G
A9CIC7_AGRFC/884-1105....V.---------------.A.T.G.---R.VA...IDL-T-AE--S.T.GKS.VG..EM.L.KSAGGSGEVRASG-L
A9H3V6_GLUDA/474-684....V.---------------.L.Q.G.---V.FDDRQPSA-P-FA--G.V.LTI.DP..MT.L.HKAPGAVRLA.ND-A
B2FP42_STRMK/1008-1250....L.---------------.R.G.G.---S.GQ...AQL-Q-AS--W.S.GGP.SD..FQ.L.ANLQGSLDLHARN-G
B4S7D6_PROA2/551-781....Y.---------------.A.T.G.---D.VS...ANL-D-LR--M.A.LDE.AF.NPL.L.ETLNGSGRITTRG-L
B7VIB8_VIBTL/1027-1268....G.---------------.IQK.A.---P.FE...LEG-Q-LT--W.D.GSP.WG..IK.M.DTLDGNVKTQFGK-G
C1D9M5_LARHH/1015-1258....L.---------------.VRG.G.---K.FR...STG-Q-LE--W.Q.GGM.TS..IQ.W.PSLSGEITLSAES-G
C3L4A9_AMOA5/534-754....H.---------------.L.G.G.---H.VC...SDI-E-LT--I.Q.TDK.QL..HIDV.NSLKADIAVQLHN-G
C4L8L8_TOLAT/989-1232....G.---------------.L.T.GT---K.SQ...LDI-D-VS--W.P.GAL.VQ..PR.L.SALDGQIRMETGE-G
E8RSC3_ASTEC/1136-1358....D.---------------.L.V.A.---T.AL...GDK-R-LS--G.G.DAV.IE..GV.Y.RNGQIDATLKGED-I
D9SHW3_GALCS/1021-1263....T.---------------.VKN.G.---S.GK...MIA-N-LS--W.D.GQP.FD..FN.Y.ASLDGTLKLDTGQ-G
D5CU11_SIDLE/1024-1263....S.---------------.LKD.G.---S.GS...LQS-D-LH--W.A.GAP.DT..FA.Y.SKLNGEIHLNVGK-G
C6WWM2_METML/1053-1294....T.---------------IM.E.G.---E.GK...LTG-Q-LR--W.P.GSP.HQ..FD.T.TRLSGELKFEVRK-G
C6XD69_METGS/1043-1284....T.---------------.VKG.G.---E.AD...LTG-Q-LK--W.P.GSP.HE..FN.S.AGLSGNLQLDARH-G
C6XK02_HIRBI/884-1092....Y.---------------LI.G.G.---T.LN...MNG-V-FG--K.E.FGT.AE..MF.M.KDIRLKGAPILAQ-V
C7PC84_CHIPD/564-796PVAKF.---------------.L.N.G.---K.IN...SHL-E-LT--G.KLGQD.MM..PL.L.SSLTGDGNLLVLE-G
E6WGF8_PANSA/1014-1257....P.---------------.LRD.A.---P.FK...IDY-D-LH--W.R.SAP.WQ..PS.E.PTLSGTLKSHFGK-G
D2UF54_XANAP/1023-1265....L.---------------.R.G.G.---E.GR...LNL-R-AA--W.P.GNP.DA..VQ.L.PILQGQLDVAVRN-G
D3SBX9_THISK/1040-1287....L.---------------.V.G.G.---E.GE...GRL-D-LS--W.P.GPL.YA..PR.L.ALLGGTMELELED-G
Q0ABM3_ALKEH/1048-1290....V.---------------.S.R.G.---R.TE...IDN-D-VA--W.D.NLP.HR..FT.L.AEMEGAVSLRIDD-G
Q0AQ38_MARMM/879-1092....Y.---------------.A.R.GG---Q.VS...VLG-S-.A--P.P.LGT.DG..PL........TARVEIRD-L
Q11YL6_CYTH3/532-755....N.---------------.L.K.G.---D.IS...ADV-S-LL--M.Q.VDN.HL..AI.LPSSIICDADVTVQN-G
Q11YT8_CYTH3/698-925PIANY.---------------.V.E.G.---N.VN...LAL-V-MN--G.L.LDK.EM.MPI.Y.STLNGKGSLGSSS-L
Q145G0_BURXL/1154-1409....T.---------------.LKA.G.---A.GS...LSG-K-MV--W.Q.GGP.TR..ID.Y.PTLNGNLAVDLRH-G
Q15ZG8_PSEA6/1002-1243....I.---------------.K.D.S.---K.AS...AKF-N-LD--W.Q.RAP.FE..FD.F.ATLNGDIDWRLSD-G
Q211X0_RHOPB/871-1087......---------------...A.G.---K.TS...LQM-T-LS--S.Q.GRS.GS..AL.A.SALTGSGLLTIDT-A
Q28TM9_JANSC/371-572....R.---------------.L.Q.G.---T.GS...ASV-E-FL--G.V.GND.LH..TI.M.DGLEAEGDIALGQ-G
Q2KY05_BORA1/936-1183....V.---------------.MSG.G.---S.GS...VEA-N-LS--W.R.NLP.WT..HS.L.VDISGHASLSLEK-G
Q2NWP0_SODGM/1012-1255....P.---------------.LRE.A.---P.FH...LNY-D-LH--W.R.EAP.WQ..PD.I.ASLNGVLHSQLGK-G
Q3IFH7_PSEHT/1008-1245....A.---------------.IKD.S.---N.AT...INY-N-LA--W.Q.AAP.YN..LD.V.ASLSGNIDWRLGE-G
Q47VG9_COLP3/1038-1280....I.---------------.I.K.D.---SGAK...IDV-N-LN--W.E.GGL.HD..FM.L.SHLNGTVNGRLDD-G
Q5R0H7_IDILO/1003-1244....A.---------------.V.R.DS---A.AV...IDF-N-LN--W.R.DHL.YQ..PD.W.SSLSGEVVWDLEK-G
Q7MHE2_VIBVY/1031-1272....G.---------------.IQK.A.---P.FE...ITS-Q-VT--W.D.GTP.WS..MR.V.NTLDGDVQTEFGK-G
Q7UYB4_RHOBA/752-985....S.---------------.LAS.G.---E.IS...GEI-S-..--L.R.GKS.IQ..SI...DDLFGRFDFKLGD-T
Q8EA16_SHEON/1025-1268....G.---------------.VDE.A.---P.LK...VNA-D-LA--W.Q.GAP.YA..FS.L.ETLNGKVKFELGK-G
Q9ZDH9_RICPR/624-849....W.---------------.S.G.G.---K.VS...ISG-S-LW--T.N.GNS.LQ..SQ.L.YNLSTKSQFVINN-I
A8GK60_SERP5/1034-1277....P.---------------.L.K.GA---P.YD...IDF-D-LY--W.R.GTP.WK..PQ.M.STLSGAMKVNMGK-G
C5BC15_EDWI9/1004-1246....P.---------------.LKQ.S.---A.FK...GDY-D-LR--W.Q.GEP.WQ..PH.I.ETLDGTLRVRLGK-G
D3HJX5_LEGLN/1065-1312....A.---------------.VHA.K.---K.GY...MEF-H-GG--W.K.NRI.YN..FS.L.AALNGEMYLQLKN-G
E0SHA8_DICD3/1031-1273....P.---------------.LRA.G.---A.FK...IDY-D-LY--W.H.GSP.WA..PH.I.PSLSGILKTDIGK-G
F4AYZ2_DOKS4/566-791PIAKA.---------------.L.Q.G.---A.LN...TKI-Q-LQ--G.Q.LDDNFS..PI.L.STISGDAFAEILT-A
G2J3B5_PSEUL/1018-1258....T.---------------.FRK.G.---E.GT...LGG-K-LH--W.P.GGL.TD..YE.L.PRVSGEMTVDFRN-G
M1FEQ6_9ALTE/970-1216....P.---------------.LEN.L.---A.TN...IEL-A-LE--W.P.GRP.DQ..FG.L.KQLSGDISMTLED-G
N0B6U7_9RHIZ/961-1176....N.---------------.MQG.G.---R.MR...LEV-N-LD--G.T.GPA.EK............TGILWVED-F
Q0KCK4_CUPNH/1119-1370....T.---------------.LSD.G.---K.GK...LEG-R-VA--W.R.GSP.LS..ID.Y.PTLSGKLSLDLEN-G
Q0VS66_ALCBS/1022-1263....M.---------------.IES.E.---D.AT...AKV-S-LG--W.A.QWP.LA..PN.Y.LALNGQARVDIGE-C
Q2K6G4_RHIEC/885-1104....V.---------------.A.N.G.---K.FG...LSL-S-ME--A.S.GKT.IN..EI.A.SSLNGSGELRLGD-T
Q32B94_SHIDS/1009-1252....P.---------------.IRQ.S.---S.FN...VDY-D-LH--W.R.KAP.WQ..PD.E.ATLNGIIHTQLGK-G
Q5ZUN8_LEGPH/1014-1261....A.---------------.VDA.G.---K.GY...IEF-H-GG--W.Q.GSL.YD..FS.L.SKLNGSMYLQLKN-G
Q63R38_BURPS/1120-1377....T.---------------.VEN.G.---R.GT...LSG-K-VA--W.R.GGP.TA..ID.Y.PTLNGRLSLDLAH-G
Q6LMA6_PHOPR/1035-1276....G.---------------.IQD.A.---S.FS...SYA-S-IQ--W.Q.GSP.WS..IH.R.ETLTGEIKTETGK-G
Q8P7K3_XANCP/1032-1273....Q.---------------.LRG.G.---E.GQ...LEL-N-AG--W.Q.GSP.TG..FA.L.GSLEGNLTVDARN-G
Q9KUU5_VIBCH/1028-1269....G.---------------.IQR.A.---P.FE...ITA-S-TQ--W.D.GAP.WS..MQ.V.NTLQGKVDTKLGK-G
Q9PEA2_XYLFA/983-1225....Q.---------------.LRG.G.---E.GQ...IQL-S-AG--W.N.GPP.VG..FQ.L.ASLSGDLKVTARN-G

PF05170

Q87TE2_VIBPA/1-570A.TAKV---------------SLQA.D----SVRF---QEQ-T-AI--E-P-RLN-AIFTPE---NIQLQELSLDWQQ-G
Q9KNJ9_VIBCH/1-570QQQAYL---------------SLNA.D----SAQW---LAT-Q-WV--E-P-SAE-LTLTPQ---GIELDGHSQVWQ.-G
Q9HU38_PSEAE/1-636SIAP..---------------......----..MN---LRE-F-LA--G-I-GVT-LPAMAD---ANTLGKFELNTRL-A
Q9KT66_VIBCH/1-595SLMVNQ---------------AISK.V----GLDA---LKL-Q-AE--L-E-GAA-LPQSPM---KLSLDS.QIAFDL-T
Q9JY87_NEIMB/8-615IETVNG---------------AFTAGG----EYAR---WDG-S-FK--L-D-KAN-LHSGIA---NIGNAEISGSFKT-P
Q9ZDI1_RICPR/1-711PILDAL---------------KLKT.D----ELPP---IIN-Q-KL--I-L-TTN-VIRDPQ---AIKLQNINLSATN-S
Q9HUT4_PSEAE/1-577......---------------......----..TS---MAN-L-YP--L-T-GIT-LPDTPA---YSTDGHLLARLKE-E
YHJG_ECOLI/1-582......---------------......----..DS---LGD-L-YE--L-T-GVL-LPDTPP---FETDGRLVAKIDT-E
Q7MQ04_VIBVY/1-571QQQGLI---------------SFSA.E----SVQD---QHN-V-WV--E-P-RIK-FTLDPN---AINVEEASAQWQQ-G

PF04357

A2U1I0_9FLAO/1175-1633..TVVI...............DEDTGDN---FNVS---GDG.E-FI--F..NMVP-.N--GR---LSLTGTFEIA.S.-G
Q83EW1_COXBU/570-928D.QILL...............DSLG...---AKGR---LAG.E-LT--L..LKPP-.N--QV---MTANGRITII.D.-G
Q1D0C2_MYXXD/935-1291..DVRV...............DNNL...---AKAR---LLG.D-VR--L..TGT.-.D--LR---PGLLGRVELA.E.-G
A5FB26_FLAJ1/992-1420..EVIL...............DRNSGHG---MKGK---GYG.S-LL--F..KINT-.L--GK---FNMWGDFQAY.E.-G
Q8YZJ8_NOSS1/1412-1829D.DVRVTSQSLLGFLPGGEVFSQPI...---LSFD---AEG.D-LI--I..NGTL-.A--S.---PLPEGVIRLT.G.-G
A4CK93_ROBBH/998-1431..EIVV...............DPQTGSS---LKGT---GAG.L-IF--M..EINT-.N--GK---FNMWGDFVVV.T.-G
A3U6I2_CROAH/1185-1647..NVII...............DEQTGDN---LRIQ---GDA.D-LK--F..NIYP-.N--GR---TTLTGRYTVN.D.-G
A0LGH5_SYNFM/889-1254S.GMAV...............RGKG...---LNAQ---IVG.S-LK--I..EKSV-.N--GP---VRLVGGLQTT.R.-G
A3HZ37_9BACT/1160-1620..TVII...............DPKTGDN---LLVS---GSA.N-LQ--M..DINP-.N--GR---ITLSGGYEIT.E.-G
A5GSG8_SYNR3/973-1387P.QLRI..............AAPPV...---AEFL---TGG.L-LT--F..NGPA-GP--D.---VRISGVVKLL.K.-G
A6L590_BACV8/1012-1461..KIIM...............DPVAGDN---ITAT---GNG.N-LQ--V..NFFN-.K--GD---FRMFGSYVID.Q.-G
A0M1P1_GRAFK/1180-1639..SIII...............NEETGDK---FQVQ---GEG.D-LI--F..NMYP-.N--GR---MALTGIYNVN.D.-G
Q2S2D2_SALRD/1057-1516..NLVF...............DPLVGDV---VTVV---GSG.R-VQ--L..QRE.-.E--GD---FSVYGSFDAT.S.-G
Q21Y28_RHOFT/928-1291P.DFQV...............RGRG...---LATR---LEG.S-LE--LRSAGR.-.S--LT---PSLTGSLRTV.R.-G
Q6MKB2_BDEBA/958-1321R.NIVI...............KNSL...---IDGS---VTG.Q-LQ--V..KGP.-.P--TN---PVLLGKISME.RR-S
Q39RU7_GEOMG/1016-1376D.RVIV...............KTEG...---IDAQ---LGG.S-VD--L..AILG-.P--DR---VTSTGAIRVI.K.-G
Q7VBL9_PROMA/867-1309P.DLRI..............VSQPI...---ASFD---AAG.T-LI--L..DGAL-DD--T.---LDLRGLIRLR.K.-G
A5FIP0_FLAJ1/1183-1626..TLLI...............DKANGDY---LNLK---GEA.E-LV--G..GIDQ-.S--GK---TTLTGKYEFS.D.-G
Q8KFW2_CHLTE/1034-1479A.PVKGTMI........FDRIRGER...---VEAQ---MNNLS-LV--V..NKT.-.G--QR---FSLFGSIDIT.G.-G
A6H009_FLAPJ/1018-1446..EVII...............DKNSGHS---LKGR---GAG.T-LA--L..EINT-.L--GK---FKMNGDFQVY.E.-G
B5E9K2_GEOBB/1121-1484D.KVRV...............EASG...---IDAR---LVG.D-MD--L..VLKG-.I--DN---IESSGEIRVV.Q.-G
Q11I59_CHESB/1185-1538A.RIFV...............RGRG...---LDAE---LGG.S-VQ--V..TGPV-.T--SV---Q.PVGGFRLI.R.-G
Q11VR9_CYTH3/1167-1624..KILV...............DPISGDS---LSVR---GDA.D-LN--F..KMDA-.S--GQ---TNLTGTYVVN.D.-G
A7HQ23_PARL1/1042-1395NPPARV...............TGRG...---INSL---WTG.S-VT--L..TGLA-.E--DP---T.VNGRIVSE.R.-G
Q7MT86_PORGI/1036-1486..DLIL...............DPQTGDG---LRGS---AGG.D-LR--I..DYHT-.L--GD---LNVFGGLELL.S.-G
Q3AQ57_CHLCH/1053-1500M.PLKYTTI........FDRIRGEE...---LETT---LSNLS-LV--V..NKN.-.S--QR---YRMFGSVQVT.S.-G
A1BDC7_CHLPD/1048-1494E.QLKFRVI........FDRTRGEE...---LEAA---ISGMQ-LM--V..NKS.-.Q--QR---YRLFGSVALS.D.-G
Q6MAC5_PARUW/935-1288G.NVSI...............EGNN...---LSSE---WKG.A-IT--I..TGTA-.N--NP---L.LNGDLSVI.N.-G
Q1QWE2_CHRSD/954-1312P.DISL...............EAYG...---LESQ---LEG.E-LE--V..RQG.-.N--GP---VQLFGDVRLV.D.-G
Q2RSJ7_RHORT/1146-1500R.RVYV...............RGRG...---VDSE---WEG.K-LN--V..GGTA-.A--AP---K.VVGTITTL.R.-G
Q2S346_SALRD/1311-1689S.NTWL...............RSSSNPE---MNVQ---FTG.D-LD--V..QKAA-.L--ED---PQVFGTIDVVERR-S
Q2INP6_ANADE/946-1304G.DARI...............ENDL...---VRGT---VTG.D-LT--L..TGT.-.L--AS---PGLVGSLTMG.Q.-G
Q9RUC9_DEIRA/223-627G.GIRL...............DENL...---ARAE---FSTPG-LV--V..SGT.-.A--AR---PQVRGQIVSQ.R.-G
Q1LSN0_BAUCH/634-981N.DVQI...............NAFG...---LTAN---LLG.N-LQ--I..TKSK-.N--RP---LSMNGEIKIP.Y.-G
B3ELK5_CHLPB/1036-1483V.PLQYSMI........FDRTRGEK...---LEAT---LQNLS-LN--V..NKN.-.Q--QN---YRLFGAVNIS.S.-G
Q8YUC2_NOSS1/1659-2048K.NVEI..............ARPPL...---LSFA---ATG.N-LK--V..NGSL-.A--D.---PVPVGTIRLR.K.-G
Q1MQI4_LAWIP/1025-1382N.RFFV...............RSSM...---FESE---WGG.N-LT--I..NKVI-.T--SP---V.ITGALTSI.R.-G
Q7VQN5_BLOFL/933-1286S.DVNF...............NGFG...---LDVK---LKG.D-LE--I..SYD.-.E--NN---LNITGQIQIP.S.-G
Q31MA1_SYNE7/1177-1568E.GVSV..............QSEPL...---FRFG---ATG.D-LT--L..DGPL-GS--T.---LSPNGKLTLT.S.-G
B4E8E1_BURCJ/988-1340N.NFRF...............KGHG...---ADLG---LRG.T-IT--V..MSAP-.G--VP---LRAVGNVRVT.E.-G
E3G0N9_STIAD/1177-1560R.NLWV...............RGAD...---VNVE---IGM.P-LN--D..FYVA-YR--HE---AEIFGTVRVL.R.-G
F4B3D6_DOKS4/1021-1426..EVVVD............KANGST...---LRGR---GVG.T-LL--I..QLDT-.N--GK---FIMNGDFIAT.E.-G
Q46LW1_PROMT/887-1319P.SLRL..............VSQPL...---ASFE---TNG.F-LI--L..NGAF-.D--ET---LDVSGVIKLD.S.-G
TAMB_HAEIN/952-1298K.DVSL...............DAYG...---LKTN---LDG.L-LS--V..KQD.-.K--GN---LGLFGQINLT.K.-G
Q5NNB3_ZYMMO/1036-1389D.QLFV...............AGMG...---LESE---WEA.D-LR--V..RGT.-.A--TA---PNITGDMRVI.R.-G

PF05359

Q4K5X6_PSEF5/140-291--------------------------EG...GQID---WSG-N-FS..V-------TP..LT---SE..GTLKVT...-D
Q4K5X6_PSEF5/360-511--------------------------KQ...GKVN---ATG-E-VN..L-------NP..VS---AK..LKVQTR...-D
B2JQ93_PARP8/874-1021--------------------------AN...GPIT---IRG-S-VN..P-------LI..PK---PALDLTATAH...-G
A0RMT1_CAMFF/653-798--------------------------NY...GFSE---ILV-T-TL..P-------FD..PR---SNTDLIVRFK...-N
Q72DG8_DESVH/963-1109--------------------------G....VPVK---LTG-T-LN..P-------VS..TP---PFADIVFSME...-G
A9BMN7_DELAS/883-1036--------------------------GT...ASLE---ITG-Q-VN..P-------LA..KP---LALDIRAQMR...-D
Q2LUD1_SYNAS/534-687--------------------------PR...GNVD---VTG-P-VI..M-------AP.RMS---VR..LQVKAD...-G
A8ZWF7_DESOH/636-783--------------------------GY...APVR---ITG-A-IN..P-------LG..TD---LFMDLDVKLS...-N
Q3A6W6_PELCD/375-529--------------------------RT...AHLS---LQG-T-LL..P-------DP..LQ---GD..LLLQLD...-G
Q5NYY7_AROAE/382-536--------------------------AG...EKSS---HRD-R-LR..L-------NP..FE---LE..GRVVAE...-N
Q2KWF8_BORA1/759-906--------------------------TT...APFS---ISG-T-VQ..P-------FA..QY---LALDLKASAK...-G
Q484B1_COLP3/382-534--------------------------TQ...GIIN---LKG-T-IK..P-------ES..KQ---LS..LALDTE...-Q
A2SI01_METPP/870-1017--------------------------GA...APLE---IGG-T-MH..P-------LG..PR---LATDITASAR...-G
Q8Y0Z7_RALSO/615-766--------------------------SK...GKLD---VRG-N-VV..P-------QP..LK---AE..LRVNAQ...-N
Q5QWM2_IDILO/380-527--------------------------EY...GLAQ---VNG-T-VH..A-------WH..PT---RQTTINVRFR...-N
Q0VP61_ALCBS/592-737--------------------------RY...APFS---VKG-R-LS...-------.S..EP---FSTDMQVSLH...-N
A3QD21_SHELP/699-846--------------------------RY...APVV---LKG-E-IN..P-------LL..EQ---PYLDLDLSFK...-H
Q63NS2_BURPS/645-797--------------------------RK...GSLE---LSG-N-VT..A-------QP..LK---VG..LKLNGN...-R
Q47FN3_DECAR/732-879--------------------------NS...APVQ---ILA-K-LN..P-------LA..AK---TYLDLKADIT...-G
A0KK00_AERHH/368-522--------------------------NQ...AKLD---FDG-D-FV..L-------AP..FS---LN..GEIKQQ...-G
Q0JZH1_CUPNH/670-829--------------------------RR...GVIG---VDG-T-VL..P-------TV..PA---SR..LQLDLR...-E
Q2LUD1_SYNAS/785-932--------------------------NS...APVE---ILG-K-IN..P-------LS..GN---LFLDLAASAK...-G
A1ARF1_PELPD/790-937--------------------------NR...SPLQ---ITG-T-IN..P-------LR..DD---LFVDLTISFK...-D
Q39RS7_GEOMG/568-719--------------------------KG...GALA---ASG-R-VT..P-------VP..LA---AK..GEITLR...-R
B9M3X2_GEODF/795-942--------------------------KH...SPLQ---ITG-K-IN..P-------LS..RE---LFADLKVRFT...-D
Q8Y0Z7_RALSO/185-339--------------------------ARIDGAPLH---FAG-K-TKPFA-------QS..LE---SS..LNIKLD...-G
Q3JBN6_NITOC/584-731--------------------------SY...GEMS---MTG-K-SN..L-------FA..LE---RATEFSAFAR...-N
Q5DZ89_VIBF1/399-549--------------------------SK...GDIS---VKG-Q-AD..A-------KQ..QA---VM..ADIDVK...-S
Q1QTZ9_CHRSD/145-295--------------------------WR..GGTLK---GTG-E-MG..F-------SP..WT---LD..IDLDAD...-Q
A9BMN7_DELAS/165-317--------------------------FALNGSRFE---SSA-Q-STPFT-------EQ..RQ---TA..VDLSLQ...-G
A9BMN7_DELAS/379-538--------------------------KP...AELQ---LSG-A-L....-------....TD---KQ..GQLAISARQ-.
Q87WR1_PSESM/386-537--------------------------KQ...GNLT---ATG-D-VN..L-------NP..VS---AR..LNVTTR...-D
B2JQ93_PARP8/616-770--------------------------GK...GTLG---VKG-D-VT..A-------TP..LK---LA..LKVDAN...-R
A1K6C3_AZOSB/734-881--------------------------PH...GEAR---AEG-R-IR..P-------FA..PD---ELTDLEVRFD...-N
Q603H4_METCA/718-865--------------------------RY...GAVD---VYG-Q-LS..P-------LA..PK---HFGDVSVAFR...-N
Q47VC1_COLP3/500-655--------------------------KY...ANFN---LTG-Y-LQ..P-------FS.KLA---TY.HIEGDFK...-E
Q15PY6_PSEA6/662-809--------------------------GY...APVA---LNG-A-IN..P-------LL..ED---MFLDLNFSVS...-G
Q88DW4_PSEPK/365-516--------------------------KQ...GKLQ---AAG-Q-VN..L-------AP..IW---AK..LDVSTR...-D
A0KK00_AERHH/578-725--------------------------RY...APVT---IRG-G-TN..L-------LI..EQ---PVLDVAVTFN...-N
B5ECC6_GEOBB/569-721--------------------------KG...AGLK---ARG-T-LT..P-------AP..FR---YQ..GMMSVA...-R
Q2LUD1_SYNAS/159-313--------------------------AVVNGAPFH---LTG-K-SKPFD-------AD..RE---AS..LNLKLN...-R
A4VPN2_PSEU5/551-698--------------------------QY...APVS---IKG-S-LT..P-------FD..PL---QSLDIATSFR...-Q
Q0VP61_ALCBS/382-530--------------------------EQ...GSLT---HSG-E-GQ..L-------AP..LS---IS..AKGALT...-A
A1K7K6_AZOSB/583-736--------------------------RA...GRLG---IEG-S-LA..L-------EP..LK---GN..LELDLR...-D
Q3JBN6_NITOC/369-521--------------------------KQ...GQLL---ARG-H-VT..A-------LP..PS---AD..LEIHLE...-S
Q5NYY7_AROAE/832-979--------------------------DT...APVT---ISG-E-FN..P-------FR..ED---RYLDIAASVK...-D
Q13S79_BURXL/640-791--------------------------RK...GTLG---VKG-D-VT..A-------TP..LK---VA..VKVNAN...-R
Q47FN3_DECAR/504-656--------------------------KK...GSLN---VDG-S-LQ..V-------YP..LD---AQ..LKVETV...-A
Q316X0_DESAG/862-1008--------------------------G....VPLT---LQG-A-LN..P-------LV..SP---PYSDLALRIA...-N
Q602F3_METCA/416-565--------------------------RK...GRIS---VQG-S-GS..F-------DP..PE---AE..LRLQVE...-N
Q2Y5K5_NITMU/673-818--------------------------KT...APLK---ISG-S-VD..A-------FG..RE---LNLDITASAK...-G
B3E4B8_GEOLS/816-963--------------------------NH...SPLQ---ITG-T-VN..P-------LR..DD---LFVDLTISFK...-D
A4VPN2_PSEU5/341-492--------------------------RQ...GALQ---AQG-P-LQ..L-------NP..IS---GQ..LAVTTR...-D
Q5NYY7_AROAE/153-307--------------------------GR....PLQ---VTG-Q-S.RPF-------AP.DRE---TA..LGIDLD...-G
Q30NX8_SULDN/563-715--------------------------SN...GSIS---SNG-S-IK..H-------TP..LE---QK..GEFEFK...-N
C1DFK3_AZOVD/367-518--------------------------RQ...GRLK---AAG-Q-VQ..L-------SP..LA---AQ..LQVGSS...-D
Q484B1_COLP3/604-751--------------------------KY...APVI---IKG-S-VN..P-------LS..HD---AFTDIDMLFN...-G
Q5NYY7_AROAE/604-757--------------------------KR...GRAA---VSG-T-IA..L-------DP..LK---GN..LRVDLR...-S
Q602F3_METCA/623-770--------------------------DT...SPVT---ISG-R-IN..P-------FL..FG---TFADLSIRFK...-N
Q316X0_DESAG/389-538--------------------------GA...GTAA---LKG-T-LG..L-------NP..LS---GE..IQASLN...-N
A5G9K9_GEOUR/137-293--------------------------AVVNGAPLH---VEG-K-LRPFP-------KA..VE---AS..ATVDLK...-D
B2JHK1_PARP8/152-309--------------------------GPSHTGRVT---FDG-W-MT..I-------AS..KD---SK..TTTTLK...-G
A5G9K9_GEOUR/551-702--------------------------QG...GSLR---ASG-S-VT..P-------IP..LK---LR..GEVAVQ...-R
A0KK00_AERHH/151-307--------------------------QQ...SPLK---ASG-E-LD..I-------MS..GA---GK..GKISLG...-K
Q1H1L3_METFK/780-927--------------------------DY...GSAR---IRG-S-VQ..P-------FQ..AT---EFTDLKLVFR...-N
B9M7L7_GEODF/383-534--------------------------KG...GSLK---ASG-N-FT..P-------AP..LK---IK..GEMAVQ...-R
A4SXW3_POLSQ/414-561--------------------------NS...GSMR---AKG-Q-AS..F-------DD..PR---RNHDILMTFR...-N
B9M3X2_GEODF/564-715--------------------------GG...AKLS---AKG-N-IT..R-------EP..LR---YN..GAVQVK...-N
A4G9D7_HERAR/154-308--------------------------ASINGSPLL---IKG-K-THPFA-------DT..VD---AV..VDLNLD...-N
Q21F55_SACD2/584-731--------------------------EY...GLMR---ANG-Y-LS..A-------MD..PT---KNSDIKLVFR...-N
Q7NY28_CHRVO/704-851--------------------------QY...GEVK---VRG-A-LS..P-------MS..PT---DSTDILLDFH...-N
Q0JZH1_CUPNH/164-317--------------------------ARVNGTPLA---LDG-E-VLPFA-------DS..RQ---TR..LNVNLD...-G
A1TWZ4_MARHV/597-744--------------------------GV...APVR---FDG-T-LG..A-------LG..TE---EPSNLKLTMK...-D
B3E4B8_GEOLS/367-514--------------------------SA...ETFA---ASG-T-AS..L-------SP..IS---AT..SRFNLS...-G
Q2IFA1_ANADE/563-710--------------------------GA...SPVR---VTG-T-LN..P-------LQ..QD---AYTELVVASE...-G
Q1QTZ9_CHRSD/348-494--------------------------EG...SPLR---IDG-T-FD..P-------LG..DA---LNGNLNLHFE...-H
Q11NN1_CYTH3/142-298--------------------------GG...GNLS---ILG-Q-VN..L-------LK..QV---PDADINMKFT...-D
Q9HV64_PSEAE/140-291--------------------------NG...GRLD---WEG-D-LT..L-------VP..IT---SR..GHLSVK...-D
Q3SGZ4_THIDA/733-880--------------------------DY...GSAR---VRG-V-IQ..P-------FR..AT---DFTDLTLSFR...-N
Q3A6W6_PELCD/162-316--------------------------NG...RPLR---VDG-R-LAPFA-------EQ..LH---TE..FDIRLD...-N
Q316X0_DESAG/600-751--------------------------PH...GRLA---AEG-S-LT..R-------DP..LR---AD..VRSSTR...-N
A1TWZ4_MARHV/166-321--------------------------EQ....VIE---WEG-D-LS..V-------TP..LY---SA..GRLRLS...-G
B9M7L7_GEODF/592-739--------------------------NQ...SPLR---ITG-Q-IN..P-------LR..SD---LFVDLRVNFT...-G
Q222N5_RHOFT/496-646--------------------------EG...GQFT---AQG-S-VV..P-------AN..GE---VQ..ADVRLK...-Q
Q3A6W6_PELCD/805-951--------------------------D....APIQ---GEG-S-IN..P-------LR..AD---AATELQAQLK...-T
A5G9K9_GEOUR/769-916--------------------------NQ...SPLR---ITG-Q-IN..P-------LR..DD---LYADLKASFT...-D
A2SI01_METPP/623-775--------------------------HG...GRLR---ASG-T-AR..P-------QP..LA---LR..SKIDLD...-S
Q083W9_SHEFN/492-642--------------------------QQ...SLLT---STG-Q-VD..A-------LA..QT---VN..AEIDFS...-N
Q083W9_SHEFN/725-872--------------------------KY...APVT---LKG-D-VN..P-------LL..AQ---PYLDLNLNFD...-K
Q12MK5_SHEDO/654-801--------------------------KY...APVV---LKG-K-VN..P-------FA..NK---PFLDVDLSFK...-R
Q3SGZ4_THIDA/517-669--------------------------QG...GRVA---ASG-T-VI..P-------AA..GS---GR..IDVRLS...-G
A1ARF1_PELPD/573-725--------------------------TN...SPIR---VRG-S-IT..P-------LP..FR---FR..GTVRVG...-R
Q39RS7_GEOMG/801-948--------------------------NL...SPLQ---ITG-K-LN..P-------LR..DD---LYADITVRFA...-D
Q603H4_METCA/502-653--------------------------QG...GEFK---ASG-S-LS..Q-------SL..DQ---AE..GTVRLG...-R
Q222N5_RHOFT/149-300--------------------------RG...GKMR---WKG-T-AS..V-------NP..IR---AS..GEVTLE...-N
A8ZWF7_DESOH/412-569--------------------------GA...APLN---VSG-Q-MV..L-------TP..LS---VE..SDVRLS...-D
A4XYD1_PSEMY/354-505--------------------------RQ...GKLQ---ASG-T-VQ..L-------SP..TS---AQ..LKVATQ...-D
Q484B1_COLP3/152-304--------------------------QG...TELN---WHG-K-FS..L-------SP..LK---SS..GDISFV...-S
Q21F55_SACD2/154-306--------------------------QG...AKLS---WSG-N-IS..L-------AP..LA---SE..GSVAIE...-G
Q3SGZ4_THIDA/147-307--------------------------QG...GTVK---WKG-D-LA..L-------NP..LA---SR..GEIGLE...-G
A7I315_CAMHC/662-807--------------------------KN...GTGK---IKI-I-TL..P-------FN..YD---QRSHMEVIFK...-N
Q74FC9_GEOSL/787-934--------------------------NH...SPIS---ITG-R-IN..P-------LR..DD---LYADIKVRFT...-D
A7H8M2_ANADF/367-518--------------------------GR...GRLS---VKG-P-VQ..P-------FA..SK---GT..LELDAV...-D
Q5DZ89_VIBF1/610-757--------------------------KY...APVK---VKG-E-IN..P-------LL..KQ---PYLDLDVVFK...-S
A4XYD1_PSEMY/562-709--------------------------RY...APMS---IKG-K-LT..P-------FD..PL---NSLDIATSFK...-N
B3E4B8_GEOLS/583-736--------------------------KN...APIK---VSG-T-VT..P-------LP..FR---FN..GTTSFA...-K
C1DFK3_AZOVD/141-292--------------------------NA...GRID---WSG-Q-FS..L-------VP..MR---SS..GKLGID...-Q
Q1LGA7_CUPMC/681-840--------------------------RK...GVMN---IDG-Q-VT..P-------TG..PA---AQ..LQLDLR...-E
B5ECC6_GEOBB/807-954--------------------------NH...SPMQ---ITG-R-LN..P-------LR..DD---LFVDLKISFR...-D
Q2IFA1_ANADE/358-509--------------------------GR...GRLA---VKG-E-VR..P-------FG..DR---GT..LALEAE...-E
A4XYD1_PSEMY/140-291--------------------------YG...GHVD---WQG-Q-VS..L-------SP..LA---SS..GSLQIT...-D
A7H8M2_ANADF/165-318--------------------------SG...ETFR---WTG-T-VR..T-------EP..LR---SA..GTLAFE...-G
A3QD21_SHELP/453-602--------------------------QS...AQVQ---SQG-Q-ID..A-------LA..KQ---VS..AELSLE...-G
Q3A6W6_PELCD/588-738--------------------------QG...GTLR---IDG-K-GT..L-------AP..LA---MN..LRVRTA...-K
A7H8M2_ANADF/579-726--------------------------GA...SPVR---VAG-T-LN..P-------LQ..KE---AYTQLTVASQ...-G
A8ETY5_ARCB4/612-759--------------------------NY...GVAK---ITG-V-VN..P-------KN..IK---ILTDINMKFQ...-N
Q30NX8_SULDN/772-919--------------------------EY...GSAK---LKG-S-VE..A-------SN..IK---SYMDLLFSFR...-N
A4VPN2_PSEU5/125-276--------------------------SG...GRID---WQG-D-LN..L-------QP..LA---SR..GQLQVS...-K
Q1LGA7_CUPMC/173-326--------------------------AKINGSPLA---LAG-T-MQPFA-------DS..RE---AN..LNINLD...-G
Q1H1L3_METFK/561-712--------------------------QG...GSFN---ASG-K-LA..P-------AP..MQ---GD..IKVKLA...-G
Q222N5_RHOFT/710-857--------------------------EF...GLAR---IRG-E-LN..P-------FA..PR---NNTDINVVFK...-N
C1DFK3_AZOVD/584-731--------------------------RY...APVS---IKG-E-LN..P-------FD..PL---DSLDIETRFQ...-R
B2U875_RALPJ/869-1016--------------------------ST...APVD---IHG-K-VN..P-------LA..PM---AFVDLTAKAD...-G
B4EKU9_BURCJ/620-772--------------------------RK...GSLN---VTG-D-VT..A-------QP..LK---LG..LKINGN...-R
D0J281_COMT2/165-316--------------------------G....SKFD---TSG-E-ST..P-------FT..DT---RQTAMQLKWE...-H
M1FB64_9ALTE/585-727--------------------------QV...GNLD---MSG-S-IA..T-------LG..TD---QQSDLVLNLE...-N
Q63NS2_BURPS/160-304--------------------------ARLDGSPIA---IDG-K-TK..P-------FA..QS---RESSINLKFD...-G
Q7VVF7_BORPE/156-309--------------------------MRINGSPFD---LTG-V-AR..P-------FDTVPS---ST..LDVSFA...-G
Q7VVF7_BORPE/538-685--------------------------GE...GALA---MQG-S-LT..A-------QP..LA---LK..SSVDLA...-R
Q87WR1_PSESM/155-306--------------------------DG...GQID---WVG-R-IS..L-------VP..IT---SE..GTLKVT...-D
Q88DW4_PSEPK/140-291--------------------------NG...GRID---WKG-T-LS..L-------SP..IA---SE..GTLKVT...-D
Q88DW4_PSEPK/581-725--------------------------RY...APVT---IKG-A-LN..P-------FN..PL---ASLDIATSFK...-R
Q8EDF6_SHEON/666-811--------------------------RY...APVT---LKG-D-IN..P-------LL..DK---PYLDLDLVFK...-S
Q9HV64_PSEAE/476-627--------------------------NR...GQVQ---ASG-Q-VV..L-------DP..VS---AR..LKVSTR...-D
Q9HV64_PSEAE/692-837--------------------------KY...APVT---IAG-E-LD..P-------FD..PL---KKLDITTSFK...-R

PF13116

C6XK02_HIRBI/457-744-------------------------------INLESGKFGDWL.ID--EGSVDLPAFHPAGA---I...SEYSATGRG.N
Q7NW94_CHRVO/514-796-------------------------------VLAQRASTVGVP.LR--QVTAVIDQLGADVP---W...LKIDGQVED.R
Q7N037_PHOLL/501-786-------------------------------MFAPQTALGEVK.AS--NLSAVIPNY.RSKK---....LLIDADLLG.D
A4XQL3_PSEMY/513-798-------------------------------VRLQSGRLLDSR.VS--EVTANIPLLHDGKP---P..RLKLDGKVQS.S
Q3J7T7_NITOC/517-810-------------------------------IHANEGQMFSAR.VA--EATVQITDLGAAIV---P...LTITVRAQG.G
D5CU11_SIDLE/524-805-------------------------------IKAATATTAGAH.LQ--NIKVSIPDLLANNL---L...LQVRGEAAD.A
A1AVR0_RUTMC/242-525-------------------------------VMVNHTMLNDMF.LQ--GMKVQILDM.SKDK---L..EISVVGKINT.Q
Q31FH6_THICR/496-774-------------------------------ITSKKVMLGNVT.GH--DVVVDIKALDTKNI---A...VQIKGKAEG.D
Q2NWP0_SODGM/504-789-------------------------------MHAPQTALGEAK.GS--NIAASIPDY.SKEK---....LLIDVGLSG.T
B8GV04_THISH/540-825-------------------------------AQSASGRLFGAQ.IQ--DATVVIEDYHNT..---...VLQIQGQVDG.P
A0RPG5_CAMFF/10-294-------------------------------FHLEKPTYMEKP.LD--GSSVVIRNIIGKNS---NM.SVNITTNSF..L
Q07WQ4_SHEFN/504-791-------------------------------LHIDQGKLDNVV.VD--GARVSIPHL.GKES---L...LRVEADITT.D
Q5ZUN8_LEGPH/507-795-------------------------------IDIIDGDAQGTL.LK--QMNLRIDDI.GKDR---E..TLLIHGIVHG.K
Q7VFV2_HELHP/222-511-------------------------------FLLKEPFFTNMN.LD--GSEVTISNIFTQPF---GV.QIAIRSHNAM.L
Q12IX1_SHEDO/530-817-------------------------------LWVTQGQLQDVA.ID--GAHVYIPEL.GENS---L...LRVEAKLNT.Q
Q15ZG8_PSEA6/490-776-------------------------------MQANAGKLLDVN.LS--GLSADIPDL.DVGA---V...LTIDAQGSA.L
A6Q385_NITSB/202-483-------------------------------FTLRKPIFQKRS.LQ--GSKVTIYHLGQSKS---YI.DILIKIKTR..F
A8GK60_SERP5/523-808-------------------------------MNAPQTKLGKVD.GK--NVTAIIPDY.LKER---....LLVDADVAG.Q
Q3IFH7_PSEHT/493-781-------------------------------IYSQQGKLVNLAVGS--SVRVSISDL.MHAD---E...LVVKIDKQA.E
D9SHW3_GALCS/523-805-------------------------------VRAPTANMLGAH.LH--NLLITQPDMSSAEP---I...LELKGEAEA.A
Q21FT5_SACD2/542-827-------------------------------VQVTQAEMQGNH.IS--GAVIDLVKAKDGKG---H..GLRIVGAITG.N
A7MJB2_CROS8/518-803-------------------------------MAAPQVMLGGVT.GK--NLTAVIPDY.SQEK---....LFIDADIAG.P
C6XD69_METGS/519-799-------------------------------LNATDGTILGTR.IT--KANIAIPGLHVAEP---V...LNITGEASG.L
A7I2E8_CAMHC/213-497-------------------------------FNMENATYLDKN.LT--NSEVEIYKIFDDDS---GI.KINLHTSAP..F
Q6LMA6_PHOPR/509-794-------------------------------LDSRHAITMGAT.AS--RVTG.VSEL.SADG---D...LKLTVDIAA.E
D0L1I5_HALNC/561-853-------------------------------ASIDHGTLADVP.VD--GSRVSIFDLDKAA.---....LDIAVTAKA.P
A3Q9Y2_SHELP/509-796-------------------------------IWVNKGMLMQVP.AD--GAHVAIPRM.SHQT---L...LTVKADLRT.Q
A6QAC9_SULNB/206-494-------------------------------FDLTNPTYENRE.IN--AT.VSITDIGKEKD---TRLNLDMYFN.TR.I
A8EUE5_ARCB4/193-478-------------------------------FNLIEPKFKDKN.IE--GSFVTIHNLTDEIN---GNVEVNIKTNSK..L
C5ZX33_9HELI/208-498-------------------------------FHPNQPTYEHIN.LQ--GSQVAITNIFQIPT---.L.EIFIQTRST..L
Q1H0H5_METFK/520-800-------------------------------LNASKGSTLGTD.IT--KSKVVITNLASHQP---V...VSIASEGQG.P
Q7MRT1_WOLSU/187-475-------------------------------FELYEPSFEGFS.LE--GSQVGLRDIWGEKP---WL.DLLIKTEAV..L
Q47VG9_COLP3/504-793-------------------------------ITGRGGELTGLD.VK--GVRAGIADL.ANGQ---I...LTVDAEIKPTQ
A4G3G0_HERAR/587-887-------------------------------IKGESGSTHGAQ.VS--NVKAVVADLLANEP---V...LEIDGRAAG.S
D1B1Z5_SULD5/203-493-------------------------------FDISAPEYEQKS.IE--KADVFIYNLLTKGT---GI.VVDLKTHAK..L
D3V5J7_XENBS/502-797-------------------------------MQVPKAKLGKVD.AT--QLTAVIPDY.GKNK---....LLIDGKLSG.S
E6WGF8_PANSA/504-789-------------------------------MKAEQAKLGEVD.AR--NISAIIPDY.LKEK---....LIIDGDLSG.E
D3VKA4_XENNA/501-791-------------------------------MQALKARLGGVD.IN--QVSAVIPDY.SQKN---....LFIDAELSG.E
Q0ABM3_ALKEH/531-818-------------------------------IRGHGGRLAGTS.VQ--RVEVTLADL...FE---P..VLAVQGEVHG.S
A0KFB2_AERHH/486-771-------------------------------MNSRATQLGKAS.SD--SVHAWIPDL.YPGA---H...LYVDAKVEG.E
A6TER2_KLEP7/497-781-------------------------------MRADKAMLGNVT.AS--NLDAAIPDY.AQEK---....LLIDADIKG.P
B4EX35_PROMH/501-782-------------------------------MSSDNVQVGKAT.AK--NLTAIIEDY.NKEK---....IVIDADIEA.T
B7VIB8_VIBTL/505-791-------------------------------LDSRSAQLMDVA.AD--RITGRIPYL.GEGG---H...IEIEAKATA.S
D3HJX5_LEGLN/559-845-------------------------------IDITHANFQGVP.AK--QMHLRIDDIGNNKE---N...LIVTGRINA.S
F0LWR2_VIBFN/505-791-------------------------------LDSHAATLMDVK.AT--RITGRIPEL.APDG---H...IEIEATAVA.Q
Q5E7X4_VIBF1/495-780-------------------------------LSSHSADLMDVH.AT--RVTGRIANL.SEDG---K...LTIRATANG.S
Q6DAI1_PECAS/504-784-------------------------------MFAPQIWLGKVE.GK--NISAVIPDY.EKE.---M...LLIDGELDG.P
Q74PM2_YERPE/511-794-------------------------------MNAPHTLLGKVI.GS--NISAIIPDYLKEK.---....LYVDADVLG.E
Q7MHE2_VIBVY/508-794-------------------------------LDSKSATLKDVK.AS--RITGRIPEL.AEGG---H...IEIEAKATA.A
Q83BN5_COXBU/480-760-------------------------------IVASHANISGNP.LD--HLKAVIPDL..KDP---V...LSVSGHSTS.N
Q8ZLP4_SALTY/504-786-------------------------------MRSDSVDLGGVK.AS--KLAAAIPDY.SKEK---....LLIDADING.P
Q9KUU5_VIBCH/504-791-------------------------------LDSRSATLMEVS.AE--RITGRIPEL.AELG---H...IEIEAVASAQQ

PF13109

A0RPG5_CAMFF/433-647---------------------------------------------------------------S-LL-------------
A6Q385_NITSB/623-836---------------------------------------------------------------A-LI-------------
A6QAC9_SULNB/640-854---------------------------------------------------------------N-FS-------------
B9L5J2_NAUPA/583-798---------------------------------------------------------------S-LL-------------
C5ZX33_9HELI/638-852---------------------------------------------------------------S-LL-------------
D3UGW6_HELM1/730-943---------------------------------------------------------------S-LV-------------
Q30RQ8_SULDN/697-907---------------------------------------------------------------S-LV-------------
Q7MRT1_WOLSU/616-829---------------------------------------------------------------S-LL-------------
Q7VFV2_HELHP/731-944---------------------------------------------------------------A-LL-------------
O25308_HELPY/745-958---------------------------------------------------------------S-LI-------------
Q0PAY6_CAMJE/635-848---------------------------------------------------------------S-LL-------------

PF13502

A0KFB2_AERHH/999-1241------------------------------------------------------------...T-LR......EVNDKG.
A1S2S6_SHEAM/1130-1371------------------------------------------------------------...S-LT......EISDKGA
A1STZ9_PSYIN/1024-1262------------------------------------------------------------...A-IT......EVNDNGA
A1TW53_ACIAC/1117-1369------------------------------------------------------------...Q-FL......K......
A1U479_MARHV/979-1225------------------------------------------------------------...M-IM......EQSNS..
A1WCZ7_ACISJ/1139-1390------------------------------------------------------------...Q-FL......Q......
A1WSB5_VEREI/1101-1362------------------------------------------------------------...Q-FL......K......
A1WYY8_HALHL/891-1129------------------------------------------------------------...R-IT......D......
A2U2U5_9FLAO/567-793------------------------------------------------------------...K-LT......A......
A3HUH0_9BACT/675-900------------------------------------------------------------...A-LKDSKILEG......
A3Q9Y2_SHELP/1046-1289------------------------------------------------------------...H-LS......EVSDKGA
E0TB83_PARBH/837-1047------------------------------------------------------------...V-AR......LLS....
A4AMF6_MARSH/560-785------------------------------------------------------------...E-IN......T......
A4CG41_ROBBH/574-799------------------------------------------------------------...D-IT......G......
A4VIB7_PSEU5/1014-1255------------------------------------------------------------...Q-FV......EVDGSAQ
A5CF63_ORITB/620-836------------------------------------------------------------...E-IT......D......
A5FJ68_FLAJ1/564-791------------------------------------------------------------...T-VN......P......
A5FUN1_ACICJ/745-973------------------------------------------------------------...T-IS......G......
A6GWN8_FLAPJ/560-787------------------------------------------------------------...T-VN......S......
A7HEC2_ANADF/581-801------------------------------------------------------------...A-FF......G......
A9CIC7_AGRFC/884-1105------------------------------------------------------------...V-LK......GLNPGA.
A9H3V6_GLUDA/474-684------------------------------------------------------------...S-IY......G......
B2FP42_STRMK/1008-1250------------------------------------------------------------...Q-LL......ELEPGAG
B4S7D6_PROA2/551-781------------------------------------------------------------...H-IE......Q......
B7VIB8_VIBTL/1027-1268------------------------------------------------------------...I-IS......DVSGAAR
C1D9M5_LARHH/1015-1258------------------------------------------------------------...Q-FT......RAEPGVG
C3L4A9_AMOA5/534-754------------------------------------------------------------...L-LR......D......
C4L8L8_TOLAT/989-1232------------------------------------------------------------...I-LR......EVKNT..
E8RSC3_ASTEC/1136-1358------------------------------------------------------------...R-IK......QIPALGQ
D9SHW3_GALCS/1021-1263------------------------------------------------------------...Q-FL......KMEPGIG
D5CU11_SIDLE/1024-1263------------------------------------------------------------...R-FL......K......
C6WWM2_METML/1053-1294------------------------------------------------------------...Q-IL......QVQPGVG
C6XD69_METGS/1043-1284------------------------------------------------------------...Q-IL......KIQPGVG
C6XK02_HIRBI/884-1092------------------------------------------------------------...F-AL......AS.....
C7PC84_CHIPD/564-796------------------------------------------------------------...A-LQ......K......
E6WGF8_PANSA/1014-1257------------------------------------------------------------...Q-IA......DVNTGRA
D2UF54_XANAP/1023-1265------------------------------------------------------------...Q-LL......ELNPGAG
D3SBX9_THISK/1040-1287------------------------------------------------------------...R-LA......DVEPGAG
Q0ABM3_ALKEH/1048-1290------------------------------------------------------------...Q-IP......DLSPGAG
Q0AQ38_MARMM/879-1092------------------------------------------------------------...T-LV......QVPVLAR
Q11YL6_CYTH3/532-755------------------------------------------------------------...E-LN......N......
Q11YT8_CYTH3/698-925------------------------------------------------------------...K-VL......SNPV...
Q145G0_BURXL/1154-1409------------------------------------------------------------...Q-IL......K......
Q15ZG8_PSEA6/1002-1243------------------------------------------------------------...Y-LT......EVTDKGS
Q211X0_RHOPB/871-1087------------------------------------------------------------...R-IA......G......
Q28TM9_JANSC/371-572------------------------------------------------------------...A-IL......G......
Q2KY05_BORA1/936-1183------------------------------------------------------------...R-FL......SVNSRTA
Q2NWP0_SODGM/1012-1255------------------------------------------------------------...K-ID......NISSGSA
Q3IFH7_PSEHT/1008-1245------------------------------------------------------------...H-LT......EVSDGGA
Q47VG9_COLP3/1038-1280------------------------------------------------------------...Y-LA......DVSDSAR
Q5R0H7_IDILO/1003-1244------------------------------------------------------------...Y-LA......EVSDGGA
Q7MHE2_VIBVY/1031-1272------------------------------------------------------------...I-IT......DVSGAAR
Q7UYB4_RHOBA/752-985------------------------------------------------------------RGAA-VP......G......
Q8EA16_SHEON/1025-1268------------------------------------------------------------...H-LS......QVSDKGA
Q9ZDH9_RICPR/624-849------------------------------------------------------------...D-VN......NFSIDSF
A8GK60_SERP5/1034-1277------------------------------------------------------------...E-ID......SMGGGRA
C5BC15_EDWI9/1004-1246------------------------------------------------------------...V-LE......SMDTGRA
D3HJX5_LEGLN/1065-1312------------------------------------------------------------...R-IT......HLSKATE
E0SHA8_DICD3/1031-1273------------------------------------------------------------...E-IV......NVGTGQA
F4AYZ2_DOKS4/566-791------------------------------------------------------------...D-VD......ADKM...
G2J3B5_PSEUL/1018-1258------------------------------------------------------------...R-FA......KVNPGAA
M1FEQ6_9ALTE/970-1216------------------------------------------------------------...V-IL......QQNNS..
N0B6U7_9RHIZ/961-1176------------------------------------------------------------...K-IL......GDPIVSE
Q0KCK4_CUPNH/1119-1370------------------------------------------------------------...Q-IL......SVEPGAA
Q0VS66_ALCBS/1022-1263------------------------------------------------------------...R-IP......DTDTKTS
Q2K6G4_RHIEC/885-1104------------------------------------------------------------...S-IR......GLNLAI.
Q32B94_SHIDS/1009-1252------------------------------------------------------------...E-IT......EINTGHA
Q5ZUN8_LEGPH/1014-1261------------------------------------------------------------...R-IT......HLSPETE
Q63R38_BURPS/1120-1377------------------------------------------------------------...Q-IL......K......
Q6LMA6_PHOPR/1035-1276------------------------------------------------------------...I-IS......GVGGAGR
Q8P7K3_XANCP/1032-1273------------------------------------------------------------...Q-LL......EVDPGAG
Q9KUU5_VIBCH/1028-1269------------------------------------------------------------...V-IS......DVSGAAR
Q9PEA2_XYLFA/983-1225------------------------------------------------------------...Q-LL......ELKPGAG

PF05170

Q87TE2_VIBPA/1-570RVQVSGQFKPTHWQL.............................................DTAS-VQGLKWVIQSDDNKD
Q9KNJ9_VIBCH/1-570DVQVKGHITETSLNL.............................................AQLT-ITGVKWIAEQPQD..
Q9HU38_PSEAE/1-636GSRNSLNLEDLKLGL.............................................DDTA-FSGR..FGIADF...
Q9KT66_VIBCH/1-595QNHLSVLLNKLTA...............................................NALS-FDGKADVTLADI...
Q9JY87_NEIMB/8-615RHQTNFSLNSPLVWT.............................................ENKG-LDAPRLYVSTLQDTV
Q9ZDI1_RICPR/1-711NITGEIVLKNLTENIIILHNLKINNFELFMSLIGVNNLSKIGILQLNGEVQKVKDTFNINNKIS-VLNTNISIKGDINLA
Q9HUT4_PSEAE/1-577GGALF.......................................................RYEN-FNGK..VGASDLHGS
YHJG_ECOLI/1-582KSSVF.......................................................DYRG-FNGR..IGDSDIHGS
Q7MQ04_VIBVY/1-571NLLFSGTLKPDAIEL.............................................DQLM-VNNVKWAAEQPGEGA

PF04357

A2U1I0_9FLAO/1175-1633---------------------------------------------------------------H.YE-------------
Q83EW1_COXBU/570-928---------------------------------------------------------------T.FT-------------
Q1D0C2_MYXXD/935-1291---------------------------------------------------------------S.QA-------------
A5FB26_FLAJ1/992-1420---------------------------------------------------------------T.YN-------------
Q8YZJ8_NOSS1/1412-1829---------------------------------------------------------------R.IS-------------
A4CK93_ROBBH/998-1431---------------------------------------------------------------S.YN-------------
A3U6I2_CROAH/1185-1647---------------------------------------------------------------H.YE-------------
A0LGH5_SYNFM/889-1254---------------------------------------------------------------T.YT-------------
A3HZ37_9BACT/1160-1620---------------------------------------------------------------H.YE-------------
A5GSG8_SYNR3/973-1387---------------------------------------------------------------R.VS-------------
A6L590_BACV8/1012-1461---------------------------------------------------------------M.YK-------------
A0M1P1_GRAFK/1180-1639---------------------------------------------------------------F.YE-------------
Q2S2D2_SALRD/1057-1516---------------------------------------------------------------T.YL-------------
Q21Y28_RHOFT/928-1291---------------------------------------------------------------T.YR-------------
Q6MKB2_BDEBA/958-1321---------------------------------------------------------------K.II-------------
Q39RU7_GEOMG/1016-1376---------------------------------------------------------------H.YS-------------
Q7VBL9_PROMA/867-1309---------------------------------------------------------------R.VN-------------
A5FIP0_FLAJ1/1183-1626---------------------------------------------------------------A.YE-------------
Q8KFW2_CHLTE/1034-1479---------------------------------------------------------------K.YT-------------
A6H009_FLAPJ/1018-1446---------------------------------------------------------------V.YN-------------
B5E9K2_GEOBB/1121-1484---------------------------------------------------------------R.YR-------------
Q11I59_CHESB/1185-1538---------------------------------------------------------------R.LS-------------
Q11VR9_CYTH3/1167-1624---------------------------------------------------------------N.YK-------------
A7HQ23_PARL1/1042-1395---------------------------------------------------------------T.LD-------------
Q7MT86_PORGI/1036-1486---------------------------------------------------------------T.YN-------------
Q3AQ57_CHLCH/1053-1500---------------------------------------------------------------T.YR-------------
A1BDC7_CHLPD/1048-1494---------------------------------------------------------------K.YR-------------
Q6MAC5_PARUW/935-1288---------------------------------------------------------------Q.YD-------------
Q1QWE2_CHRSD/954-1312---------------------------------------------------------------A.YT-------------
Q2RSJ7_RHORT/1146-1500---------------------------------------------------------------Q.AD-------------
Q2S346_SALRD/1311-1689---------------------------------------------------------------TLRQ-------------
Q2INP6_ANADE/946-1304---------------------------------------------------------------S.RA-------------
Q9RUC9_DEIRA/223-627---------------------------------------------------------------S.VF-------------
Q1LSN0_BAUCH/634-981---------------------------------------------------------------Y.YH-------------
B3ELK5_CHLPB/1036-1483---------------------------------------------------------------T.YR-------------
Q8YUC2_NOSS1/1659-2048---------------------------------------------------------------G.VN-------------
Q1MQI4_LAWIP/1025-1382---------------------------------------------------------------N.FN-------------
Q7VQN5_BLOFL/933-1286---------------------------------------------------------------S.CK-------------
Q31MA1_SYNE7/1177-1568---------------------------------------------------------------Q.VN-------------
B4E8E1_BURCJ/988-1340---------------------------------------------------------------STYT-------------
E3G0N9_STIAD/1177-1560---------------------------------------------------------------R.VD-------------
F4B3D6_DOKS4/1021-1426---------------------------------------------------------------V.FN-------------
Q46LW1_PROMT/887-1319---------------------------------------------------------------Y.VN-------------
TAMB_HAEIN/952-1298---------------------------------------------------------------R.YA-------------
Q5NNB3_ZYMMO/1036-1389---------------------------------------------------------------T.YT-------------

PF05359

Q4K5X6_PSEF5/140-291-----------------------------------------------------------------GK-------------
Q4K5X6_PSEF5/360-511-----------------------------------------------------------------ID-------------
B2JQ93_PARP8/874-1021-----------------------------------------------------------------IE-------------
A0RMT1_CAMFF/653-798-----------------------------------------------------------------IN-------------
Q72DG8_DESVH/963-1109-----------------------------------------------------------------LD-------------
A9BMN7_DELAS/883-1036-----------------------------------------------------------------LE-------------
Q2LUD1_SYNAS/534-687-----------------------------------------------------------------LP-------------
A8ZWF7_DESOH/636-783-----------------------------------------------------------------ME-------------
Q3A6W6_PELCD/375-529-----------------------------------------------------------------LS-------------
Q5NYY7_AROAE/382-536-----------------------------------------------------------------FQ-------------
Q2KWF8_BORA1/759-906-----------------------------------------------------------------VD-------------
Q484B1_COLP3/382-534-----------------------------------------------------------------IS-------------
A2SI01_METPP/870-1017-----------------------------------------------------------------ID-------------
Q8Y0Z7_RALSO/615-766-----------------------------------------------------------------LS-------------
Q5QWM2_IDILO/380-527-----------------------------------------------------------------LQ-------------
Q0VP61_ALCBS/592-737-----------------------------------------------------------------YE-------------
A3QD21_SHELP/699-846-----------------------------------------------------------------VE-------------
Q63NS2_BURPS/645-797-----------------------------------------------------------------LD-------------
Q47FN3_DECAR/732-879-----------------------------------------------------------------VD-------------
A0KK00_AERHH/368-522-----------------------------------------------------------------LP-------------
Q0JZH1_CUPNH/670-829-----------------------------------------------------------------VE-------------
Q2LUD1_SYNAS/785-932-----------------------------------------------------------------VD-------------
A1ARF1_PELPD/790-937-----------------------------------------------------------------IE-------------
Q39RS7_GEOMG/568-719-----------------------------------------------------------------IP-------------
B9M3X2_GEODF/795-942-----------------------------------------------------------------IE-------------
Q8Y0Z7_RALSO/185-339-----------------------------------------------------------------LE-------------
Q3JBN6_NITOC/584-731-----------------------------------------------------------------IA-------------
Q5DZ89_VIBF1/399-549-----------------------------------------------------------------LK-------------
Q1QTZ9_CHRSD/145-295-----------------------------------------------------------------VP-------------
A9BMN7_DELAS/165-317-----------------------------------------------------------------VD-------------
A9BMN7_DELAS/379-538-----------------------------------------------------------------LP-------------
Q87WR1_PSESM/386-537-----------------------------------------------------------------ID-------------
B2JQ93_PARP8/616-770-----------------------------------------------------------------LD-------------
A1K6C3_AZOSB/734-881-----------------------------------------------------------------VA-------------
Q603H4_METCA/718-865-----------------------------------------------------------------VD-------------
Q47VC1_COLP3/500-655-----------------------------------------------------------------FS-------------
Q15PY6_PSEA6/662-809-----------------------------------------------------------------AE-------------
Q88DW4_PSEPK/365-516-----------------------------------------------------------------ID-------------
A0KK00_AERHH/578-725-----------------------------------------------------------------LE-------------
B5ECC6_GEOBB/569-721-----------------------------------------------------------------LP-------------
Q2LUD1_SYNAS/159-313-----------------------------------------------------------------LG-------------
A4VPN2_PSEU5/551-698-----------------------------------------------------------------VE-------------
Q0VP61_ALCBS/382-530-----------------------------------------------------------------LP-------------
A1K7K6_AZOSB/583-736-----------------------------------------------------------------ID-------------
Q3JBN6_NITOC/369-521-----------------------------------------------------------------LS-------------
Q5NYY7_AROAE/832-979-----------------------------------------------------------------FE-------------
Q13S79_BURXL/640-791-----------------------------------------------------------------LD-------------
Q47FN3_DECAR/504-656-----------------------------------------------------------------IP-------------
Q316X0_DESAG/862-1008-----------------------------------------------------------------LD-------------
Q602F3_METCA/416-565-----------------------------------------------------------------LG-------------
Q2Y5K5_NITMU/673-818-----------------------------------------------------------------ID-------------
B3E4B8_GEOLS/816-963-----------------------------------------------------------------IE-------------
A4VPN2_PSEU5/341-492-----------------------------------------------------------------ID-------------
Q5NYY7_AROAE/153-307-----------------------------------------------------------------FD-------------
Q30NX8_SULDN/563-715-----------------------------------------------------------------IS-------------
C1DFK3_AZOVD/367-518-----------------------------------------------------------------LD-------------
Q484B1_COLP3/604-751-----------------------------------------------------------------IE-------------
Q5NYY7_AROAE/604-757-----------------------------------------------------------------VD-------------
Q602F3_METCA/623-770-----------------------------------------------------------------VD-------------
Q316X0_DESAG/389-538-----------------------------------------------------------------TD-------------
A5G9K9_GEOUR/137-293-----------------------------------------------------------------IA-------------
B2JHK1_PARP8/152-309-----------------------------------------------------------------VD-------------
A5G9K9_GEOUR/551-702-----------------------------------------------------------------IP-------------
A0KK00_AERHH/151-307-----------------------------------------------------------------LA-------------
Q1H1L3_METFK/780-927-----------------------------------------------------------------LE-------------
B9M7L7_GEODF/383-534-----------------------------------------------------------------IP-------------
A4SXW3_POLSQ/414-561-----------------------------------------------------------------LP-------------
B9M3X2_GEODF/564-715-----------------------------------------------------------------LP-------------
A4G9D7_HERAR/154-308-----------------------------------------------------------------MD-------------
Q21F55_SACD2/584-731-----------------------------------------------------------------VS-------------