Sequence alignment for CL0401

PF13109

A0RPG5_CAMFF/433-647--------------------------------------------------------------------------------
A6Q385_NITSB/623-836--------------------------------------------------------------------------------
A6QAC9_SULNB/640-854--------------------------------------------------------------------------------
B9L5J2_NAUPA/583-798--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1U479_MARAV/979-1225--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
A3Q9Y2_SHELP/1046-1289--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FJ68_FLAJ1/564-791--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRT5/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B2FP42_STRMK/1008-1250--------------------------------------------------------------------------------
F2G3T4_ALTMD/1046-1287--------------------------------------------------------------------------------
B4S7D6_PROA2/551-781--------------------------------------------------------------------------------
B7VIB8_VIBSL/1027-1268--------------------------------------------------------------------------------
B8CI63_SHEPW/997-1240--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
E6WGF8_PANSA/1014-1257--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
D3SBX9_THISK/1040-1287--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
Q11YL6_CYTH3/532-755--------------------------------------------------------------------------------
Q11YT8_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_BURXL/1154-1409--------------------------------------------------------------------------------
Q15ZG8_PSEA6/1002-1243--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q2NWP0_SODGM/1012-1255--------------------------------------------------------------------------------
Q3IFH7_PSEHT/1008-1245--------------------------------------------------------------------------------
Q47VG9_COLP3/1038-1280--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7MHE2_VIBVY/1031-1272--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
A8GK60_SERP5/1034-1277--------------------------------------------------------------------------------
C4YU88_9RICK/640-864--------------------------------------------------------------------------------
C5BC15_EDWI9/1004-1246--------------------------------------------------------------------------------
D3HJX5_LEGLN/1065-1312--------------------------------------------------------------------------------
D5CDA5_ENTCC/1010-1252--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_KROS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
I0DWA9_PROSM/1000-1242--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
N0B6U7_9RHIZ/961-1176--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q2K6G4_RHIEC/885-1104--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570MKTARRILILLLVVLIVLP....ATIIALLTTSYANSTWQW.VSPYLGLPIQAERV..............HYDFPY.HLS
Q9KNJ9_VIBCH/1-570MRKILAIGVAGIALLLILV....LAGFGIMHTRYFTPSAQWIVQQLWPETLRFAKI..............EYLYPF.KLR
Q9HU38_PSEAE/1-636MKAFGKVLGLFFLGLLLLVVALGFALTHLFDPNDYKDEIRQIARDKANLELDLKGDIG............WSLFPWLGLE
Q9KT66_VIBCH/1-595MKK....LFISLLGLVVLIVGALLALVLLVNPNQFKPLIVEQAKKQTGLDLVIEGDIG............WQFFPSIGFE
Q9JY87_NEIMB/8-615HKYRLKYAVAVLTILLLAAVGLHASVYRTFTPENIRSRLQQSIA.HTHRKISFDADIQ............RRLLPRPTVI
Q9ZDI1_RICPR/1-711MPKALKYSLIIFITIILLL....IIIPFFIPLNNYKGVLIDKVKEATNRNLTINGDIK............LSLLPTPTIS
Q9HUT4_PSEAE/1-577MTRGRKILTWSLASLVLLLA.ALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFS
YHJG_ECOLI/1-582MSKAGKITAAISGAFLLLIV.VAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVH
Q7MQ04_VIBVY/1-571MKKALISVALLLIVIALIP....ISILVSLQTRYASQVFNQ.LNQFSGLGMQAESV..............HYQYPD.HFS

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q1D0C2_MYXXD/935-1291--------------------------------------------------------------------------------
A5FB26_FLAJ1/992-1420--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
A0M1P1_GRAFK/1180-1639--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_ALBFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
Q016Y8_OSTTA/1647-2059--------------------------------------------------------------------------------
A5FIP0_FLAJ1/1183-1626--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
Q11VR9_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q6MAC5_PARUW/935-1288--------------------------------------------------------------------------------
Q1QWE2_CHRSD/954-1312--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
B4E8E1_BURCJ/988-1340--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_KROS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------------------------
Q4K5X6_PSEF5/360-511--------------------------------------------------------------------------------
B2JQ93_BURP8/874-1021--------------------------------------------------------------------------------
A0RMT1_CAMFF/653-798--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
A7ZFK9_CAMC1/750-895--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
Q484B1_COLP3/382-534--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
A3QD21_SHELP/699-846--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
Q47FN3_DECAR/732-879--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_VIBF1/399-549--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_BURP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q47VC1_COLP3/500-655--------------------------------------------------------------------------------
Q15PY6_PSEA6/662-809--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_BURXL/640-791--------------------------------------------------------------------------------
Q47FN3_DECAR/504-656--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
C1DFK3_AZOVD/367-518--------------------------------------------------------------------------------
Q484B1_COLP3/604-751--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_BURP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLSQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
A1TWZ4_MARAV/597-744--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------------------------
Q11NN1_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
A1TWZ4_MARAV/166-321--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_ALBFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_ALBFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q484B1_COLP3/152-304--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
F2GAL8_ALTMD/716-863--------------------------------------------------------------------------------
Q5DZ89_VIBF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
C1DFK3_AZOVD/141-292--------------------------------------------------------------------------------
Q1LGA7_RALME/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
A3QD21_SHELP/453-602--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_RALME/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_ALBFT/710-857--------------------------------------------------------------------------------
C1DFK3_AZOVD/584-731--------------------------------------------------------------------------------
B2U875_RALPJ/869-1016--------------------------------------------------------------------------------
B4EKU9_BURCJ/620-772--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A7ZDM6_CAMC1/160-458--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_THICR/496-774--------------------------------------------------------------------------------
Q2NWP0_SODGM/504-789--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
A0RPG5_CAMFF/10-294--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
Q15ZG8_PSEA6/490-776--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
A8GK60_SERP5/523-808--------------------------------------------------------------------------------
Q3IFH7_PSEHT/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
C7R9G7_KANKD/505-791--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
A7MJB2_CROS8/518-803--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A3Q9Y2_SHELP/509-796--------------------------------------------------------------------------------
A6QAC9_SULNB/206-494--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
Q47VG9_COLP3/504-793--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3V5J7_XENBS/502-797--------------------------------------------------------------------------------
E6WGF8_PANSA/504-789--------------------------------------------------------------------------------
F2G3T4_ALTMD/500-787--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B4EX35_PROMH/501-782--------------------------------------------------------------------------------
B7VIB8_VIBSL/505-791--------------------------------------------------------------------------------
D3HJX5_LEGLN/559-845--------------------------------------------------------------------------------
F0LWR2_VIBFN/505-791--------------------------------------------------------------------------------
G9AWD3_PANAN/505-788--------------------------------------------------------------------------------
I0DWA9_PROSM/493-771--------------------------------------------------------------------------------
Q5E7X4_VIBF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
Q74PM2_YERPE/511-794--------------------------------------------------------------------------------
Q7MHE2_VIBVY/508-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A0RPG5_CAMFF/433-647------------------------NELNFDGLF----D--NG--------------E-VKLNK-----------------
A6Q385_NITSB/623-836------------------------ETIHFSGNY----G--PT--------------R-YVFMY-----------------
A6QAC9_SULNB/640-854------------------------NTITAVGNL----G--SD--------------K-VTFRK-----------------
B9L5J2_NAUPA/583-798------------------------DNFNFHSIY----K--DS--------------S-LNGYT-----------------
C5ZX33_9HELI/638-852------------------------DELKATLKH----K--NG--------------Q-AQIYK-----------------
D3UGW6_HELM1/730-943------------------------QRTLASLTY----K--NG--------------I-ANVDF-----------------
Q30RQ8_SULDN/697-907------------------------DIFSAELKY----K--AG--------------K-ATFLS-----------------
Q7MRT1_WOLSU/616-829------------------------ENISATLSY----K--NG--------------T-LKANL-----------------
Q7VFV2_HELHP/731-944------------------------GIIRADVTY----G--NG--------------V-ANVDM-----------------
O25308_HELPY/745-958------------------------DRVKIDGNY----K--NA--------------M-IMADL-----------------
Q0PAY6_CAMJE/635-848------------------------.ALDLKGSR----G--NA--------------K-FDLYY-----------------

PF13502

A0KFB2_AERHH/999-1241-----------------------LGEVKGELIP....G..AD.........KLSLKG-LEMRL-----------------
A1S2S6_SHEAM/1130-1371-----------------------LGHLVLQGQP....E..PG.........RYNFQT-LSLSS-----------------
A1STZ9_PSYIN/1024-1262-----------------------LSPMRLHIFP....N..KK.........NLNINY-IKIGN-----------------
A1TW53_ACIAC/1117-1369-----------------------LGRIEVEAQN....R..GGAG....APREWRLSK-LNLTV-----------------
A1U479_MARAV/979-1225-----------------------AGSWRFKLRP....E..PY.........RLRVQE-VEGRL-----------------
A1WCZ7_ACISJ/1139-1390-----------------------LGRIEIEARN....R..GTEG....GQREWRLSK-FNLTA-----------------
A1WSB5_VEREI/1101-1362-----------------------LGQLEMQARN....Q..GTDGGDAGLQREWRLTR-FNLLT-----------------
A1WYY8_HALHL/891-1129-----------------------AGVGRVRLRP....R..GE.........VLYLDE-ASIRG-----------------
A2U2U5_9FLAO/567-793-----------------------LKNVSGIIYV....K..DE.........TINLQN-LNSDV-----------------
A3HUH0_9BACT/675-900-----------------------LKEMKGEMLL....K..DG.........ILTFRD-ASMST-----------------
A3Q9Y2_SHELP/1046-1289-----------------------LGHLVLQATP....K..NG.........DYQIQT-IAITT-----------------
E0TB83_PARBH/837-1047-----------------------LHDLTVSGLF....D..GE.........RVERLI-ADGRL-----------------
A4AMF6_MARSH/560-785-----------------------LKNVRGNLRI....V..DE.........KAVLTD-VTSSL-----------------
A4CG41_ROBBH/574-799-----------------------LRNVSGNLQI....R..DQ.........ELQLRD-VRSDA-----------------
A4VIB7_PSEU5/1014-1255-----------------------LGAWALKLRP....V..GT.........GVEFHD-LALQL-----------------
A5CF63_ORITB/620-836-----------------------IQDFISKFSV....Q..DS.........IIQVKD-INCRI-----------------
A5FJ68_FLAJ1/564-791-----------------------LKDVSGKLII....K..DE.........KALLEN-FKTSI-----------------
A5FUN1_ACICJ/745-973-----------------------ARHASFSLAL....D..QGKL.....APRIAVTL-NRAEV-----------------
A6GWN8_FLAPJ/560-787-----------------------LKAVSGKMII....R..DE.........AVTLQN-IKTNI-----------------
A7HEC2_ANADF/581-801-----------------------ARNVAVRVRV....K..GD.........EVTFEQ-ARLEA-----------------
A9CIC7_AGRT5/884-1105-----------------------VTGVSAKLTH....D..AG.........SLSLDD-VAGTF-----------------
A9H3V6_GLUDA/474-684-----------------------LTGVHA..HL....E..DN.........GVRLTR-MRFAM-----------------
B2FP42_STRMK/1008-1250-----------------------LGQAVLRTRP....L..AN.........GLNVDE-LRFRA-----------------
F2G3T4_ALTMD/1046-1287-----------------------FGEITLDIAK....E..DN.........GLAIRQ-LLVRS-----------------
B4S7D6_PROA2/551-781-----------------------FTDASGGLTL....K..DE.........TLSFTN-VKASS-----------------
B7VIB8_VIBSL/1027-1268-----------------------VGKVDVEMTR....Q..ED.........RIEWNK-IQVRS-----------------
B8CI63_SHEPW/997-1240-----------------------MGHLVLQATP....K..EN.........TYNIQT-LSMTT-----------------
C1D9M5_LARHH/1015-1258-----------------------MGKLTLMSTR....Q..KN.........EWKLDR-FQLSN-----------------
C3L4A9_AMOA5/534-754-----------------------GNKIRGRFKI....V..EQ.........QLIADA-IELIF-----------------
C4L8L8_TOLAT/989-1232-----------------------LGQFRGHLYP....V..KQ.........GGEIRD-LHWQV-----------------
E8RSC3_ASTEC/1136-1358-----------------------LVDISAVRTS....Q..DG.........VFSEVE-LKAGW-----------------
D9SHW3_GALCS/1021-1263-----------------------LGRFELIGTP....E..GQ.........NWRLRR-LHITN-----------------
D5CU11_SIDLE/1024-1263-----------------------LGKLEMNMSE....S..DG.........DVLLDN-LQLVN-----------------
C6WWM2_METML/1053-1294-----------------------LGSLELIAYP....E..ND.........NWDIQK-IKFNT-----------------
C6XD69_METGS/1043-1284-----------------------LGRLELQASE....Q..ND.........DWSIEK-LKIIN-----------------
C6XK02_HIRBI/884-1092-----------------------LLNSKIVLDM....N..PE.........TLERGL-VSGTI-----------------
C7PC84_CHIPD/564-796-----------------------MSNLSGNLLL....K..DE.........TVSMQQ-IKANA-----------------
E6WGF8_PANSA/1014-1257-----------------------FGHMQALLQP....R..GD.........TLALTN-GSVDT-----------------
D2UF54_XANAP/1023-1265-----------------------FGAASLRTRK....L..AD.........GMQVDQ-LHLRS-----------------
D3SBX9_THISK/1040-1287-----------------------LADVHLALGP....V..NQ.........GLRVDS-LRARG-----------------
Q0ABM3_ALKEH/1048-1290-----------------------LGRLDLRVTP....E..GD.........SARFES-IRLDT-----------------
Q0AQ38_MARMM/879-1092-----------------------LDQFNLIWRS....E..AA.........GIRAVS-VSGNA-----------------
Q11YL6_CYTH3/532-755-----------------------ASKITSKIEW....N..FP.........YLNFTN-SNLIF-----------------
Q11YT8_CYTH3/698-925-----------------------MTNMKGAIIV....R..NG.........IVKMDK-LNFNS-----------------
Q145G0_BURXL/1154-1409-----------------------VGRLEVDAHN....F..DEDG.....VPVWQLDK-LDITN-----------------
Q15ZG8_PSEA6/1002-1243-----------------------LGRVDFKLSR....A..AN.........GMHIDS-LRLNN-----------------
Q211X0_RHOPB/871-1087-----------------------LRPVSGLLRS....D..GG.........SLIIDK-LTGKI-----------------
Q28TM9_JANSC/371-572-----------------------LSEIDLRSTL....T..RG.........RLVFDI-ASIRT-----------------
Q2KY05_BORA1/936-1183-----------------------LGELQLLGTN....TEVGH.........RWRLDK-LQIRN-----------------
Q2NWP0_SODGM/1012-1255-----------------------LGQISATIQP....Q..QD.........TLMLTG-GVIDT-----------------
Q3IFH7_PSEHT/1008-1245-----------------------LGKVSASLLG....D..GK.........RLVISE-LVVDK-----------------
Q47VG9_COLP3/1038-1280-----------------------LGEVDVNIKR...ID..QQ.........TIEFKN-FTAKR-----------------
Q5R0H7_IDILO/1003-1244-----------------------LGEVELVLAP....L..ED.........GFSIEK-MALKK-----------------
Q7MHE2_VIBVY/1031-1272-----------------------VGKVNIDLQR....Q..GK.........ALVWKN-ISLVS-----------------
Q7UYB4_RHOBA/752-985-----------------------AGNAHSALVA....T..ANFQS...SKWSVNFPS-VRSRV-----------------
Q8EA16_SHEON/1025-1268-----------------------FGKLVVQASP....Q..AS.........GYRIQT-LSLTT-----------------
Q9ZDH9_RICPR/624-849-----------------------FRNVKFYLAN....H..NN.........LLQFNN-IEAEL-----------------
A8GK60_SERP5/1034-1277-----------------------LGKVEADLAN....Q..GD.........TLTLEH-GLVDT-----------------
C4YU88_9RICK/640-864-----------------------LKNVKFYVAN....N..NN.........LLQFNN-IEAEL-----------------
C5BC15_EDWI9/1004-1246-----------------------LGKVAADMRV....E..GD.........TLQLTD-GLLDS-----------------
D3HJX5_LEGLN/1065-1312-----------------------IGNITLKSQS....S..VG.........KWSINY-CRIDS-----------------
D5CDA5_ENTCC/1010-1252-----------------------.GRIDGDFAI....Q..GN.........TLSLTG-GLVDT-----------------
E0SHA8_DICD3/1031-1273-----------------------.GQVKGTLQP....E..PN.........KLVLAN-GLVDN-----------------
F4AYZ2_KROS4/566-791-----------------------LSNTKGSVTI....A..NE.........QASLSN-LNSGI-----------------
G2J3B5_PSEUL/1018-1258-----------------------.GKLELHAVQ....S..GK.........DWLLDR-FVLRS-----------------
I0DWA9_PROSM/1000-1242-----------------------LGKLSAHLKP....Q..GN.........TLQLSG-GTLSN-----------------
M1FEQ6_9ALTE/970-1216-----------------------LGQWSFLLRP....Q..AG.........GVSIES-IEGKL-----------------
N0B6U7_9RHIZ/961-1176-----------------------LRNVKMQIET....R..GG.........NLTALN-VKGTL-----------------
Q0KCK4_CUPNH/1119-1370-----------------------..KLEVKAHTGTSSA..DP.........VWTLEK-LQIEQ-----------------
Q0VS66_ALCBS/1022-1263-----------------------FGQWQAELRP....T..EQ.........GLRIND-LQGRW-----------------
Q2K6G4_RHIEC/885-1104-----------------------.SDFTSNVAY....K..GD.........ELQLND-MAGNW-----------------
Q32B94_SHIDS/1009-1252-----------------------FGRIDSDITI....S..GN.........TLTLTN-GLIDT-----------------
Q5ZUN8_LEGPH/1014-1261-----------------------IGNITLKSHS....T..SE.........QWKIDY-CRIDS-----------------
Q63R38_BURPS/1120-1377-----------------------IGRLEVDARN....V..DENG.....IPVWQLDK-LELAN-----------------
Q6LMA6_PHOPR/1035-1276-----------------------LGKVSGKLRK....D..NN.........TLVLQN-LQVKS-----------------
Q8P7K3_XANCP/1032-1273-----------------------.GAATLRSSR....L..TD.........GMQVDQ-LQLRS-----------------
Q9KUU5_VIBCH/1028-1269-----------------------IGQANVDFQR....Q..GD.........TLLWKS-IDFTS-----------------
Q9PEA2_XYLFA/983-1225-----------------------FGRMELRTRH....M..SD.........GMQVDQ-LQTNS-----------------

PF05170

Q87TE2_VIBPA/1-570LQNVRSQDAQ..........LPYIEQVDVWLNP---DIRRDG---------KWIIDS-LLIDG-----------------
Q9KNJ9_VIBCH/1-570LSGVQIASEP..........TIELQQMDLWLNP---YGLLEQ---------QLEIDS-VLIDG-----------------
Q9HU38_PSEAE/1-636LHDTSIASAATPTKP.....FADLQMLGLSVRV---LPLLRK---------DVQMSA-IRVEG-----------------
Q9KT66_VIBCH/1-595LGKTELKNPQGFASP....NLFKVESVGIDVSV---MPLLDK---------QLKIGN-IRLDG-----------------
Q9JY87_NEIMB/8-615LKNLTITEPGGDQT......AVSVQETKIGLSW---KNLWSD---------QIQIEK-WVVSS-----------------
Q9ZDI1_RICPR/1-711LSEIKLSSINGAKVP....HLVSVEAVKASLRL---FPLFRG---------VIEVAL-IELQK-----------------
Q9HUT4_PSEAE/1-577AEDITLGNPEWTAGKTKASEFASLERIEFRLAP---LPLLWQ---------TIRIPQ-IKLTQ-----------------
YHJG_ECOLI/1-582AEDIILGNPPDIPEV....TMVHLPRVEATLAP---LALLTK---------TVWLPW-IKLEK-----------------
Q7MQ04_VIBVY/1-571FKNVSFTHNE..........VSYIEQLEIWLSP---ELYANG---------RVQIAS-VLLDG-----------------

PF04357

A2U1I0_9FLAO/1175-1633------------------------SK..FTILD...AN--RN---------SLVLSG-.KILT...............ES
Q83EW1_COXBU/570-928------------------------EG.Y........SQ--NQ---------PIQITG-.QTRL................D
Q1D0C2_MYXXD/935-1291------------------------EH..LQGQL....N--DG---------RVSARG-.DVRL...............ER
A5FB26_FLAJ1/992-1420------------------------RNNQLTDT....KY--KT---------KGLLNG-.TIEH...............HN
Q8YZJ8_NOSS1/1412-1829------------------------QG..IQATY....N--QG---------LVSASG-.NLPIF............ATG.
A4CK93_ROBBH/998-1431------------------------QNIRLTDR....AE--GT---------TAVLDG-.TISH...............QF
A3U6I2_CROAH/1185-1647------------------------DNFKIAD.....EK--KN---------TFTVDG-.DVFT...............ES
A0LGH5_SYNFM/889-1254------------------------DRAGMK......VL--GG---------HVELTG-.RLDY.................
A3HZ37_9BACT/1160-1620------------------------SQFTVKD.....AD--NN---------TFIVDG-.SILT...............ND
A5GSG8_SYNR3/973-1387------------------------ER..FSARS...GE--.G---------SIDGQG-.NLA.F............RQE.
A6L590_BACV8/1012-1461------------------------GSLDFRNVKVYDRE--GH---------DGLVNG-.YLHH...............TK
A0M1P1_GRAFK/1180-1639------------------------DNFNIED.....AN--DN---------SIVVNG-.KIIT...............EN
Q2S2D2_SALRD/1057-1516------------------------RTLRVQD......E--EG---------TATVDG-.SILF...............ND
Q21Y28_ALBFT/928-1291------------------------QG..AG..G...AS--GG---------QLSITG-.SVLWL.............PPT
Q6MKB2_BDEBA/958-1321------------------------NS..INGQI....A--GG---------TLTGDG-.GIQI...............NG
Q39RU7_GEOMG/1016-1376------------------------ES..L.RAK...SG--AG---------TLTATA-.VIGL................D
Q7VBL9_PROMA/867-1309------------------------QT..LTARI...GD--KG---------VVKANG-.GMYIF............RDD.
Q016Y8_OSTTA/1647-2059------------------------DD..VEAR....SG--KG---------VLRMKG-.AMPILKPSRPAGGETWEGLVA
A5FIP0_FLAJ1/1183-1626------------------------DKFSLFD.....EN--DN---------ELYVNG-.NIKS...............PD
Q8KFW2_CHLTE/1034-1479------------------------GR..LEVKD...AE--NG---------TGAVSG-.MIGL...............DG
A6H009_FLAPJ/1018-1446------------------------RNIKITDS....KY--ST---------KGILSG-.GIKH...............HN
B5E9K2_GEOBB/1121-1484------------------------ER..L.RAR...SG--EG---------ELVGNL-.LVQL................N
Q11I59_CHESB/1185-1538------------------------RS..ASAAL...AA--GG---------LLSLSG-.TIST...............SA
Q11VR9_CYTH3/1167-1624------------------------KSFNILD.....SL--NN---------EAIING-.TVGI...............EK
A7HQ23_PARL1/1042-1395------------------------T...MSARD...SG--DG---------RLTGEG-.TVSL...............AA
Q7MT86_PORGI/1036-1486------------------------TRMRFENMLVSDPD--GH---------TARLNA-.HISH...............RA
Q3AQ57_CHLCH/1053-1500------------------------RN..ITLSD...NN--NG---------KGSIRG-.FVHL...............EK
A1BDC7_CHLPD/1048-1494------------------------RD..LRIAD...LQ--NG---------TGSLNG-.LLKI...............EN
Q6MAC5_PARUW/935-1288------------------------KH..FSAEN...SK--HG---------SITAKG-.KISL...............DK
Q1QWE2_CHRSD/954-1312------------------------EG..FVAG....EE--.G---------RLDLVG-.DADW.................
Q2RSJ7_RHORT/1146-1500------------------------D...LDARD...GG--KG---------RVSLKG-.RVLL...............VD
Q2S346_SALRD/1311-1689------------------------EQARLRT.....PN--GG---------SLRADG-.TISL...............PE
Q2INP6_ANADE/946-1304------------------------ED..LGALL....N--GG---------HARFTG-.EVEL...............AR
Q9RUC9_DEIRA/223-627------------------------DA..RSRSTNPVTG--AG---------TLTLSG-.ALTP.................
Q1LSN0_BAUCH/634-981------------------------QG..FIG.....TT--HG---------QIYLNG-.YADW...............CN
B3ELK5_CHLPB/1036-1483------------------------RD..IQIKD...VR--GG---------TGRING-.SATL...............EN
Q8YUC2_NOSS1/1659-2048------------------------EG..LEGKF....S--RG---------QVQASG-.AIPVFD...........NSS.
Q1MQI4_LAWIP/1025-1382------------------------SHIQATASD...GK--QG---------SIQLIG-.NIGS................S
Q7VQN5_BLOFL/933-1286------------------------DG..VVNV....MN--GG---------RLYLDG-RIINF...............NV
Q31MA1_SYNE7/1177-1568------------------------ET..LSSNF....N--GG---------TLTAQG-.ILPIAQ..........LLPAS
B4E8E1_BURCJ/988-1340------------------------.....EFH....GG--DG---------TLRALG-.RVRL................D
E3G0N9_STIAD/1177-1560------------------------.E..LFAR....AG--AG---------ELKLTA-.DAKA................T
F4B3D6_KROS4/1021-1426------------------------............KY--KT---------LGALNG-.SISH...............KS
Q46LW1_PROMT/887-1319------------------------.D..LKANM...GA--NG---------IISSQG-.GISL..............FDS
TAMB_HAEIN/952-1298------------------------..............--DS---------HLNLTG-.RANW...............AN
Q5NNB3_ZYMMO/1036-1389------------------------.K..MTGK....AG--KG---------TLTAKG-.YASF...............DA

PF05359

Q4K5X6_PSEF5/140-291----------------------------FPVRI----E-------------RIKLAG.GYLHF-----------------
Q4K5X6_PSEF5/360-511----------------------------WQVLL----K-------------DVQLRN.YQVHL-----------------
B2JQ93_BURP8/874-1021----------------------------VRLHF----G-------------QLVLQN.GRVNY-----------------
A0RMT1_CAMFF/653-798----------------------------FKLSL----K-------------NLTLKN.GSLEF-----------------
Q72DG8_DESVH/963-1109----------------------------DRFTL----G-------------EVTVRG.GKIAF-----------------
A9BMN7_DELAS/883-1036----------------------------PVIKI----G-------------PIVLTG.GRVQF-----------------
A7ZFK9_CAMC1/750-895----------------------------LKFSV----K-------------NFSLKN.GEVDF-----------------
Q2LUD1_SYNAS/534-687----------------------------WQYGV----K-------------KVALND.IGVHW-----------------
A8ZWF7_DESOH/636-783----------------------------TPIQI----G-------------RFLMNN.TELKF-----------------
Q3A6W6_PELCD/375-529----------------------------LPLHL----K-------------RFELRD.ARLLW-----------------
Q5NYY7_AROAE/382-536----------------------------PVFLL----D-------------EAKISG.ATVRF-----------------
Q2KWF8_BORA1/759-906----------------------------PDMSV----N-------------SVTLKR.GRMSF-----------------
Q484B1_COLP3/382-534----------------------------WDLEI----K-------------AISTSN.NNIVI-----------------
A2SI01_METPP/870-1017----------------------------PQLRW----R-------------EIRLAG.GTVDF-----------------
Q8Y0Z7_RALSO/615-766----------------------------WAVTV----Q-------------ALRLDN.GAIGF-----------------
Q5QWM2_IDILO/380-527----------------------------FGITI----E-------------GVELSD.GDVQF-----------------
Q0VP61_ALCBS/592-737----------------------------WQVTV----D-------------KLRLVG.SQVRH-----------------
A3QD21_SHELP/699-846----------------------------MALSI----N-------------KIVFKD.GSTFF-----------------
Q63NS2_BURPS/645-797----------------------------WRYRI----D-------------ELNVKD.AKANF-----------------
Q47FN3_DECAR/732-879----------------------------VPIKI----A-------------KITLQN.GTVNF-----------------
A0KK00_AERHH/368-522----------------------------WRWSL----K-------------QTRIEQ.GQLKL-----------------
Q0JZH1_CUPNH/670-829----------------------------WKADI----G-------------KVTVEG.GSARL-----------------
Q2LUD1_SYNAS/785-932----------------------------VPIKI----N-------------RVTLQG.GRVNF-----------------
A1ARF1_PELPD/790-937----------------------------HQISI----G-------------AVTIQD.GTIAF-----------------
Q39RS7_GEOMG/568-719----------------------------FRYRI----A-------------SVAASG.LGLTF-----------------
B9M3X2_GEODF/795-942----------------------------PEIRI----D-------------TVTLQE.GTVSF-----------------
Q8Y0Z7_RALSO/185-339----------------------------ARFVF----A-------------NLQLNN.GAIQF-----------------
Q3JBN6_NITOC/584-731----------------------------LPIAI----N-------------SIRIKK.GSANF-----------------
Q5DZ89_VIBF1/399-549----------------------------WLVTL----D-------------GIEIKD.YQLNV-----------------
Q1QTZ9_CHRSD/145-295----------------------------APLRI----D-------------RLTVSD.GRLDW-----------------
A9BMN7_DELAS/165-317----------------------------VGFAL----Y-------------NIALRD.GRVEL-----------------
A9BMN7_DELAS/379-538----------------------------WKVSL----D-------------RLSVAH.ATVHW-----------------
Q87WR1_PSESM/386-537----------------------------WQVLL----R-------------DVQLRN.YTVHL-----------------
B2JQ93_BURP8/616-770----------------------------WHYSI----A-------------ELNLKN.GAATF-----------------
A1K6C3_AZOSB/734-881----------------------------FPLRV----E-------------RVELRD.GIVEF-----------------
Q603H4_METCA/718-865----------------------------WLVTV----E-------------AVRVEK.GDIDF-----------------
Q47VC1_COLP3/500-655----------------------------V.FSF----K-------------ELRFINENSFAF-----------------
Q15PY6_PSEA6/662-809----------------------------MAINI----G-------------EIRLLG.GSAYF-----------------
Q88DW4_PSEPK/365-516----------------------------WQVLL----K-------------DVQLRN.YLVHL-----------------
A0KK00_AERHH/578-725----------------------------PRVSI----A-------------QVRTEQ.GNLRF-----------------
B5ECC6_GEOBB/569-721----------------------------FAYRV----Q-------------RLQLDG.FKLAF-----------------
Q2LUD1_SYNAS/159-313----------------------------MRFSL----N-------------NIRITQ.GRIEF-----------------
A4VPN2_PSEU5/551-698----------------------------LAIRI----G-------------GINIAD.GSANF-----------------
Q0VP61_ALCBS/382-530----------------------------WVTRL----D-------------NLAIEG.NTLRL-----------------
A1K7K6_AZOSB/583-736----------------------------WSVGV----Q-------------KLALSD.ASLRL-----------------
Q3JBN6_NITOC/369-521----------------------------WRAAI----K-------------KIKVEN.VSASL-----------------
Q5NYY7_AROAE/832-979----------------------------PPISI----G-------------KILIKQ.GNIAF-----------------
Q13S79_BURXL/640-791----------------------------WHYKI----G-------------ELVLKD.ATANF-----------------
Q47FN3_DECAR/504-656----------------------------WIGKV----G-------------KLAVED.LAFRF-----------------
Q316X0_DESAG/862-1008----------------------------SDVRL----G-------------GAFISD.GTVHF-----------------
Q602F3_METCA/416-565----------------------------WAFSL----G-------------EGVIRN.YRLNL-----------------
Q2Y5K5_NITMU/673-818----------------------------LPISI----G-------------RIVMQG.GHVNF-----------------
B3E4B8_GEOLS/816-963----------------------------GQIKI----D-------------TLTVQD.GTIAF-----------------
A4VPN2_PSEU5/341-492----------------------------WQVLL----H-------------DAQLRD.YRMHL-----------------
Q5NYY7_AROAE/153-307----------------------------ARFSL----N-------------NIRVID.GKLLV-----------------
Q30NX8_SULDN/563-715----------------------------YNVKL----D-------------SFDMNG.AKLLF-----------------
C1DFK3_AZOVD/367-518----------------------------WQIVL----A-------------DVRLRG.SRLYL-----------------
Q484B1_COLP3/604-751----------------------------FTADI----N-------------EINITN.GKLDF-----------------
Q5NYY7_AROAE/604-757----------------------------WSFAL----E-------------RLAFDD.WAVRF-----------------
Q602F3_METCA/623-770----------------------------FAVTV----G-------------SLLVRD.GSADF-----------------
Q316X0_DESAG/389-538----------------------------FSIQL----D-------------AASVTG.GSVAL-----------------
A5G9K9_GEOUR/137-293----------------------------PRFSL----N-------------NIAVTN.GSIDF-----------------
B2JHK1_BURP8/152-309----------------------------AEKLI----D-------------HIAFAD.GRFVF-----------------
A5G9K9_GEOUR/551-702----------------------------LSYRI----G-------------RVSGAG.MNIVF-----------------
A0KK00_AERHH/151-307----------------------------LLVQI----N-------------QLAAEQ.GHITY-----------------
Q1H1L3_METFK/780-927----------------------------FPVAI----E-------------RIRIDN.ANLEF-----------------
B9M7L7_GEODF/383-534----------------------------LRYGI----G-------------RISGTG.VNVVF-----------------
A4SXW3_POLSQ/414-561----------------------------FGLDI----K-------------TLGMKN.GEVFF-----------------
B9M3X2_GEODF/564-715----------------------------FHYTV----S-------------SVVGKG.IDVSF-----------------
A4G9D7_HERAR/154-308----------------------------ARFSV----F-------------NIELDK.GRIEF-----------------
Q21F55_SACD2/584-731----------------------------MALTI----G-------------KIEILQ.SAGHF-----------------
Q7NY28_CHRVO/704-851----------------------------PQVDV----H-------------SIHVQN.GAVEF-----------------
Q0JZH1_CUPNH/164-317----------------------------ARFSV----N-------------NIAVTG.SSFGY-----------------
A1TWZ4_MARAV/597-744----------------------------FIFRI----G-------------ELVVEQ.GSMAY-----------------
B3E4B8_GEOLS/367-514----------------------------LQLMV----E-------------NLALTD.GAVSF-----------------
Q2IFA1_ANADE/563-710----------------------------WRTAI----G-------------SVEVVG.GRVAL-----------------
Q1QTZ9_CHRSD/348-494----------------------------MHVAI----G-------------TLAIER.GAVAF-----------------
Q11NN1_CYTH3/142-298----------------------------LPIEI----N-------------RFEIHN.GKIKY-----------------
Q9HV64_PSEAE/140-291----------------------------FPLRI----D-------------RIQLAE.GSLHF-----------------
Q3SGZ4_THIDA/733-880----------------------------FPLSV----G-------------RLRITG.ANAEF-----------------
Q3A6W6_PELCD/162-316----------------------------FGVML----T-------------DLEITG.GLIHF-----------------
Q316X0_DESAG/600-751----------------------------WSFTV----Q-------------KAALQN.SECVL-----------------
A1TWZ4_MARAV/166-321----------------------------PRLYF----Q-------------QVTIDG.GELLF-----------------
B9M7L7_GEODF/592-739----------------------------GMIRI----G-------------TITMQS.GTLSF-----------------
Q222N5_ALBFT/496-646----------------------------WVAVA----K-------------TVELSK.FGADV-----------------
Q3A6W6_PELCD/805-951----------------------------VTLGI----G-------------GLQISD.ANLVM-----------------
A5G9K9_GEOUR/769-916----------------------------RLVRI----D-------------TVTMQD.GTLAF-----------------
A2SI01_METPP/623-775----------------------------WQ..V----G-------------ELSCSN.CRVTL-----------------
Q083W9_SHEFN/492-642----------------------------WLVTL----D-------------KISIAQ.YQVKL-----------------
Q083W9_SHEFN/725-872----------------------------MKLNI----N-------------KIGFTD.SSAFF-----------------
Q12MK5_SHEDO/654-801----------------------------LSFEI----E-------------RIRFDK.SSAFF-----------------
Q3SGZ4_THIDA/517-669----------------------------MALHL----G-------------RLGLND.IAVEV-----------------
A1ARF1_PELPD/573-725----------------------------FSYRL----R-------------RFQTDR.LNLAF-----------------
Q39RS7_GEOMG/801-948----------------------------RQIAI----D-------------TVILQE.GTLAF-----------------
Q603H4_METCA/502-653----------------------------WRYAV----Q-------------QFVLED.FGLAL-----------------
Q222N5_ALBFT/149-300----------------------------PRVIV----E-------------QLALEQ.GTVDM-----------------
A8ZWF7_DESOH/412-569----------------------------FVVDV----D-------------RFVLTG.GTARF-----------------
A4XYD1_PSEMY/354-505----------------------------WQVLL----Q-------------DVQLRD.YKAHL-----------------
Q484B1_COLP3/152-304----------------------------WILSI----D-------------KFRHNE.GIINF-----------------
Q21F55_SACD2/154-306----------------------------PRIRI----S-------------DIQFSI.ARIDL-----------------
Q3SGZ4_THIDA/147-307----------------------------VRLLV----D-------------HIRIAD.GRVAY-----------------
A7I315_CAMHC/662-807----------------------------FDFTL----K-------------NIKLLG.GEIDF-----------------
Q74FC9_GEOSL/787-934----------------------------RAITI----G-------------AVTMQA.GTLDF-----------------
A7H8M2_ANADF/367-518----------------------------WRWSV----G-------------ALAVTG.LAVEL-----------------
F2GAL8_ALTMD/716-863----------------------------LAIAV----G-------------GVSIEN.GRAYF-----------------
Q5DZ89_VIBF1/610-757----------------------------FALSV----R-------------KIAFNN.GSAFF-----------------
A4XYD1_PSEMY/562-709----------------------------LAIRI----G-------------GVAIND.GSANF-----------------
B3E4B8_GEOLS/583-736----------------------------LSWQV----K-------------KINVTG.LSTTF-----------------
C1DFK3_AZOVD/141-292----------------------------FPVHL----D-------------RFLLSA.GQIHF-----------------
Q1LGA7_RALME/681-840----------------------------WKVRV----G-------------KMAVDG.GSARL-----------------
B5ECC6_GEOBB/807-954----------------------------RQVSV----G-------------SVTIQN.GTLSF-----------------
Q2IFA1_ANADE/358-509----------------------------WRWSV----G-------------ALAVSG.LAVDV-----------------
A4XYD1_PSEMY/140-291----------------------------FPLRI----D-------------NLHLRE.KALHF-----------------
A7H8M2_ANADF/165-318----------------------------PRVSI----G-------------RLAVEE.ASVTF-----------------
A3QD21_SHELP/453-602----------------------------WHAKL----E-------------KISLSN.YQLNL-----------------
Q3A6W6_PELCD/588-738----------------------------WQTQL----A-------------ELKLVD.GQISI-----------------
A7H8M2_ANADF/579-726----------------------------WRTAI----G-------------AVQVVR.GRASF-----------------
A8ETY5_ARCB4/612-759----------------------------TKLNI----G-------------PVNIKN.AVLDF-----------------
Q30NX8_SULDN/772-919----------------------------LSYKL----L-------------NLKVTN.GSANF-----------------
A4VPN2_PSEU5/125-276----------------------------FPLRI----D-------------QLQLVR.GHLAF-----------------
Q1LGA7_RALME/173-326----------------------------ARFSV----S-------------NIAVTN.TSFVY-----------------
Q1H1L3_METFK/561-712----------------------------WAFDL----K-------------RFAIED.AGLHF-----------------
Q222N5_ALBFT/710-857----------------------------FPVRI----R-------------RLRLQN.AKLDF-----------------
C1DFK3_AZOVD/584-731----------------------------LGIRI----G-------------AVEIKN.GSANF-----------------
B2U875_RALPJ/869-1016----------------------------.DLRV----D-------------AITLQD.GNIRF-----------------
B4EKU9_BURCJ/620-772----------------------------WHYRI----D-------------ALNVKE.ASANF-----------------
D0J281_COMT2/165-316----------------------------.SFAL----Y-------------NIALRD.GRIEL-----------------
M1FB64_9ALTE/585-727----------------------------.IFRI----G-------------ELQLDN.ADVDY-----------------
Q63NS2_BURPS/160-304----------------------------.RFSV----S-------------NIQVND.GRIEF-----------------
Q7VVF7_BORPE/156-309----------------------------.RFSL----N-------------NMVLEG.GEITL-----------------
Q7VVF7_BORPE/538-685----------------------------.....----E-------------GAALRL.SDLSL-----------------
Q87WR1_PSESM/155-306----------------------------FPLRI----G-------------EIKLAD.GYVHF-----------------
Q88DW4_PSEPK/140-291----------------------------FPLRI----G-------------SIKLID.GYLHF-----------------
Q88DW4_PSEPK/581-725----------------------------..IHI----G-------------QIDIND.GSANF-----------------
Q8EDF6_SHEON/666-811----------------------------..LDI----Q-------------KISFNQ.GSAFF-----------------
Q9HV64_PSEAE/476-627----------------------------WNIVL----R-------------DAQLRG.YKAHL-----------------
Q9HV64_PSEAE/692-837----------------------------..IHI----G-------------GVRINN.GSANF-----------------

PF13116

C6XK02_HIRBI/457-744-----------------------KASPQQIIS.YWP..-------------.VKLGS-GARDW-----------------
Q7NW94_CHRVO/514-796-----------------------QIKAARVAA.YLP..-------------.RHVGE-HTSSW-----------------
Q7N037_PHOLL/501-786-----------------------VYDAGDAWR.YFPE.-------------.PLMGT-PLTDY-----------------
A7ZDM6_CAMC1/160-458-----------------------ARSIKDFIDELDRR.-------------.IELNS-EVKSW-----------------
A4XQL3_PSEMY/513-798-----------------------DGDAAYTEK.YLPSR-------------SPGMSA-ELDKW-----------------
Q3J7T7_NITOC/517-810-----------------------KIDLAALPQ.YLPS.-------------.PAMKP-GLVRW-----------------
D5CU11_SIDLE/524-805-----------------------RVAVQRTGR.YTPL.-------------.PAVNK-ATHDW-----------------
A1AVR0_RUTMC/242-525-----------------------RMNVINISD.YLPM.-------------.VLIGD-INHQW-----------------
Q31FH6_THICR/496-774-----------------------PDKLSFVKQ.YLPY.-------------.GLMSS-KLENW-----------------
Q2NWP0_SODGM/504-789-----------------------LDNAADAWR.YFPE.-------------.PLMGT-RLVDY-----------------
B8GV04_THISH/540-825-----------------------DGDGSRTAA.YLPV.-------------.GIMPQ-NTSRW-----------------
A0RPG5_CAMFF/10-294-----------------------ANSIEKFIDNLAEK.-------------.TDLHT-EIKNW-----------------
Q07WQ4_SHEFN/504-791-----------------------INDVSHLGR.YFPL.-------------.MAMSP-NLTTY-----------------
Q5ZUN8_LEGPH/507-795-----------------------GKNLQKWMP.YLPK.-------------.KHMKA-KLFAW-----------------
Q7VFV2_HELHP/222-511-----------------------LYNLESIKP.YILK.-------------..LNNP-TLNNW-----------------
Q12IX1_SHEDO/530-817-----------------------VKQAQHLGD.YFPL.-------------.AAMSP-ELVEY-----------------
Q15ZG8_PSEA6/490-776-----------------------GLDVAQVNQ.LLPG.-------------.VVMGK-DTKAY-----------------
A6Q385_NITSB/202-483-----------------------NRQLQNLFV.QIPI.-------------....NE-EIKSW-----------------
A8GK60_SERP5/523-808-----------------------LYDAADAWR.YFPE.-------------.PLMGK-HLVDY-----------------
Q3IFH7_PSEHT/493-781-----------------------APDASIAGH.YFPL.-------------.KAMSP-ELVSY-----------------
D9SHW3_GALCS/523-805-----------------------HGEIGHAAR.YIPL.-------------.VALDK-KDSDW-----------------
C7R9G7_KANKD/505-791-----------------------DLKIAELHK.YWPR.-------------.QGMKK-KAVDY-----------------
Q21FT5_SACD2/542-827-----------------------ASNASSHRR.YVP..-------------.KVVPQ-ALYRW-----------------
A7MJB2_CROS8/518-803-----------------------TSDAAQAWR.YFPE.-------------.NLMGK-DLVDY-----------------
C6XD69_METGS/519-799-----------------------QADAQYARF.YYP..-------------.KILGE-HTLAW-----------------
A7I2E8_CAMHC/213-497-----------------------AKSIKNFMDEIALK.-------------.TDMSR-TTKNW-----------------
Q6LMA6_PHOPR/509-794-----------------------ISNAGEAWR.YLPT.-------------.LALGH-DLTDY-----------------
D0L1I5_HALNC/561-853-----------------------DIHVARVPA.YLPR.-------------.NLLGK-NVLHW-----------------
A3Q9Y2_SHELP/509-796-----------------------VKNAARAKY.YFPK.-------------.HAMSE-SLVDY-----------------
A6QAC9_SULNB/206-494-----------------------FGDLKTFID....R.-------------.LPMNE-KVNAW-----------------
A8EUE5_ARCB4/193-478-----------------------FENLKFLKEH.....-------------.LDLPQ-EANEW-----------------
C5ZX33_9HELI/208-498-----------------------FKNINFLLP.LLPP.-------------..FKNQ-LLKEW-----------------
Q1H0H5_METFK/520-800-----------------------RVDGQYARF.YYP..-------------.VMLGE-HTLSW-----------------
Q7MRT1_WOLSU/187-475-----------------------FDSLRFLKD.VVEI.-------------...ENP-NIRAW-----------------
Q47VG9_COLP3/504-793-----------------------NGNAGLVGR.YLPL.-------------.PIMSE-NLVNY-----------------
A4G3G0_HERAR/587-887-----------------------GLELNKIGN.YLP..-------------.LGMNA-QFRTW-----------------
D1B1Z5_SULD5/203-493-----------------------NVELSNFMDFLAPK.-------------.VELEQ-IVKDW-----------------
D3V5J7_XENBS/502-797-----------------------VDDAGEAWR.YFPR.-------------.SLMGA-SLADY-----------------
E6WGF8_PANSA/504-789-----------------------VTDAGDAWR.YFPE.-------------.PLMGH-GLTHY-----------------
F2G3T4_ALTMD/500-787-----------------------PIALNTVSD.LFPA.-------------.GVMGA-NTDKY-----------------
D3VKA4_XENNA/501-791-----------------------LDDSGEAWR.YFPK.-------------.PLMGE-SLTNY-----------------
Q0ABM3_ALKEH/531-818-----------------------DGDASRTAR.YLPL.-------------.RHLPP-AAREW-----------------
A0KFB2_AERHH/486-771-----------------------.KNAANADR.YYPL.-------------.QVMDK-SLVDY-----------------
A6TER2_KLEP7/497-781-----------------------.NDGGQAWR.YFPE.-------------.NLMGK-ALVDY-----------------
B4EX35_PROMH/501-782-----------------------.TDAGETWR.YLPE.-------------.KYVGK-DLTQY-----------------
B7VIB8_VIBSL/505-791-----------------------.YNVGETWR.YLPT.-------------.LALGQ-DLTDY-----------------
D3HJX5_LEGLN/559-845-----------------------.KNWQQWVA.FLPK.-------------.EYLKP-KLYLW-----------------
F0LWR2_VIBFN/505-791-----------------------.YNAGETWR.YLPT.-------------.LALGH-DLTDY-----------------
G9AWD3_PANAN/505-788-----------------------.TDAGDAWR.YFPT.-------------.PLMGH-SLTRY-----------------
I0DWA9_PROSM/493-771-----------------------.DNAGEAWR.YFPQ.-------------.QLMGE-SLADY-----------------
Q5E7X4_VIBF1/495-780-----------------------.FNADQTWR.YLPT.-------------.LALGQ-DLTDY-----------------
Q6DAI1_PECAS/504-784-----------------------.TDAADAWR.YYPE.-------------.LFMGT-DLVDY-----------------
Q74PM2_YERPE/511-794-----------------------.YDATDAWR.YFPV.-------------.SLMGE-KLADY-----------------
Q7MHE2_VIBVY/508-794-----------------------.YNVGETWR.YLPT.-------------.LALGR-ELTDY-----------------
Q83BN5_COXBU/480-760-----------------------.KNINAIKN.YLPS.-------------.RGLSP-HLRAW-----------------
Q8ZLP4_SALTY/504-786-----------------------.DDGSQAWR.YFPE.-------------.NLMGK-ALVDY-----------------
Q9KUU5_VIBCH/504-791-----------------------.FNAGETWR.YLPT.-------------.LALGR-ELTDY-----------------

PF13109

A0RPG5_CAMFF/433-647-----------QK-----NSV--------K-I---------------------------EGD---GLD------------
A6Q385_NITSB/623-836-----------QN-----NNV--------N-I---------------------------SMK---NMH------------
A6QAC9_SULNB/640-854-----------TG-----AKI--------A-I---------------------------EAL---RIH------------
B9L5J2_NAUPA/583-798-----------KQ-----GYL--------L-L---------------------------EGK---NFS------------
C5ZX33_9HELI/638-852-----------KG-----DYI--------T-L---------------------------DAK---EFG------------
D3UGW6_HELM1/730-943-----------LD-----GSI--------Y-I---------------------------KAS---NFS------------
Q30RQ8_SULDN/697-907-----------KN-----NDF--------H-L---------------------------HGE---KFN------------
Q7MRT1_WOLSU/616-829-----------QN-----KRL--------K-I---------------------------EAR---HFN------------
Q7VFV2_HELHP/731-944-----------AY-----SRA--------V-L---------------------------RLS---NFS------------
O25308_HELPY/745-958-----------VH-----GAL--------Y-L---------------------------KAH---NFS------------
Q0PAY6_CAMJE/635-848-----------SS-----NDL--------N-L---------------------------NVS---NID------------

PF13502

A0KFB2_AERHH/999-1241-----------AG-----SQL.-------N-G...------------------------SAE...WLA..G.......--
A1S2S6_SHEAM/1130-1371-----------GA-----ATL.-------K-G...------------------------QGG...WLM..D.......--
A1STZ9_PSYIN/1024-1262-----------EK-----EFT.-------E-I...------------------------SGV...WDQ..........--
A1TW53_ACIAC/1117-1369-----------PE-----ATF.-------T-S...------------------------SGN...WVL.LG.......--
A1U479_MARAV/979-1225-----------GS-----LVL.-------S-G...------------------------DMT...WSI..V.......--
A1WCZ7_ACISJ/1139-1390-----------PE-----AVL.-------T-S...------------------------QGH...WAL.VGS......--
A1WSB5_VEREI/1101-1362-----------PE-----ASL.-------S-A...------------------------QGNWARLNA..TG......--
A1WYY8_HALHL/891-1129-----------PT-----LHL.-------V-T...------------------------SGE...WRS..T.......--
A2U2U5_9FLAO/567-793-----------FG-----GKI.-------G-F...------------------------NGN...VST..K.......--
A3HUH0_9BACT/675-900-----------MG-----GRI.-------A-L...------------------------TGS...YDS..RD......--
A3Q9Y2_SHELP/1046-1289-----------PG-----ITL.-------K-G...------------------------KGA...WSN..S.......--
E0TB83_PARBH/837-1047-----------GE-----GTF.-------A-S...------------------------RLA...PAG..E.......--
A4AMF6_MARSH/560-785-----------FN-----GNV.-------S-F...------------------------DGE...VST..K.......--
A4CG41_ROBBH/574-799-----------LD-----GKL.-------A-L...------------------------NGT...VAT..G.......--
A4VIB7_PSEU5/1014-1255-----------KG-----LRI.-------S-G...------------------------NGG...WGA..G.......--
A5CF63_ORITB/620-836-----------DN-----GEF.-------Q-A...------------------------KGS...ILM..........--
A5FJ68_FLAJ1/564-791-----------FG-----GTI.-------G-L...------------------------TGA...VST..K.......--
A5FUN1_ACICJ/745-973-----------VG-----GRL.-------S-G...------------------------RAI...LTG..AA......--
A6GWN8_FLAPJ/560-787-----------FD-----GQI.-------G-L...------------------------SGL...VST..K.......--
A7HEC2_ANADF/581-801-----------FG-----GAV.-------S-A...------------------------AGTH.LAVA..R.......--
A9CIC7_AGRT5/884-1105-----------MG-----GKL.-------A-G...------------------------RLA...MST..G.......--
A9H3V6_GLUDA/474-684-----------AG-----PSP.-------A-SAIL------------------------TPE...SDG..R.......--
B2FP42_STRMK/1008-1250-----------PD-----QEI.-------D-I...------------------------SGR...WLG..R.......--
F2G3T4_ALTMD/1046-1287-----------DD-----TNI.-------T-A...------------------------SGY...WKH..V.......--
B4S7D6_PROA2/551-781-----------LG-----GTV.-------T-L...------------------------KGY...YST..K.......--
B7VIB8_VIBSL/1027-1268-----------GG-----NKA.-------D-I...------------------------SGW...WEL..Q.......--
B8CI63_SHEPW/997-1240-----------DE-----VSL.-------R-G...------------------------NGT...WSI..L.......--
C1D9M5_LARHH/1015-1258-----------GD-----GQI.-------N-L...------------------------RGV...QRT..Q.......--
C3L4A9_AMOA5/534-754-----------AG-----GKA.-------R-L...------------------------AGS...IST..K.......--
C4L8L8_TOLAT/989-1232-----------AN-----SHF.-------D-G...------------------------QAG...WSI..K.......--
E8RSC3_ASTEC/1136-1358-----------DG-----RNLI-------A-G...------------------------EGS...ALT..R.......--
D9SHW3_GALCS/1021-1263-----------PD-----GTL.-------T-G...------------------------DGL...WRS..E.......--
D5CU11_SIDLE/1024-1263-----------PD-----GVL.-------S-M...------------------------SGK...WQA..........--
C6WWM2_METML/1053-1294-----------PE-----GTI.-------S-A...------------------------EGQ...WNN.WV.......--
C6XD69_METGS/1043-1284-----------PD-----STL.-------T-A...------------------------EGE...WHN..W.......--
C6XK02_HIRBI/884-1092-----------SR-----GKGV-------E-A...------------------------TFE...RDG..G.......--
C7PC84_CHIPD/564-796-----------LQ-----GNM.-------E-V...------------------------NGS...YST..KN......--
E6WGF8_PANSA/1014-1257-----------GS-----SKL.-------S-I...------------------------NGE...WVN..K.......--
D2UF54_XANAP/1023-1265-----------DQ-----QQI.-------D-I...------------------------SGD...WRG..K.......--
D3SBX9_THISK/1040-1287-----------PD-----GDL.-------Q-VQ.G------------------------SGH...WHVLAD.......--
Q0ABM3_ALKEH/1048-1290-----------PS-----FAL.-------Q-G...------------------------DMA...WHY..R.......--
Q0AQ38_MARMM/879-1092-----------FD-----GPF.-------Q-A...------------------------SFG...ASE..T.......--
Q11YL6_CYTH3/532-755-----------CN-----GFY.-------S-G...------------------------KTA...LRILNE.......--
Q11YT8_CYTH3/698-925-----------LG-----GSF.-------L-F...------------------------SGD...YNT..QD......--
Q145G0_BURXL/1154-1409-----------PA-----ATL.-------S-A...------------------------TAN...WRT..STDL....--
Q15ZG8_PSEA6/1002-1243-----------DH-----GLF.-------Y-A...------------------------SGD...WLF..T.......--
Q211X0_RHOPB/871-1087-----------GG-----GDA.-------V-G...------------------------DIA...VRR..S.......--
Q28TM9_JANSC/371-572-----------YE-----GQL.-------A-G...------------------------QFV...ING..R.......--
Q2KY05_BORA1/936-1183-----------DD-----ATL.-------N-A...------------------------TGE...WRL..A.......--
Q2NWP0_SODGM/1012-1255-----------GN-----ARL.-------T-A...------------------------EGS...WLH..N.......--
Q3IFH7_PSEHT/1008-1245-----------ND-----HIL.-------R-T...------------------------HGQ...WQN..G.......--
Q47VG9_COLP3/1038-1280-----------NK-----TSL.-------N-L...------------------------DGS...WLH..N.......--
Q5R0H7_IDILO/1003-1244-----------GS-----DEL.-------A-V...------------------------TGY...WRY..T.......--
Q7MHE2_VIBVY/1031-1272-----------GS-----NRV.-------D-V...------------------------NGD...WTL..D.......--
Q7UYB4_RHOBA/752-985-----------GG-----GQL.-------E-G...------------------------GLL...LSS..G.......--
Q8EA16_SHEON/1025-1268-----------PE-----VSL.-------Q-G...------------------------NGI...WQQ..Q.......--
Q9ZDH9_RICPR/624-849-----------LG-----GKF.-------Q-G...------------------------SGN...ILL..........--
A8GK60_SERP5/1034-1277-----------GK-----GRM.-------T-A...------------------------SGL...WKQ..N.......--
C4YU88_9RICK/640-864-----------LG-----GKL.-------R-G...------------------------SGN...ILL..E.......--
C5BC15_EDWI9/1004-1246-----------GN-----TRL.-------T-L...------------------------SGR...WQQ..Q.......--
D3HJX5_LEGLN/1065-1312-----------PV-----YQF.-------D-I...------------------------QGE...WTE..K.......--
D5CDA5_ENTCC/1010-1252-----------GF-----GRL.-------T-A...------------------------AGE...WVN..N.......--
E0SHA8_DICD3/1031-1273-----------GK-----AKL.-------T-L...------------------------DGS...WQE..S.......--
F4AYZ2_KROS4/566-791-----------FG-----GAA.-------G-L...------------------------SGS...VTT..R.......--
G2J3B5_PSEUL/1018-1258-----------DS-----GLL.-------Q-G...------------------------AAR...ASD..G.......--
I0DWA9_PROSM/1000-1242-----------SA-----TQL.-------K-L...------------------------DAL...WQS..G.......--
M1FEQ6_9ALTE/970-1216-----------ES-----LAL.-------A-G...------------------------EFN...WLL..Q.......--
N0B6U7_9RHIZ/961-1176-----------DG-----GA..-------P-L...------------------------AAE...VDK..S.......--
Q0KCK4_CUPNH/1119-1370-----------PG-----ATL.-------T-G...------------------------SGS...WRV..PRQL...R--
Q0VS66_ALCBS/1022-1263-----------RA-----SRI.-------L-G...------------------------TVD...WTE..D.......--
Q2K6G4_RHIEC/885-1104-----------DG-----GKL.-------S-G...------------------------NLL...FIN..A.......--
Q32B94_SHIDS/1009-1252-----------GF-----SRL.-------T-A...------------------------DGE...WIN..N.......--
Q5ZUN8_LEGPH/1014-1261-----------PY-----YQA.-------N-F...------------------------EGE...WLQ..K.......--
Q63R38_BURPS/1120-1377-----------PA-----AKL.-------T-A...------------------------TAN...WRT..SRRALAHG--
Q6LMA6_PHOPR/1035-1276-----------GA-----TAL.-------N-L...------------------------DAH...WTL..D.......--
Q8P7K3_XANCP/1032-1273-----------DD-----QNI.-------G-L...------------------------TGA...WRG..K.......--
Q9KUU5_VIBCH/1028-1269-----------GT-----NQL.-------H-V...------------------------NGT...WTL..T.......--
Q9PEA2_XYLFA/983-1225-----------PS-----QRL.-------S-M...------------------------FAT...WRG..K.......--

PF05170

Q87TE2_VIBPA/1-570-----------VS-----LKKG-------I-PTQP------------------------NL.---..ESIQFHQIALKNI
Q9KNJ9_VIBCH/1-570-----------AN-----LAHG-------L-...P------------------------NFT---LPESVHLNQLALHNI
Q9HU38_PSEAE/1-636-----------LS-----LDLV-------R-DKQG------------------------KGN---WENIGKPAQPQAPAA
Q9KT66_VIBCH/1-595-----------AE-----FHLE-------T-LKDG------------------------RSN---LDALTQAQSKPASAP
Q9JY87_NEIMB/8-615-----------AE-----LALT-------R-DGKG------------------------VWN---IQDLIDSQKRQASV.
Q9ZDI1_RICPR/1-711-----------PT-----ISLE-------V-LDNG------------------------QKS---WQLYISNNNNTINN.
Q9HUT4_PSEAE/1-577-----------PR-----AELL-------R-LADG------------------------RAN---WDFDLPASDSDEPS.
YHJG_ECOLI/1-582-----------PD-----ARLI-------R-LSEK------------------------NNN---WTFNLANDDNKDAN.
Q7MQ04_VIBVY/1-571-----------LS-----LQTG-------L-SRSP------------------------KTF---IPNTVQIHQLAISNL

PF04357

A2U1I0_9FLAO/1175-1633FINPE......FD-----LQL.-------R-A.KD..FRLLNAKKEDNPSLYGLAT.F.NAN...ADL------------
Q83EW1_COXBU/570-928APGRP......TT-----LTV.-------H-G.EN..LLIVNTHQYI.......IY.G.SGE...LKI------------
Q1D0C2_MYXXD/935-1291FLPQR......LG-----LTI.-------Q-L.DE..VPYRLTEDLP.......AT.F.SGL...LQV------------
A5FB26_FLAJ1/992-1420FGDWK......LD-----LTI.-------T-S.KR..LLALDTKDSEDA..AYFGTAFINGT...ASI------------
Q8YZJ8_NOSS1/1412-1829.ETVT......NP-----LTV.-------A-IQNQ..LNFQVAGLYT.......GD.V.SGN...AVI------------
A4CK93_ROBBH/998-1431FSDWR......LN-----LDV.-------D-T.QGERFLLLNTEYDEEE..LYYGTAFAEGT...GRI------------
A3U6I2_CROAH/1185-1647LINPA......FN-----LSF.-------K-A.KD..FKVLNSTKEDND..LYYGTAIFDLD...ATL------------
A0LGH5_SYNFM/889-1254PSFQT......AK-----LSA.-------S-G.RD..LRVSKVYGIE.......GK.I.SGK...ADL------------
A3HZ37_9BACT/1160-1620FTNPE......FD-----LTL.-------L-A.KN..FMVVNSTDKDNE..LVYGRGTIDAD...VSI------------
A5GSG8_SYNR3/973-1387.GGE.......PG-----LNF.-------T-I.KA..FPIRRPDA.R.......LQ.V.DGS...LKL------------
A6L590_BACV8/1012-1461LKNLM......YH-----FNI.-------R-G.NN..LLMYNTYEAGNM..PFYGKVYGTGN...VVL------------
A0M1P1_GRAFK/1180-1639LLNPG......FD-----LDV.-------Q-A.DG..FRLLNSTEEDND..LFYGTAVVDVD...GTV------------
Q2S2D2_SALRD/1057-1516YQYFS......FD-----LSA.-------S-L.DG..ITVIDVSQAEDL..PFYGRIRGSGP...LHL------------
Q21Y28_ALBFT/928-1291GPDAKVAARLRME-----LDA.-------T-L.AA..LRVSARADRR.......LV.V.SGQ...LSA------------
Q6MKB2_BDEBA/958-1321IKDIP......TT-----IRA.-------R-L.EG..VTFNVPDKVR.......SS.G.SAD...LLF------------
Q39RU7_GEOMG/1016-1376RWRVA.....SYR-----GTV.-------T-G.DR..FQTVNIPEVQ.......ML.A.TPK...LTF------------
Q7VBL9_PROMA/867-1309.KEIS......KE-----LNL.-------V-I.KS..IEFDQNNF.D.......FK.V.SSN...LNV------------
Q016Y8_OSTTA/1647-2059RADTQ......GG-----VKV.-------S-M.DG..LDMRVRNVYS.......GQ.L.NAN...MVA------------
A5FIP0_FLAJ1/1183-1626FRKYN......FD-----LVV.-------E-A.DD..FRAINSKAKDND..LFYGDLFLDTK...LNI------------
Q8KFW2_CHLTE/1034-1479LKPVT......VN-----LSG.-------S-F.SN..LLLYNKKDMKDD..TSFGT.I.RGTTGNLRF------------
A6H009_FLAPJ/1018-1446FGDWF......LD-----LNL.-------A-S.NR..LLALDTKDAEEV..LYYGTAFIDGD...ATI------------
B5E9K2_GEOBB/1121-1484GREIA.....GYT-----GTL.-------S-G.QG..FQTVYLPELR.......MT.T.SPQ...LTF------------
Q11I59_CHESB/1185-1538AAGFP......AD-----LML.-------R-L.NE..ARYADGEMVT.......AT.V.SGG...LQL------------
Q11VR9_CYTH3/1167-1624FDNAT......FN-----LTV.-------T-T.ND..FMILNTTAVNNK..LYYGRVFLDSK...ISI------------
A7HQ23_PARL1/1042-1395DASPA......VD-----IRT.-------Q-F.SD..MQVVRRQDLV.......LA.V.NGA...LAL------------
Q7MT86_PORGI/1036-1486FDDIK......VD-----LKVS-------E-A.RN..ILAYNVPERDNP..NIHGRVYVSGAAYLRDV------------
Q3AQ57_CHLCH/1053-1500LQPSR......LE-----LAA.-------S-C.NN..LLFYNKKDQQDD..TSFGS.I.VGSTRNFTL------------
A1BDC7_CHLPD/1048-1494LKPKT......IT-----LGA.-------N-L.SK..LLLFHKKDTRDE..KPFGT.I.IGSTRNLLL------------
Q6MAC5_PARUW/935-1288KQHFP......FD-----IKL.-------E-P.KQ..IAIMESDYAD.......IE.A.SGS...LQL------------
Q1QWE2_CHRSD/954-1312QDPAAW....RAH-----LEI.-------D-G.QDDPLLVSLPQFGR.......LR.V.APD...LSV------------
Q2RSJ7_RHORT/1146-1500LTRPI......GR-----IDL.-------D-I.TQ..AVVVRRDDAV.......AE.I.SAD...LAM------------
Q2S346_SALRD/1311-1689LTVGE......YD-----LTL.-------N-A.SE..FLAINTAAYR.......RA.VIDGD...MTL------------
Q2INP6_ANADE/946-1304LAPSR......LR-----VEG.-------A-L.DE..VPVALPSYLP.......AT.L.SGR...IEA------------
Q9RUC9_DEIRA/223-627....R......WD-----LNL.-------S-A.RNYNLPVSAIYARE.......SA.L.TGD...FRL------------
Q1LSN0_BAUCH/634-981LHTWH......IY-----VTL.-------K-G.NK..IRIYMPSMRF.......DV...SPN...IIF------------
B3ELK5_CHLPB/1036-1483LEAST......ID-----LTA.-------S-F.EN..LLLFNKQDKKDE..TSFGT.I.TGTSDRIRY------------
Q8YUC2_NOSS1/1659-2048.VAIE......NP-----LTV.-------N-L.EQ..LQLNLKGLYQ.......GG.A.NGN...IQV------------
Q1MQI4_LAWIP/1025-1382KEHFP......LS-----ING.-------S-F.TN..LAPLQRKDLS.......LT.L.SGA...ATL------------
Q7VQN5_BLOFL/933-1286IQNFK......IL-----LNI.-------Q-G.NQ..VDFYLSPTMY.......VK.I.FPK...LTC------------
Q31MA1_SYNE7/1177-1568DPDRE......QP-----LTI.-------A-L.RD..ATIALPNLFT.......GK.T.EAD...LQI------------
B4E8E1_BURCJ/988-1340GEAPD......LT-----ASI.-------V-A.DK..LELFAAPDRK.......LS.L.SGK...ATV------------
E3G0N9_STIAD/1177-1560RGVFE......LT-----GKT.-------H-L.KD..FPIISDDQLL.......AV.V.SLD...STL------------
F4B3D6_KROS4/1021-1426FSDWK......LD-----LGI.-------S-A.TR..IAVLDTEEDLES..LYYGTAFLEGE...AFI------------
Q46LW1_PROMT/887-1319QLSES......EP-----LAL.-------S-I.EK..TRIKTAFT.D.......IR.A.SSS...LVV------------
TAMB_HAEIN/952-1298IEHWT......TE-----LNA.-------Q-A.NN..FNVDIPSMAK.......LR.F.SPN...ITI------------
Q5NNB3_ZYMMO/1036-1389ASDYD......SA-----LNI.-------T-L.DK..ATLARADEMK.......ST.V.SGN...LDI------------

PF05359

Q4K5X6_PSEF5/140-291-----------KD.....LRP--------S-E---------------------------.PIE..FLY------------
Q4K5X6_PSEF5/360-511-----------AD.....RKA--------K-P---------------------------.AVA..LEL------------
B2JQ93_BURP8/874-1021-----------TD.....NFI--------K-P---------------------------.NYS..ANL------------
A0RMT1_CAMFF/653-798-----------KD.....DSL--------A-L---------------------------.PFD..TNI------------
Q72DG8_DESVH/963-1109-----------RD.....ERF--------S-P---------------------------.AFD..TSL------------
A9BMN7_DELAS/883-1036-----------SD.....YFI--------Q-P---------------------------.NYS..ADL------------
A7ZFK9_CAMC1/750-895-----------SD.....ASL--------F-M---------------------------.PFA..TTI------------
Q2LUD1_SYNAS/534-687-----------ED.....QMP--------S-A---------------------------GTAE..IGI------------
A8ZWF7_DESOH/636-783-----------AD.....RSV--------D-P---------------------------.HYA..TRL------------
Q3A6W6_PELCD/375-529-----------QD.....QKV--------K-G---------------------------.GFK..AEA------------
Q5NYY7_AROAE/382-536-----------ED.....RAA--------S-A---------------------------.PFR..TEL------------
Q2KWF8_BORA1/759-906-----------TD.....RFV--------Q-P---------------------------.NYT..AEL------------
Q484B1_COLP3/382-534-----------ND.....SSV--------S-P---------------------------.IAI..HDV------------
A2SI01_METPP/870-1017-----------TD.....NFI--------R-P---------------------------.NYS..AKL------------
Q8Y0Z7_RALSO/615-766-----------ED.....QTN--------S-R---------------------------.PVK..VRV------------
Q5QWM2_IDILO/380-527-----------AD.....KSL--------P-L---------------------------.PFS..TSI------------
Q0VP61_ALCBS/592-737-----------ED.....LSL--------S-P---------------------------.HFR..IGL------------
A3QD21_SHELP/699-846-----------AD.....NSL--------T-P---------------------------.NFA..ASI------------
Q63NS2_BURPS/645-797-----------TD.....RST--------P-R---------------------------.PVK..LAI------------
Q47FN3_DECAR/732-879-----------SD.....FFV--------K-P---------------------------.NYT..VNL------------
A0KK00_AERHH/368-522-----------TE.....SSS--------G-K---------------------------PLL...REL------------
Q0JZH1_CUPNH/670-829-----------ADYQPAGANR--------G-R---------------------------.PVI..HQF------------
Q2LUD1_SYNAS/785-932-----------SD.....RFI--------K-P---------------------------.NYN..ANL------------
A1ARF1_PELPD/790-937-----------SD.....HHL--------R-Q---------------------------.QFT..STF------------
Q39RS7_GEOMG/568-719-----------TD.....RKA--------V-G---------------------------.NPR..FDL------------
B9M3X2_GEODF/795-942-----------LD.....QHT--------P-Q---------------------------.QFG..TTM------------
Q8Y0Z7_RALSO/185-339-----------VD.....Q..--------P-L---------------------------.GAQ..HTV------------
Q3JBN6_NITOC/584-731-----------AD.....LSV--------S-P---------------------------.KFS..MGI------------
Q5DZ89_VIBF1/399-549-----------EE.....KVI--------T-K---------------------------KANL..WQI------------
Q1QTZ9_CHRSD/145-295-----------IN.....RRP--------D-A---------------------------.PLT..LSL------------
A9BMN7_DELAS/165-317-----------QD.....E..--------V-Q---------------------------.RRQ..HML------------
A9BMN7_DELAS/379-538-----------RD.....AAP--------D-A---------------------------GKSGAALQA------------
Q87WR1_PSESM/386-537-----------TD.....RVP--------K-E---------------------------.PVA..LDV------------
B2JQ93_BURP8/616-770-----------TD.....NTT--------A-R---------------------------.PVK..VAV------------
A1K6C3_AZOSB/734-881-----------AD.....FSL--------V-L---------------------------.PFS..TRV------------
Q603H4_METCA/718-865-----------SD.....GSL--------V-L---------------------------.PFA..THI------------
Q47VC1_COLP3/500-655-----------TD.....FSV--------D-P---------------------------.IYQRTLFL------------
Q15PY6_PSEA6/662-809-----------ED.....NSL--------R-P---------------------------.RFA..SSI------------
Q88DW4_PSEPK/365-516-----------AD.....RSQ--------K-E---------------------------.PVA..LDI------------
A0KK00_AERHH/578-725-----------AD.....RSL--------S-P---------------------------.EFV..VDI------------
B5ECC6_GEOBB/569-721-----------TD.....KTY--------E-E---------------------------.PPR..FTL------------
Q2LUD1_SYNAS/159-313-----------DD.....R..--------P-K---------------------------.YRR..HEI------------
A4VPN2_PSEU5/551-698-----------AD.....FSL--------R-P---------------------------.PFV..TAI------------
Q0VP61_ALCBS/382-530-----------TD.....RTL--------N-P---------------------------AQT...MTL------------
A1K7K6_AZOSB/583-736-----------ED.....RMQ--------A-K---------------------------.PVT..LAV------------
Q3JBN6_NITOC/369-521-----------QD.....RTI--------E-P---------------------------.PAT..LNI------------
Q5NYY7_AROAE/832-979-----------SD.....RFI--------R-P---------------------------.NYD..ANL------------
Q13S79_BURXL/640-791-----------TD.....NTT--------P-Q---------------------------.PVK..LNI------------
Q47FN3_DECAR/504-656-----------ED.....QSM--------N-P---------------------------.VAV..QEI------------
Q316X0_DESAG/862-1008-----------RD.....VSV--------S-P---------------------------.PFE..LTL------------
Q602F3_METCA/416-565-----------AD.....HGV--------D-P---------------------------.PAR..IGL------------
Q2Y5K5_NITMU/673-818-----------QD.....QFI--------Q-P---------------------------.NYR..AYL------------
B3E4B8_GEOLS/816-963-----------SD.....VHL--------P-Q---------------------------.QFR..STF------------
A4VPN2_PSEU5/341-492-----------AD.....RVP--------D-D---------------------------.EVQ..LEL------------
Q5NYY7_AROAE/153-307-----------ED.....RPV--------G-L---------------------------...E..HEL------------
Q30NX8_SULDN/563-715-----------DD.....KSI--------Q-D---------------------------.NSK..TII------------
C1DFK3_AZOVD/367-518-----------AD.....RVP--------K-Q---------------------------.DVE..LLV------------
Q484B1_COLP3/604-751-----------SD.....SSL--------T-P---------------------------.KFS..AGI------------
Q5NYY7_AROAE/604-757-----------ED.....RTQ--------G-A---------------------------.PIV..LQA------------
Q602F3_METCA/623-770-----------SD.....LSL--------Q-P---------------------------.SVS..VDI------------
Q316X0_DESAG/389-538-----------HD.....NMV--------E-G---------------------------.GFN..HTF------------
A5G9K9_GEOUR/137-293-----------ID.....RGL--------P-V---------------------------.EKL..HAL------------
B2JHK1_BURP8/152-309-----------YD.....ETI--------S-K---------------------------PPYK..VVV------------
A5G9K9_GEOUR/551-702-----------TD.....GLL--------E-E---------------------------.RPS..FVL------------
A0KK00_AERHH/151-307-----------QD....SRKQ--------S-S---------------------------PGWVPSLTL------------
Q1H1L3_METFK/780-927-----------AD.....LSL--------T-P---------------------------.QFG..THI------------
B9M7L7_GEODF/383-534-----------TD.....EML--------A-G---------------------------.RPS..FTF------------
A4SXW3_POLSQ/414-561-----------TD.....LAM--------R-P---------------------------.NFK..VDI------------
B9M3X2_GEODF/564-715-----------RD.....EAR--------S-S---------------------------.APR..FDL------------
A4G9D7_HERAR/154-308-----------DD.....R..--------P-A---------------------------.QTV..HKI------------
Q21F55_SACD2/584-731-----------AD.....LSL--------P-L---------------------------.PFD..THI------------
Q7NY28_CHRVO/704-851-----------AD.....HGM--------T-P---------------------------.DFA..TRM------------
Q0JZH1_CUPNH/164-317-----------DD.....K..--------Q-L---------------------------.GSS..LRV------------
A1TWZ4_MARAV/597-744-----------TD.....RTL--------E-P---------------------------.PFS..TAF------------
B3E4B8_GEOLS/367-514-----------HD.....RQP--------A-G---------------------------.GFK..SRL------------
Q2IFA1_ANADE/563-710-----------VD.....RSV--------T-P---------------------------.AAV..VNL------------
Q1QTZ9_CHRSD/348-494-----------TD.....RHL--------P-R---------------------------.PFA..LDF------------
Q11NN1_CYTH3/142-298-----------ND.....FHA--------S-P---------------------------.KVD..IFV------------
Q9HV64_PSEAE/140-291-----------QD.....LRP--------S-E---------------------------.PVD..FSF------------
Q3SGZ4_THIDA/733-880-----------AD.....LSL--------T-P---------------------------.QFG..TVM------------
Q3A6W6_PELCD/162-316-----------RD.....DIR--------V-.---------------------------..TE..HTV------------
Q316X0_DESAG/600-751-----------LD.....ETL--------P-R---------------------------.AAR..LTV------------
A1TWZ4_MARAV/166-321-----------RD.....FSQ--------G-G---------------------------DPAE..FRV------------
B9M7L7_GEODF/592-739-----------TD.....RHV--------A-G---------------------------.GYT..TTF------------
Q222N5_ALBFT/496-646-----------AD.....EGA--------G-.---------------------------..VK..VQV------------
Q3A6W6_PELCD/805-951-----------RD.....ERY--------Q-P---------------------------.AVI..NRL------------
A5G9K9_GEOUR/769-916-----------TD.....RYV--------P-R---------------------------.EYS..TIL------------
A2SI01_METPP/623-775-----------SD.....RSV--------K-P---------------------------.VAV..FGV------------
Q083W9_SHEFN/492-642-----------GE.....GIA--------S-D---------------------------KIIL..WQI------------
Q083W9_SHEFN/725-872-----------AD.....NSL--------T-P---------------------------.NFA..SGI------------
Q12MK5_SHEDO/654-801-----------AD.....NSL--------N-P---------------------------.NFS..SGI------------
Q3SGZ4_THIDA/517-669-----------VD.....RSP--------P-T---------------------------.PVR..LDV------------
A1ARF1_PELPD/573-725-----------TD.....KSR--------E-E---------------------------.KPR..FTL------------
Q39RS7_GEOMG/801-948-----------SD.....HHM--------S-R---------------------------.EYD..TTF------------
Q603H4_METCA/502-653-----------AD.....RTF--------A-P---------------------------.AIA..YDL------------
Q222N5_ALBFT/149-300-----------HD.....RRA--------G-Y---------------------------...D..NTF------------
A8ZWF7_DESOH/412-569-----------VDFAVAGPED--------G-P---------------------------VEN....AI------------
A4XYD1_PSEMY/354-505-----------AD.....RVP--------Q-Q---------------------------.EVA..VDV------------
Q484B1_COLP3/152-304-----------SD.....QNR--------E-T---------------------------.AYH..HTI------------
Q21F55_SACD2/154-306-----------LD.....QVP--------A-T---------------------------.PFA..TQL------------
Q3SGZ4_THIDA/147-307-----------RD.....ANR--------A-G---------------------------EPFT..ALL------------
A7I315_CAMHC/662-807-----------ID.....HSL--------M-I---------------------------.PFD..IKI------------
Q74FC9_GEOSL/787-934-----------SD.....RHM--------P-K---------------------------.PYA..TTF------------
A7H8M2_ANADF/367-518-----------ED.....RTP--------A-R---------------------------.PVV..LPL------------
F2GAL8_ALTMD/716-863-----------AD.....HSL--------T-P---------------------------.KFA..SAI------------
Q5DZ89_VIBF1/610-757-----------AD.....NSL--------T-P---------------------------.NFS..SGI------------
A4XYD1_PSEMY/562-709-----------AD.....FSL--------T-P---------------------------.SFA..TAI------------
B3E4B8_GEOLS/583-736-----------AD.....KQF--------S-E---------------------------.PPV..FTL------------
C1DFK3_AZOVD/141-292-----------QD.....QQP--------S-E---------------------------.PVE..VRY------------
Q1LGA7_RALME/681-840-----------ADYEPAEANR--------G-R---------------------------.PVI..HQF------------
B5ECC6_GEOBB/807-954-----------TD.....NHL--------P-Q---------------------------.TFN..STF------------
Q2IFA1_ANADE/358-509-----------ED.....RST--------A-R---------------------------.PVR..LPL------------
A4XYD1_PSEMY/140-291-----------QD.....LRP--------S-E---------------------------.PVE..FAY------------
A7H8M2_ANADF/165-318-----------RD.....ATR--------R-P---------------------------.AFD..TLL------------
A3QD21_SHELP/453-602-----------TE.....QLF--------K-E---------------------------.ENL..WQI------------
Q3A6W6_PELCD/588-738-----------GL.....EGP--------R-Q---------------------------.TST..AVF------------
A7H8M2_ANADF/579-726-----------VD.....RSV--------S-P---------------------------.PAL..VNV------------
A8ETY5_ARCB4/612-759-----------ED.....KNL--------P-I---------------------------.PFK..TTV------------
Q30NX8_SULDN/772-919-----------AD.....YSL--------P-L---------------------------.DFK..TAI------------
A4VPN2_PSEU5/125-276-----------RD.....RRP--------S-E---------------------------.PIE..LVY------------
Q1LGA7_RALME/173-326-----------ED.....K..--------L-L---------------------------.NTV..QRV------------
Q1H1L3_METFK/561-712-----------RD.....QSA--------N-S---------------------------.PVA..LDI------------
Q222N5_ALBFT/710-857-----------TD.....LSL--------R-P---------------------------.QFS..AKI------------
C1DFK3_AZOVD/584-731-----------AD.....FSL--------R-P---------------------------.NFA..TAI------------
B2U875_RALPJ/869-1016-----------TD.....NFV--------K-P---------------------------.NYT..ANL------------
B4EKU9_BURCJ/620-772-----------TD.....LST--------P-R---------------------------.PVK..LAI------------
D0J281_COMT2/165-316-----------ND.....EFV--------Q-R---------------------------...K..HEL------------
M1FB64_9ALTE/585-727-----------TD.....RTL--------K-P---------------------------.ELT..TRF------------
Q63NS2_BURPS/160-304-----------DD.....R..--------L-L---------------------------.NAR..HVV------------
Q7VVF7_BORPE/156-309-----------DD.....KVS--------G-.---------------------------..RQ..QRI------------
Q7VVF7_BORPE/538-685-----------RD.....ESV--------K-P---------------------------.AVP..VSV------------
Q87WR1_PSESM/155-306-----------QD.....VRP--------S-E---------------------------.PIE..FLY------------
Q88DW4_PSEPK/140-291-----------ED.....LRP--------S-E---------------------------.PIE..FLY------------
Q88DW4_PSEPK/581-725-----------AD.....LSL--------T-P---------------------------.NFA..TAI------------
Q8EDF6_SHEON/666-811-----------AD.....NSL--------T-P---------------------------.NFA..SGI------------
Q9HV64_PSEAE/476-627-----------VD.....RQP--------A-T---------------------------.EVP..LEV------------
Q9HV64_PSEAE/692-837-----------AD.....LTL--------M-P---------------------------.PFG..TAI------------

PF13116

C6XK02_HIRBI/457-744-----------AK-----RNIK.......D.G---------------------------RATKLNFFM------------
Q7NW94_CHRVO/514-796-----------LR-----QGLQ.......D.G---------------------------IARNVRMKL------------
Q7N037_PHOLL/501-786-----------LT-----ASII.......K.G---------------------------QIENATFVF------------
A7ZDM6_CAMC1/160-458-----------IY-----GYVV.......A.N---------------------------DYHLNEING------------
A4XQL3_PSEMY/513-798-----------LK-----TAIR.......S.G---------------------------RVEEGYFQY------------
Q3J7T7_NITOC/517-810-----------LK-----QAFP.......Q.G---------------------------GAAEGSLVF------------
D5CU11_SIDLE/524-805-----------LQ-----AALQ.......G.G---------------------------QADKFRVRL------------
A1AVR0_RUTMC/242-525-----------IK-----HAFQ.......S.G---------------------------ELDNINISI------------
Q31FH6_THICR/496-774-----------LK-----AALV.......K.G---------------------------DGIKGRLRV------------
Q2NWP0_SODGM/504-789-----------MT-----GALK.......G.G---------------------------QVDNATLVF------------
B8GV04_THISH/540-825-----------LR-----ESIK.......A.G---------------------------RVTEGTVVY------------
A0RPG5_CAMFF/10-294-----------IY-----GYII.......A.K---------------------------EYTLYSLHG------------
Q07WQ4_SHEFN/504-791-----------LN-----DGLV.......A.G---------------------------QINDAQVVW------------
Q5ZUN8_LEGPH/507-795-----------LN-----NDIK.......R.L---------------------------GQATGKITI------------
Q7VFV2_HELHP/222-511-----------LF-----KNVH.......Y.D---------------------------VLKLHSLRF------------
Q12IX1_SHEDO/530-817-----------LN-----GAII.......K.G---------------------------QIPDASVVW------------
Q15ZG8_PSEA6/490-776-----------LQ-----RALK.......A.G---------------------------YVNGAKILW------------
A6Q385_NITSB/202-483-----------SC-----KKIR.......A.K---------------------------KYRLQFFEG------------
A8GK60_SERP5/523-808-----------LS-----GAIQ.......G.G---------------------------QVDNATLLY------------
Q3IFH7_PSEHT/493-781-----------LN-----GAIK.......G.G---------------------------EVSKAQVLF------------
D9SHW3_GALCS/523-805-----------LN-----DALL.......S.G---------------------------KTEDFRLRL------------
C7R9G7_KANKD/505-791-----------LD-----MSLK.......G.G---------------------------VVERAKLVW------------
Q21FT5_SACD2/542-827-----------LD-----KSIQ.......G.G---------------------------DIKNVGFLY------------
A7MJB2_CROS8/518-803-----------LS-----GAIQ.......G.G---------------------------QVENATLVY------------
C6XD69_METGS/519-799-----------LD-----SAIL.......K.G---------------------------RGQDINVTV------------
A7I2E8_CAMHC/213-497-----------IY-----GNII.......A.D---------------------------NYEIKKFVA------------
Q6LMA6_PHOPR/509-794-----------LS-----AAIR.......G.G---------------------------KADAAQLLW------------
D0L1I5_HALNC/561-853-----------LD-----TNLELPEQGGGQPG---------------------------RVDRGHFVF------------
A3Q9Y2_SHELP/509-796-----------LS-----GAIK.......A.G---------------------------QSQDAKVVW------------
A6QAC9_SULNB/206-494-----------IT-----RKIE.......A.K---------------------------SYRLYMLTG------------
A8EUE5_ARCB4/193-478-----------MY-----NNVT.........G---------------------------DFKLDWLYG------------
C5ZX33_9HELI/208-498-----------IF-----NNYQ.......I.T---------------------------SAQIKEFSL------------
Q1H0H5_METFK/520-800-----------LD-----NAIL.......A.G---------------------------KSEDVSIIV------------
Q7MRT1_WOLSU/187-475-----------LY-----DNIH.......S.P---------------------------GMELASFSF------------
Q47VG9_COLP3/504-793-----------LN-----AAVV.......S.G---------------------------RVEDAQVLI------------
A4G3G0_HERAR/587-887-----------LS-----DALI.......A.G---------------------------TLNDGYIRL------------
D1B1Z5_SULD5/203-493-----------IH-----TNIV.......G.K---------------------------NYVLHFLEG------------
D3V5J7_XENBS/502-797-----------LT-----HSLI.......K.G---------------------------KIENATLLF------------
E6WGF8_PANSA/504-789-----------LS-----DAIK.......G.G---------------------------KVDNATLLF------------
F2G3T4_ALTMD/500-787-----------LT-----RAFT.......GKG---------------------------DIENARVLW------------
D3VKA4_XENNA/501-791-----------LT-----TSLI.......K.G---------------------------KVDNATLIF------------
Q0ABM3_ALKEH/531-818-----------VA-----AAVI.......G.G---------------------------EVTEARVHW------------
A0KFB2_AERHH/486-771-----------LS-----GAIK.......G.G---------------------------KAKGADLLW------------
A6TER2_KLEP7/497-781-----------LS-----GAIK.......A.G---------------------------QASDATLVY------------
B4EX35_PROMH/501-782-----------LS-----DAII.......A.G---------------------------NVKNGTFIF------------
B7VIB8_VIBSL/505-791-----------LS-----TAIQ.......A.G---------------------------KADTVKLLW------------
D3HJX5_LEGLN/559-845-----------LK-----NDLK.......R.I---------------------------AEASGRIRL------------
F0LWR2_VIBFN/505-791-----------LS-----TAIQ.......G.G---------------------------KVTTAKLVW------------
G9AWD3_PANAN/505-788-----------LS-----GAVK.......G.G---------------------------RVDNATLLF------------
I0DWA9_PROSM/493-771-----------LS-----NAII.......A.G---------------------------QAKDATVVF------------
Q5E7X4_VIBF1/495-780-----------LS-----AAVQ.......G.G---------------------------NAKTVQLLW------------
Q6DAI1_PECAS/504-784-----------LS-----GALK.......G.G---------------------------RVDNATLIF------------
Q74PM2_YERPE/511-794-----------LT-----EALQ.......G.G---------------------------QVDNATLVY------------
Q7MHE2_VIBVY/508-794-----------LS-----TAIQ.......G.G---------------------------KVNTAKLLW------------
Q83BN5_COXBU/480-760-----------LN-----QAFS.......T.G---------------------------EITSGTVNF------------
Q8ZLP4_SALTY/504-786-----------LS-----GAIQ.......G.G---------------------------EADNATLVY------------
Q9KUU5_VIBCH/504-791-----------LS-----TAIQ.......A.G---------------------------QVNTAKLIW------------

PF13109

A0RPG5_CAMFF/433-647--------------------------------------------------------------------------------
A6Q385_NITSB/623-836--------------------------------------------------------------------------------
A6QAC9_SULNB/640-854--------------------------------------------------------------------------------
B9L5J2_NAUPA/583-798--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------
O25308_HELPY/745-958--------------------------------------------------------------------------------
Q0PAY6_CAMJE/635-848--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1U479_MARAV/979-1225--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
A3Q9Y2_SHELP/1046-1289--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5FJ68_FLAJ1/564-791--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A9CIC7_AGRT5/884-1105--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
B2FP42_STRMK/1008-1250--------------------------------------------------------------------------------
F2G3T4_ALTMD/1046-1287--------------------------------------------------------------------------------
B4S7D6_PROA2/551-781--------------------------------------------------------------------------------
B7VIB8_VIBSL/1027-1268--------------------------------------------------------------------------------
B8CI63_SHEPW/997-1240--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METGS/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
E6WGF8_PANSA/1014-1257--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
D3SBX9_THISK/1040-1287--------------------------------------------------------------------------------
Q0ABM3_ALKEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
Q11YL6_CYTH3/532-755--------------------------------------------------------------------------------
Q11YT8_CYTH3/698-925--------------------------------------------------------------------------------
Q145G0_BURXL/1154-1409--------------------------------------------------------------------------------
Q15ZG8_PSEA6/1002-1243--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q2NWP0_SODGM/1012-1255--------------------------------------------------------------------------------
Q3IFH7_PSEHT/1008-1245--------------------------------------------------------------------------------
Q47VG9_COLP3/1038-1280--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q7MHE2_VIBVY/1031-1272--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------
A8GK60_SERP5/1034-1277--------------------------------------------------------------------------------
C4YU88_9RICK/640-864--------------------------------------------------------------------------------
C5BC15_EDWI9/1004-1246--------------------------------------------------------------------------------
D3HJX5_LEGLN/1065-1312--------------------------------------------------------------------------------
D5CDA5_ENTCC/1010-1252--------------------------------------------------------------------------------
E0SHA8_DICD3/1031-1273--------------------------------------------------------------------------------
F4AYZ2_KROS4/566-791--------------------------------------------------------------------------------
G2J3B5_PSEUL/1018-1258--------------------------------------------------------------------------------
I0DWA9_PROSM/1000-1242--------------------------------------------------------------------------------
M1FEQ6_9ALTE/970-1216--------------------------------------------------------------------------------
N0B6U7_9RHIZ/961-1176--------------------------------------------------------------------------------
Q0KCK4_CUPNH/1119-1370--------------------------------------------------------------------------------
Q0VS66_ALCBS/1022-1263--------------------------------------------------------------------------------
Q2K6G4_RHIEC/885-1104--------------------------------------------------------------------------------
Q32B94_SHIDS/1009-1252--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/1014-1261--------------------------------------------------------------------------------
Q63R38_BURPS/1120-1377--------------------------------------------------------------------------------
Q6LMA6_PHOPR/1035-1276--------------------------------------------------------------------------------
Q8P7K3_XANCP/1032-1273--------------------------------------------------------------------------------
Q9KUU5_VIBCH/1028-1269--------------------------------------------------------------------------------
Q9PEA2_XYLFA/983-1225--------------------------------------------------------------------------------

PF05170

Q87TE2_VIBPA/1-570DYAGP.....RFSVTGLSIQIQDPTWLNAQQLWPYGAIQASAEQMYWHGEAIQKVLVDVDYQAQNSTLYGTS........
Q9KNJ9_VIBCH/1-570DWADQ.....GIIARGVSLQIKQPVWDSPQQQLPYGKIQLAADQITIDGEAFNQVLVDANYQAQDSTVYGFS........
Q9HU38_PSEAE/1-636PSETPPAADGKGAQAQAPEQAPQNDSPRTPIKLDIDSLNVNNARVTYTDEASGKQYNVEGIELSTGAIREGSSIPLKLN.
Q9KT66_VIBCH/1-595AT...........TDSAPASQPSSSEPAAAWSIELGGVSVSNAVLEITDKKAGSHTKLYDVQLSVAEFVP..........
Q9JY87_NEIMB/8-615...................................NRIIVENSTVRLNFLQEQLILKEINLNLQSPDSSGQP........
Q9ZDI1_RICPR/1-711................NNTVQSNYTQTVLELPILISHLKIKGGKVIYIEKNNEKIFNDINLETKMKSIKGPIDFTIALNA
Q9HUT4_PSEAE/1-577.............................AWQLDIREIGFDKGSVSLDDQRLKT.....RLEVLVDPLGKP.........
YHJG_ECOLI/1-582.........................AKPSAWSFRLDNILFDQGRIAIDDKVSKA.....DLEIFVDPLGKP.........
Q7MQ04_VIBVY/1-571DYADN.....QLSARGIKFQVKQPQWQRSDQFIPFGEIQFSAQQLYWQGEAFNQPLLDIDYKPQDSALYGLS........

PF04357

A2U1I0_9FLAO/1175-1633--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
Q1D0C2_MYXXD/935-1291--------------------------------------------------------------------------------
A5FB26_FLAJ1/992-1420--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
A0M1P1_GRAFK/1180-1639--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
Q21Y28_ALBFT/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
Q016Y8_OSTTA/1647-2059--------------------------------------------------------------------------------
A5FIP0_FLAJ1/1183-1626--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q11I59_CHESB/1185-1538--------------------------------------------------------------------------------
Q11VR9_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q6MAC5_PARUW/935-1288--------------------------------------------------------------------------------
Q1QWE2_CHRSD/954-1312--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
B4E8E1_BURCJ/988-1340--------------------------------------------------------------------------------
E3G0N9_STIAD/1177-1560--------------------------------------------------------------------------------
F4B3D6_KROS4/1021-1426--------------------------------------------------------------------------------
Q46LW1_PROMT/887-1319--------------------------------------------------------------------------------
TAMB_HAEIN/952-1298--------------------------------------------------------------------------------
Q5NNB3_ZYMMO/1036-1389--------------------------------------------------------------------------------

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------------------------
Q4K5X6_PSEF5/360-511--------------------------------------------------------------------------------
B2JQ93_BURP8/874-1021--------------------------------------------------------------------------------
A0RMT1_CAMFF/653-798--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
A7ZFK9_CAMC1/750-895--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
Q484B1_COLP3/382-534--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
A3QD21_SHELP/699-846--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
Q47FN3_DECAR/732-879--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEODF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_VIBF1/399-549--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_BURP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q47VC1_COLP3/500-655--------------------------------------------------------------------------------
Q15PY6_PSEA6/662-809--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_BURXL/640-791--------------------------------------------------------------------------------
Q47FN3_DECAR/504-656--------------------------------------------------------------------------------
Q316X0_DESAG/862-1008--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
C1DFK3_AZOVD/367-518--------------------------------------------------------------------------------
Q484B1_COLP3/604-751--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESAG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_BURP8/152-309--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEODF/383-534--------------------------------------------------------------------------------
A4SXW3_POLSQ/414-561--------------------------------------------------------------------------------
B9M3X2_GEODF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
A1TWZ4_MARAV/597-744--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------------------------
Q11NN1_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
Q316X0_DESAG/600-751--------------------------------------------------------------------------------
A1TWZ4_MARAV/166-321--------------------------------------------------------------------------------
B9M7L7_GEODF/592-739--------------------------------------------------------------------------------
Q222N5_ALBFT/496-646--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_ALBFT/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q484B1_COLP3/152-304--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
F2GAL8_ALTMD/716-863--------------------------------------------------------------------------------
Q5DZ89_VIBF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
C1DFK3_AZOVD/141-292--------------------------------------------------------------------------------
Q1LGA7_RALME/681-840--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
A3QD21_SHELP/453-602--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_RALME/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_ALBFT/710-857--------------------------------------------------------------------------------
C1DFK3_AZOVD/584-731--------------------------------------------------------------------------------
B2U875_RALPJ/869-1016--------------------------------------------------------------------------------
B4EKU9_BURCJ/620-772--------------------------------------------------------------------------------
D0J281_COMT2/165-316--------------------------------------------------------------------------------
M1FB64_9ALTE/585-727--------------------------------------------------------------------------------
Q63NS2_BURPS/160-304--------------------------------------------------------------------------------
Q7VVF7_BORPE/156-309--------------------------------------------------------------------------------
Q7VVF7_BORPE/538-685--------------------------------------------------------------------------------
Q87WR1_PSESM/155-306--------------------------------------------------------------------------------
Q88DW4_PSEPK/140-291--------------------------------------------------------------------------------
Q88DW4_PSEPK/581-725--------------------------------------------------------------------------------
Q8EDF6_SHEON/666-811--------------------------------------------------------------------------------
Q9HV64_PSEAE/476-627--------------------------------------------------------------------------------
Q9HV64_PSEAE/692-837--------------------------------------------------------------------------------

PF13116

C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A7ZDM6_CAMC1/160-458--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
Q31FH6_THICR/496-774--------------------------------------------------------------------------------
Q2NWP0_SODGM/504-789--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
A0RPG5_CAMFF/10-294--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
Q15ZG8_PSEA6/490-776--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
A8GK60_SERP5/523-808--------------------------------------------------------------------------------
Q3IFH7_PSEHT/493-781--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
C7R9G7_KANKD/505-791--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
A7MJB2_CROS8/518-803--------------------------------------------------------------------------------
C6XD69_METGS/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A3Q9Y2_SHELP/509-796--------------------------------------------------------------------------------
A6QAC9_SULNB/206-494--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
Q47VG9_COLP3/504-793--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3V5J7_XENBS/502-797--------------------------------------------------------------------------------
E6WGF8_PANSA/504-789--------------------------------------------------------------------------------
F2G3T4_ALTMD/500-787--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
Q0ABM3_ALKEH/531-818--------------------------------------------------------------------------------
A0KFB2_AERHH/486-771--------------------------------------------------------------------------------
A6TER2_KLEP7/497-781--------------------------------------------------------------------------------
B4EX35_PROMH/501-782--------------------------------------------------------------------------------
B7VIB8_VIBSL/505-791--------------------------------------------------------------------------------
D3HJX5_LEGLN/559-845--------------------------------------------------------------------------------
F0LWR2_VIBFN/505-791--------------------------------------------------------------------------------
G9AWD3_PANAN/505-788--------------------------------------------------------------------------------
I0DWA9_PROSM/493-771--------------------------------------------------------------------------------
Q5E7X4_VIBF1/495-780--------------------------------------------------------------------------------
Q6DAI1_PECAS/504-784--------------------------------------------------------------------------------
Q74PM2_YERPE/511-794--------------------------------------------------------------------------------
Q7MHE2_VIBVY/508-794--------------------------------------------------------------------------------
Q83BN5_COXBU/480-760--------------------------------------------------------------------------------
Q8ZLP4_SALTY/504-786--------------------------------------------------------------------------------
Q9KUU5_VIBCH/504-791--------------------------------------------------------------------------------

PF13109

A0RPG5_CAMFF/433-647----------------------------ASFV-------------------NDFLGL.-DGFK-----------------
A6Q385_NITSB/623-836----------------------------DEVL-------------------HKLFKM.-NFLS-----------------
A6QAC9_SULNB/640-854----------------------------DRML-------------------HPLINF.-DGLQ-----------------
B9L5J2_NAUPA/583-798----------------------------NEEF-------------------KAFLPKF-DFFS-----------------
C5ZX33_9HELI/638-852----------------------------DTFV-------------------NALANK.-NIVT-----------------
D3UGW6_HELM1/730-943----------------------------ADFI-------------------NMVAKK.-ELLH-----------------
Q30RQ8_SULDN/697-907----------------------------DEFM-------------------EKIFSL.-SKFK-----------------
Q7MRT1_WOLSU/616-829----------------------------DEFV-------------------NTFFNK.-EIAS-----------------
Q7VFV2_HELHP/731-944----------------------------DKFL-------------------NRVWQR.-DIFR-----------------
O25308_HELPY/745-958----------------------------GDYI-------------------NTILQK.-DFVE-----------------
Q0PAY6_CAMJE/635-848----------------------------DNYL-------------------NEFLQK.-QAVQ-----------------

PF13502

A0KFB2_AERHH/999-1241-------------------------...ADGM.Q.....----------..TRARAHI-SSNN-----------------
A1S2S6_SHEAM/1130-1371-------------------------....V.N.Q.....----------..TRMEFSL-KADK-----------------
A1STZ9_PSYIN/1024-1262-------------------------......Y.K.....----------..TNLIVKS-VGNE-----------------
A1TW53_ACIAC/1117-1369-------------------------...GG.A.TAP..R----------RRTSMDFRL-DIRD-----------------
A1U479_MARAV/979-1225-------------------------...DDRE.T.....----------..TRFTGKL-EGGA-----------------
A1WCZ7_ACISJ/1139-1390-------------------------.GAQAQR.R.....----------..TVMDFEL-DIRD-----------------
A1WSB5_VEREI/1101-1362-------------------------.PGA....GPRPAE----------RRTALSFEL-DIRD-----------------
A1WYY8_HALHL/891-1129-------------------------........G.....----------..TALRGRL-RSGD-----------------
A2U2U5_9FLAO/567-793-------------------------...NNAS.T.....----------..FKVDLDL-KELN-----------------
A3HUH0_9BACT/675-900-------------------------..LST.P.K.....----------..FNFDLNV-SDLS-----------------
A3Q9Y2_SHELP/1046-1289-------------------------...EGQN.L.....----------..TEFQVDL-KAKQ-----------------
E0TB83_PARBH/837-1047-------------------------........G.....----------..QDAKLMV-ETSD-----------------
A4AMF6_MARSH/560-785-------------------------...NQLP.N.....----------..FRMKLNM-DQLG-----------------
A4CG41_ROBBH/574-799-------------------------...EGLP.R.....----------..FNMDLGI-DGFR-----------------
A4VIB7_PSEU5/1014-1255-------------------------...QS.........----------..W.YKGRL-EGGN-----------------
A5CF63_ORITB/620-836-------------------------...SP.L.A.....----------..MTLVYAY-NSFY-----------------
A5FJ68_FLAJ1/564-791-------------------------...SKVP.T.....----------..FDMNLGF-NQVD-----------------
A5FUN1_ACICJ/745-973-------------------------..GSTPA.T.....----------..LSLQASL-TGAR-----------------
A6GWN8_FLAPJ/560-787-------------------------...GKVP.T.....----------..FSMNLDL-NKVD-----------------
A7HEC2_ANADF/581-801-------------------------...PD.A.P.....----------..FEVALDL-KGVA-----------------
A9CIC7_AGRT5/884-1105-------------------------...EG.AGI.....----------..FRSKIAV-TDAN-----------------
A9H3V6_GLUDA/474-684-------------------------...HLWASV.....----------..QDLGLML-RGLD-----------------
B2FP42_STRMK/1008-1250-------------------------...TGGA.R.....----------..TELTAQV-RSED-----------------
F2G3T4_ALTMD/1046-1287-------------------------...GRDI.Q.....----------..SAIKGSL-TSPD-----------------
B4S7D6_PROA2/551-781-------------------------...GGKA.D.....----------..TEFSAEA-AEVN-----------------
B7VIB8_VIBSL/1027-1268-------------------------...GDKS.H.....----------..SSLTLDV-EGEN-----------------
B8CI63_SHEPW/997-1240-------------------------...DGES.L.....----------..TSFSLTL-DATK-----------------
C1D9M5_LARHH/1015-1258-------------------------...DGQM.R.....----------..SQLNVQL-DSAS-----------------
C3L4A9_AMOA5/534-754-------------------------...ADSL.E.....----------..IYTYANL-QNVQ-----------------
C4L8L8_TOLAT/989-1232-------------------------...NYQP.L.....----------..STLKGKF-VSNN-----------------
E8RSC3_ASTEC/1136-1358-------------------------...LG.S.L.....----------..VTLDFKP-QN.D-----------------
D9SHW3_GALCS/1021-1263-------------------------...QTSM.Q.....----------..TQVNLLL-TISN-----------------
D5CU11_SIDLE/1024-1263-------------------------...KP.E.Q.....----------..TQVKLRV-DISD-----------------
C6WWM2_METML/1053-1294-------------------------...RN.A.N.....----------..TSLNVRW-DIKD-----------------
C6XD69_METGS/1043-1284-------------------------...KRNP.N.....----------..TRITLNW-DIKD-----------------
C6XK02_HIRBI/884-1092-------------------------..............----------...DIAFQL-RSDD-----------------
C7PC84_CHIPD/564-796-------------------------..SKTNP.D.....----------..INMAYSV-QNVD-----------------
E6WGF8_PANSA/1014-1257-------------------------...PGEQ.R.....----------..TSLKGTL-SGNN-----------------
D2UF54_XANAP/1023-1265-------------------------...GAAA.H.....----------..TQLSARV-ESQD-----------------
D3SBX9_THISK/1040-1287-------------------------...GR.P.D.....----------..TRLDIRL-SGDD-----------------
Q0ABM3_ALKEH/1048-1290-------------------------...DGGH.R.....----------..TELKSRL-QGER-----------------
Q0AQ38_MARMM/879-1092-------------------------...GG.Q.......----------..RD..FRI-EAQS-----------------
Q11YL6_CYTH3/532-755-------------------------...KT.V.E.....----------..INADARI-RAMN-----------------
Q11YT8_CYTH3/698-925-------------------------..ITK.P.S.....----------..FAMDMLM-KDVA-----------------
Q145G0_BURXL/1154-1409-------------------------GSSA....DEAT.A----------RRTVFDFKL-DIKD-----------------
Q15ZG8_PSEA6/1002-1243-------------------------...PRGN.Q.....----------..TKIEGEF-SSSD-----------------
Q211X0_RHOPB/871-1087-------------------------...ADGV.A.....----------..LDARLKW-SGVD-----------------
Q28TM9_JANSC/371-572-------------------------...GG.L.S.....----------..VGGDLIL-ANVA-----------------
Q2KY05_BORA1/936-1183-------------------------...GEQR.G.....----------..LTVQAKA-EFKD-----------------
Q2NWP0_SODGM/1012-1255-------------------------...RREN.R.....----------..TSLKGTL-AGKD-----------------
Q3IFH7_PSEHT/1008-1245-------------------------........Q.....----------..TQLSGEL-KSED-----------------
Q47VG9_COLP3/1038-1280-------------------------...EQAS.I.....----------..TTLVGNL-SVDD-----------------
Q5R0H7_IDILO/1003-1244-------------------------...DEQA.L.....----------..SALSGRL-EAGD-----------------
Q7MHE2_VIBVY/1031-1272-------------------------...GETS.Q.....----------..SRMNLKV-KSDN-----------------
Q7UYB4_RHOBA/752-985-------------------------..RSGGV.D.....----------..MTSHWKT-RRMD-----------------
Q8EA16_SHEON/1025-1268-------------------------...NGQN.Q.....----------..TELSVSL-NASQ-----------------
Q9ZDH9_RICPR/624-849-------------------------...EP.Y.S.....----------..INFVYAV-NTID-----------------
A8GK60_SERP5/1034-1277-------------------------...AQEE.R.....----------..SSLKGKL-LGGK-----------------
C4YU88_9RICK/640-864-------------------------....P.Y.S.....----------..INFVYAL-NTID-----------------
C5BC15_EDWI9/1004-1246-------------------------...DGIS.R.....----------..TQISGVL-QGAN-----------------
D3HJX5_LEGLN/1065-1312-------------------------...NKVN.Q.....----------..TKLDVKL-NMTQ-----------------
D5CDA5_ENTCC/1010-1252-------------------------...PGEQ.R.....----------..TSLKGDI-KGNK-----------------
E0SHA8_DICD3/1031-1273-------------------------...GEGT.R.....----------..TAIKGQL-SGGS-----------------
F4AYZ2_KROS4/566-791-------------------------...DGAP.T.....----------..FNMTVDL-SSID-----------------
G2J3B5_PSEUL/1018-1258-------------------------...VT.P.R.....----------..VDVDFKL-ESAN-----------------
I0DWA9_PROSM/1000-1242-------------------------...KQ.N.R.....----------..TQIAGSL-SGEQ-----------------
M1FEQ6_9ALTE/970-1216-------------------------...GQNQ.V.....----------..SRFKGSV-TGGQ-----------------
N0B6U7_9RHIZ/961-1176-------------------------...SG.........----------...TRRLLV-DSPD-----------------
Q0KCK4_CUPNH/1119-1370-------------------------ADANAER.R.....----------..TLLSFSI-DVRD-----------------
Q0VS66_ALCBS/1022-1263-------------------------...DGAQ.Y.....----------..TRFNGSL-TSDN-----------------
Q2K6G4_RHIEC/885-1104-------------------------...DGTG.F.....----------..LQTKLAL-ADSD-----------------
Q32B94_SHIDS/1009-1252-------------------------...PGNE.R.....----------..TSLKGKL-RGQK-----------------
Q5ZUN8_LEGPH/1014-1261-------------------------...GKFN.Q.....----------..TKLQSKM-YLKD-----------------
Q63R38_BURPS/1120-1377-------------------------ADEEDAPRR.....----------..TVFDFTL-AIDD-----------------
Q6LMA6_PHOPR/1035-1276-------------------------...GDQN.E.....----------..TQLAFDV-EGEN-----------------
Q8P7K3_XANCP/1032-1273-------------------------...GEAA.S.....----------..TRLSARV-DSRN-----------------
Q9KUU5_VIBCH/1028-1269-------------------------...DTQS.R.....----------..TQMNLDM-KGDN-----------------
Q9PEA2_XYLFA/983-1225-------------------------...GEAA.S.....----------..IRLSARV-DSRD-----------------

PF05170

Q87TE2_VIBPA/1-570.........................FKWRNSQISGQGEQ----------YPQGW.SLV-NVTI.DKLAITNAQRQSLLS.
Q9KNJ9_VIBCH/1-570.........................FNWRNSPISGQAEQ----------YPQGW.SLI-NVTL.SRLNLNLDEWRHH...
Q9HU38_PSEAE/1-636.................AYLGTNQPVVRVKTELTGNLRF----------DTALRRYQL-EDAR.LSGEASGEPLQGKTAT
Q9KT66_VIBCH/1-595.........................DNWTKATFAAKGDK----------DQQKFAAQG-EAEVRLSADFKQYALRNI...
Q9JY87_NEIMB/8-615.........................FESSGILVWGKLSV----------PWKSRGLFL-SNGI.GPPEISPFHFEASTSL
Q9ZDI1_RICPR/1-711LQQQIHIDGHVKEIGKIIPLSTNINLAGAKIKIDGKFDS----------KNNSFIGNA-NIKG.NTKTLGMPYDLNNDYT
Q9HUT4_PSEAE/1-577.........................VPFGQLAGKALATG----------DAANAQDYV-FGWK.VKGTYKGQALAGSGKV
YHJG_ECOLI/1-582.........................LPFSEVTGS.KGKA----------DKEKVGDYV-FGLK.AQGRYNGEPLTGTGKI
Q7MQ04_VIBVY/1-571.........................LSWRGAKVSGQAEQ----------YPQGW.SLV-NVTV.EGLDLSQQQLTSILA.

PF04357

A2U1I0_9FLAO/1175-1633----------------------------TG..DL.....----------QIPKLSANV-.TLGSDTNVTYVLP.TAYASV
Q83EW1_COXBU/570-928----------------------------DI..VD....R----------.NIDITGTL-.TVPRAILKPTTFS.RAAALT
Q1D0C2_MYXXD/935-1291----------------------------IG..PP....K----------.GFTVTGGM-.DIVKMRYQKALDV.DALLKT
A5FB26_FLAJ1/992-1420----------------------------KG..PT....E----------.SLFIKVDA-.KSEKGTEVKIPIN.NVQSVG
Q8YZJ8_NOSS1/1412-1829----------------------------RG..TA....L----------.RPRIGGEI-.TLSNGQVTIGNTT.ANSKQT
A4CK93_ROBBH/998-1431----------------------------FG..PT....N----------.ALNINFEG-.STARGTSLKIPIS.DVASLG
A3U6I2_CROAH/1185-1647----------------------------NG..DL....E----------.LPKLNATL-.NVGSETNVTYVLP.PSQVAV
A0LGH5_SYNFM/889-1254----------------------------SR..TP.....----------QGIELSGNL-.LLSDAEMNLGRLE.SDLARS
A3HZ37_9BACT/1160-1620----------------------------KG..DL....N----------.LPIVRAKL-.NVRESTDLSLLIP.ESQLDI
A5GSG8_SYNR3/973-1387----------------------------QG..SL....R----------.QPALGGEV-.KLSQGSITVSPSE.LSSA..
A6L590_BACV8/1012-1461----------------------------DGGNN......----------.AMTVDASL-.TTGNNTSFTYITG.VTTEAA
A0M1P1_GRAFK/1180-1639----------------------------TG..DL....T----------.LPVVNMDI-.DIKESTDFTYVVP.ETELQM
Q2S2D2_SALRD/1057-1516----------------------------NG..PL....P----------.DATLESNA-ARTTPDSELYIPVS.GRTVEE
Q21Y28_ALBFT/928-1291----------------------------RL..NE....S----------.KLALRGTL-.KADSALFILPEDT.APQL.G
Q6MKB2_BDEBA/958-1321----------------------------SGRWFP.....----------..FTLSGTY-.HVTSAMVEKEFTE.DGGGVT
Q39RU7_GEOMG/1016-1376----------------------------EG..TP....A----------.KVAVRGEI-.TVPELLVTAAGTG.GPVKSS
Q7VBL9_PROMA/867-1309----------------------------KG..SI....L----------.QPLLGGDI-.TIEQGSISTKRSR.VDKKNS
Q016Y8_OSTTA/1647-2059----------------------------KG..TV....L----------.APELSGDV-.RFSRGTALVQQQA.PVEGAL
A5FIP0_FLAJ1/1183-1626----------------------------KG..NL....D----------.SPVVDGTL-.KINKETKFTVVLP.QSDPSI
Q8KFW2_CHLTE/1034-1479----------------------------YG..EL....S----------.APVAEGDL-.VLNSVNFSLYRKG.SNESAK
A6H009_FLAPJ/1018-1446----------------------------KG..PT....N----------.GLVITVNA-.KSEKGTSVKIPIT.DSEVSS
B5E9K2_GEOBB/1121-1484----------------------------KG..EG....D----------.RVTLQGEI-.GVPEMLILGSPAH.QAETAS
Q11I59_CHESB/1185-1538----------------------------TG..PI....T----------RDPLLSGNI-.EVSRAEILVPDGF.G.GSAA
Q11VR9_CYTH3/1167-1624----------------------------RG..DQ....N----------.LPVINATI-.DIEKGSHFTFAIP.DSKISV
A7HQ23_PARL1/1042-1395----------------------------TA.PALPPSLD----------QPMLLEGEL-.TTTTARFHVPEQL.PGGVAH
Q7MT86_PORGI/1036-1486----------------------------PG.........----------.GMRCDVNL-.ISEKGTHIVLNFT.QPTTAE
Q3AQ57_CHLCH/1053-1500----------------------------TG..SL....R----------.SPIVEGEV-.QIDRADYSLYSAG.ANESAQ
A1BDC7_CHLPD/1048-1494----------------------------NG..DI....S----------.SPVVEGDI-.TINSADFTMYRPG.ANESAK
Q6MAC5_PARUW/935-1288----------------------------VG..NL.....----------KKSKLRGDL-.TVDNAVIHMEEAL.P.KQIK
Q1QWE2_CHRSD/954-1312----------------------------DA..RP....T----------.RLRVRGDV-.DIPWGRLEVGQIPPSAVAPS
Q2RSJ7_RHORT/1146-1500----------------------------VL..AA.....----------DQMTVSGTV-.TTGPVEIRLVGGG.GPSIAE
Q2S346_SALRD/1311-1689----------------------------RG..TV....R----------.RPVLSGGL-.QVQSASVYYAEAL.AEGAAA
Q2INP6_ANADE/946-1304----------------------------RG..TP....E----------.ATDVTGRL-.HVVRARYTADVDL.EGSLLE
Q9RUC9_DEIRA/223-627----------------------------RD..SG....D----------.FVRVSGEG-.DFARLVLGRVDAP.TTLPAA
Q1LSN0_BAUCH/634-981----------------------------EAKPNL.....----------..LTLNGQV-.NIPWMRIKVKEWQ.QTTADI
B3ELK5_CHLPB/1036-1483----------------------------YG..DT....A----------.QPVLTGNL-.LITNADFTLYRTG.SNESTK
Q8YUC2_NOSS1/1659-2048----------------------------TG..SA....L----------.NPRIGGKV-.DLYSGQILLAESS.DPNQPA
Q1MQI4_LAWIP/1025-1382----------------------------EG..TL.....----------KQSEVKGDI-.VINQGEFQLTEGL.TSNIPT
Q7VQN5_BLOFL/933-1286----------------------------TI..TV....N----------.TIDIQGDI-.NVPYGYIKIKDFQ.RNIMGV
Q31MA1_SYNE7/1177-1568----------------------------LG..SA....L----------.EPAIAGDI-.RVNQANIQLPGPD.RLT...
B4E8E1_BURCJ/988-1340----------------------------ANDGPR....G----------.ALSIDGKF-.VVDRALFDLPEQS.APHL.S
E3G0N9_STIAD/1177-1560----------------------------AG..TL....S----------AQSVNIRDL-.HIPEAHIELPEVK.RKDLQA
F4B3D6_KROS4/1021-1426----------------------------KG..PT....D----------.NLVIDVFG-.ETARGTTFKIPID.DSEALG
Q46LW1_PROMT/887-1319----------------------------KG..SI....L----------.KPQLSGEV-.FISEGSIFAKRAK.NPSKTS
TAMB_HAEIN/952-1298----------------------------KA..NP....K----------.ELNLSGTV-.DIPWARIKIDSLPDTAEPVS
Q5NNB3_ZYMMO/1036-1389----------------------------TS..NR....K----------DGGSIKGKL-.KLPETRYRFIMDN.K.ETVH

PF05359

Q4K5X6_PSEF5/140-291---------------------------------------------------NKLDFEL.KNLS-----------------
Q4K5X6_PSEF5/360-511---------------------------------------------------GPLNLDL.QNFD-----------------
B2JQ93_BURP8/874-1021---------------------------------------------------IAIQGTV.GAFG-----------------
A0RMT1_CAMFF/653-798---------------------------------------------------TKISTTI.NELS-----------------
Q72DG8_DESVH/963-1109---------------------------------------------------DKVDAAV.TGFT-----------------
A9BMN7_DELAS/883-1036---------------------------------------------------SELAGRL.SAFS-----------------
A7ZFK9_CAMC1/750-895---------------------------------------------------SKLNGKL.TDID-----------------
Q2LUD1_SYNAS/534-687---------------------------------------------------EKIQGRI.DNIS-----------------
A8ZWF7_DESOH/636-783---------------------------------------------------TLTDLKV.TGLT-----------------
Q3A6W6_PELCD/375-529---------------------------------------------------EHIAVTL.TDL.-----------------
Q5NYY7_AROAE/382-536---------------------------------------------------KDLVLEA.KNVG-----------------
Q2KWF8_BORA1/759-906---------------------------------------------------SAIEGSI.SAVS-----------------
Q484B1_COLP3/382-534---------------------------------------------------TIKSLTI.EHLK-----------------
A2SI01_METPP/870-1017---------------------------------------------------TDIGGEV.SALA-----------------
Q8Y0Z7_RALSO/615-766---------------------------------------------------EPLNVLV.QNAS-----------------
Q5QWM2_IDILO/380-527---------------------------------------------------HTLSGEV.STLS-----------------
Q0VP61_ALCBS/592-737---------------------------------------------------YQLAGTV.SNLD-----------------
A3QD21_SHELP/699-846---------------------------------------------------EQLEGNI.ANLS-----------------
Q63NS2_BURPS/645-797---------------------------------------------------APLALNV.RQIS-----------------
Q47FN3_DECAR/732-879---------------------------------------------------TKLGGRV.SGLS-----------------
A0KK00_AERHH/368-522---------------------------------------------------SALALAL.GPL.-----------------
Q0JZH1_CUPNH/670-829---------------------------------------------------RNIALST.GSVA-----------------
Q2LUD1_SYNAS/785-932---------------------------------------------------VQIGGRI.SGLS-----------------
A1ARF1_PELPD/790-937---------------------------------------------------HNLGGRV.SGMS-----------------
Q39RS7_GEOMG/568-719---------------------------------------------------RRIGFNA.SNIT-----------------
B9M3X2_GEODF/795-942---------------------------------------------------YNLGGRI.SGLS-----------------
Q8Y0Z7_RALSO/185-339---------------------------------------------------DGLQIGV.PFLA-----------------
Q3JBN6_NITOC/584-731---------------------------------------------------HSLQSEI.QNLS-----------------
Q5DZ89_VIBF1/399-549---------------------------------------------------SPINLTT.SQIV-----------------
Q1QTZ9_CHRSD/145-295---------------------------------------------------KNLDLEA.RHYD-----------------
A9BMN7_DELAS/165-317---------------------------------------------------EQLQLRL.PFIS-----------------
A9BMN7_DELAS/379-538---------------------------------------------------RELSLQV.RDI.-----------------
Q87WR1_PSESM/386-537---------------------------------------------------GPLNLDM.QNFD-----------------
B2JQ93_BURP8/616-770---------------------------------------------------TPLNLKV.QKIS-----------------
A1K6C3_AZOSB/734-881---------------------------------------------------EQLAGQM.LGID-----------------
Q603H4_METCA/718-865---------------------------------------------------HDFFGTA.AGLS-----------------
Q47VC1_COLP3/500-655---------------------------------------------------DTLDVGALSNR.-----------------
Q15PY6_PSEA6/662-809---------------------------------------------------EALNGSI.AGLS-----------------
Q88DW4_PSEPK/365-516---------------------------------------------------GPLNADL.QGFD-----------------
A0KK00_AERHH/578-725---------------------------------------------------AALSGQS.RHIS-----------------
B5ECC6_GEOBB/569-721---------------------------------------------------KNTSLTL.SNLQ-----------------
Q2LUD1_SYNAS/159-313---------------------------------------------------HDLSLAI.PFLS-----------------
A4VPN2_PSEU5/551-698---------------------------------------------------QSLNGDI.GVLS-----------------
Q0VP61_ALCBS/382-530---------------------------------------------------TDGGLTL.SNLI-----------------
A1K7K6_AZOSB/583-736---------------------------------------------------DGLSVKA.DNLS-----------------
Q3JBN6_NITOC/369-521---------------------------------------------------SDLGLQL.IDVT-----------------
Q5NYY7_AROAE/832-979---------------------------------------------------TGMEGEV.VGLS-----------------
Q13S79_BURXL/640-791---------------------------------------------------TPLQLKV.QNIS-----------------
Q47FN3_DECAR/504-656---------------------------------------------------EAFSLHG.EGLT-----------------
Q316X0_DESAG/862-1008---------------------------------------------------AGLNATL.SSVS-----------------
Q602F3_METCA/416-565---------------------------------------------------DDLEIRL.QGVD-----------------
Q2Y5K5_NITMU/673-818---------------------------------------------------TDLAGRI.GPLN-----------------
B3E4B8_GEOLS/816-963---------------------------------------------------HNLGGMV.SGLS-----------------
A4VPN2_PSEU5/341-492---------------------------------------------------GPLNLDI.SDFD-----------------
Q5NYY7_AROAE/153-307---------------------------------------------------SAINIGL.PFLS-----------------
Q30NX8_SULDN/563-715---------------------------------------------------DNINISA.KNID-----------------
C1DFK3_AZOVD/367-518---------------------------------------------------GPLDLSL.RDFD-----------------
Q484B1_COLP3/604-751---------------------------------------------------YSLNGDI.TGLS-----------------
Q5NYY7_AROAE/604-757---------------------------------------------------AGIKLKA.DGLS-----------------
Q602F3_METCA/623-770---------------------------------------------------RGLTGVV.QSLS-----------------
Q316X0_DESAG/389-538---------------------------------------------------GPLDITL.NNLS-----------------
A5G9K9_GEOUR/137-293---------------------------------------------------RKVELTI.PFVT-----------------
B2JHK1_BURP8/152-309---------------------------------------------------SDASASV.DHIH-----------------
A5G9K9_GEOUR/551-702---------------------------------------------------KKMAFTL.DKLT-----------------
A0KK00_AERHH/151-307---------------------------------------------------SGLDLQL.PTFS-----------------
Q1H1L3_METFK/780-927---------------------------------------------------NSLSGVI.NGMS-----------------
B9M7L7_GEODF/383-534---------------------------------------------------KKTSFSL.EQLT-----------------
A4SXW3_POLSQ/414-561---------------------------------------------------KKFNATL.IGVS-----------------
B9M3X2_GEODF/564-715---------------------------------------------------KSIDVSA.TGIT-----------------
A4G9D7_HERAR/154-308---------------------------------------------------ADLKIGV.PFVS-----------------
Q21F55_SACD2/584-731---------------------------------------------------TKLHGEL.STLA-----------------
Q7NY28_CHRVO/704-851---------------------------------------------------HHLRGSI.QNLS-----------------
Q0JZH1_CUPNH/164-317---------------------------------------------------DNLTLTL.PFLS-----------------
A1TWZ4_MARAV/597-744---------------------------------------------------QELTGSV.TGFS-----------------
B3E4B8_GEOLS/367-514---------------------------------------------------QAINVKL.SNLS-----------------
Q2IFA1_ANADE/563-710---------------------------------------------------TGAQATV.TRLS-----------------
Q1QTZ9_CHRSD/348-494---------------------------------------------------AELNGEW.RQIG-----------------
Q11NN1_CYTH3/142-298---------------------------------------------------NQFELLL.TNIT-----------------
Q9HV64_PSEAE/140-291---------------------------------------------------DPLGFEL.HNLS-----------------
Q3SGZ4_THIDA/733-880---------------------------------------------------HDLGGVV.TGLS-----------------
Q3A6W6_PELCD/162-316---------------------------------------------------ADLGFYV.PFTS-----------------
Q316X0_DESAG/600-751---------------------------------------------------TGINLDV.TGAG-----------------
A1TWZ4_MARAV/166-321---------------------------------------------------APLDLTL.NDLA-----------------
B9M7L7_GEODF/592-739---------------------------------------------------FNLGGRI.SGLS-----------------
Q222N5_ALBFT/496-646---------------------------------------------------TDLALKL.EGAS-----------------
Q3A6W6_PELCD/805-951---------------------------------------------------DKLAVTV.EAVE-----------------
A5G9K9_GEOUR/769-916---------------------------------------------------YNLGGRI.SGLS-----------------
A2SI01_METPP/623-775---------------------------------------------------TRTDLKL.RQLD-----------------
Q083W9_SHEFN/492-642---------------------------------------------------GPIDFTT.GVIK-----------------
Q083W9_SHEFN/725-872---------------------------------------------------EMLNGQI.TNLS-----------------
Q12MK5_SHEDO/654-801---------------------------------------------------EELKGEI.TNLS-----------------
Q3SGZ4_THIDA/517-669---------------------------------------------------AEGFVTF.EDLS-----------------
A1ARF1_PELPD/573-725---------------------------------------------------RNTAFSL.ADLS-----------------
Q39RS7_GEOMG/801-948---------------------------------------------------YNLGGRI.SGLS-----------------
Q603H4_METCA/502-653---------------------------------------------------ENLRLSL.GPIA-----------------
Q222N5_ALBFT/149-300---------------------------------------------------APIDFSL.SNFS-----------------
A8ZWF7_DESOH/412-569---------------------------------------------------SDLNVTV.APF.-----------------
A4XYD1_PSEMY/354-505---------------------------------------------------GPLNLDL.KNFD-----------------
Q484B1_COLP3/152-304---------------------------------------------------KEINVAL.DNFS-----------------
Q21F55_SACD2/154-306---------------------------------------------------GPIHFGV.SDFS-----------------
Q3SGZ4_THIDA/147-307---------------------------------------------------EPLGIEL.DGLS-----------------
A7I315_CAMHC/662-807---------------------------------------------------SKVRTAV.NKVA-----------------
Q74FC9_GEOSL/787-934---------------------------------------------------YNLGGRV.SGLT-----------------
A7H8M2_ANADF/367-518---------------------------------------------------TEVQLRL.EQLR-----------------
F2GAL8_ALTMD/716-863---------------------------------------------------ESLNGKI.SGID-----------------
Q5DZ89_VIBF1/610-757---------------------------------------------------EQLKGNI.GHVS-----------------
A4XYD1_PSEMY/562-709---------------------------------------------------QQMNGRI.GVLD-----------------
B3E4B8_GEOLS/583-736---------------------------------------------------SNIRLST.GNLT-----------------
C1DFK3_AZOVD/141-292---------------------------------------------------DALQLEV.RNLG-----------------
Q1LGA7_RALME/681-840---------------------------------------------------RNIGFTS.GTVT-----------------
B5ECC6_GEOBB/807-954---------------------------------------------------YNLGGRV.SGLS-----------------
Q2IFA1_ANADE/358-509---------------------------------------------------TDVAVTL.EGIR-----------------
A4XYD1_PSEMY/140-291---------------------------------------------------DSLDVEL.HNLS-----------------
A7H8M2_ANADF/165-318---------------------------------------------------GPLTVRL.ESFR-----------------
A3QD21_SHELP/453-602---------------------------------------------------GQLQLTT.GAVD-----------------
Q3A6W6_PELCD/588-738---------------------------------------------------HKLTGSI.TGYD-----------------
A7H8M2_ANADF/579-726---------------------------------------------------TGADASV.TRLS-----------------
A8ETY5_ARCB4/612-759---------------------------------------------------TKLNGKI.SEIK-----------------
Q30NX8_SULDN/772-919---------------------------------------------------HGLNGNV.YAIS-----------------
A4VPN2_PSEU5/125-276---------------------------------------------------DSLDLEL.HNLA-----------------
Q1LGA7_RALME/173-326---------------------------------------------------ENFTLTL.PFLS-----------------
Q1H1L3_METFK/561-712---------------------------------------------------ENANLEV.KDVS-----------------
Q222N5_ALBFT/710-857---------------------------------------------------YELNGVI.NGLS-----------------
C1DFK3_AZOVD/584-731---------------------------------------------------QQLNGRI.GSLD-----------------
B2U875_RALPJ/869-1016---------------------------------------------------TAIGGSI.GTIS-----------------
B4EKU9_BURCJ/620-772---------------------------------------------------KPLELSV.QKVS-----------------
D0J281_COMT2/165-316---------------------------------------------------KDLQLSI.PFIS-----------------
M1FB64_9ALTE/585-727---------------------------------------------------GQLYGNL.SGLS-----------------
Q63NS2_BURPS/160-304---------------------------------------------------DQWTVGI.PFIA-----------------
Q7VVF7_BORPE/156-309---------------------------------------------------DEIALGV.PFIS-----------------
Q7VVF7_BORPE/538-685---------------------------------------------------KQFEARF.DRLA-----------------
Q87WR1_PSESM/155-306---------------------------------------------------DALNFEL.KNLS-----------------
Q88DW4_PSEPK/140-291---------------------------------------------------DNMNLEL.KNLS-----------------
Q88DW4_PSEPK/581-725---------------------------------------------------QQLNGQI.GTID-----------------
Q8EDF6_SHEON/666-811---------------------------------------------------EQLEGHI.SHLS-----------------
Q9HV64_PSEAE/476-627---------------------------------------------------GPLDLDL.QNVD-----------------
Q9HV64_PSEAE/692-837---------------------------------------------------QQLSGEV.GTLD-----------------

PF13116

C6XK02_HIRBI/457-744----------------------------DFPPGTNSKPI.....VPD..KALTLDFRV-EDAE-----------------
Q7NW94_CHRVO/514-796----------------------------AGNLDQ.FPFP.....GGK.DGEFLVEADI-EKAR-----------------
Q7N037_PHOLL/501-786----------------------------QGNPKD.FPFA.....KNN..GQFQVFAPL-RHAT-----------------
A7ZDM6_CAMC1/160-458----------------------------KVDLAKNDFYL..........NDLNATAYA-KNLL-----------------
A4XQL3_PSEMY/513-798----------------------------QGSLNK.GASL.....GARSLSLF...FQV-KDAE-----------------
Q3J7T7_NITOC/517-810----------------------------QGPWSH.FPSS.....RDG..SQLTVELDI-RGAK-----------------
D5CU11_SIDLE/524-805----------------------------RGDLRD.FPFV.....GNK.RGIFKLEARA-KDVE-----------------
A1AVR0_RUTMC/242-525----------------------------KKNLSTQLP............AKIKFDAHL-SNTE-----------------
Q31FH6_THICR/496-774----------------------------KGDLND.FPFR.....HQE..GLFEATADI-HKAE-----------------
Q2NWP0_SODGM/504-789----------------------------AGSPSR.FPFK.....HND..GQFEVWVPL-KQAE-----------------
B8GV04_THISH/540-825----------------------------RGPFTR.LPFE.....EGE..GEFEVRARV-EEGL-----------------
A0RPG5_CAMFF/10-294----------------------------KLNLKNFDFYP..........NELYAKAVA-KDLS-----------------
Q07WQ4_SHEFN/504-791----------------------------HGALGD.YPYQ.....DSS..GVFQADFTL-DKGI-----------------
Q5ZUN8_LEGPH/507-795----------------------------NGMAKD.FPFD.....NGN..GEFSIVSHV-VGGD-----------------
Q7VFV2_HELHP/222-511----------------------------QSTLNKHFFAQ........LQKTLALDLAI-ESPK-----------------
Q12IX1_SHEDO/530-817----------------------------HGALSH.YPYE.....DNS..GVFQAGFTL-ENAV-----------------
Q15ZG8_PSEA6/490-776----------------------------NGELSQ.FPYA.....NNQ..GVFQITVGV-EDAS-----------------
A6Q385_NITSB/202-483----------------------------KIDLKKGFDP...........NLFKGRAVA-YDGT-----------------
A8GK60_SERP5/523-808----------------------------NGDPQH.FPYR.....KHE..GQFEVFVPL-RHST-----------------
Q3IFH7_PSEHT/493-781----------------------------AGPLTG.FPFS.....DGS..GQFDVLAQI-DNAT-----------------
D9SHW3_GALCS/523-805----------------------------KGNLSD.FPLN.....GST.PSLFEIGARA-HDVS-----------------
C7R9G7_KANKD/505-791----------------------------RGGVEA.FPYQ.....DES..GQFYVEAKV-RDAL-----------------
Q21FT5_SACD2/542-827----------------------------SGSVMK..........DPEVRPTIQVFGDV-ENAT-----------------
A7MJB2_CROS8/518-803----------------------------VGNPQH.FPYK.....QND..GQFEVYVPL-HNAT-----------------
C6XD69_METGS/519-799----------------------------KGNLHD.FPYP.....NNK.TGLFRVTAKI-NDGE-----------------
A7I2E8_CAMHC/213-497----------------------------KINLKSGEIFK..........DDFLADGIL-QNVS-----------------
Q6LMA6_PHOPR/509-794----------------------------YGELSD.FPYQ.....NNE..GIFQAKVPL-KKAK-----------------
D0L1I5_HALNC/561-853----------------------------NGDPAR.FPFI.....KGG..GWFSVVFDF-KHLV-----------------
A3Q9Y2_SHELP/509-796----------------------------NGPLKH.FPYD.....DNS..GVFQAGFSL-NQAR-----------------
A6QAC9_SULNB/206-494----------------------------KGIVHGTDFKL.....DWNSLKG...NALL-EDVQ-----------------
A8EUE5_ARCB4/193-478----------------------------EYDLKKNELVQ..........NSIEGKAHI-KDGK-----------------
C5ZX33_9HELI/208-498----------------------------TLPLDSKNLIK.......DSLDSLYVVGEI-RDAK-----------------
Q1H0H5_METFK/520-800----------------------------KGNMRE.FPFA.....DNK.NSLFQVKAKI-HDGE-----------------
Q7MRT1_WOLSU/187-475----------------------------DSELNEKAILE.......SIEKRLKARLEI-ASPE-----------------
Q47VG9_COLP3/504-793----------------------------NGPISR.FPFT.....DGS..GIFVVDAEL-SKSE-----------------
A4G3G0_HERAR/587-887----------------------------KGDLNQ.FPFHTQKAAEKS.KGEFIFGGKI-DNGG-----------------
D1B1Z5_SULD5/203-493----------------------------ILDIQTGEYFP..........MQMRGHATV-QEAT-----------------
D3V5J7_XENBS/502-797----------------------------QGNPHD.FPFK.....QNN..GQFQVWVPL-RHAT-----------------
E6WGF8_PANSA/504-789----------------------------AGDPTL.FPFR.....HND..GMFEVWVPL-RQAT-----------------
F2G3T4_ALTMD/500-787----------------------------HGRTRD.FPFE.....DNS..GIFQAYVDI-KDGD-----------------
D3VKA4_XENNA/501-791----------------------------QGNPHD.FPFK.....QNN..GQFQVFVPL-RDAI-----------------
Q0ABM3_ALKEH/531-818----------------------------DGPLSG.ERFR.....QGE..VAFQAGGRV-IDGE-----------------
A0KFB2_AERHH/486-771----------------------------YGEFRD.FPYR.....KGE..GIFQVAVPL-QQAS-----------------
A6TER2_KLEP7/497-781----------------------------GGNPHL.FPYP.....HNE..GQFQVYVPL-KNAT-----------------
B4EX35_PROMH/501-782----------------------------HGDPRD.FPFE.....QHN..GWFQVYAPV-KQAT-----------------
B7VIB8_VIBSL/505-791----------------------------HGELAQ.YPYT.....NHD..GIFQVWVGL-EDAK-----------------
D3HJX5_LEGLN/559-845----------------------------NGLAKD.FPFD.....DNT..GEFTIDSFA-SGGE-----------------
F0LWR2_VIBFN/505-791----------------------------YGELDH.FPYQ.....HHN..GIFQAWVGL-KEGK-----------------
G9AWD3_PANAN/505-788----------------------------NGNPAL.FPFQ.....HND..GMFQVWVPL-RKAT-----------------
I0DWA9_PROSM/493-771----------------------------KGDPKH.FPFN.....QND..GQFQVFVPL-RKAT-----------------
Q5E7X4_VIBF1/495-780----------------------------YGELND.FPYT.....KYD..GIFQVKVGL-KDAQ-----------------
Q6DAI1_PECAS/504-784----------------------------AGNPQH.FPYT.....HSE..GQFEVWVPV-KDAT-----------------
Q74PM2_YERPE/511-794----------------------------NGNPHD.FPYK.....NKE..GQFQVYVPL-RNAV-----------------
Q7MHE2_VIBVY/508-794----------------------------YGELAD.FPYT.....KND..GMFQAWVGL-KQGK-----------------
Q83BN5_COXBU/480-760----------------------------KGPLDR.FPFL.....HQE..GSFDAIANV-DRVT-----------------
Q8ZLP4_SALTY/504-786----------------------------GGNPHL.FPYK.....HNE..GQFEVLVPL-RNAT-----------------
Q9KUU5_VIBCH/504-791----------------------------YGALDQ.FPYR.....MHN..GVFQAWVGL-KEAK-----------------

PF13109

A0RPG5_CAMFF/433-647-----------------------------------------------DGNFT-------V..R.LNG.E-----------
A6Q385_NITSB/623-836-----------------------------------------------KGEYE-------L..V.LHG.P-----------
A6QAC9_SULNB/640-854-----------------------------------------------KGRYT-------F..RISGT.P-----------
B9L5J2_NAUPA/583-798-----------------------------------------------LINLD-------F..V.MVKSP-----------
C5ZX33_9HELI/638-852-----------------------------------------------QGRFS-------I..N.ANT.N-----------
D3UGW6_HELM1/730-943-----------------------------------------------GGLFT-------L..I.GAY.K-----------
Q30RQ8_SULDN/697-907-----------------------------------------------GGKME-------FYIS.GQL.D-----------
Q7MRT1_WOLSU/616-829-----------------------------------------------GGRFD-------L..I.GEY.G-----------
Q7VFV2_HELHP/731-944-----------------------------------------------GGLFN-------F..K.GIY.D-----------
O25308_HELPY/745-958-----------------------------------------------GGLFT-------L..I.GAL.E-----------
Q0PAY6_CAMJE/635-848-----------------------------------------------DGVFN-------L..S.IKG.S-----------

PF13502

A0KFB2_AERHH/999-1241-----------------------------------------------SELLL.......K--RLG.YTS----------.
A1S2S6_SHEAM/1130-1371-----------------------------------------------FDALA.......Q--QLG.ITP----------.
A1STZ9_PSYIN/1024-1262-----------------------------------------------VNDIV.......K--RLGYSSP----------.
A1TW53_ACIAC/1117-1369-----------------------------------------------SGQLL.......A--RFG.MEG----------.
A1U479_MARAV/979-1225-----------------------------------------------LKDLE.......A--LTGSTIP----------.
A1WCZ7_ACISJ/1139-1390-----------------------------------------------CGALL.......A--RFG.MDG----------.
A1WSB5_VEREI/1101-1362-----------------------------------------------AGALL.......E--RLG.LAH----------.
A1WYY8_HALHL/891-1129-----------------------------------------------AGDLF.......G--LLQ.APR----------.
A2U2U5_9FLAO/567-793-----------------------------------------------IKESF.......S--SLE.MLE----------S
A3HUH0_9BACT/675-900-----------------------------------------------ISEAFSTL.NTVK--AFAPIAQ----------.
A3Q9Y2_SHELP/1046-1289-----------------------------------------------FDEVS.......E--RLG.IDP----------.
E0TB83_PARBH/837-1047-----------------------------------------------FGQLL.......R--GLF.GIE----------.
A4AMF6_MARSH/560-785-----------------------------------------------IGESF.......K--SLE.LFK----------F
A4CG41_ROBBH/574-799-----------------------------------------------IRETL.......E--SIE.LFE----------T
A4VIB7_PSEU5/1014-1255-----------------------------------------------LADVL.......L--AWGFAPS----------.
A5CF63_ORITB/620-836-----------------------------------------------IPTFS.......F--ILQ.DKE----------.
A5FJ68_FLAJ1/564-791-----------------------------------------------IAQTF.......T--QLD.MMK----------K
A5FUN1_ACICJ/745-973-----------------------------------------------ASAVA.......S--IAA.THG----------L
A6GWN8_FLAPJ/560-787-----------------------------------------------IAKTF.......T--QLD.MLK----------K
A7HEC2_ANADF/581-801-----------------------------------------------GEEAL.......K--LLG.DRK----------.
A9CIC7_AGRT5/884-1105-----------------------------------------------PEPIL.......W--ANA.NGP----------.
A9H3V6_GLUDA/474-684-----------------------------------------------VTTQF.......E--..G.GRT----------.
B2FP42_STRMK/1008-1250-----------------------------------------------LGALM.......Q--NLDYGGQ----------.
F2G3T4_ALTMD/1046-1287-----------------------------------------------VGQML.......K--EYG.VES----------.
B4S7D6_PROA2/551-781-----------------------------------------------IVESYKSV.SLLK--TLAPVAE----------.
B7VIB8_VIBSL/1027-1268-----------------------------------------------NSELM.......E--RFG.ITS----------.
B8CI63_SHEPW/997-1240-----------------------------------------------FDHLS.......K--QLGFDPG----------.
C1D9M5_LARHH/1015-1258-----------------------------------------------LGKLL.......A--RIG.EAD----------.
C3L4A9_AMOA5/534-754-----------------------------------------------LPALFYTFENFNQ--RFL.EDR----------.
C4L8L8_TOLAT/989-1232-----------------------------------------------TEVFL.......G--HFG.FDP----------.
E8RSC3_ASTEC/1136-1358-----------------------------------------------YTAFT.......F--EAD.DLG----------.
D9SHW3_GALCS/1021-1263-----------------------------------------------AGKIL.......S--RSG.YPN----------.
D5CU11_SIDLE/1024-1263-----------------------------------------------AGKIL.......S--RSG.YPE----------.
C6WWM2_METML/1053-1294-----------------------------------------------LGQTL.......A--RLG.YAD----------.
C6XD69_METGS/1043-1284-----------------------------------------------LGKTL.......E--RFG.YPG----------.
C6XK02_HIRBI/884-1092-----------------------------------------------AGYIL.......K--TLF.KTD----------.
C7PC84_CHIPD/564-796-----------------------------------------------VQQTF.......N--AFN.TVQ----------A
E6WGF8_PANSA/1014-1257-----------------------------------------------INDAT.......N--WFG.VNT----------.
D2UF54_XANAP/1023-1265-----------------------------------------------LGALM.......Q--SLDFGGQ----------.
D3SBX9_THISK/1040-1287-----------------------------------------------WGGAL.......T--SARLSRA----------.
Q0ABM3_ALKEH/1048-1290-----------------------------------------------AGDIL.......A--TLGYLPS----------.
Q0AQ38_MARMM/879-1092-----------------------------------------------LQRIS.......A--LLG.MEG----------.
Q11YL6_CYTH3/532-755-----------------------------------------------IDSLFYVFENFSQ--NFI.TNK----------.
Q11YT8_CYTH3/698-925-----------------------------------------------AKEAY.......K--TFN.SVK----------K
Q145G0_BURXL/1154-1409-----------------------------------------------AGALL.......E--RFG.QPR----------.
Q15ZG8_PSEA6/1002-1243-----------------------------------------------FGLFL.......K--GFEFDSG----------.
Q211X0_RHOPB/871-1087-----------------------------------------------GAALR.......Y--RAL.AMP----------.
Q28TM9_JANSC/371-572-----------------------------------------------LQPLL.......G--AMA.DYE----------.
Q2KY05_BORA1/936-1183-----------------------------------------------AGKFL.......D--RVG.LKQ----------.
Q2NWP0_SODGM/1012-1255-----------------------------------------------IGAAA.......D--YIG.MDL----------.
Q3IFH7_PSEHT/1008-1245-----------------------------------------------IGALF.......N--EFD.LTT----------.
Q47VG9_COLP3/1038-1280-----------------------------------------------VEAEL.......K--AAG.YES----------.
Q5R0H7_IDILO/1003-1244-----------------------------------------------LGDLL.......R--DYG.LET----------.
Q7MHE2_VIBVY/1031-1272-----------------------------------------------NSDLM.......E--RFG.ITS----------.
Q7UYB4_RHOBA/752-985-----------------------------------------------FVRLT.......D--QLG.RSS----------.
Q8EA16_SHEON/1025-1268-----------------------------------------------FHHLS.......D--QLG.INP----------.
Q9ZDH9_RICPR/624-849-----------------------------------------------LNKIL.......A--LMHNIFT----------.
A8GK60_SERP5/1034-1277-----------------------------------------------IDETA.......A--FFG.ITT----------.
C4YU88_9RICK/640-864-----------------------------------------------LNKVS.......A--LMK.IFT----------.
C5BC15_EDWI9/1004-1246-----------------------------------------------LTDSA.......D--FFG.LTL----------.
D3HJX5_LEGLN/1065-1312-----------------------------------------------LSKTL.......E--RWN.ITP----------.
D5CDA5_ENTCC/1010-1252-----------------------------------------------LDAAA.......N--FFG.IST----------.
E0SHA8_DICD3/1031-1273-----------------------------------------------LSDNA.......D--WLG.LAT----------.
F4AYZ2_KROS4/566-791-----------------------------------------------IDRSF.......K--ELD.MLQ----------G
G2J3B5_PSEUL/1018-1258-----------------------------------------------LGELL.......G--RFG.YGD----------.
I0DWA9_PROSM/1000-1242-----------------------------------------------FDETA.......A--YYGILVP----------.
M1FEQ6_9ALTE/970-1216-----------------------------------------------LAELG.......G--LFG.ADV----------.
N0B6U7_9RHIZ/961-1176-----------------------------------------------AGQVM.......K--LVN.FYP----------.
Q0KCK4_CUPNH/1119-1370-----------------------------------------------AGATL.......E--RLG.LAH----------.
Q0VS66_ALCBS/1022-1263-----------------------------------------------LGRSL.......R--AWG.LPE----------.
Q2K6G4_RHIEC/885-1104-----------------------------------------------LAGVI.......W--LRD.GAP----------.
Q32B94_SHIDS/1009-1252-----------------------------------------------IDAAA.......E--FFG.VTT----------.
Q5ZUN8_LEGPH/1014-1261-----------------------------------------------LAKSL.......D--RWA.INP----------.
Q63R38_BURPS/1120-1377-----------------------------------------------AGALL.......E--RVG.LPR----------.
Q6LMA6_PHOPR/1035-1276-----------------------------------------------SSDLM.......G--RFG.ISS----------.
Q8P7K3_XANCP/1032-1273-----------------------------------------------LGNLL.......Q--NLT.LGG----------.
Q9KUU5_VIBCH/1028-1269-----------------------------------------------NSDLM.......A--RFG.INS----------.
Q9PEA2_XYLFA/983-1225-----------------------------------------------LGELA.......Q--AIG.YGE----------.

PF05170

Q87TE2_VIBPA/1-570.....................KPWQELPFTINHINSLDLLNADIEW.GEWHWQNL..ELSIEDASLPAS----------L
Q9KNJ9_VIBCH/1-570.....................SLWQTIAPSIYHINSLDLLNSQLTL.NGVAWENL..NLSVEDYDLRHS----------L
Q9HU38_PSEAE/1-636FSAQ................GQLLLDQSAQIAEWNGLKLSVNQLRA.LGEL......KARELDKDTKFS----------G
Q9KT66_VIBCH/1-595.....................NLDASFSDPSNQIDSAKLKLDTFEF.DKANALTFSVAGKAADMKLNAQ----------G
Q9JY87_NEIMB/8-615DGH.................GITISTTGSPSVRFNAGGADAAGLGLRADTSFRNLHLTAQIPALALRNN----------S
Q9ZDI1_RICPR/1-711LTMSISACSKNINIRDARLHYPNIELLANTNYDMERNNLESNIIVN.PGNLITKIQSNLDKTNILLQAD----------S
Q9HUT4_PSEAE/1-577GGM..................LALQDASKPFPLQAEVSAGSTRAAV.VGTLTDPL..NLGALDLRLKLS----------G
YHJG_ECOLI/1-582GGM..................LALRGEGTPFPVQADFRSGNTRVAF.DGVVNDPM..KMGGVDLRLKFS----------G
Q7MQ04_VIBVY/1-571.....................KPWDRFGSQITHINSLDILRSSLAL.EDYRLINF..ELSSENLTLPFS----------L

PF04357

A2U1I0_9FLAO/1175-1633E.NRD........DVVVFVNRE.............NPDAILTQ............TEEKSAVITGFDIF----------A
Q83EW1_COXBU/570-928G.............DVVFIGAD..........................................EKQTP----------W
Q1D0C2_MYXXD/935-1291M.QKR.......TT............................H............LAAGSLSSSGEPPK----------P
A5FB26_FLAJ1/992-1420E.SS..........WIHFVTPKEKYN.....LQKGIVERTRN....................YNGLELE----------F
Q8YZJ8_NOSS1/1412-1829T..TTETNTRATTIELNSNIPE....................A..........TVTQQPPTRPNL..PV----------E
A4CK93_ROBBH/998-1431D.YS..........FINFIEKDERRT.....IEAQRTLRE......................YEGLELE----------F
A3U6I2_CROAH/1185-1647ESRD.........GVVIFVNKDNPDS.....ILTQTQEEESA.............I......ISGFDIK----------T
A0LGH5_SYNFM/889-1254I.............TVVEGDAE....................S..........DFVEIGSSDKTHDRYY----------S
A3HZ37_9BACT/1160-1620VERD.........GVVLFVNKENPDD.....ILTGQTEETTT.............A......FSGYDIQ----------A
A5GSG8_SYNR3/973-1387....GG.....PSVPVDQAVPEASWD.....FQQPVVVRGPRVES.......ADGAAVRRRVPT.FGPL----------S
A6L590_BACV8/1012-1461SNQ...........FITFVDKTPKRI.....HDNVETNLYHHSN........VRKTKEDDGPPMDLRIN----------M
A0M1P1_GRAFK/1180-1639QERD.........GIVIFVNKENPED.....ILSQT.EEESY.............V......ISGYDIF----------M
Q2S2D2_SALRD/1057-1516D.AG..........FIVFADSTGRTP.....SVSQLTRRPNILA.........DRPAGVPSFVEGLNLD----------L
Q21Y28_ALBFT/928-1291G.............DVLVRRPG.............PSQAGTAA..........PTAPTASTAAAQ..ER----------V
Q6MKB2_BDEBA/958-1321G.VR..........QSLYLPKL.........................................LREGQF----------E
Q39RU7_GEOMG/1016-1376P.............DVVLEG...............APPHEET.............E...........FP----------L
Q7VBL9_PROMA/867-1309T..STQKISTNSTQRYFNQLPEQNWD.....YKDPLVLFIEDKNS.......PANKLLRSGLPKGLSFI----------G
Q016Y8_OSTTA/1647-2059N.QE..........SDKRGVLAGILE.....RAARANDPNHRDGY......SSDLENEFMSEKNLEKLQ----------N
A5FIP0_FLAJ1/1183-1626ADRE.........GIVEFVNEDNMYL.....KQTVDLQNKLDQ...........SE......LKGMDVN----------V
Q8KFW2_CHLTE/1034-1479Y.IGV.......EKFIKFVPRR..................PAPKP......VEAAAPPEKLEFHYNLLD----------I
A6H009_FLAPJ/1018-1446E.ND..........YIKFKSRKDDFV.....NKTKNKKQKT.....................YKGVELN----------F
B5E9K2_GEOBB/1121-1484S.............DVILEG...............APAESARK............P...........FP----------L
Q11I59_CHESB/1185-1538...S.........ID..VQHLNP..........PPAVERTLEKA........RVADDGTPM..PSQRPS----------V
Q11VR9_CYTH3/1167-1624DRGD.........GIVIFTTDSSSLD.....PIMLRQNEEVIA...........EK......ITGLDLS----------A
A7HQ23_PARL1/1042-1395.............IDVILVRGP.................................GEADIVEEPEEAPP----------L
Q7MT86_PORGI/1036-1486EYR...........FLRFVDPKSSRE.....RARQETSPDRPSL.........LLPATGGDPETDFHLV----------M
Q3AQ57_CHLCH/1053-1500Y.VGI.......DNTISFVARN................PKPKAPK......AKELKSGGSKEFYYSLID----------I
A1BDC7_CHLPD/1048-1494Y.IGV.......EKFIEFVPRY................PSQQSMV......AQTDLDSDPVGFNYSLID----------I
Q6MAC5_PARUW/935-1288...S.........VAVIFINQNP..........DH.....KSKRS......SEVSNSSPL.........----------.
Q1QWE2_CHRSD/954-1312S.............DEVIITRE.............QDAAQQGEKA......SGEQGEATAQALSE..AG----------M
Q2RSJ7_RHORT/1146-1500.............LDVVEIGGK..................GQATS......ATQAVADREALRMAAQTP----------I
Q2S346_SALRD/1311-1689M.GAVEL....TAQDQLTLEER....................F...........GLRLTSADTTTFDAY----------E
Q2INP6_ANADE/946-1304L.RR....................................................RPPPPPKPYDKSG----------E
Q9RUC9_DEIRA/223-627P.GSTGN....GAKDTFVSPLPEEY......TTFPKPAAGSGQGK......GTTGTGSSTSPATTPLLE----------R
Q1LSN0_BAUCH/634-981S.LD..........DAILLDEQ....................L............NLIPMLTNYKRIIA----------L
B3ELK5_CHLPB/1036-1483Y.VGA.......ERFITFVPRY...............PEKIDPDQ......PENPEKPVNPEFYYTLID----------I
Q8YUC2_NOSS1/1659-2048N..NVS......AI............................S..........LTKFNKQDTPT.TASA----------N
Q1MQI4_LAWIP/1025-1382L.NV.........VDSTQQQNT........................................KTKKATY----------Q
Q7VQN5_BLOFL/933-1286S.S...........EEIVLNDK...................................FKPITNKPKNVG----------M
Q31MA1_SYNE7/1177-1568..........................................N...........LASGDLGAPTL..PV----------R
B4E8E1_BURCJ/988-1340D.............DVVIVQPDG..........TVR...GETPTG.......TAV.AKPKAVEDKPAPS----------L
E3G0N9_STIAD/1177-1560L.ERP........GDIVLVRNGLLM.......NKRR...KPATAPAGTGGTGNAGTAEENA.SEEEKPA----------V
F4B3D6_KROS4/1021-1426D.NS..........YIKFLSPE.............EKEARIN............GVQVITEAVKGLSVN----------F
Q46LW1_PROMT/887-1319S.EKSDRY.QDSKVRIIRRLPEQNWNQKEPLVLFIQD.....EDA.......PASRIVSAGLPNG..FE----------S
TAMB_HAEIN/952-1298E.............DEVILNGP............HKSKEE................LIKREFAAKTKSG----------M
Q5NNB3_ZYMMO/1036-1389D.LS..........GVKRK..G.............QVEDTAAH...........QTKESSASASM..LA----------S

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------.TLP.DD----------S
Q4K5X6_PSEF5/360-511--------------------------------------------------------------.SLN.QS----------P
B2JQ93_BURP8/874-1021--------------------------------------------------------------.TES.KQ----------S
A0RMT1_CAMFF/653-798--------------------------------------------------------------.NDK...----------I
Q72DG8_DESVH/963-1109--------------------------------------------------------------.MAP.ES----------R
A9BMN7_DELAS/883-1036--------------------------------------------------------------.SEQPAS----------Q
A7ZFK9_CAMC1/750-895--------------------------------------------------------------.KKR...----------P
Q2LUD1_SYNAS/534-687--------------------------------------------------------------.SVP.NS----------A
A8ZWF7_DESOH/636-783--------------------------------------------------------------.SED.FK----------A
Q3A6W6_PELCD/375-529--------------------------------------------------------------.DLPGSD----------P
Q5NYY7_AROAE/382-536--------------------------------------------------------------.SAP.DA----------I
Q2KWF8_BORA1/759-906--------------------------------------------------------------.SRN.PK----------P
Q484B1_COLP3/382-534--------------------------------------------------------------.PFT.DE----------L
A2SI01_METPP/870-1017--------------------------------------------------------------.WDS.PQ----------P
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------.TDL.GK----------P
Q5QWM2_IDILO/380-527--------------------------------------------------------------.SDS.SE----------P
Q0VP61_ALCBS/592-737--------------------------------------------------------------.TRS.GR----------T
A3QD21_SHELP/699-846--------------------------------------------------------------.SSS.EK----------A
Q63NS2_BURPS/645-797--------------------------------------------------------------.EDL.SK----------P
Q47FN3_DECAR/732-879--------------------------------------------------------------.SAA.DT----------V
A0KK00_AERHH/368-522--------------------------------------------------------------.GSQSGQ----------R
Q0JZH1_CUPNH/670-829--------------------------------------------------------------WPLT.PA----------A
Q2LUD1_SYNAS/785-932--------------------------------------------------------------.SNL.AT----------T
A1ARF1_PELPD/790-937--------------------------------------------------------------.SDD.SK----------F
Q39RS7_GEOMG/568-719--------------------------------------------------------------.GPR.ME----------T
B9M3X2_GEODF/795-942--------------------------------------------------------------.SED.FR----------Y
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------.SLP.AD----------.
Q3JBN6_NITOC/584-731--------------------------------------------------------------.SMD.QG----------R
Q5DZ89_VIBF1/399-549--------------------------------------------------------------.SDL.SK----------P
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------NSDD...----------.
A9BMN7_DELAS/165-317--------------------------------------------------------------.NLE.SK----------.
A9BMN7_DELAS/379-538--------------------------------------------------------------.RWPLEQ----------P
Q87WR1_PSESM/386-537--------------------------------------------------------------.SLN.KS----------P
B2JQ93_BURP8/616-770--------------------------------------------------------------.DDL.SR----------A
A1K6C3_AZOSB/734-881--------------------------------------------------------------.NRP.GS----------E
Q603H4_METCA/718-865--------------------------------------------------------------.TRS.EA----------R
Q47VC1_COLP3/500-655--------------------------------------------------------------.KEKKQQ----------Q
Q15PY6_PSEA6/662-809--------------------------------------------------------------.SSA.DN----------P
Q88DW4_PSEPK/365-516--------------------------------------------------------------.SLN.QS----------P
A0KK00_AERHH/578-725--------------------------------------------------------------.NIP.GQ----------R
B5ECC6_GEOBB/569-721--------------------------------------------------------------.GPK.FA----------P
Q2LUD1_SYNAS/159-313--------------------------------------------------------------.NLF.YR----------.
A4VPN2_PSEU5/551-698--------------------------------------------------------------.NRE.QK----------A
Q0VP61_ALCBS/382-530--------------------------------------------------------------IGE..EA----------T
A1K7K6_AZOSB/583-736--------------------------------------------------------------.TAK.GA----------N
Q3JBN6_NITOC/369-521--------------------------------------------------------------.SVP.GL----------A
Q5NYY7_AROAE/832-979--------------------------------------------------------------.SDP.AT----------L
Q13S79_BURXL/640-791--------------------------------------------------------------.DDL.SR----------P
Q47FN3_DECAR/504-656--------------------------------------------------------------.NEA.NQ----------K
Q316X0_DESAG/862-1008--------------------------------------------------------------.LSA.AS----------R
Q602F3_METCA/416-565--------------------------------------------------------------.....TR----------Q
Q2Y5K5_NITMU/673-818--------------------------------------------------------------...P.RK----------T
B3E4B8_GEOLS/816-963--------------------------------------------------------------.SDM.NT----------R
A4VPN2_PSEU5/341-492--------------------------------------------------------------.SLA.NR----------P
Q5NYY7_AROAE/153-307--------------------------------------------------------------...NLPS----------K
Q30NX8_SULDN/563-715--------------------------------------------------------------.SKE.KS----------W
C1DFK3_AZOVD/367-518--------------------------------------------------------------.SLG.RS----------P
Q484B1_COLP3/604-751--------------------------------------------------------------.SNE.DS----------R
Q5NYY7_AROAE/604-757--------------------------------------------------------------.TAK.GA----------A
Q602F3_METCA/623-770--------------------------------------------------------------.SRP.DA----------E
Q316X0_DESAG/389-538--------------------------------------------------------------TTG....----------.
A5G9K9_GEOUR/137-293--------------------------------------------------------------.TIP.YL----------.
B2JHK1_BURP8/152-309--------------------------------------------------------------LPDL.SE----------P
A5G9K9_GEOUR/551-702--------------------------------------------------------------.GPT.FG----------P
A0KK00_AERHH/151-307--------------------------------------------------------------.TAP.GR----------A
Q1H1L3_METFK/780-927--------------------------------------------------------------.TNP.ST----------T
B9M7L7_GEODF/383-534--------------------------------------------------------------.GPP.FG----------M
A4SXW3_POLSQ/414-561--------------------------------------------------------------.NAP.GH----------F
B9M3X2_GEODF/564-715--------------------------------------------------------------.DIL.RI----------P
A4G9D7_HERAR/154-308--------------------------------------------------------------.SLP.SQ----------.
Q21F55_SACD2/584-731--------------------------------------------------------------.SAS.TQ----------P
Q7NY28_CHRVO/704-851--------------------------------------------------------------.TRA.GG----------R
Q0JZH1_CUPNH/164-317--------------------------------------------------------------.NLP.HD----------.
A1TWZ4_MARAV/597-744--------------------------------------------------------------.NVP.PQ----------Q
B3E4B8_GEOLS/367-514--------------------------------------------------------------.TTA.NT----------Q
Q2IFA1_ANADE/563-710--------------------------------------------------------------.SDP.KV----------R
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------.AEQ.AS----------A
Q11NN1_CYTH3/142-298--------------------------------------------------------------.NVEDKE----------K
Q9HV64_PSEAE/140-291--------------------------------------------------------------.TLP.DD----------G
Q3SGZ4_THIDA/733-880--------------------------------------------------------------.NDP.AT----------T
Q3A6W6_PELCD/162-316--------------------------------------------------------------.TLK.RH----------R
Q316X0_DESAG/600-751--------------------------------------------------------------.SDA.AA----------P
A1TWZ4_MARAV/166-321--------------------------------------------------------------.TWPRDG----------S
B9M7L7_GEODF/592-739--------------------------------------------------------------.SED.NR----------F
Q222N5_ALBFT/496-646--------------------------------------------------------------.SDL.KQ----------T
Q3A6W6_PELCD/805-951--------------------------------------------------------------.NTP.DS----------L
A5G9K9_GEOUR/769-916--------------------------------------------------------------.SEE.NR----------F
A2SI01_METPP/623-775--------------------------------------------------------------.SDL.TK----------P
Q083W9_SHEFN/492-642--------------------------------------------------------------.SDL.SS----------P
Q083W9_SHEFN/725-872--------------------------------------------------------------.SNP.ET----------T
Q12MK5_SHEDO/654-801--------------------------------------------------------------.SKL.DS----------R
Q3SGZ4_THIDA/517-669--------------------------------------------------------------.LDM.DK----------A
A1ARF1_PELPD/573-725--------------------------------------------------------------.GPK.FT----------P
Q39RS7_GEOMG/801-948--------------------------------------------------------------.SEA.SR----------F
Q603H4_METCA/502-653--------------------------------------------------------------.SDE.GR----------P
Q222N5_ALBFT/149-300--------------------------------------------------------------.TLP.EQ----------N
A8ZWF7_DESOH/412-569--------------------------------------------------------------.TTAPEK----------E
A4XYD1_PSEMY/354-505--------------------------------------------------------------.SLG.DK----------P
Q484B1_COLP3/152-304--------------------------------------------------------------.TKAGDN----------N
Q21F55_SACD2/154-306--------------------------------------------------------------.TLP.NK----------T
Q3SGZ4_THIDA/147-307--------------------------------------------------------------.TLP.ED----------R
A7I315_CAMHC/662-807--------------------------------------------------------------.SKG...----------L
Q74FC9_GEOSL/787-934--------------------------------------------------------------.SEE.SK----------F
A7H8M2_ANADF/367-518--------------------------------------------------------------.PDV.DA----------T
F2GAL8_ALTMD/716-863--------------------------------------------------------------.SRS.ND----------P
Q5DZ89_VIBF1/610-757--------------------------------------------------------------.SIP.GT----------K
A4XYD1_PSEMY/562-709--------------------------------------------------------------.NQK.PQ----------A
B3E4B8_GEOLS/583-736--------------------------------------------------------------.GPT.FS----------A
C1DFK3_AZOVD/141-292--------------------------------------------------------------.TLP.ND----------T
Q1LGA7_RALME/681-840--------------------------------------------------------------WPLS.PG----------A
B5ECC6_GEOBB/807-954--------------------------------------------------------------.SEE.SK----------F
Q2IFA1_ANADE/358-509--------------------------------------------------------------.PGP.ET----------A
A4XYD1_PSEMY/140-291--------------------------------------------------------------.TLA.GD----------N
A7H8M2_ANADF/165-318--------------------------------------------------------------.TRG.GG----------D
A3QD21_SHELP/453-602--------------------------------------------------------------.ESL.SQ----------P
Q3A6W6_PELCD/588-738--------------------------------------------------------------.SAT.NP----------P
A7H8M2_ANADF/579-726--------------------------------------------------------------.SDP.RV----------R
A8ETY5_ARCB4/612-759--------------------------------------------------------------.NTK.LG----------K
Q30NX8_SULDN/772-919--------------------------------------------------------------.SAK.EE----------V
A4VPN2_PSEU5/125-276--------------------------------------------------------------.TRT.DG----------S
Q1LGA7_RALME/173-326--------------------------------------------------------------.NLP.HD----------.
Q1H1L3_METFK/561-712--------------------------------------------------------------.LDT.KR----------A
Q222N5_ALBFT/710-857--------------------------------------------------------------.SNR.EA----------R
C1DFK3_AZOVD/584-731--------------------------------------------------------------.NRR.PK----------P
B2U875_RALPJ/869-1016--------------------------------------------------------------.TAANQT----------P
B4EKU9_BURCJ/620-772--------------------------------------------------------------.DDL.TK----------P
D0J281_COMT2/165-316--------------------------------------------------------------.NLASKR----------E
M1FB64_9ALTE/585-727--------------------------------------------------------------.NIP.PQ----------Q
Q63NS2_BURPS/160-304--------------------------------------------------------------.TLP.SK----------.
Q7VVF7_BORPE/156-309--------------------------------------------------------------.TFG.YA----------.
Q7VVF7_BORPE/538-685--------------------------------------------------------------..LD.AQ----------P
Q87WR1_PSESM/155-306--------------------------------------------------------------.TLP.ED----------N
Q88DW4_PSEPK/140-291--------------------------------------------------------------.TLP.ND----------N
Q88DW4_PSEPK/581-725--------------------------------------------------------------.NRK.PQ----------P
Q8EDF6_SHEON/666-811--------------------------------------------------------------.SKP.NT----------K
Q9HV64_PSEAE/476-627--------------------------------------------------------------.SLG.KT----------P
Q9HV64_PSEAE/692-837--------------------------------------------------------------.TRN.SQ----------P

PF13116

C6XK02_HIRBI/457-744---------------------------------------------------------------VKFLED..........L
Q7NW94_CHRVO/514-796---------------------------------------------------------------LSYQQG..........W
Q7N037_PHOLL/501-786---------------------------------------------------------------FQYQPN..........W
A7ZDM6_CAMC1/160-458---------------------------------------------------------------VKFEKD..........L
A4XQL3_PSEMY/513-798---------------------------------------------------------------LAFQPD..........W
Q3J7T7_NITOC/517-810---------------------------------------------------------------LNYARG..........W
D5CU11_SIDLE/524-805---------------------------------------------------------------MEFAKG..........W
A1AVR0_RUTMC/242-525---------------------------------------------------------------LLFNTD..........W
Q31FH6_THICR/496-774---------------------------------------------------------------LKFQPD..........W
Q2NWP0_SODGM/504-789---------------------------------------------------------------YEFEPG..........W
B8GV04_THISH/540-825---------------------------------------------------------------LDYQRG..........W
A0RPG5_CAMFF/10-294---------------------------------------------------------------IKFHEN..........I
Q07WQ4_SHEFN/504-791---------------------------------------------------------------FKFQPD..........W
Q5ZUN8_LEGPH/507-795---------------------------------------------------------------ILITPE..........W
Q7VFV2_HELHP/222-511---------------------------------------------------------------VYLAPH..........L
Q12IX1_SHEDO/530-817---------------------------------------------------------------YRFEPD..........W
Q15ZG8_PSEA6/490-776---------------------------------------------------------------FEFAED..........W
A6Q385_NITSB/202-483---------------------------------------------------------------IDFQKG..........I
A8GK60_SERP5/523-808---------------------------------------------------------------FQFQPD..........W
Q3IFH7_PSEHT/493-781---------------------------------------------------------------YQFDPD..........W
D9SHW3_GALCS/523-805---------------------------------------------------------------MQFAPD..........W
C7R9G7_KANKD/505-791---------------------------------------------------------------FKFDPE..........W
Q21FT5_SACD2/542-827---------------------------------------------------------------LKFDPE..........W
A7MJB2_CROS8/518-803---------------------------------------------------------------YAFQPD..........W
C6XD69_METGS/519-799---------------------------------------------------------------LDYAPG..........W
A7I2E8_CAMHC/213-497---------------------------------------------------------------VKFDKK..........L
Q6LMA6_PHOPR/509-794---------------------------------------------------------------FSFDTA..........W
D0L1I5_HALNC/561-853---------------------------------------------------------------LPFLPD..........W
A3Q9Y2_SHELP/509-796---------------------------------------------------------------YRFQPD..........W
A6QAC9_SULNB/206-494---------------------------------------------------------------IHYKEG..........L
A8EUE5_ARCB4/193-478---------------------------------------------------------------IRFHKD..........V
C5ZX33_9HELI/208-498---------------------------------------------------------------VTFQKG..........L
Q1H0H5_METFK/520-800---------------------------------------------------------------LRFSPE..........W
Q7MRT1_WOLSU/187-475---------------------------------------------------------------VTFHPD..........L
Q47VG9_COLP3/504-793---------------------------------------------------------------FKFVDN..........W
A4G3G0_HERAR/587-887---------------------------------------------------------------LNYAPDMFGRDGKAPLW
D1B1Z5_SULD5/203-493---------------------------------------------------------------IIFEKS..........V
D3V5J7_XENBS/502-797---------------------------------------------------------------FQYQPD..........W
E6WGF8_PANSA/504-789---------------------------------------------------------------YQFQPG..........W
F2G3T4_ALTMD/500-787---------------------------------------------------------------FLFAPD..........W
D3VKA4_XENNA/501-791---------------------------------------------------------------FQYQPD..........W
Q0ABM3_ALKEH/531-818---------------------------------------------------------------LAYQPD..........W
A0KFB2_AERHH/486-771---------------------------------------------------------------YEFFPG..........W
A6TER2_KLEP7/497-781---------------------------------------------------------------FAFQPD..........W
B4EX35_PROMH/501-782---------------------------------------------------------------FKYDSE..........W
B7VIB8_VIBSL/505-791---------------------------------------------------------------FSFDTA..........W
D3HJX5_LEGLN/559-845---------------------------------------------------------------LAINSK..........W
F0LWR2_VIBFN/505-791---------------------------------------------------------------FSFDTA..........W
G9AWD3_PANAN/505-788---------------------------------------------------------------YGFQPG..........W
I0DWA9_PROSM/493-771---------------------------------------------------------------FEYDKG..........W
Q5E7X4_VIBF1/495-780---------------------------------------------------------------FAFDTA..........W
Q6DAI1_PECAS/504-784---------------------------------------------------------------FEFQPG..........W
Q74PM2_YERPE/511-794---------------------------------------------------------------FQFQPD..........W
Q7MHE2_VIBVY/508-794---------------------------------------------------------------FSFDTA..........W
Q83BN5_COXBU/480-760---------------------------------------------------------------LNYHSG..........W
Q8ZLP4_SALTY/504-786---------------------------------------------------------------FAFQPD..........W
Q9KUU5_VIBCH/504-791---------------------------------------------------------------FAFDTA..........W

PF13109

A0RPG5_CAMFF/433-647------.--------G-F--TK---FK---S-------------------------EIK-V-S-N-TY-L--S--NY---
A6Q385_NITSB/623-836------.--------V-.--GK---MR---G-------------------------RFS-V-Q-R-AY-I--K--NL---
A6QAC9_SULNB/640-854------.--------G-.--KL---MK---G-------------------------EIL-L-D-G-GV-L--K--SF---
B9L5J2_NAUPA/583-798------.--------D-.--DF---YS---G-------------------------KIY-I-N-R-AI-V--R--EL---
C5ZX33_9HELI/638-852------P--------K-.--GA---LI---G-------------------------KLG-I-L-N-TN-I--N--QL---
D3UGW6_HELM1/730-943------.--------D-.--SI---FS---G-------------------------ELK-M-Q-N-TL-F--K--NF---
Q30RQ8_SULDN/697-907------.--------E-.--..---YS---G-------------------------TVN-I-V-D-TT-I--Q--DY---
Q7MRT1_WOLSU/616-829------.--------G-.--GV---FK---G-------------------------KSF-I-W-D-TT-L--K--NL---
Q7VFV2_HELHP/731-944------.--------E-.--GI---LK---G-------------------------EIS-M-Q-N-TI-Y--Q--DL---
O25308_HELPY/745-958------.--------D-.--QV---FN---G-------------------------ELK-F-Q-N-TS-L--K--NF---
Q0PAY6_CAMJE/635-848------.--------G-L--EY---FD---G-------------------------QID-F-K-N-TY-V--K--DL---

PF13502

A0KFB2_AERHH/999-1241......P..--IGD.A.P.-GK...MA---L-------------------------DLS-W.R.D-VP.Y--R..PN.--
A1S2S6_SHEAM/1130-1371......G..--IKD.S.P.-LD...IS---A-------------------------ELF-W.Q.G-AP.H--E..FD.--
A1STZ9_PSYIN/1024-1262......M..--I.Y.S.K.-AE...LS---G-------------------------ALN-W.I.G-AP.W--S..FN.--
A1TW53_ACIAC/1117-1369......V..--LRR.G.K.-GR...ME---G-------------------------QVA-W.M.G-AP.L--N..PD.--
A1U479_MARAV/979-1225......M..--T.N.E.E.-TA...VE---L-------------------------DLD-W.P.G-SP.N--N..IA.--
A1WCZ7_ACISJ/1139-1390......V..--VRH.G.K.-GR...IG---G-------------------------QVG-W.L.G-SP.L--S..PD.--
A1WSB5_VEREI/1101-1362......V..--VRH.G.K.-GL...LQ---G-------------------------RVA-W.L.G-AP.F--N..PD.--
A1WYY8_HALHL/891-1129......A..--V.TVA.D.-VD...IS---A-------------------------ELG-W.P.Q-AP.W--G..VE.--
A2U2U5_9FLAO/567-793IAPIANT..--I.G.G.K.-MN...SK---V-------------------------NVS-G.V.L-DENM--A..PS.--
A3HUH0_9BACT/675-900......N..--L.T.G.T.-FN...SN---L-------------------------NFS-GVL.G-QD.M--M..PL.--
A3Q9Y2_SHELP/1046-1289......G..--LKE.A.P.-LD...LQ---A-------------------------ELS-W.Q.G-AP.Y--A..FS.--
E0TB83_PARBH/837-1047......S..--V.W.GAA.-AA...FE---A-------------------------TLP-A.E.G-GL.Y--G..EF.--
A4AMF6_MARSH/560-785LAPVASA..--L.Q.G.R.-MN...SD---I-------------------------ELS-G.S.L-KD.D--F.TPD.--
A4CG41_ROBBH/574-799LAPIASI..--V.E.G.K.-LN...SR---V-------------------------QLS-G.L.L-NSDF--S..PD.--
A4VIB7_PSEU5/1014-1255......V..--T.S.E.S.-FR...LD---A-------------------------DGR-W.P.G-SP.A--W..FA.--
A5CF63_ORITB/620-836......SFL--P.K.G.F.-AS...MQ---G-------------------------TIT-T.N.G-EN.L--A..DI.--
A5FJ68_FLAJ1/564-791IAPIAGI..--I.N.G.K.-LN...ST---I-------------------------KLN-G.N.L-DA.K--ELTPD.--
A5FUN1_ACICJ/745-973A...LPL..--S.G.G.T.-VD...LG---A-------------------------NLM-A.Q.G-DS.G--R..AW.--
A6GWN8_FLAPJ/560-787IAPIAGI..--I.N.G.K.-LN...SN---I-------------------------KLS-G.N.L-NA.I--EMTPD.--
A7HEC2_ANADF/581-801......V..--I.G.G.T.-LD...AV---L-------------------------KLG-G.T.G-WN.A--G..LL.--
A9CIC7_AGRT5/884-1105......V..--A.T.G.R.-VA...ID---L-------------------------TAE-S.T.G-KS.V--G..EM.--
A9H3V6_GLUDA/474-684......V..--L.Q.G.V.-FDDRQPS---A-------------------------PFA-G.V.L-TI.D--P..MT.--
B2FP42_STRMK/1008-1250......L..--R.G.G.S.-GQ...AQ---L-------------------------QAS-W.S.G-GP.S--D..FQ.--
F2G3T4_ALTMD/1046-1287......G..--IKD.S.S.-AE...VK---F-------------------------DIS-W.P.N-AP.M--D..FG.--
B4S7D6_PROA2/551-781......Y..--A.T.G.D.-VS...AN---L-------------------------DLR-M.A.L-DE.A--F.NPL.--
B7VIB8_VIBSL/1027-1268......G..--IQK.A.P.-FE...LE---G-------------------------QLT-W.D.G-SP.W--G..IK.--
B8CI63_SHEPW/997-1240......L..--K.D.A.P.-TA...VT---G-------------------------EIS-W.S.G-AP.Y--A..FS.--
C1D9M5_LARHH/1015-1258......L..--VRG.G.K.-FR...ST---G-------------------------QLE-W.Q.G-GM.T--S..IQ.--
C3L4A9_AMOA5/534-754......H..--L.G.G.H.-VC...SD---I-------------------------ELT-I.Q.T-DK.Q--L..HID--
C4L8L8_TOLAT/989-1232......G..--L.T.GTK.-SQ...LD---I-------------------------DVS-W.P.G-AL.V--Q..PR.--
E8RSC3_ASTEC/1136-1358......D..--L.V.A.T.-AL...GD---K-------------------------RLS-G.G.D-AV.I--E..GV.--
D9SHW3_GALCS/1021-1263......T..--VKN.G.S.-GK...MI---A-------------------------NLS-W.D.G-QP.F--D..FN.--
D5CU11_SIDLE/1024-1263......S..--LKD.G.S.-GS...LQ---S-------------------------DLH-W.A.G-AP.D--T..FA.--
C6WWM2_METML/1053-1294......T.I--M.E.G.E.-GK...LT---G-------------------------QLR-W.P.G-SP.H--Q..FD.--
C6XD69_METGS/1043-1284......T..--VKG.G.E.-AD...LT---G-------------------------QLK-W.P.G-SP.H--E..FN.--
C6XK02_HIRBI/884-1092......Y.L--I.G.G.T.-LN...MN---G-------------------------VFG-K.E.F-GT.A--E..MF.--
C7PC84_CHIPD/564-796LMPVAKF..--L.N.G.K.-IN...SH---L-------------------------ELT-G.KLG-QD.M--M..PL.--
E6WGF8_PANSA/1014-1257......P..--LRD.A.P.-FK...ID---Y-------------------------DLH-W.R.S-AP.W--Q..PS.--
D2UF54_XANAP/1023-1265......L..--R.G.G.E.-GR...LN---L-------------------------RAA-W.P.G-NP.D--A..VQ.--
D3SBX9_THISK/1040-1287......L..--V.G.G.E.-GE...GR---L-------------------------DLS-W.P.G-PL.Y--A..PR.--
Q0ABM3_ALKEH/1048-1290......V..--S.R.G.R.-TE...ID---N-------------------------DVA-W.D.N-LP.H--R..FT.--
Q0AQ38_MARMM/879-1092......Y..--A.R.GGQ.-VS...VL---G-------------------------S.A-P.P.L-GT.D--G..PL.--
Q11YL6_CYTH3/532-755......N..--L.K.G.D.-IS...AD---V-------------------------SLL-M.Q.V-DN.H--L..AI.--
Q11YT8_CYTH3/698-925MAPIANY..--V.E.G.N.-VN...LA---L-------------------------VMN-G.L.L-DK.E--M.MPI.--
Q145G0_BURXL/1154-1409......T..--LKA.G.A.-GS...LS---G-------------------------KMV-W.Q.G-GP.T--R..ID.--
Q15ZG8_PSEA6/1002-1243......I..--K.D.S.K.-AS...AK---F-------------------------NLD-W.Q.R-AP.F--E..FD.--
Q211X0_RHOPB/871-1087.........--..A.G.K.-TS...LQ---M-------------------------TLS-S.Q.G-RS.G--S..AL.--
Q28TM9_JANSC/371-572......R..--L.Q.G.T.-GS...AS---V-------------------------EFL-G.V.G-ND.L--H..TI.--
Q2KY05_BORA1/936-1183......V..--MSG.G.S.-GS...VE---A-------------------------NLS-W.R.N-LP.W--T..HS.--
Q2NWP0_SODGM/1012-1255......P..--LRE.A.P.-FH...LN---Y-------------------------DLH-W.R.E-AP.W--Q..PD.--
Q3IFH7_PSEHT/1008-1245......A..--IKD.S.N.-AT...IN---Y-------------------------NLA-W.Q.A-AP.Y--N..LD.--
Q47VG9_COLP3/1038-1280......I..--I.K.D.SG-AK...ID---V-------------------------NLN-W.E.G-GL.H--D..FM.--
Q5R0H7_IDILO/1003-1244......A..--V.R.DSA.-AV...ID---F-------------------------NLN-W.R.D-HL.Y--Q..PD.--
Q7MHE2_VIBVY/1031-1272......G..--IQK.A.P.-FE...IT---S-------------------------QVT-W.D.G-TP.W--S..MR.--
Q7UYB4_RHOBA/752-985......S..--LAS.G.E.-IS...GE---I-------------------------S..-L.R.G-KS.I--Q..SI.--
Q8EA16_SHEON/1025-1268......G..--VDE.A.P.-LK...VN---A-------------------------DLA-W.Q.G-AP.Y--A..FS.--
Q9ZDH9_RICPR/624-849......W..--S.G.G.K.-VS...IS---G-------------------------SLW-T.N.G-NS.L--Q..SQ.--
A8GK60_SERP5/1034-1277......P..--L.K.GAP.-YD...ID---F-------------------------DLY-W.R.G-TP.W--K..PQ.--
C4YU88_9RICK/640-864......A..--S.S.E.K.-VS...IS---G-------------------------SLG-T.N.G-NT.L--Q..SQ.--
C5BC15_EDWI9/1004-1246......P..--LKQ.S.A.-FK...GD---Y-------------------------DLR-W.Q.G-EP.W--Q..PH.--
D3HJX5_LEGLN/1065-1312......A..--VHA.K.K.-GY...ME---F-------------------------HGG-W.K.N-RI.Y--N..FS.--
D5CDA5_ENTCC/1010-1252......P..--L.R.GSS.-FD...VD---Y-------------------------DLH-W.R.D-AP.W--K..PD.--
E0SHA8_DICD3/1031-1273......P..--LRA.G.A.-FK...ID---Y-------------------------DLY-W.H.G-SP.W--A..PH.--
F4AYZ2_KROS4/566-791LAPIAKA..--L.Q.G.A.-LN...TK---I-------------------------QLQ-G.Q.L-DDNF--S..PI.--
G2J3B5_PSEUL/1018-1258......T..--FRK.G.E.-GT...LG---G-------------------------KLH-W.P.G-GL.T--D..YE.--
I0DWA9_PROSM/1000-1242......I..--I.G.S.P.-YT...LD---F-------------------------ELN-W.Q.D-VP.W--S..PD.--
M1FEQ6_9ALTE/970-1216......P..--LEN.L.A.-TN...IE---L-------------------------ALE-W.P.G-RP.D--Q..FG.--
N0B6U7_9RHIZ/961-1176......N..--MQG.G.R.-MR...LE---V-------------------------NLD-G.T.G-PA.E--K.....--
Q0KCK4_CUPNH/1119-1370......T..--LSD.G.K.-GK...LE---G-------------------------RVA-W.R.G-SP.L--S..ID.--
Q0VS66_ALCBS/1022-1263......M..--IES.E.D.-AT...AK---V-------------------------SLG-W.A.Q-WP.L--A..PN.--
Q2K6G4_RHIEC/885-1104......V..--A.N.G.K.-FG...LS---L-------------------------SME-A.S.G-KT.I--N..EI.--
Q32B94_SHIDS/1009-1252......P..--IRQ.S.S.-FN...VD---Y-------------------------DLH-W.R.K-AP.W--Q..PD.--
Q5ZUN8_LEGPH/1014-1261......A..--VDA.G.K.-GY...IE---F-------------------------HGG-W.Q.G-SL.Y--D..FS.--
Q63R38_BURPS/1120-1377......T..--VEN.G.R.-GT...LS---G-------------------------KVA-W.R.G-GP.T--A..ID.--
Q6LMA6_PHOPR/1035-1276......G..--IQD.A.S.-FS...SY---A-------------------------SIQ-W.Q.G-SP.W--S..IH.--
Q8P7K3_XANCP/1032-1273......Q..--LRG.G.E.-GQ...LE---L-------------------------NAG-W.Q.G-SP.T--G..FA.--
Q9KUU5_VIBCH/1028-1269......G..--IQR.A.P.-FE...IT---A-------------------------STQ-W.D.G-AP.W--S..MQ.--
Q9PEA2_XYLFA/983-1225......Q..--LRG.G.E.-GQ...IQ---L-------------------------SAG-W.N.G-PP.V--G..FQ.--

PF05170

Q87TE2_VIBPA/1-570WNA.TAKVS--LQA.D-SV-RF---QE---Q-------------------------TAI-E-P-R-LN-A--IFTPE---
Q9KNJ9_VIBCH/1-570WQQQQAYLS--LNA.D-SA-QW---LA---T-------------------------QWV-E-P-S-AE-L--TLTPQ---
Q9HU38_PSEAE/1-636GLSIAP...--.....-..-MN---LR---E-------------------------FLA-G-I-G-VT-L--PAMAD---
Q9KT66_VIBCH/1-595SASLMVNQA--ISK.V-GL-DA---LK---L-------------------------QAE-L-E-G-AA-L--PQSPM---
Q9JY87_NEIMB/8-615IKIETVNGA--FTAGG-EY-AR---WD---G-------------------------SFK-L-D-K-AN-L--HSGIA---
Q9ZDI1_RICPR/1-711LKPILDALK--LKT.D-EL-PP---II---N-------------------------QKL-I-L-T-TN-V--IRDPQ---
Q9HUT4_PSEAE/1-577.........--.....-..-TS---MA---N-------------------------LYP-L-T-G-IT-L--PDTPA---
YHJG_ECOLI/1-582.........--.....-..-DS---LG---D-------------------------LYE-L-T-G-VL-L--PDTPP---
Q7MQ04_VIBVY/1-571WQQQQGLIS--FSA.E-SV-QD---QH---N-------------------------VWV-E-P-R-IK-F--TLDPN---

PF04357

A2U1I0_9FLAO/1175-1633KLNVNKEAS--V..-.----.T---VV---I...............DEDTGDNF..NVS-G-D-G.EFIF..NMVP.N--
Q83EW1_COXBU/570-928RTNINIKII--L.G-D----.Q---IL---L...............DSLG...A..KGR-L-A-G.ELTL..LKPP.N--
Q1D0C2_MYXXD/935-1291WVIWDVNVH--F.G-.----.D---VR---V...............DNNL...A..KAR-L-L-G.DVRL..TGT..D--
A5FB26_FLAJ1/992-1420DFDITPDAE--V..-.----.E---VI---L...............DRNSGHGM..KGK-G-Y-G.SLLF..KINT.L--
Q8YZJ8_NOSS1/1412-1829..FADLRLN--L.G-D----.D---VR---VTSQSLLGFLPGGEVFSQPI...L..SFD-A-E-G.DLII..NGTL.A--
A4CK93_ROBBH/998-1431DLDVTPEAE--V..-.----.E---IV---V...............DPQTGSSL..KGT-G-A-G.LIFM..EINT.N--
A3U6I2_CROAH/1185-1647NIKVGKEAV--V..-.----.N---VI---I...............DEQTGDNL..RIQ-G-D-A.DLKF..NIYP.N--
A0LGH5_SYNFM/889-1254SLKTDVVLD--LPA-S----.G---MA---V...............RGKG...L..NAQ-I-V-G.SLKI..EKSV.N--
A3HZ37_9BACT/1160-1620QLTADPKAK--F..-.----.T---VI---I...............DPKTGDNL..LVS-G-S-A.NLQM..DINP.N--
A5GSG8_SYNR3/973-1387..FRNLRVA--L.G-P----.Q---LR---I..............AAPPV...A..EFL-T-G-G.LLTF..NGPAGP--
A6L590_BACV8/1012-1461LIEATPSAT--M..-.----.K---II---M...............DPVAGDNI..TAT-G-N-G.NLQV..NFFN.K--
A0M1P1_GRAFK/1180-1639KIGVDEGAT--F..-.----.S---II---I...............NEETGDKF..QVQ-G-E-G.DLIF..NMYP.N--
Q2S2D2_SALRD/1057-1516NVIAPDEST--V..-.----.N---LV---F...............DPLVGDVV..TVV-G-S-G.RVQL..QRE..E--
Q21Y28_ALBFT/928-1291TPDVAITLD--L.G-P----.D---FQ---V...............RGRG...L..ATR-L-E-G.SLELRSAGR..S--
Q6MKB2_BDEBA/958-1321AILLDLQIL--L.S-R----.N---IV---I...............KNSL...I..DGS-V-T-G.QLQV..KGP..P--
Q39RU7_GEOMG/1016-1376ALDIRIGVT--L.G-D----.R---VI---V...............KTEG...I..DAQ-L-G-G.SVDL..AILG.P--
Q7VBL9_PROMA/867-1309..FDSLKLR--L.G-P----.D---LR---I..............VSQPI...A..SFD-A-A-G.TLIL..DGALDD--
Q016Y8_OSTTA/1647-2059FRLRGLQIN--V.G-P----.E---IS---V...............VYP....FVMNFG-V-S-G.EITL..DGAVDA--
A5FIP0_FLAJ1/1183-1626AISIDKEAE--L..-.----.T---LL---I...............DKANGDYL..NLK-G-E-A.ELVG..GIDQ.S--
Q8KFW2_CHLTE/1034-1479LQIKNLRLS--N.S-A----.P---VK---GTMI........FDRIRGER...V..EAQ-M-N-NLSLVV..NKT..G--
A6H009_FLAPJ/1018-1446ELDITKDAE--I..-.----.E---VI---I...............DKNSGHSL..KGR-G-A-G.TLAL..EINT.L--
B5E9K2_GEOBB/1121-1484VLDGRVKVV--L.G-D----.K---VR---V...............EASG...I..DAR-L-V-G.DMDL..VLKG.I--
Q11I59_CHESB/1185-1538M.RLNVNIN--A.P-A----.R---IF---V...............RGRG...L..DAE-L-G-G.SVQV..TGPV.T--
Q11VR9_CYTH3/1167-1624KIHIDRNST--L..-.----.K---IL---V...............DPISGDSL..SVR-G-D-A.DLNF..KMDA.S--
A7HQ23_PARL1/1042-1395PLMLDVRLA--I.G-N----PP---AR---V...............TGRG...I..NSL-W-T-G.SVTL..TGLA.E--
Q7MT86_PORGI/1036-1486NVGVTPDAE--V..-.----.D---LI---L...............DPQTGDGL..RGS-A-G-G.DLRI..DYHT.L--
Q3AQ57_CHLCH/1053-1500LTIHNLRIS--S.P-M----.P---LK---YTTI........FDRIRGEE...L..ETT-L-S-NLSLVV..NKN..S--
A1BDC7_CHLPD/1048-1494LQLKDLKIR--S.A-E----.Q---LK---FRVI........FDRTRGEE...L..EAA-I-S-GMQLMV..NKS..Q--
Q6MAC5_PARUW/935-1288..AFDIKLQ--I.P-G----.N---VS---I...............EGNN...L..SSE-W-K-G.AITI..TGTA.N--
Q1QWE2_CHRSD/954-1312ALDVSVMLS--L.G-P----.D---IS---L...............EAYG...L..ESQ-L-E-G.ELEV..RQG..N--
Q2RSJ7_RHORT/1146-1500PVLLDITVS--L.P-R----.R---VY---V...............RGRG...V..DSE-W-E-G.KLNV..GGTA.A--
Q2S346_SALRD/1311-1689ALALDLAVQ--I.Q-S----.N---TW---L...............RSSSNPEM..NVQ-F-T-G.DLDV..QKAA.L--
Q2INP6_ANADE/946-1304WLRFDLQLV--V.D-G----.D---AR---I...............ENDL...V..RGT-V-T-G.DLTL..TGT..L--
Q9RUC9_DEIRA/223-627FLFEDVQLR--A.S-G----.G---IR---L...............DENL...A..RAE-F-S-TPGLVV..SGT..A--
Q1LSN0_BAUCH/634-981PIVTNLLLH--L.N-N----.D---VQ---I...............NAFG...L..TAN-L-L-G.NLQI..TKSK.N--
B3ELK5_CHLPB/1036-1483ITIKNLRLT--S.A-V----.P---LQ---YSMI........FDRTRGEK...L..EAT-L-Q-NLSLNV..NKN..Q--
Q8YUC2_NOSS1/1659-2048TSFNNLELE--L.G-K----.N---VE---I..............ARPPL...L..SFA-A-T-G.NLKV..NGSL.A--
Q1MQI4_LAWIP/1025-1382QPTLSIALS--I.P-N----.R---FF---V...............RSSM...F..ESE-W-G-G.NLTI..NKVI.T--
Q7VQN5_BLOFL/933-1286LTISNLIIH--I.G-S----.D---VN---F...............NGFG...L..DVK-L-K-G.DLEI..SYD..E--
Q31MA1_SYNE7/1177-1568..FQQLKIA--L.E-E----.G---VS---V..............QSEPL...F..RFG-A-T-G.DLTL..DGPLGS--
B4E8E1_BURCJ/988-1340APRANIDVG--L.G-N----.N---FR---F...............KGHG...A..DLG-L-R-G.TITV..MSAP.G--
E3G0N9_STIAD/1177-1560QRTYELHVR--A.P-R----.N---LW---V...............RGAD...V..NVE-I-G-M.PLND..FYVAYR--
F4B3D6_KROS4/1021-1426DLDIDPDAE--V..-.----.E---VV---VD............KANGST...L..RGR-G-V-G.TLLI..QLDT.N--
Q46LW1_PROMT/887-1319LTFDNLKLA--L.G-P----.S---LR---L..............VSQPL...A..SFE-T-N-G.FLIL..NGAF.D--
TAMB_HAEIN/952-1298EIRSDLRIN--I.G-K----.D---VS---L...............DAYG...L..KTN-L-D-G.LLSV..KQD..K--
Q5NNB3_ZYMMO/1036-1389AWKLDIRIS--A.P-D----.Q---LF---V...............AGMG...L..ESE-W-E-A.DLRV..RGT..A--

PF05359

Q4K5X6_PSEF5/140-291.....ADMT..L....VAT.GP---EG...G-------------------------QID-W-S-G-NF----S..VTP..
Q4K5X6_PSEF5/360-511.....FTLK..L....DTG.LG---KQ...G-------------------------KVN-A-T-G-EV----N..LNP..
B2JQ93_BURP8/874-1021.....APVD..V....SAK.LA---AN...G-------------------------PIT-I-R-G-SV----N..PLI..
A0RMT1_CAMFF/653-798.....SNIA..L....HGV.VA---NY...G-------------------------FSE-I-L-V-TT----L..PFD..
Q72DG8_DESVH/963-1109.....AEVS..A....GGT.LE---G....V-------------------------PVK-L-T-G-TL----N..PVS..
A9BMN7_DELAS/883-1036QAPQLADVE..L....RGR.AQ---GT...A-------------------------SLE-I-T-G-QV----N..PLA..
A7ZFK9_CAMC1/750-895.....SSGE..F....QGV.VG---KN...G-------------------------FAQ-I-T-A-KL----F..PFE..
Q2LUD1_SYNAS/534-687.....ANLF..L....KAR.VS---PR...G-------------------------NVD-V-T-G-PV----I..MAP.R
A8ZWF7_DESOH/636-783.....ADVM..A....KGT.ID---GY...A-------------------------PVR-I-T-G-AI----N..PLG..
Q3A6W6_PELCD/375-529.....AELQ..A....DLT.LN---RT...A-------------------------HLS-L-Q-G-TL----L..PDP..
Q5NYY7_AROAE/382-536.....AEVA..L....DFV.TD---AG...E-------------------------KSS-H-R-D-RL----R..LNP..
Q2KWF8_BORA1/759-906.....ATVK..V....GGR.VY---TT...A-------------------------PFS-I-S-G-TV----Q..PFA..
Q484B1_COLP3/382-534.....ALLS..S....TIG.LN---TQ...G-------------------------IIN-L-K-G-TI----K..PES..
A2SI01_METPP/870-1017.....ATVK..I....SGK.VD---GA...A-------------------------PLE-I-G-G-TM----H..PLG..
Q8Y0Z7_RALSO/615-766.....VDVQ..I....GAG.LG---SK...G-------------------------KLD-V-R-G-NV----V..PQP..
Q5QWM2_IDILO/380-527.....ARVK..F....EGE.VA---EY...G-------------------------LAQ-V-N-G-TV----H..AWH..
Q0VP61_ALCBS/592-737.....ANVN..L....SAQ.VD---RY...A-------------------------PFS-V-K-G-RL----S....S..
A3QD21_SHELP/699-846.....AKVD..I....KGK.ID---RY...A-------------------------PVV-L-K-G-EI----N..PLL..
Q63NS2_BURPS/645-797.....LPVR..L....TAT.LN---RK...G-------------------------SLE-L-S-G-NV----T..AQP..
Q47FN3_DECAR/732-879.....ADME..V....RGK.YA---NS...A-------------------------PVQ-I-L-A-KL----N..PLA..
A0KK00_AERHH/368-522.....SPLT..L....SWA.LN---NQ...A-------------------------KLD-F-D-G-DF----V..LAP..
Q0JZH1_CUPNH/670-829.....VPLK..L....HAE.SG---RR...G-------------------------VIG-V-D-G-TV----L..PTV..
Q2LUD1_SYNAS/785-932.....ADLE..I....RGK.VD---NS...A-------------------------PVE-I-L-G-KI----N..PLS..
A1ARF1_PELPD/790-937.....ADVD..L....RGN.LE---NR...S-------------------------PLQ-I-T-G-TI----N..PLR..
Q39RS7_GEOMG/568-719.....IPYR..F....SAG.YG---KG...G-------------------------ALA-A-S-G-RV----T..PVP..
B9M3X2_GEODF/795-942.....ADVD..L....RGD.LD---KH...S-------------------------PLQ-I-T-G-KI----N..PLS..
Q8Y0Z7_RALSO/185-339.....VDIF..V....QPL.LA---ARIDGA-------------------------PLH-F-A-G-KT----KPFAQS..
Q3JBN6_NITOC/584-731.....SSIS..L....EGT.VE---SY...G-------------------------EMS-M-T-G-KS----N..LFA..
Q5DZ89_VIBF1/399-549.....IDFD..F....FAS.VN---SK...G-------------------------DIS-V-K-G-QA----D..AKQ..
Q1QTZ9_CHRSD/145-295.....RPFA..L....QGQ.AD---WR..GG-------------------------TLK-G-T-G-EM----G..FSP..
A9BMN7_DELAS/165-317.....REIK..V....LPH.LS---FALNGS-------------------------RFE-S-S-A-QS----TPFTEQ..
A9BMN7_DELAS/379-538LQ.LAASMQ..VQPESAGE.GA---KP...A-------------------------ELQ-L-S-G-AL----........
Q87WR1_PSESM/386-537.....FTLK..L....DTG.LG---KQ...G-------------------------NLT-A-T-G-DV----N..LNP..
B2JQ93_BURP8/616-770.....LPVD..L....QAT.VN---GK...G-------------------------TLG-V-K-G-DV----T..ATP..
A1K6C3_AZOSB/734-881.....AVVD..A....RGR.IQ---PH...G-------------------------EAR-A-E-G-RI----R..PFA..
Q603H4_METCA/718-865.....ALLQ..F....HGQ.VD---RY...G-------------------------AVD-V-Y-G-QL----S..PLA..
Q47VC1_COLP3/500-655.....TPYT..L....VGR.SN---KY...A-------------------------NFN-L-T-G-YL----Q..PFS.K
Q15PY6_PSEA6/662-809.....AEVD..I....AGK.ID---GY...A-------------------------PVA-L-N-G-AI----N..PLL..
Q88DW4_PSEPK/365-516.....FTLK..L....DTG.VG---KQ...G-------------------------KLQ-A-A-G-QV----N..LAP..
A0KK00_AERHH/578-725.....SELA..F....NGK.VD---RY...A-------------------------PVT-I-R-G-GT----N..LLI..
B5ECC6_GEOBB/569-721.....MPMT..F....AST.YG---KG...A-------------------------GLK-A-R-G-TL----T..PAP..
Q2LUD1_SYNAS/159-313.....VDKY..I....EPE.FS---AVVNGA-------------------------PFH-L-T-G-KS----KPFDAD..
A4VPN2_PSEU5/551-698.....ASVN..I....AGK.VD---QY...A-------------------------PVS-I-K-G-SL----T..PFD..
Q0VP61_ALCBS/382-530.....FTWQ..G....KAT.LQ---EQ...G-------------------------SLT-H-S-G-EG----Q..LAP..
A1K7K6_AZOSB/583-736.....ARLS..V....GAR.IN---RA...G-------------------------RLG-I-E-G-SL----A..LEP..
Q3JBN6_NITOC/369-521.....STFN..L....QFH.LN---KQ...G-------------------------QLL-A-R-G-HV----T..ALP..
Q5NYY7_AROAE/832-979.....ARLD..L....QGK.VD---DT...A-------------------------PVT-I-S-G-EF----N..PFR..
Q13S79_BURXL/640-791.....LPVD..L....QAT.LN---RK...G-------------------------TLG-V-K-G-DV----T..ATP..
Q47FN3_DECAR/504-656.....GKIA..L....QGK.IN---KK...G-------------------------SLN-V-D-G-SL----Q..VYP..
Q316X0_DESAG/862-1008.....PDLR..V....DGR.LN---G....V-------------------------PLT-L-Q-G-AL----N..PLV..
Q602F3_METCA/416-565.....GKFALRL....ESV.VD---RK...G-------------------------RIS-V-Q-G-SG----S..FDP..
Q2Y5K5_NITMU/673-818.....GEVD..I....RGA.VD---KT...A-------------------------PLK-I-S-G-SV----D..AFG..
B3E4B8_GEOLS/816-963.....AEVD..L....RGN.LE---NH...S-------------------------PLQ-I-T-G-TV----N..PLR..
A4VPN2_PSEU5/341-492.....FSLK..L....DTG.VG---RQ...G-------------------------ALQ-A-Q-G-PL----Q..LNP..
Q5NYY7_AROAE/153-307.....VELF..VEPELSAL.VN---GR....-------------------------PLQ-V-T-G-QS----.RPFAP.D
Q30NX8_SULDN/563-715.....FDYA..L....GLR.VN---SN...G-------------------------SIS-S-N-G-SI----K..HTP..
C1DFK3_AZOVD/367-518.....FRLE..L....DSG.IG---RQ...G-------------------------RLK-A-A-G-QV----Q..LSP..
Q484B1_COLP3/604-751.....AKID..L....KGK.VD---KY...A-------------------------PVI-I-K-G-SV----N..PLS..
Q5NYY7_AROAE/604-757.....TKFE..L....GAR.VN---KR...G-------------------------RAA-V-S-G-TI----A..LDP..
Q602F3_METCA/623-770.....AEVS..I....KGS.IS---DT...S-------------------------PVT-I-S-G-RI----N..PFL..
Q316X0_DESAG/389-538.....GKGS..V....GIS.MQ---GA...G-------------------------TAA-L-K-G-TL----G..LNP..
A5G9K9_GEOUR/137-293.....ADRY..I....TPR.FS---AVVNGA-------------------------PLH-V-E-G-KL----RPFPKA..
B2JHK1_BURP8/152-309.....TGIS..M....KGA.IK---GPSHTG-------------------------RVT-F-D-G-WM----T..IAS..
A5G9K9_GEOUR/551-702.....IPFR..M....SAA.YA---QG...G-------------------------SLR-A-S-G-SV----T..PIP..
A0KK00_AERHH/151-307.....NPFV..L....AAT.LN---QQ...S-------------------------PLK-A-S-G-EL----D..IMS..
Q1H1L3_METFK/780-927.....AQVE..L....DGK.VD---DY...G-------------------------SAR-I-R-G-SV----Q..PFQ..
B9M7L7_GEODF/383-534.....IPFM..V....TGA.YG---KG...G-------------------------SLK-A-S-G-NF----T..PAP..
A4SXW3_POLSQ/414-561.....ATVA..M....DGV.VA---NS...G-------------------------SMR-A-K-G-QA----S..FDD..
B9M3X2_GEODF/564-715.....IPVR..F....NAS.YG---GG...A-------------------------KLS-A-K-G-NI----T..REP..
A4G9D7_HERAR/154-308.....VDVY..V....EPL.LS---ASINGS-------------------------PLL-I-K-G-KT----HPFADT..
Q21F55_SACD2/584-731.....SQLS..L....EGQ.VD---EY...G-------------------------LMR-A-N-G-YL----S..AMD..
Q7NY28_CHRVO/704-851.....GRIT..L....DGA.VD---QY...G-------------------------EVK-V-R-G-AL----S..PMS..
Q0JZH1_CUPNH/164-317.....VEIV..T....RPT.LS---ARVNGT-------------------------PLA-L-D-G-EV----LPFADS..
A1TWZ4_MARAV/597-744.....GRVA..I....SGQ.LA---GV...A-------------------------PVR-F-D-G-TL----G..ALG..
B3E4B8_GEOLS/367-514.....SAYE..I....SFN.GD---SA...E-------------------------TFA-A-S-G-TA----S..LSP..
Q2IFA1_ANADE/563-710.....SSVD..V....RLQ.VE---GA...S-------------------------PVR-V-T-G-TL----N..PLQ..
Q1QTZ9_CHRSD/348-494.....AQLT..L....EGQ.VA---EG...S-------------------------PLR-I-D-G-TF----D..PLG..
Q11NN1_CYTH3/142-298A..LPSDLT..V....SGS.SI---GG...G-------------------------NLS-I-L-G-QV----N..LLK..
Q9HV64_PSEAE/140-291.....AKMT..L....VAT.GP---NG...G-------------------------RLD-W-E-G-DL----T..LVP..
Q3SGZ4_THIDA/733-880.....AQVE..L....DGK.VD---DY...G-------------------------SAR-V-R-G-VI----Q..PFR..
Q3A6W6_PELCD/162-316.....ERAITPY....LEA.VI---NG...R-------------------------PLR-V-D-G-RL----APFAEQ..
Q316X0_DESAG/600-751.....VEFS..F....SGN.WL---PH...G-------------------------RLA-A-E-G-SL----T..RDP..
A1TWZ4_MARAV/166-321....DSQYS..V....MAA.LG---EQ....-------------------------VIE-W-E-G-DL----S..VTP..
B9M7L7_GEODF/592-739.....ADVD..L....RGN.LE---NQ...S-------------------------PLR-I-T-G-QI----N..PLR..
Q222N5_ALBFT/496-646.....VKFN..T....DLK.LR---EG...G-------------------------QFT-A-Q-G-SV----V..PAN..
Q3A6W6_PELCD/805-951.....AKIS..F....AGE.LD---D....A-------------------------PIQ-G-E-G-SI----N..PLR..
A5G9K9_GEOUR/769-916.....ADVD..L....RGN.LE---NQ...S-------------------------PLR-I-T-G-QI----N..PLR..
A2SI01_METPP/623-775.....LSFE..L....ATA.LQ---HG...G-------------------------RLR-A-S-G-TA----R..PQP..
Q083W9_SHEFN/492-642.....IDYQ..F....SAG.IN---QQ...S-------------------------LLT-S-T-G-QV----D..ALA..
Q083W9_SHEFN/725-872.....ASVD..L....AGK.ID---KY...A-------------------------PVT-L-K-G-DV----N..PLL..
Q12MK5_SHEDO/654-801.....ATVL..L....DGK.ID---KY...A-------------------------PVV-L-K-G-KV----N..PFA..
Q3SGZ4_THIDA/517-669.....VPLE..A....GFA.LR---QG...G-------------------------RVA-A-S-G-TV----I..PAA..
A1ARF1_PELPD/573-725.....AQLR..C....STT.YG---TN...S-------------------------PIR-V-R-G-SI----T..PLP..
Q39RS7_GEOMG/801-948.....ADVD..L....RGN.LQ---NL...S-------------------------PLQ-I-T-G-KL----N..PLR..
Q603H4_METCA/502-653.....MSFD..A....AFV.VG---QG...G-------------------------EFK-A-S-G-SL----S..QSL..
Q222N5_ALBFT/149-300.....DAHT..F....TAQ.SA---RG...G-------------------------KMR-W-K-G-TA----S..VNP..
A8ZWF7_DESOH/412-569.....SRFD..V....SAL.IN---GA...A-------------------------PLN-V-S-G-QM----V..LTP..
A4XYD1_PSEMY/354-505.....FELR..L....DSG.LG---RQ...G-------------------------KLQ-A-S-G-TV----Q..LSP..
Q484B1_COLP3/152-304.....MHLV.......KAK.TS---QG...T-------------------------ELN-W-H-G-KF----S..LSP..
Q21F55_SACD2/154-306.....GKQE..F....SFA.TE---QG...A-------------------------KLS-W-S-G-NI----S..LAP..
Q3SGZ4_THIDA/147-307.....GAYLLAA.....RL.PA---QG...G-------------------------TVK-W-K-G-DL----A..LNP..
A7I315_CAMHC/662-807.....TKLD..F....NGL.VG---KN...G-------------------------TGK-I-K-I-IT----L..PFN..
Q74FC9_GEOSL/787-934.....ADVD..L....RGN.LE---NH...S-------------------------PIS-I-T-G-RI----N..PLR..
A7H8M2_ANADF/367-518.....WPLA..L....SLV.WN---GR...G-------------------------RLS-V-K-G-PV----Q..PFA..
F2GAL8_ALTMD/716-863.....ASVD..I....TGK.ID---NY...A-------------------------PVK-L-A-G-TI----H..PLK..
Q5DZ89_VIBF1/610-757.....ATVD..I....SGN.IE---KY...A-------------------------PVK-V-K-G-EI----N..PLL..
A4XYD1_PSEMY/562-709.....ASVD..I....QGK.VD---RY...A-------------------------PMS-I-K-G-KL----T..PFD..
B3E4B8_GEOLS/583-736.....MPLQ..F....SSV.FN---KN...A-------------------------PIK-V-S-G-TV----T..PLP..
C1DFK3_AZOVD/141-292.....AELT..L....QAS.GP---NA...G-------------------------RID-W-S-G-QF----S..LVP..
Q1LGA7_RALME/681-840.....VPMK..L....HAE.SG---RK...G-------------------------VMN-I-D-G-QV----T..PTG..
B5ECC6_GEOBB/807-954.....ADVD..L....RGN.LE---NH...S-------------------------PMQ-I-T-G-RL----N..PLR..
Q2IFA1_ANADE/358-509.....CPLT..A....SLA.WN---GR...G-------------------------RLA-V-K-G-EV----R..PFG..
A4XYD1_PSEMY/140-291.....ARMT..L....TAR.GP---YG...G-------------------------HVD-W-Q-G-QV----S..LSP..
A7H8M2_ANADF/165-318.....SPYA..F....AGT.TE---SG...E-------------------------TFR-W-T-G-TV----R..TEP..
A3QD21_SHELP/453-602.....IDYQ..L....ALA.IN---QS...A-------------------------QVQ-S-Q-G-QI----D..ALA..
Q3A6W6_PELCD/588-738.....LDIA..L....SGR.EK---QG...G-------------------------TLR-I-D-G-KG----T..LAP..
A7H8M2_ANADF/579-726.....STVD..V....KLQ.VE---GA...S-------------------------PVR-V-A-G-TL----N..PLQ..
A8ETY5_ARCB4/612-759.....TNLE..I....NGV.VD---NY...G-------------------------VAK-I-T-G-VV----N..PKN..
Q30NX8_SULDN/772-919.....SYVE..I....DGG.VD---EY...G-------------------------SAK-L-K-G-SV----E..ASN..
A4VPN2_PSEU5/125-276.....ADAR..L....TAT.GA---SG...G-------------------------RID-W-Q-G-DL----N..LQP..
Q1LGA7_RALME/173-326.....VTLN..T....APS.LF---AKINGS-------------------------PLA-L-A-G-TM----QPFADS..
Q1H1L3_METFK/561-712.....LPVS..L....AFR.AK---QG...G-------------------------SFN-A-S-G-KL----A..PAP..
Q222N5_ALBFT/710-857.....SQIE..L....DGR.VD---EF...G-------------------------LAR-I-R-G-EL----N..PFA..
C1DFK3_AZOVD/584-731.....ASVD..I....KGK.VD---RY...A-------------------------PVS-I-K-G-EL----N..PFD..
B2U875_RALPJ/869-1016.....ADVT..L....RGS.VD---ST...A-------------------------PVD-I-H-G-KV----N..PLA..
B4EKU9_BURCJ/620-772.....LPVQ..L....KAT.LN---RK...G-------------------------SLN-V-T-G-DV----T..AQP..
D0J281_COMT2/165-316.....IKVLPHL....AFD.LN---G....S-------------------------KFD-T-S-G-ES----T..PFT..
M1FB64_9ALTE/585-727.....GRVS..L....KGK.VN---QV...G-------------------------NLD-M-S-G-SI----A..TLG..
Q63NS2_BURPS/160-304.....TDIF..V....EPK.LR---ARLDGS-------------------------PIA-I-D-G-KT----K..PFA..
Q7VVF7_BORPE/156-309.....TDID..V....QPR.VH---MRINGS-------------------------PFD-L-T-G-VA----R..PFDTV
Q7VVF7_BORPE/538-685.....SPFT..L....KADGVQ---GE...G-------------------------ALA-M-Q-G-SL----T..AQP..
Q87WR1_PSESM/155-306.....ADMT..L....VAA.GP---DG...G-------------------------QID-W-V-G-RI----S..LVP..
Q88DW4_PSEPK/140-291.....ADMT..L....VAS.GP---NG...G-------------------------RID-W-K-G-TL----S..LSP..
Q88DW4_PSEPK/581-725.....AKVD..V....KGK.VD---RY...A-------------------------PVT-I-K-G-AL----N..PFN..
Q8EDF6_SHEON/666-811.....ASVD..I....KGK.ID---RY...A-------------------------PVT-L-K-G-DI----N..PLL..
Q9HV64_PSEAE/476-627.....FDLK..L....KTG.LG---NR...G-------------------------QVQ-A-S-G-QV----V..LDP..
Q9HV64_PSEAE/692-837.....AKVD..I....KGK.VD---KY...A-------------------------PVT-I-A-G-EL----D..PFD..

PF13116

C6XK02_HIRBI/457-744PPITEASGVGRLRGNSMKINLESGKFG-----------------------------DWL.I-D-EGSVDLPAFHPAGAI.
Q7NW94_CHRVO/514-796PTIDDIDARLRFHNEGMQVLAQRASTV-----------------------------GVP.L-R-QVTAVIDQLGADVPW.
Q7N037_PHOLL/501-786PALLDFNIDLNFQNNGLWMFAPQTALG-----------------------------EVK.A-S-NLSAVIPNY.RSKK..
A7ZDM6_CAMC1/160-458PAVNVAEANITLKNSKLKFDLTAPVYK-----------------------------GKK.L-D-GSNVAINNIFDEKSAN
A4XQL3_PSEMY/513-798PSLREGNGEVLIEDDAVRVRLQSGRLL-----------------------------DSR.V-S-EVTANIPLLHDGKPP.
Q3J7T7_NITOC/517-810PVLERVAAHLHSDGQYMTIHANEGQMF-----------------------------SAR.V-A-EATVQITDLGAAIVP.
D5CU11_SIDLE/524-805PRIEDAQTDLLIEGNKLEIKAATATTA-----------------------------GAH.L-Q-NIKVSIPDLLANNLL.
A1AVR0_RUTMC/242-525QSLKQLDANIAIDGRKITVMVNHTMLN-----------------------------DMF.L-Q-GMKVQILDM.SKDKL.
Q31FH6_THICR/496-774PALDDFSAKLKFTPYNLQITSKKVMLG-----------------------------NVT.G-H-DVVVDIKALDTKNIA.
Q2NWP0_SODGM/504-789PPLTQLDIDLDFVNDGLFMHAPQTALG-----------------------------EAK.G-S-NIAASIPDY.SKEK..
B8GV04_THISH/540-825PAIDALAGELIFTDRGMRAQSASGRLF-----------------------------GAQ.I-Q-DATVVIEDYHNT....
A0RPG5_CAMFF/10-294TPVKSNLAYAELKNDSLFFHLEKPTYM-----------------------------EKP.L-D-GSSVVIRNIIGKNSNM
Q07WQ4_SHEFN/504-791PAVSSLTLSALFENDMMDLHIDQGKLD-----------------------------NVV.V-D-GARVSIPHL.GKESL.
Q5ZUN8_LEGPH/507-795RLIKDLEGYIKLKNRNLDIDIIDGDAQ-----------------------------GTL.L-K-QMNLRIDDI.GKDRE.
Q7VFV2_HELHP/222-511KPIEATRAILYMRDEKLTFLLKEPFFT-----------------------------NMN.L-D-GSEVTISNIFTQPFGV
Q12IX1_SHEDO/530-817PVITELRLDALFENAAMDLWVTQGQLQ-----------------------------DVA.I-D-GAHVYIPEL.GENSL.
Q15ZG8_PSEA6/490-776PQLNDLNIDLLFENKGLFMQANAGKLL-----------------------------DVN.L-S-GLSADIPDL.DVGAV.
A6Q385_NITSB/202-483APVVVKQIILDYKSNNLYFTLRKPIFQ-----------------------------KRS.L-Q-GSKVTIYHLGQSKSYI
A8GK60_SERP5/523-808PALTDLAIDLDFANEGLWMNAPQTKLG-----------------------------KVD.G-K-NVTAIIPDY.LKER..
Q3IFH7_PSEHT/493-781PAVTNASAQLHFANERMDIYSQQGKLV-----------------------------NLAVG-S-SVRVSISDL.MHADE.
D9SHW3_GALCS/523-805PKIENLSGEFQIHNNKLQVRAPTANML-----------------------------GAH.L-H-NLLITQPDMSSAEPI.
C7R9G7_KANKD/505-791PQAEQLNATAIFDNDEMRIVAETGQLL-----------------------------GST.V-N-SASATIDSF.SNDIS.
Q21FT5_SACD2/542-827PALEKINAHLFVDNADLTVQVTQAEMQ-----------------------------GNH.I-S-GAVIDLVKAKDGKGH.
A7MJB2_CROS8/518-803PALKDFAINLDFRNDGLWMAAPQVMLG-----------------------------GVT.G-K-NLTAVIPDY.SQEK..
C6XD69_METGS/519-799PKILGIKLDMLFEGNRMELNATDGTIL-----------------------------GTR.I-T-KANIAIPGLHVAEPV.
A7I2E8_CAMHC/213-497PAVMIGEANVSLRNQSLKFNMENATYL-----------------------------DKN.L-T-NSEVEIYKIFDDDSGI
Q6LMA6_PHOPR/509-794PILTDLQLDLLFENDFMYLDSRHAITM-----------------------------GAT.A-S-RVTG.VSEL.SADGD.
D0L1I5_HALNC/561-853PALKDADGNIAFVNQQFHASIDHGTLA-----------------------------DVP.V-D-GSRVSIFDLDKAA...
A3Q9Y2_SHELP/509-796PEVTELSLNALFENAAMDIWVNKGMLM-----------------------------QVP.A-D-GAHVAIPRM.SHQTL.
A6QAC9_SULNB/206-494PPVKSEKVVLNYKQNSLFFDLTNPTYE-----------------------------NRE.I-N-AT.VSITDIGKEKDTR
A8EUE5_ARCB4/193-478DEIFTKSIDVTYKDDNLHFNLIEPKFK-----------------------------DKN.I-E-GSFVTIHNLTDEINGN
C5ZX33_9HELI/208-498SPILSPNVKLIFQNNTLEFHPNQPTYE-----------------------------HIN.L-Q-GSQVAITNIFQIPT.L
Q1H0H5_METFK/520-800PKIENIALDMLFESNRMELNASKGSTL-----------------------------GTD.I-T-KSKVVITNLASHQPV.
Q7MRT1_WOLSU/187-475PPLHGRGVSVIYDERGVSFELYEPSFE-----------------------------GFS.L-E-GSQVGLRDIWGEKPWL
Q47VG9_COLP3/504-793PAITDFVANLNFTNNSMLITGRGGELT-----------------------------GLD.V-K-GVRAGIADL.ANGQI.
A4G3G0_HERAR/587-887PLLENVKGTILFDRTRMEIKGESGSTH-----------------------------GAQ.V-S-NVKAVVADLLANEPV.
D1B1Z5_SULD5/203-493PPAYAKEIGITLTEDKLLFDISAPEYE-----------------------------QKS.I-E-KADVFIYNLLTKGTGI
D3V5J7_XENBS/502-797PALFDFDIDLNFQNNGLWMQVPKAKLG-----------------------------KVD.A-T-QLTAVIPDY.GKNK..
E6WGF8_PANSA/504-789PAINNLDIDLDFVNDGLWMKAEQAKLG-----------------------------EVD.A-R-NISAIIPDY.LKEK..
F2G3T4_ALTMD/500-787PALNDLDLSLYFVNNALVMESPSATLA-----------------------------DMK.I-S-NMSAAIPSF.KPGAR.
D3VKA4_XENNA/501-791PALFDLDIDLNFQNNGLRMQALKARLG-----------------------------GVD.I-N-QVSAVIPDY.SQKN..
Q0ABM3_ALKEH/531-818PRLTGAEAELDFRGRSMHIRGHGGRLA-----------------------------GTS.V-Q-RVEVTLADL...FEP.
A0KFB2_AERHH/486-771QPLTDLQIDLLFQNASLDMNSRATQLG-----------------------------KAS.S-D-SVHAWIPDL.YPGAH.
A6TER2_KLEP7/497-781PALTGLNIDLNFINNGLWMRADKAMLG-----------------------------NVT.A-S-NLDAAIPDY.AQEK..
B4EX35_PROMH/501-782PALFDLNVNLNFKNNGLWMSSDNVQVG-----------------------------KAT.A-K-NLTAIIEDY.NKEK..
B7VIB8_VIBSL/505-791PLITDLQLDLLFENDAMYLDSRSAQLM-----------------------------DVA.A-D-RITGRIPYL.GEGGH.
D3HJX5_LEGLN/559-845QVIKDIDGYIHLNKRNLNIDITHANFQ-----------------------------GVP.A-K-QMHLRIDDIGNNKEN.
F0LWR2_VIBFN/505-791PAITDMQLDLLFENDAMYLDSHAATLM-----------------------------DVK.A-T-RITGRIPEL.APDGH.
G9AWD3_PANAN/505-788PDISNLDIDLNFLNDGLWMQAHLAKLG-----------------------------EVN.A-R-NVSAVIPDY.MKEK..
I0DWA9_PROSM/493-771PALSNLDINLDFKRSGLAMRADSVKLG-----------------------------EAT.A-T-QLTADIPNY.QNEM..
Q5E7X4_VIBF1/495-780PPLTNLQLDLMFQNASMFLSSHSADLM-----------------------------DVH.A-T-RVTGRIANL.SEDGK.
Q6DAI1_PECAS/504-784PALTPLDINLDFANNGLWMFAPQIWLG-----------------------------KVE.G-K-NISAVIPDY.EKE.M.
Q74PM2_YERPE/511-794PALDNLAIDLNFLNEGLWMNAPHTLLG-----------------------------KVI.G-S-NISAIIPDYLKEK...
Q7MHE2_VIBVY/508-794PPITDLQLDLLFQNDAMYLDSKSATLK-----------------------------DVK.A-S-RITGRIPEL.AEGGH.
Q83BN5_COXBU/480-760PALQNIKAKVMFHNNQLRIVASHANIS-----------------------------GNP.L-D-HLKAVIPDL..KDPV.
Q8ZLP4_SALTY/504-786PALKNLNIELDFLNDGLWMRSDSVDLG-----------------------------GVK.A-S-KLAAAIPDY.SKEK..
Q9KUU5_VIBCH/504-791PPITDLQLDLLFENDAMYLDSRSATLM-----------------------------EVS.A-E-RITGRIPEL.AELGH.

PF13109

A0RPG5_CAMFF/433-647--KFYQQFLSFLDSIP---------------------------------------------------------------S
A6Q385_NITSB/623-836--QAFNNLFAFINSVP---------------------------------------------------------------A
A6QAC9_SULNB/640-854--KAYSKTRDFIRKDK---------------------------------------------------------------N
B9L5J2_NAUPA/583-798--KSLNNVIAFINTIP---------------------------------------------------------------S
C5ZX33_9HELI/638-852--SILQNLMAFIDTIP---------------------------------------------------------------S
D3UGW6_HELM1/730-943--VVLQNLISLIDTIP---------------------------------------------------------------S
Q30RQ8_SULDN/697-907--KILNNILAFVNTVP---------------------------------------------------------------S
Q7MRT1_WOLSU/616-829--NTLQNVIALIDSIP---------------------------------------------------------------S
Q7VFV2_HELHP/731-944--AIVQNVLALIDTIP---------------------------------------------------------------A
O25308_HELPY/745-958--ALMQNMINLINTIP---------------------------------------------------------------S
Q0PAY6_CAMJE/635-848--KGINQLISFIDTVP---------------------------------------------------------------S

PF13502

A0KFB2_AERHH/999-1241V.PTLSGTADYQLEGG------------------------------------------------------------...T
A1S2S6_SHEAM/1130-1371L.GSLSGGLKFALGKG------------------------------------------------------------...S
A1STZ9_PSYIN/1024-1262L.DSLKGTFSAKLTDG------------------------------------------------------------...A
A1TW53_ACIAC/1117-1369Y.RSMAGQINVNVESG------------------------------------------------------------...Q
A1U479_MARAV/979-1225L.SKISGTVSARLDDG------------------------------------------------------------...M
A1WCZ7_ACISJ/1139-1390Y.RTMSGQMNVNVEAG------------------------------------------------------------...Q
A1WSB5_VEREI/1101-1362Y.RSMTGQTHLNIESG------------------------------------------------------------...Q
A1WYY8_HALHL/891-1129L.ADLVGAVRVRMNDG------------------------------------------------------------...R
A2U2U5_9FLAO/567-793L.KTITGNLFGKLINP------------------------------------------------------------...K
A3HUH0_9BACT/675-900L.ASLDGNGLLKVAET------------------------------------------------------------...A
A3Q9Y2_SHELP/1046-1289L.ETLNGQISYKLGKG------------------------------------------------------------...H
E0TB83_PARBH/837-1047R....TGDLILRRAPT------------------------------------------------------------...V
A4AMF6_MARSH/560-785L.KTITGKVLAELLSP------------------------------------------------------------...E
A4CG41_ROBBH/574-799L.MSLAGNVVAEVLAS------------------------------------------------------------...D
A4VIB7_PSEU5/1014-1255M.ARYSGSMQPRLRKG------------------------------------------------------------...Q
A5CF63_ORITB/620-836M.NNFNVTAKFVAKDV------------------------------------------------------------...E
A5FJ68_FLAJ1/564-791L.KSISGDLLGQLLST------------------------------------------------------------...T
A5FUN1_ACICJ/745-973Q.RSLAGSLTASSHGI------------------------------------------------------------...T
A6GWN8_FLAPJ/560-787L.NTISGDLLGQLLST------------------------------------------------------------...T
A7HEC2_ANADF/581-801T.KSVTGGVDGTLRNG------------------------------------------------------------...A
A9CIC7_AGRT5/884-1105L.KSAGGSGEVRASGL------------------------------------------------------------...V
A9H3V6_GLUDA/474-684L.HKAPGAVRLA.NDA------------------------------------------------------------...S
B2FP42_STRMK/1008-1250L.ANLQGSLDLHARNG------------------------------------------------------------...Q
F2G3T4_ALTMD/1046-1287F.EALNGDVEWSLSDG------------------------------------------------------------...Y
B4S7D6_PROA2/551-781L.ETLNGSGRITTRGL------------------------------------------------------------...H
B7VIB8_VIBSL/1027-1268M.DTLDGNVKTQFGKG------------------------------------------------------------...I
B8CI63_SHEPW/997-1240L.ETLNGQIGFELGKG------------------------------------------------------------...H
C1D9M5_LARHH/1015-1258W.PSLSGEITLSAESG------------------------------------------------------------...Q
C3L4A9_AMOA5/534-754V.NSLKADIAVQLHNG------------------------------------------------------------...L
C4L8L8_TOLAT/989-1232L.SALDGQIRMETGEG------------------------------------------------------------...I
E8RSC3_ASTEC/1136-1358Y.RNGQIDATLKGEDI------------------------------------------------------------...R
D9SHW3_GALCS/1021-1263Y.ASLDGTLKLDTGQG------------------------------------------------------------...Q
D5CU11_SIDLE/1024-1263Y.SKLNGEIHLNVGKG------------------------------------------------------------...R
C6WWM2_METML/1053-1294T.TRLSGELKFEVRKG------------------------------------------------------------...Q
C6XD69_METGS/1043-1284S.AGLSGNLQLDARHG------------------------------------------------------------...Q
C6XK02_HIRBI/884-1092M.KDIRLKGAPILAQV------------------------------------------------------------...F
C7PC84_CHIPD/564-796L.SSLTGDGNLLVLEG------------------------------------------------------------...A
E6WGF8_PANSA/1014-1257E.PTLSGTLKSHFGKG------------------------------------------------------------...Q
D2UF54_XANAP/1023-1265L.PILQGQLDVAVRNG------------------------------------------------------------...Q
D3SBX9_THISK/1040-1287L.ALLGGTMELELEDG------------------------------------------------------------...R
Q0ABM3_ALKEH/1048-1290L.AEMEGAVSLRIDDG------------------------------------------------------------...Q
Q0AQ38_MARMM/879-1092.......TARVEIRDL------------------------------------------------------------...T
Q11YL6_CYTH3/532-755LPSSIICDADVTVQNG------------------------------------------------------------...E
Q11YT8_CYTH3/698-925Y.STLNGKGSLGSSSL------------------------------------------------------------...K
Q145G0_BURXL/1154-1409Y.PTLNGNLAVDLRHG------------------------------------------------------------...Q
Q15ZG8_PSEA6/1002-1243F.ATLNGDIDWRLSDG------------------------------------------------------------...Y
Q211X0_RHOPB/871-1087A.SALTGSGLLTIDTA------------------------------------------------------------...R
Q28TM9_JANSC/371-572M.DGLEAEGDIALGQG------------------------------------------------------------...A
Q2KY05_BORA1/936-1183L.VDISGHASLSLEKG------------------------------------------------------------...R
Q2NWP0_SODGM/1012-1255I.ASLNGVLHSQLGKG------------------------------------------------------------...K
Q3IFH7_PSEHT/1008-1245V.ASLSGNIDWRLGEG------------------------------------------------------------...H
Q47VG9_COLP3/1038-1280L.SHLNGTVNGRLDDG------------------------------------------------------------...Y
Q5R0H7_IDILO/1003-1244W.SSLSGEVVWDLEKG------------------------------------------------------------...Y
Q7MHE2_VIBVY/1031-1272V.NTLDGDVQTEFGKG------------------------------------------------------------...I
Q7UYB4_RHOBA/752-985..DDLFGRFDFKLGDT------------------------------------------------------------RGAA
Q8EA16_SHEON/1025-1268L.ETLNGKVKFELGKG------------------------------------------------------------...H
Q9ZDH9_RICPR/624-849L.YNLSTKSQFVINNI------------------------------------------------------------...D
A8GK60_SERP5/1034-1277M.STLSGAMKVNMGKG------------------------------------------------------------...E
C4YU88_9RICK/640-864L.YNLTTKSQFAINNI------------------------------------------------------------...D
C5BC15_EDWI9/1004-1246I.ETLDGTLRVRLGKG------------------------------------------------------------...V
D3HJX5_LEGLN/1065-1312L.AALNGEMYLQLKNG------------------------------------------------------------...R
D5CDA5_ENTCC/1010-1252E.ASLNGILKTRFGKG------------------------------------------------------------...E
E0SHA8_DICD3/1031-1273I.PSLSGILKTDIGKG------------------------------------------------------------...E
F4AYZ2_KROS4/566-791L.STISGDAFAEILTA------------------------------------------------------------...D
G2J3B5_PSEUL/1018-1258L.PRVSGEMTVDFRNG------------------------------------------------------------...R
I0DWA9_PROSM/1000-1242I.ATLNGALSSKLGKG------------------------------------------------------------...A
M1FEQ6_9ALTE/970-1216L.KQLSGDISMTLEDG------------------------------------------------------------...V
N0B6U7_9RHIZ/961-1176.......TGILWVEDF------------------------------------------------------------...K
Q0KCK4_CUPNH/1119-1370Y.PTLSGKLSLDLENG------------------------------------------------------------...Q
Q0VS66_ALCBS/1022-1263Y.LALNGQARVDIGEC------------------------------------------------------------...R
Q2K6G4_RHIEC/885-1104A.SSLNGSGELRLGDT------------------------------------------------------------...S
Q32B94_SHIDS/1009-1252E.ATLNGIIHTQLGKG------------------------------------------------------------...E
Q5ZUN8_LEGPH/1014-1261L.SKLNGSMYLQLKNG------------------------------------------------------------...R
Q63R38_BURPS/1120-1377Y.PTLNGRLSLDLAHG------------------------------------------------------------...Q
Q6LMA6_PHOPR/1035-1276R.ETLTGEIKTETGKG------------------------------------------------------------...I
Q8P7K3_XANCP/1032-1273L.GSLEGNLTVDARNG------------------------------------------------------------...Q
Q9KUU5_VIBCH/1028-1269V.NTLQGKVDTKLGKG------------------------------------------------------------...V
Q9PEA2_XYLFA/983-1225L.ASLSGDLKVTARNG------------------------------------------------------------...Q

PF05170

Q87TE2_VIBPA/1-570--NIQLQELSLDWQQGRVQVSGQFKPTHWQL.............................................DTAS
Q9KNJ9_VIBCH/1-570--GIELDGHSQVWQ.GDVQVKGHITETSLNL.............................................AQLT
Q9HU38_PSEAE/1-636--ANTLGKFELNTRLAGSRNSLNLEDLKLGL.............................................DDTA
Q9KT66_VIBCH/1-595--KLSLDS.QIAFDLTQNHLSVLLNKLTA...............................................NALS
Q9JY87_NEIMB/8-615--NIGNAEISGSFKTPRHQTNFSLNSPLVWT.............................................ENKG
Q9ZDI1_RICPR/1-711--AIKLQNINLSATNSNITGEIVLKNLTENIIILHNLKINNFELFMSLIGVNNLSKIGILQLNGEVQKVKDTFNINNKIS
Q9HUT4_PSEAE/1-577--YSTDGHLLARLKEEGGALF.......................................................RYEN
YHJG_ECOLI/1-582--FETDGRLVAKIDTEKSSVF.......................................................DYRG
Q7MQ04_VIBVY/1-571--AINVEEASAQWQQGNLLFSGTLKPDAIEL.............................................DQLM

PF04357

A2U1I0_9FLAO/1175-1633GRLSLTGTFEIA.S.G---------------------------------------------------------------H
Q83EW1_COXBU/570-928QVMTANGRITII.D.G---------------------------------------------------------------T
Q1D0C2_MYXXD/935-1291LRPGLLGRVELA.E.G---------------------------------------------------------------S
A5FB26_FLAJ1/992-1420GKFNMWGDFQAY.E.G---------------------------------------------------------------T
Q8YZJ8_NOSS1/1412-1829S.PLPEGVIRLT.G.G---------------------------------------------------------------R
A4CK93_ROBBH/998-1431GKFNMWGDFVVV.T.G---------------------------------------------------------------S
A3U6I2_CROAH/1185-1647GRTTLTGRYTVN.D.G---------------------------------------------------------------H
A0LGH5_SYNFM/889-1254GPVRLVGGLQTT.R.G---------------------------------------------------------------T
A3HZ37_9BACT/1160-1620GRITLSGGYEIT.E.G---------------------------------------------------------------H
A5GSG8_SYNR3/973-1387D.VRISGVVKLL.K.G---------------------------------------------------------------R
A6L590_BACV8/1012-1461GDFRMFGSYVID.Q.G---------------------------------------------------------------M
A0M1P1_GRAFK/1180-1639GRMALTGIYNVN.D.G---------------------------------------------------------------F
Q2S2D2_SALRD/1057-1516GDFSVYGSFDAT.S.G---------------------------------------------------------------T
Q21Y28_ALBFT/928-1291LTPSLTGSLRTV.R.G---------------------------------------------------------------T
Q6MKB2_BDEBA/958-1321TNPVLLGKISME.RRS---------------------------------------------------------------K
Q39RU7_GEOMG/1016-1376DRVTSTGAIRVI.K.G---------------------------------------------------------------H
Q7VBL9_PROMA/867-1309T.LDLRGLIRLR.K.G---------------------------------------------------------------R
Q016Y8_OSTTA/1647-2059NAIKPNGSLYFD.R.G---------------------------------------------------------------D
A5FIP0_FLAJ1/1183-1626GKTTLTGKYEFS.D.G---------------------------------------------------------------A
Q8KFW2_CHLTE/1034-1479QRFSLFGSIDIT.G.G---------------------------------------------------------------K
A6H009_FLAPJ/1018-1446GKFKMNGDFQVY.E.G---------------------------------------------------------------V
B5E9K2_GEOBB/1121-1484DNIESSGEIRVV.Q.G---------------------------------------------------------------R
Q11I59_CHESB/1185-1538SVQ.PVGGFRLI.R.G---------------------------------------------------------------R
Q11VR9_CYTH3/1167-1624GQTNLTGTYVVN.D.G---------------------------------------------------------------N
A7HQ23_PARL1/1042-1395DPT.VNGRIVSE.R.G---------------------------------------------------------------T
Q7MT86_PORGI/1036-1486GDLNVFGGLELL.S.G---------------------------------------------------------------T
Q3AQ57_CHLCH/1053-1500QRYRMFGSVQVT.S.G---------------------------------------------------------------T
A1BDC7_CHLPD/1048-1494QRYRLFGSVALS.D.G---------------------------------------------------------------K
Q6MAC5_PARUW/935-1288NPL.LNGDLSVI.N.G---------------------------------------------------------------Q
Q1QWE2_CHRSD/954-1312GPVQLFGDVRLV.D.G---------------------------------------------------------------A
Q2RSJ7_RHORT/1146-1500APK.VVGTITTL.R.G---------------------------------------------------------------Q
Q2S346_SALRD/1311-1689EDPQVFGTIDVVERRS---------------------------------------------------------------T
Q2INP6_ANADE/946-1304ASPGLVGSLTMG.Q.G---------------------------------------------------------------S
Q9RUC9_DEIRA/223-627ARPQVRGQIVSQ.R.G---------------------------------------------------------------S
Q1LSN0_BAUCH/634-981RPLSMNGEIKIP.Y.G---------------------------------------------------------------Y
B3ELK5_CHLPB/1036-1483QNYRLFGAVNIS.S.G---------------------------------------------------------------T
Q8YUC2_NOSS1/1659-2048D.PVPVGTIRLR.K.G---------------------------------------------------------------G
Q1MQI4_LAWIP/1025-1382SPV.ITGALTSI.R.G---------------------------------------------------------------N
Q7VQN5_BLOFL/933-1286NNLNITGQIQIP.S.G---------------------------------------------------------------S
Q31MA1_SYNE7/1177-1568T.LSPNGKLTLT.S.G---------------------------------------------------------------Q
B4E8E1_BURCJ/988-1340VPLRAVGNVRVT.E.G---------------------------------------------------------------S
E3G0N9_STIAD/1177-1560HEAEIFGTVRVL.R.G---------------------------------------------------------------R
F4B3D6_KROS4/1021-1426GKFIMNGDFIAT.E.G---------------------------------------------------------------V
Q46LW1_PROMT/887-1319ETLDVSGVIKLD.S.G---------------------------------------------------------------Y
TAMB_HAEIN/952-1298GNLGLFGQINLT.K.G---------------------------------------------------------------R
Q5NNB3_ZYMMO/1036-1389TAPNITGDMRVI.R.G---------------------------------------------------------------T

PF05359

Q4K5X6_PSEF5/140-291LTSE..GTLKVT...D----------------------------------------------------------------
Q4K5X6_PSEF5/360-511VSAK..LKVQTR...D----------------------------------------------------------------
B2JQ93_BURP8/874-1021PKPALDLTATAH...G----------------------------------------------------------------
A0RMT1_CAMFF/653-798PRSNTDLIVRFK...N----------------------------------------------------------------
Q72DG8_DESVH/963-1109TPPFADIVFSME...G----------------------------------------------------------------
A9BMN7_DELAS/883-1036KPLALDIRAQMR...D----------------------------------------------------------------
A7ZFK9_CAMC1/750-895LKQNTDIKLDFK...D----------------------------------------------------------------
Q2LUD1_SYNAS/534-687MSVR..LQVKAD...G----------------------------------------------------------------
A8ZWF7_DESOH/636-783TDLFMDLDVKLS...N----------------------------------------------------------------
Q3A6W6_PELCD/375-529LQGD..LLLQLD...G----------------------------------------------------------------
Q5NYY7_AROAE/382-536FELE..GRVVAE...N----------------------------------------------------------------
Q2KWF8_BORA1/759-906QYLALDLKASAK...G----------------------------------------------------------------
Q484B1_COLP3/382-534KQLS..LALDTE...Q----------------------------------------------------------------
A2SI01_METPP/870-1017PRLATDITASAR...G----------------------------------------------------------------
Q8Y0Z7_RALSO/615-766LKAE..LRVNAQ...N----------------------------------------------------------------
Q5QWM2_IDILO/380-527PTRQTTINVRFR...N----------------------------------------------------------------
Q0VP61_ALCBS/592-737EPFSTDMQVSLH...N----------------------------------------------------------------
A3QD21_SHELP/699-846EQPYLDLDLSFK...H----------------------------------------------------------------
Q63NS2_BURPS/645-797LKVG..LKLNGN...R----------------------------------------------------------------
Q47FN3_DECAR/732-879AKTYLDLKADIT...G----------------------------------------------------------------
A0KK00_AERHH/368-522FSLN..GEIKQQ...G----------------------------------------------------------------
Q0JZH1_CUPNH/670-829PASR..LQLDLR...E----------------------------------------------------------------
Q2LUD1_SYNAS/785-932GNLFLDLAASAK...G----------------------------------------------------------------
A1ARF1_PELPD/790-937DDLFVDLTISFK...D----------------------------------------------------------------
Q39RS7_GEOMG/568-719LAAK..GEITLR...R----------------------------------------------------------------
B9M3X2_GEODF/795-942RELFADLKVRFT...D----------------------------------------------------------------
Q8Y0Z7_RALSO/185-339LESS..LNIKLD...G----------------------------------------------------------------
Q3JBN6_NITOC/584-731LERATEFSAFAR...N----------------------------------------------------------------
Q5DZ89_VIBF1/399-549QAVM..ADIDVK...S----------------------------------------------------------------
Q1QTZ9_CHRSD/145-295WTLD..IDLDAD...Q----------------------------------------------------------------
A9BMN7_DELAS/165-317RQTA..VDLSLQ...G----------------------------------------------------------------
A9BMN7_DELAS/379-538TDKQ..GQLAISARQ.----------------------------------------------------------------
Q87WR1_PSESM/386-537VSAR..LNVTTR...D----------------------------------------------------------------
B2JQ93_BURP8/616-770LKLA..LKVDAN...R----------------------------------------------------------------
A1K6C3_AZOSB/734-881PDELTDLEVRFD...N----------------------------------------------------------------
Q603H4_METCA/718-865PKHFGDVSVAFR...N----------------------------------------------------------------
Q47VC1_COLP3/500-655LATY.HIEGDFK...E----------------------------------------------------------------
Q15PY6_PSEA6/662-809EDMFLDLNFSVS...G----------------------------------------------------------------
Q88DW4_PSEPK/365-516IWAK..LDVSTR...D----------------------------------------------------------------
A0KK00_AERHH/578-725EQPVLDVAVTFN...N----------------------------------------------------------------
B5ECC6_GEOBB/569-721FRYQ..GMMSVA...R----------------------------------------------------------------
Q2LUD1_SYNAS/159-313REAS..LNLKLN...R----------------------------------------------------------------
A4VPN2_PSEU5/551-698PLQSLDIATSFR...Q----------------------------------------------------------------
Q0VP61_ALCBS/382-530LSIS..AKGALT...A----------------------------------------------------------------
A1K7K6_AZOSB/583-736LKGN..LELDLR...D----------------------------------------------------------------
Q3JBN6_NITOC/369-521PSAD..LEIHLE...S----------------------------------------------------------------
Q5NYY7_AROAE/832-979EDRYLDIAASVK...D----------------------------------------------------------------
Q13S79_BURXL/640-791LKVA..VKVNAN...R----------------------------------------------------------------
Q47FN3_DECAR/504-656LDAQ..LKVETV...A----------------------------------------------------------------
Q316X0_DESAG/862-1008SPPYSDLALRIA...N----------------------------------------------------------------
Q602F3_METCA/416-565PEAE..LRLQVE...N----------------------------------------------------------------
Q2Y5K5_NITMU/673-818RELNLDITASAK...G----------------------------------------------------------------
B3E4B8_GEOLS/816-963DDLFVDLTISFK...D----------------------------------------------------------------
A4VPN2_PSEU5/341-492ISGQ..LAVTTR...D----------------------------------------------------------------
Q5NYY7_AROAE/153-307RETA..LGIDLD...G----------------------------------------------------------------
Q30NX8_SULDN/563-715LEQK..GEFEFK...N----------------------------------------------------------------
C1DFK3_AZOVD/367-518LAAQ..LQVGSS...D----------------------------------------------------------------
Q484B1_COLP3/604-751HDAFTDIDMLFN...G----------------------------------------------------------------
Q5NYY7_AROAE/604-757LKGN..LRVDLR...S----------------------------------------------------------------
Q602F3_METCA/623-770FGTFADLSIRFK...N----------------------------------------------------------------
Q316X0_DESAG/389-538LSGE..IQASLN...N----------------------------------------------------------------
A5G9K9_GEOUR/137-293VEAS..ATVDLK...D----------------------------------------------------------------
B2JHK1_BURP8/152-309KDSK..TTTTLK...G----------------------------------------------------------------
A5G9K9_GEOUR/551-702LKLR..GEVAVQ...R----------------------------------------------------------------
A0KK00_AERHH/151-307GAGK..GKISLG...K----------------------------------------------------------------
Q1H1L3_METFK/780-927ATEFTDLKLVFR...N----------------------------------------------------------------
B9M7L7_GEODF/383-534LKIK..GEMAVQ...R----------------------------------------------------------------
A4SXW3_POLSQ/414-561PRRNHDILMTFR...N----------------------------------------------------------------
B9M3X2_GEODF/564-715LRYN..GAVQVK...N----------------------------------------------------------------
A4G9D7_HERAR/154-308VDAV..VDLNLD...N----------------------------------------------------------------
Q21F55_SACD2/584-731PTKNSDIKLVFR...N----------------------------------------------------------------
Q7NY28_CHRVO/704-851PTDSTDILLDFH...N----------------------------------------------------------------
Q0JZH1_CUPNH/164-317RQTR..LNVNLD...G----------------------------------------------------------------
A1TWZ4_MARAV/597-744TEEPSNLKLTMK...D----------------------------------------------------------------
B3E4B8_GEOLS/367-514ISAT..SRFNLS...G----------------------------------------------------------------
Q2IFA1_ANADE/563-710QDAYTELVVASE...G----------------------------------------------------------------
Q1QTZ9_CHRSD/348-494DALNGNLNLHFE...H----------------------------------------------------------------
Q11NN1_CYTH3/142-298QVPDADINMKFT...D----------------------------