Sequence alignment for CL0401

PF13109

A0RPG5_CAMFF/433-647--------------------------------------------------------------------------------
A1VYN9_CAMJJ/621-835--------------------------------------------------------------------------------
A6DEH3_9PROT/738-953--------------------------------------------------------------------------------
A6Q385_NITSB/623-836--------------------------------------------------------------------------------
A6QAC9_SULNB/640-854--------------------------------------------------------------------------------
A7GYI8_CAMC5/627-841--------------------------------------------------------------------------------
B2UTP1_HELPS/745-958--------------------------------------------------------------------------------
B6BK75_9PROT/827-1037--------------------------------------------------------------------------------
B9D263_WOLRE/627-841--------------------------------------------------------------------------------
B9KGG1_CAMLR/634-848--------------------------------------------------------------------------------
B9L5J2_NAUPA/583-798--------------------------------------------------------------------------------
C3XGB2_9HELI/333-551--------------------------------------------------------------------------------
C3XNN9_9HELI/639-853--------------------------------------------------------------------------------
C5F1J2_9HELI/616-830--------------------------------------------------------------------------------
C5ZX33_9HELI/638-852--------------------------------------------------------------------------------
D3UGW6_HELM1/730-943--------------------------------------------------------------------------------
Q30RQ8_SULDN/697-907--------------------------------------------------------------------------------
Q4HHM4_CAMCO/634-848--------------------------------------------------------------------------------
Q4HS43_CAMUP/629-843--------------------------------------------------------------------------------
Q7MRT1_WOLSU/616-829--------------------------------------------------------------------------------
Q7VFV2_HELHP/731-944--------------------------------------------------------------------------------

PF13502

A0KFB2_AERHH/999-1241--------------------------------------------------------------------------------
A0YA02_9GAMM/903-1114--------------------------------------------------------------------------------
A1S2S6_SHEAM/1130-1371--------------------------------------------------------------------------------
A1STZ9_PSYIN/1024-1262--------------------------------------------------------------------------------
A1TW53_ACIAC/1117-1369--------------------------------------------------------------------------------
A1U479_MARAV/979-1225--------------------------------------------------------------------------------
A1WCZ7_ACISJ/1139-1390--------------------------------------------------------------------------------
A1WSB5_VEREI/1101-1362--------------------------------------------------------------------------------
A1WYY8_HALHL/891-1129--------------------------------------------------------------------------------
A1ZG80_9BACT/721-947--------------------------------------------------------------------------------
A2TRX7_9FLAO/566-791--------------------------------------------------------------------------------
A2U2U5_9FLAO/567-793--------------------------------------------------------------------------------
A3HUH0_9BACT/675-900--------------------------------------------------------------------------------
A3I060_9BACT/816-1020--------------------------------------------------------------------------------
A3J4A5_9FLAO/560-786--------------------------------------------------------------------------------
A3J4S5_9FLAO/687-891--------------------------------------------------------------------------------
A3JK78_9ALTE/987-1233--------------------------------------------------------------------------------
A3Q9Y2_SHELP/1046-1289--------------------------------------------------------------------------------
E0TB83_PARBH/837-1047--------------------------------------------------------------------------------
A3WPW6_9GAMM/1014-1255--------------------------------------------------------------------------------
A3XKT3_LEEBM/574-799--------------------------------------------------------------------------------
A3YBT0_9GAMM/1003-1247--------------------------------------------------------------------------------
A4AMF6_MARSH/560-785--------------------------------------------------------------------------------
A4BQN1_9GAMM/991-1233--------------------------------------------------------------------------------
A4C0T1_9FLAO/568-794--------------------------------------------------------------------------------
A4C806_9GAMM/1004-1241--------------------------------------------------------------------------------
A4CG41_ROBBH/574-799--------------------------------------------------------------------------------
A4VIB7_PSEU5/1014-1255--------------------------------------------------------------------------------
A5CF63_ORITB/620-836--------------------------------------------------------------------------------
A5EPF4_BRASB/898-1114--------------------------------------------------------------------------------
A5FBT6_FLAJ1/701-905--------------------------------------------------------------------------------
A5FJ68_FLAJ1/564-791--------------------------------------------------------------------------------
A5FJN3_FLAJ1/697-901--------------------------------------------------------------------------------
A5FUN1_ACICJ/745-973--------------------------------------------------------------------------------
A5ICR0_LEGPC/1014-1262--------------------------------------------------------------------------------
A6C314_9PLAN/969-1200--------------------------------------------------------------------------------
A6CFZ4_9PLAN/844-1050--------------------------------------------------------------------------------
A6EDA1_9SPHI/197-401--------------------------------------------------------------------------------
A6F4Z2_9ALTE/986-1232--------------------------------------------------------------------------------
A6FEV3_9GAMM/980-1223--------------------------------------------------------------------------------
A6GWN8_FLAPJ/560-787--------------------------------------------------------------------------------
A6SW78_JANMA/1081-1328--------------------------------------------------------------------------------
A6U693_SINMW/393-597--------------------------------------------------------------------------------
A6UB33_SINMW/880-1101--------------------------------------------------------------------------------
A7AAH7_9PORP/866-1069--------------------------------------------------------------------------------
A7HEC2_ANADF/581-801--------------------------------------------------------------------------------
A7HWU4_PARL1/297-497--------------------------------------------------------------------------------
A8EI17_BURPE/1120-1377--------------------------------------------------------------------------------
A8GRQ7_RICRS/625-850--------------------------------------------------------------------------------
A8PNA6_9COXI/753-1000--------------------------------------------------------------------------------
A8UEF9_9FLAO/566-791--------------------------------------------------------------------------------
A9CIC7_AGRT5/884-1105--------------------------------------------------------------------------------
A9DPS2_9FLAO/819-1056--------------------------------------------------------------------------------
A9H3V6_GLUDA/474-684--------------------------------------------------------------------------------
A9VZI8_METEP/849-1067--------------------------------------------------------------------------------
B0NQ23_BACSE/741-944--------------------------------------------------------------------------------
B1KJH7_SHEWM/1029-1272--------------------------------------------------------------------------------
B1XRV0_POLNS/1079-1327--------------------------------------------------------------------------------
B1XVC5_POLNS/28-239--------------------------------------------------------------------------------
B2FP42_STRMK/1008-1250--------------------------------------------------------------------------------
B2PXM1_PROST/1000-1242--------------------------------------------------------------------------------
B3JDW0_9BACE/854-1057--------------------------------------------------------------------------------
B3PTQ9_RHIE6/884-1105--------------------------------------------------------------------------------
B3R439_CUPTR/1186-1441--------------------------------------------------------------------------------
B4D2P2_9BACT/252-462--------------------------------------------------------------------------------
F2G3T4_ALTMD/1046-1287--------------------------------------------------------------------------------
B4S7D6_PROA2/551-781--------------------------------------------------------------------------------
B4WWS5_9GAMM/996-1238--------------------------------------------------------------------------------
B5D2W9_9BACE/743-946--------------------------------------------------------------------------------
B5RZT4_RALSL/864-1116--------------------------------------------------------------------------------
B6C3U8_9GAMM/392-603--------------------------------------------------------------------------------
B6ELQ6_ALISL/633-885--------------------------------------------------------------------------------
B6JB61_OLICO/637-850--------------------------------------------------------------------------------
B6XFK3_9ENTR/1013-1256--------------------------------------------------------------------------------
B7RTJ0_9GAMM/1040-1283--------------------------------------------------------------------------------
B7RZC0_9GAMM/833-1042--------------------------------------------------------------------------------
B7VIB8_VIBSL/1027-1268--------------------------------------------------------------------------------
B8B0X9_ORYSI/279-522--------------------------------------------------------------------------------
B8CI63_SHEPW/997-1240--------------------------------------------------------------------------------
B8DNW5_DESVM/971-1157--------------------------------------------------------------------------------
B8J2T2_DESDA/848-1034--------------------------------------------------------------------------------
B8KWT1_9GAMM/869-1081--------------------------------------------------------------------------------
B9BCU5_9BURK/1099-1356--------------------------------------------------------------------------------
B9XF33_9BACT/756-966--------------------------------------------------------------------------------
B9Z3I6_9NEIS/1017-1259--------------------------------------------------------------------------------
C0N416_9GAMM/1005-1255--------------------------------------------------------------------------------
C1D9M5_LARHH/1015-1258--------------------------------------------------------------------------------
C2M1Y5_CAPGI/573-798--------------------------------------------------------------------------------
C3K7G5_PSEFS/1015-1260--------------------------------------------------------------------------------
C3L4A9_AMOA5/534-754--------------------------------------------------------------------------------
C3MGL5_RHISN/425-630--------------------------------------------------------------------------------
C3XBS4_OXAFO/1106-1353--------------------------------------------------------------------------------
C4L8L8_TOLAT/989-1232--------------------------------------------------------------------------------
C4U7R6_YERAL/1011-1254--------------------------------------------------------------------------------
C4UIL5_YERRU/1014-1257--------------------------------------------------------------------------------
E8RSC3_ASTEC/1136-1358--------------------------------------------------------------------------------
E3IRW1_DESVR/941-1125--------------------------------------------------------------------------------
D9SHW3_GALCS/1021-1263--------------------------------------------------------------------------------
C6B1K3_RHILS/408-616--------------------------------------------------------------------------------
D5CU11_SIDLE/1024-1263--------------------------------------------------------------------------------
D8JRU2_HYPDA/915-1130--------------------------------------------------------------------------------
C6UUQ9_ECO5T/1009-1252--------------------------------------------------------------------------------
C6WWM2_METML/1053-1294--------------------------------------------------------------------------------
C6XD69_METSD/1043-1284--------------------------------------------------------------------------------
C6XK02_HIRBI/884-1092--------------------------------------------------------------------------------
C6XTR4_PEDHD/806-1010--------------------------------------------------------------------------------
C7BLT0_PHOAA/1013-1256--------------------------------------------------------------------------------
C7JI05_ACEP3/380-581--------------------------------------------------------------------------------
C7PC84_CHIPD/564-796--------------------------------------------------------------------------------
C7PJB3_CHIPD/809-1013--------------------------------------------------------------------------------
E6WGF8_PANSA/1014-1257--------------------------------------------------------------------------------
C9NN95_9VIBR/1009-1250--------------------------------------------------------------------------------
C9P2T1_VIBME/1028-1269--------------------------------------------------------------------------------
C9PMQ2_9PAST/191-392--------------------------------------------------------------------------------
D0HXR9_VIBCL/115-356--------------------------------------------------------------------------------
D0I525_VIBHO/1024-1266--------------------------------------------------------------------------------
D0TG62_9BACE/829-1032--------------------------------------------------------------------------------
D0Z1U4_LISDA/1035-1276--------------------------------------------------------------------------------
D1JQS4_9BACE/740-943--------------------------------------------------------------------------------
D1RKZ9_LEGLO/1049-1297--------------------------------------------------------------------------------
D5WC43_BURSC/1144-1399--------------------------------------------------------------------------------
D2C1Z1_DICD5/1022-1265--------------------------------------------------------------------------------
D2U2L7_9ENTR/1008-1250--------------------------------------------------------------------------------
D2UF54_XANAP/1023-1265--------------------------------------------------------------------------------
D2ZL55_9ENTR/1006-1249--------------------------------------------------------------------------------
D3SBX9_THISK/1040-1287--------------------------------------------------------------------------------
D4BXD7_PRORE/987-1229--------------------------------------------------------------------------------
D4EGY4_AGGAC/176-377--------------------------------------------------------------------------------
D4GCB7_PANAM/1019-1262--------------------------------------------------------------------------------
D4HUV7_ERWAC/1008-1251--------------------------------------------------------------------------------
D4IQI7_9BACT/568-774--------------------------------------------------------------------------------
Q0ABM3_ALHEH/1048-1290--------------------------------------------------------------------------------
Q0AQ38_MARMM/879-1092--------------------------------------------------------------------------------
Q0BUM1_GRABC/651-853--------------------------------------------------------------------------------
Q0BY26_HYPNA/311-513--------------------------------------------------------------------------------
Q0G0J1_9RHIZ/903-1122--------------------------------------------------------------------------------
Q11U15_CYTH3/815-1020--------------------------------------------------------------------------------
Q11YL6_CYTH3/532-755--------------------------------------------------------------------------------
Q11YT8_CYTH3/698-925--------------------------------------------------------------------------------
Q134A2_RHOPS/861-1075--------------------------------------------------------------------------------
Q145G0_BURXL/1154-1409--------------------------------------------------------------------------------
Q15ZG8_PSEA6/1002-1243--------------------------------------------------------------------------------
Q1MYL9_9GAMM/998-1245--------------------------------------------------------------------------------
Q1RIG6_RICBR/624-851--------------------------------------------------------------------------------
Q1VS98_9FLAO/575-799--------------------------------------------------------------------------------
Q1YH64_MOBAS/407-618--------------------------------------------------------------------------------
Q1YJ92_MOBAS/882-1101--------------------------------------------------------------------------------
Q1Z1R2_PHOPR/1035-1276--------------------------------------------------------------------------------
Q211X0_RHOPB/871-1087--------------------------------------------------------------------------------
Q26HN2_FLABB/569-794--------------------------------------------------------------------------------
Q28TM9_JANSC/371-572--------------------------------------------------------------------------------
Q2BKP5_9GAMM/1026-1270--------------------------------------------------------------------------------
Q2C0H6_9GAMM/1034-1275--------------------------------------------------------------------------------
Q2KY05_BORA1/936-1183--------------------------------------------------------------------------------
Q2NWP0_SODGM/1012-1255--------------------------------------------------------------------------------
Q3BRF7_XANC5/416-658--------------------------------------------------------------------------------
Q3IFH7_PSEHT/1008-1245--------------------------------------------------------------------------------
Q3R1J6_XYLFA/553-795--------------------------------------------------------------------------------
Q47VG9_COLP3/1038-1280--------------------------------------------------------------------------------
Q5FSF1_GLUOX/412-615--------------------------------------------------------------------------------
Q5R0H7_IDILO/1003-1244--------------------------------------------------------------------------------
Q6IT20_EDWIC/723-966--------------------------------------------------------------------------------
Q6N438_RHOPA/862-1076--------------------------------------------------------------------------------
Q7MHE2_VIBVY/1031-1272--------------------------------------------------------------------------------
Q7UYB4_RHOBA/752-985--------------------------------------------------------------------------------
Q7W992_BORPA/953-1200--------------------------------------------------------------------------------
Q8EA16_SHEON/1025-1268--------------------------------------------------------------------------------
Q9ZDH9_RICPR/624-849--------------------------------------------------------------------------------

PF05170

C9QVM3_ECOD1/6-588MSKAGKITAAISGAFLLLIV.VAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVH
Q87TE2_VIBPA/1-570MKTARRILILLLVVLIVLP....ATIIALLTTSYANSTWQW.VSPYLGLPIQAERV..............HYDFPY.HLS
Q8DDS5_VIBVU/1-572MKKALISVALLLIVIALIP....ISILVSLQTRYASQVFNQ.LSQFSGLGMQAELV..............HYQYPD.HFS
ASMA_ECOLI/1-512MRRFLTTLMILLVVLVAGL....SALVLLVNPNDFRDYMVKQVAARSGYQLQLDGPLR............WHVWPQLSIL
Q9KNJ9_VIBCH/1-570MRKILAIGVAGIALLLILV....LAGFGIMHTRYFTPSAQWIVQQLWPETLRFAKI..............EYLYPF.KLR
Q8Z2I4_SALTI/1-562MKLIGRLLLYVLIACLVVI....FGFYFLLQTRWGADHVSNWVSENSGYHLTFDVMDH............RFSAPS.HLL
Q9HU38_PSEAE/1-636MKAFGKVLGLFFLGLLLLVVALGFALTHLFDPNDYKDEIRQIARDKANLELDLKGDIG............WSLFPWLGLE
Q9KT66_VIBCH/1-595MKK....LFISLLGLVVLIVGALLALVLLVNPNQFKPLIVEQAKKQTGLDLVIEGDIG............WQFFPSIGFE
YICH_ECOLI/1-562MKFIGKLLLYILIALLVAI....AGLYFLLQTRWGAEHISAWVSENSDYHLAFGAMDH............RFSAPS.HIV
Q9JY87_NEIMB/8-615HKYRLKYAVAVLTILLLAAVGLHASVYRTFTPENIRSRLQQSIA.HTHRKISFDADIQ............RRLLPRPTVI
Q9ZDI1_RICPR/1-711MPKALKYSLIIFITIILLL....IIIPFFIPLNNYKGVLIDKVKEATNRNLTINGDIK............LSLLPTPTIS
Q9HUT4_PSEAE/1-577MTRGRKILTWSLASLVLLLA.ALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFS

PF04357

A2TNG0_9FLAO/994-1409--------------------------------------------------------------------------------
A2TNW4_9FLAO/1182-1640--------------------------------------------------------------------------------
Q2C929_9GAMM/905-1251--------------------------------------------------------------------------------
Q2Y828_NITMU/994-1331--------------------------------------------------------------------------------
A0KIJ1_AERHH/913-1251--------------------------------------------------------------------------------
Q3AKV0_SYNSC/1030-1473--------------------------------------------------------------------------------
A7IN53_XANP2/1076-1428--------------------------------------------------------------------------------
A3PNN1_RHOS1/926-1276--------------------------------------------------------------------------------
Q83EW1_COXBU/570-928--------------------------------------------------------------------------------
A6E3M1_9RHOB/900-1246--------------------------------------------------------------------------------
Q0HJ58_SHESM/1055-1401--------------------------------------------------------------------------------
Q1D0C2_MYXXD/935-1291--------------------------------------------------------------------------------
Q3IIS8_PSEHT/883-1224--------------------------------------------------------------------------------
A5FB26_FLAJ1/992-1420--------------------------------------------------------------------------------
A4CXF7_SYNPV/1039-1478--------------------------------------------------------------------------------
A0YIL4_LYNSP/1701-2096--------------------------------------------------------------------------------
Q1MB16_RHIL3/1685-2033--------------------------------------------------------------------------------
Q8YZJ8_NOSS1/1412-1829--------------------------------------------------------------------------------
A4CK93_ROBBH/998-1431--------------------------------------------------------------------------------
Q481M2_COLP3/971-1308--------------------------------------------------------------------------------
B1YUT5_BURA4/998-1353--------------------------------------------------------------------------------
A2C147_PROM1/886-1319--------------------------------------------------------------------------------
Q26C01_FLABB/1165-1623--------------------------------------------------------------------------------
A5ZK99_9BACE/1057-1469--------------------------------------------------------------------------------
A3U6I2_CROAH/1185-1647--------------------------------------------------------------------------------
A1VCI4_DESVV/1414-1783--------------------------------------------------------------------------------
Q4C5Y1_CROWT/1556-1977--------------------------------------------------------------------------------
Q9JXB6_NEIMB/1050-1387--------------------------------------------------------------------------------
Q6G572_BARHE/1198-1548--------------------------------------------------------------------------------
Q1IBQ7_PSEE4/893-1224--------------------------------------------------------------------------------
A4A832_9GAMM/725-1058--------------------------------------------------------------------------------
A3PBW3_PROM0/863-1296--------------------------------------------------------------------------------
A0LAI9_MAGSM/1120-1462--------------------------------------------------------------------------------
Q4QMM3_HAEI8/941-1294--------------------------------------------------------------------------------
Q2ND20_ERYLH/1053-1400--------------------------------------------------------------------------------
Q9PDZ6_XYLFA/845-1179--------------------------------------------------------------------------------
A6GMC8_9BURK/963-1338--------------------------------------------------------------------------------
Q5LV35_SILPO/1012-1360--------------------------------------------------------------------------------
A4SGG7_PROVI/1036-1486--------------------------------------------------------------------------------
A0LGH5_SYNFM/889-1254--------------------------------------------------------------------------------
A5VFU9_SPHWW/1048-1392--------------------------------------------------------------------------------
Q3A844_PELCD/965-1307--------------------------------------------------------------------------------
A6EEW2_9SPHI/1267-1720--------------------------------------------------------------------------------
Q28VV1_JANSC/853-1206--------------------------------------------------------------------------------
A3HZ37_9BACT/1160-1620--------------------------------------------------------------------------------
A5GSG8_SYNR3/973-1387--------------------------------------------------------------------------------
Q065Y1_9SYNE/1038-1479--------------------------------------------------------------------------------
Q1IMU4_KORVE/977-1317--------------------------------------------------------------------------------
Q1NAC8_9SPHN/1059-1410--------------------------------------------------------------------------------
A6L590_BACV8/1012-1461--------------------------------------------------------------------------------
A3J9P9_9ALTE/935-1267--------------------------------------------------------------------------------
A3UCX7_9RHOB/1006-1342--------------------------------------------------------------------------------
A0M1P1_GRAFK/1180-1639--------------------------------------------------------------------------------
Q2S2D2_SALRD/1057-1516--------------------------------------------------------------------------------
A4BTF4_9GAMM/974-1321--------------------------------------------------------------------------------
F2GCG9_ALTMD/897-1246--------------------------------------------------------------------------------
A3U2G6_9RHOB/1005-1359--------------------------------------------------------------------------------
Q21Y28_RHOFD/928-1291--------------------------------------------------------------------------------
Q6MKB2_BDEBA/958-1321--------------------------------------------------------------------------------
Q39RU7_GEOMG/1016-1376--------------------------------------------------------------------------------
Q0YSH5_9CHLB/1047-1493--------------------------------------------------------------------------------
Q21PP5_SACD2/924-1270--------------------------------------------------------------------------------
Q7VBL9_PROMA/867-1309--------------------------------------------------------------------------------
A2SER1_METPP/1091-1433--------------------------------------------------------------------------------
Q0G3A4_9RHIZ/1842-2187--------------------------------------------------------------------------------
A8LNM1_DINSH/737-1084--------------------------------------------------------------------------------
Q167D7_ROSDO/855-1205--------------------------------------------------------------------------------
Q0C134_HYPNA/1036-1371--------------------------------------------------------------------------------
Q3JE49_NITOC/917-1262--------------------------------------------------------------------------------
A6FC33_9GAMM/920-1259--------------------------------------------------------------------------------
Q016Y8_OSTTA/1647-2059--------------------------------------------------------------------------------
A3XNV5_LEEBM/1180-1639--------------------------------------------------------------------------------
A5FIP0_FLAJ1/1183-1626--------------------------------------------------------------------------------
Q0F1G3_9PROT/799-1133--------------------------------------------------------------------------------
Q8KFW2_CHLTE/1034-1479--------------------------------------------------------------------------------
Q47IW3_DECAR/842-1201--------------------------------------------------------------------------------
Q2JHB3_SYNJB/1232-1612--------------------------------------------------------------------------------
Q0ALB2_MARMM/1025-1362--------------------------------------------------------------------------------
A7AE74_9PORP/1075-1490--------------------------------------------------------------------------------
Q15Z95_PSEA6/908-1250--------------------------------------------------------------------------------
A6H009_FLAPJ/1018-1446--------------------------------------------------------------------------------
A3M6L3_ACIBT/799-1145--------------------------------------------------------------------------------
B5E9K2_GEOBB/1121-1484--------------------------------------------------------------------------------
Q0AB99_ALHEH/929-1273--------------------------------------------------------------------------------
Q493V0_BLOPB/931-1279--------------------------------------------------------------------------------
Q1GSU8_SPHAL/1054-1406--------------------------------------------------------------------------------
Q2LXD8_SYNAS/968-1324--------------------------------------------------------------------------------
Q4C605_CROWT/1446-1815--------------------------------------------------------------------------------
Q1QA38_PSYCK/1311-1664--------------------------------------------------------------------------------
Q01ZK1_SOLUE/1253-1604--------------------------------------------------------------------------------
Q11I59_MESSB/1185-1538--------------------------------------------------------------------------------
Q9A7W5_CAUCR/1057-1398--------------------------------------------------------------------------------
Q5P2G0_AROAE/979-1332--------------------------------------------------------------------------------
A4G804_HERAR/984-1318--------------------------------------------------------------------------------
A1ZDJ2_9BACT/1130-1588--------------------------------------------------------------------------------
A3J5Q1_9FLAO/987-1412--------------------------------------------------------------------------------
B8CZ01_HALOH/1096-1430--------------------------------------------------------------------------------
A1SW21_PSYIN/987-1327--------------------------------------------------------------------------------
A3V315_9RHOB/1064-1418--------------------------------------------------------------------------------
Q11VR9_CYTH3/1167-1624--------------------------------------------------------------------------------
A7HQ23_PARL1/1042-1395--------------------------------------------------------------------------------
Q7MT86_PORGI/1036-1486--------------------------------------------------------------------------------
A3WNV7_9GAMM/844-1182--------------------------------------------------------------------------------
Q5FPE8_GLUOX/1025-1381--------------------------------------------------------------------------------
Q0BVY3_GRABC/1010-1362--------------------------------------------------------------------------------
A4BHU2_9GAMM/1208-1569--------------------------------------------------------------------------------
Q73JH5_TREDE/1097-1467--------------------------------------------------------------------------------
Q3AQ57_CHLCH/1053-1500--------------------------------------------------------------------------------
Q5SKS5_THET8/2271-2658--------------------------------------------------------------------------------
Q1NV21_9DELT/955-1283--------------------------------------------------------------------------------
A1BDC7_CHLPD/1048-1494--------------------------------------------------------------------------------
Q2I8W0_9BACT/387-729--------------------------------------------------------------------------------
Q3SKJ4_THIDA/904-1242--------------------------------------------------------------------------------
P73551_SYNY3/1571-1978--------------------------------------------------------------------------------
Q7P0N2_CHRVO/933-1270--------------------------------------------------------------------------------
A3Z198_9SYNE/1096-1522--------------------------------------------------------------------------------
Q0VRK9_ALCBS/827-1164--------------------------------------------------------------------------------
Q08V51_STIAD/1146-1530--------------------------------------------------------------------------------
Q1W0M9_9FLAO/1152-1612--------------------------------------------------------------------------------
Q7W1D4_BORPA/859-1210--------------------------------------------------------------------------------
A2U1I0_9FLAO/1154-1612--------------------------------------------------------------------------------
Q6MAC5_PARUW/935-1288--------------------------------------------------------------------------------
A1HRF9_9FIRM/1091-1444--------------------------------------------------------------------------------
E0TG81_PARBH/951-1296--------------------------------------------------------------------------------
Q1QWE2_CHRSD/954-1312--------------------------------------------------------------------------------
A5FUW2_ACICJ/973-1319--------------------------------------------------------------------------------
Q2RSJ7_RHORT/1146-1500--------------------------------------------------------------------------------
Q2S346_SALRD/1311-1689--------------------------------------------------------------------------------
Q2INP6_ANADE/946-1304--------------------------------------------------------------------------------
Q9RUC9_DEIRA/223-627--------------------------------------------------------------------------------
Q1LSN0_BAUCH/634-981--------------------------------------------------------------------------------
Q02B21_SOLUE/1013-1363--------------------------------------------------------------------------------
Q1ZD28_9GAMM/976-1315--------------------------------------------------------------------------------
A4EWK7_9RHOB/813-1161--------------------------------------------------------------------------------
A0NU08_9RHOB/1094-1448--------------------------------------------------------------------------------
B3ELK5_CHLPB/1036-1483--------------------------------------------------------------------------------
A3ISK4_9CHRO/1570-1981--------------------------------------------------------------------------------
Q2IMB0_ANADE/1148-1504--------------------------------------------------------------------------------
Q8YUC2_NOSS1/1659-2048--------------------------------------------------------------------------------
Q1MQI4_LAWIP/1025-1382--------------------------------------------------------------------------------
P73871_SYNY3/1377-1749--------------------------------------------------------------------------------
Q1H099_METFK/711-1055--------------------------------------------------------------------------------
Q2SJX7_HAHCH/929-1280--------------------------------------------------------------------------------
Q8DGE2_THEEB/1182-1567--------------------------------------------------------------------------------
A3VBU1_9RHOB/1020-1371--------------------------------------------------------------------------------
Q7VQN5_BLOFL/933-1286--------------------------------------------------------------------------------
Q9X3V6_ZYMMB/22-376--------------------------------------------------------------------------------
Q119K9_TRIEI/1940-2322--------------------------------------------------------------------------------
Q7NCN7_GLOVI/1184-1556--------------------------------------------------------------------------------
Q31MA1_SYNE7/1177-1568--------------------------------------------------------------------------------
Q1INS5_KORVE/1027-1368--------------------------------------------------------------------------------

PF05359

Q4K5X6_PSEF5/140-291--------------------------------------------------------------------------------
Q4K5X6_PSEF5/360-511--------------------------------------------------------------------------------
C6BEV1_RALP1/874-1022--------------------------------------------------------------------------------
B2JQ93_BURP8/874-1021--------------------------------------------------------------------------------
A3JB00_9ALTE/379-531--------------------------------------------------------------------------------
Q1BJG4_BURCA/621-773--------------------------------------------------------------------------------
A0RMT1_CAMFF/653-798--------------------------------------------------------------------------------
A3LK23_PSEAI/690-837--------------------------------------------------------------------------------
Q72DG8_DESVH/963-1109--------------------------------------------------------------------------------
A9BMN7_DELAS/883-1036--------------------------------------------------------------------------------
A4SM57_AERS4/366-520--------------------------------------------------------------------------------
A6WLY0_SHEB8/520-670--------------------------------------------------------------------------------
A7ZFK9_CAMC1/750-895--------------------------------------------------------------------------------
Q2LUD1_SYNAS/534-687--------------------------------------------------------------------------------
A8ZWF7_DESOH/636-783--------------------------------------------------------------------------------
Q3A6W6_PELCD/375-529--------------------------------------------------------------------------------
Q5NYY7_AROAE/382-536--------------------------------------------------------------------------------
B7X1L0_COMTE/164-316--------------------------------------------------------------------------------
Q2KWF8_BORA1/759-906--------------------------------------------------------------------------------
A0KYD6_SHESA/671-818--------------------------------------------------------------------------------
Q7WMQ9_BORBR/155-309--------------------------------------------------------------------------------
Q1I4N7_PSEE4/579-726--------------------------------------------------------------------------------
Q484B1_COLP3/382-534--------------------------------------------------------------------------------
A3JB00_9ALTE/590-737--------------------------------------------------------------------------------
A2SI01_METPP/870-1017--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/615-766--------------------------------------------------------------------------------
Q48E84_PSE14/155-306--------------------------------------------------------------------------------
Q5QWM2_IDILO/380-527--------------------------------------------------------------------------------
Q0VP61_ALCBS/592-737--------------------------------------------------------------------------------
A7GWE3_CAMC5/514-660--------------------------------------------------------------------------------
A3QD21_SHELP/699-846--------------------------------------------------------------------------------
A1RL15_SHESW/447-597--------------------------------------------------------------------------------
Q63NS2_BURPS/645-797--------------------------------------------------------------------------------
Q47FN3_DECAR/732-879--------------------------------------------------------------------------------
A0KK00_AERHH/368-522--------------------------------------------------------------------------------
Q0JZH1_CUPNH/670-829--------------------------------------------------------------------------------
Q2LUD1_SYNAS/785-932--------------------------------------------------------------------------------
A1ARF1_PELPD/790-937--------------------------------------------------------------------------------
Q39RS7_GEOMG/568-719--------------------------------------------------------------------------------
B9M3X2_GEOSF/795-942--------------------------------------------------------------------------------
Q8Y0Z7_RALSO/185-339--------------------------------------------------------------------------------
Q3JBN6_NITOC/584-731--------------------------------------------------------------------------------
Q5DZ89_VIBF1/399-549--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/145-295--------------------------------------------------------------------------------
Q0HTT4_SHESR/437-587--------------------------------------------------------------------------------
A9BMN7_DELAS/165-317--------------------------------------------------------------------------------
Q7WB91_BORPA/527-681--------------------------------------------------------------------------------
A9BMN7_DELAS/379-538--------------------------------------------------------------------------------
Q87WR1_PSESM/386-537--------------------------------------------------------------------------------
B2JQ93_BURP8/616-770--------------------------------------------------------------------------------
A1K6C3_AZOSB/734-881--------------------------------------------------------------------------------
Q603H4_METCA/718-865--------------------------------------------------------------------------------
Q47VC1_COLP3/500-655--------------------------------------------------------------------------------
Q15PY6_PSEA6/662-809--------------------------------------------------------------------------------
Q88DW4_PSEPK/365-516--------------------------------------------------------------------------------
A6F3L7_9ALTE/590-737--------------------------------------------------------------------------------
A0KK00_AERHH/578-725--------------------------------------------------------------------------------
B5ECC6_GEOBB/569-721--------------------------------------------------------------------------------
Q2LUD1_SYNAS/159-313--------------------------------------------------------------------------------
A4VPN2_PSEU5/551-698--------------------------------------------------------------------------------
Q3K6Q1_PSEPF/371-522--------------------------------------------------------------------------------
A3L3D9_PSEAI/478-629--------------------------------------------------------------------------------
Q0VP61_ALCBS/382-530--------------------------------------------------------------------------------
A1K7K6_AZOSB/583-736--------------------------------------------------------------------------------
Q3JBN6_NITOC/369-521--------------------------------------------------------------------------------
Q5NYY7_AROAE/832-979--------------------------------------------------------------------------------
Q13S79_BURXL/640-791--------------------------------------------------------------------------------
Q47FN3_DECAR/504-656--------------------------------------------------------------------------------
A7GWE3_CAMC5/719-864--------------------------------------------------------------------------------
B1KJ13_SHEWM/617-764--------------------------------------------------------------------------------
A5W979_PSEP1/140-291--------------------------------------------------------------------------------
Q316X0_DESDG/862-1008--------------------------------------------------------------------------------
Q1NN12_9DELT/591-738--------------------------------------------------------------------------------
Q602F3_METCA/416-565--------------------------------------------------------------------------------
Q2Y5K5_NITMU/673-818--------------------------------------------------------------------------------
B3E4B8_GEOLS/816-963--------------------------------------------------------------------------------
A4VPN2_PSEU5/341-492--------------------------------------------------------------------------------
Q5NYY7_AROAE/153-307--------------------------------------------------------------------------------
Q30NX8_SULDN/563-715--------------------------------------------------------------------------------
C1DFK3_AZOVD/367-518--------------------------------------------------------------------------------
Q484B1_COLP3/604-751--------------------------------------------------------------------------------
Q5NYY7_AROAE/604-757--------------------------------------------------------------------------------
Q602F3_METCA/623-770--------------------------------------------------------------------------------
Q316X0_DESDG/389-538--------------------------------------------------------------------------------
A5G9K9_GEOUR/137-293--------------------------------------------------------------------------------
B2JHK1_BURP8/152-309--------------------------------------------------------------------------------
B1KJ13_SHEWM/407-556--------------------------------------------------------------------------------
A5G9K9_GEOUR/551-702--------------------------------------------------------------------------------
A1K6C3_AZOSB/165-302--------------------------------------------------------------------------------
A0KK00_AERHH/151-307--------------------------------------------------------------------------------
Q1H1L3_METFK/780-927--------------------------------------------------------------------------------
B9M7L7_GEOSF/383-534--------------------------------------------------------------------------------
Q0F0H3_9PROT/538-688--------------------------------------------------------------------------------
A4SXW3_POLSQ/414-561--------------------------------------------------------------------------------
A6FDI0_9GAMM/443-592--------------------------------------------------------------------------------
B9M3X2_GEOSF/564-715--------------------------------------------------------------------------------
A4G9D7_HERAR/154-308--------------------------------------------------------------------------------
Q21F55_SACD2/584-731--------------------------------------------------------------------------------
Q7NY28_CHRVO/704-851--------------------------------------------------------------------------------
Q0JZH1_CUPNH/164-317--------------------------------------------------------------------------------
Q3K6Q1_PSEPF/144-295--------------------------------------------------------------------------------
A1TWZ4_MARAV/597-744--------------------------------------------------------------------------------
A4JK45_BURVG/159-312--------------------------------------------------------------------------------
B3E4B8_GEOLS/367-514--------------------------------------------------------------------------------
Q2IFA1_ANADE/563-710--------------------------------------------------------------------------------
A4SM57_AERS4/151-307--------------------------------------------------------------------------------
Q1QTZ9_CHRSD/348-494--------------------------------------------------------------------------------
Q11NN1_CYTH3/142-298--------------------------------------------------------------------------------
Q9HV64_PSEAE/140-291--------------------------------------------------------------------------------
Q3SGZ4_THIDA/733-880--------------------------------------------------------------------------------
Q3A6W6_PELCD/162-316--------------------------------------------------------------------------------
A4A3Z9_9GAMM/583-730--------------------------------------------------------------------------------
Q316X0_DESDG/600-751--------------------------------------------------------------------------------
A8H2Y8_SHEPA/433-583--------------------------------------------------------------------------------
A6T355_JANMA/478-631--------------------------------------------------------------------------------
A1TWZ4_MARAV/166-321--------------------------------------------------------------------------------
A6DTM8_9BACT/927-1074--------------------------------------------------------------------------------
B9M7L7_GEOSF/592-739--------------------------------------------------------------------------------
Q222N5_RHOFD/496-646--------------------------------------------------------------------------------
A6T355_JANMA/155-309--------------------------------------------------------------------------------
Q1K3A0_DESAC/497-651--------------------------------------------------------------------------------
Q3A6W6_PELCD/805-951--------------------------------------------------------------------------------
A5G9K9_GEOUR/769-916--------------------------------------------------------------------------------
A2SI01_METPP/623-775--------------------------------------------------------------------------------
Q2T396_BURTA/231-384--------------------------------------------------------------------------------
Q46V48_CUPPJ/649-808--------------------------------------------------------------------------------
Q083W9_SHEFN/492-642--------------------------------------------------------------------------------
A8FUB9_SHESH/389-538--------------------------------------------------------------------------------
Q083W9_SHEFN/725-872--------------------------------------------------------------------------------
Q12MK5_SHEDO/654-801--------------------------------------------------------------------------------
Q3SGZ4_THIDA/517-669--------------------------------------------------------------------------------
A1ARF1_PELPD/573-725--------------------------------------------------------------------------------
Q39RS7_GEOMG/801-948--------------------------------------------------------------------------------
Q603H4_METCA/502-653--------------------------------------------------------------------------------
Q222N5_RHOFD/149-300--------------------------------------------------------------------------------
A8ZWF7_DESOH/412-569--------------------------------------------------------------------------------
A4XYD1_PSEMY/354-505--------------------------------------------------------------------------------
Q484B1_COLP3/152-304--------------------------------------------------------------------------------
Q21F55_SACD2/154-306--------------------------------------------------------------------------------
Q3SGZ4_THIDA/147-307--------------------------------------------------------------------------------
A7I315_CAMHC/662-807--------------------------------------------------------------------------------
Q74FC9_GEOSL/787-934--------------------------------------------------------------------------------
A7H8M2_ANADF/367-518--------------------------------------------------------------------------------
F2GAL8_ALTMD/716-863--------------------------------------------------------------------------------
Q5DZ89_VIBF1/610-757--------------------------------------------------------------------------------
A4XYD1_PSEMY/562-709--------------------------------------------------------------------------------
B3E4B8_GEOLS/583-736--------------------------------------------------------------------------------
A6GL92_9BURK/612-759--------------------------------------------------------------------------------
Q2BL34_9GAMM/505-657--------------------------------------------------------------------------------
C1DFK3_AZOVD/141-292--------------------------------------------------------------------------------
Q1LGA7_RALME/681-840--------------------------------------------------------------------------------
Q1JXN5_DESAC/795-942--------------------------------------------------------------------------------
B5ECC6_GEOBB/807-954--------------------------------------------------------------------------------
Q2IFA1_ANADE/358-509--------------------------------------------------------------------------------
A4XYD1_PSEMY/140-291--------------------------------------------------------------------------------
A7H8M2_ANADF/165-318--------------------------------------------------------------------------------
A3QD21_SHELP/453-602--------------------------------------------------------------------------------
Q3A6W6_PELCD/588-738--------------------------------------------------------------------------------
A7H8M2_ANADF/579-726--------------------------------------------------------------------------------
A8ETY5_ARCB4/612-759--------------------------------------------------------------------------------
Q30NX8_SULDN/772-919--------------------------------------------------------------------------------
A6FDI0_9GAMM/664-811--------------------------------------------------------------------------------
A6DTM8_9BACT/382-537--------------------------------------------------------------------------------
A4VPN2_PSEU5/125-276--------------------------------------------------------------------------------
Q1LGA7_RALME/173-326--------------------------------------------------------------------------------
Q1H1L3_METFK/561-712--------------------------------------------------------------------------------
Q222N5_RHOFD/710-857--------------------------------------------------------------------------------
C1DFK3_AZOVD/584-731--------------------------------------------------------------------------------

PF13116

A3ZDT1_CAMJU/201-486--------------------------------------------------------------------------------
A4THD4_YERPP/510-796--------------------------------------------------------------------------------
A1RP07_SHESW/505-792--------------------------------------------------------------------------------
B5F9M1_VIBFM/506-792--------------------------------------------------------------------------------
B5REW7_SALG2/474-759--------------------------------------------------------------------------------
C4X0M1_KLEPN/504-789--------------------------------------------------------------------------------
C6XK02_HIRBI/457-744--------------------------------------------------------------------------------
C6DIL6_PECCP/503-788--------------------------------------------------------------------------------
D2YHX2_VIBMI/503-791--------------------------------------------------------------------------------
Q7NW94_CHRVO/514-796--------------------------------------------------------------------------------
Q7N037_PHOLL/501-786--------------------------------------------------------------------------------
A7ZDM6_CAMC1/160-458--------------------------------------------------------------------------------
A4XQL3_PSEMY/513-798--------------------------------------------------------------------------------
Q3J7T7_NITOC/517-810--------------------------------------------------------------------------------
C3XNN9_9HELI/210-498--------------------------------------------------------------------------------
Q0HZG8_SHESR/505-792--------------------------------------------------------------------------------
D5CU11_SIDLE/524-805--------------------------------------------------------------------------------
A3YBT0_9GAMM/494-783--------------------------------------------------------------------------------
B2PXM1_PROST/492-780--------------------------------------------------------------------------------
C3X5K0_OXAFO/598-890--------------------------------------------------------------------------------
A1AVR0_RUTMC/242-525--------------------------------------------------------------------------------
D1RKZ9_LEGLO/542-830--------------------------------------------------------------------------------
B6XFK3_9ENTR/506-794--------------------------------------------------------------------------------
B9D263_WOLRE/198-487--------------------------------------------------------------------------------
Q31FH6_THICR/496-774--------------------------------------------------------------------------------
A6D042_9VIBR/509-797--------------------------------------------------------------------------------
Q48EA0_PSE14/513-795--------------------------------------------------------------------------------
Q2NWP0_SODGM/504-789--------------------------------------------------------------------------------
B8GV04_THISH/540-825--------------------------------------------------------------------------------
A9KBH4_COXBN/479-764--------------------------------------------------------------------------------
A8H923_SHEPA/510-797--------------------------------------------------------------------------------
B3CN56_WOLPP/322-604--------------------------------------------------------------------------------
B0KQG7_PSEPG/513-795--------------------------------------------------------------------------------
A0RPG5_CAMFF/10-294--------------------------------------------------------------------------------
D2C1Z1_DICD5/509-794--------------------------------------------------------------------------------
D4GCB7_PANAM/504-789--------------------------------------------------------------------------------
Q07WQ4_SHEFN/504-791--------------------------------------------------------------------------------
Q5ZUN8_LEGPH/507-795--------------------------------------------------------------------------------
Q7VFV2_HELHP/222-511--------------------------------------------------------------------------------
D2TDE3_ERWP6/503-788--------------------------------------------------------------------------------
A8T949_9VIBR/505-792--------------------------------------------------------------------------------
C0F958_9RICK/390-675--------------------------------------------------------------------------------
C8PGF2_9PROT/201-488--------------------------------------------------------------------------------
Q12IX1_SHEDO/530-817--------------------------------------------------------------------------------
Q15ZG8_PSEA6/490-776--------------------------------------------------------------------------------
C9P9S4_VIBFU/504-791--------------------------------------------------------------------------------
A6Q385_NITSB/202-483--------------------------------------------------------------------------------
A8GK60_SERP5/523-808--------------------------------------------------------------------------------
B8K935_VIBPA/486-773--------------------------------------------------------------------------------
Q3IFH7_PSEHT/493-781--------------------------------------------------------------------------------
A8PNA6_9COXI/430-712--------------------------------------------------------------------------------
A7GYI8_CAMC5/195-484--------------------------------------------------------------------------------
D9SHW3_GALCS/523-805--------------------------------------------------------------------------------
C7R9G7_KANKD/505-791--------------------------------------------------------------------------------
A4SSL2_AERS4/495-781--------------------------------------------------------------------------------
Q21FT5_SACD2/542-827--------------------------------------------------------------------------------
B9KGG1_CAMLR/206-490--------------------------------------------------------------------------------
A3UZ19_VIBSP/503-790--------------------------------------------------------------------------------
B6INC8_RHOCS/363-622--------------------------------------------------------------------------------
C0AZI2_9ENTR/255-539--------------------------------------------------------------------------------
A7MJB2_CROS8/518-803--------------------------------------------------------------------------------
C9QN32_VIBOR/503-790--------------------------------------------------------------------------------
C2LNU1_PROMI/500-784--------------------------------------------------------------------------------
A6SW78_JANMA/540-840--------------------------------------------------------------------------------
C6XD69_METSD/519-799--------------------------------------------------------------------------------
A7I2E8_CAMHC/213-497--------------------------------------------------------------------------------
Q6LMA6_PHOPR/509-794--------------------------------------------------------------------------------
D0L1I5_HALNC/561-853--------------------------------------------------------------------------------
A3Q9Y2_SHELP/509-796--------------------------------------------------------------------------------
A6QAC9_SULNB/206-494--------------------------------------------------------------------------------
A8EUE5_ARCB4/193-478--------------------------------------------------------------------------------
A8FQQ2_SHESH/504-791--------------------------------------------------------------------------------
C5ZX33_9HELI/208-498--------------------------------------------------------------------------------
D0I525_VIBHO/503-790--------------------------------------------------------------------------------
Q1H0H5_METFK/520-800--------------------------------------------------------------------------------
A9D952_9GAMM/504-796--------------------------------------------------------------------------------
C0N416_9GAMM/506-794--------------------------------------------------------------------------------
Q7MRT1_WOLSU/187-475--------------------------------------------------------------------------------
Q2C0H6_9GAMM/506-792--------------------------------------------------------------------------------
B1KJH7_SHEWM/508-795--------------------------------------------------------------------------------
Q47VG9_COLP3/504-793--------------------------------------------------------------------------------
A4G3G0_HERAR/587-887--------------------------------------------------------------------------------
D1B1Z5_SULD5/203-493--------------------------------------------------------------------------------
D3V5J7_XENBS/502-797--------------------------------------------------------------------------------
A6GR98_9BURK/554-836--------------------------------------------------------------------------------
D4E146_SEROD/303-588--------------------------------------------------------------------------------
A4C806_9GAMM/497-784--------------------------------------------------------------------------------
E6WGF8_PANSA/504-789--------------------------------------------------------------------------------
Q4HS43_CAMUP/200-483--------------------------------------------------------------------------------
Q8DCG6_VIBVU/507-794--------------------------------------------------------------------------------
C5F1J2_9HELI/186-475--------------------------------------------------------------------------------
C9P2T1_VIBME/504-791--------------------------------------------------------------------------------
Q5GSY1_WOLTR/325-607--------------------------------------------------------------------------------
F2G3T4_ALTMD/500-787--------------------------------------------------------------------------------
D1KAX2_9GAMM/256-540--------------------------------------------------------------------------------
A0Y2B2_9GAMM/494-782--------------------------------------------------------------------------------
A3WPW6_9GAMM/495-781--------------------------------------------------------------------------------
Q4HHM4_CAMCO/202-487--------------------------------------------------------------------------------
A5CXF5_VESOH/244-528--------------------------------------------------------------------------------
Q0AGL5_NITEC/528-819--------------------------------------------------------------------------------
D3VKA4_XENNA/501-791--------------------------------------------------------------------------------
C6C4M2_DICDC/503-788--------------------------------------------------------------------------------
C3XBS4_OXAFO/577-871--------------------------------------------------------------------------------
Q0ABM3_ALHEH/531-818--------------------------------------------------------------------------------

PF13109

A0RPG5_CAMFF/433-647------------------------NELNFDGLF---D--N--G---------EV-K-------L-NK-------------
A1VYN9_CAMJJ/621-835------------------------NALDLKGSR---G--N--.---------.A-K-------F-DL-------------
A6DEH3_9PROT/738-953------------------------KNLFLKSKY---K--T--S---------TL-N-------G-YT-------------
A6Q385_NITSB/623-836------------------------ETIHFSGNY---G--P--T---------RY-V-------F-MY-------------
A6QAC9_SULNB/640-854------------------------NTITAVGNL---G--S--D---------KV-T-------F-RK-------------
A7GYI8_CAMC5/627-841------------------------SSISLNGLP---K--Q--G---------RV-G-------L-FK-------------
B2UTP1_HELPS/745-958------------------------DRVKIDGNY---K--N--G---------MI-M-------A-DL-------------
B6BK75_9PROT/827-1037------------------------NIVSAQLKH---K--N--G---------NA-G-------F-EL-------------
B9D263_WOLRE/627-841------------------------GTVRFDAKP---A--R--G---------NF-S-------L-IK-------------
B9KGG1_CAMLR/634-848------------------------DYVKAWANR---N--E--S---------KF-D-------F-LL-------------
B9L5J2_NAUPA/583-798------------------------DNFNFHSIY---K--D--S---------SL-N-------G-YT-------------
C3XGB2_9HELI/333-551------------------------NRIVVDGQY---G--K--G---------IL-N-------A-SL-------------
C3XNN9_9HELI/639-853------------------------NTIQGTLKH---K--N--G---------SA-D-------L-YK-------------
C5F1J2_9HELI/616-830------------------------DELKATLTH---K--N--G---------RA-D-------I-YK-------------
C5ZX33_9HELI/638-852------------------------DELKATLKH---K--N--G---------QA-Q-------I-YK-------------
D3UGW6_HELM1/730-943------------------------QRTLASLTY---K--N--G---------IA-N-------V-DF-------------
Q30RQ8_SULDN/697-907------------------------DIFSAELKY---K--A--G---------KA-T-------F-LS-------------
Q4HHM4_CAMCO/634-848------------------------DILDARATR---K--N--A---------..-N-------F-DL-------------
Q4HS43_CAMUP/629-843------------------------AVLNASASS---G--K--T---------QI-S-------F-HK-------------
Q7MRT1_WOLSU/616-829------------------------ENISATLSY---K--N--G---------TL-K-------A-NL-------------
Q7VFV2_HELHP/731-944------------------------GIIRADVTY---G--N--G---------VA-N-------V-DM-------------

PF13502

A0KFB2_AERHH/999-1241-----------------------LGEVKGELIP...G..A..D.........KL.S-------L-KG-------------
A0YA02_9GAMM/903-1114-----------------------LKDVYLQANL...M..N..G.........IL.T-------V-PS-------------
A1S2S6_SHEAM/1130-1371-----------------------LGHLVLQGQP...E..P..G.........RY.N-------F-QT-------------
A1STZ9_PSYIN/1024-1262-----------------------LSPMRLHIFP...N..K..K.........NL.N-------I-NY-------------
A1TW53_ACIAC/1117-1369-----------------------LGRIEVEAQN...R..G..GAG....APREW.R-------L-SK-------------
A1U479_MARAV/979-1225-----------------------AGSWRFKLRP...E..P..Y.........RL.R-------V-QE-------------
A1WCZ7_ACISJ/1139-1390-----------------------LGRIEIEARN...R..G..TEG....GQREW.R-------L-SK-------------
A1WSB5_VEREI/1101-1362-----------------------LGQLEMQARN...Q..G..TDGGDAGLQREW.R-------L-TR-------------
A1WYY8_HALHL/891-1129-----------------------AGVGRVRLRP...R..G..E.........VL.Y-------L-DE-------------
A1ZG80_9BACT/721-947-----------------------IKNIKGKIIV...K..D..G.........RV.L-------L-NG-------------
A2TRX7_9FLAO/566-791-----------------------LSNTKGSVTI...A..N..E.........QA.S-------L-SN-------------
A2U2U5_9FLAO/567-793-----------------------LKNVSGIIYV...K..D..E.........TI.N-------L-QN-------------
A3HUH0_9BACT/675-900-----------------------LKEMKGEMLL...K..D..G.........IL.T-------F-RD-------------
A3I060_9BACT/816-1020-----------------------IRNFNGNLST...K..P..G.........II.S-------L-DK-------------
A3J4A5_9FLAO/560-786-----------------------LKDVSGNMVI...R..D..E.........AI.S-------L-NN-------------
A3J4S5_9FLAO/687-891-----------------------IENLRGKLII...Q..N..G.........SL.Q-------L-SN-------------
A3JK78_9ALTE/987-1233-----------------------LGQWSFLLRP...Q..A..G.........GV.S-------I-ES-------------
A3Q9Y2_SHELP/1046-1289-----------------------LGHLVLQATP...K..N..G.........DY.Q-------I-QT-------------
E0TB83_PARBH/837-1047-----------------------LHDLTVSGLF...D..G..E.........RV.E-------R-LI-------------
A3WPW6_9GAMM/1014-1255-----------------------LGRVHAELVP...I..Q..G.........GI.A-------L-NQ-------------
A3XKT3_LEEBM/574-799-----------------------LSNVKGNVTV...Q..N..E.........TA.S-------L-NN-------------
A3YBT0_9GAMM/1003-1247-----------------------YGDWHLLITN...L..G..K.........KI.R-------I-DP-------------
A4AMF6_MARSH/560-785-----------------------LKNVRGNLRI...V..D..E.........KA.V-------L-TD-------------
A4BQN1_9GAMM/991-1233-----------------------FGHLRLSLAR...V..S..G.........GL.V-------L-ET-------------
A4C0T1_9FLAO/568-794-----------------------LTSVSGELHI...K..E..E.........SV.R-------L-KN-------------
A4C806_9GAMM/1004-1241-----------------------LDKVQLNLDP...A..T..D.........GI.M-------I-SD-------------
A4CG41_ROBBH/574-799-----------------------LRNVSGNLQI...R..D..Q.........EL.Q-------L-RD-------------
A4VIB7_PSEU5/1014-1255-----------------------LGAWALKLRP...V..G..T.........GV.E-------F-HD-------------
A5CF63_ORITB/620-836-----------------------IQDFISKFSV...Q..D..S.........II.Q-------V-KD-------------
A5EPF4_BRASB/898-1114-----------------------LRPLGGAVAS...D..G..Q.........SL.T-------I-EN-------------
A5FBT6_FLAJ1/701-905-----------------------LNKLSGKVGI...T..K..G.........SF.Y-------L-EN-------------
A5FJ68_FLAJ1/564-791-----------------------LKDVSGKLII...K..D..E.........KA.L-------L-EN-------------
A5FJN3_FLAJ1/697-901-----------------------LQNATGYLTM...N..K..G.........KL.T-------M-QN-------------
A5FUN1_ACICJ/745-973-----------------------ARHASFSLAL...D..Q..GKL.....APRI.A-------V-TL-------------
A5ICR0_LEGPC/1014-1262-----------------------IGNITLKSHS...T..S..E.........QW.K-------I-DY-------------
A6C314_9PLAN/969-1200-----------------------SGKTNIEATI...K..D..G.........QI.H-------I-TP-------------
A6CFZ4_9PLAN/844-1050-----------------------IRREQFQSVS...L..P..Q.........NN.S-------M-QP-------------
A6EDA1_9SPHI/197-401-----------------------IKDAKGTMTL...N..N..G.........TL.S-------L-IQ-------------
A6F4Z2_9ALTE/986-1232-----------------------AGSWSFQLRP...D..A..A.........QL.R-------V-QD-------------
A6FEV3_9GAMM/980-1223-----------------------LGRTSVEVTK...S..A..S.........GL.T-------L-KA-------------
A6GWN8_FLAPJ/560-787-----------------------LKAVSGKMII...R..D..E.........AV.T-------L-QN-------------
A6SW78_JANMA/1081-1328-----------------------LGRLELLAHY...V..R..ATE.....GREW.R-------I-RN-------------
A6U693_SINMW/393-597-----------------------LTDVAAGVMI...D..G..R.........RV.S-------L-DI-------------
A6UB33_SINMW/880-1101-----------------------VSNFAGRLEW...K..G..D.........EL.A-------L-SD-------------
A7AAH7_9PORP/866-1069-----------------------LKNVVGEIVL...R..D..Q.........SI.N-------L-SK-------------
A7HEC2_ANADF/581-801-----------------------ARNVAVRVRV...K..G..D.........EV.T-------F-EQ-------------
A7HWU4_PARL1/297-497-----------------------LTSLKLPLKL...T..G..G.........KL.A-------A-.P-------------
A8EI17_BURPE/1120-1377-----------------------IGRLEVDARN...V..D..ENG.....IPVW.Q-------L-DK-------------
A8GRQ7_RICRS/625-850-----------------------LKNVKFYVAN...N..N..N.........LL.Q-------F-NN-------------
A8PNA6_9COXI/753-1000-----------------------LGAVQLKLNP...V..L..G.........GV.L-------I-RE-------------
A8UEF9_9FLAO/566-791-----------------------LKNVKGQLLI...K..D..Q.........NA.N-------L-KN-------------
A9CIC7_AGRT5/884-1105-----------------------VTGVSAKLTH...D..A..G.........SL.S-------L-DD-------------
A9DPS2_9FLAO/819-1056-----------------------LQKIKADLRT...T..P..E.........HYIY-------V-DT-------------
A9H3V6_GLUDA/474-684-----------------------LTGVHA..HL...E..D..N.........GV.R-------L-TR-------------
A9VZI8_METEP/849-1067-----------------------ADSASLTLVR...E..G..D.........AL.S-------L-RD-------------
B0NQ23_BACSE/741-944-----------------------FNDVRGAVDI...R..N..Q.........SV.Y-------L-KQ-------------
B1KJH7_SHEWM/1029-1272-----------------------LGHLVLQGTP...Q..G..N.........NY.Q-------I-QT-------------
B1XRV0_POLNS/1079-1327-----------------------FGQVKIKTKT...T..G..N.........TI.N-------I-DS-------------
B1XVC5_POLNS/28-239-----------------------LTNFKTTLQF...K..K..N.........SI.D-------V-ND-------------
B2FP42_STRMK/1008-1250-----------------------LGQAVLRTRP...L..A..N.........GL.N-------V-DE-------------
B2PXM1_PROST/1000-1242-----------------------LGKLSAHLKP...Q..G..N.........TL.Q-------L-SG-------------
B3JDW0_9BACE/854-1057-----------------------FEDVRGAVDI...R..N..Q.........AV.H-------L-KG-------------
B3PTQ9_RHIE6/884-1105-----------------------VSDFTSNVAY...K..G..D.........EL.Q-------L-ND-------------
B3R439_CUPTR/1186-1441-----------------------FGKLEVKAHT...E..T..GAGG...TDPVW.T-------L-DK-------------
B4D2P2_9BACT/252-462-----------------------FENVSTPFSF...A..G..G.........AF.D-------L-SQ-------------
F2G3T4_ALTMD/1046-1287-----------------------FGEITLDIAK...E..D..N.........GL.A-------I-RQ-------------
B4S7D6_PROA2/551-781-----------------------FTDASGGLTL...K..D..E.........TL.S-------F-TN-------------
B4WWS5_9GAMM/996-1238-----------------------FGEWQADLRP...T..A..Q.........GV.R-------I-NN-------------
B5D2W9_9BACE/743-946-----------------------FENVQGAVDI...R..N..Q.........AV.Y-------L-KK-------------
B5RZT4_RALSL/864-1116-----------------------LGKLELKARGQ.IN..D..GA.......PVW.T-------L-ET-------------
B6C3U8_9GAMM/392-603-----------------------IQGGKLNIAI...K..E..K.........QL.A-------L-HP-------------
B6ELQ6_ALISL/633-885-----------------------LKDLVVRFSG...KEHN..H.........KL.Q-------I-.D-------------
B6JB61_OLICO/637-850-----------------------VTAVSGALRG...D..G..A.........SL.A-------L-DD-------------
B6XFK3_9ENTR/1013-1256-----------------------LGEITAKITP...E..G..Q........HTL.K-------L-TA-------------
B7RTJ0_9GAMM/1040-1283-----------------------IGDLQMSLES...D..G..P.........VV.R-------A-KD-------------
B7RZC0_9GAMM/833-1042-----------------------NNAVELKLRL...N..N..G.........KL.S-------S-QS-------------
B7VIB8_VIBSL/1027-1268-----------------------VGKVDVEMTR...Q..E..D.........RI.E-------W-NK-------------
B8B0X9_ORYSI/279-522-----------------------LGKVEADLTN...R..G..D.........TL.T-------L-DH-------------
B8CI63_SHEPW/997-1240-----------------------MGHLVLQATP...K..E..N.........TY.N-------I-QT-------------
B8DNW5_DESVM/971-1157-----------------------FDGFTAPILL...R..D..G.........QL.E-------V-GP-------------
B8J2T2_DESDA/848-1034-----------------------VQNLRSRYKL...E..N..G.........RL.T-------S-DS-------------
B8KWT1_9GAMM/869-1081-----------------------ISDAALKGQV...L..D..G.........GL.Y-------I-SS-------------
B9BCU5_9BURK/1099-1356-----------------------IGRLVVNARN...V..D..ENG.....TPVW.Q-------L-DR-------------
B9XF33_9BACT/756-966-----------------------VAHISGGVHW...V..G..D.........HL.N-------L-SQ-------------
B9Z3I6_9NEIS/1017-1259-----------------------VGKLELHAVQ...S..G..K.........DW.L-------L-DR-------------
C0N416_9GAMM/1005-1255-----------------------LGHLSLSAKQ...T..Q..T.........DW.Q-------L-ES-------------
C1D9M5_LARHH/1015-1258-----------------------MGKLTLMSTR...Q..K..N.........EW.K-------L-DR-------------
C2M1Y5_CAPGI/573-798-----------------------LTNVSGKLII...K..D..E.........KV.S-------L-QN-------------
C3K7G5_PSEFS/1015-1260-----------------------IGAWSLKIRP...T..A..K.........GL.A-------F-NN-------------
C3L4A9_AMOA5/534-754-----------------------GNKIRGRFKI...V..E..Q.........QL.I-------A-DA-------------
C3MGL5_RHISN/425-630-----------------------LTEVAAGVLI...D..G..K.........RA.S-------L-DI-------------
C3XBS4_OXAFO/1106-1353-----------------------LGRTEIIANNVNFQ..G..G........REW.R-------I-NK-------------
C4L8L8_TOLAT/989-1232-----------------------LGQFRGHLYP...V..K..Q.........GG.E-------I-RD-------------
C4U7R6_YERAL/1011-1254-----------------------IGRVNADLTP...K..G..S.........VL.V-------L-TN-------------
C4UIL5_YERRU/1014-1257-----------------------IGKVTADIAH...S..G..D.........IL.S-------L-TN-------------
E8RSC3_ASTEC/1136-1358-----------------------LVDISAVRTS...Q..D..G.........VF.S-------E-VE-------------
E3IRW1_DESVR/941-1125-----------------------LSRVVIPVSL...N..A..G.........VL.E-------V-IP-------------
D9SHW3_GALCS/1021-1263-----------------------LGRFELIGTP...E..G..Q.........NW.R-------L-RR-------------
C6B1K3_RHILS/408-616-----------------------LSDVGASVIV...A..G..G.........EA.K-------F-DI-------------
D5CU11_SIDLE/1024-1263-----------------------LGKLEMNMSE...S..D..G.........DV.L-------L-DN-------------
D8JRU2_HYPDA/915-1130-----------------------LRNLKMQIET...R..A..G.........NL.A-------A-LD-------------
C6UUQ9_ECO5T/1009-1252-----------------------FGRIDSDITI...S..G..N.........TL.T-------L-TN-------------
C6WWM2_METML/1053-1294-----------------------LGSLELIAYP...E..N..D.........NW.D-------I-QK-------------
C6XD69_METSD/1043-1284-----------------------LGRLELQASE...Q..N..D.........DW.S-------I-EK-------------
C6XK02_HIRBI/884-1092-----------------------LLNSKIVLDM...N..P..E.........TL.E-------R-GL-------------
C6XTR4_PEDHD/806-1010-----------------------IKNARGGLRL...N..N..G.........VL.T-------L-DK-------------
C7BLT0_PHOAA/1013-1256-----------------------LGSVSGTLIP...E..G..N.........AL.V-------L-KD-------------
C7JI05_ACEP3/380-581-----------------------FNQAQISLSQ...M..P..G.........RI.D-------V-SS-------------
C7PC84_CHIPD/564-796-----------------------MSNLSGNLLL...K..D..E.........TV.S-------M-QQ-------------
C7PJB3_CHIPD/809-1013-----------------------ISKFHGQLLV...D..N..G.........SL.Q-------L-NK-------------
E6WGF8_PANSA/1014-1257-----------------------FGHMQALLQP...R..G..D.........TL.A-------L-TN-------------
C9NN95_9VIBR/1009-1250-----------------------VGKTHLDLQR...Q..G..E.........RL.E-------W-KK-------------
C9P2T1_VIBME/1028-1269-----------------------VGKLSMDFQR...Q..G..D.........TL.A-------W-KK-------------
C9PMQ2_9PAST/191-392-----------------------FPFLKAQLNM...N..S..P.........RV.L-------E-LN-------------
D0HXR9_VIBCL/115-356-----------------------IGQANVDFQR...Q..G..D.........TL.L-------W-KS-------------
D0I525_VIBHO/1024-1266-----------------------LGSVNTQLLK...R..G..D.........TI.T-------M-PK-------------
D0TG62_9BACE/829-1032-----------------------LEDVKGEVVI...R..D..Q.........SI.N-------L-SD-------------
D0Z1U4_LISDA/1035-1276-----------------------LGKVEGQLLK...K..G..S.........SL.T-------L-PK-------------
D1JQS4_9BACE/740-943-----------------------FENVHGAVDI...K..N..Q.........AI.H-------L-ED-------------
D1RKZ9_LEGLO/1049-1297-----------------------IGNITLKSQS...S..V..G.........KW.S-------I-NY-------------
D5WC43_BURSC/1144-1399-----------------------VGRLEVDAHN...Y..D..ENG.....VPVW.Q-------L-DK-------------
D2C1Z1_DICD5/1022-1265-----------------------IGQVRGAIQP...E..P..N.........KL.V-------L-TN-------------
D2U2L7_9ENTR/1008-1250-----------------------LGELKAQIMR...N..R..Q.........TL.I-------L-KE-------------
D2UF54_XANAP/1023-1265-----------------------FGAASLRTRK...L..A..D.........GM.Q-------V-DQ-------------
D2ZL55_9ENTR/1006-1249-----------------------YGRIDGDFAI...R..G..N.........TL.S-------L-TG-------------
D3SBX9_THISK/1040-1287-----------------------LADVHLALGP...V..N..Q.........GL.R-------V-DS-------------
D4BXD7_PRORE/987-1229-----------------------LGEISANIQP...K..G..T.........LL.Q-------L-TD-------------
D4EGY4_AGGAC/176-377-----------------------LGFIQADLDL...S..QYTK.........HL.T-------A-DI-------------
D4GCB7_PANAM/1019-1262-----------------------YGRVNARLQP...N..G..S.........TL.A-------L-TN-------------
D4HUV7_ERWAC/1008-1251-----------------------FGRIQAELNP...S..G..D.........TL.K-------L-QN-------------
D4IQI7_9BACT/568-774-----------------------IGDISGEMRV...A..G..G.........AL.S-------L-ER-------------
Q0ABM3_ALHEH/1048-1290-----------------------LGRLDLRVTP...E..G..D.........SA.R-------F-ES-------------
Q0AQ38_MARMM/879-1092-----------------------LDQFNLIWRS...E..A..A.........GI.R-------A-VS-------------
Q0BUM1_GRABC/651-853-----------------------WSKATIGLSL...G..T..A.........GI.R-------V-QP-------------
Q0BY26_HYPNA/311-513-----------------------IRGLKLEIEI...E..G..R.........VV.R-------A-PV-------------
Q0G0J1_9RHIZ/903-1122-----------------------VEDFAARLSS...S..A..R.........EL.S-------L-GG-------------
Q11U15_CYTH3/815-1020-----------------------ITKLKGKIAI...R..N..G.........IL.T-------L-NE-------------
Q11YL6_CYTH3/532-755-----------------------ASKITSKIEW...N..F..P.........YL.N-------F-TN-------------
Q11YT8_CYTH3/698-925-----------------------MTNMKGAIIV...R..N..G.........IV.K-------M-DK-------------
Q134A2_RHOPS/861-1075-----------------------LQPFGGVLRH...D..G..R.........TL.T-------L-D.-------------
Q145G0_BURXL/1154-1409-----------------------VGRLEVDAHN...F..D..EDG.....VPVW.Q-------L-DK-------------
Q15ZG8_PSEA6/1002-1243-----------------------LGRVDFKLSR...A..A..N.........GM.H-------I-DS-------------
Q1MYL9_9GAMM/998-1245-----------------------YGSWSLDLDS...D..G..Q.........QI.F-------I-NN-------------
Q1RIG6_RICBR/624-851-----------------------LKNVKFYAVN...N..N..N.........LL.Q-------F-NN-------------
Q1VS98_9FLAO/575-799-----------------------LKNAKGSLAL...K..N..E.........SA.I-------L-KN-------------
Q1YH64_MOBAS/407-618-----------------------MSEIAAVVAL...D..D..G.........VA.K-------L-DI-------------
Q1YJ92_MOBAS/882-1101-----------------------FTDFSATMSG...G..A..G.........EA.A-------F-SD-------------
Q1Z1R2_PHOPR/1035-1276-----------------------LGKVSGKLRK...D..N..N.........TL.V-------L-QN-------------
Q211X0_RHOPB/871-1087-----------------------LRPVSGLLRS...D..G..G.........SL.I-------I-DK-------------
Q26HN2_FLABB/569-794-----------------------LTNVKGLALV...R..D..E.........TL.T-------L-NN-------------
Q28TM9_JANSC/371-572-----------------------LSEIDLRSTL...T..R..G.........RL.V-------F-DI-------------
Q2BKP5_9GAMM/1026-1270-----------------------MGRWSFALRP...S..E..Q.........GA.Q-------V-EN-------------
Q2C0H6_9GAMM/1034-1275-----------------------LGQVNAVLEK...S..S..N.........QL.T-------L-KT-------------
Q2KY05_BORA1/936-1183-----------------------LGELQLLGTN...TEVG..H.........RW.R-------L-DK-------------
Q2NWP0_SODGM/1012-1255-----------------------LGQISATIQP...Q..Q..D.........TL.M-------L-TG-------------
Q3BRF7_XANC5/416-658-----------------------FGAATLRSSR...L..T..D.........GM.Q-------V-DQ-------------
Q3IFH7_PSEHT/1008-1245-----------------------LGKVSASLLG...D..G..K.........RL.V-------I-SE-------------
Q3R1J6_XYLFA/553-795-----------------------LGRVGLRTRR...L..S..D.........GM.Q-------V-DQ-------------
Q47VG9_COLP3/1038-1280-----------------------LGEVDVNIKR..ID..Q..Q.........TI.E-------F-KN-------------
Q5FSF1_GLUOX/412-615-----------------------FANLKIQAAQ...I..P..N.........RI.D-------I-PV-------------
Q5R0H7_IDILO/1003-1244-----------------------LGEVELVLAP...L..E..D.........GF.S-------I-EK-------------
Q6IT20_EDWIC/723-966-----------------------LGKVAADMRV...E..G..D.........TL.Q-------L-TD-------------
Q6N438_RHOPA/862-1076-----------------------LQPLRGVVRS...D..G..R.........SL.T-------L-D.-------------
Q7MHE2_VIBVY/1031-1272-----------------------VGKVNIDLQR...Q..G..K.........AL.V-------W-KN-------------
Q7UYB4_RHOBA/752-985-----------------------AGNAHSALVA...T..A..NFQS...SKWSV.N-------F-PS-------------
Q7W992_BORPA/953-1200-----------------------LGSLQLIGTNM.ER..G..R.........LW.R-------L-DK-------------
Q8EA16_SHEON/1025-1268-----------------------FGKLVVQASP...Q..A..S.........GY.R-------I-QT-------------
Q9ZDH9_RICPR/624-849-----------------------FRNVKFYLAN...H..N..N.........LL.Q-------F-NN-------------

PF05170

C9QVM3_ECOD1/6-588AEDIILGNPPDIPEV....TMVHLPRVEATLAPLALL--T--K---------TV-W-------L-PW-------------
Q87TE2_VIBPA/1-570LQNVRSQDAQ..........LPYIEQVDVWLNPDIRR--D--G---------KW-I-------I-DS-------------
Q8DDS5_VIBVU/1-572FKNVSFAHNE..........VSYVEQLEIWLSPDLYA--N--G---------RV-Q-------I-AS-------------
ASMA_ECOLI/1-512SGRMSLTAQGASQP......LVRADNMRLDVALLPLL--S--H---------QL-S-------V-KQ-------------
Q9KNJ9_VIBCH/1-570LSGVQIASEP..........TIELQQMDLWLNPYGLL--E--Q---------QL-E-------I-DS-------------
Q8Z2I4_SALTI/1-562LENVTFGRDGQPA.......TLVAKTVDIGLSIRQL.--T--A---------PL-H-------V-DT-------------
Q9HU38_PSEAE/1-636LHDTSIASAATPTKP.....FADLQMLGLSVRVLPLL--R--K---------DV-Q-------M-SA-------------
Q9KT66_VIBCH/1-595LGKTELKNPQGFASP....NLFKVESVGIDVSVMPLL--D--K---------QL-K-------I-GN-------------
YICH_ECOLI/1-562LENVTFGRDGQPA.......TLVAKSVDIALSSRQL.--T--E---------PR-H-------V-DT-------------
Q9JY87_NEIMB/8-615LKNLTITEPGGDQT......AVSVQETKIGLSWKNLW--S--D---------QI-Q-------I-EK-------------
Q9ZDI1_RICPR/1-711LSEIKLSSINGAKVP....HLVSVEAVKASLRLFPLF--R--G---------VI-E-------V-AL-------------
Q9HUT4_PSEAE/1-577AEDITLGNPEWTAGKTKASEFASLERIEFRLAPLPLL--W--Q---------TI-R-------I-PQ-------------

PF04357

A2TNG0_9FLAO/994-1409-----------------------VQ..LEDI....KY--K--T---------LG-V-------L-NG.....KISH....
A2TNW4_9FLAO/1182-1640-----------------------SN..FTIRD...AK--E--N---------KL-T-------V-DG.....LVGT....
Q2C929_9GAMM/905-1251-----------------------MG..NIYT....PD--.--G---------QL-L-------L-RG.....TGDW....
Q2Y828_NITMU/994-1331-----------------------RH..L.ELA...KG--P--G---------TL-R-------A-SG.....VLDF....
A0KIJ1_AERHH/913-1251-----------------------DG..TMLV....GK--.--G---------PL-A-------L-GG.....WLSW....
Q3AKV0_SYNSC/1030-1473-----------------------QR..LEAEV...GR--G--G---------VL-R-------G-SG.....TLGLFS..
A7IN53_XANP2/1076-1428-----------------------SS..LTART...PN--G--G---------GL-S-------A-RG.....TVAL....
A3PNN1_RHOS1/926-1276-----------------------Q.....GRP...AA--G--G---------RL-A-------L-TG.....SIGL....
Q83EW1_COXBU/570-928-----------------------EG.Y........SQ--N--Q---------PI-Q-------I-TG.....QTRL....
A6E3M1_9RHOB/900-1246-----------------------T.....AQM...RD--G--G---------QI-R-------V-TG.....PVGL....
Q0HJ58_SHESM/1055-1401-----------------------KG..RWMM....GN--.--G---------LG-R-------V-TG.....DMRW....
Q1D0C2_MYXXD/935-1291-----------------------EH..LQGQL....N--D--G---------RV-S-------A-RG.....DVRL....
Q3IIS8_PSEHT/883-1224-----------------------KG..LLTD....PQ--G--G---------NI-K-------L-NG.....DIDW....
A5FB26_FLAJ1/992-1420-----------------------RNNQLTDT....KY--K--T---------KG-L-------L-NG.....TIEH....
A4CXF7_SYNPV/1039-1478-----------------------QS..LTGRV...GS--G--G---------QL-K-------G-SG.....SLALLS..
A0YIL4_LYNSP/1701-2096-----------------------NG..IEGELVGEAG--S--G---------NI-M-------V-QG.....VLPLIFP.
Q1MB16_RHIL3/1685-2033-----------------------SR..LSGNL...GG--G--G---------TI-S-------A-SG.....TIGI....
Q8YZJ8_NOSS1/1412-1829-----------------------QG..IQATY....N--Q--G---------LV-S-------A-SG.....NLPIFA..
A4CK93_ROBBH/998-1431-----------------------QNIRLTDR....AE--G--T---------TA-V-------L-DG.....TISH....
Q481M2_COLP3/971-1308-----------------------DA..DFYL....AD--.--K---------LA-K-------V-QG.....NMSW....
B1YUT5_BURA4/998-1353-----------------------QQ..V.EFH...GG--D--G---------TL-R-------A-IG.....RVRL....
A2C147_PROM1/886-1319-----------------------RD..LKANM...GA--N--G---------II-S-------S-QG.....GISLFD..
Q26C01_FLABB/1165-1623-----------------------NKLRIAD.....AQ--G--D---------IF-T-------V-NG.....TIGT....
A5ZK99_9BACE/1057-1469-----------------------DKFAIYT.....TS--K--N---------PF-T-------I-DG.....YVDF....
A3U6I2_CROAH/1185-1647-----------------------DNFKIAD.....EK--K--N---------TF-T-------V-DG.....DVFT....
A1VCI4_DESVV/1414-1783-----------------------QG..MGNHADPTSG--T--G---------QF-R-------A-AI.....PGPY....
Q4C5Y1_CROWT/1556-1977-----------------------DQ..LTLD....VV--K--T---------RL-D-------I-TG.....KFPLLP..
Q9JXB6_NEIMB/1050-1387-----------------------DS..L.KF....RH--E--G---------TA-E-------L-SG.....TVGM....
Q6G572_BARHE/1198-1548-----------------------EK..ALAVS...SE--G--G---------SI-S-------A-SG.....RISN....
Q1IBQ7_PSEE4/893-1224-----------------------SG..DWRS....GD--T--G---------RG-Q-------L-AG.....QMTW....
A4A832_9GAMM/725-1058-----------------------DG..SALL....GG--.--A---------PL-T-------L-AG.....NCCD....
A3PBW3_PROM0/863-1296-----------------------EN..LEAIS...ED--S--G---------KF-L-------V-KG.....FMPF....
A0LAI9_MAGSM/1120-1462-----------------------NH..FTAHD...GE--G--G---------TL-K-------M-VG.....QGAY....
Q4QMM3_HAEI8/941-1294-----------------------QG..KIET....VD--.--S---------HL-N-------L-TG.....RANW....
Q2ND20_ERYLH/1053-1400-----------------------TR..FAGTA...AN--G--G---------QV-S-------G-SG.....VVDLAN..
Q9PDZ6_XYLFA/845-1179-----------------------LA....SVR...SG--D--G---------TL-N-------I-DG.....GLSW....
A6GMC8_9BURK/963-1338-----------------------EE..LGPLI...QG--N--G---------KV-K-------A-EG.....VWNL....
Q5LV35_SILPO/1012-1360-----------------------R.....GGV...RA--G--G---------GF-T-------V-SG.....PVSL....
A4SGG7_PROVI/1036-1486-----------------------RG..LQLRD...SL--N--G---------TG-T-------L-SG.....LLKL....
A0LGH5_SYNFM/889-1254-----------------------DRAGMK......VL--G--G---------HV-E-------L-TG.....RLDY....
A5VFU9_SPHWW/1048-1392-----------------------DK..LSGQT...RG--G--G---------TI-A-------G-RA.....AFDF....
Q3A844_PELCD/965-1307-----------------------DN..L.SLQ...SG--K--G---------TL-R-------G-KG.....SLQL....
A6EEW2_9SPHI/1267-1720-----------------------DS.L..........--N--R---------KA-T-------I-GG.....GIRT....
Q28VV1_JANSC/853-1206-----------------------N...ANGNL...SS--G--G---------DL-S-------A-NG.....SINLA...
A3HZ37_9BACT/1160-1620-----------------------SQFTVKD.....AD--N--N---------TF-I-------V-DG.....SILT....
A5GSG8_SYNR3/973-1387-----------------------ER..FSARS...GE--.--G---------SI-D-------G-QG.....NLA.FR..
Q065Y1_9SYNE/1038-1479-----------------------QR..LEARV...GS--D--G---------TL-S-------G-AG.....SIGLFQ..
Q1IMU4_KORVE/977-1317-----------------------TS..FKGTL....G--G--G---------DI-T-------A-SG.....AVIY....
Q1NAC8_9SPHN/1059-1410-----------------------RD..FSGRA....G--D--G---------TV-Q-------A-TG.....DVGL....
A6L590_BACV8/1012-1461-----------------------GSLDFRNVKVYDRE--G--H---------DG-L-------V-NG.....YLHH....
A3J9P9_9ALTE/935-1267-----------------------NG..VIRA....NE--R--S---------EL-V-------L-QG.....ELDW....
A3UCX7_9RHOB/1006-1342-----------------------DS..VQIGE...GG--K--S---------GA-T-------G-QA.....EFRA....
A0M1P1_GRAFK/1180-1639-----------------------DNFNIED.....AN--D--N---------SI-V-------V-NG.....KIIT....
Q2S2D2_SALRD/1057-1516-----------------------RTLRVQD......E--E--G---------TA-T-------V-DG.....SILF....
A4BTF4_9GAMM/974-1321-----------------------SL..DARS....GG--.--G---------TL-R-------L-AG.....TANF....
F2GCG9_ALTMD/897-1246-----------------------DG..TFVL....GG--.--G---------KG-T-------L-KG.....ELDW....
A3U2G6_9RHOB/1005-1359-----------------------D...LAASV...NG--G--G---------.L-T-------L-QG.....PVTL....
Q21Y28_RHOFD/928-1291-----------------------QG..AG..G...AS--G--G---------QL-S-------I-TG.....SVLWL...
Q6MKB2_BDEBA/958-1321-----------------------NS..INGQI....A--G--G---------TL-T-------G-DG.....GIQI....
Q39RU7_GEOMG/1016-1376-----------------------ES..L.RAK...SG--A--G---------TL-T-------A-TA.....VIGL....
Q0YSH5_9CHLB/1047-1493-----------------------RD..IKIRD...NL--K--G---------TG-H-------I-NG.....VVKL....
Q21PP5_SACD2/924-1270-----------------------SN..ISIED...TR--G--G---------KV-T-------A-QG.....ALNWL...
Q7VBL9_PROMA/867-1309-----------------------QT..LTARI...GD--K--G---------VV-K-------A-NG.....GMYIFR..
A2SER1_METPP/1091-1433-----------------------TT..L.RFK...AG--E--G---------EL-R-------A-SG.....DARL....
Q0G3A4_9RHIZ/1842-2187-----------------------SA..FSASL...GQ--G--G---------TI-Q-------V-GG.....TVGL....
A8LNM1_DINSH/737-1084-----------------------S.....GRG...NR--G--G---------RI-D-------L-GG.....SLGL....
Q167D7_ROSDO/855-1205-----------------------D...VGANF...VT--G--G---------RV-E-------V-GG.....SVNL....
Q0C134_HYPNA/1036-1371-----------------------D...ATGQG...PD--G--G---------TL-K-------A-SG.....RLDE....
Q3JE49_NITOC/917-1262-----------------------TG..GVHS....GE--.--G---------EL-A-------V-NG.....QVRL....
A6FC33_9GAMM/920-1259-----------------------TG..SANS....GK--.--G---------LA-K-------I-TG.....SLVW....
Q016Y8_OSTTA/1647-2059-----------------------DD..VEAR....SG--K--G---------VL-R-------M-KG.....AMPILKPS
A3XNV5_LEEBM/1180-1639-----------------------DDFKVLD.....KN--Q--N---------SI-V-------I-NG.....SVGT....
A5FIP0_FLAJ1/1183-1626-----------------------DKFSLFD.....EN--D--N---------EL-Y-------V-NG.....NIKS....
Q0F1G3_9PROT/799-1133-----------------------DL....HLH...SG--D--G---------EL-V-------I-SG.....PLDI....
Q8KFW2_CHLTE/1034-1479-----------------------GR..LEVKD...AE--N--G---------TG-A-------V-SG.....MIGL....
Q47IW3_DECAR/842-1201-----------------------AG..L...T...QK--P--G---------RL-E-------V-TG.....EMRI....
Q2JHB3_SYNJB/1232-1612-----------------------QE..LRGQL....G--G--G---------SL-L-------A-EG.....FLPVNSR.
Q0ALB2_MARMM/1025-1362-----------------------TR..LSAND...NR--E--G---------QL-S-------G-EG.....HVEF....
A7AE74_9PORP/1075-1490-----------------------DKYNIYA.....SG--T--N---------PF-V-------V-DG.....TIDI....
Q15Z95_PSEA6/908-1250-----------------------SG..PFQL....GN--.--G---------EG-Q-------I-DG.....EFSW....
A6H009_FLAPJ/1018-1446-----------------------RNIKITDS....KY--S--T---------KG-I-------L-SG.....GIKH....
A3M6L3_ACIBT/799-1145-----------------------DG..AFNS....GQ--.--G---------VG-L-------L-KG.....SFDW....
B5E9K2_GEOBB/1121-1484-----------------------ER..L.RAR...SG--E--G---------EL-V-------G-NL.....LVQL....
Q0AB99_ALHEH/929-1273-----------------------AG..TFRA....G.--A--G---------RG-E-------L-RG.....RVLW....
Q493V0_BLOPB/931-1279-----------------------NG..TIDT....DY--G--Y---------RL-H-------L-NG....NIMNF....
Q1GSU8_SPHAL/1054-1406-----------------------AD..LTARA....G--E--G---------TI-A-------A-SG.....YVSL....
Q2LXD8_SYNAS/968-1324-----------------------DS..L.RAN...SG--P--G---------SI-D-------L-QA.....EIVL....
Q4C605_CROWT/1446-1815-----------------------DS..LQGSF....S--G--G---------EF-N-------I-NG.....SLPLL...
Q1QA38_PSYCK/1311-1664-----------------------DG..RFNS....GT--.--G---------KG-T-------V-AG.....TVNW....
Q01ZK1_SOLUE/1253-1604-----------------------QN...ISGE...SG--G--G---------KV-T-------L-SG.....AISY....
Q11I59_MESSB/1185-1538-----------------------RS..ASAAL...AA--G--G---------LL-S-------L-SG.....TIST....
Q9A7W5_CAUCR/1057-1398-----------------------SQ..AIGED...GE--G--G---------SI-S-------G-AG.....RISL....
Q5P2G0_AROAE/979-1332-----------------------AR..F...T...RE--P--G---------RL-T-------A-SG.....EIAL....
A4G804_HERAR/984-1318-----------------------SN..LG..F...QN--E--G---------SL-T-------I-SG.....PLSL....
A1ZDJ2_9BACT/1130-1588-----------------------KNFTITD.....QN--G--Q---------TN-T-------I-NG.....KIHN....
A3J5Q1_9FLAO/987-1412-----------------------RKIEVTDT....KY--K--T---------KG-V-------I-DG.....TIKH....
B8CZ01_HALOH/1096-1430-----------------------EN..ITGRY....G--R--G---------SF-R-------I-EG.....YVYP....
A1SW21_PSYIN/987-1327-----------------------KT..ITKED...IE--K--G---------KS-Y-------I-SG.....EFDW....
A3V315_9RHOB/1064-1418-----------------------D...LRSGV...EA--G--G---------SL-A-------I-SG.....SVGL....
Q11VR9_CYTH3/1167-1624-----------------------KSFNILD.....SL--N--N---------EA-I-------I-NG.....TVGI....
A7HQ23_PARL1/1042-1395-----------------------T...MSARD...SG--D--G---------RL-T-------G-EG.....TVSL....
Q7MT86_PORGI/1036-1486-----------------------TRMRFENMLVSDPD--G--H---------TA-R-------L-NA.....HISH....
A3WNV7_9GAMM/844-1182-----------------------SGEGK.......VG--D--G---------DF-T-------L-SG.....EFNL....
Q5FPE8_GLUOX/1025-1381-----------------------NH..IVAHA...GP--.--G---------TI-V-------L-EG.....TVGAF...
Q0BVY3_GRABC/1010-1362-----------------------DQ..FSAGA...GQ--.--G---------TL-S-------L-GG.....SVGIK...
A4BHU2_9GAMM/1208-1569-----------------------VQ..AQATD...GD--D--G---------QV-S-------I-DG.....DIRFVP..
Q73JH5_TREDE/1097-1467-----------------------PYTILHGKIGSLWG--E--A---------SS-E-------F-IG.....WIPY....
Q3AQ57_CHLCH/1053-1500-----------------------RN..ITLSD...NN--N--G---------KG-S-------I-RG.....FVHL....
Q5SKS5_THET8/2271-2658-----------------------EGDLRAFRV...TA--K--G---------TA-S-------L-PGLKEATPLEAVLRY
Q1NV21_9DELT/955-1283-----------------------EH..LRGRL....G--G--A---------PF-T-------V-RG.....HLRPDGD.
A1BDC7_CHLPD/1048-1494-----------------------RD..LRIAD...LQ--N--G---------TG-S-------L-NG.....LLKI....
Q2I8W0_9BACT/387-729-----------------------VS....QLQ...SG--D--G---------RL-S-------L-VG.....DLNK....
Q3SKJ4_THIDA/904-1242-----------------------QQGEL.KGA...GG--G--G---------RI-R-------V-SG.....EAQL....
P73551_SYNY3/1571-1978-----------------------EQ..LTGQ....LD--Q--S---------RI-E-------V-AG.....ILPLF...
Q7P0N2_CHRVO/933-1270-----------------------QQ..L.RFV...SG--K--G---------DV-T-------A-SG.....TLDL....
A3Z198_9SYNE/1096-1522-----------------------QE..FKARM...GS--T--G---------EL-D-------G-SG.....GLGLFR..
Q0VRK9_ALCBS/827-1164-----------------------IG..SAQM....GS--.--N---------TV-A-------L-NG.....AVD.....
Q08V51_STIAD/1146-1530-----------------------QE...LFAR...AG--A--G---------EL-K-------L-TA.....DAKATR..
Q1W0M9_9FLAO/1152-1612-----------------------SNFTVLD.....ED--G--N---------KF-T-------V-NG.....NVGL....
Q7W1D4_BORPA/859-1210-----------------------ST....NPD...AK--G--G---------YL-E-------A-TG.....QWEL....
A2U1I0_9FLAO/1154-1612-----------------------SKFTILD.....AN--R--N---------SL-V-------L-SG.....KILT....
Q6MAC5_PARUW/935-1288-----------------------KH..FSAEN...SK--H--G---------SI-T-------A-KG.....KISL....
A1HRF9_9FIRM/1091-1444-----------------------KT..FDGQM....G--G--G---------SY-R-------L-AG.....ALRL....
E0TG81_PARBH/951-1296-----------------------N...........GR--A--D---------AF-R-------L-TG.....TVDT....
Q1QWE2_CHRSD/954-1312-----------------------EG..FVAG....EE--.--G---------RL-D-------L-VG.....DADW....
A5FUW2_ACICJ/973-1319-----------------------DR..LSAKA...GV--.--G---------TI-D-------G-SG.....TFGLA...
Q2RSJ7_RHORT/1146-1500-----------------------D...LDARD...GG--K--G---------RV-S-------L-KG.....RVLL....
Q2S346_SALRD/1311-1689-----------------------EQARLRT.....PN--G--G---------SL-R-------A-DG.....TISL....
Q2INP6_ANADE/946-1304-----------------------ED..LGALL....N--G--G---------HA-R-------F-TG.....EVEL....
Q9RUC9_DEIRA/223-627-----------------------DA..RSRSTNPVTG--A--G---------TL-T-------L-SG.....ALTP....
Q1LSN0_BAUCH/634-981-----------------------QG..FIG.....TT--H--G---------QI-Y-------L-NG.....YADW....
Q02B21_SOLUE/1013-1363-----------------------QS...LTGE...TG--G--G---------KI-D-------L-SG.....FVSY....
Q1ZD28_9GAMM/976-1315-----------------------QL..AIRE....LP--S--G---------QA-Y-------F-KG.....DLNW....
A4EWK7_9RHOB/813-1161-----------------------S.....AQP...QE--G--G---------SL-Q-------I-SG.....PVSL....
A0NU08_9RHOB/1094-1448-----------------------NG..IAGDL...AT--G--G---------SM-S-------A-AG.....TVGM....
B3ELK5_CHLPB/1036-1483-----------------------RD..IQIKD...VR--G--G---------TG-R-------I-NG.....SATL....
A3ISK4_9CHRO/1570-1981-----------------------EQ..IRGN....FA--D--S---------TL-N-------I-AG.....VLPLF...
Q2IMB0_ANADE/1148-1504-----------------------RR..VAAR....RA--H--G---------SF-E-------A-HG.....ALRG....
Q8YUC2_NOSS1/1659-2048-----------------------EG..LEGKF....S--R--G---------QV-Q-------A-SG.....AIPVFD..
Q1MQI4_LAWIP/1025-1382-----------------------SHIQATASD...GK--Q--G---------SI-Q-------L-IG.....NIGS....
P73871_SYNY3/1377-1749-----------------------TN..LTGQI....S--G--G---------RL-A-------M-VG.....SLPLQN..
Q1H099_METFK/711-1055-----------------------DT..L.RFT...GG--Q--G---------TI-N-------A-SG.....NISL....
Q2SJX7_HAHCH/929-1280-----------------------SD..SSASD...GG--S--G---------KL-E-------L-LG.....HVDWSEL.
Q8DGE2_THEEB/1182-1567-----------------------DS..IQGLF....S--Q--G---------QI-T-------M-TG.....VLPIQTP.
A3VBU1_9RHOB/1020-1371-----------------------E...VGAAV...SS--G--G---------RI-E-------I-AG.....PITL....
Q7VQN5_BLOFL/933-1286-----------------------DG..VVNV....MN--G--G---------RL-Y-------L-DG....RIINF....
Q9X3V6_ZYMMB/22-376-----------------------DK..MTGKA....G--K--G---------TL-T-------A-KG.....YASF....
Q119K9_TRIEI/1940-2322-----------------------EK..IQGNI....S--D--G---------VV-E-------V-TG.....VLPIRES.
Q7NCN7_GLOVI/1184-1556-----------------------DR..LAANL....G--G--A---------PL-T-------G-EG.....ELAL....
Q31MA1_SYNE7/1177-1568-----------------------ET..LSSNF....N--G--G---------TL-T-------A-QG.....ILPIAQL.
Q1INS5_KORVE/1027-1368-----------------------ES...LTAH...TG--G--G---------DL-A-------I-SG.....FIGY....

PF05359

Q4K5X6_PSEF5/140-291---------------------------------------F------------PV-R-------I-ER-------------
Q4K5X6_PSEF5/360-511---------------------------------------W------------QV-L-------L-KD-------------
C6BEV1_RALP1/874-1022---------------------------------------A------------DL-R-------V-DA-------------
B2JQ93_BURP8/874-1021---------------------------------------V------------RL-H-------F-GQ-------------
A3JB00_9ALTE/379-531---------------------------------------F------------RW-L-------V-AG-------------
Q1BJG4_BURCA/621-773---------------------------------------W------------HY-R-------I-EA-------------
A0RMT1_CAMFF/653-798---------------------------------------F------------KL-S-------L-KN-------------
A3LK23_PSEAI/690-837---------------------------------------L------------GI-H-------I-GG-------------
Q72DG8_DESVH/963-1109---------------------------------------D------------RF-T-------L-GE-------------
A9BMN7_DELAS/883-1036---------------------------------------P------------VI-K-------I-GP-------------
A4SM57_AERS4/366-520---------------------------------------W------------RW-S-------L-KE-------------
A6WLY0_SHEB8/520-670---------------------------------------W------------FV-Q-------L-DA-------------
A7ZFK9_CAMC1/750-895---------------------------------------L------------KF-S-------V-KN-------------
Q2LUD1_SYNAS/534-687---------------------------------------W------------QY-G-------V-KK-------------
A8ZWF7_DESOH/636-783---------------------------------------T------------PI-Q-------I-GR-------------
Q3A6W6_PELCD/375-529---------------------------------------L------------PL-H-------L-KR-------------
Q5NYY7_AROAE/382-536---------------------------------------P------------VF-L-------L-DE-------------
B7X1L0_COMTE/164-316---------------------------------------V------------SF-A-------L-YN-------------
Q2KWF8_BORA1/759-906---------------------------------------P------------DM-S-------V-NS-------------
A0KYD6_SHESA/671-818---------------------------------------L------------SL-D-------I-QK-------------
Q7WMQ9_BORBR/155-309---------------------------------------P------------RF-S-------L-NN-------------
Q1I4N7_PSEE4/579-726---------------------------------------L------------GI-H-------V-GQ-------------
Q484B1_COLP3/382-534---------------------------------------W------------DL-E-------I-KA-------------
A3JB00_9ALTE/590-737---------------------------------------F------------IF-R-------I-GE-------------
A2SI01_METPP/870-1017---------------------------------------P------------QL-R-------W-RE-------------
Q8Y0Z7_RALSO/615-766---------------------------------------W------------AV-T-------V-QA-------------
Q48E84_PSE14/155-306---------------------------------------F------------PL-R-------I-DE-------------
Q5QWM2_IDILO/380-527---------------------------------------F------------GI-T-------I-EG-------------
Q0VP61_ALCBS/592-737---------------------------------------W------------QV-T-------V-DK-------------
A7GWE3_CAMC5/514-660---------------------------------------F------------KF-S-------V-KN-------------
A3QD21_SHELP/699-846---------------------------------------M------------AL-S-------I-NK-------------
A1RL15_SHESW/447-597---------------------------------------W------------LV-Q-------L-DK-------------
Q63NS2_BURPS/645-797---------------------------------------W------------RY-R-------I-DE-------------
Q47FN3_DECAR/732-879---------------------------------------V------------PI-K-------I-AK-------------
A0KK00_AERHH/368-522---------------------------------------W------------RW-S-------L-KQ-------------
Q0JZH1_CUPNH/670-829---------------------------------------W------------KA-D-------I-GK-------------
Q2LUD1_SYNAS/785-932---------------------------------------V------------PI-K-------I-NR-------------
A1ARF1_PELPD/790-937---------------------------------------H------------QI-S-------I-GA-------------
Q39RS7_GEOMG/568-719---------------------------------------F------------RY-R-------I-AS-------------
B9M3X2_GEOSF/795-942---------------------------------------P------------EI-R-------I-DT-------------
Q8Y0Z7_RALSO/185-339---------------------------------------A------------RF-V-------F-AN-------------
Q3JBN6_NITOC/584-731---------------------------------------L------------PI-A-------I-NS-------------
Q5DZ89_VIBF1/399-549---------------------------------------W------------LV-T-------L-DG-------------
Q1QTZ9_CHRSD/145-295---------------------------------------A------------PL-R-------I-DR-------------
Q0HTT4_SHESR/437-587---------------------------------------W------------LV-A-------L-GG-------------
A9BMN7_DELAS/165-317---------------------------------------V------------GF-A-------L-YN-------------
Q7WB91_BORPA/527-681---------------------------------------T------------QV-V-------A-EG-------------
A9BMN7_DELAS/379-538---------------------------------------W------------KV-S-------L-DR-------------
Q87WR1_PSESM/386-537---------------------------------------W------------QV-L-------L-RD-------------
B2JQ93_BURP8/616-770---------------------------------------W------------HY-S-------I-AE-------------
A1K6C3_AZOSB/734-881---------------------------------------F------------PL-R-------V-ER-------------
Q603H4_METCA/718-865---------------------------------------W------------LV-T-------V-EA-------------
Q47VC1_COLP3/500-655---------------------------------------V------------.F-S-------F-KE-------------
Q15PY6_PSEA6/662-809---------------------------------------M------------AI-N-------I-GE-------------
Q88DW4_PSEPK/365-516---------------------------------------W------------QV-L-------L-KD-------------
A6F3L7_9ALTE/590-737---------------------------------------F------------IF-R-------I-GQ-------------
A0KK00_AERHH/578-725---------------------------------------P------------RV-S-------I-AQ-------------
B5ECC6_GEOBB/569-721---------------------------------------F------------AY-R-------V-QR-------------
Q2LUD1_SYNAS/159-313---------------------------------------M------------RF-S-------L-NN-------------
A4VPN2_PSEU5/551-698---------------------------------------L------------AI-R-------I-GG-------------
Q3K6Q1_PSEPF/371-522---------------------------------------W------------QV-L-------L-KD-------------
A3L3D9_PSEAI/478-629---------------------------------------W------------HI-V-------L-RD-------------
Q0VP61_ALCBS/382-530---------------------------------------W------------VT-R-------L-DN-------------
A1K7K6_AZOSB/583-736---------------------------------------W------------SV-G-------V-QK-------------
Q3JBN6_NITOC/369-521---------------------------------------W------------RA-A-------I-KK-------------
Q5NYY7_AROAE/832-979---------------------------------------P------------PI-S-------I-GK-------------
Q13S79_BURXL/640-791---------------------------------------W------------HY-K-------I-GE-------------
Q47FN3_DECAR/504-656---------------------------------------W------------IG-K-------V-GK-------------
A7GWE3_CAMC5/719-864---------------------------------------F------------DF-A-------V-KD-------------
B1KJ13_SHEWM/617-764---------------------------------------L------------KI-L-------I-GK-------------
A5W979_PSEP1/140-291---------------------------------------F------------PL-R-------I-GS-------------
Q316X0_DESDG/862-1008---------------------------------------S------------DV-R-------L-GG-------------
Q1NN12_9DELT/591-738---------------------------------------M------------AI-T-------V-DH-------------
Q602F3_METCA/416-565---------------------------------------W------------AF-S-------L-GE-------------
Q2Y5K5_NITMU/673-818---------------------------------------L------------PI-S-------I-GR-------------
B3E4B8_GEOLS/816-963---------------------------------------G------------QI-K-------I-DT-------------
A4VPN2_PSEU5/341-492---------------------------------------W------------QV-L-------L-HD-------------
Q5NYY7_AROAE/153-307---------------------------------------A------------RF-S-------L-NN-------------
Q30NX8_SULDN/563-715---------------------------------------Y------------NV-K-------L-DS-------------
C1DFK3_AZOVD/367-518---------------------------------------W------------QI-V-------L-AD-------------
Q484B1_COLP3/604-751---------------------------------------F------------TA-D-------I-NE-------------
Q5NYY7_AROAE/604-757---------------------------------------W------------SF-A-------L-ER-------------
Q602F3_METCA/623-770---------------------------------------F------------AV-T-------V-GS-------------
Q316X0_DESDG/389-538---------------------------------------F------------SI-Q-------L-DA-------------
A5G9K9_GEOUR/137-293---------------------------------------P------------RF-S-------L-NN-------------
B2JHK1_BURP8/152-309---------------------------------------A------------EK-L-------I-DH-------------
B1KJ13_SHEWM/407-556---------------------------------------W------------SA-I-------I-DK-------------
A5G9K9_GEOUR/551-702---------------------------------------L------------SY-R-------I-GR-------------
A1K6C3_AZOSB/165-302---------------------------------------A------------DV-L-------I-RH-------------
A0KK00_AERHH/151-307---------------------------------------L------------LV-Q-------I-NQ-------------
Q1H1L3_METFK/780-927---------------------------------------F------------PV-A-------I-ER-------------
B9M7L7_GEOSF/383-534---------------------------------------L------------RY-G-------I-GR-------------
Q0F0H3_9PROT/538-688---------------------------------------S------------QL-L-------V-DE-------------
A4SXW3_POLSQ/414-561---------------------------------------F------------GL-D-------I-KT-------------
A6FDI0_9GAMM/443-592---------------------------------------W------------VV-N-------L-GE-------------
B9M3X2_GEOSF/564-715---------------------------------------F------------HY-T-------V-SS-------------
A4G9D7_HERAR/154-308---------------------------------------A------------RF-S-------V-FN-------------
Q21F55_SACD2/584-731---------------------------------------M------------AL-T-------I-GK-------------
Q7NY28_CHRVO/704-851---------------------------------------P------------QV-D-------V-HS-------------
Q0JZH1_CUPNH/164-317---------------------------------------A------------RF-S-------V-NN-------------
Q3K6Q1_PSEPF/144-295---------------------------------------F------------PL-R-------I-DR-------------
A1TWZ4_MARAV/597-744---------------------------------------F------------IF-R-------I-GE-------------
A4JK45_BURVG/159-312---------------------------------------T------------LF-S-------V-SN-------------
B3E4B8_GEOLS/367-514---------------------------------------L------------QL-M-------V-EN-------------
Q2IFA1_ANADE/563-710---------------------------------------W------------RT-A-------I-GS-------------
A4SM57_AERS4/151-307---------------------------------------P------------LV-Q-------I-AK-------------
Q1QTZ9_CHRSD/348-494---------------------------------------M------------HV-A-------I-GT-------------
Q11NN1_CYTH3/142-298---------------------------------------L------------PI-E-------I-NR-------------
Q9HV64_PSEAE/140-291---------------------------------------F------------PL-R-------I-DR-------------
Q3SGZ4_THIDA/733-880---------------------------------------F------------PL-S-------V-GR-------------
Q3A6W6_PELCD/162-316---------------------------------------F------------GV-M-------L-TD-------------
A4A3Z9_9GAMM/583-730---------------------------------------W------------RV-Q-------L-AN-------------
Q316X0_DESDG/600-751---------------------------------------W------------SF-T-------V-QK-------------
A8H2Y8_SHEPA/433-583---------------------------------------W------------TA-V-------L-KA-------------
A6T355_JANMA/478-631---------------------------------------Y------------TV-D-------I-NK-------------
A1TWZ4_MARAV/166-321---------------------------------------P------------RL-Y-------F-QQ-------------
A6DTM8_9BACT/927-1074---------------------------------------P------------HI-E-------I-KK-------------
B9M7L7_GEOSF/592-739---------------------------------------G------------MI-R-------I-GT-------------
Q222N5_RHOFD/496-646---------------------------------------W------------VA-V-------A-KT-------------
A6T355_JANMA/155-309---------------------------------------A------------RF-S-------A-FN-------------
Q1K3A0_DESAC/497-651---------------------------------------L------------AV-V-------V-GA-------------
Q3A6W6_PELCD/805-951---------------------------------------V------------TL-G-------I-GG-------------
A5G9K9_GEOUR/769-916---------------------------------------R------------LV-R-------I-DT-------------
A2SI01_METPP/623-775---------------------------------------W------------Q.-.-------V-GE-------------
Q2T396_BURTA/231-384---------------------------------------V------------RF-S-------V-SN-------------
Q46V48_CUPPJ/649-808---------------------------------------W------------KV-R-------L-GK-------------
Q083W9_SHEFN/492-642---------------------------------------W------------LV-T-------L-DK-------------
A8FUB9_SHESH/389-538---------------------------------------W------------SA-T-------L-GG-------------
Q083W9_SHEFN/725-872---------------------------------------M------------KL-N-------I-NK-------------
Q12MK5_SHEDO/654-801---------------------------------------L------------SF-E-------I-ER-------------
Q3SGZ4_THIDA/517-669---------------------------------------M------------AL-H-------L-GR-------------
A1ARF1_PELPD/573-725---------------------------------------F------------SY-R-------L-RR-------------
Q39RS7_GEOMG/801-948---------------------------------------R------------QI-A-------I-DT-------------
Q603H4_METCA/502-653---------------------------------------W------------RY-A-------V-QQ-------------
Q222N5_RHOFD/149-300---------------------------------------P------------RV-I-------V-EQ-------------
A8ZWF7_DESOH/412-569---------------------------------------F------------VV-D-------V-DR-------------
A4XYD1_PSEMY/354-505---------------------------------------W------------QV-L-------L-QD-------------
Q484B1_COLP3/152-304---------------------------------------W------------IL-S-------I-DK-------------
Q21F55_SACD2/154-306---------------------------------------P------------RI-R-------I-SD-------------
Q3SGZ4_THIDA/147-307---------------------------------------V------------RL-L-------V-DH-------------
A7I315_CAMHC/662-807---------------------------------------F------------DF-T-------L-KN-------------
Q74FC9_GEOSL/787-934---------------------------------------R------------AI-T-------I-GA-------------
A7H8M2_ANADF/367-518---------------------------------------W------------RW-S-------V-GA-------------
F2GAL8_ALTMD/716-863---------------------------------------L------------AI-A-------V-GG-------------
Q5DZ89_VIBF1/610-757---------------------------------------F------------AL-S-------V-RK-------------
A4XYD1_PSEMY/562-709---------------------------------------L------------AI-R-------I-GG-------------
B3E4B8_GEOLS/583-736---------------------------------------L------------SW-Q-------V-KK-------------
A6GL92_9BURK/612-759---------------------------------------F------------AV-N-------I-DR-------------
Q2BL34_9GAMM/505-657---------------------------------------F------------RV-S-------I-GS-------------
C1DFK3_AZOVD/141-292---------------------------------------F------------PV-H-------L-DR-------------
Q1LGA7_RALME/681-840---------------------------------------W------------KV-R-------V-GK-------------
Q1JXN5_DESAC/795-942---------------------------------------A------------DI-R-------I-DA-------------
B5ECC6_GEOBB/807-954---------------------------------------R------------QV-S-------V-GS-------------
Q2IFA1_ANADE/358-509---------------------------------------W------------RW-S-------V-GA-------------
A4XYD1_PSEMY/140-291---------------------------------------F------------PL-R-------I-DN-------------
A7H8M2_ANADF/165-318---------------------------------------P------------RV-S-------I-GR-------------
A3QD21_SHELP/453-602---------------------------------------W------------HA-K-------L-EK-------------
Q3A6W6_PELCD/588-738---------------------------------------W------------QT-Q-------L-AE-------------
A7H8M2_ANADF/579-726---------------------------------------W------------RT-A-------I-GA-------------
A8ETY5_ARCB4/612-759---------------------------------------T------------KL-N-------I-GP-------------
Q30NX8_SULDN/772-919---------------------------------------L------------SY-K-------L-LN-------------
A6FDI0_9GAMM/664-811---------------------------------------M------------LI-E-------I-NK-------------
A6DTM8_9BACT/382-537---------------------------------------I------------NF-V-------I-K.-------------
A4VPN2_PSEU5/125-276---------------------------------------F------------PL-R-------I-DQ-------------
Q1LGA7_RALME/173-326---------------------------------------A------------RF-S-------V-SN-------------
Q1H1L3_METFK/561-712---------------------------------------W------------AF-D-------L-KR-------------
Q222N5_RHOFD/710-857---------------------------------------F------------PV-R-------I-RR-------------
C1DFK3_AZOVD/584-731---------------------------------------L------------GI-R-------I-GA-------------

PF13116

A3ZDT1_CAMJU/201-486-----------------------IRNITEIFKRVNKR..IELPQSLNLWVAYRA-K.......G.EF-------------
A4THD4_YERPP/510-796-----------------------LYDATDAWR.YFPV..SLMGEKLADYLTEAL-Q.......G.GQ-------------
A1RP07_SHESW/505-792-----------------------VKNSANADK.YFPV..KAMGESLAKYLDDAI-K.......A.GH-------------
B5F9M1_VIBFM/506-792-----------------------AFNADQTWR.YLPT..LALGQDLTDYLSAAV-Q.......G.GN-------------
B5REW7_SALG2/474-759-----------------------TDDGSQAWR.YFPE..NLMGKALVDYLSGAI-Q.......G.GE-------------
C4X0M1_KLEPN/504-789-----------------------TNDGGQAWR.YFPE..NLMGKALVDYLSGAI-K.......A.GQ-------------
C6XK02_HIRBI/457-744-----------------------KASPQQIIS.YWP...VKLGSGARDWAKRNI-K.......D.GR-------------
C6DIL6_PECCP/503-788-----------------------LTDAADAWR.YYPE..QFMGTELVDYLSGAL-K.......G.GR-------------
D2YHX2_VIBMI/503-791-----------------------LVNAGETWR.YLPR..LALGQELTDYLSTAI-Q.......A.GQ-------------
Q7NW94_CHRVO/514-796-----------------------QIKAARVAA.YLP...RHVGEHTSSWLRQGL-Q.......D.GI-------------
Q7N037_PHOLL/501-786-----------------------VYDAGDAWR.YFPE..PLMGTPLTDYLTASI-I.......K.GQ-------------
A7ZDM6_CAMC1/160-458-----------------------ARSIKDFIDELDRR..IELNSEVKSWIYGYV-V.......A.ND-------------
A4XQL3_PSEMY/513-798-----------------------DGDAAYTEK.YLPSRSPGMSAELDKWLKTAI-R.......S.GR-------------
Q3J7T7_NITOC/517-810-----------------------KIDLAALPQ.YLPS..PAMKPGLVRWLKQAF-P.......Q.GG-------------
C3XNN9_9HELI/210-498-----------------------FSDIKFLKS.LIPE...ISNKLVEAWIFDNY-S.......V.EN-------------
Q0HZG8_SHESR/505-792-----------------------VKNAANADR.YFPV..KAMGEALVEYLDGAI-K.......A.GQ-------------
D5CU11_SIDLE/524-805-----------------------RVAVQRTGR.YTPL..PAVNKATHDWLQAAL-Q.......G.GQ-------------
A3YBT0_9GAMM/494-783-----------------------NLGVLDGVG.YIPG..RALPQSAHDWLDGAL-L.......S.GL-------------
B2PXM1_PROST/492-780-----------------------IDNAGEAWR.YFPQ..QLMGESLADYLSNAI-I.......A.GQ-------------
C3X5K0_OXAFO/598-890-----------------------NLDIADVKK.YIP...LQTPETLHQWLFGAL-K.......G.GR-------------
A1AVR0_RUTMC/242-525-----------------------RMNVINISD.YLPM..VLIGDINHQWIKHAF-Q.......S.GE-------------
D1RKZ9_LEGLO/542-830-----------------------GKNWQQWVA.FLPK..EYLKPKLYLWLKNDL-K.......R.IA-------------
B6XFK3_9ENTR/506-794-----------------------TDNAGEAWR.YFPQ..KLMGQALADYLTKAI-I.......A.GH-------------
B9D263_WOLRE/198-487-----------------------ATSLRGFMDELGAK..TGLDKEIKSWIYGYI-T.......A.DN-------------
Q31FH6_THICR/496-774-----------------------PDKLSFVKQ.YLPY..GLMSSKLENWLKAAL-V.......K.GD-------------
A6D042_9VIBR/509-797-----------------------LYNAGEVWR.YLPT..LAMGQSLTDYLSAAI-Q.......A.GR-------------
Q48EA0_PSE14/513-795-----------------------DGDGRYTSK.YLPT...ALSPELDHWLRTAV-V.......S.GA-------------
Q2NWP0_SODGM/504-789-----------------------LDNAADAWR.YFPE..PLMGTRLVDYMTGAL-K.......G.GQ-------------
B8GV04_THISH/540-825-----------------------DGDGSRTAA.YLPV..GIMPQNTSRWLRESI-K.......A.GR-------------
A9KBH4_COXBN/479-764-----------------------LKNINAIKN.YLPS..RGLSPHLRAWLNQAF-S.......T.GE-------------
A8H923_SHEPA/510-797-----------------------IHDVAKAHL.YFPL..KGMSKDLVTYLTGAL-K.......A.GK-------------
B3CN56_WOLPP/322-604-----------------------KLVAKDLCT.YVPD..GLVNNEFRKWYCNNI-D.......G..N-------------
B0KQG7_PSEPG/513-795-----------------------EGDGRYTAK.YLPE...VLSPALDEWLRSAI-V.......K.GA-------------
A0RPG5_CAMFF/10-294-----------------------ANSIEKFIDNLAEK..TDLHTEIKNWIYGYI-I.......A.KE-------------
D2C1Z1_DICD5/509-794-----------------------LGDAADAWR.YYPE..YFMGKNLVDYLTGAI-K.......S.GQ-------------
D4GCB7_PANAM/504-789-----------------------VTDAGDAWR.YFPT..PLMGHSLTRYLSGAV-K.......G.GR-------------
Q07WQ4_SHEFN/504-791-----------------------INDVSHLGR.YFPL..MAMSPNLTTYLNDGL-V.......A.GQ-------------
Q5ZUN8_LEGPH/507-795-----------------------GKNLQKWMP.YLPK..KHMKAKLFAWLNNDI-K.......R.LG-------------
Q7VFV2_HELHP/222-511-----------------------LYNLESIKP.YILK...LNNPTLNNWLFKNV-H.......Y.DV-------------
D2TDE3_ERWP6/503-788-----------------------LTNAGDAWR.YFPE..PLMGKSLTDYLSGAI-K.......G.GE-------------
A8T949_9VIBR/505-792-----------------------LYNAGETWR.YLPT..LALGQDLTDYLSTAI-Q.......G.GK-------------
C0F958_9RICK/390-675-----------------------KFAAKDLCT.YIPD..SVVNSKFKSWYCDNI-E.......G..D-------------
C8PGF2_9PROT/201-488-----------------------ALSLKNFMNELGAL..TGLNPLANEWIYGKA-V.......A.QN-------------
Q12IX1_SHEDO/530-817-----------------------VKQAQHLGD.YFPL..AAMSPELVEYLNGAI-I.......K.GQ-------------
Q15ZG8_PSEA6/490-776-----------------------GLDVAQVNQ.LLPG..VVMGKDTKAYLQRAL-K.......A.GY-------------
C9P9S4_VIBFU/504-791-----------------------AYNAGETWR.YLPT..LALGHDLTDYLSTAI-Q.......G.GK-------------
A6Q385_NITSB/202-483-----------------------NRQLQNLFV.QIPI.....NEEIKSWSCKKI-R.......A.KK-------------
A8GK60_SERP5/523-808-----------------------LYDAADAWR.YFPE..PLMGKHLVDYLSGAI-Q.......G.GQ-------------
B8K935_VIBPA/486-773-----------------------LYNAGETWR.YLPT..LALGQDLTDYLSTAI-Q.......A.GK-------------
Q3IFH7_PSEHT/493-781-----------------------APDASIAGH.YFPL..KAMSPELVSYLNGAI-K.......G.GE-------------
A8PNA6_9COXI/430-712-----------------------LNDSGALSH.YLPQ..TQLGPELIHWLSTAI-N.......K.G.-------------
A7GYI8_CAMC5/195-484-----------------------ADSLKNFIAALDEK..FDLSDDVKNWIYGYI-I.......A.QE-------------
D9SHW3_GALCS/523-805-----------------------HGEIGHAAR.YIPL..VALDKKDSDWLNDAL-L.......S.GK-------------
C7R9G7_KANKD/505-791-----------------------DLKIAELHK.YWPR..QGMKKKAVDYLDMSL-K.......G.GV-------------
A4SSL2_AERS4/495-781-----------------------VKNAGNADR.YYPL..QVMDKSLVDYLSGAI-K.......G.GQ-------------
Q21FT5_SACD2/542-827-----------------------ASNASSHRR.YVP...KVVPQALYRWLDKSI-Q.......G.GD-------------
B9KGG1_CAMLR/206-490-----------------------SNNISKIFD.VLVENGVHLPSDLPLWVGGKV-K.......A.DF-------------
A3UZ19_VIBSP/503-790-----------------------AYNVGETWR.YLPT..LALGQDLTDYLSTAI-Q.......A.GK-------------
B6INC8_RHOCS/363-622-----------------------KLTAEDLAR.YWP...PSLKPKARSWMVENL-T.......R.GS-------------
C0AZI2_9ENTR/255-539-----------------------VTNAGDAWR.YLPE..EYVGKALTQYLSDAI-I.......A.GN-------------
A7MJB2_CROS8/518-803-----------------------TSDAAQAWR.YFPE..NLMGKDLVDYLSGAI-Q.......G.GQ-------------
C9QN32_VIBOR/503-790-----------------------LYNAGETWR.YLPT..LALGRDLTDYLSTAI-Q.......G.GR-------------
C2LNU1_PROMI/500-784-----------------------VTDAGETWR.YLPE..KYVGKDLTQYLSDAI-I.......A.GN-------------
A6SW78_JANMA/540-840-----------------------GLELNKIGN.YLP...TAMNADFRTWLSHAL-I.......A.GT-------------
C6XD69_METSD/519-799-----------------------QADAQYARF.YYP...KILGEHTLAWLDSAI-L.......K.GR-------------
A7I2E8_CAMHC/213-497-----------------------AKSIKNFMDEIALK..TDMSRTTKNWIYGNI-I.......A.DN-------------
Q6LMA6_PHOPR/509-794-----------------------ISNAGEAWR.YLPT..LALGHDLTDYLSAAI-R.......G.GK-------------
D0L1I5_HALNC/561-853-----------------------DIHVARVPA.YLPR..NLLGKNVLHWLDTNL-ELPEQGGGQPGR-------------
A3Q9Y2_SHELP/509-796-----------------------VKNAARAKY.YFPK..HAMSESLVDYLSGAI-K.......A.GQ-------------
A6QAC9_SULNB/206-494-----------------------FGDLKTFID....R..LPMNEKVNAWITRKI-E.......A.KS-------------
A8EUE5_ARCB4/193-478-----------------------FENLKFLKEH......LDLPQEANEWMYNNV-T.........GD-------------
A8FQQ2_SHESH/504-791-----------------------INDVVDVGN.YFPL..HGMDAGLVDYLEAGL-V.......A.GN-------------
C5ZX33_9HELI/208-498-----------------------FKNINFLLP.LLPP...FKNQLLKEWIFNNY-Q.......I.TS-------------
D0I525_VIBHO/503-790-----------------------LNNAGETWR.YLPT..LALGETLTDYLSAAI-R.......G.GQ-------------
Q1H0H5_METFK/520-800-----------------------RVDGQYARF.YYP...VMLGEHTLSWLDNAI-L.......A.GK-------------
A9D952_9GAMM/504-796-----------------------VNDVVEVGN.YLPL..DGMSQGLIDYLKVGL-V.......A.GR-------------
C0N416_9GAMM/506-794-----------------------DVIVNRWKK.YVPQ..KVLPDDFKRWANEAF-K.......D.GV-------------
Q7MRT1_WOLSU/187-475-----------------------FDSLRFLKD.VVEI....ENPNIRAWLYDNI-H.......S.PG-------------
Q2C0H6_9GAMM/506-792-----------------------VKDAGQAWR.YLPR..PALGNKLTHYLATAI-K.......G.GT-------------
B1KJH7_SHEWM/508-795-----------------------LHDVSRASN.YFPL..HGMSEDLVEYLDTGL-V.......A.GN-------------
Q47VG9_COLP3/504-793-----------------------NGNAGLVGR.YLPL..PIMSENLVNYLNAAV-V.......S.GR-------------
A4G3G0_HERAR/587-887-----------------------GLELNKIGN.YLP...LGMNAQFRTWLSDAL-I.......A.GT-------------
D1B1Z5_SULD5/203-493-----------------------NVELSNFMDFLAPK..VELEQIVKDWIHTNI-V.......G.KN-------------
D3V5J7_XENBS/502-797-----------------------VDDAGEAWR.YFPR..SLMGASLADYLTHSL-I.......K.GK-------------
A6GR98_9BURK/554-836-----------------------MANLGRVAN.YLP...LVVGASAREWLTENL-K.......A.GM-------------
D4E146_SEROD/303-588-----------------------LYDGADAWR.YFPE..PLMGTHLVNYLSGAI-Q.......G.GQ-------------
A4C806_9GAMM/497-784-----------------------GPPALSARQ.YYPR..GYLPQATIDYLNGAI-K.......G.GE-------------
E6WGF8_PANSA/504-789-----------------------VTDAGDAWR.YFPE..PLMGHGLTHYLSDAI-K.......G.GK-------------
Q4HS43_CAMUP/200-483-----------------------LKNINLLSKHIKKQ..TQLPKELELWLFERA-K.......A.EF-------------
Q8DCG6_VIBVU/507-794-----------------------AYNVGETWR.YLPT..LALGRELTDYLSTAI-Q.......G.GK-------------
C5F1J2_9HELI/186-475-----------------------FENINFLRP.LLPP...FHNKILESWIFDNY-T.......L.SS-------------
C9P2T1_VIBME/504-791-----------------------LYNAGETWR.YLPT..RALGQSLTDYLSTSI-Q.......G.GN-------------
Q5GSY1_WOLTR/325-607-----------------------KFAAKDLCT.YVPD..YIINSEFKSWYCDNI-D.......G..N-------------
F2G3T4_ALTMD/500-787-----------------------PIALNTVSD.LFPA..GVMGANTDKYLTRAF-T.......GKGD-------------
D1KAX2_9GAMM/256-540-----------------------QVEIDSIGE.YLPP..KLLSSATYAWLNRAF-V.......S.GK-------------
A0Y2B2_9GAMM/494-782-----------------------AEDASIAGH.YFPL..KAMSPELVSYLNGAI-K.......G.GE-------------
A3WPW6_9GAMM/495-781-----------------------PFAVDSLKT.ALP...DVMGEGLKRYLSGAL-A.......E.GA-------------
Q4HHM4_CAMCO/202-487-----------------------IRDITTIFNQAKKR..IALPEPLVLWVAHRA-K.......G.DF-------------
A5CXF5_VESOH/244-528-----------------------RMNVVKISD.YLPV..VLIGSATYQWIKQAF-Q.......S.GT-------------
Q0AGL5_NITEC/528-819-----------------------QADIPLLGQ.YIA...WVTDETVVNEINKAI-I.......S.GQ-------------
D3VKA4_XENNA/501-791-----------------------LDDSGEAWR.YFPK..PLMGESLTNYLTTSL-I.......K.GK-------------
C6C4M2_DICDC/503-788-----------------------LQDAADAWR.YYPE..PFMGKALVDYLSTAL-K.......S.GY-------------
C3XBS4_OXAFO/577-871-----------------------NLDIDKVKH.YIP...LQTPKTLKEWLSGGL-K.......G.GK-------------
Q0ABM3_ALHEH/531-818-----------------------DGDASRTAR.YLPL..RHLPPAAREWVAAAV-I.......G.GE-------------

PF13109

A0RPG5_CAMFF/433-647------------------------QK-NS..VKI-E.-.G--D--GL------------------------DAS---F--
A1VYN9_CAMJJ/621-835------------------------YY-SSNDLNL-N.-.V--S--NI------------------------DDN---Y--
A6DEH3_9PROT/738-953------------------------KQ-GY..FLL-E.-.G--K--NY------------------------EKE---E--
A6Q385_NITSB/623-836------------------------QN-NN..VNI-S.-.M--K--NM------------------------HDE---V--
A6QAC9_SULNB/640-854------------------------TG-AK..IAI-E.-.A--L--RI------------------------HDR---M--
A7GYI8_CAMC5/627-841------------------------DK-KS..LNL-D.-.A--T--DI------------------------SGE---F--
B2UTP1_HELPS/745-958------------------------VH-GA..LYL-K.-.A--H--NF------------------------SGD---Y--
B6BK75_9PROT/827-1037------------------------KD-GK..FYL-Y.-.G--D--DF------------------------NDE---F--
B9D263_WOLRE/627-841------------------------SD-KK..FEM-S.-.A--N--DI------------------------RGE---F--
B9KGG1_CAMLR/634-848------------------------KE-NQ..MQI-R.-.A--L--KM------------------------DDD---F--
B9L5J2_NAUPA/583-798------------------------KQ-GY..LLL-E.-.G--K--NF------------------------SNE---E--
C3XGB2_9HELI/333-551------------------------IK-DN..VYV-K.-.A--K--NF------------------------SGD---F--
C3XNN9_9HELI/639-853------------------------NE-NF..ITL-D.-.A--R--EF------------------------GDT---F--
C5F1J2_9HELI/616-830------------------------KG-DS..ITI-D.-.A--K--EF------------------------GDL---F--
C5ZX33_9HELI/638-852------------------------KG-DY..ITL-D.-.A--K--EF------------------------GDT---F--
D3UGW6_HELM1/730-943------------------------LD-GS..IYI-K.-.A--S--NF------------------------SAD---F--
Q30RQ8_SULDN/697-907------------------------KN-ND..FHL-H.-.G--E--KF------------------------NDE---F--
Q4HHM4_CAMCO/634-848------------------------HY-SP..NDL-KL-FI--K--NI------------------------NDE---H--
Q4HS43_CAMUP/629-843------------------------SP-ER..LSL-I.-.A--N--DM------------------------SDE---F--
Q7MRT1_WOLSU/616-829------------------------QN-KR..LKI-E.-.A--R--HF------------------------NDE---F--
Q7VFV2_HELHP/731-944------------------------AY-SR..AVL-R.-.L--S--NF------------------------SDK---F--

PF13502

A0KFB2_AERHH/999-1241------------------------LE.MR--..L-A---G--S--QL..-----NG...------------SAE...W..
A0YA02_9GAMM/903-1114------------------------LV.AT--..T-M---L--G--NI..-----DS...------------SLS...Y..
A1S2S6_SHEAM/1130-1371------------------------LS.LS--..S-G---A--A--TL..-----KG...------------QGG...W..
A1STZ9_PSYIN/1024-1262------------------------IK.IG--..N-E---K--E--FT..-----EI...------------SGV...W..
A1TW53_ACIAC/1117-1369------------------------LN.LT--..V-P---E--A--TF..-----TS...------------SGN...W..
A1U479_MARAV/979-1225------------------------VE.GR--..L-G---S--L--VL..-----SG...------------DMT...W..
A1WCZ7_ACISJ/1139-1390------------------------FN.LT--..A-P---E--A--VL..-----TS...------------QGH...W..
A1WSB5_VEREI/1101-1362------------------------FN.LL--..T-P---E--A--SL..-----SA...------------QGNWARL..
A1WYY8_HALHL/891-1129------------------------AS.IR--..G-P---T--L--HL..-----VT...------------SGE...W..
A1ZG80_9BACT/721-947------------------------LK.FN--..M-L---E--G--GF..-----TM...------------SGA...Y..
A2TRX7_9FLAO/566-791------------------------LN.SG--..I-F---G--G--AA..-----GL...------------SGS...V..
A2U2U5_9FLAO/567-793------------------------LN.SD--..V-F---G--G--KI..-----GF...------------NGN...V..
A3HUH0_9BACT/675-900------------------------AS.MS--..T-M---G--G--RI..-----AL...------------TGS...Y..
A3I060_9BACT/816-1020------------------------TD.LE--..L-V---G--A--NI..-----SM...------------KGN...Y..
A3J4A5_9FLAO/560-786------------------------LK.MG--..I-F---G--G--SI..-----GL...------------TGT...V..
A3J4S5_9FLAO/687-891------------------------SS.LG--..I-I---G--A--TA..-----KM...------------EAM...Y..
A3JK78_9ALTE/987-1233------------------------IE.GK--..L-E---S--L--AL..-----AG...------------EFN...W..
A3Q9Y2_SHELP/1046-1289------------------------IA.IT--..T-P---G--I--TL..-----KG...------------KGA...W..
E0TB83_PARBH/837-1047------------------------AD.GR--..L-G---E--G--TF..-----AS...------------RLA...P..
A3WPW6_9GAMM/1014-1255------------------------LK.MT--..T-E---T--E--QL..-----EA...------------SGF...W..
A3XKT3_LEEBM/574-799------------------------IS.SD--..I-F---G--G--AI..-----GL...------------NGN...V..
A3YBT0_9GAMM/1003-1247------------------------FS.TE--..L-E---N--G--DF..-----YG...------------SIF...W..
A4AMF6_MARSH/560-785------------------------VT.SS--..L-F---N--G--NV..-----SF...------------DGE...V..
A4BQN1_9GAMM/991-1233------------------------MN.LT--..G-P---V--L--KI..-----KA...------------AGR...W..
A4C0T1_9FLAO/568-794------------------------IT.SA--..V-F---G--G--NI..-----DF...------------DGV...V..
A4C806_9GAMM/1004-1241------------------------LI.ID--..K-G---K--H--NL..-----VA...------------KGA...W..
A4CG41_ROBBH/574-799------------------------VR.SD--..A-L---D--G--KL..-----AL...------------NGT...V..
A4VIB7_PSEU5/1014-1255------------------------LA.LQ--..L-K---G--L--RI..-----SG...------------NGG...W..
A5CF63_ORITB/620-836------------------------IN.CR--..I-D---N--G--EF..-----QA...------------KGS...I..
A5EPF4_BRASB/898-1114------------------------LK.GK--..L-G---G--G--DV..-----TA...------------TVE...A..
A5FBT6_FLAJ1/701-905------------------------TS.LN--..I-I---D--C--IL..-----GV...------------NAA...Y..
A5FJ68_FLAJ1/564-791------------------------FK.TS--..I-F---G--G--TI..-----GL...------------TGA...V..
A5FJN3_FLAJ1/697-901------------------------TG.FN--..L-I---G--C--NV..-----AM...------------NAN...Y..
A5FUN1_ACICJ/745-973------------------------NR.AE--..V-V---G--G--RL..-----SG...------------RAI...L..
A5ICR0_LEGPC/1014-1262------------------------CR.ID--..S-P---Y--Y--QA..-----NF...------------EGE...W..
A6C314_9PLAN/969-1200------------------------LD.LQ--..V-S---G--G--RL..-----RIA.P------------IVR...L..
A6CFZ4_9PLAN/844-1050------------------------IS.AK--..A-I---R--G--VL..-----TC...------------MGD...I..
A6EDA1_9SPHI/197-401------------------------TG.FK--..L-I---G--A--PV..-----TM...------------DAT...Y..
A6F4Z2_9ALTE/986-1232------------------------IV.GT--..L-K---S--L--TL..-----TG...------------ELT...W..
A6FEV3_9GAMM/980-1223------------------------LD.ID--..M-E---H--S--TV..-----AM...------------TGR...WFT
A6GWN8_FLAPJ/560-787------------------------IK.TN--..I-F---D--G--QI..-----GL...------------SGL...V..
A6SW78_JANMA/1081-1328------------------------LS.LS--..N-P---D--A--SL..-----KA...------------SGS...W..
A6U693_SINMW/393-597------------------------GD.ST--..Y-A---N--G--RL..-----SG...------------RAV...L..
A6UB33_SINMW/880-1101------------------------AT.GD--..W-L---G--G--KL..-----EG...------------RMH...F..
A7AAH7_9PORP/866-1069------------------------LN.IQ--..S-N---M--G--NG..-----NL...------------TMV...Y..
A7HEC2_ANADF/581-801------------------------AR.LE--..A-F---G--G--AV..-----SA...------------AGTH.LA..
A7HWU4_PARL1/297-497------------------------LT.AE--..Y-R---G--S--PV..-----KL...------------AIN...A..
A8EI17_BURPE/1120-1377------------------------LE.LA--..N-P---A--A--KL..-----TA...------------TAN...W..
A8GRQ7_RICRS/625-850------------------------IE.AE--..L-L---G--G--KL..-----QG...------------NGN...I..
A8PNA6_9COXI/753-1000------------------------LN.AG--..D-E---N--Y--HL..-----IA...------------SGA...W..
A8UEF9_9FLAO/566-791------------------------MT.TD--..L-F---N--G--QL..-----GI...------------SGN...V..
A9CIC7_AGRT5/884-1105------------------------VA.GT--..F-M---G--G--KL..-----AG...------------RLA...M..
A9DPS2_9FLAO/819-1056------------------------LQ.MN--..A-A---G--G--NI..-----RL...------------SGY...F..
A9H3V6_GLUDA/474-684------------------------MR.FA--..M-A---G--P--SP..-----ASAIL------------TPE...S..
A9VZI8_METEP/849-1067------------------------LS.AG--..L-A---G--G--RL..-----GG...------------SIT...L..
B0NQ23_BACSE/741-944------------------------LS.MK--..G-M---G--S--DM..-----NT...------------TLV...Y..
B1KJH7_SHEWM/1029-1272------------------------LS.LT--..T-P---E--V--TL..-----SG...------------SGA...W..
B1XRV0_POLNS/1079-1327------------------------VQ.FS--..N-P---Q--G--SS..-----TT...------------TGR...W..
B1XVC5_POLNS/28-239------------------------LS.FN--..V-G---K--G--GA..-----LA...------------QIS...I..
B2FP42_STRMK/1008-1250------------------------LR.FR--..A-P---D--Q--EI..-----DI...------------SGR...W..
B2PXM1_PROST/1000-1242------------------------GT.LS--..N-S---A--T--QL..-----KL...------------DAL...W..
B3JDW0_9BACE/854-1057------------------------LS.MK--..G-M---D--A--QM..-----NA...------------TLV...Y..
B3PTQ9_RHIE6/884-1105------------------------MA.GN--..W-D---G--G--KL..-----SG...------------NLL...F..
B3R439_CUPTR/1186-1441------------------------LQ.IE--..Q-P---G--A--TL..-----TG...------------NGS...W..
B4D2P2_9BACT/252-462------------------------ID.AT--..F-A---G--G--KV..-----QG...------------KYH...T..
F2G3T4_ALTMD/1046-1287------------------------LL.VR--..S-D---D--T--NI..-----TA...------------SGY...W..
B4S7D6_PROA2/551-781------------------------VK.AS--..S-L---G--G--TV..-----TL...------------KGY...Y..
B4WWS5_9GAMM/996-1238------------------------LQ.GR--..W-R---A--S--RI..-----QG...------------TVD...W..
B5D2W9_9BACE/743-946------------------------LT.MR--..G-L---E--A--DL..-----ET...------------TLV...Y..
B5RZT4_RALSL/864-1116------------------------LK.ID--..Q-P---A--A--TL..-----TA...------------QGT...W..
B6C3U8_9GAMM/392-603------------------------IK.VR--..M-L---G--G--GI..-----SL...------------EGL...I..
B6ELQ6_ALISL/633-885------------------------LD.SN--..V-I---Q--S--HL..-----LF...------------NGS...L..
B6JB61_OLICO/637-850------------------------GK.AS--..I-G---G--G--AL..-----SL...------------SGV...A..
B6XFK3_9ENTR/1013-1256------------------------GL.LK--..N-S---A--G--EL..-----KL...------------DAL...W..
B7RTJ0_9GAMM/1040-1283------------------------IQ.GQ--..L-A---G--L--QLLP-----DQ...------------PAE...L..
B7RZC0_9GAMM/833-1042------------------------LV.WD--..G-D---E--S--SG..-----SA...------------QFE...I..
B7VIB8_VIBSL/1027-1268------------------------IQ.VR--..S-G---G--N--KA..-----DI...------------SGW...W..
B8B0X9_ORYSI/279-522------------------------GL.VD--..T-G---Q--G--RM..-----TA...------------TGL...W..
B8CI63_SHEPW/997-1240------------------------LS.MT--..T-D---E--V--SL..-----RG...------------NGT...W..
B8DNW5_DESVM/971-1157------------------------IA.SG--..F-Y---G--G--TL..-----GG...------------SIR...A..
B8J2T2_DESDA/848-1034------------------------IT.GQ--..F-Y---G--A--PI..-----IS...------------KGT...I..
B8KWT1_9GAMM/869-1081------------------------AALTD--..S-I---R--G--AL..-----QF...------------RGA...V..
B9BCU5_9BURK/1099-1356------------------------LT.LT--..N-P---D--A--KL..-----SA...------------TGN...W..
B9XF33_9BACT/756-966------------------------IQ.AD--..F-Y---K--G--TL..-----TG...------------SAE...F..
B9Z3I6_9NEIS/1017-1259------------------------FV.LR--..S-D---S--G--LL..-----QG...------------AAR...A..
C0N416_9GAMM/1005-1255------------------------AS.LK--..S-D---V--M--NA..-----SA...------------TGS...W..
C1D9M5_LARHH/1015-1258------------------------FQ.LS--..N-G---D--G--QI..-----NL...------------RGV...Q..
C2M1Y5_CAPGI/573-798------------------------LQ.TD--..I-F---G--G--KT..-----AV...------------TGS...V..
C3K7G5_PSEFS/1015-1260------------------------LD.LG--..L-K---G--M--QL..-----KG...------------AGG...W..
C3L4A9_AMOA5/534-754------------------------IE.LI--..F-A---G--G--KA..-----RL...------------AGS...I..
C3MGL5_RHISN/425-630------------------------GD.SN--..Y-A---N--G--SL..-----SG...------------RVV...L..
C3XBS4_OXAFO/1106-1353------------------------LK.IT--..N-P---D--A--IL..-----DA...------------SGS...W..
C4L8L8_TOLAT/989-1232------------------------LH.WQ--..V-A---N--S--HF..-----DG...------------QAG...W..
C4U7R6_YERAL/1011-1254------------------------GL.ID--..A-G---N--G--QA..-----KV...------------SGQ...W..
C4UIL5_YERRU/1014-1257------------------------GL.IE--..V-S---G--A--RM..-----AV...------------NGT...W..
E8RSC3_ASTEC/1136-1358------------------------LK.AG--..W-D---G--R--NL.I-----AG...------------EGS...A..
E3IRW1_DESVR/941-1125------------------------AT.AG--..F-S---G--G--RV..-----TS...------------SLR...S..
D9SHW3_GALCS/1021-1263------------------------LH.IT--..N-P---D--G--TL..-----TG...------------DGL...W..
C6B1K3_RHILS/408-616------------------------GD.SQ--..F-E---G--G--EM..-----TA...------------HLE...A..
D5CU11_SIDLE/1024-1263------------------------LQ.LV--..N-P---D--G--VL..-----SM...------------SGK...W..
D8JRU2_HYPDA/915-1130------------------------AK.GT--..L-D---G--G--A...-----PL...------------SAE...V..
C6UUQ9_ECO5T/1009-1252------------------------GL.ID--..T-G---F--S--RL..-----TA...------------DGE...W..
C6WWM2_METML/1053-1294------------------------IK.FN--..T-P---E--G--TI..-----SA...------------EGQ...W..
C6XD69_METSD/1043-1284------------------------LK.II--..N-P---D--S--TL..-----TA...------------EGE...W..
C6XK02_HIRBI/884-1092------------------------VS.GT--..I-S---R--G--KG.V-----EA...------------TFE...R..
C6XTR4_PEDHD/806-1010------------------------TR.FN--..L-I---D--A--TV..-----SM...------------DAK...Y..
C7BLT0_PHOAA/1013-1256------------------------GK.AE--..N-S---V--S--KL..-----DL...------------TGR...W..
C7JI05_ACEP3/380-581------------------------MK.MN--..W-L---G--A--SI..-----QA...------------SGH...L..
C7PC84_CHIPD/564-796------------------------IK.AN--..A-L---Q--G--NM..-----EV...------------NGS...Y..
C7PJB3_CHIPD/809-1013------------------------TG.FS--..I-I---G--A--PV..-----AM...------------DAV...Y..
E6WGF8_PANSA/1014-1257------------------------GS.VD--..T-G---S--S--KL..-----SI...------------NGE...W..
C9NN95_9VIBR/1009-1250------------------------LS.FQ--..S-G---A--N--KV..-----DM...------------NGS...W..
C9P2T1_VIBME/1028-1269------------------------ID.IV--..S-G---T--N--QI..-----NI...------------SGE...W..
C9PMQ2_9PAST/191-392------------------------GQ.ID--..Y-L---N--Q--RS..-----SS...------------TFT...L..
D0HXR9_VIBCL/115-356------------------------ID.FT--..S-G---T--N--QL..-----HV...------------NGT...W..
D0I525_VIBHO/1024-1266------------------------FV.LD--..S-G---G--T--QI..-----RA...------------SGD...W..
D0TG62_9BACE/829-1032------------------------LC.MS--SNI-G---S--G--DL..-----TM...------------VYT...T..
D0Z1U4_LISDA/1035-1276------------------------FS.VT--..T-G---A--M--AL..-----NM...------------QGA...W..
D1JQS4_9BACE/740-943------------------------LS.IR--..A-L---D--A--DM..-----KA...------------VMV...Y..
D1RKZ9_LEGLO/1049-1297------------------------CR.ID--..S-P---V--Y--QF..-----DI...------------QGE...W..
D5WC43_BURSC/1144-1399------------------------LD.VT--..N-P---T--A--TL..-----TA...------------TAN...W..
D2C1Z1_DICD5/1022-1265------------------------GL.VD--..N-G---K--A--KL..-----TL...------------DGS...W..
D2U2L7_9ENTR/1008-1250------------------------GS.LK--..N-S---A--T--NL..-----KI...------------SGI...W..
D2UF54_XANAP/1023-1265------------------------LH.LR--..S-D---Q--Q--QI..-----DI...------------SGD...W..
D2ZL55_9ENTR/1006-1249------------------------GL.VD--..T-G---F--G--RL..-----TA...------------QGE...W..
D3SBX9_THISK/1040-1287------------------------LR.AR--..G-P---D--G--DL..-----QVQ.G------------SGH...W..
D4BXD7_PRORE/987-1229------------------------GT.LD--..N-S---V--T--KL..-----KL...------------DAI...W..
D4EGY4_AGGAC/176-377------------------------NS.YC--..L-P---D--S--PC..-----TA...------------RLD...Y..
D4GCB7_PANAM/1019-1262------------------------GL.VD--..T-G---T--S--RL..-----NI...------------QGE...W..
D4HUV7_ERWAC/1008-1251------------------------GL.ID--..S-G---S--A--RL..-----TA...------------SGE...W..
D4IQI7_9BACT/568-774------------------------LA.MG--..V-F---G--G--RA..-----TA...------------SGS...Y..
Q0ABM3_ALHEH/1048-1290------------------------IR.LD--..T-P---S--F--AL..-----QG...------------DMA...W..
Q0AQ38_MARMM/879-1092------------------------VS.GN--..A-F---D--G--PF..-----QA...------------SFG...A..
Q0BUM1_GRABC/651-853------------------------LH.MQ--..A-P---G--Q--RG..-----PV...------------SAM...L..
Q0BY26_HYPNA/311-513------------------------LE.VR--..F-A---E--G--QL..-----SS...------------YVT...L..
Q0G0J1_9RHIZ/903-1122------------------------IK.GR--..L-E---G--G--DI..-----AG...------------DVS...L..
Q11U15_CYTH3/815-1020------------------------TG.FN--..S-S---N--G--YF..-----SV...------------DGD...Y..
Q11YL6_CYTH3/532-755------------------------SN.LI--..F-C---N--G--FY..-----SG...------------KTA...L..
Q11YT8_CYTH3/698-925------------------------LN.FN--..S-L---G--G--SF..-----LF...------------SGD...Y..
Q134A2_RHOPS/861-1075------------------------AK.GK--..L-G---G--G--DT..-----KL...------------VIH...A..
Q145G0_BURXL/1154-1409------------------------LD.IT--..N-P---A--A--TL..-----SA...------------TAN...W..
Q15ZG8_PSEA6/1002-1243------------------------LR.LN--..N-D---H--G--LF..-----YA...------------SGD...W..
Q1MYL9_9GAMM/998-1245------------------------ID.GF--..I-K---K--L--SV..-----KG...------------SAQ...W..
Q1RIG6_RICBR/624-851------------------------IE.AE--..L-L---G--G--KL..-----QG...------------SGN...I..
Q1VS98_9FLAO/575-799------------------------VN.AD--..I-F---G--G--SI..-----SL...------------DGK...V..
Q1YH64_MOBAS/407-618------------------------GD.AQ--..I-F---G--G--RG..-----QA...------------NLT...F..
Q1YJ92_MOBAS/882-1101------------------------AS.LT--..L-P---G--G--TL..-----TG...------------TFA...L..
Q1Z1R2_PHOPR/1035-1276------------------------LQ.VK--..S-G---A--T--AL..-----NL...------------DAH...W..
Q211X0_RHOPB/871-1087------------------------LT.GK--..I-G---G--G--DA..-----VG...------------DIA...V..
Q26HN2_FLABB/569-794------------------------TT.TD--..I-F---N--G--NI..-----GL...------------NGS...V..
Q28TM9_JANSC/371-572------------------------AS.IR--..T-Y---E--G--QL..-----AG...------------QFV...I..
Q2BKP5_9GAMM/1026-1270------------------------IK.AD--..L-L---G--S--TV..-----DG...------------QIR...W..
Q2C0H6_9GAMM/1034-1275------------------------FN.IN--..S-G---N--I--KL..-----DA...------------NGR...W..
Q2KY05_BORA1/936-1183------------------------LQ.IR--..N-D---D--A--TL..-----NA...------------TGE...W..
Q2NWP0_SODGM/1012-1255------------------------GV.ID--..T-G---N--A--RL..-----TA...------------EGS...W..
Q3BRF7_XANC5/416-658------------------------LQ.LR--..S-D---D--Q--NI..-----GL...------------TGA...W..
Q3IFH7_PSEHT/1008-1245------------------------LV.VD--..K-N---D--H--IL..-----RT...------------HGQ...W..
Q3R1J6_XYLFA/553-795------------------------LQ.TN--..S-P---S--Q--RL..-----SM...------------FAT...W..
Q47VG9_COLP3/1038-1280------------------------FT.AK--..R-N---K--T--SL..-----NL...------------DGS...W..
Q5FSF1_GLUOX/412-615------------------------LR.LG--..Y-V---G--A--SL..-----SA...------------NGH...I..
Q5R0H7_IDILO/1003-1244------------------------MA.LK--..K-G---S--D--EL..-----AV...------------TGY...W..
Q6IT20_EDWIC/723-966------------------------GL.LD--..S-G---N--T--RL..-----TL...------------SGR...W..
Q6N438_RHOPA/862-1076------------------------SS.GK--..L-G---G--G--DA..-----KA...------------VLT...A..
Q7MHE2_VIBVY/1031-1272------------------------IS.LV--..S-G---S--N--RV..-----DV...------------NGD...W..
Q7UYB4_RHOBA/752-985------------------------VR.SR--..V-G---G--G--QL..-----EG...------------GLL...L..
Q7W992_BORPA/953-1200------------------------LQ.IA--..N-D---A--A--RL..-----DA...------------TGN...W..
Q8EA16_SHEON/1025-1268------------------------LS.LT--..T-P---E--V--SL..-----QG...------------NGI...W..
Q9ZDH9_RICPR/624-849------------------------IE.AE--..L-L---G--G--KF..-----QG...------------SGN...I..

PF05170

C9QVM3_ECOD1/6-588------------------------IK-LE----------K--P--DA-------RLIRL------------SEKNNNWTF
Q87TE2_VIBPA/1-570------------------------LL-ID----------G--V--SL-------KKGIP------------TQPNL...E
Q8DDS5_VIBVU/1-572------------------------VL-LD----------G--L--SL-------QTGLS------------RSPKTFIPN
ASMA_ECOLI/1-512------------------------VM-LK----------G--A--VI-------QLTPQ------------TEAVRSEDA
Q9KNJ9_VIBCH/1-570------------------------VL-ID----------G--A--NL-------AHGL.------------..PNFTLPE
Q8Z2I4_SALTI/1-562------------------------IL-LQ----------D--G--TL-------NISVQ------------TAPFPFEAD
Q9HU38_PSEAE/1-636------------------------IR-VE----------G--L--SL-------DLVRD------------KQGKGNWEN
Q9KT66_VIBCH/1-595------------------------IR-LD----------G--A--EF-------HLETL------------KDGRSNLDA
YICH_ECOLI/1-562------------------------IL-LE----------N--G--TL-------NLTDQ------------TAPLPFKAD
Q9JY87_NEIMB/8-615------------------------WV-VS----------S--A--EL-------ALTRD------------GKGVWNIQD
Q9ZDI1_RICPR/1-711------------------------IE-LQ----------K--P--TI-------SLEVL------------DNGQKSWQL
Q9HUT4_PSEAE/1-577------------------------IK-LT----------Q--P--RA-------ELLRL------------ADGRANWDF

PF04357

A2TNG0_9FLAO/994-1409...........KSFNDWK......LD-LG----I.SA.SR..I--AVLD-----TEEDLES..LYYGTAFLEGE...AFI
A2TNW4_9FLAO/1182-1640...........EHFINPT......FD-LK----V.VA.ND..F--QALN-----AEKGDNDFVYGIAV.F.DAT...ASI
Q2C929_9GAMM/905-1251.............QDMAAW....KTE-LN----I.NG.KE..L--QVSM-----PPMVS.......LK.V.SPD...LII
Q2Y828_NITMU/994-1331............TGERGS........-VE----I.TA.NL..V--PLAQ-----RPDRW.......II.A.SGS...GNA
A0KIJ1_AERHH/913-1251.............AQLPV.....TGS-LT----I.QG.KE..L--EAQY-----PGMGR.......VR.V.SPD...IAI
Q3AKV0_SYNSC/1030-1473..........PQ..SDV.......SP-LT----M.QL.SQ..G--QIRQ-----PIV.Q.......FQ.A.DGE...LQV
A7IN53_XANP2/1076-1428...........EPAQGFP......GR-ID----V.DL.TN..A--GLVN-----SDLMR.......LV.A.EGR...LAV
A3PNN1_RHOS1/926-1276...........EAP..FA......AD-LA----L.EI.RR..A--VLRD-----PELYE.......TT.A.SGR...ITV
Q83EW1_COXBU/570-928............DAPGRP......TT-LT----V.HG.EN..L--LIVN-----THQYI.......IY.G.SGE...LKI
A6E3M1_9RHOB/900-1246...........TPG..FT......GD-LS----V.GL.DG..L--VLSD-----QLIYT.......TT.V.NGN...IGV
Q0HJ58_SHESM/1055-1401............PQGQFS......GE-LA----V.KG.DK..L--AVIQ-----PPLAL.......LD.V.SPD...LTI
Q1D0C2_MYXXD/935-1291...........ERFLPQR......LG-LT----I.QL.DE..V--PYRL-----TEDLP.......AT.F.SGL...LQV
Q3IIS8_PSEHT/883-1224.............QGEQP.....AVN-VA----I.VG.EQ..F--YVRA-----QQGVV.......FK.V.SPD...LKI
A5FB26_FLAJ1/992-1420...........HNFGDWK......LD-LT----I.TS.KR..L--LALD-----TKDSEDA..AYFGTAFINGT...ASI
A4CXF7_SYNPV/1039-1478..........PA..PEA.......KP-LR----L.QL.EK..A--RIKL-----TIA.D.......VQ.V.GAD...LTI
A0YIL4_LYNSP/1701-2096.........FEEEDPDVE......NP-LQ----I.KL.AN..L--QVGV-----EELYV.......GD.A.AGM...IAI
Q1MB16_RHIL3/1685-2033...........QPAGGFP......AD-IS----I.KL.DK..A--VYVD-----GTLVV.......ST.V.NGT...VGL
Q8YZJ8_NOSS1/1412-1829..........TG..ETVT......NP-LT----V.AIQNQ..L--NFQV-----AGLYT.......GD.V.SGN...AVI
A4CK93_ROBBH/998-1431...........QFFSDWR......LN-LD----V.DT.QGERF--LLLN-----TEYDEEE..LYYGTAFAEGT...GRI
Q481M2_COLP3/971-1308.............QNSLS......MN-LD----L.TG.YA..L--PLVF-----PPQLV.......MS.I.SPT...LNF
B1YUT5_BURA4/998-1353............DGAAPD......LT-AS----I.VA.DK..L--ELFA-----APDRK.......LS.L.SG.....KA
A2C147_PROM1/886-1319..........SQ..LSES......EP-LA----L.SI.EK..T--RIKT-----AFT.D.......IR.A.SSS...LVV
Q26C01_FLABB/1165-1623...........ENLLVPT......FD-LQ----L.KA.KD..F--TALN-----STEKDND..LYYGKATFDAN...ATI
A5ZK99_9BACE/1057-1469...........RDMSRPM......AN-LN----M.LA.QN..Y--TLLD-----AKRTRES..LVYGKVFADFR...ATV
A3U6I2_CROAH/1185-1647...........ESLINPA......FN-LS----F.KA.KD..F--KVLN-----STKEDND..LYYGTAIFDLD...ATL
A1VCI4_DESVV/1414-1783........................IV-LR----G.AM.AG..L--RPFR-----RDDLD.......VT.L.SGP...VEL
Q4C5Y1_CROWT/1556-1977..........LQNEQDIN......NP-LT----I.QV.SQ..D--EVNE-----SGIYQ.......GL.I.NGN...III
Q9JXB6_NEIMB/1050-1387............ENSGPD......VD-IG----A.VF.DK..Y--RILS-----RPNRR.......LT.V.SG.....NT
Q6G572_BARHE/1198-1548...........N....LQ......PD-LV----L.HL.NN..A--NYND-----GSMIL.......AT.L.SGK...ITM
Q1IBQ7_PSEE4/893-1224.............GQVLA......MD-LR----L.QG.QQ..L--PVSV-----EPYAA.......LE.V.APD...LTI
A4A832_9GAMM/725-1058.............DGTLE......AV-..----L.KG.EK..N--ELLL-----PTLGV.......EALL.SPQ...LNL
A3PBW3_PROM0/863-1296...........YQNDPRK......GR-IN----L.KT.NK..F--NIKT-----DNLNF..........LLDSD...LDL
A0LAI9_MAGSM/1120-1462...........QEDGLHP......VA-MQ----L.RL.LR..M--NLVQ-----RDDAV.......AN.A.SGA...IDL
Q4QMM3_HAEI8/941-1294.............ANIEHW....TTE-LN----A.QA.NN..F--NVDI-----PSMAK.......LR.F.SPD...ITI
Q2ND20_ERYLH/1053-1400..........ISATRGPE......ID-LR----I.AA.SN..A--QLIA-----ANGLD.......AT.V.TGP...IRI
Q9PDZ6_XYLFA/845-1179..............FGENN....PLQ-LN----I.RG.RN..V--LAYN-----TSELR.......IV.S.DPD...LRF
A6GMC8_9BURK/963-1338............TGLNGE........-IR----L.SM.DR..V--PLLQ-----RLDRW.......MM.V.NSSVTVQQP
Q5LV35_SILPO/1012-1360...........LPP..FD......GQ-IA----V.RL.ND..L--VLTD-----NLSYD.......SR.L.GGQ...ITL
A4SGG7_PROVI/1036-1486...........KNLQPGE......LS-ID----A.RV.NR..L--LLYN-----KKDNKDE..TSFGT.I.TGTSNGMHL
A0LGH5_SYNFM/889-1254.............PSFQT......AK-LS----A.SG.RD..L--RVSK-----VYGIE.......GK.I.SGK...ADL
A5VFU9_SPHWW/1048-1392...........AAEKGIG......MD-VS----L.DA.QN..A--QLIN-----RDDIG.......AI.V.TGP...ITI
Q3A844_PELCD/965-1307............HDWKPG.....NYN-VT----L.KG.QG..V--QLVN-----LPEIQ.......IQ.A.DPD...LLI
A6EEW2_9SPHI/1267-1720...........TDYTNFK......FN-MN----I.KT.DN..F--RALN-----STAEDNE..MIYGTVYLTSD...IKV
Q28VV1_JANSC/853-1206...........SPG..MD......GQ-IA----I.GL.RN..A--RLVD-----PTLYE.......AQ.ITTAD...LTI
A3HZ37_9BACT/1160-1620...........NDFTNPE......FD-LT----L.LA.KN..F--MVVN-----STDKDNE..LVYGRGTIDAD...VSI
A5GSG8_SYNR3/973-1387..........QE..GGE.......PG-LN----F.TI.KA..F--PIRR-----PDA.R.......LQ.V.DGS...LKL
Q065Y1_9SYNE/1038-1479..........EK..VVE.......SP-LT----F.AL.TT..A--KIRQ-----EIA.R.......YQ.V.DGT...LIV
Q1IMU4_KORVE/977-1317.............KPSLQ......FN-LA----L.AT.SD..A--HLLY-----QDSIR.......VG.A.NSQ...LAL
Q1NAC8_9SPHN/1059-1410...........AANSGFP......IN-IA----V.KL.DR..A--RLAR-----SEAIT.......SV.V.SGT...LNI
A6L590_BACV8/1012-1461...........TKLKNLM......YH-FN----I.RG.NN..L--LMYN-----TYEAGNM..PFYGKVYGTGN...VVL
A3J9P9_9ALTE/935-1267............QSDLPS......GS-VS----L.RG.ER..L--PINI-----EPYAE.......LE.V.APD...LTI
A3UCX7_9RHOB/1006-1342...........TSDGV.E......GE-GR----I.EL.NQ..L--YLVD-----RPELS.......GG.A.SGY...AEF
A0M1P1_GRAFK/1180-1639...........ENLLNPG......FD-LD----V.QA.DG..F--RLLN-----STEEDND..LFYGTAVVDVD...GTV
Q2S2D2_SALRD/1057-1516...........NDYQYFS......FD-LS----A.SL.DG..I--TVID-----VSQAEDL..PFYGRIRGSGP...LHL
A4BTF4_9GAMM/974-1321.............TGKA.P....RAE-MQ----I.NG.QD..F--QAFN-----TDDAH.......VF.I.SPA...LQI
F2GCG9_ALTMD/897-1246.............SSTPS......AT-FN----L.KG.NG..F--EIRQ-----PD.IR.......LK.V.SPN...IDI
A3U2G6_9RHOB/1005-1359...........SGA..YP......AN-LS----A.TL.NN..I--PIER-----PGLVT.......TR.A.NGR...ITV
Q21Y28_RHOFD/928-1291..........PPTGPDAKVAARLRME-LD----A.TL.AA..L--RVSA-----RADRR.......LV.V.SGQ...LSA
Q6MKB2_BDEBA/958-1321...........NGIKDIP......TT-IR----A.RL.EG..V--TFNV-----PDKVR.......SS.G.SAD...LLF
Q39RU7_GEOMG/1016-1376............DRWRVA.....SYR-GT----V.TG.DR..F--QTVN-----IPEVQ.......ML.A.TPK...LTF
Q0YSH5_9CHLB/1047-1493...........DKLEPGA......LA-LE----C.RI.DN..L--LLFN-----KKDRKDE..TSFGT.I.TGSTNNLLL
Q21PP5_SACD2/924-1270...........EPFADNA......VQ-LT----I.QA.HN..M--NAID-----RKEIE.......GQ.I.NGE...LQL
Q7VBL9_PROMA/867-1309..........DD..KEIS......KE-LN----L.VI.KS..I--EFDQ-----NNF.D.......FK.V.SSN...LNV
A2SER1_METPP/1091-1433...........GDAPQAR........-LQ----L.TA.ER..A--TVLG-----RVDRR.......VV.A.SGQ...ASL
Q0G3A4_9RHIZ/1842-2187...........TPP..FN......AD-IS----V.VL.NQ..G--RYTD-----GEIVT.......AS.L.SAD...LSI
A8LNM1_DINSH/737-1084...........TGS..QV......AD-LS----V.VL.DD..L--RLAI-----QGFLA.......TE.L.DGE...IAF
Q167D7_ROSDO/855-1205...........A.T..LV......GD-LT----I.AL.RD..A--LLLD-----PNLYA.......AT.I.GAD...INV
Q0C134_HYPNA/1036-1371...............AGA......AR-VD----I.DL.NR..L--LVYD-----RNSDN.......MR.L.TGN...AAL
Q3JE49_NITOC/917-1262.............EPEAGW....PAK-VT----V.TG.ER..F--EAMG-----TSDIR.......VL.I.SPQ...LQI
A6FC33_9GAMM/920-1259.............VDEFN......YR-ML----L.HG.DN..F--EFDD-----NKGLK.......LH.F.SPE...ILV
Q016Y8_OSTTA/1647-2059RPAGGETWEGLVARADTQ......GG-VK----V.SM.DG..L--DMRV-----RNVYS.......GQ.L.NAN...MVA
A3XNV5_LEEBM/1180-1639...........ESFINPT......FD-LN----L.KA.EN..F--TALN-----STKEDFD..LVYGKAVFDAD...AQI
A5FIP0_FLAJ1/1183-1626...........PDFRKYN......FD-LV----V.EA.DD..F--RAIN-----SKAKDND..LFYGDLFLDTK...LNI
Q0F1G3_9PROT/799-1133...............DRR......TV-PD----L.KF.KR..F--ALMN-----LPDQQ.......LV.V.SGT...ISA
Q8KFW2_CHLTE/1034-1479...........DGLKPVT......VN-LS----G.SF.SN..L--LLYN-----KKDMKDD..TSFGT.I.RGTTGNLRF
Q47IW3_DECAR/842-1201............DQGQAQD....KAF-LD----I.HL.DR..L--GAYQ-----LPDQW.......VA.V.SGD...G..
Q2JHB3_SYNJB/1232-1612.........GALQMDETS......PP-LT----L.QL.QG..I--QLNL-----PNLYT.......GH.L.DGE...VAV
Q0ALB2_MARMM/1025-1362...........GADGLPQ......GA-AS----F.TF.QR..F--VAVR-----RTELT.......VQ.A.SGD...VDF
A7AE74_9PORP/1075-1490...........HNLSRMT......AN-LK----L.TA.HD..M--QLLN-----VKRNKES..MVYGKLLVNLN...STV
Q15Z95_PSEA6/908-1250.............QDTPS......AT-VN----V.KG.DE..M--EIDY-----QNIVR.......AK.L.SPD...INV
A6H009_FLAPJ/1018-1446...........HNFGDWF......LD-LN----L.AS.NR..L--LALD-----TKDAEEV..LYYGTAFIDGD...ATI
A3M6L3_ACIBT/799-1145.............KNAPR......LQ-LN----L.KG.DN..L--LVRQ-----APLIT.......AI.A.NPN...LTL
B5E9K2_GEOBB/1121-1484............NGREIA.....GYT-GT----L.SG.QG..F--QTVY-----LPELR.......MT.T.SPQ...LTF
Q0AB99_ALHEH/929-1273.............GGEAW.....QVF-AN----L.DG.EA..L--EVFL-----PPGLD.......LE.V.WPA...LRA
Q493V0_BLOPB/931-1279...........DSISNIR......AF-FK----I.RG.NQ..I--NFCM-----SPEIK.......MK.I.SPD...FNC
Q1GSU8_SPHAL/1054-1406...........SQADGYP......MD-LA----A.TL.DN..A--RLAR-----SENIA.......AR.A.TGD...LRL
Q2LXD8_SYNAS/968-1324............SGSQVS.....SYS-GT----V.KG.DR..F--QTVN-----LPELQ.......LL.T.SPD...LRF
Q4C605_CROWT/1446-1815..........KL..TQNN......PS-VT----V.QM.NN..I--ALNL-----PQMYQ.......GG.V.QGN...LNI
Q1QA38_PSYCK/1311-1664.............QQKLQ......AK-LS----I.DG.KG..L--ILTQ-----PPLLV.......AS.V.DPD...IDI
Q01ZK1_SOLUE/1253-1604............GGPEMQ......FR-LQ----A.TA.NQ..V--HVDA-----PATIT.......TQ.F.GAR...LTL
Q11I59_MESSB/1185-1538...........SAAAGFP......AD-LM----L.RL.NE..A--RYAD-----GEMVT.......AT.V.SGG...LQL
Q9A7W5_CAUCR/1057-1398.............SRGGE......GN-FK----L.DM.KS..F--RLID-----NDLAS.......AV.A.TGQ...ASV
Q5P2G0_AROAE/979-1332............DSGTG.......SF-I.----Y.QA.DR..L--PILQ-----RPDRW.......LI.L.SGG...GTA
A4G804_HERAR/984-1318............VREQLA......LE-LA----I.KA.EH..Y--KLID-----RSDRK.......LV.I.SGS.....S
A1ZDJ2_9BACT/1130-1588...........LGFSAFY......TN-LK----V.KG.DN..F--QLMK-----SSAYNFK..TLYGTIVSDYD...IKV
A3J5Q1_9FLAO/987-1412...........DKLGDWG......LD-LH----L.IS.DN..I--LALD-----TKDSDDA..YYYGTAFMKGK...ASI
B8CZ01_HALOH/1096-1430............FDQDKT......WD-IF----L.QG.KN..L--PFSH-----GSFEG..........KFDPR...VKM
A1SW21_PSYIN/987-1327.............QDKFK......GK-VN----L.YG.NQ..M--VIND-----YSKIY.......LL.V.SPN...LEL
A3V315_9RHOB/1064-1418...........GDG..NP......AD-VT----I.RL.DD..V--VLQD-----TQLYR.......AN.V.GGT...ITL
Q11VR9_CYTH3/1167-1624...........EKFDNAT......FN-LT----V.TT.ND..F--MILN-----TTAVNNK..LYYGRVFLDSK...ISI
A7HQ23_PARL1/1042-1395...........AADASPA......VD-IR----T.QF.SD..M--QVVR-----RQDLV.......LA.V.NGA...LAL
Q7MT86_PORGI/1036-1486...........RAFDDIK......VD-LK----VSEA.RN..I--LAYN-----VPERDNP..NIHGRVYVSGAAYLRDV
A3WNV7_9GAMM/844-1182..............NDLT......GT-LD----L.KG.TD..L--VVMD-----SPRIR.......IT.A.TPN...LKL
Q5FPE8_GLUOX/1025-1381...........RPD..LP......VD-LH----I.TS.EK..A--RPVS-----SDLLT.......AT.I.NTD...LHI
Q0BVY3_GRABC/1010-1362...........PP...MP......VD-LT----V.KA.SN..A--TLIA-----SDLMT.......ER.L.DAD...LTL
A4BHU2_9GAMM/1208-1569..........GDTLFGHE......LS-VD----L.SF.AD..A--ALLN-----QAQMD.......AA.V.DGQ...IQA
Q73JH5_TREDE/1097-1467...............YTT......VN-CG----V.LE.NT..Q--ALIK-----TKNIAFH..ADGRA...EGK...IKL
Q3AQ57_CHLCH/1053-1500...........EKLQPSR......LE-LA----A.SC.NN..L--LFYN-----KKDQQDD..TSFGS.I.VGSTRNFTL
Q5SKS5_THET8/2271-2658PGYGVEVRLGEALAQGTL......FP-LR----L.AGYGK..L--PLYY-----PQYYL.......QEGLLDVKSFFLYE
Q1NV21_9DELT/955-1283.........QPLAWQQAR......LE-LA----L.SG.RE..L--VFYR-----AEGIH.......LR.G.DSE...LQI
A1BDC7_CHLPD/1048-1494...........ENLKPKT......IT-LG----A.NL.SK..L--LLFH-----KKDTRDE..KPFGT.I.IGSTRNLLL
Q2I8W0_9BACT/387-729.............FGTPDW....NLQ-GF----V.NG.SD..F--KVVS-----LPQLK.......AT.L.SPD...LKL
Q3SKJ4_THIDA/904-1242............RNPQAG........-LT----L.EF.EK..F--AAIQ-----RSDRQ.......VI.V.SGT...TRL
P73551_SYNY3/1571-1978...........EPQPDLE......NP-LQ----V.SI.KP..T--NITI-----PNLYQ.......GN.L.AGF...VTV
Q7P0N2_CHRVO/933-1270............SDDLPD......AR-VK----V.AL.QS..F--SVFD-----RPGRR.......LV.V.SG.....QS
A3Z198_9SYNE/1096-1522..........DI..PQR.......QP-LN----L.TV.KT..A--RISA-----PRL.N.......AL.T.DGT...LSL
Q0VRK9_ALCBS/827-1164.............PSQPNI....PMQ-LT----L.SG.DR..L--LAAD-----RPDAR.......IL.L.TPD...LTL
Q08V51_STIAD/1146-1530..........GV....FE......LT-GK----T.HL.KD..F--PIIS-----DDQLL.......AV.V.SLD...STL
Q1W0M9_9FLAO/1152-1612...........EEFTNPK......FN-LT----F.DT.KN..F--QVLN-----STIEDNS..LYYGKLILDAS...AKL
Q7W1D4_BORPA/859-1210............SAARGQ........-VR----L.QL.HR..F--PALQ-----RSDRY.......GM.V.SGV...VTL
A2U1I0_9FLAO/1154-1612...........ESFINPE......FD-LQ----L.RA.KD..F--RLLN-----AKKEDNP..SLYGLATFNAN...ADL
Q6MAC5_PARUW/935-1288...........DKKQHFP......FD-IK----L.EP.KQ..I--AIME-----SDYAD.......IE.A.SGS...LQL
A1HRF9_9FIRM/1091-1444...........QGMALAD......YD-LL----L.VL.DH..L--GISH-----KYFHG.......PL...NGT...LTL
E0TG81_PARBH/951-1296............TPSDPR......VD-AR----L.IL.AD..A--TLID-----SRDLE.......LR.T.DAD...LTL
Q1QWE2_CHRSD/954-1312.............QDPAAW....RAH-LE----I.DG.QDDPL--LVSL-----PQFGR.......LR.V.APD...LSV
A5FUW2_ACICJ/973-1319...........KP...MP......VD-LR----I.AF.HH..A--SPIA-----SDILT.......ER.L.GGA...LSL
Q2RSJ7_RHORT/1146-1500...........VDLTRPI......GR-ID----L.DI.TQ..A--VVVR-----RDDAV.......AE.I.SAD...LAM
Q2S346_SALRD/1311-1689...........PELTVGE......YD-LT----L.NA.SE..F--LAIN-----TAAYR.......RA.VIDGD...MTL
Q2INP6_ANADE/946-1304...........ARLAPSR......LR-VE----G.AL.DE..V--PVAL-----PSYLP.......AT.L.SGR...IEA
Q9RUC9_DEIRA/223-627.................R......WD-LN----L.SA.RNYNL--PVSA-----IYARE.......SA.L.TGD...FRL
Q1LSN0_BAUCH/634-981...........CNLHTWH......IY-VT----L.KG.NK..I--RIYM-----PSMRF.......DV...SPN...IIF
Q02B21_SOLUE/1013-1363............GSGGTV......FR-IH----A.RA.TE..V--RVRY-----PEGVS.......TV.A.NAS...LNF
Q1ZD28_9GAMM/976-1315.............QHRFQ......GA-LH----F.YA.HK..L--FFYD-----HKKIN.......ML.L.SPD...IYL
A4EWK7_9RHOB/813-1161...........SAP..FQ......TA-LN----I.GL.SG..V--VLKD-----HLSYE.......TL.L.NGD...LNL
A0NU08_9RHOB/1094-1448...........K..DGFP......AD-LS----L.KL.DN..G--RYVD-----PGLVT.......AE.V.DAD...LKV
B3ELK5_CHLPB/1036-1483...........ENLEAST......ID-LT----A.SF.EN..L--LLFN-----KQDKKDE..TSFGT.I.TGTSDRIRY
A3ISK4_9CHRO/1570-1981...........QQQTNLE......NP-LT----V.AI.ER..G--EINL-----EGLYR.......GL.V.DGR...IVV
Q2IMB0_ANADE/1148-1504...........MGGPDAR......LE-GR----I.VS.RE..L--PIMH-----AGMDL.......AT.L.DLQ...VDA
Q8YUC2_NOSS1/1659-2048.........NSS..VAIE......NP-LT----V.NL.EQ..L--QLNL-----KGLYQ.......GG.A.NGN...IQV
Q1MQI4_LAWIP/1025-1382............SKEHFP......LS-IN----G.SF.TN..L--APLQ-----RKDLS.......LT.L.SGA...ATL
P73871_SYNY3/1377-1749..........AL..PDVD......QG-LQ----L.SL.NN..L--AVDI-----PNLYQ.......GA.L.GGL...VQI
Q1H099_METFK/711-1055............VAGKPA......ME-LD----W.IL.DD..F--TAAE-----RTDRT.......LV.L.KGS...AKT
Q2SJX7_HAHCH/929-1280........NGGEENEDNP......IA-LQ----L.VA.TN..A--SILR-----RSDME.......GA.V.SGK...LTL
Q8DGE2_THEEB/1182-1567.........LAAADPDAA......TP-LT----A.SL.RR..L--QVNA-----GNIYR.......GT.V.DGT...LVI
A3VBU1_9RHOB/1020-1371...........EPP..FN......GD-LV----I.RL.QN..V--GLTD-----PSLYD.......TQ.I.NGQ...LTV
Q7VQN5_BLOFL/933-1286...........NVIQNFK......IL-LN----I.QG.NQ..V--DFYL-----SPTMY.......VK.I.FPK...LTC
Q9X3V6_ZYMMB/22-376...........DAASDYD......SA-LN----I.TL.DK..A--TLAR-----ADEMK.......ST.V.SGN...LDI
Q119K9_TRIEI/1940-2322.........LGREDSDIN......NP-LT----I.TL.KK..L--NVDF-----KKVFK.......GG.I.DGE...VII
Q7NCN7_GLOVI/1184-1556...........LPNNGAG......GE-LA----L.SI.VG...--DINL-----PGLYR.......GG.I.DGQ...LSV
Q31MA1_SYNE7/1177-1568.........LPASDPDRE......QP-LT----I.AL.RD..A--TIAL-----PNLFT.......GK.T.EAD...LQI
Q1INS5_KORVE/1027-1368............GRI.IS......FN-LA----A.TG.KD..V--RIRY-----PEGVS.......SN.G.DAD...LRL

PF05359

Q4K5X6_PSEF5/140-291------------------------IK-LA------.G.GY--L..HFKD.....LRPSE------------.PIE..FLY
Q4K5X6_PSEF5/360-511------------------------VQ-LR------.N.YQ--V..HLAD.....RKAKP------------.AVA..LEL
C6BEV1_RALP1/874-1022------------------------IT-LQ------.D.GN--I..RFTD.....NFVKP------------.NYT..ANL
B2JQ93_BURP8/874-1021------------------------LV-LQ------.N.GR--V..NYTD.....NFIKP------------.NYS..ANL
A3JB00_9ALTE/379-531------------------------VD-IR------.D.GQ--L..SWRD.....QVPAN------------AAE...LQL
Q1BJG4_BURCA/621-773------------------------LN-VK------.E.AS--A..NFTD.....LSTPR------------.PVK..LAI
A0RMT1_CAMFF/653-798------------------------LT-LK------.N.GS--L..EFKD.....DSLAL------------.PFD..TNI
A3LK23_PSEAI/690-837------------------------VR-IN------.N.GS--A..NFAD.....LTLMP------------.PFG..TAI
Q72DG8_DESVH/963-1109------------------------VT-VR------.G.GK--I..AFRD.....ERFSP------------.AFD..TSL
A9BMN7_DELAS/883-1036------------------------IV-LT------.G.GR--V..QFSD.....YFIQP------------.NYS..ADL
A4SM57_AERS4/366-520------------------------TR-IS------.Q.GE--F..KLTE.....SSSGK------------PLL...REI
A6WLY0_SHEB8/520-670------------------------LN-IE------.N.YD--L..NLSE.....QKLTE------------TPQQ..WRV
A7ZFK9_CAMC1/750-895------------------------FS-LK------.N.GE--V..DFSD.....ASLFM------------.PFA..TTI
Q2LUD1_SYNAS/534-687------------------------VA-LN------.D.IG--V..HWED.....QMPSA------------GTAE..IGI
A8ZWF7_DESOH/636-783------------------------FL-MN------.N.TE--L..KFAD.....RSVDP------------.HYA..TRL
Q3A6W6_PELCD/375-529------------------------FE-LR------.D.AR--L..LWQD.....QKVKG------------.GFK..AEA
Q5NYY7_AROAE/382-536------------------------AK-IS------.G.AT--V..RFED.....RAASA------------.PFR..TEL
B7X1L0_COMTE/164-316------------------------IA-LR------.D.GR--V..ELND.....E..SV------------.QRK..HEL
Q2KWF8_BORA1/759-906------------------------VT-LK------.R.GR--M..SFTD.....RFVQP------------.NYT..AEL
A0KYD6_SHESA/671-818------------------------IS-FN------.Q.GS--A..FFAD.....NSLTP------------.NFA..SGI
Q7WMQ9_BORBR/155-309------------------------MV-LE------.G.GE--I..TLDD.....K..VS------------.GRQ..QRI
Q1I4N7_PSEE4/579-726------------------------IS-IN------.D.GS--A..NFAD.....LTLTP------------.NFA..TAV
Q484B1_COLP3/382-534------------------------IS-TS------.N.NN--I..VIND.....SSVSP------------.IAI..HDV
A3JB00_9ALTE/590-737------------------------LQ-LD------.N.AD--V..DYTD.....RTLKP------------.ELT..TRF
A2SI01_METPP/870-1017------------------------IR-LA------.G.GT--V..DFTD.....NFIRP------------.NYS..AKL
Q8Y0Z7_RALSO/615-766------------------------LR-LD------.N.GA--I..GFED.....QTNSR------------.PVK..VRV
Q48E84_PSE14/155-306------------------------IK-LA------.D.GY--V..HFQD.....MRPSQ------------.PIE..FLY
Q5QWM2_IDILO/380-527------------------------VE-LS------.D.GD--V..QFAD.....KSLPL------------.PFS..TSI
Q0VP61_ALCBS/592-737------------------------LR-LV------.G.SQ--V..RHED.....LSLSP------------.HFR..IGL
A7GWE3_CAMC5/514-660------------------------SS-IN------.A.AD--I..GINH.....IFEGQ------------.KIA..HKF
A3QD21_SHELP/699-846------------------------IV-FK------.D.GS--T..FFAD.....NSLTP------------.NFA..ASI
A1RL15_SHESW/447-597------------------------LT-LE------.N.YD--V..NFSE.....QKLTP------------SPQQ..WRI
Q63NS2_BURPS/645-797------------------------LN-VK------.D.AK--A..NFTD.....RSTPR------------.PVK..LAI
Q47FN3_DECAR/732-879------------------------IT-LQ------.N.GT--V..NFSD.....FFVKP------------.NYT..VNL
A0KK00_AERHH/368-522------------------------TR-IE------.Q.GQ--L..KLTE.....SSSGK------------PLL...REL
Q0JZH1_CUPNH/670-829------------------------VT-VE------.G.GS--A..RLADYQPAGANRGR------------.PVI..HQF
Q2LUD1_SYNAS/785-932------------------------VT-LQ------.G.GR--V..NFSD.....RFIKP------------.NYN..ANL
A1ARF1_PELPD/790-937------------------------VT-IQ------.D.GT--I..AFSD.....HHLRQ------------.QFT..STF
Q39RS7_GEOMG/568-719------------------------VA-AS------.G.LG--L..TFTD.....RKAVG------------.NPR..FDL
B9M3X2_GEOSF/795-942------------------------VT-LQ------.E.GT--V..SFLD.....QHTPQ------------.QFG..TTM
Q8Y0Z7_RALSO/185-339------------------------LQ-LN------.N.GA--I..QFVD.....Q..PL------------.GAQ..HTV
Q3JBN6_NITOC/584-731------------------------IR-IK------.K.GS--A..NFAD.....LSVSP------------.KFS..MGI
Q5DZ89_VIBF1/399-549------------------------IE-IK------.D.YQ--L..NVEE.....KVITK------------KANL..WQI
Q1QTZ9_CHRSD/145-295------------------------LT-VS------.D.GR--L..DWIN.....RRPDA------------.PLT..LSL
Q0HTT4_SHESR/437-587------------------------LS-IE------.N.YD--I..QLEE.....HKLTQ------------TAQQ..WRV
A9BMN7_DELAS/165-317------------------------IA-LR------.D.GR--V..ELQD.....E..VQ------------.RRQ..HML
Q7WB91_BORPA/527-681------------------------AA-LR------.L.SD--L..SLRD.....ESVKP------------.AVP..VSV
A9BMN7_DELAS/379-538------------------------LS-VA------.H.AT--V..HWRD.....AAPDA------------GKSGAALQA
Q87WR1_PSESM/386-537------------------------VQ-LR------.N.YT--V..HLTD.....RVPKE------------.PVA..LDV
B2JQ93_BURP8/616-770------------------------LN-LK------.N.GA--A..TFTD.....NTTAR------------.PVK..VAV
A1K6C3_AZOSB/734-881------------------------VE-LR------.D.GI--V..EFAD.....FSLVL------------.PFS..TRV
Q603H4_METCA/718-865------------------------VR-VE------.K.GD--I..DFSD.....GSLVL------------.PFA..THI
Q47VC1_COLP3/500-655------------------------LR-FI------.NENS--F..AFTD.....FSVDP------------.IYQRTLFL
Q15PY6_PSEA6/662-809------------------------IR-LL------.G.GS--A..YFED.....NSLRP------------.RFA..SSI
Q88DW4_PSEPK/365-516------------------------VQ-LR------.N.YL--V..HLAD.....RSQKE------------.PVA..LDI
A6F3L7_9ALTE/590-737------------------------LM-LE------.E.GV--I..SYTD.....RTLDP------------.TFA..TRF
A0KK00_AERHH/578-725------------------------VR-TE------.Q.GN--L..RFAD.....RSLSP------------.EFV..VDI
B5ECC6_GEOBB/569-721------------------------LQ-LD------.G.FK--L..AFTD.....KTYEE------------.PPR..FTL
Q2LUD1_SYNAS/159-313------------------------IR-IT------.Q.GR--I..EFDD.....R..PK------------.YRR..HEI
A4VPN2_PSEU5/551-698------------------------IN-IA------.D.GS--A..NFAD.....FSLRP------------.PFV..TAI
Q3K6Q1_PSEPF/371-522------------------------VQ-LR------.D.YK--V..HLAD.....RSAKP------------.EVT..LDV
A3L3D9_PSEAI/478-629------------------------AQ-LR------.G.YK--A..HLVD.....RQPAT------------.EVP..LEV
Q0VP61_ALCBS/382-530------------------------LA-IE------.G.NT--L..RLTD.....RTLNP------------AQT...MTL
A1K7K6_AZOSB/583-736------------------------LA-LS------.D.AS--L..RLED.....RMQAK------------.PVT..LAV
Q3JBN6_NITOC/369-521------------------------IK-VE------.N.VS--A..SLQD.....RTIEP------------.PAT..LNI
Q5NYY7_AROAE/832-979------------------------IL-IK------.Q.GN--I..AFSD.....RFIRP------------.NYD..ANL
Q13S79_BURXL/640-791------------------------LV-LK------.D.AT--A..NFTD.....NTTPQ------------.PVK..LNI
Q47FN3_DECAR/504-656------------------------LA-VE------.D.LA--F..RFED.....QSMNP------------.VAV..QEI
A7GWE3_CAMC5/719-864------------------------FS-IK------.N.AE--V..DFSD.....ASLFM------------.PFA..TTI
B1KJ13_SHEWM/617-764------------------------LG-FT------.Q.GS--T..FFAD.....NSLTP------------.NFA..ASI
A5W979_PSEP1/140-291------------------------IK-LV------.D.GY--L..HFED.....LRPSE------------.PIE..FLY
Q316X0_DESDG/862-1008------------------------AF-IS------.D.GT--V..HFRD.....VSVSP------------.PFE..LTL
Q1NN12_9DELT/591-738------------------------TV-VD------.S.AR--V..DFAD.....WSLPL------------.PFA..VSM
Q602F3_METCA/416-565------------------------GV-IR------.N.YR--L..NLAD.....HGVDP------------.PAR..IGL
Q2Y5K5_NITMU/673-818------------------------IV-MQ------.G.GH--V..NFQD.....QFIQP------------.NYR..AYL
B3E4B8_GEOLS/816-963------------------------LT-VQ------.D.GT--I..AFSD.....VHLPQ------------.QFR..STF
A4VPN2_PSEU5/341-492------------------------AQ-LR------.D.YR--M..HLAD.....RVPDD------------.EVQ..LEL
Q5NYY7_AROAE/153-307------------------------IR-VI------.D.GK--L..LVED.....RPVGL------------...E..HEL
Q30NX8_SULDN/563-715------------------------FD-MN------.G.AK--L..LFDD.....KSIQD------------.NSK..TII
C1DFK3_AZOVD/367-518------------------------VR-LR------.G.SR--L..YLAD.....RVPKQ------------.DVE..LLV
Q484B1_COLP3/604-751------------------------IN-IT------.N.GK--L..DFSD.....SSLTP------------.KFS..AGI
Q5NYY7_AROAE/604-757------------------------LA-FD------.D.WA--V..RFED.....RTQGA------------.PIV..LQA
Q602F3_METCA/623-770------------------------LL-VR------.D.GS--A..DFSD.....LSLQP------------.SVS..VDI
Q316X0_DESDG/389-538------------------------AS-VT------.G.GS--V..ALHD.....NMVEG------------.GFN..HTF
A5G9K9_GEOUR/137-293------------------------IA-VT------.N.GS--I..DFID.....RGLPV------------.EKL..HAL
B2JHK1_BURP8/152-309------------------------IA-FA------.D.GR--F..VFYD.....ETISK------------PPYK..VVV
B1KJ13_SHEWM/407-556------------------------VE-LK------.E.FD--I..KVTE.....NLASD------------.NTQ..WQV
A5G9K9_GEOUR/551-702------------------------VS-GA------.G.MN--I..VFTD.....GLLEE------------.RPS..FVL
A1K6C3_AZOSB/165-302------------------------LA-LR------.N.AT--L..TLID.....RASPD------------.AA...LAV
A0KK00_AERHH/151-307------------------------LA-AE------.Q.GH--I..TYQD....SRKQSS------------PGWVPSLTL
Q1H1L3_METFK/780-927------------------------IR-ID------.N.AN--L..EFAD.....LSLTP------------.QFG..THI
B9M7L7_GEOSF/383-534------------------------IS-GT------.G.VN--V..VFTD.....EMLAG------------.RPS..FTF
Q0F0H3_9PROT/538-688------------------------LI-VA------KG.SR--A..EMRD.....ASVLP------------.AFDTRMVV
A4SXW3_POLSQ/414-561------------------------LG-MK------.N.GE--V..FFTD.....LAMRP------------.NFK..VDI
A6FDI0_9GAMM/443-592------------------------FN-LT------.N.YD--I..NIVE.....SWITK------------.ATK..WRI
B9M3X2_GEOSF/564-715------------------------VV-GK------.G.ID--V..SFRD.....EARSS------------.APR..FDL
A4G9D7_HERAR/154-308------------------------IE-LD------.K.GR--I..EFDD.....R..PA------------.QTV..HKI
Q21F55_SACD2/584-731------------------------IE-IL------.Q.SA--G..HFAD.....LSLPL------------.PFD..THI
Q7NY28_CHRVO/704-851------------------------IH-VQ------.N.GA--V..EFAD.....HGMTP------------.DFA..TRM
Q0JZH1_CUPNH/164-317------------------------IA-VT------.G.SS--F..GYDD.....K..QL------------.GSS..LRV
Q3K6Q1_PSEPF/144-295------------------------IQ-LA------.G.GN--L..HFVD.....ARPSE------------.PIE..FLY
A1TWZ4_MARAV/597-744------------------------LV-VE------.Q.GS--M..AYTD.....RTLEP------------.PFS..TAF
A4JK45_BURVG/159-312------------------------IQ-VN------.D.GR--I..DFDD.....R..LL------------.NER..HVV
B3E4B8_GEOLS/367-514------------------------LA-LT------.D.GA--V..SFHD.....RQPAG------------.GFK..SRL
Q2IFA1_ANADE/563-710------------------------VE-VV------.G.GR--V..ALVD.....RSVTP------------.AAV..VNL
A4SM57_AERS4/151-307------------------------LA-AV------.Q.GH--V..SYQD....SRKKNS------------AGWIPPLTL
Q1QTZ9_CHRSD/348-494------------------------LA-IE------.R.GA--V..AFTD.....RHLPR------------.PFA..LDF
Q11NN1_CYTH3/142-298------------------------FE-IH------.N.GK--I..KYND.....FHASP------------.KVD..IFV
Q9HV64_PSEAE/140-291------------------------IQ-LA------.E.GS--L..HFQD.....LRPSE------------.PVD..FSF
Q3SGZ4_THIDA/733-880------------------------LR-IT------.G.AN--A..EFAD.....LSLTP------------.QFG..TVM
Q3A6W6_PELCD/162-316------------------------LE-IT------.G.GL--I..HFRD.....DIRV.------------..TE..HTV
A4A3Z9_9GAMM/583-730------------------------FR-LR------.E.GR--L..DFAD.....ASLPL------------.HFK..TLI
Q316X0_DESDG/600-751------------------------AA-LQ------.N.SE--C..VLLD.....ETLPR------------.AAR..LTV
A8H2Y8_SHEPA/433-583------------------------IK-LK------.D.YQ--V..NLTE.....QLVTK------------.NTL..WQI
A6T355_JANMA/478-631------------------------IA-VS------.N.WS--A..RLED.....RSLPK------------.PAI..TTI
A1TWZ4_MARAV/166-321------------------------VT-ID------.G.GE--L..LFRD.....FSQGG------------DPAE..FRV
A6DTM8_9BACT/927-1074------------------------FT-LN------.N.AH--G..KFND.....LSISP------------.NFS..MSL
B9M7L7_GEOSF/592-739------------------------IT-MQ------.S.GT--L..SFTD.....RHVAG------------.GYT..TTF
Q222N5_RHOFD/496-646------------------------VE-LS------.K.FG--A..DVAD.....EGAG.------------..VK..VQV
A6T355_JANMA/155-309------------------------IE-ID------.K.GH--I..ELDD.....K..TA------------.QTK..HEI
Q1K3A0_DESAC/497-651------------------------FV-VD------GN.SQ--L..VIED.....QGVTP------------.SVR..LHG
Q3A6W6_PELCD/805-951------------------------LQ-IS------.D.AN--L..VMRD.....ERYQP------------.AVI..NRL
A5G9K9_GEOUR/769-916------------------------VT-MQ------.D.GT--L..AFTD.....RYVPR------------.EYS..TIL
A2SI01_METPP/623-775------------------------LS-CS------.N.CR--V..TLSD.....RSVKP------------.VAV..FGV
Q2T396_BURTA/231-384------------------------IQ-VN------.D.GR--I..DFDD.....R..LL------------.NAK..HVV
Q46V48_CUPPJ/649-808------------------------VG-LE------.G.GW--A..RLADYAPAEVNRGR------------.PVI..HQY
Q083W9_SHEFN/492-642------------------------IS-IA------.Q.YQ--V..KLGE.....GIASD------------KIIL..WQI
A8FUB9_SHESH/389-538------------------------VS-VK------.D.YA--L..NLQE.....SLLTK------------.NTP..WHI
Q083W9_SHEFN/725-872------------------------IG-FT------.D.SS--A..FFAD.....NSLTP------------.NFA..SGI
Q12MK5_SHEDO/654-801------------------------IR-FD------.K.SS--A..FFAD.....NSLNP------------.NFS..SGI
Q3SGZ4_THIDA/517-669------------------------LG-LN------.D.IA--V..EVVD.....RSPPT------------.PVR..LDV
A1ARF1_PELPD/573-725------------------------FQ-TD------.R.LN--L..AFTD.....KSREE------------.KPR..FTL
Q39RS7_GEOMG/801-948------------------------VI-LQ------.E.GT--L..AFSD.....HHMSR------------.EYD..TTF
Q603H4_METCA/502-653------------------------FV-LE------.D.FG--L..ALAD.....RTFAP------------.AIA..YDL
Q222N5_RHOFD/149-300------------------------LA-LE------.Q.GT--V..DMHD.....RRAGY------------...D..NTF
A8ZWF7_DESOH/412-569------------------------FV-LT------.G.GT--A..RFVDFAVAGPEDGP------------VEN....AI
A4XYD1_PSEMY/354-505------------------------VQ-LR------.D.YK--A..HLAD.....RVPQQ------------.EVA..VDV
Q484B1_COLP3/152-304------------------------FR-HN------.E.GI--I..NFSD.....QNRET------------.AYH..HTI
Q21F55_SACD2/154-306------------------------IQ-FS------.I.AR--I..DLLD.....QVPAT------------.PFA..TQL
Q3SGZ4_THIDA/147-307------------------------IR-IA------.D.GR--V..AYRD.....ANRAG------------EPFT..ALL
A7I315_CAMHC/662-807------------------------IK-LL------.G.GE--I..DFID.....HSLMI------------.PFD..IKI
Q74FC9_GEOSL/787-934------------------------VT-MQ------.A.GT--L..DFSD.....RHMPK------------.PYA..TTF
A7H8M2_ANADF/367-518------------------------LA-VT------.G.LA--V..ELED.....RTPAR------------.PVV..LPL
F2GAL8_ALTMD/716-863------------------------VS-IE------.N.GR--A..YFAD.....HSLTP------------.KFA..SAI
Q5DZ89_VIBF1/610-757------------------------IA-FN------.N.GS--A..FFAD.....NSLTP------------.NFS..SGI
A4XYD1_PSEMY/562-709------------------------VA-IN------.D.GS--A..NFAD.....FSLTP------------.SFA..TAI
B3E4B8_GEOLS/583-736------------------------IN-VT------.G.LS--T..TFAD.....KQFSE------------.PPV..FTL
A6GL92_9BURK/612-759------------------------FN-IA------.N.SE--M..DFAD.....ESLFI------------.PFG..TRI
Q2BL34_9GAMM/505-657------------------------IN-LS------GN.NP--V..SVVD.....KGVKP------------.SFK..TDL
C1DFK3_AZOVD/141-292------------------------FL-LS------.A.GQ--I..HFQD.....QQPSE------------.PVE..VRY
Q1LGA7_RALME/681-840------------------------MA-VD------.G.GS--A..RLADYEPAEANRGR------------.PVI..HQF
Q1JXN5_DESAC/795-942------------------------VT-LQ------.G.GT--V..SFTD.....RHLPS------------.TFA..TTM
B5ECC6_GEOBB/807-954------------------------VT-IQ------.N.GT--L..SFTD.....NHLPQ------------.TFN..STF
Q2IFA1_ANADE/358-509------------------------LA-VS------.G.LA--V..DVED.....RSTAR------------.PVR..LPL
A4XYD1_PSEMY/140-291------------------------LH-LR------.E.KA--L..HFQD.....LRPSE------------.PVE..FAY
A7H8M2_ANADF/165-318------------------------LA-VE------.E.AS--V..TFRD.....ATRRP------------.AFD..TLL
A3QD21_SHELP/453-602------------------------IS-LS------.N.YQ--L..NLTE.....QLFKE------------.ENL..WQI
Q3A6W6_PELCD/588-738------------------------LK-LV------.D.GQ--I..SIGL.....EGPRQ------------.TST..AVF
A7H8M2_ANADF/579-726------------------------VQ-VV------.R.GR--A..SFVD.....RSVSP------------.PAL..VNV
A8ETY5_ARCB4/612-759------------------------VN-IK------.N.AV--L..DFED.....KNLPI------------.PFK..TTV
Q30NX8_SULDN/772-919------------------------LK-VT------.N.GS--A..NFAD.....YSLPL------------.DFK..TAI
A6FDI0_9GAMM/664-811------------------------FT-LV------.G.GK--V..DYTD.....NVLKP------------.SFA..AVI
A6DTM8_9BACT/382-537------------------------.E-VR------.G.EK--LNAYFTD.....ESTQE------------.KPH..AKI
A4VPN2_PSEU5/125-276------------------------LQ-LV------.R.GH--L..AFRD.....RRPSE------------.PIE..LVY
Q1LGA7_RALME/173-326------------------------IA-VT------.N.TS--F..VYED.....K..LL------------.NTV..QRV
Q1H1L3_METFK/561-712------------------------FA-IE------.D.AG--L..HFRD.....QSANS------------.PVA..LDI
Q222N5_RHOFD/710-857------------------------LR-LQ------.N.AK--L..DFTD.....LSLRP------------.QFS..AKI
C1DFK3_AZOVD/584-731------------------------VE-IK------.N.GS--A..NFAD.....FSLRP------------.NFA..TAI

PF13116

A3ZDT1_CAMJU/201-486------------------------YH-LD------YLQGF--I--DF-------TKDNYYL..........DNISASGYV
A4THD4_YERPP/510-796------------------------VD-NA------TLVYN--G--NP-------HD.FPYK.....NKE..GQFQVYVPL
A1RP07_SHESW/505-792------------------------SQ-NA------QVLWQ--G--AL-------AN.FPFD.....DNS..GVFQAAFTL
B5F9M1_VIBFM/506-792------------------------AK-TV------QLLWY--G--EL-------DD.FPYT.....KYD..GIFQVKVGL
B5REW7_SALG2/474-759------------------------AD-NA------TLVYG--G--NP-------HL.FPYK.....HNE..GQFEVLVPL
C4X0M1_KLEPN/504-789------------------------AS-DA------TLVYG--G--NP-------HL.FPYP.....HNE..GQFQVYVPL
C6XK02_HIRBI/457-744------------------------AT-KL------NFFMD--F--PP-------GTNSKPI.....VPD..KALTLDFRV
C6DIL6_PECCP/503-788------------------------VD-NA------TLIFA--G--NP-------QH.FPYT.....HNE..GQFEVWVPV
D2YHX2_VIBMI/503-791------------------------VN-TA------KLVWY--G--AL-------DQ.FPYR.....MHN..GVFQAWVGL
Q7NW94_CHRVO/514-796------------------------AR-NV------RMKLA--G--NL-------DQ.FPFP.....GGKD.GEFLVEADI
Q7N037_PHOLL/501-786------------------------IE-NA------TFVFQ--G--NP-------KD.FPFA.....KNN..GQFQVFAPL
A7ZDM6_CAMC1/160-458------------------------YH-LN------EINGK--V--DL-------AKNDFYL..........NDLNATAYA
A4XQL3_PSEMY/513-798------------------------VE-EG------YFQYQ--G--SL-------NK.GASL.....GARSLSLF...FQV
Q3J7T7_NITOC/517-810------------------------AA-EG------SLVFQ--G--PW-------SH.FPSS.....RDG..SQLTVELDI
C3XNN9_9HELI/210-498------------------------VQ-IN------DFSLT--I--PL-------KSNHILQ.......DSINSLYVLATA
Q0HZG8_SHESR/505-792------------------------SQ-NA------QVLWQ--G--AL-------AH.FPFE.....DNS..GVFQAAFSL
D5CU11_SIDLE/524-805------------------------AD-KF------RVRLR--G--DL-------RD.FPFV.....GNKR.GIFKLEARA
A3YBT0_9GAMM/494-783------------------------AT-SL------DFSLS--T--KL-------VE..........KPD..PKIEVNLDV
B2PXM1_PROST/492-780------------------------AK-DA------TVVFK--G--DP-------KH.FPFN.....QND..GQFQVFVPL
C3X5K0_OXAFO/598-890------------------------VS-EG------MIQIK--G--DL-------AD.FPYA..S..GKTE.GLFTVQAKL
A1AVR0_RUTMC/242-525------------------------LD-NI------NISIK--K--NL-------STQLP............AKIKFDAHL
D1RKZ9_LEGLO/542-830------------------------EA-SG------RIRLN--G--LA-------KD.FPFD.....DNT..GEFTIDSFA
B6XFK3_9ENTR/506-794------------------------VD-NA------TLVYK--G--DP-------AH.YPYY.....KND..GQFQVYVPL
B9D263_WOLRE/198-487------------------------YF-VK------SLRGK--F--NL-------GSQEPYL..........NELSAQGFS
Q31FH6_THICR/496-774------------------------GI-KG------RLRVK--G--DL-------ND.FPFR.....HQE..GLFEATADI
A6D042_9VIBR/509-797------------------------VN-TS------KLLWY--G--KL-------SD.FPYR.....EHN..GMFQAWVGL
Q48EA0_PSE14/513-795------------------------VK-QG------FFQYQ--G--SL-------NK.SSPD.....TARVISLF...FDV
Q2NWP0_SODGM/504-789------------------------VD-NA------TLVFA--G--SP-------SR.FPFK.....HND..GQFEVWVPL
B8GV04_THISH/540-825------------------------VT-EG------TVVYR--G--PF-------TR.LPFE.....EGE..GEFEVRARV
A9KBH4_COXBN/479-764------------------------IT-SG------TVNFK--G--PL-------DR.FPFL.....HQE..GSFDAIANV
A8H923_SHEPA/510-797------------------------TD-DA------IVVWH--G--AF-------SG.YPYA.....QHD..GIFQAGFTL
B3CN56_WOLPP/322-604------------------------II-NT------IISFN--G--KI-------DS.....L....INDDLSGIVIVADI
B0KQG7_PSEPG/513-795------------------------VD-EG------YFQYQ--G--SL-------NH.GAVP.....EARSISLF...FKV
A0RPG5_CAMFF/10-294------------------------YT-LY------SLHGK--L--NL-------KNFDFYP..........NELYAKAVA
D2C1Z1_DICD5/509-794------------------------VD-NA------TLVFA--G--NP-------AQ.FPFE.....HQE..GQFQVWVPL
D4GCB7_PANAM/504-789------------------------VD-NA------TLLFN--G--NP-------AL.FPFQ.....HND..GMFQVWVPL
Q07WQ4_SHEFN/504-791------------------------IN-DA------QVVWH--G--AL-------GD.YPYQ.....DSS..GVFQADFTL
Q5ZUN8_LEGPH/507-795------------------------QA-TG------KITIN--G--MA-------KD.FPFD.....NGN..GEFSIVSHV
Q7VFV2_HELHP/222-511------------------------LK-LH------SLRFQ--S--TL-------NKHFFAQ........LQKTLALDLAI
D2TDE3_ERWP6/503-788------------------------VH-NA------TLLFA--G--DP-------HQ.FPFA.....HHE..GMFEVAVPL
A8T949_9VIBR/505-792------------------------AN-TA------KLLWY--G--EL-------GD.FPYK.....QNN..GLFQAWVGL
C0F958_9RICK/390-675------------------------VL-NT------IVSFN--G--KI-------NN.....L....VDDDLSDIVIVADI
C8PGF2_9PROT/201-488------------------------YY-IE------NLHAK--V--DL-------KDPRPIA..........ENVSATAYA
Q12IX1_SHEDO/530-817------------------------IP-DA------SVVWH--G--AL-------SH.YPYE.....DNS..GVFQAGFTL
Q15ZG8_PSEA6/490-776------------------------VN-GA------KILWN--G--EL-------SQ.FPYA.....NNQ..GVFQITVGV
C9P9S4_VIBFU/504-791------------------------VT-TA------KLVWY--G--EL-------DH.FPYQ.....HHN..GIFQAWVGL
A6Q385_NITSB/202-483------------------------YR-LQ------FFEGK--I--DL-------KKGFDP...........NLFKGRAVA
A8GK60_SERP5/523-808------------------------VD-NA------TLLYN--G--DP-------QH.FPYR.....KHE..GQFEVFVPL
B8K935_VIBPA/486-773------------------------VD-TA------KLLWY--G--EL-------AN.FPYK.....NND..GMFQAWVGL
Q3IFH7_PSEHT/493-781------------------------VS-KA------QVLFA--G--PL-------TG.FPFS.....DGS..GQFDVLAQI
A8PNA6_9COXI/430-712------------------------SS-VG------SLVLQ--G--PL-------NQ.FPFD.....KHN..GTFLIDTHI
A7GYI8_CAMC5/195-484------------------------YT-VN------EMNGK--F--DL-------KNENFYL..........NDLNATAVA
D9SHW3_GALCS/523-805------------------------TE-DF------RLRLK--G--NL-------SD.FPLN.....GSTP.SLFEIGARA
C7R9G7_KANKD/505-791------------------------VE-RA------KLVWR--G--GV-------EA.FPYQ.....DES..GQFYVEAKV
A4SSL2_AERS4/495-781------------------------AK-GA------DLLWY--G--EF-------KD.FPYS.....KGE..GIFQVAVPL
Q21FT5_SACD2/542-827------------------------IK-NV------GFLYS--G--SV-------MK..........DPEVRPTIQVFGDV
B9KGG1_CAMLR/206-490------------------------YF-IE------KLTGF--A--DF-------GKHRYYL..........NDISAKGYV
A3UZ19_VIBSP/503-790------------------------AD-TV------KLLWH--G--DL-------SQ.YPYT.....NHD..GIFQVWVGL
B6INC8_RHOCS/363-622------------------------YD-RT------EFELE--A--TA-------PADDPAA.....LEP..TRMQGRFAF
C0AZI2_9ENTR/255-539------------------------ID-NG------TFIFH--G--DP-------AD.FPFD.....NHK..GWFQVYAPV
A7MJB2_CROS8/518-803------------------------VE-NA------TLVYV--G--NP-------QH.FPYK.....QND..GQFEVYVPL
C9QN32_VIBOR/503-790------------------------VN-TA------KLLWY--G--EL-------GD.FPYQ.....NNN..GMFQAWVGL
C2LNU1_PROMI/500-784------------------------VK-NG------TFIFH--G--DP-------RD.FPFE.....QHN..GWFQVYAPV
A6SW78_JANMA/540-840------------------------LR-DA------RIKLK--G--DL-------AH.FPFHTTKPNEKPK.GEFTFGGRI
C6XD69_METSD/519-799------------------------GQ-DI------NVTVK--G--NL-------HD.FPYP.....NNKT.GLFRVTAKI
A7I2E8_CAMHC/213-497------------------------YE-IK------KFVAK--I--NL-------KSGEIFK..........DDFLADGIL
Q6LMA6_PHOPR/509-794------------------------AD-AA------QLLWY--G--EL-------SD.FPYQ.....NNE..GIFQAKVPL
D0L1I5_HALNC/561-853------------------------VD-RG------HFVFN--G--DP-------AR.FPFI.....KGG..GWFSVVFDF
A3Q9Y2_SHELP/509-796------------------------SQ-DA------KVVWN--G--PL-------KH.FPYD.....DNS..GVFQAGFSL
A6QAC9_SULNB/206-494------------------------YR-LY------MLTGK--G--IV-------HGTDFKL.....DWNSLKG...NALL
A8EUE5_ARCB4/193-478------------------------FK-LD------WLYGE--Y--DL-------KKNELVQ..........NSIEGKAHI
A8FQQ2_SHESH/504-791------------------------TQ-DA------RVVWH--G--PL-------NQ.YPYK.....DHS..GIFQAAFTL
C5ZX33_9HELI/208-498------------------------AQ-IK------EFSLT--L--PL-------DSKNLIK.......DSLDSLYVVGEI
D0I525_VIBHO/503-790------------------------AD-HA------KLVWY--G--DF-------AT.FPYP.....EHQ..GIFQAYVPL
Q1H0H5_METFK/520-800------------------------SE-DV------SIIVK--G--NM-------RE.FPFA.....DNKN.SLFQVKAKI
A9D952_9GAMM/504-796------------------------IQ-DG------VVVWN--G--AL-------SD.YPYL.....NHS..GVFKANFTL
C0N416_9GAMM/506-794------------------------IR-TG------QMKLK--G--DL-------EA.FPFD.....AESEQGTFDLALQV
Q7MRT1_WOLSU/187-475------------------------ME-LA------SFSFD--S--EL-------NEKAILE.......SIEKRLKARLEI
Q2C0H6_9GAMM/506-792------------------------VK-DA------ELLWF--G--PL-------NT.FPYP.....NHD..GVFEVKVPL
B1KJH7_SHEWM/508-795------------------------TQ-DA------KVLWH--G--PL-------AN.YPYF.....DHS..GVFQADFTI
Q47VG9_COLP3/504-793------------------------VE-DA------QVLIN--G--PI-------SR.FPFT.....DGS..GIFVVDAEL
A4G3G0_HERAR/587-887------------------------LN-DG------YIRLK--G--DL-------NQ.FPFHTQKAAEKSK.GEFIFGGKI
D1B1Z5_SULD5/203-493------------------------YV-LH------FLEGI--L--DI-------QTGEYFP..........MQMRGHATV
D3V5J7_XENBS/502-797------------------------IE-NA------TLLFQ--G--NP-------HD.FPFK.....QNN..GQFQVWVPL
A6GR98_9BURK/554-836------------------------AK-NG------QFELS--G--RL-------SD.FPFA.....DPKHPGVFRIDVPI
D4E146_SEROD/303-588------------------------VD-NA------SLIFS--G--NP-------HH.FPFE.....KNE..GQFEVYVPL
A4C806_9GAMM/497-784------------------------IT-QA------QLLWY--G--AL-------NG.FPYQ.....DQS..GKFEVRAQI
E6WGF8_PANSA/504-789------------------------VD-NA------TLLFA--G--DP-------TL.FPFR.....HND..GMFEVWVPL
Q4HS43_CAMUP/200-483------------------------YH-LD------FLEGF--A--DF-------SKKEYYL..........DELKARGFA
Q8DCG6_VIBVU/507-794------------------------VN-TA------KLLWY--G--EL-------AD.FPYT.....KND..GMFQAWVGL
C5F1J2_9HELI/186-475------------------------AK-IN------DFSLT--I--PL-------KFDNILT.......ESLNSLYVSGEV
C9P2T1_VIBME/504-791------------------------VD-TA------KLLWY--G--EL-------AA.FPYQ.....DNN..GIFQAWVGL
Q5GSY1_WOLTR/325-607------------------------IL-NV------IVSFN--G--KI-------NN.....L....INNDLSDVIVVADI
F2G3T4_ALTMD/500-787------------------------IE-NA------RVLWH--G--RT-------RD.FPFE.....DNS..GIFQAYVDI
D1KAX2_9GAMM/256-540------------------------LS-NV------KLNVK--K--NL-------SKQTP............AEIKVNAHL
A0Y2B2_9GAMM/494-782------------------------IS-KA------QVLFA--G--PL-------SG.FPFK.....DGS..GQFDVLAQI
A3WPW6_9GAMM/495-781------------------------VK-QM------TLAWR--A--EH-------FM.LPRN.....INQ..GVFNASVQF
Q4HHM4_CAMCO/202-487------------------------YH-FD------FIQGF--I--DF-------SKNNYYF..........DDISAWGYA
A5CXF5_VESOH/244-528------------------------ID-NI------NIDIK--K--NL-------SKELP............AKIKINAHL
Q0AGL5_NITEC/528-819------------------------LH-DT------RFHVK--G--TL-------NS.QSTD.....KKNR.LSIRAETDI
D3VKA4_XENNA/501-791------------------------VD-NA------TLIFQ--G--NP-------HD.FPFK.....QNN..GQFQVFVPL
C6C4M2_DICDC/503-788------------------------VD-NA------TLVFA--G--NP-------HD.FPFE.....HQE..GQFQVWVPL
C3XBS4_OXAFO/577-871------------------------VS-EG------VIQIK--G--NL-------AD.FPYSVEK..KKNT.GVFKVNAKI
Q0ABM3_ALHEH/531-818------------------------VT-EA------RVHWD--G--PL-------SG.ERFR.....QGE..VAFQAGGRV

PF13109

A0RPG5_CAMFF/433-647----------------------------------------------------------VNDFLG..----------...L
A1VYN9_CAMJJ/621-835----------------------------------------------------------LNEFLQ..----------...K
A6DEH3_9PROT/738-953----------------------------------------------------------LVPLLDF.----------..FN
A6Q385_NITSB/623-836----------------------------------------------------------LHKLFK..----------...M
A6QAC9_SULNB/640-854----------------------------------------------------------LHPLIN..----------...F
A7GYI8_CAMC5/627-841----------------------------------------------------------VNQLFG..----------...I
B2UTP1_HELPS/745-958----------------------------------------------------------INTILQ..----------...K
B6BK75_9PROT/827-1037----------------------------------------------------------MDKLFA..----------...L
B9D263_WOLRE/627-841----------------------------------------------------------INSIFN..----------...I
B9KGG1_CAMLR/634-848----------------------------------------------------------LNTFMR..----------...Q
B9L5J2_NAUPA/583-798----------------------------------------------------------FKAFLP..----------...K
C3XGB2_9HELI/333-551----------------------------------------------------------INIILASA----------KGGK
C3XNN9_9HELI/639-853----------------------------------------------------------LNTIAN..----------...K
C5F1J2_9HELI/616-830----------------------------------------------------------FNTLIG..----------...Q
C5ZX33_9HELI/638-852----------------------------------------------------------VNALAN..----------...K
D3UGW6_HELM1/730-943----------------------------------------------------------INMVAK..----------...K
Q30RQ8_SULDN/697-907----------------------------------------------------------MEKIFS..----------...L
Q4HHM4_CAMCO/634-848----------------------------------------------------------LNEFLQ..----------...K
Q4HS43_CAMUP/629-843----------------------------------------------------------LNTFLQ..----------...K
Q7MRT1_WOLSU/616-829----------------------------------------------------------VNTFFN..----------...K
Q7VFV2_HELHP/731-944----------------------------------------------------------LNRVWQ..----------...R

PF13502

A0KFB2_AERHH/999-1241LA..G......-------------------------...AD.GM..Q...........TRARAH---------------I
A0YA02_9GAMM/903-1114KP..E......-------------------------...GD.SY..V...........LESQLR---------------A
A1S2S6_SHEAM/1130-1371LM..D......-------------------------....V..N..Q...........TRMEFS---------------L
A1STZ9_PSYIN/1024-1262DQ.........-------------------------.......Y..K...........TNLIVK---------------S
A1TW53_ACIAC/1117-1369VL.LG......-------------------------...GG..A..TAP......RRRTSMDFR---------------L
A1U479_MARAV/979-1225SI..V......-------------------------...DD.RE..T...........TRFTGK---------------L
A1WCZ7_ACISJ/1139-1390AL.VGS.....-------------------------.GAQA.QR..R...........TVMDFE---------------L
A1WSB5_VEREI/1101-1362NA..TG.....-------------------------.PGA......GPRP....AERRTALSFE---------------L
A1WYY8_HALHL/891-1129RS..T......-------------------------..........G...........TALRGR---------------L
A1ZG80_9BACT/721-947DT.YD......-------------------------...VT.HP..K...........YDFKMN---------------I
A2TRX7_9FLAO/566-791TT..R......-------------------------...DG.AP..T...........FNMTVD---------------L
A2U2U5_9FLAO/567-793ST..K......-------------------------...NN.AS..T...........FKVDLD---------------L
A3HUH0_9BACT/675-900DS..RD.....-------------------------..LST..P..K...........FNFDLN---------------V
A3I060_9BACT/816-1020QA..T......-------------------------...DPFSA..T...........FAYQID---------------A
A3J4A5_9FLAO/560-786ST..K......-------------------------...GN.TP..K...........FDMDLG---------------L
A3J4S5_9FLAO/687-891KN..EG.....-------------------------..TQK..A..Y...........FDYKIN---------------A
A3JK78_9ALTE/987-1233LL..Q......-------------------------...GQ.NQ..V...........SRFKGS---------------V
A3Q9Y2_SHELP/1046-1289SN..S......-------------------------...EG.QN..L...........TEFQVD---------------L
E0TB83_PARBH/837-1047AG..E......-------------------------..........G...........QDAKLM---------------V
A3WPW6_9GAMM/1014-1255MV..S......-------------------------...EG.QP..L...........TQLSGE---------------L
A3XKT3_LEEBM/574-799ST..K......-------------------------...NT.TP..T...........FEMALD---------------L
A3YBT0_9GAMM/1003-1247QD..D......-------------------------...EH..S..N...........VELSLN---------------V
A4AMF6_MARSH/560-785ST..K......-------------------------...NQ.LP..N...........FRMKLN---------------M
A4BQN1_9GAMM/991-1233DD..N......-------------------------...EP.RG..H...........STIELN---------------V
A4C0T1_9FLAO/568-794ST..A......-------------------------...EK.RS..K...........FALDLN---------------L
A4C806_9GAMM/1004-1241QA..G......-------------------------..........Q...........TKLAGQ---------------F
A4CG41_ROBBH/574-799AT..G......-------------------------...EG.LP..R...........FNMDLG---------------I
A4VIB7_PSEU5/1014-1255GA..G......-------------------------...QS.................W.YKGR---------------L
A5CF63_ORITB/620-836LM.........-------------------------...SP..L..A...........MTLVYA---------------Y
A5EPF4_BRASB/898-1114RS..N......-------------------------...AN.GL..V...........LNGRVE---------------L
A5FBT6_FLAJ1/701-905KD..E......-------------------------..SPT.SA..H...........FDAHFT---------------A
A5FJ68_FLAJ1/564-791ST..K......-------------------------...SK.VP..T...........FDMNLG---------------F
A5FJN3_FLAJ1/697-901QA.VT......-------------------------..PQK..A..N...........FDYAVK---------------A
A5FUN1_ACICJ/745-973TG..AA.....-------------------------..GST.PA..T...........LSLQAS---------------L
A5ICR0_LEGPC/1014-1262LQ..K......-------------------------...GK.FN..Q...........TKLQSK---------------M
A6C314_9PLAN/969-1200DV..KPAV..L-------------------------VFEKGDVI.DN...........FQFTPE---------------M
A6CFZ4_9PLAN/844-1050EL..N......-------------------------...DI..P..T...........YNMQIE---------------L
A6EDA1_9SPHI/197-401KS.LN......-------------------------...PR.SA..T...........FNYHIL---------------A
A6F4Z2_9ALTE/986-1232SI..A......-------------------------...AG.RE..I...........TRFTGD---------------I
A6FEV3_9GAMM/980-1223DA..Q......-------------------------...GK..Q..A...........TQLRGE---------------L
A6GWN8_FLAPJ/560-787ST..K......-------------------------...GK.VP..T...........FSMNLD---------------L
A6SW78_JANMA/1081-1328LA..K......-------------------------...KS.GN..S...........SSLDYS---------------M
A6U693_SINMW/393-597SE..K......-------------------------...GL.EQ..G...........GKLQAS---------------L
A6UB33_SINMW/880-1101GN..A......-------------------------...NG.SG..Y...........LRSRLD---------------L
A7AAH7_9PORP/866-1069RAKNG......-------------------------...QE..A..T...........AGLDLD---------------M
A7HEC2_ANADF/581-801VA..R......-------------------------...PD..A..P...........FEVALD---------------L
A7HWU4_PARL1/297-497DG.........-------------------------...GA..N..R...........VNVDVN---------------A
A8EI17_BURPE/1120-1377RT..S......-------------------------...RR.AL..AHGADEEDAPRRTVFDFT---------------L
A8GRQ7_RICRS/625-850LL.........-------------------------...EP..Y..A...........INFVYA---------------L
A8PNA6_9COXI/753-1000HI..Q......-------------------------...GS..H..S...........TELRGQ---------------L
A8UEF9_9FLAO/566-791ST..K......-------------------------...EA.KP..I...........FDMKLA---------------M
A9CIC7_AGRT5/884-1105ST..G......-------------------------...EG..A.GI...........FRSKIA---------------V
A9DPS2_9FLAO/819-1056NG..SD.....-------------------------..PKH..I..Y...........MQPDLV---------------M
A9H3V6_GLUDA/474-684DG..R......-------------------------...HL.WA.SV...........QDLGLM---------------L
A9VZI8_METEP/849-1067AR..P......-------------------------...AG.AA..A...........VSGEGS---------------V
B0NQ23_BACSE/741-944QA..K......-------------------------...SPEEG..F...........AGFDFR---------------L
B1KJH7_SHEWM/1029-1272NN..S......-------------------------...AD.EN..L...........TEFNVK---------------L
B1XRV0_POLNS/1079-1327VG..G......-------------------------..TQNAPA..H...........TNLNID---------------L
B1XVC5_POLNS/28-239AG.FD......-------------------------...ST.AP..K...........ISFKGL---------------A
B2FP42_STRMK/1008-1250LG..R......-------------------------...TG.GA..R...........TELTAQ---------------V
B2PXM1_PROST/1000-1242QS..G......-------------------------...KQ..N..R...........TQIAGS---------------L
B3JDW0_9BACE/854-1057RA..Q......-------------------------..EKK..Q.GY...........AGFDFR---------------L
B3PTQ9_RHIE6/884-1105TN..A......-------------------------...DG.TG..F...........LQTKLA---------------L
B3R439_CUPTR/1186-1441RV..P......-------------------------...RR..L..RADAT...AERRTLLSFA---------------I
B4D2P2_9BACT/252-462HN..E......-------------------------...GE.HS..P...........FKIAVN---------------F
F2G3T4_ALTMD/1046-1287KH..V......-------------------------...GR.DI..Q...........SAIKGS---------------L
B4S7D6_PROA2/551-781ST..K......-------------------------...GG.KA..D...........TEFSAE---------------A
B4WWS5_9GAMM/996-1238TE..D......-------------------------...SG.NQ..Y...........TRFNGS---------------L
B5D2W9_9BACE/743-946RA..R......-------------------------..RKT.RG..Y...........AGFDFR---------------L
B5RZT4_RALSL/864-1116RI..PRRL...-------------------------RGGDD..PERR...........TLLDFR---------------L
B6C3U8_9GAMM/392-603DQ..S......-------------------------...KN.NL.TE...........ADLRLN---------------V
B6ELQ6_ALISL/633-885ER..K......-------------------------...KG..W..K...........GELSKA---------------D
B6JB61_OLICO/637-850QR..G......-------------------------...AA.DT..A...........IEASFK---------------L
B6XFK3_9ENTR/1013-1256HS..N......-------------------------...NG..N..K...........TEIAGS---------------L
B7RTJ0_9GAMM/1040-1283TW..N......-------------------------...QG..Q..N...........SELQAM---------------F
B7RZC0_9GAMM/833-1042EA..L......-------------------------...DD.AL..T...........VSVNTQ---------------G
B7VIB8_VIBSL/1027-1268EL..Q......-------------------------...GD.KS..H...........SSLTLD---------------V
B8B0X9_ORYSI/279-522KQ..N......-------------------------...AQ.EE..R...........SSLKGK---------------L
B8CI63_SHEPW/997-1240SI..L......-------------------------...DG.ES..L...........TSFSLT---------------L
B8DNW5_DESVM/971-1157TS..G......-------------------------...DA..L..A...........TRLVLD---------------A
B8J2T2_DESDA/848-1034TF..N......-------------------------...KG..L..S...........FSNSLT---------------I
B8KWT1_9GAMM/869-1081TP..A......-------------------------...EK.GT..R...........VALRAT---------------G
B9BCU5_9BURK/1099-1356RT..S......-------------------------...RR.AL..ARGVEESEAPRRSVFDFR---------------L
B9XF33_9BACT/756-966DFAHR......-------------------------...KG..A..D...........FGFDFI---------------V
B9Z3I6_9NEIS/1017-1259SD..G......-------------------------...AT..P..R...........VDVDFK---------------L
C0N416_9GAMM/1005-1255LK..T......-------------------------...DT..A.DR...........SQFDIV---------------V
C1D9M5_LARHH/1015-1258RT..Q......-------------------------...DG.QM..R...........SQLNVQ---------------L
C2M1Y5_CAPGI/573-798ST..K......-------------------------...GD.TS..T...........FSVDLD---------------M
C3K7G5_PSEFS/1015-1260EG..A......-------------------------...AG.DS..S...........SWYKGR---------------L
C3L4A9_AMOA5/534-754ST..K......-------------------------...AD.SL..E...........IYTYAN---------------L
C3MGL5_RHISN/425-630SD..Q......-------------------------...GL.EH..G...........GRLQAR---------------L
C3XBS4_OXAFO/1106-1353IS.ST......-------------------------...GN.KQ..Q...........TKLNYV---------------L
C4L8L8_TOLAT/989-1232SI..K......-------------------------...NY.QP..L...........STLKGK---------------F
C4U7R6_YERAL/1011-1254QQ..D......-------------------------...GN.GD..K...........TAFNIT---------------L
C4UIL5_YERRU/1014-1257RK..N......-------------------------...GD.DN..T...........TSLTAK---------------V
E8RSC3_ASTEC/1136-1358LT..R......-------------------------...LG..S..L...........VTLDFK---------------P
E3IRW1_DESVR/941-1125EA..G......-------------------------...AG..L..T...........TRLRFD---------------A
D9SHW3_GALCS/1021-1263RS..E......-------------------------...QT.SM..Q...........TQVNLL---------------L
C6B1K3_RHILS/408-616TQ..R......-------------------------...DF.DG..G...........GKLRLS---------------I
D5CU11_SIDLE/1024-1263QA.........-------------------------...KP..E..Q...........TQVKLR---------------V
D8JRU2_HYPDA/915-1130DK..S......-------------------------..........T...........GTRRLL---------------V
C6UUQ9_ECO5T/1009-1252IN..N......-------------------------...PG.NE..R...........TSLKGK---------------L
C6WWM2_METML/1053-1294NN.WV......-------------------------...RN..A..N...........TSLNVR---------------W
C6XD69_METSD/1043-1284HN..W......-------------------------...KR.NP..N...........TRITLN---------------W
C6XK02_HIRBI/884-1092DG..G......-------------------------.......................DIAFQ---------------L
C6XTR4_PEDHD/806-1010QS..I......-------------------------...NPLSA..T...........FDYHIQ---------------A
C7BLT0_PHOAA/1013-1256QE..S......-------------------------...AV.GN..S...........THLMGQ---------------F
C7JI05_ACEP3/380-581LA..G......-------------------------...QK.GT..R...........VQATVN---------------V
C7PC84_CHIPD/564-796ST..KN.....-------------------------..SKT.NP..D...........INMAYS---------------V
C7PJB3_CHIPD/809-1013TP.LS......-------------------------..EQS..A..A...........FDYRIN---------------A
E6WGF8_PANSA/1014-1257VN..K......-------------------------...PG.EQ..R...........TSLKGT---------------L
C9NN95_9VIBR/1009-1250LL..T......-------------------------...KD.QS..H...........TKFNIV---------------M
C9P2T1_VIBME/1028-1269TL..T......-------------------------...ED.HS..H...........TLMNID---------------M
C9PMQ2_9PAST/191-392NA..Q......-------------------------...SD.SI.SA...........KKIHIQ---------------G
D0HXR9_VIBCL/115-356TL..T......-------------------------...DT.QS..R...........TQMNLD---------------M
D0I525_VIBHO/1024-1266SI..T......-------------------------..RQG.FN..H...........SDLTFD---------------V
D0TG62_9BACE/829-1032KT..D......-------------------------...QE..A..T...........MGFELS---------------L
D0Z1U4_LISDA/1035-1276QI..K......-------------------------...GN.TS..T...........TQLSAK---------------I
D1JQS4_9BACE/740-943KA..G......-------------------------...SPRGG..Y...........AGFDFK---------------I
D1RKZ9_LEGLO/1049-1297TE..K......-------------------------...NK.VN..Q...........TKLDVK---------------L
D5WC43_BURSC/1144-1399RT..STELPIS-------------------------ADEAT..P.RR...........TVFDFK---------------L
D2C1Z1_DICD5/1022-1265QE..S......-------------------------...GE.GT..R...........TAIKGQ---------------L
D2U2L7_9ENTR/1008-1250QA..D......-------------------------...QQ..N..R...........TSIRGI---------------L
D2UF54_XANAP/1023-1265RG..K......-------------------------...GA.AA..H...........TQLSAR---------------V
D2ZL55_9ENTR/1006-1249VN..N......-------------------------...PG.GQ..R...........TSLKGD---------------I
D3SBX9_THISK/1040-1287HVLAD......-------------------------...GR..P..D...........TRLDIR---------------L
D4BXD7_PRORE/987-1229NS..E......-------------------------...KG..N..K...........TQIAGS---------------L
D4EGY4_AGGAC/176-377VS..E......-------------------------....P..E..K...........SAVGFS---------------A
D4GCB7_PANAM/1019-1262VN..R......-------------------------...PD.DQ..R...........TSLKGT---------------L
D4HUV7_ERWAC/1008-1251VN..R......-------------------------...AG.EQ..R...........TALKGV---------------L
D4IQI7_9BACT/568-774ST..AA.....-------------------------..DPA.RP..V...........LKLDAA---------------V
Q0ABM3_ALHEH/1048-1290HY..R......-------------------------...DG.GH..R...........TELKSR---------------L
Q0AQ38_MARMM/879-1092SE..T......-------------------------...GG..Q..............RD..FR---------------I
Q0BUM1_GRABC/651-853DW..R......-------------------------...RD..G..T...........LSAALD---------------A
Q0BY26_HYPNA/311-513DG..S......-------------------------...QS.PA..M...........TTAEGK---------------L
Q0G0J1_9RHIZ/903-1122RN..L......-------------------------...DG..L.GS...........ISADIR---------------S
Q11U15_CYTH3/815-1020NT.VD......-------------------------...SN.RP..F...........FDVHLD---------------I
Q11YL6_CYTH3/532-755RILNE......-------------------------...KT..V..E...........INADAR---------------I
Q11YT8_CYTH3/698-925NT..QD.....-------------------------..ITK..P..S...........FAMDML---------------M
Q134A2_RHOPS/861-1075KP..G......-------------------------...DA.GV..A...........LDANVA---------------V
Q145G0_BURXL/1154-1409RT..STDL...-------------------------GSSA......DEAT.....ARRTVFDFK---------------L
Q15ZG8_PSEA6/1002-1243LF..T......-------------------------...PR.GN..Q...........TKIEGE---------------F
Q1MYL9_9GAMM/998-1245QK..AR.....-------------------------..ANQ.PP..L...........TSVDLR---------------L
Q1RIG6_RICBR/624-851LL.........-------------------------...DP..Y..S...........LNFVYA---------------L
Q1VS98_9FLAO/575-799TT..S......-------------------------...DV..P..N...........FDMKLG---------------L
Q1YH64_MOBAS/407-618HS..T......-------------------------...SE.RP..T...........ATGSLT---------------L
Q1YJ92_MOBAS/882-1101RN..A......-------------------------...DG..L.GR...........VTLDAA---------------T
Q1Z1R2_PHOPR/1035-1276TL..D......-------------------------...GG.QN..E...........TQIAFD---------------V
Q211X0_RHOPB/871-1087RR..S......-------------------------...AD.GV..A...........LDARLK---------------W
Q26HN2_FLABB/569-794TT..K......-------------------------...GD.TP..L...........FNMALD---------------M
Q28TM9_JANSC/371-572NG..R......-------------------------...GG..L..S...........VGGDLI---------------L
Q2BKP5_9GAMM/1026-1270DK..G......-------------------------...SS..E..V...........TDLTVK---------------L
Q2C0H6_9GAMM/1034-1275YF..K......-------------------------...DN.RN..H...........SALSFI---------------V
Q2KY05_BORA1/936-1183RL..A......-------------------------...GE.QR..G...........LTVQAK---------------A
Q2NWP0_SODGM/1012-1255LH..N......-------------------------...RR.EN..R...........TSLKGT---------------L
Q3BRF7_XANC5/416-658RG..K......-------------------------...GE.AA..S...........TRLSAR---------------V
Q3IFH7_PSEHT/1008-1245QN..G......-------------------------..........Q...........TQLSGE---------------L
Q3R1J6_XYLFA/553-795RG..K......-------------------------...GE.AA..S...........IRLSAR---------------V
Q47VG9_COLP3/1038-1280LH..N......-------------------------...EQ.AS..I...........TTLVGN---------------L
Q5FSF1_GLUOX/412-615EA..D......-------------------------..GKS.SS..R...........IAAELA---------------L
Q5R0H7_IDILO/1003-1244RY..T......-------------------------...DE.QA..L...........SALSGR---------------L
Q6IT20_EDWIC/723-966QQ..Q......-------------------------...DG.IS..R...........TQISGV---------------L
Q6N438_RHOPA/862-1076KL..T......-------------------------...DA.GM..A...........LDAQLT---------------L
Q7MHE2_VIBVY/1031-1272TL..D......-------------------------...GE.TS..Q...........SRMNLK---------------V
Q7UYB4_RHOBA/752-985SS..G......-------------------------..RSG.GV..D...........MTSHWK---------------T
Q7W992_BORPA/953-1200RL..D......-------------------------...GT.QR..G...........LTVQAN---------------A
Q8EA16_SHEON/1025-1268QQ..Q......-------------------------...NG.QN..Q...........TELSVS---------------L
Q9ZDH9_RICPR/624-849LL.........-------------------------...EP..Y..S...........INFVYA---------------V

PF05170

C9QVM3_ECOD1/6-588NLANDDNKDAN..........................AKPSAWSFRL-----------DNILFDQG----------RIAI
Q87TE2_VIBPA/1-570SIQFHQIALKNIDYAGP.....RFSVTGLSIQIQDPTWLNAQQLWPY-----------GAIQASAE----------QMYW
Q8DDS5_VIBVU/1-572TVQIHQLAISNLDYADN.....QLSARGIKFQVKQPQWQRSDQFIPF-----------GEIQFSAQ----------QLYW
ASMA_ECOLI/1-512PVAPRDNTLPD.........................LSDDRGWSFDI-----------SSLKVADS----------VLVF
Q9KNJ9_VIBCH/1-570SVHLNQLALHNIDWADQ.....GIIARGVSLQIKQPVWDSPQQQLPY-----------GKIQLAAD----------QITI
Q8Z2I4_SALTI/1-562RLQLRNMALNS.............................PGSEWRL-----------SAQRVNGG----------VMPW
Q9HU38_PSEAE/1-636IGKPAQPQAPAAPSETPPAADGKGAQAQAPEQAPQNDSPRTPIKLDI-----------DSLNVNNA----------RVTY
Q9KT66_VIBCH/1-595LTQAQSKPASAPAT...........TDSAPASQPSSSEPAAAWSIEL-----------GGVSVSNA----------VLEI
YICH_ECOLI/1-562RLQLRDMAFNS.............................PNSEWKL-----------SAQRVNGG----------VVPW
Q9JY87_NEIMB/8-615LIDSQKRQASV....................................-----------NRIIVENS----------TVRL
Q9ZDI1_RICPR/1-711YISNNNNTINN.................NNTVQSNYTQTVLELPILI-----------SHLKIKGG----------KVIY
Q9HUT4_PSEAE/1-577DLPASDSDEPS..............................AWQLDI-----------REIGFDKG----------SVSL

PF04357

A2TNG0_9FLAO/994-1409KG..P----------------------------------T.D....N-----------LVIDVF..----------G.ET
A2TNW4_9FLAO/1182-1640TG..D----------------------------------L.Q....I-----------PVIDLD..----------A.TV
Q2C929_9GAMM/905-1251TA..T----------------------------------P.K....S-----------ADISGK..----------V.GI
Q2Y828_NITMU/994-1331ML..E----------------------------------H.N....M-----------LTLKGN..----------L.MA
A0KIJ1_AERHH/913-1251SL..G----------------------------------E.E....T-----------.RITGQ..----------V.DI
Q3AKV0_SYNSC/1030-1473SG..A----------------------------------L.V....Q-----------PVLSGN..----------L.AL
A7IN53_XANP2/1076-1428EG..A----------------------------------F..A..NN-----------PRVTGR..----------L.VV
A3PNN1_RHOS1/926-1276QG..P----------------------------------L..T..GG-----------AQIAGR..----------I.DL
Q83EW1_COXBU/570-928DI..V----------------------------------D.R....N-----------IDITGT..----------L.TV
A6E3M1_9RHOB/900-1246NG..P----------------------------------L..T..GG-----------ARISGA..----------L.TL
Q0HJ58_SHESM/1055-1401AF..S----------------------------------S.Q....Q-----------LEVKGV..----------V.NV
Q1D0C2_MYXXD/935-1291IG..P----------------------------------P.K....G-----------FTVTGG..----------M.DI
Q3IIS8_PSEHT/883-1224GL..A----------------------------------N.N....A-----------INLVGE..----------V.IV
A5FB26_FLAJ1/992-1420KG..P----------------------------------T.E....S-----------LFIKVD..----------A.KS
A4CXF7_SYNPV/1039-1478TG..A----------------------------------L.V....K-----------PEVGGT..----------L.EV
A0YIL4_LYNSP/1701-2096DG..S----------------------------------V.L....R-----------PEIGGG..----------I.TL
Q1MB16_RHIL3/1685-2033RG..P----------------------------------I.....KS-----------ATLSGK..----------L.RL
Q8YZJ8_NOSS1/1412-1829RG..T----------------------------------A.L....R-----------PRIGGE..----------I.TL
A4CK93_ROBBH/998-1431FG..P----------------------------------T.N....A-----------LNINFE..----------G.ST
Q481M2_COLP3/971-1308SL..V----------------------------------E.K....A-----------LTISGN..----------I.DV
B1YUT5_BURA4/998-1353TV..A----------------------------------N.DGPRGA-----------LAIDGK..----------F.VV
A2C147_PROM1/886-1319KG..S----------------------------------I.L....K-----------PQLSGE..----------V.FI
Q26C01_FLABB/1165-1623TG..N----------------------------------M.T....I-----------PEINLD..----------L.TV
A5ZK99_9BACE/1057-1469KG..P----------------------------------L.D....G-----------LNMRGN..----------V.SL
A3U6I2_CROAH/1185-1647NG..D----------------------------------L.E....L-----------PKLNAT..----------L.NV
A1VCI4_DESVV/1414-1783IG..P----------------------------------L.....RA-----------PSLHAD..----------L.VL
Q4C5Y1_CROWT/1556-1977TG..A----------------------------------L.I....S-----------PKIAGN..----------I.NL
Q9JXB6_NEIMB/1050-1387RL..R----------------------------------Y.SP.QKG-----------ISVTGM..----------I.KT
Q6G572_BARHE/1198-1548TG..H----------------------------------F..G..DG-----------LVIGGD..----------I.TV
Q1IBQ7_PSEE4/893-1224RL..V----------------------------------D.D....K-----------LAITGK..----------V.RV
A4A832_9GAMM/725-1058RL..N----------------------------------R.E....S-----------VHVGGE..----------V.TV
A3PBW3_PROM0/863-1296TG..S----------------------------------F.E....S-----------PILGGS..----------I.SF
A0LAI9_MAGSM/1120-1462TG..H----------------------------------A.....QA-----------FAVKGD..----------I.TL
Q4QMM3_HAEI8/941-1294KA..N----------------------------------P.K....E-----------LNLSGT..----------V.DI
Q2ND20_ERYLH/1053-1400VS..D----------------------------------...G..IG-----------GTIAGR..----------L.RI
Q9PDZ6_XYLFA/845-1179GL..I----------------------------------N.N....T-----------MQLQGE..----------V.AV
A6GMC8_9BURK/963-1338SV..D----------------------------------G.Q....P-----------LKIRGE..----------V.DT
Q5LV35_SILPO/1012-1360SG..P----------------------------------L..T..GN-----------SRLAGQ..----------I.EV
A4SGG7_PROVI/1036-1486RG..S----------------------------------L.E....A-----------PVLEGE..----------L.RV
A0LGH5_SYNFM/889-1254SR..T----------------------------------P.....QG-----------IELSGN..----------L.LL
A5VFU9_SPHWW/1048-1392RS..D----------------------------------...G..GS-----------GTIGGD..----------V.RL
Q3A844_PELCD/965-1307TG..S----------------------------------T.S....E-----------LKVTGT..----------V.KL
A6EEW2_9SPHI/1267-1720RG..D----------------------------------L.N....Q-----------PDVNMS..----------V.KV
Q28VV1_JANSC/853-1206SG..A----------------------------------L..A..RG-----------PQISGT..----------I.NL
A3HZ37_9BACT/1160-1620KG..D----------------------------------L.N....L-----------PIVRAK..----------L.NV
A5GSG8_SYNR3/973-1387QG..S----------------------------------L.R....Q-----------PALGGE..----------V.KL
Q065Y1_9SYNE/1038-1479KG..A----------------------------------L.A....R-----------PSIGGE..----------L.TL
Q1IMU4_KORVE/977-1317TG..N----------------------------------L.....DD-----------AYLRGQ..----------V.SL
Q1NAC8_9SPHN/1059-1410TN..S----------------------------------A..A..NG-----------GLIKGD..----------L.RL
A6L590_BACV8/1012-1461DGGNN----------------------------------.......A-----------MTVDAS..----------L.TT
A3J9P9_9ALTE/935-1267AF..S----------------------------------G.G....E-----------LLVNGR..----------I.NV
A3UCX7_9RHOB/1006-1342SL..E----------------------------------...G..RV-----------LTLTGE..----------A.DI
A0M1P1_GRAFK/1180-1639TG..D----------------------------------L.T....L-----------PVVNMD..----------I.DI
Q2S2D2_SALRD/1057-1516NG..P----------------------------------L.P....D-----------ATLESN..----------AART
A4BTF4_9GAMM/974-1321SL..D----------------------------------E.S....A-----------ISVTGE..----------V.RV
F2GCG9_ALTMD/897-1246AA..T----------------------------------Q.E....K-----------VDVNGE..----------V.NI
A3U2G6_9RHOB/1005-1359TG..G----------------------------------L..T..GG-----------GRIAGR..----------I.GL
Q21Y28_RHOFD/928-1291RL..N----------------------------------E.S....K-----------LALRGT..----------L.KA
Q6MKB2_BDEBA/958-1321SGRWF----------------------------------P.......-----------FTLSGT..----------Y.HV
Q39RU7_GEOMG/1016-1376EG..T----------------------------------P.A....K-----------VAVRGE..----------I.TV
Q0YSH5_9CHLB/1047-1493HG..T----------------------------------F.T....S-----------PLAEGE..----------L.RI
Q21PP5_SACD2/924-1270NG..N----------------------------------F.....EA-----------LLLSGD..----------L.EV
Q7VBL9_PROMA/867-1309KG..S----------------------------------I.L....Q-----------PLLGGD..----------I.TI
A2SER1_METPP/1091-1433AL..D----------------------------------T.Q....T-----------IKIDGD..----------F.RA
Q0G3A4_9RHIZ/1842-2187TG..P----------------------------------L..T..DG-----------PTIAGD..----------I.TA
A8LNM1_DINSH/737-1084AG..P----------------------------------L..T..GG-----------AALTGV..----------I.NV
Q167D7_ROSDO/855-1205DG..P----------------------------------L..T..GG-----------ARIAGQ..----------I.DL
Q0C134_HYPNA/1036-1371TE..T----------------------------------E.....TA-----------RVVSGR..----------L.NV
Q3JE49_NITOC/917-1262TK..A----------------------------------E.E....A-----------IRVEGE..----------V.VI
A6FC33_9GAMM/920-1259EG..D----------------------------------D.K....G-----------AKITGD..----------I.VI
Q016Y8_OSTTA/1647-2059KG..T----------------------------------V.L....A-----------PELSGD..----------V.RF
A3XNV5_LEEBM/1180-1639TG..D----------------------------------L.N....L-----------PNVTLD..----------L.TV
A5FIP0_FLAJ1/1183-1626KG..N----------------------------------L.D....S-----------PVVDGT..----------L.KI
Q0F1G3_9PROT/799-1133SE..Q----------------------------------K.K....V-----------SIIKGA..----------L.EV
Q8KFW2_CHLTE/1034-1479YG..E----------------------------------L.S....A-----------PVAEGD..----------L.VL
Q47IW3_DECAR/842-1201RL..T----------------------------------W.Q....D-----------GTLGAQGK----------L.AV
Q2JHB3_SYNJB/1232-1612RG..L----------------------------------L.L....Q-----------PLLEGR..----------L.EV
Q0ALB2_MARMM/1025-1362TL..D----------------------------------...T..DG-----------LLISGE..----------S.RV
A7AE74_9PORP/1075-1490KG..P----------------------------------L.N....A-----------LIMRGD..----------L.QL
Q15Z95_PSEA6/908-1250QF..G----------------------------------E.A....G-----------LSVKGE..----------V.TL
A6H009_FLAPJ/1018-1446KG..P----------------------------------T.N....G-----------LVITVN..----------A.KS
A3M6L3_ACIBT/799-1145DMYPF----------------------------------D.K....R-----------LSLKGS..----------V.DV
B5E9K2_GEOBB/1121-1484KG..E----------------------------------G.D....R-----------VTLQGE..----------I.GV
Q0AB99_ALHEH/929-1273VV..R----------------------------------P.N....H-----------ILLRGR..----------V.DV
Q493V0_BLOPB/931-1279TI..T----------------------------------P.E....K-----------IHIEGN..----------V.AI
Q1GSU8_SPHAL/1054-1406QK..V----------------------------------A..G..QT-----------ALLSGD..----------L.RL
Q2LXD8_SYNAS/968-1324EG..N----------------------------------L.E....K-----------LAVRGS..----------V.SV
Q4C605_CROWT/1446-1815GG..S----------------------------------V.F....N-----------PEIGGE..----------V.NL
Q1QA38_PSYCK/1311-1664IVRPS----------------------------------D.R....Y-----------VNITGA..----------V.SV
Q01ZK1_SOLUE/1253-1604TG..S----------------------------------T.S....K-----------SLVSGN..----------V.FI
Q11I59_MESSB/1185-1538TG..P----------------------------------I..T..RD-----------PLLSGN..----------I.EV
Q9A7W5_CAUCR/1057-1398NR..S----------------------------------A..D..GK-----------IKLTGA..----------V.TL
Q5P2G0_AROAE/979-1332QS..T----------------------------------W.T....S-----------LDLDAE..----------F.RA
A4G804_HERAR/984-1318VV..G----------------------------------W.R....D-----------GSAKANGK----------F.EV
A1ZDJ2_9BACT/1130-1588DG..L----------------------------------L.D....D-----------LKIKAD..----------V.TV
A3J5Q1_9FLAO/987-1412TG..S----------------------------------I.D....A-----------LNIKVA..----------G.ES
B8CZ01_HALOH/1096-1430VG..P----------------------------------L.N....R-----------PLIEGE..----------L.IT
A1SW21_PSYIN/987-1327TF...----------------------------------D.Q....N-----------INLTGD..----------V.VV
A3V315_9RHOB/1064-1418QG..P----------------------------------L..Q..GG-----------ARIDGQ..----------L.SL
Q11VR9_CYTH3/1167-1624RG..D----------------------------------Q.N....L-----------PVINAT..----------I.DI
A7HQ23_PARL1/1042-1395TA.PA----------------------------------LPPSLDQP-----------MLLEGE..----------L.TT
Q7MT86_PORGI/1036-1486PG...----------------------------------.......G-----------MRCDVN..----------L.IS
A3WNV7_9GAMM/844-1182NL..T----------------------------------K.D....I-----------IALNGE..----------V.KI
Q5FPE8_GLUOX/1025-1381HG..Q----------------------------------A..T..TR-----------LDVDGK..----------V.NI
Q0BVY3_GRABC/1010-1362RG..Q----------------------------------M..T..KE-----------LTASGH..----------I.KI
A4BHU2_9GAMM/1208-1569TG..S----------------------------------Y.....RN-----------LLLAGE..----------L.QL
Q73JH5_TREDE/1097-1467EI..N----------------------------------P.E....L-----------ITLEGD..----------A.YF
Q3AQ57_CHLCH/1053-1500TG..S----------------------------------L.R....S-----------PIVEGE..----------V.QI
Q5SKS5_THET8/2271-2658EG...----------------------------------......GT-----------YHLTGE..----------A.QV
Q1NV21_9DELT/955-1283SG..P----------------------------------L.A....A-----------LLVSGE..----------V.SI
A1BDC7_CHLPD/1048-1494NG..D----------------------------------I.S....S-----------PVVEGD..----------I.TI
Q2I8W0_9BACT/387-729TA..T----------------------------------R.D....A-----------MHIEGE..----------A.VI
Q3SKJ4_THIDA/904-1242VI..D----------------------------------P.R....H-----------LELRGE..----------L.TA
P73551_SYNY3/1571-1978QG..S----------------------------------A.L....A-----------PSLTGD..----------V.AL
Q7P0N2_CHRVO/933-1270EL..A----------------------------------F.VG.GK.-----------LSLSGR..----------I.RA
A3Z198_9SYNE/1096-1522RG..S----------------------------------L.L....R-----------PLLSGE..----------L.SL
Q0VRK9_ALCBS/827-1164TG..S----------------------------------L.E....G-----------LTLSGS..----------L.TI
Q08V51_STIAD/1146-1530AGTLS----------------------------------A......Q-----------SVNIRD..----------L.HI
Q1W0M9_9FLAO/1152-1612KG..D----------------------------------L.E....F-----------PKIDLD..----------L.RV
Q7W1D4_BORPA/859-1210DA..A----------------------------------L.P....R-----------ISINGD..----------I.TA
A2U1I0_9FLAO/1154-1612TG..D----------------------------------L.Q....I-----------PKLSAN..----------V.TL
Q6MAC5_PARUW/935-1288VG..N----------------------------------L.....KK-----------SKLRGD..----------L.TV
A1HRF9_9FIRM/1091-1444TS..R----------------------------------G.G....T-----------PFLSGR..----------L.LF
E0TG81_PARBH/951-1296AG..P----------------------------------F.....TD-----------LSLSGS..----------I.TL
Q1QWE2_CHRSD/954-1312DA..R----------------------------------P.T....R-----------LRVRGD..----------V.DI
A5FUW2_ACICJ/973-1319TG..D----------------------------------I..D..TG-----------TRLAGT..----------I.AI
Q2RSJ7_RHORT/1146-1500VL..A----------------------------------A.....DQ-----------MTVSGT..----------V.TT
Q2S346_SALRD/1311-1689RG..T----------------------------------V.R....R-----------PVLSGG..----------L.QV
Q2INP6_ANADE/946-1304RG..T----------------------------------P.E....A-----------TDVTGR..----------L.HV
Q9RUC9_DEIRA/223-627RD..S----------------------------------G.D....F-----------VRVSGE..----------G.DF
Q1LSN0_BAUCH/634-981EAKPN----------------------------------L.......-----------LTLNGQ..----------V.NI
Q02B21_SOLUE/1013-1363TG..T----------------------------------T.S....S-----------SMLAGT..----------V.TI
Q1ZD28_9GAMM/976-1315TF...----------------------------------D.K....T-----------LNVKGN..----------V.LL
A4EWK7_9RHOB/813-1161TG..A----------------------------------L..T..GQ-----------AGLSGR..----------I.DV
A0NU08_9RHOB/1094-1448AG..P----------------------------------L.ASTSAS-----------ALISGQ..----------V.SI
B3ELK5_CHLPB/1036-1483YG..D----------------------------------T.A....Q-----------PVLTGN..----------L.LI
A3ISK4_9CHRO/1570-1981TG..S----------------------------------A.I....Q-----------PVVSGD..----------V.QL
Q2IMB0_ANADE/1148-1504TG...----------------------------------..AYQPGA-----------LQVK....----------L.TV
Q8YUC2_NOSS1/1659-2048TG..S----------------------------------A.L....N-----------PRIGGK..----------V.DL
Q1MQI4_LAWIP/1025-1382EG..T----------------------------------L.....KQ-----------SEVKGD..----------I.VI
P73871_SYNY3/1377-1749TG..T----------------------------------A.I....A-----------PQIGGQ..----------L.AL
Q1H099_METFK/711-1055TL..Q----------------------------------N.N....E-----------LILDGD..----------L.RI
Q2SJX7_HAHCH/929-1280EG..D----------------------------------F.....KN-----------LLLSGK..----------V.EV
Q8DGE2_THEEB/1182-1567TD..T----------------------------------L.L....S-----------PDLGGS..----------V.QL
A3VBU1_9RHOB/1020-1371SG..P----------------------------------L..T..GG-----------ARIAGT..----------V.RP
Q7VQN5_BLOFL/933-1286TI..T----------------------------------V.N....T-----------IDIQGD..----------I.NV
Q9X3V6_ZYMMB/22-376TS..N----------------------------------R..K..DG-----------GSIKGK..----------L.KL
Q119K9_TRIEI/1940-2322TG..T----------------------------------A.L....E-----------PVVGGN..----------V.EV
Q7NCN7_GLOVI/1184-1556GG..A----------------------------------L.L....A-----------PRIGGN..----------L.TV
Q31MA1_SYNE7/1177-1568LG..S----------------------------------A.L....E-----------PAIAGD..----------I.RV
Q1INS5_KORVE/1027-1368VG..T----------------------------------V.K....N-----------AMLSGD..----------V.VI

PF05359

Q4K5X6_PSEF5/140-291NK--------------------------------------------------------LDFEL.----------------
Q4K5X6_PSEF5/360-511GP--------------------------------------------------------LNLDL.----------------
C6BEV1_RALP1/874-1022TA--------------------------------------------------------IGGSI.----------------
B2JQ93_BURP8/874-1021IA--------------------------------------------------------IQGTV.----------------
A3JB00_9ALTE/379-531NG--------------------------------------------------------LNLSL.----------------
Q1BJG4_BURCA/621-773KP--------------------------------------------------------LELSV.----------------
A0RMT1_CAMFF/653-798TK--------------------------------------------------------ISTTI.----------------
A3LK23_PSEAI/690-837QQ--------------------------------------------------------LSGEV.----------------
Q72DG8_DESVH/963-1109DK--------------------------------------------------------VDAAV.----------------
A9BMN7_DELAS/883-1036SE--------------------------------------------------------LAGRL.----------------
A4SM57_AERS4/366-520SG--------------------------------------------------------LNLTL.----------------
A6WLY0_SHEB8/520-670YP--------------------------------------------------------LNFST.----------------
A7ZFK9_CAMC1/750-895SK--------------------------------------------------------LNGKL.----------------
Q2LUD1_SYNAS/534-687EK--------------------------------------------------------IQGRI.----------------
A8ZWF7_DESOH/636-783TL--------------------------------------------------------TDLKV.----------------
Q3A6W6_PELCD/375-529EH--------------------------------------------------------IAVTL.----------------
Q5NYY7_AROAE/382-536KD--------------------------------------------------------LVLEA.----------------
B7X1L0_COMTE/164-316KD--------------------------------------------------------LQLSI.----------------
Q2KWF8_BORA1/759-906SA--------------------------------------------------------IEGSI.----------------
A0KYD6_SHESA/671-818EQ--------------------------------------------------------LDGNI.----------------
Q7WMQ9_BORBR/155-309DE--------------------------------------------------------IALGV.----------------
Q1I4N7_PSEE4/579-726QQ--------------------------------------------------------LNGQI.----------------
Q484B1_COLP3/382-534TI--------------------------------------------------------KSLTI.----------------
A3JB00_9ALTE/590-737GQ--------------------------------------------------------LQGNL.----------------
A2SI01_METPP/870-1017TD--------------------------------------------------------IGGEV.----------------
Q8Y0Z7_RALSO/615-766EP--------------------------------------------------------LNVLV.----------------
Q48E84_PSE14/155-306DT--------------------------------------------------------LNFEL.----------------
Q5QWM2_IDILO/380-527HT--------------------------------------------------------LSGEV.----------------
Q0VP61_ALCBS/592-737YQ--------------------------------------------------------LAGTV.----------------
A7GWE3_CAMC5/514-660DN--------------------------------------------------------LNIKA.----------------
A3QD21_SHELP/699-846EQ--------------------------------------------------------LEGNI.----------------
A1RL15_SHESW/447-597YP--------------------------------------------------------LNFAT.----------------
Q63NS2_BURPS/645-797AP--------------------------------------------------------LALNV.----------------
Q47FN3_DECAR/732-879TK--------------------------------------------------------LGGRV.----------------
A0KK00_AERHH/368-522SA--------------------------------------------------------LALAL.----------------
Q0JZH1_CUPNH/670-829RN--------------------------------------------------------IALST.----------------
Q2LUD1_SYNAS/785-932VQ--------------------------------------------------------IGGRI.----------------
A1ARF1_PELPD/790-937HN--------------------------------------------------------LGGRV.----------------
Q39RS7_GEOMG/568-719RR--------------------------------------------------------IGFNA.----------------
B9M3X2_GEOSF/795-942YN--------------------------------------------------------LGGRI.----------------
Q8Y0Z7_RALSO/185-339DG--------------------------------------------------------LQIGV.----------------
Q3JBN6_NITOC/584-731HS--------------------------------------------------------LQSEI.----------------
Q5DZ89_VIBF1/399-549SP--------------------------------------------------------INLTT.----------------
Q1QTZ9_CHRSD/145-295KN--------------------------------------------------------LDLEA.----------------
Q0HTT4_SHESR/437-587YP--------------------------------------------------------LNFAT.----------------
A9BMN7_DELAS/165-317EQ--------------------------------------------------------LQLRL.----------------
Q7WB91_BORPA/527-681KQ--------------------------------------------------------FEARF.----------------
A9BMN7_DELAS/379-538RE--------------------------------------------------------LSLQV.----------------
Q87WR1_PSESM/386-537GP--------------------------------------------------------LNLDM.----------------
B2JQ93_BURP8/616-770TP--------------------------------------------------------LNLKV.----------------
A1K6C3_AZOSB/734-881EQ--------------------------------------------------------LAGQM.----------------
Q603H4_METCA/718-865HD--------------------------------------------------------FFGTA.----------------
Q47VC1_COLP3/500-655DT--------------------------------------------------------LDVGAL----------------
Q15PY6_PSEA6/662-809EA--------------------------------------------------------LNGSI.----------------
Q88DW4_PSEPK/365-516GP--------------------------------------------------------LNADL.----------------
A6F3L7_9ALTE/590-737DQ--------------------------------------------------------LRGSV.----------------
A0KK00_AERHH/578-725AA--------------------------------------------------------LSGQS.----------------
B5ECC6_GEOBB/569-721KN--------------------------------------------------------TSLTL.----------------
Q2LUD1_SYNAS/159-313HD--------------------------------------------------------LSLAI.----------------
A4VPN2_PSEU5/551-698QS--------------------------------------------------------LNGDI.----------------
Q3K6Q1_PSEPF/371-522TP--------------------------------------------------------LNVDL.----------------
A3L3D9_PSEAI/478-629GP--------------------------------------------------------LDLDL.----------------
Q0VP61_ALCBS/382-530TD--------------------------------------------------------GGLTL.----------------
A1K7K6_AZOSB/583-736DG--------------------------------------------------------LSVKA.----------------
Q3JBN6_NITOC/369-521SD--------------------------------------------------------LGLQL.----------------
Q5NYY7_AROAE/832-979TG--------------------------------------------------------MEGEV.----------------
Q13S79_BURXL/640-791TP--------------------------------------------------------LQLKV.----------------
Q47FN3_DECAR/504-656EA--------------------------------------------------------FSLHG.----------------
A7GWE3_CAMC5/719-864TK--------------------------------------------------------VNGKL.----------------
B1KJ13_SHEWM/617-764EQ--------------------------------------------------------LEGQV.----------------
A5W979_PSEP1/140-291DN--------------------------------------------------------MNLEL.----------------
Q316X0_DESDG/862-1008AG--------------------------------------------------------LNATL.----------------
Q1NN12_9DELT/591-738SE--------------------------------------------------------LGGDI.----------------
Q602F3_METCA/416-565DD--------------------------------------------------------LEIRL.----------------
Q2Y5K5_NITMU/673-818TD--------------------------------------------------------LAGRI.----------------
B3E4B8_GEOLS/816-963HN--------------------------------------------------------LGGMV.----------------
A4VPN2_PSEU5/341-492GP--------------------------------------------------------LNLDI.----------------
Q5NYY7_AROAE/153-307SA--------------------------------------------------------INIGL.----------------
Q30NX8_SULDN/563-715DN--------------------------------------------------------INISA.----------------
C1DFK3_AZOVD/367-518GP--------------------------------------------------------LDLSL.----------------
Q484B1_COLP3/604-751YS--------------------------------------------------------LNGDI.----------------
Q5NYY7_AROAE/604-757AG--------------------------------------------------------IKLKA.----------------
Q602F3_METCA/623-770RG--------------------------------------------------------LTGVV.----------------
Q316X0_DESDG/389-538GP--------------------------------------------------------LDITL.----------------
A5G9K9_GEOUR/137-293RK--------------------------------------------------------VELTI.----------------
B2JHK1_BURP8/152-309SD--------------------------------------------------------ASASV.----------------
B1KJ13_SHEWM/407-556SP--------------------------------------------------------LNLTT.----------------
A5G9K9_GEOUR/551-702KK--------------------------------------------------------MAFTL.----------------
A1K6C3_AZOSB/165-302AG--------------------------------------------------------LDAEI.----------------
A0KK00_AERHH/151-307SG--------------------------------------------------------LDLQL.----------------
Q1H1L3_METFK/780-927NS--------------------------------------------------------LSGVI.----------------
B9M7L7_GEOSF/383-534KK--------------------------------------------------------TSFSL.----------------
Q0F0H3_9PROT/538-688EK--------------------------------------------------------MRLAP.----------------
A4SXW3_POLSQ/414-561KK--------------------------------------------------------FNATL.----------------
A6FDI0_9GAMM/443-592SP--------------------------------------------------------LNFST.----------------
B9M3X2_GEOSF/564-715KS--------------------------------------------------------IDVSA.----------------
A4G9D7_HERAR/154-308AD--------------------------------------------------------LKIGV.----------------
Q21F55_SACD2/584-731TK--------------------------------------------------------LHGEL.----------------
Q7NY28_CHRVO/704-851HH--------------------------------------------------------LRGSI.----------------
Q0JZH1_CUPNH/164-317DN--------------------------------------------------------LTLTL.----------------
Q3K6Q1_PSEPF/144-295DK--------------------------------------------------------LDFEL.----------------
A1TWZ4_MARAV/597-744QE--------------------------------------------------------LTGSV.----------------
A4JK45_BURVG/159-312DN--------------------------------------------------------WTLGI.----------------
B3E4B8_GEOLS/367-514QA--------------------------------------------------------INVKL.----------------
Q2IFA1_ANADE/563-710TG--------------------------------------------------------AQATV.----------------
A4SM57_AERS4/151-307SG--------------------------------------------------------LDLQL.----------------
Q1QTZ9_CHRSD/348-494AE--------------------------------------------------------LNGEW.----------------
Q11NN1_CYTH3/142-298NQ--------------------------------------------------------FELLL.----------------
Q9HV64_PSEAE/140-291DP--------------------------------------------------------LGFEL.----------------
Q3SGZ4_THIDA/733-880HD--------------------------------------------------------LGGVV.----------------
Q3A6W6_PELCD/162-316AD--------------------------------------------------------LGFYV.----------------
A4A3Z9_9GAMM/583-730DG--------------------------------------------------------IEADI.----------------
Q316X0_DESDG/600-751TG--------------------------------------------------------INLDV.----------------
A8H2Y8_SHEPA/433-583DD--------------------------------------------------------IDLTT.----------------
A6T355_JANMA/478-631DP--------------------------------------------------------LTLSL.----------------
A1TWZ4_MARAV/166-321AP--------------------------------------------------------LDLTL.----------------
A6DTM8_9BACT/927-1074DK--------------------------------------------------------FSGSI.----------------
B9M7L7_GEOSF/592-739FN--------------------------------------------------------LGGRI.----------------
Q222N5_RHOFD/496-646TD--------------------------------------------------------LALKL.----------------
A6T355_JANMA/155-309TD--------------------------------------------------------LKLGV.----------------
Q1K3A0_DESAC/497-651DD--------------------------------------------------------LRLRL.----------------
Q3A6W6_PELCD/805-951DK--------------------------------------------------------LAVTV.----------------
A5G9K9_GEOUR/769-916YN--------------------------------------------------------LGGRI.----------------
A2SI01_METPP/623-775TR--------------------------------------------------------TDLKL.----------------
Q2T396_BURTA/231-384DQ--------------------------------------------------------WTLGI.----------------
Q46V48_CUPPJ/649-808RN--------------------------------------------------------IGLST.----------------
Q083W9_SHEFN/492-642GP--------------------------------------------------------IDFTT.----------------
A8FUB9_SHESH/389-538AP--------------------------------------------------------INLTT.----------------
Q083W9_SHEFN/725-872EM--------------------------------------------------------LNGQI.----------------
Q12MK5_SHEDO/654-801EE--------------------------------------------------------LKGEI.----------------
Q3SGZ4_THIDA/517-669AE--------------------------------------------------------GFVTF.----------------
A1ARF1_PELPD/573-725RN--------------------------------------------------------TAFSL.----------------
Q39RS7_GEOMG/801-948YN--------------------------------------------------------LGGRI.----------------
Q603H4_METCA/502-653EN--------------------------------------------------------LRLSL.----------------
Q222N5_RHOFD/149-300AP--------------------------------------------------------IDFSL.----------------
A8ZWF7_DESOH/412-569SD--------------------------------------------------------LNVTV.----------------
A4XYD1_PSEMY/354-505GP--------------------------------------------------------LNLDL.----------------
Q484B1_COLP3/152-304KE--------------------------------------------------------INVAL.----------------
Q21F55_SACD2/154-306GP--------------------------------------------------------IHFGV.----------------
Q3SGZ4_THIDA/147-307EP--------------------------------------------------------LGIEL.----------------
A7I315_CAMHC/662-807SK--------------------------------------------------------VRTAV.----------------
Q74FC9_GEOSL/787-934YN--------------------------------------------------------LGGRV.----------------
A7H8M2_ANADF/367-518TE--------------------------------------------------------VQLRL.----------------
F2GAL8_ALTMD/716-863ES--------------------------------------------------------LNGKI.----------------
Q5DZ89_VIBF1/610-757EQ--------------------------------------------------------LKGNI.----------------
A4XYD1_PSEMY/562-709QQ--------------------------------------------------------MNGRI.----------------
B3E4B8_GEOLS/583-736SN--------------------------------------------------------IRLST.----------------
A6GL92_9BURK/612-759HS--------------------------------------------------------LEGVV.----------------
Q2BL34_9GAMM/505-657NL--------------------------------------------------------SKLVL.----------------
C1DFK3_AZOVD/141-292DA--------------------------------------------------------LQLEV.----------------
Q1LGA7_RALME/681-840RN--------------------------------------------------------IGFTS.----------------
Q1JXN5_DESAC/795-942YD--------------------------------------------------------LGGRI.----------------
B5ECC6_GEOBB/807-954YN--------------------------------------------------------LGGRV.----------------
Q2IFA1_ANADE/358-509TD--------------------------------------------------------VAVTL.----------------
A4XYD1_PSEMY/140-291DS--------------------------------------------------------LDVEL.----------------
A7H8M2_ANADF/165-318GP--------------------------------------------------------LTVRL.----------------
A3QD21_SHELP/453-602GQ--------------------------------------------------------LQLTT.----------------
Q3A6W6_PELCD/588-738HK--------------------------------------------------------LTGSI.----------------
A7H8M2_ANADF/579-726TG--------------------------------------------------------ADASV.----------------
A8ETY5_ARCB4/612-759TK--------------------------------------------------------LNGKI.----------------
Q30NX8_SULDN/772-919HG--------------------------------------------------------LNGNV.----------------
A6FDI0_9GAMM/664-811EN--------------------------------------------------------IEGHV.----------------
A6DTM8_9BACT/382-537ED--------------------------------------------------------IEFSL.----------------
A4VPN2_PSEU5/125-276DS--------------------------------------------------------LDLEL.----------------
Q1LGA7_RALME/173-326EN--------------------------------------------------------FTLTL.----------------
Q1H1L3_METFK/561-712EN--------------------------------------------------------ANLEV.----------------
Q222N5_RHOFD/710-857YE--------------------------------------------------------LNGVI.----------------
C1DFK3_AZOVD/584-731QQ--------------------------------------------------------LNGRI.----------------

PF13116

A3ZDT1_CAMJU/201-486NN--------------------------------------------------------VKVRLDDK..........MNAI
A4THD4_YERPP/510-796RN--------------------------------------------------------AVFQFQPD..........WPAL
A1RP07_SHESW/505-792QD--------------------------------------------------------AQFQFQPD..........WPAV
B5F9M1_VIBFM/506-792KD--------------------------------------------------------AQFAFDTA..........WPPL
B5REW7_SALG2/474-759RN--------------------------------------------------------ATFAFQPD..........WPAL
C4X0M1_KLEPN/504-789KN--------------------------------------------------------ATFAFQPD..........WPAL
C6XK02_HIRBI/457-744ED--------------------------------------------------------AEVKFLED..........LPPI
C6DIL6_PECCP/503-788KG--------------------------------------------------------ATFEFQPG..........WPAL
D2YHX2_VIBMI/503-791KQ--------------------------------------------------------AKFAFDTA..........WPPI
Q7NW94_CHRVO/514-796EK--------------------------------------------------------ARLSYQQG..........WPTI
Q7N037_PHOLL/501-786RH--------------------------------------------------------ATFQYQPN..........WPAL
A7ZDM6_CAMC1/160-458KN--------------------------------------------------------LLVKFEKD..........LPAV
A4XQL3_PSEMY/513-798KD--------------------------------------------------------AELAFQPD..........WPSL
Q3J7T7_NITOC/517-810RG--------------------------------------------------------AKLNYARG..........WPVL
C3XNN9_9HELI/210-498KN--------------------------------------------------------AEVIFHPK..........LQAA
Q0HZG8_SHESR/505-792DN--------------------------------------------------------AEYQFQPD..........WPAV
D5CU11_SIDLE/524-805KD--------------------------------------------------------VEMEFAKG..........WPRI
A3YBT0_9GAMM/494-783VD--------------------------------------------------------AKVKFAPD..........WPVA
B2PXM1_PROST/492-780RK--------------------------------------------------------ATFEYDKG..........WPAL
C3X5K0_OXAFO/598-890VD--------------------------------------------------------GALNYAPTLLSPDGRRPLWPVI
A1AVR0_RUTMC/242-525SN--------------------------------------------------------TELLFNTD..........WQSL
D1RKZ9_LEGLO/542-830SG--------------------------------------------------------GELAINSK..........WQVI
B6XFK3_9ENTR/506-794RD--------------------------------------------------------GTFEYDDQ..........WPAL
B9D263_WOLRE/198-487KN--------------------------------------------------------VKVKFHEK..........LPAA
Q31FH6_THICR/496-774HK--------------------------------------------------------AELKFQPD..........WPAL
A6D042_9VIBR/509-797RD--------------------------------------------------------AKFSFDTN..........WPPL
Q48EA0_PSE14/513-795SN--------------------------------------------------------ATLAFQPG..........WPSL
Q2NWP0_SODGM/504-789KQ--------------------------------------------------------AEYEFEPG..........WPPL
B8GV04_THISH/540-825EE--------------------------------------------------------GLLDYQRG..........WPAI
A9KBH4_COXBN/479-764DR--------------------------------------------------------VTLNYHSG..........WPAL
A8H923_SHEPA/510-797AE--------------------------------------------------------AEFEFQDT..........WPAV
B3CN56_WOLPP/322-604EN--------------------------------------------------------GSVQFDED..........FERV
B0KQG7_PSEPG/513-795HD--------------------------------------------------------AALDFQPG..........WPQV
A0RPG5_CAMFF/10-294KD--------------------------------------------------------LSIKFHEN..........ITPV
D2C1Z1_DICD5/509-794EK--------------------------------------------------------SRFEFQPG..........WPAL
D4GCB7_PANAM/504-789RK--------------------------------------------------------ATYGFQPG..........WPDI
Q07WQ4_SHEFN/504-791DK--------------------------------------------------------GIFKFQPD..........WPAV
Q5ZUN8_LEGPH/507-795VG--------------------------------------------------------GDILITPE..........WRLI
Q7VFV2_HELHP/222-511ES--------------------------------------------------------PKVYLAPH..........LKPI
D2TDE3_ERWP6/503-788RQ--------------------------------------------------------ATYEFQPG..........WPAL
A8T949_9VIBR/505-792KN--------------------------------------------------------AKFSFDTA..........WPTI
C0F958_9RICK/390-675EN--------------------------------------------------------GSVKFDED..........FEQV
C8PGF2_9PROT/201-488QD--------------------------------------------------------LTIKFQPQ..........IEAV
Q12IX1_SHEDO/530-817EN--------------------------------------------------------AVYRFEPD..........WPVI
Q15ZG8_PSEA6/490-776ED--------------------------------------------------------ASFEFAED..........WPQL
C9P9S4_VIBFU/504-791KE--------------------------------------------------------GKFSFDTA..........WPAI
A6Q385_NITSB/202-483YD--------------------------------------------------------GTIDFQKG..........IAPV
A8GK60_SERP5/523-808RH--------------------------------------------------------STFQFQPD..........WPAL
B8K935_VIBPA/486-773KD--------------------------------------------------------AKFSFDTA..........WPPI
Q3IFH7_PSEHT/493-781DN--------------------------------------------------------ATYQFDPD..........WPAV
A8PNA6_9COXI/430-712KD--------------------------------------------------------ATLTYDKA..........WPRL
A7GYI8_CAMC5/195-484KN--------------------------------------------------------LKVKFEKT..........LDAV
D9SHW3_GALCS/523-805HD--------------------------------------------------------VSMQFAPD..........WPKI
C7R9G7_KANKD/505-791RD--------------------------------------------------------ALFKFDPE..........WPQA
A4SSL2_AERS4/495-781EQ--------------------------------------------------------ATFQFFPG..........WQPL
Q21FT5_SACD2/542-827EN--------------------------------------------------------ATLKFDPE..........WPAL
B9KGG1_CAMLR/206-490NN--------------------------------------------------------LKVVLDKG..........VDPI
A3UZ19_VIBSP/503-790ED--------------------------------------------------------AKFSFDTA..........WPLI
B6INC8_RHOCS/363-622SG--------------------------------------------------------FDVRYMET..........LPPV
C0AZI2_9ENTR/255-539KQ--------------------------------------------------------ATFKFDSE..........WPAL
A7MJB2_CROS8/518-803HN--------------------------------------------------------ATYAFQPD..........WPAL
C9QN32_VIBOR/503-790KQ--------------------------------------------------------AKFSFDTA..........WPAI
C2LNU1_PROMI/500-784KQ--------------------------------------------------------ATFKYDSE..........WPAL
A6SW78_JANMA/540-840DD--------------------------------------------------------GGLNYAPDMFAKDGKKPMWPLL
C6XD69_METSD/519-799ND--------------------------------------------------------GELDYAPG..........WPKI
A7I2E8_CAMHC/213-497QN--------------------------------------------------------VSVKFDKK..........LPAV
Q6LMA6_PHOPR/509-794KK--------------------------------------------------------AKFSFDTA..........WPIL
D0L1I5_HALNC/561-853KH--------------------------------------------------------LVLPFLPD..........WPAL
A3Q9Y2_SHELP/509-796NQ--------------------------------------------------------ARYRFQPD..........WPEV
A6QAC9_SULNB/206-494ED--------------------------------------------------------VQIHYKEG..........LPPV
A8EUE5_ARCB4/193-478KD--------------------------------------------------------GKIRFHKD..........VDEI
A8FQQ2_SHESH/504-791SD--------------------------------------------------------AEFKFQPD..........WPAV
C5ZX33_9HELI/208-498RD--------------------------------------------------------AKVTFQKG..........LSPI
D0I525_VIBHO/503-790KN--------------------------------------------------------AQFSFDTQ..........WPTL
Q1H0H5_METFK/520-800HD--------------------------------------------------------GELRFSPE..........WPKI
A9D952_9GAMM/504-796ED--------------------------------------------------------AEFKFQPD..........WPAV
C0N416_9GAMM/506-794EN--------------------------------------------------------AQLHYAPD..........WPDI
Q7MRT1_WOLSU/187-475AS--------------------------------------------------------PEVTFHPD..........LPPL
Q2C0H6_9GAMM/506-792KK--------------------------------------------------------AKFQFDPD..........WPLL
B1KJH7_SHEWM/508-795QD--------------------------------------------------------AEFEFQPD..........WPSV
Q47VG9_COLP3/504-793SK--------------------------------------------------------SEFKFVDN..........WPAI
A4G3G0_HERAR/587-887DN--------------------------------------------------------GGLNYAPDMFGRDGKAPLWPLL
D1B1Z5_SULD5/203-493QE--------------------------------------------------------ATIIFEKS..........VPPA
D3V5J7_XENBS/502-797RH--------------------------------------------------------ATFQYQPD..........WPAL
A6GR98_9BURK/554-836EN--------------------------------------------------------GELTYAPG..........WPGI
D4E146_SEROD/303-588RQ--------------------------------------------------------ATFQFQPG..........WPAL
A4C806_9GAMM/497-784QQ--------------------------------------------------------GEFQFEPS..........WPTI
E6WGF8_PANSA/504-789RQ--------------------------------------------------------ATYQFQPG..........WPAI
Q4HS43_CAMUP/200-483KN--------------------------------------------------------VSVHLDER..........VTPI
Q8DCG6_VIBVU/507-794KQ--------------------------------------------------------GKFSFDTA..........WPPI
C5F1J2_9HELI/186-475KN--------------------------------------------------------ANVTFKEN..........LPPI
C9P2T1_VIBME/504-791KN--------------------------------------------------------AKFSFDTA..........WPAI
Q5GSY1_WOLTR/325-607EN--------------------------------------------------------GSVKFDED..........FEQV
F2G3T4_ALTMD/500-787KD--------------------------------------------------------GDFLFAPD..........WPAL
D1KAX2_9GAMM/256-540SD--------------------------------------------------------SELLFDSD..........WEAL
A0Y2B2_9GAMM/494-782DN--------------------------------------------------------ATYQFDPQ..........WPAV
A3WPW6_9GAMM/495-781DT--------------------------------------------------------LTYRFQPD..........WPAL
Q4HHM4_CAMCO/202-487NN--------------------------------------------------------VKVRLDNQ..........MNAI
A5CXF5_VESOH/244-528TN--------------------------------------------------------TELLFNAD..........WHNL
Q0AGL5_NITEC/528-819GN--------------------------------------------------------ATIKTPGD..........WPEI
D3VKA4_XENNA/501-791RD--------------------------------------------------------AIFQYQPD..........WPAL
C6C4M2_DICDC/503-788ER--------------------------------------------------------ANFEFEPG..........WPAL
C3XBS4_OXAFO/577-871VD--------------------------------------------------------GVLNYAPDMVNRNTRKPAWPII
Q0ABM3_ALHEH/531-818ID--------------------------------------------------------GELAYQPD..........WPRL

PF13109

A0RPG5_CAMFF/433-647.DGFKDGNFT----------------------------------------------------V..R...L.N.G.E----
A1VYN9_CAMJJ/621-835.QAVQDGVFN----------------------------------------------------LSIK...G...S.G----
A6DEH3_9PROT/738-953.HFTSINLDF----------------------------------------------------V..L...V.K.S.P----
A6Q385_NITSB/623-836.NFLSKGEYE----------------------------------------------------L..V...L.H.G.P----
A6QAC9_SULNB/640-854.DGLQKGRYT----------------------------------------------------F..R..IS.G.T.P----
A7GYI8_CAMC5/627-841.QSFEGGKFR----------------------------------------------------L..K...I.V.G.S----
B2UTP1_HELPS/745-958.DFVEGGLFT----------------------------------------------------L..I...G.A.L.E----
B6BK75_9PROT/827-1037.SDFKGGKLS----------------------------------------------------F..S...M.A.G.S----
B9D263_WOLRE/627-841.KSFEGGSFK----------------------------------------------------M..RVLGG.S.T.D----
B9KGG1_CAMLR/634-848.NVFEKGEFN----------------------------------------------------L..Y..VD.G.N.S----
B9L5J2_NAUPA/583-798FDFFSLINLD----------------------------------------------------F..V...M.V.KSP----
C3XGB2_9HELI/333-551.KMLNGGAFS----------------------------------------------------L..D...G.I.Y.R----
C3XNN9_9HELI/639-853.HIFNKGRFF----------------------------------------------------L..N...ANT.N.E----
C5F1J2_9HELI/616-830.NAFSNGRFF----------------------------------------------------L..N...ANT.N.E----
C5ZX33_9HELI/638-852.NIVTQGRFS----------------------------------------------------I..N...A.N.T.N----
D3UGW6_HELM1/730-943.ELLHGGLFT----------------------------------------------------L..I...G.A.Y.K----
Q30RQ8_SULDN/697-907.SKFKGGKME----------------------------------------------------FYIS...G.Q.L.D----
Q4HHM4_CAMCO/634-848.RAVQEGVFN----------------------------------------------------F..S...V.I.G.S----
Q4HS43_CAMUP/629-843.NAFKEGVFN----------------------------------------------------V..K...A.EGS.N----
Q7MRT1_WOLSU/616-829.EIASGGRFD----------------------------------------------------L..I...G.E.Y.G----
Q7VFV2_HELHP/731-944.DIFRGGLFN----------------------------------------------------F..K...G.I.Y.D----

PF13502

A0KFB2_AERHH/999-1241-SSNNSELLL.......K------------------------------------------R.L------G.Y-T-S-...
A0YA02_9GAMM/903-1114-SNFYFPGAE.......K------------------------------------------...------..K-E-E-...
A1S2S6_SHEAM/1130-1371-KADKFDALA.......Q------------------------------------------Q.L------G.I-T-P-...
A1STZ9_PSYIN/1024-1262-VGNEVNDIV.......K------------------------------------------R.L------GYS-S-P-...
A1TW53_ACIAC/1117-1369-DIRDSGQLL.......A------------------------------------------R.F------G.M-E-G-...
A1U479_MARAV/979-1225-EGGALKDLE.......A------------------------------------------L.T------GST-I-P-...
A1WCZ7_ACISJ/1139-1390-DIRDCGALL.......A------------------------------------------R.F------G.M-D-G-...
A1WSB5_VEREI/1101-1362-DIRDAGALL.......E------------------------------------------R.L------G.L-A-H-...
A1WYY8_HALHL/891-1129-RSGDAGDLF.......G------------------------------------------L.L------Q.A-P-R-...
A1ZG80_9BACT/721-947-NRLSIGKAHSSFSVVKK------------------------------------------L.I------P.M-A-Q-...
A2TRX7_9FLAO/566-791-SSIDIDRSF.......K------------------------------------------E.L------E.M-L-Q-GLA
A2U2U5_9FLAO/567-793-KELNIKESF.......S------------------------------------------S.L------E.M-L-E-SIA
A3HUH0_9BACT/675-900-SDLSISEAFSTL.NTVK------------------------------------------A.F------API-A-Q-...
A3I060_9BACT/816-1020-KEFDINRAY.......Q------------------------------------------E.I------P.M-F-R-EMA
A3J4A5_9FLAO/560-786-NAVNIAESF.......S------------------------------------------Q.L------D.M-L-K-SIA
A3J4S5_9FLAO/687-891-TDFDIKRAY.......N------------------------------------------E.I------K.M-F-R-EIV
A3JK78_9ALTE/987-1233-TGGQLAELG.......G------------------------------------------L.F------G.A-D-V-...
A3Q9Y2_SHELP/1046-1289-KAKQFDEVS.......E------------------------------------------R.L------G.I-D-P-...
E0TB83_PARBH/837-1047-ETSDFGQLL.......R------------------------------------------G.L------F.G-I-E-...
A3WPW6_9GAMM/1014-1255-TTSDIGELL.......R------------------------------------------E.Y------G.L-E-T-...
A3XKT3_LEEBM/574-799-SSVDISESFNGL.EMLQ------------------------------------------Q.L------TPI-A-K-...
A3YBT0_9GAMM/1003-1247-EGENIDELT.......K------------------------------------------K.F------S.S-D-A-...
A4AMF6_MARSH/560-785-DQLGIGESF.......K------------------------------------------S.L------E.L-F-K-FLA
A4BQN1_9GAMM/991-1233-ASEDTGKAL.......T------------------------------------------L.F------G.F-A-Q-...
A4C0T1_9FLAO/568-794-KKLNIADSF.......N------------------------------------------H.L------K.M-L-E-AIA
A4C806_9GAMM/1004-1241-SSSDIGELF.......D------------------------------------------E.Y------D.L-T-S-...
A4CG41_ROBBH/574-799-DGFRIRETL.......E------------------------------------------S.I------E.L-F-E-TLA
A4VIB7_PSEU5/1014-1255-EGGNLADVL.......L------------------------------------------A.W------GFA-P-S-...
A5CF63_ORITB/620-836-NSFYIPTFS.......F------------------------------------------I.L------Q.D-K-E-...
A5EPF4_BRASB/898-1114-AGIDGNALR.......Y------------------------------------------R.S------L.K-M-P-...
A5FBT6_FLAJ1/701-905-KDFSVQRAY.......K------------------------------------------E.I------P.M-F-H-DMV
A5FJ68_FLAJ1/564-791-NQVDIAQTF.......T------------------------------------------Q.L------D.M-M-K-KIA
A5FJN3_FLAJ1/697-901-SDFDIKRAYNEIEVFRK------------------------------------------M.A------S.A-A-E-...
A5FUN1_ACICJ/745-973-TGARASAVA.......S------------------------------------------I.A------A.T-H-G-LA.
A5ICR0_LEGPC/1014-1262-YLKDLAKSL.......D------------------------------------------R.W------A.I-N-P-...
A6C314_9PLAN/969-1200-TRNSLKYVA.......P------------------------------------------M.L------A.N-S-T-...
A6CFZ4_9PLAN/844-1050-NRGLLEEYA.......A------------------------------------------RYM------P.G-Q-S-...
A6EDA1_9SPHI/197-401-SEFDVARAYKEIRLFRE------------------------------------------M.A------T.S-A-S-...
A6F4Z2_9ALTE/986-1232-NGQSLADLD.......T------------------------------------------L.V------GAE-I-P-...
A6FEV3_9GAMM/980-1223-KTKSIEEFM.......T------------------------------------------G.L------G.L-I-S-...
A6GWN8_FLAPJ/560-787-NKVDIAKTF.......T------------------------------------------Q.L------D.M-L-K-KIA
A6SW78_JANMA/1081-1328-NINNAGNLL.......G------------------------------------------R.F------G.F-A-D-...
A6U693_SINMW/393-597-KNADFAAVL.......D------------------------------------------R.F------G.L-K-G-...
A6UB33_SINMW/880-1101-KGADLAEAG.......W------------------------------------------V.R------A.N-G-P-...
A7AAH7_9PORP/866-1069-EDVKVEKLI.......A------------------------------------------L.F------P.S-I-D-TLV
A7HEC2_ANADF/581-801-KGVAGEEAL.......K------------------------------------------L.L------G.D-R-K-...
A7HWU4_PARL1/297-497-ANFDIGKLL.......A------------------------------------------D.L------D.V-S-T-...
A8EI17_BURPE/1120-1377-AIDDAGALL.......E------------------------------------------R.V------G.L-P-R-...
A8GRQ7_RICRS/625-850-NTIDLNKVS.......A------------------------------------------L.M------PKI-F-T-...
A8PNA6_9COXI/753-1000-DSGQLSNFL.......R------------------------------------------N.W------GLP-T-S-...
A8UEF9_9FLAO/566-791-QQFDISQSF.......E------------------------------------------E.L------E.M-L-K-FLA
A9CIC7_AGRT5/884-1105-TDANPEPIL.......W------------------------------------------A.N------A.N-G-P-...
A9DPS2_9FLAO/819-1056-EKVDLDKLLF....KFE------------------------------------------N.F------G.Q-D-H-...
A9H3V6_GLUDA/474-684-RGLDVTTQF.......E------------------------------------------...------G.G-R-T-...
A9VZI8_METEP/849-1067-EGADLTGLI........------------------------------------------...------..G-A-G-...
B0NQ23_BACSE/741-944-HNINIGKLVDFAPSLDT------------------------------------------I.V------P.M-L-R-...
B1KJH7_SHEWM/1029-1272-NATRFDDLS.......T------------------------------------------I.L------G.T-D-P-...
B1XRV0_POLNS/1079-1327-DIKDAGQII.......S------------------------------------------H.W------TNQ-K-S-...
B1XVC5_POLNS/28-239-KDFSLEQII.......S------------------------------------------S.A------DSG-A-K-...
B2FP42_STRMK/1008-1250-RSEDLGALM.......Q------------------------------------------N.L------DYG-G-Q-...
B2PXM1_PROST/1000-1242-SGEQFDETA.......A------------------------------------------Y.Y------GIL-V-P-...
B3JDW0_9BACE/854-1057-HKINIAKLVEFAPSLDT------------------------------------------I.V------P.M-L-R-...
B3PTQ9_RHIE6/884-1105-ADSDLAGVI.......W------------------------------------------L.R------D.G-A-P-...
B3R439_CUPTR/1186-1441-DVRDAGATL.......D------------------------------------------R.L------G.L-P-H-...
B4D2P2_9BACT/252-462-LQVNLDQLG.......R------------------------------------------Q.W------GTD-P-G-...
F2G3T4_ALTMD/1046-1287-TSPDVGQML.......K------------------------------------------E.Y------G.V-E-S-...
B4S7D6_PROA2/551-781-AEVNIVESYKSV.SLLK------------------------------------------T.L------APV-A-E-...
B4WWS5_9GAMM/996-1238-ASDNLGRSL.......S------------------------------------------A.W------G.L-P-E-...
B5D2W9_9BACE/743-946-RKVNIGKLVDFIPSLDT------------------------------------------I.V------P.M-L-R-...
B5RZT4_RALSL/864-1116-DLRNSGELL.......Q------------------------------------------K.M------G.F-A-K-...
B6C3U8_9GAMM/392-603-NNFELKQISESLADLDN------------------------------------------K.L------N.I-D-D-...
B6ELQ6_ALISL/633-885-VVTEIGPWKLDKKASLA------------------------------------------Y.D------I.Q-K-Q-...
B6JB61_OLICO/637-850-DKADAAALK........------------------------------------------..Y------R.E-L-A-...
B6XFK3_9ENTR/1013-1256-TGEAFDETA.......A------------------------------------------Y.F------GVL-V-P-...
B7RTJ0_9GAMM/1040-1283-HFSDFGDTL.......D------------------------------------------Q.L------G.Y-A-P-...
B7RZC0_9GAMM/833-1042-ERLPFLWLL........------------------------------------------...------I.G-D-P-...
B7VIB8_VIBSL/1027-1268-EGENNSELM.......E------------------------------------------R.F------G.I-T-S-...
B8B0X9_ORYSI/279-522-LGGKIDETA.......A------------------------------------------F.F------G.I-T-I-...
B8CI63_SHEPW/997-1240-DATKFDHLS.......K------------------------------------------Q.L------GFD-P-G-...
B8DNW5_DESVM/971-1157-RDFELEPVG.......L------------------------------------------R.F------A.G-K-D-...
B8J2T2_DESDA/848-1034-NNFDLTEAS.......N------------------------------------------A.R------G.G-S-A-...
B8KWT1_9GAMM/869-1081-EQLMMNLAG.......T------------------------------------------S.K------E.E-Q-D-...
B9BCU5_9BURK/1099-1356-DVDDAGALL.......D------------------------------------------R.V------G.L-P-R-...
B9XF33_9BACT/756-966-TDSNLHLLM.......A------------------------------------------DLY------S.G-T-N-...
B9Z3I6_9NEIS/1017-1259-ESANLGELL.......G------------------------------------------R.F------GYG-D-T-...
C0N416_9GAMM/1005-1255-SSDDLKALL.......A------------------------------------------Y.Y------N.Y-Q-Q-...
C1D9M5_LARHH/1015-1258-DSASLGKLL.......A------------------------------------------R.I------G.E-A-D-...
C2M1Y5_CAPGI/573-798-NKLNVMESF.......S------------------------------------------Q.I------E.M-L-K-KIM
C3K7G5_PSEFS/1015-1260-DGKNIGDVL.......K------------------------------------------G.W------G.Y-A-P-...
C3L4A9_AMOA5/534-754-QNVQLPALFYTFENFNQ------------------------------------------R.F------L.E-D-R-...
C3MGL5_RHISN/425-630-KDANFAAVL.......A------------------------------------------S.F------G.L-A-G-...
C3XBS4_OXAFO/1106-1353-NIRDAGKLL.......D------------------------------------------R.F------G.Y-K-G-...
C4L8L8_TOLAT/989-1232-VSNNTEVFL.......G------------------------------------------H.F------G.F-D-P-...
C4U7R6_YERAL/1011-1254-NGPKIDETI.......S------------------------------------------F.F------G.L-S-T-...
C4UIL5_YERRU/1014-1257-SGSKIDRTL.......S------------------------------------------F.F------G.I-I-T-...
E8RSC3_ASTEC/1136-1358-QN.DYTAFT.......F------------------------------------------E.A------D.D-L-G-...
E3IRW1_DESVR/941-1125-VDFDLSPLV.......M------------------------------------------R.H------W.N-R-D-...
D9SHW3_GALCS/1021-1263-TISNAGKIL.......S------------------------------------------R.S------G.Y-P-N-...
C6B1K3_RHILS/408-616-RDADFAALA.......E------------------------------------------R.L------Q.L-K-G-...
D5CU11_SIDLE/1024-1263-DISDAGKIL.......S------------------------------------------R.S------G.Y-P-E-...
D8JRU2_HYPDA/915-1130-NSSDAGQVL.......K------------------------------------------L.V------NFY-P-N-...
C6UUQ9_ECO5T/1009-1252-RGQKIDAAA.......E------------------------------------------F.F------G.V-T-T-...
C6WWM2_METML/1053-1294-DIKDLGQTL.......A------------------------------------------R.L------G.Y-A-D-...
C6XD69_METSD/1043-1284-DIKDLGKTL.......E------------------------------------------R.F------G.Y-P-G-...
C6XK02_HIRBI/884-1092-RSDDAGYIL.......K------------------------------------------T.L------F.K-T-D-...
C6XTR4_PEDHD/806-1010-TEFDVAKAYKEI.KLFR------------------------------------------D.M------ATS-A-S-...
C7BLT0_PHOAA/1013-1256-SGGRFDEMA.......S------------------------------------------Y.L------GVV-V-P-...
C7JI05_ACEP3/380-581-DNGDIDQFR.......K------------------------------------------Q.A------G.F-S-P-...
C7PC84_CHIPD/564-796-QNVDVQQTF.......N------------------------------------------A.F------N.T-V-Q-ALM
C7PJB3_CHIPD/809-1013-RQFDIKRAYNEI.RLFH------------------------------------------D.M------ATS-A-G-...
E6WGF8_PANSA/1014-1257-SGNNINDAT.......N------------------------------------------W.F------G.V-N-T-...
C9NN95_9VIBR/1009-1250-SGENNSDVM.......E------------------------------------------R.F------G.I-T-S-...
C9P2T1_VIBME/1028-1269-QGENNSDLM.......E------------------------------------------R.F------G.I-T-S-...
C9PMQ2_9PAST/191-392-ENIIAEQWL.......K------------------------------------------V.L------D.L-P-L-...
D0HXR9_VIBCL/115-356-KGDNNSDLM.......A------------------------------------------R.F------G.I-N-S-...
D0I525_VIBHO/1024-1266-TANNSSDLM.......G------------------------------------------R.F------A.V-T-G-...
D0TG62_9BACE/829-1032-NDILVERLI.......S------------------------------------------L.F------P.D-I-D-TLV
D0Z1U4_LISDA/1035-1276-KGEDSTDLM.......G------------------------------------------R.L------G.I-S-G-...
D1JQS4_9BACE/740-943-RNINIAKLVDFVPALDT------------------------------------------I.V------P.M-L-R-...
D1RKZ9_LEGLO/1049-1297-NMTQLSKTL.......E------------------------------------------R.W------N.I-T-P-...
D5WC43_BURSC/1144-1399-DIKDAGAML.......E------------------------------------------R.F------G.L-P-R-...
D2C1Z1_DICD5/1022-1265-SGNNLSDNA.......D------------------------------------------W.L------G.L-A-T-...
D2U2L7_9ENTR/1008-1250-KGNRFDDLA.......A------------------------------------------Y.Y------G.I-L-V-...
D2UF54_XANAP/1023-1265-ESQDLGALM.......Q------------------------------------------S.L------DFG-G-Q-...
D2ZL55_9ENTR/1006-1249-KGNKLDAAA.......N------------------------------------------F.F------G.I-S-T-...
D3SBX9_THISK/1040-1287-SGDDWGGAL.......T------------------------------------------S.A------RLS-R-A-...
D4BXD7_PRORE/987-1229-TGEAFDETA.......A------------------------------------------Y.F------GIL-V-P-...
D4EGY4_AGGAC/176-377-KNYPLERLL.......T------------------------------------------W.L------T.F-P-K-...
D4GCB7_PANAM/1019-1262-QGSNINNAT.......N------------------------------------------W.F------G.V-N-T-...
D4HUV7_ERWAC/1008-1251-SGKQIDRAI.......Q------------------------------------------W.F------G.I-T-S-...
D4IQI7_9BACT/568-774-SGASFRKTF.......E------------------------------------------E.L------E.M-V-Q-QLV
Q0ABM3_ALHEH/1048-1290-QGERAGDIL.......A------------------------------------------T.L------GYL-P-S-...
Q0AQ38_MARMM/879-1092-EAQSLQRIS.......A------------------------------------------L.L------G.M-E-G-...
Q0BUM1_GRABC/651-853-GALPLEALV.......A------------------------------------------L.M------K.Q-P-G-...
Q0BY26_HYPNA/311-513-IGVPFANLA.......A------------------------------------------...------...-D-P-...
Q0G0J1_9RHIZ/903-1122-DELRLSKIA.......P------------------------------------------A.L------A.A-A-G-...
Q11U15_CYTH3/815-1020-RELDINKAYTEI.ALVR------------------------------------------K.L------A.P-A-A-...
Q11YL6_CYTH3/532-755-RAMNIDSLFYVFENFSQ------------------------------------------N.F------I.T-N-K-...
Q11YT8_CYTH3/698-925-KDVAAKEAY.......K------------------------------------------T.F------N.S-V-K-KMA
Q134A2_RHOPS/861-1075-SGADATAL.........------------------------------------------R.Y------G.D-Q-M-...
Q145G0_BURXL/1154-1409-DIKDAGALL.......E------------------------------------------R.F------G.Q-P-R-...
Q15ZG8_PSEA6/1002-1243-SSSDFGLFL.......K------------------------------------------G.F------EFD-S-G-...
Q1MYL9_9GAMM/998-1245-ASNDVAGIQ.......A------------------------------------------A.W------R.T-K-P-...
Q1RIG6_RICBR/624-851-NTIDLDKTS.......A------------------------------------------L.L------PKI-F-A-...
Q1VS98_9FLAO/575-799-TTIKIVEAF.......Q------------------------------------------Q.M------E.L-V-K-GLA
Q1YH64_MOBAS/407-618-SGIDTDAFL.......G------------------------------------------A.L------D.V-T-T-...
Q1YJ92_MOBAS/882-1101-ESFALDSVW.......P------------------------------------------G.L------A.A-F-E-...
Q1Z1R2_PHOPR/1035-1276-EGKNSSDLM.......G------------------------------------------R.F------G.I-S-G