Sequence alignment for CL0404

PF07242

A7GQL2_BACCN/621-721-------------------------VLFVAL------------------LGYL------F--------------------
A5MAB6_STRPN/576-675-------------------------ILTLST------------------A..I------L--------------------
Q9L651_LACLL/549-647-------------------------SIALIS------------------S..T------F--------------------
A5M6X5_STRPN/166-265-------------------------IVGIAS------------------S..L------L--------------------
Q931U7_STAAM/555-653-------------------------IIIAII------------------L..I------I--------------------
Q8CY97_STRR6/155-254-------------------------VLGIAT------------------S..I------L--------------------
Q6GIZ0_STAAR/545-643-------------------------IINVFI------------------L..L------I--------------------
Q926X5_LISIN/619-718-------------------------IILAIS------------------S..Y------S--------------------
Q93MD9_CLOPE/619-718-------------------------VILLAV------------------I..S------I--------------------
Q9KG35_BACHD/612-712-------------------------VLTATI------------------A..L------F--------------------
B9WU46_STRSU/561-660-------------------------ILGIFT------------------S..I------L--------------------
Q9CJI4_LACLA/565-662-------------------------VILIFL------------------S...------.--------------------
Q8Y3Q8_LISMO/620-718-------------------------ILALCL------------------C...------S--------------------
Q896P1_CLOTE/604-706-------------------------LLLLVS------------------I..S------I--------------------
Q892J9_CLOTE/609-706-------------------------IML...------------------...V------I--------------------
A8AXA7_STRGC/592-691-------------------------IFGMAT------------------S..I------L--------------------
Q9CE29_LACLA/560-659-------------------------IITIIV------------------I..S------F--------------------
Q181M6_CLOD6/617-718-------------------------IIIIAI------------------S.NL------M--------------------
A7GNK2_BACCN/616-716-------------------------IVTLIL------------------S.NL------L--------------------

PF02687

O50782_BORBU/276-402-----------------------MFILVLIS------------------LLIF------I--------------------
A3I1M1_9BACT/289-407-----------------------GIVALLLI------------------AIGV------I--------------------
A7VH46_9CLOT/421-541-----------------------GA...ILL------------------ILIS------Y--------------------
A8ABZ3_IGNH4/248-373-----------------------EVMSEISW------------------AVVT------I--------------------
Q9F443_STRSL/517-633-----------------------TFLSILFI------------------ICTG------S--------------------
A7H0E4_CAMC5/307-422-----------------------GIVSILAL------------------VVSA------I--------------------
A3UQ03_VIBSP/269-395-----------------------GLMLGLII------------------GVAA------F--------------------
A5Z5I3_9FIRM/662-784-----------------------QVLSWLVF------------------LFGV------I--------------------
A8H349_SHEPA/695-810-----------------------SLVLVLVL------------------LASA------L--------------------
Q9WZG5_THEMA/725-844-----------------------KFIFLFGF------------------LSAS------S--------------------
Q9FBP3_STRCO/657-772-----------------------FVGAACVL------------------ALIG------A--------------------
Q2CDR4_9RHOB/175-297-----------------------VFALLLIA------------------GSTG------A--------------------
A6DHZ0_9BACT/321-438-----------------------LIIMSSSL------------------SLAI------L--------------------
A5ZCK7_9BACE/250-369-----------------------SIVAVLIL------------------LVAL------L--------------------
O28455_ARCFU/275-396-----------------------VLFPAFFI------------------LVSI------F--------------------
Q481M7_COLP3/705-820-----------------------SGFAVMII------------------LLAI------I--------------------
A4YKC0_BRASO/734-849-----------------------RGASAVTL------------------ISAI------L--------------------
Q0HRW4_SHESR/279-392-----------------------TMMVVLLL------------------LITS------L--------------------
A7AZK1_RUMGN/757-876-----------------------YSLTALFG------------------IIGI------S--------------------
Q64W75_BACFR/294-427-----------------------GGALLALL------------------LVPA------I--------------------
A8AR20_CITK8/231-351-----------------------AMIGVLMV------------------AAVF------L--------------------
A3UCF7_9RHOB/264-386-----------------------WPLAIIMA------------------VGAL------A--------------------
Y684_MYCPN/989-1110-----------------------VVIAAFLS------------------ILAL------Y--------------------
Q2RPK1_RHORT/279-403-----------------------VSAVGGLG------------------AFGL------M--------------------
A6H1M7_FLAPJ/284-410-----------------------IVILVIMI------------------VVST------I--------------------
A8G4C7_PROM2/272-386-----------------------SLGALMGF------------------VVGC------V--------------------
A0PQZ2_MYCUA/174-295-----------------------FAVALVQA------------------VGAI------L--------------------
Q4QBC9_LEIMA/977-1097-----------------------YFTSVICI------------------TLCA------F--------------------
Q025M3_SOLUE/351-471-----------------------VAAAGFLL------------------VIAC------A--------------------
Q54MT9_DICDI/545-666-----------------------NLIVFVFL------------------LLSI------L--------------------
Q6MGV4_BDEBA/659-778-----------------------AILLLFAV------------------TISG------A--------------------
A6L8W9_PARD8/653-767-----------------------IVFSIIAI------------------LISL------L--------------------
Q4A9N5_MYCHJ/2523-2644-----------------------NIVVIIFL------------------VVSL------I--------------------
A4CDR0_9GAMM/687-801-----------------------QWLLILSA------------------SLTV------I--------------------
Q01VW7_SOLUE/1278-1396-----------------------LLLGVVAT------------------VLAT------T--------------------
A3I5H5_9BACI/646-767-----------------------SIVGFLFI------------------IVTC------I--------------------
A5USK7_ROSS1/311-433-----------------------ALFAVPLL------------------VVIG------Y--------------------
Q9A6K3_CAUCR/352-465-----------------------GFSAFLGL------------------LIGV------A--------------------
Q72UY4_LEPIC/260-379-----------------------SLLGLSAF------------------FLGG------I--------------------
Q5V3A9_HALMA/874-995-----------------------GVLVVLSA------------------LSTV------G--------------------
Q8NS27_CORGL/613-739-----------------------SSLASSAA------------------LTAV------A--------------------
B1JTM3_BURCC/259-376-----------------------RLVSYVVI------------------LIIM------A--------------------
A7AFS2_9PORP/465-579-----------------------MIGGLITL------------------IISL------I--------------------
A8F9W5_BACP2/316-420-----------------------ILLTVTLS------------------LFSL------V--------------------
A8HA97_SHEPA/673-786-----------------------SSMALLII------------------FLVI------F--------------------
Q97DB8_CLOAB/716-835-----------------------KAFPIIAL------------------IIGA------F--------------------
A6F274_9ALTE/258-378-----------------------LLGGSLAV------------------MLAA------V--------------------
A7HK62_FERNB/257-383-----------------------SGFSILS.------------------..SF------L--------------------
B8FRQ9_DESHD/291-412-----------------------LFICIFLG------------------VMSL------F--------------------
A1TXE6_MARAV/183-306-----------------------DALGVLVL------------------LITS------L--------------------
Q93H51_STRAW/242-364-----------------------GTAGGVTA------------------FVSV------F--------------------
Q54290_STRHY/294-451-----------------------TLAMWLMG------------------LAGA------A--------------------
Q830M8_ENTFA/579-698-----------------------LYVSMFVA------------------ILAL------F--------------------
Q81N14_BACAN/248-369-----------------------IVLSTLIL------------------IVTA------L--------------------
A7B7J6_RUMGN/273-419-----------------------KAVLAAIG------------------VFGT------F--------------------
Q5LCL1_BACFN/272-387-----------------------AMAGVLVI------------------VCSL------F--------------------
Q9KF85_BACHD/539-650-----------------------VLIAGLFL------------------FVSI------S--------------------
A3D8C2_SHEB5/283-407-----------------------NAMSMLAF------------------VVGL------F--------------------
A1SKN4_NOCSJ/300-416-----------------------PLLMAQLG------------------LLAL------V--------------------
A7VFS5_9CLOT/263-395-----------------------GVLILAIV------------------LFSV------V--------------------
Q5JEM5_PYRKO/203-318-----------------------MSFFYLLL------------------GTAL------L--------------------
A7VIB2_9CLOT/622-743-----------------------YMFEVFAL------------------AMFM------L--------------------
Q8G7P9_BIFLO/320-438-----------------------KTGTIVLV------------------AVGG------V--------------------
Q735D4_BACC1/728-843-----------------------SIVALFAF------------------LTAV------L--------------------
A6BFN6_9FIRM/685-806-----------------------YLFMAVVG------------------LIGF------M--------------------
A4CAI1_9GAMM/683-798-----------------------AGLIVVTL------------------LLTG------L--------------------
A3ZPC9_9PLAN/633-758-----------------------VIVGAGVF------------------LFGT------I--------------------
A9KQT2_CLOPH/343-506-----------------------ITFMIVVM------------------VLGG------V--------------------
A1ZGZ7_9BACT/274-392-----------------------SILGAFFI------------------ALSF------V--------------------
Q6F1V8_MESFL/1691-1810-----------------------LFLITGII------------------IISV------L--------------------
Q601V9_MYCH2/401-522-----------------------LLGIQLLL------------------LIAL------I--------------------
B8G588_CHLAD/255-383-----------------------PVITVLMF------------------IVGV------L--------------------
Q04L09_STRP2/60-182-----------------------GFGMFVVT------------------LASA------I--------------------
Q048H0_LACDB/280-404-----------------------AIFSLAIM------------------VIAV------L--------------------
A4BXN0_9FLAO/168-283-----------------------FVLSGFLA------------------LVAI------I--------------------
Q9PPU7_UREPA/163-284-----------------------LSLIVLIL------------------LLGI------Y--------------------
A5LLD1_STRPN/291-413-----------------------NIFPVVLY------------------AVAA------M--------------------
A6TSQ0_ALKMQ/264-387-----------------------FMMTTMVL------------------FISI------F--------------------
A7VD43_9CLOT/805-930-----------------------SLSFLVAV------------------ILCT------I--------------------
Q8RTI8_9GAMM/277-411-----------------------YLLMLIVY------------------VVVA------V--------------------
A5N346_CLOK5/473-593-----------------------YGFLAIIT------------------LVTV------L--------------------
Q053J3_LEPBL/252-373-----------------------LVISFISL------------------IIAL------F--------------------
A7H957_ANADF/284-394-----------------------AMFLVILS------------------VVSA------A--------------------
A1SH34_NOCSJ/769-890-----------------------RVELALAA------------------ILVL------A--------------------
A6LCJ9_PARD8/285-395-----------------------FSASFLVV------------------LIAV------I--------------------
B8I8J6_CLOCE/296-424-----------------------NLFILIFL------------------VVIS------I--------------------
Q6AA47_PROAC/602-722-----------------------LAAGFLL.------------------..IL------V--------------------
Q4MWW1_BACCE/235-351-----------------------NKYYYKFI------------------LVAI------V--------------------
A6NZ14_9FIRM/176-297-----------------------IILVVMLV------------------VMSL------F--------------------
Q6MT15_MYCMS/562-682-----------------------IVIGIFVL------------------LLSF------V--------------------
A4VW57_STRSY/998-1117-----------------------TILVILSI------------------LLGL------V--------------------
Q18EP9_HALWD/299-419-----------------------IAAFVVAL------------------IVGV------L--------------------
Q8EUA2_MYCPE/1360-1480-----------------------VSFLSILL------------------IITV------L--------------------
A5MD01_STRPN/302-451-----------------------NLLFWGSL------------------SFSV------L--------------------
Q47EZ3_DECAR/243-372-----------------------LTVLAGAI------------------LAFV------I--------------------
Q034M7_LACC3/404-519-----------------------RQIALLFI------------------MASM------I--------------------
A3I2Y5_9BACT/746-861-----------------------LFSATLSV------------------ILAL------L--------------------
Q0RJL1_FRAAA/639-753-----------------------NVVILTSL------------------PIAG------C--------------------
Q7UPA2_RHOBA/581-706-----------------------LALSFFVI------------------LAAM------M--------------------
Q8A9F6_BACTN/266-381-----------------------SLVAILVL------------------LIGI------F--------------------
A4C0M9_9FLAO/275-395-----------------------SLIAYLIL------------------VISC------I--------------------
Q14QM1_SPICI/154-274-----------------------NVLEGLTI------------------AIVA------L--------------------
Q97LN0_CLOAB/737-854-----------------------YTFIIMIS------------------LIAV------A--------------------
A3ZPB7_9PLAN/791-914-----------------------SQLPIAAV------------------AIAG------F--------------------
Q737Y3_BACC1/256-376-----------------------IIISALLM------------------LIAM------L--------------------
A7VDT8_9CLOT/311-424-----------------------EILAFLLC------------------MIAG------I--------------------
Q4A9N5_MYCHJ/1802-1923-----------------------IYLSLFLS------------------ILVL------F--------------------
Q899W1_CLOTE/250-369-----------------------VFVSCLII------------------LVSV------S--------------------
Q4DFN5_TRYCC/444-565-----------------------TCFVIGIV------------------ALCA------L--------------------
A7ADY9_9PORP/281-400-----------------------TVTGLLLL------------------LCVF------F--------------------
A7ADZ2_9PORP/274-398-----------------------PLIGLLIL------------------IAAM------I--------------------
Q2SRI5_MYCCT/367-490-----------------------YSVAVLLA------------------VISV------V--------------------
Q71YS2_LISMF/59-181-----------------------SSASLMLI------------------LFII------F--------------------
Q638M9_BACCZ/706-820-----------------------IVVIVVIL------------------FSIT------L--------------------
Q8KD33_CHLTE/268-389-----------------------TVLPTIFL------------------AVAV------F--------------------
A7GNK2_BACCN/187-299-----------------------NVSQMIII------------------GLVI------L--------------------
A3JAL8_9ALTE/692-813-----------------------RAMTFVTL------------------VLAA------V--------------------
Q6F163_MESFL/1281-1400-----------------------LIFVLLTT------------------VLLA------I--------------------
Q6AMB4_DESPS/278-415-----------------------DLANYISL------------------IASA------V--------------------
A7K544_VIBSE/291-411-----------------------MAVSGFVV------------------IAGL------L--------------------
Q2SSK7_MYCCT/644-765-----------------------FLTSSLIA------------------LISA------L--------------------
A3QAU8_SHELP/312-429-----------------------VGLSALFL------------------SVCL------V--------------------
Q6F1W1_MESFL/1301-1420-----------------------AIAIVLIL------------------SLTF------V--------------------
A6LZM8_CLOB8/286-398-----------------------IFRIIIIT------------------IIAS------A--------------------
A7VI29_9CLOT/290-409-----------------------LELFFIVA------------------ISAC------V--------------------
Q6UCA9_BACFG/30-146-----------------------SLLGFAIL------------------FAAT------M--------------------
Q2ST97_MYCCT/1669-1788-----------------------IIIITAIM------------------LCAS------L--------------------
A7AE18_9PORP/286-404-----------------------LISALLIL------------------LIAC------S--------------------
A7V9H5_BACUN/291-408-----------------------RLIVIFFV------------------FNVF------I--------------------
Q6GDI1_STAAR/59-180-----------------------IIANFFMA------------------LLTF------I--------------------
A8FMY2_CAMJ8/150-267-----------------------WLFLFIII------------------LLAF------V--------------------
A7ZGQ8_ECO24/256-370-----------------------NIIYFFLT------------------VTSI------V--------------------
A7VI30_9CLOT/297-409-----------------------TLIVAVMI------------------LFGI------M--------------------

PF03739

Q3ATU7_CHLCH/6-355-----------RYIFQQFIKAFLFTALVFVS------------------LFII------I.NMIEKLGNF.MDHH..VS.
Q1CSH4_HELPH/4-343-----------HYLFMAVSQVFFSFFLVLFF------------------ISSI------V.LLISIASVT.LVIK..VS.
A5TUK8_FUSNP/11-360-----------KY....FIKFFLMNIIGFMG------------------VFLL------A.QTFKIIKYI.NQGK..LA.
Q4UQP7_XANC8/6-349-----------RYLLSDFTQSFLATLIVLLV------------------VSVG------G.VLVDILGNI.ADGR..IP.
A4N619_HAEIF/7-355-----------RYIGKSILGAIFATLMTLVG------------------LSAI------I.KFVEQFRSV.GKGT..YD.
A4JGZ3_BURVG/5-348-----------RSLQRELAYTAGAVFMVLLT------------------IMLT------T.MMIRIVGYA.ASGE..ID.
Q118T4_TRIEI/24-389-----------RYIIAELIGPFLFGVGLFSS------------------LGIT------VGAMFELVRKV.TESG..LP.
A0LEN9_SYNFM/39-391-----------RYLIKEQMVPLGVCLMGVSL------------------VLIT------G.RLFQLLKVL.FTSS..FT.
A6EGW2_9SPHI/13-364-----------WYIISKYLGTFLYTLTLFVV------------------IIVI------F.DLSEKLDDF.LSNN..LT.
Q72LM8_THET2/4-334-----------RYVLREVLVPYLVGVFLFAA------------------LLTF------..DLLSSLSGVLLSRG..VG.
A3UJ93_9RHOB/6-356-----------RYTFRQALWPFLGAMAALTG------------------LAVL------T.QSLSNLDLM.AERG..ET.
Q66F08_YERPS/5-354-----------RYLVRETLKSQIAILFILLL------------------IFFS------Q.KLVRILGAA.VDGE..IP.
Q4HT94_CAMUP/6-348-----------HFISFIYLKNFFILFFALVG------------------FYCG------V.DLLLNFKDLPASAN.....
Q92FY2_RICCN/24-375-----------KYFIKNILPLLIVVTFSVTS------------------IVWI------T.QILKLLYLF..DKG..IK.
A3ZYQ2_9PLAN/6-385-----------RYILWEILKIFFLALGALTL------------------LIVL------V.GVVQQA....LREG..LG.
A8A4E0_ECOHS/6-354-----------RYLIRHLFLGFAAAAGLLLP------------------LFTT------F.NLINELDDV.SPGG..YR.
A7HYF9_PARL1/7-370-----------RYLFFQTLGPFVVASVVLSG------------------IIWL------T.QALRMLDVL.ITQG..QT.
Q8DIL4_THEEB/18-374-----------QYLLSLLLPGFVLGLTVFTT------------------LALT------VGTIFDLVRQI.ADAQ..LP.
Q82W93_NITEU/6-348-----------RYITRELLFPFIVVTVILIG------------------LFVS------F.SVARFLTSA.VTET..LG.
A0LB31_MAGSM/6-364-----------RYLLQLFLQGFVKVFSIFIA------------------LFFL------M.DGAEQIRRFGGRDH..VI.
Q6MKD0_BDEBA/11-364-----------QYIFFEMLPSFILGLLVFVS------------------IILM------F.QVLRLTEFA.LVHG..VA.
Q4HIC5_CAMCO/6-341-----------RYVLNQFLSTNLSIFFVLFT------------------IVSM------V.FFIQLAKLT.SSIE..IN.
Q6FFD6_ACIAD/9-354-----------KHVTKTTALAMLGTTIVLVI------------------LQVL------F.TYLGELSNL..KAD..YS.
A7ADX1_9PORP/9-487-----------TFMLQTFLPLFLMTFGICLF------------------IVLM------Q.FLWRYIDDM.VGKG..LG.
Q0C1U6_HYPNA/7-346-----------RYLSWLFLQRLLVTVFALVA------------------LLGV------L.DALSNADKL..PAG..AG.
Q11U59_CYTH3/9-455-----------LLVLKAFFGPFILTVFVVTF------------------IFLM------Q.TILKYIDEL.VGKG..LS.
Q7P2I8_FUSNV/6-353-----------KYILDELKGPIILAVFVFTF------------------IFLL------D.IVVTMMEHI.IVKG..IS.
A1AWC7_RUTMC/20-369-----------RYLMRNVSVLLSVVFIVISL------------------VVFG------N.QLVLIIKET.SKEG..IP.
Q73NV9_TREDE/13-373-----------VYVFKELLLYFIVSFLFFFF------------------IFFV------N.QILLMAEEI.LSKK..AP.
A3SQ70_9RHOB/5-359-----------FYFARKFLWTLIGIATVFSV------------------LLGL------I.DLVDELQDF...PD..LP.
Q1PXZ0_9BACT/7-354-----------RYLLKAFFPTFFLCLLIISG------------------TYVI------I.DLLQKLDDF.LEMG..IN.
Q1VZU1_9FLAO/6-482-----------RYILVSFVKTFLSVFTILML------------------IFIL------Q.SVWRFIEEF.AGKD..ID.
Q1GR36_SPHAL/14-363-----------LYVGRLFLFRTFAILFALVL------------------ILQT------L.DLLGESGKILAVPG..NG.
Q8G1M6_BRUSU/6-359-----------LYILRRVAIMFFAVLGAAVG------------------ITWT------V.QVLQRINFL.TTSG..QT.
A5EXI6_DICNV/8-348-----------RYMMREISALFLAITMILLT------------------IIIS------F.RFSSLLSRA.LDGS..VS.
Q7VQS8_BLOFL/9-358-----------RYIKKYVLLNIFMIFLIFIS------------------LSSI------I.RLVDELRNF.QKQT..YS.
Q85G79_CYAME/6-326-----------QYIWSHLWTPFLYALSACLA------------------LTFS------AGALVDVMRQI..TQG..LS.
A6C004_9PLAN/10-385-----------RYLLKRYFHVFVIGFIATYG------------------LYVV------F.DGFTNIDGFQAGAEKVSSN
Q2PY37_9BACT/6-356-----------RYILSKFLGNFALFMGLIML------------------IAMV------F.DVSQKLDDF.MDND..LN.
Q310A0_DESDG/6-352-----------RYLLRTNLFLTMLTLTIGTG------------------IYLL------S.DLFDRLDDF.LGAG..LG.
A3XBE3_9RHOB/6-359-----------RYVLSQYLLFFSFFALILVA------------------VFWV------N.RAVVLFDRL.IGDG..QT.
Q1NXF0_9DELT/6-358-----------RYLITSFGRNLATVLGGLLA------------------IYLL------V.DFFERVDNF.LDAG..LG.
Q2JVE3_SYNJA/13-373-----------RYLFGQMLTPVLAGIAGGTL------------------LLLA------G.RLFTLAERL.VEGS..VP.
Q5SL96_THET8/6-344-----------RYLLRETLPLFGGGLLVIVL------------------LFLG------G.AVYEVLAPL.VAKG..AD.
A6EIS0_9SPHI/6-447-----------VLLLKAFIRPFFVTFFIVMF------------------ILLM------F.FLFKYVDDL.IGKG..FE.
A7NDI7_FRATF/5-351-----------KYYNKDIVNTFTSITLFIIS------------------IVSA------N.LLIRLFQEA.YSQG..LG.
Q6MJL5_BDEBA/6-356-----------RYTAWLFVGYFVGGLLVFLT------------------LFTA------V.DAMSTMVNY...KD..VA.
Q0F2Q6_9PROT/5-349-----------RYMLRLWLGPFFGGLVFVLA------------------VMLL------A.RALKLLGTV.SDTA..EA.
A5WBH3_PSYWF/27-466-----------RYMTRQVASTTALVLGFLVV------------------LLLG------G.RMIRYFGIA.AEGR..LD.
E0TCF8_PARBH/6-360-----------GYLAKRTLGGVLGLLLVIWL------------------IVVS------V.DLIEAMRDIARIPG..AG.
Q984S3_RHILO/7-356-----------RYFFFRYVTITIWFFLGLLA------------------LVFL------I.DFTELSGRTTGLPG..FT.
Q2S3I0_SALRD/55-410-----------RHIIKRLLKGFVLFVGALLV------------------FFIV------L.HWVEYSDDF.LDGG..AT.
Q1IRI3_KORVE/435-789-----------DMILRDFLLYFVMVLTTFVM------------------LALV------F.TFFELLGDI.VKNR..VS.
A3ZKX1_9PLAN/6-376-----------RYLLTQFIKSFLIFFISFTG------------------LYVV------I.DSFNNLDEFLRYGE..QT.
Q8FDM9_ECOL6/6-352-----------HYIMRGTRRLVLIIVGFLIF------------------IFAS------Y.SAQRYLTEA.ANGT..LA.
Q054H5_LEPBL/30-383-----------RYLFGEFFKVFIGTVVLLTG------------------IMLL------S.LVNDNMRNF.TTTK..AP.
A1WAC0_ACISJ/11-359-----------RYAVRLFAVPLLTALATMLL------------------ATML------Q.RLLRLFDIA.ASTG..AS.
Q1CRE0_HELPH/5-350-----------RFVGWYYFKYFLIVLLALEL------------------FFVG------I.DSLKYADKM.......PD.
A3YF37_9GAMM/6-351-----------SYIGKGVVWAFFAVVFILLG------------------LDYV------L.TFIEQVKRI..SEF..YT.
Q8D296_WIGBR/5-350-----------KYLIKKILKSQFHILCILFL------------------IFFC------Q.KLVRILSSM.SEEL..IP.
Q6MDI9_PARUW/8-358-----------RYFVSEFIKVFLLFLVCFYG------------------LYVL------I.DYASHTSAL.PHHHIQLR.
Q9A939_CAUCR/5-350-----------LYVLRTVATRILGAALILMS------------------VLQI------L.DLLDVTSDI.LDRG..LG.
Q0SM43_BORAP/5-351-----------KLFVKSIILTFLSMNLIFMI------------------LIIL------G.DLFVNLLNF.LEKN..IS.
Q1D894_MYXXD/7-356-----------IYVLRTYLRFALGILAGLVL------------------VFVV------V.DFVDRAKLY.TGPG...W.
A6CDW2_9PLAN/6-388-----------RYVLFELLRVFTLMITVLTV------------------LLVF------V.GAFQQA....TSQG..LG.
A4BIX3_9GAMM/5-349-----------RYLYGQIMKPFVFMTLVLLI------------------LLIA------T.EISDTLTKI.LTGQ..FS.
Q1QKW5_NITHX/6-356-----------KYIFRTTLASFVVVLVSLTG------------------VIWI------T.QALRGIDLM.TSQG..QT.
Q5H4N0_XANOR/38-393-----------WYVGRVVLSTVLLTWAVLLG------------------LDLV------N.AFASEAKDI.GQGS..YT.
A6DAN3_9PROT/6-318-----------VYILNQFLPLFLTIFFVISA------------------IISL------I.YIITISNIT.SKIQ..IT.
Q143Z1_BURXL/6-377-----------RYFARQIYLTFIFILFAFSG------------------LFFF------F.DLINELNSV.GHGN..YK.
Q68VX9_RICTY/9-358-----------LYLTKLYSKCFFIILFLLIV------------------LLII------S.NIFDLLQKF.KNIY..VP.
A5PCY0_9SPHN/10-365-----------RYIARLVIVPMVGVFVLAAS------------------LLVL------D.KMLRLLDFVAVEGG...P.
Q0FGB6_9RHOB/5-362-----------IYFGKRYLISFIRVFLSIVL------------------LVLL------F.DFLTNLNRL...NGIEAQ.
B5EBA8_GEOBB/11-361-----------AYIFKEIPTPFLVGMVTFTF------------------VLLM------G.RFLKLAEMV.VEKG..IP.
A4BIX2_9GAMM/6-351-----------GYLVKQTSLMVSIVLLAIAG------------------LLFV------T.GIADEAARR.MTDT..YT.
A6DH34_9BACT/8-357-----------RYIMRSMLLPFVCCICGFIF------------------IFFI------A.NVQDDLSDM.LKLD...N.
A3I2C6_9BACT/6-354-----------KLIIKDFLKTYFFVVLMLIL------------------IVLV------L.DFTEKNDSY.IRND..VP.
Q2RQ55_RHORT/8-372-----------RYILRNLLVGLAVGSVALIV------------------LIWL------I.NSLKFLDWF.VNKG..LS.
A1WUU9_HALHL/6-348-----------GYLARTVIAASLVALAAILA------------------LDFV------F.SMVDGV....ADDG..LD.
A3ZM39_9PLAN/6-376-----------TYVVWEVFKIFFLCLLATVL------------------LMVV------G.GGVNEG....LKKG..LP.
Q0AH24_NITEC/6-352-----------RYIALQVLTGMIIATVVLLP------------------LFSF------F.DLLDQLDDV.GKGT..YT.
A5G1T7_ACICJ/24-378-----------RYVFRQLLIGLAVSTLGLVA------------------LVWL------T.QSLRFIQLI.IQHG..LS.
Q1NXE9_9DELT/10-360-----------TYLLTEMLAPFFAALLVINA------------------VLFL------G.RLVPMLDEI.FSLG..VG.
Q3B4Y3_PELLD/6-432-----------RYILKSLVGPFFLAFLTIMF------------------VLIL------Q.FFANFADRF.IGRG..ID.
Q0BZX3_HYPNA/9-369-----------RYILRECLSGLVLVLGILLL------------------AILM------I.DVVEQMRTIGGDVE..IT.
A2U291_9FLAO/6-450-----------KYILKSFLVPFIATFLIVLF------------------VLVM------Q.ALWQAFENI.AGKG..IS.
Q0BKY7_FRATO/8-349-----------RYIFRTVFSSFLIVSIIFCI------------------LFFI------F.TYLAQVSNN..TAN..VS.
A0LB30_MAGSM/6-357-----------RYLLTECALTSFTALVVLTT------------------LVLL------P.QILMLVDLW.VNKS..VS.
E0TCF9_PARBH/51-404-----------RYIFKQVAVPFLLILACTTA------------------VIWF------T.QMLQRVDLM.VEDG..GS.
Q1K323_DESAC/6-357-----------RYLLTTFTKITSLSLAAFVG------------------IYLL------V.DFFEKVDDF.LEHE..AA.
A5EXI7_DICNV/7-348-----------RHIARIITAHIIIVLIFLLG------------------IDFL------V.QSAEESDNI.GRGN..YH.
B8CYZ1_HALOH/12-360-----------VYIIKEVLYPFLIGVSIIGV------------------IMLS------..GLLRQLSDLIIIKK..IP.
Q1MPZ1_LAWIP/7-360-----------RQIFRESTYIFFLVVGALLT------------------LIII------N.RAIQMRDLF.IGLK..LE.
A3EV76_9BACT/6-358-----------RYIASELFKIFLLCFISLEA------------------IYGV------I.DSVEKIKDF.LSHH..AA.
Q5X1R0_LEGPA/5-353-----------RYLTKEVFLTLIALTAILVL------------------IFMS------N.QFIQYLNRA.ASGS..IP.
A8ZZ83_DESOH/6-356-----------RYIIAEILKALAVVMAVVIV------------------IYVA------V.DFFEKIDDF.LGAG..VP.
A8EWU1_ARCB4/5-331-----------RYLYSQLAITFFPIFFGLFF------------------ITAV------I.FLVKISALT.AIIT..VN.
Q0F2D4_9PROT/6-348-----------RWIFSGCLSRSLVTMSALLA------------------IFVI------I.ESFDKARYL..GHG..LD.
Q04UA4_LEPBJ/109-561-----------RYILGEILSPFLVALAFFTM------------------VYMV------L.ALQKMIGLF.VGKG..VD.
Q1PWZ7_9BACT/56-571-----------RYVIREWFQTFWPSFLCFEI------------------LMFL------G.FVIQILHKG.......LD.
Q31ET4_THICR/6-346-----------KYLYKELFATFFAVLSVLLL------------------ITFG------T.EATKLLAVA.VEGA..IP.
A3EV77_9BACT/6-356-----------RYLFVELLPPFVIGLLVLVV------------------LILT------Q.QTLMIMNLL.VNKG..LS.
Q1IZ54_DEIGD/6-380-----------RYVTRELLPPLVAGTLLFTA------------------ILSF------G.YFFISSQWL...RG..VP.
Q1J2D3_DEIGD/10-350-----------RSVLREVLRWYAAGVALFLI------------------LQLT------D.ALSTTVGVL.LLYH..AT.
Q2S0T8_SALRD/7-449-----------WIVLRRLPGPFFGWLGTLMF------------------LLLM------Q.FLIRWLPEI.AGKG..IP.
A4A3Y2_9GAMM/5-358-----------GYLAGDVLGHTLAVSSVLLA------------------IILT------G.RFVKYLAEA.ASGK..LA.
Q6MDI8_PARUW/7-377-----------RYSINHFLKIVFACVFAFIS------------------ILLT------M..RLDEIANF.AALG..AP.
B8CYX9_HALOH/6-362-----------RYLTRELIMPFLFGVAAFTA------------------IFIG------T.DILFTLTRLYNNFG..VE.
Q1IRI3_KORVE/8-376-----------RYILGEVLSHGAIGLALFTF------------------VIFM------R.DLGRLLELI.VRNS..AP.
O83854_TREPA/1-358-----------MYVCEVVFKHILVGVLCFFL------------------VFFV------N.NVLLFAQTL.LTKH..VS.
Q8D297_WIGBR/7-348-----------RYIRSLIFKTTIVALFILLT------------------ISGI------I.KFSEKIQSI.DNSY..IS.
Q9AA49_CAUCR/9-364-----------RYLLRRTLAPMSAVLISTMV------------------AFLM------E.RLMRSFDLL.SQTT..EG.
Q3J9X2_NITOC/9-352-----------RYILKELSLNATAITLVLLL------------------IFGG------I.RFIRFLSQA.TEGK..VP.
A7IJ85_XANP2/6-384-----------RYIFSTAAVAFLGVVVVLAG------------------MIWA------T.QALRQLDLV.TSQG..QT.
Q9TLY0_CYACA/27-394-----------SYLFKSLVLPFLFCWVSFVF------------------IELS------V.GCVNQLMSD.LSSG..LP.
Q0C1U7_HYPNA/7-360-----------RYLIRSFLGMFAGLTVLAMA------------------LLLL------E.RLIRITEIV.SGSG..SA.
Q0BVK4_GRABC/5-352-----------RYAAMAALKAVGLSAIALTA------------------LFSL------L.EFVQQLASV.GQGR..YG.
Q5FU64_GLUOX/35-392-----------IYIARQFMLSTLSMVLALTG------------------LVSL------F.DFIDLLRRAATRPN..VP.
Q5FPA9_GLUOX/26-376-----------KALNRALLGRFLLCGAVLVS------------------LLEI------L.ALLEKTTPI.LNRH..LG.
Q1D895_MYXXD/6-362-----------RYLLGELLVPLGVWVAFMFL------------------LLFV------M.QFLRGTDVL.LGSS..VT.
Q9PL80_CHLMU/6-348-----------KVLIFRYLKTTVFCTLSLIC------------------ISII------S.SLQEIVSYI..AKD..VP.
A1AXG9_RUTMC/6-356-----------RYIVKTMAFYTSAVMLVWLG------------------IYAF------F.NFLEEVTFI.GQAN..YT.
Q0G6N0_9RHIZ/6-358-----------RYIFRRALISSVGSLVSLAL------------------IVWI------V.QALSRIDIV.KTSA..SA.
A6QBC8_SULNB/6-335-----------GYISSNFTKAFLTIFIPFFL------------------IISL------V.YLVKISSLT.AQIQ..IN.
A6QBZ1_SULNB/12-355-----------RYLAKHYIKNLLAILFGLSF------------------AFAA------I.DYFQYTEELQGSWN..YK.
Q7VQS9_BLOFL/5-358-----------KYIMKEICKNQLIILILLLL------------------ACFC------Q.KSIKVLS...LSNN..IP.
Q319A3_PROM9/28-396-----------RWLLGQIIPPMLFAISAFTV------------------ISLS------VGVMFDLIRKI.VEYG..LP.
Q0SM44_BORAP/10-425-----------SYIITEFFKYFLITFLFFFF------------------VFFI------N.QILFFMRIL.LQNY..VP.
A5ILH5_THEP1/6-352-----------KYLLKLSVVPFLIGLGGFIV------------------FVSL------..EILYQLSDLIVRHR..VG.
A6DC21_9PROT/4-336-----------WYILRNYLKNFVITLIGFAL------------------LFVL------V.DYSFNFAKLPNSSN..LQ.
Q73NV8_TREDE/6-354-----------RYLLKLFIPTFVVAMLFFIL------------------LLQL------G.DLFANIVAY.LQNG..AQ.

PF00528

YQGH_BACSU/107-309GIAGAIFMT...EIAPNWGKKVLQPVIELLV.....GIPSVVYGFIGLTVLVP......FIAQ.................
YQGI_BACSU/80-293GVGGGVFMA..EYAPNNKVTDFIRTCIEVLS.....SLPSIV.......IGMF......GLLMF................
NIKB_ECOLI/116-308SVPLGIWAA...RHRDRLPDFAVRFIAFLGV.....SMPNFW.......LAFL......LVMAFSVYL............
Q97UG4_SULSO/116-318GSYLGSIAG...FNRRSRKDLVILIITSILA.....ALPSFV.......ILMY......LEMWLSVQHGIFLIS......
YCKA_BACSU/41-224GTVIGLFISLARMSKLALLRWPAKLYISFMR.....GVPILV.......ILFI......LYFGF................
Q97VK6_SULSO/120-341GLFTGAIAA...SNRNKPLDYLVRGVYLVTW.....ASPPFL.......IAVI......LQLVIAYYLRLLPPTGTVNPV
Q9FAT0_VIBPA/116-319GYALGLVAG...LKNKSTLGKCLYYGSWILS.....CLPSFW.......VGII......LIAIFALKLHWFPVG......
Q44374_RHIRD/87-266GSGLGLLAG....LRKGWLDMALSRFVDLVM.....SMPTLI.......LAMM......LL...................
Q9KB56_BACHD/117-308SILLGVICA...MKGGKAIDKSIRGFSFLLM.....GIPSYL.......LASF......MIWYFSVKL............
OPUBD_BACSU/40-211GVPAGILIA.....HFRRLSAWVFAVTNVIQ.....TIPALA.......MLAV......LM...................
Q9LAT6_LISMN/112-304GILLGVIAA...MYQNRWPDYTSTFIAILGK.....SVPSFV.......FATV......LQYWLGAKL............
LACF_RHIRD/87-298MITMALILAAMLNNPKLRYSGLFRTMIF.........LPCVSSLVAYSILFKS......MFSLDGVVNNTLL........
Y355_HAEIN/68-243GFLFGLISAL.LLSFSRQISAVLLPILVISQ.....AIPVFA.......IAPL......LV...................
Q982M9_RHILO/75-250GNLAAVLLAV.LFVHNRILQATYFPIVLFFN.....TIPILA.......LSPI......II...................
GLNP_RICPR/33-217GLVIGMLLAICKVNKNRVLRLFANFYTSIFR.....GTPLLV.......QLSI......IYFAAPYI.............
AMIC_STRR6/298-492AVPLGSAMA...RFKNTWIDSLSTGALTFLL.....ALPTIA.......LVYI......VRLIGSSIAL...........
TCYB_BACSU/46-230GMILALITALARMSKVRPLRWVFSVYVSAIR.....GTPLLV.......QLFI......IFYLF................
AMID_STRR6/125-308GVFVGGIWG.....ISKSVDRVMMEVYNVIS.....NIPPLL.......IVIV......LT...................
NRTB_SYNE7/98-276AACTGILVGG.VLGMSKFLGKGLDPVIQVLR.....TVPPLA.......WFPI......SL...................
Q9HIL1_THEAC/131-337GNRLGRYAG...INRNTSKDLAIDVFAMFMA.....SFPAFV.......LAFI......VLDIFSVYGHIFPLGGA....
Q9X0U9_THEMA/119-323GNRFGAFVA.....RKKRLDNFALPVFYTLT.....ASPYFW.......FGIL......LAWIFGVVIPLFPLAGA....
UGPA_ECOLI/90-294SLFFAALVEYIVRGS.........RFYQTLM.....LLPYAVAPAVAAVLWIF......LFNPGRGLITHF.........
SAPB_HAEIN/93-316GLPLGIISA...VNSEQVFAKSLQILSYVGL.....SIPIFW.......LAPI......LLYVAALSHWEIAAIGQYNLL
MSMG_STRMU/87-273IPAAAYSIA..RNMSRRKAFNIMYSLLILGI.....FVPFQV.......IMIP......ITV..................
OPPC_LACLS/106-293GNILGVITG....YFGGRFDLIFMRFTDFVM.....ILPSMM.......IIIV......FV...................
Q57M02_SALCH/27-221AVLIGLVGAGAKLSQNRVTGLIFEGYTTLIR.....GVPDLV.......LMLL......IFYGLQIALN...........
NIKC_ECOLI/89-273GLVIGGSAG....LIGGRVDQATMRVADMFM.....TFPTSI.......LSFF......MV...................
Q9WYD8_THEMA/94-282AITIGMLSG....YLGGTTDRILMALTDTFM.....VMPVFP.......LLLL......LS...................
POTH_ECOLI/117-315GYPLAWAVA....HSKPSTRNILLLLVILPS.....WTSFLIRVYAWMGILKNNGVLNNFLLWLG...............
LPLC_BACSU/93-290QLFFTFTMAYPLAKRHVKGRNLLLNLVIFSMLFSGGMIPTYL.................VV...................
CYST_ECOLI/74-276NGVFGLLMAWILTRYRFPGRTLLDALMDLPF.....ALPTAVAGLTLASLFSVNGFYGEWLAK.................
Q9ZBG1_STRCO/128-331GLLLGVLAA...RRPGSVLDRAVTSLSYTLE.....AAPVFW.......IALL......AVWLFALQWDVLPAG......
Q97UH1_SULSO/128-336GNLLGRVAA...LSRGKISDYAILGLMMFLY.....TFPVFV.......TGEI......LIEVLAIDLHIFPTGGQY...
Q97VF6_SULSO/101-289GIVVGIIAG....YLGGIIDNILMGITDIIL.....TLPSLI.......LIII......IV...................
LACG_RHIRD/89-270SSLAGYGFE....MFRSKLRERVYTVILLTL.....MVPFAA.......LMIP......LFM..................
Q9HLG4_THEAC/81-265GGLFGIIAG....YRGGYLDEVIMRITDAFL.....SLPALI.......LVIA......LS...................
MALD_STRR6/87-275QTSIIVLAGYAYSRYNFLARKQSLVFFLIIQ.....MVPTMAALTAFFVMALM......LN...................
GLTJ_ECOLI/43-239AFLVGSFFGILRTVPNRFLSGLGTLYVELFR.....NVPLIVQFFTWYLVIPE......LLPEKIGM.............
YEHW_ECOLI/68-240GTGAGIAVT...RPWGAEFRPLVETIAAVGQ.....TFPPVA.......VLAI......AV...................
Q9FAT1_VIBPA/84-268ALMLAIIAN.....LNRRWNMLIDFIVDCAL.....SLPSLL.......LLMI......LT...................
Q9A534_CAUCR/67-247ASLIACGLAL.LVSLNGFLEDAVRPIAVTLQ.....VTPLVA.......IAPL......VT...................
YEJB_ECOLI/151-361SIPLGIRKA...VYNGSRFDVWSSAFIIIGY.....AIPAFL.......FAIL......LIVFFAGGSYFDLFPLRG...
YOR2_CALSR/83-265ILIISSMAAFAFSRFKFALNNLLYSLIIAGM.....AIPIHV.......TLIP......IYVLT................
O66777_AQUAE/114-319SIPLGTLAA...FKENSLFDRFVVGFSYTFM.....SVPSFF.......LAFL......LLFFASKTGILPVGGM.....
YEHY_ECOLI/195-381GVPLGIWCY.....FSTARQGAIFSLLNVIQ.....TVPSVA.......LFGL......LIAPLAALVT...........
Q9WXN6_THEMA/92-279GTIIGSFSA....VKRGIVDDVLMGITNIVL.....TTPSIL.......IAIL......IA...................
Q9Y9N0_AERPE/121-339GVGSGVVAA....FRGGLVDRLLRTSSIVAY.....TLFIPW.......LGLM......LKYVFSIKLGILPTGGRIDPR
Q9WY46_THEMA/67-238GLPVGFFMG.....ISDRVYEFLRPLVTVVQ.....AVPVVS.......WLVV......VI...................
Q9Z6P7_CHLPN/68-243AITLSIVLAT.IMLSYKSAKDLLQPLFILLQ.....CTPMFA.......LAPL......IV...................
GLNP_SHIFL/33-218GLVIGLLAGFARTFGGWIANHVALVFIEVIR.....GTPIVV.......QVMF......IYFALPMA.............
Q98K60_RHILO/105-289GTALGIIIAV.GIVHVATLDRSLMPWIIASQ.....TIPILA.......VAPM......IIV..................
UGPE_ECOLI/91-278KITVSMLSAFAIVWFRFPLRNLFFWMIFITL.....MLPVEVRIFPTVEVIAN......LQM..................
OPPB_LACLS/113-318AIPMSIVAA...RNEGKWQDQLWLTYNSITF.....GIPPYV.......FYLL......IIFIFGYSLNWFPTGG.....
Q49553_MYCHO/234-419GISIGAFLG...FYAGKLIDTIIMRVIEIFL.....APPTLI.......WILL......FV...................
FBPB_SERMA/341-526ITLCAIPMAWLSVRYPARLYRVLEGCNYVTS.....SLPGIV.......VALA......LVTIT................
Q987J0_RHILO/100-280GVVLGMTAA....VIGGWVDTCLSRFLDAMN.....SIPSKL.......FGLV......VV...................
Q9CLG9_PASMU/73-248GVSLGLISAL.LLSASDYLSKLLLPLLVISQ.....AIPVFA.......IAPL......LV...................
Q9PPS8_UREPA/183-374GIPLGIFVG...RKPGGILDSVSTVIISVIS.....AVPSLV.......FGLI......LLLIGKEVG............
PSTA_ECOLI/101-295GIMAGIYLA..EYGRKSWLAEVIRFINDILL.....SAPSIVVGLFVYTIVVA...........................
Q98QF6_MYCPU/174-365GVPLGIWVG...KNPGKFLDNASTVVVSIFS.....SIPSLV.......FSLL......LLLIGRAFG............
MALC_STRR6/209-434QIVIGIFTAIIANQPFIKGKRIFGVIFLLPW.....AVPAFITILTFSNMFND......SVGAINTQVLPILAK......
LPLB_BACSU/104-314AFPAPLILA...LLLNEVRKAVYKRCIQTFI.....YVPHFVSWTIVVSITFV......FFTVDTGVINKLI........
YHDY_ECOLI/173-362ALPWGILLALGRRSHMPIVRILSVIFIEFWR.....GVPLIT.......VLFMSSVMLPLFMAEGTS.............
B3XCM3_ECOLX/104-273SIPFGLMSA..ENLVPWWVYQPVRRLMDACR.....AINEMV.......FAML......FV...................
Q9AKQ9_RHIML/112-306GVITGTIAA...LRQNSFLDFAVMSVSTIGV.....TVPNFV.......VGPV......LTLIFAIVLA...........
Q97YP1_SULSO/131-332AIVVGAYAA...LKRNKAVDHIISNYMILQY.....NIPGFF.......ILAV......LWVVFAVYIKAIPI.......
O28506_ARCFU/135-354GVATGSIAA...FRRGSKVDSGMRIYSIVAY.....TLFIPW.......FGML......LQMLFGVYLKVLPIGGRITPG
Q98K61_RHILO/75-251GSGAGFITAI.LADRVPFLRRGLLPIGNMVS.....ALPIIG.......VAPI......MV...................
AMYC_THETU/83-269IAIFSSMTAYALQRVKRKSSVIIYMIFTVAM.....LIPFQS.......VMIP......LVA..................
Q9ZGP1_STAAU/117-308SIILGVVSA...LKRGKFTDRAIRSVAFFLT.....ALPSYW.......IASI......LIIYVSVKL............
Q9EWP8_STRCO/101-281GMTAGVLAA....MVSRRLGDLTVRCVDALA.....VLPALL.......VVLV......LA...................
Q9KKK5_VIBCH/118-310AIPIGVYCG...KRTDRWADNLALLTSIMIK.....AQPVFL.......IGLG......LVILFALQL............
YEJE_ECOLI/158-341GVLAGALQG....YYGGKVDLWGQRFIEVWS.....GMPTLF.......LIIL......LS...................
O86691_STRCO/402-574GVLLGLVPR............VSAPLVDTVN.....AVPPVL.......VALL......VT...................
Q98QS7_MYCPU/195-382GIIVGTYMG...FHIGKKVDNILMRVIEIIN.....SIPWFL.......IFII......LV...................
AMYD_THETU/85-290INVVGLSLA.....MLVTRKIFARNFMRTAF.....YLPNLIGGLILGFIWNF......IFVDVFQTISDA.........
O34157_SALTM/115-319GVTLGFLAG...RFLHRWPDKMICRISYLLS.....SLPTFW.......IAML......SGAVCRPLAVLPVCC......
Q9PL65_CHLMU/67-242ALLLSISLSV.TMLLFPSIQGVLHPLCVLVQ.....CLPMFT.......LTPL......IV...................
Q9RX04_DEIRA/318-494GGLGGLLLGY.PIAKSRALERFLSPFIVASQ.....STPIVV.......LAPL......LV...................
SSUC_BACSU/94-269GAGLGLMIGI.LAGFSKRTELYLDPSLQMLR.....TVPHLA.......VTPL......FI...................
Q9UYG7_PYRAB/121-325GNWLGALAG.....KNKKYDKYLMPVFYFLA.....SIPYFW.......FAMV......LVYFLGVKLNIFPYQGA....

PF07242

A7GQL2_BACCN/621-721--------------------------------------------ISM----FTTLNYLE-----QYKLKHTIKIIHGYSY
A5MAB6_STRPN/576-675--------------------------------------------LFD----SMNLLYFE-----QFRRELMIKRLAGMTI
Q9L651_LACLL/549-647--------------------------------------------LFY----LMNKIYLY-----QNRKKFAVARISGESL
A5M6X5_STRPN/166-265--------------------------------------------LFY----SVNLLYFE-----QFRRDILIKRISGLRF
Q931U7_STAAM/555-653--------------------------------------------IIL----FDVKYYFE-----QHRKLLVIKKLYGYST
Q8CY97_STRR6/155-254--------------------------------------------LFN----TMNRLYFE-----EFRRAIFIKRIAGLRF
Q6GIZ0_STAAR/545-643--------------------------------------------ATV----FETIQYFS-----WNKKQLLLRKIHGYSL
Q926X5_LISIN/619-718--------------------------------------------FMI----LLVLSYYR-----ENLYKQLIYHVFGYSF
Q93MD9_CLOPE/619-718--------------------------------------------IIL----QNTSLYFN-----QNKNKIIVKKLHGYRL
Q9KG35_BACHD/612-712--------------------------------------------MIV----QSSHLLFA-----QHKKRFLLRRLFGHSL
B9WU46_STRSU/561-660--------------------------------------------LFN----TMNLLYFE-----TFKREIAIKRIAGMRF
Q9CJI4_LACLA/565-662--------------------------------------------MIL----TTTVFYFE-----TYKKKIAVKRLYGISF
Q8Y3Q8_LISMO/620-718--------------------------------------------FMV----LLVLSYYR-----ENLYKQLIYHVFGYSF
Q896P1_CLOTE/604-706--------------------------------------------III----QNIYTFFE-----QFKVYLAIKQLHGYKK
Q892J9_CLOTE/609-706--------------------------------------------IVT----QSVLSFFE-----QYKKIISIRSFHGYKS
A8AXA7_STRGC/592-691--------------------------------------------LFN----TMNFLYFE-----EFRKPIFLKKIAGMDF
Q9CE29_LACLA/560-659--------------------------------------------FYI----LLHVLYFT-----HFRRTIVIKFISGMPN
Q181M6_CLOD6/617-718--------------------------------------------ITY----NIVASYYE-----RNKYKLYIKKIFGYST
A7GNK2_BACCN/616-716--------------------------------------------LTY----NVVATYYQ-----KNKFKLYVQKLFGYSA

PF02687

O50782_BORBU/276-402--------------------------------------------AFF.--.QIMTALSI.....ERTRELGTLRAIGLTK
A3I1M1_9BACT/289-407--------------------------------------------NYV.--.NLATAEAT.....ERNKEVGLRKVMGAGR
A7VH46_9CLOT/421-541--------------------------------------------VLS.--.VFVVHSID.....QESAVIGALYALGVKR
A8ABZ3_IGNH4/248-373--------------------------------------------VLL.--.IVSVIYIE.....RNVREVATLRSIGASL
Q9F443_STRSL/517-633--------------------------------------------ILY.--.FTSLIEIM.....ENKEEYSYLSKLGYSK
A7H0E4_CAMC5/307-422--------------------------------------------GIT.--.SLMTSEIY.....RRKKEIGLLKAIGASN
A3UQ03_VIBSP/269-395--------------------------------------------NII.--.SALIMVVM.....EKQSEVAILKTQGMTD
A5Z5I3_9FIRM/662-784--------------------------------------------NLI.--.NTTLSNQM.....SRKQENSVLRSIGLTQ
A8H349_SHEPA/695-810--------------------------------------------VMI.--.AQTEAGMA.....TRQRELAVLRTFGASG
Q9WZG5_THEMA/725-844--------------------------------------------GLL.--.LFVLKSYF.....SRIKIMGTLRAVGMKI
Q9FBP3_STRCO/657-772--------------------------------------------SLL.--.VSQLEQLR.....ERKKLLSALVAFGTRR
Q2CDR4_9RHOB/175-297--------------------------------------------MIT.--.LAAQAALA.....ANEQVIRVLRLVGAQD
A6DHZ0_9BACT/321-438--------------------------------------------TIL.--.ILSMHNLR.....ERRNELGIYSANGFSK
A5ZCK7_9BACE/250-369--------------------------------------------NFF.--.HFQIGSII.....NRQREFTIRKIIGNDM
O28455_ARCFU/275-396--------------------------------------------MTY.--.ALLSRIFR.....LQLGNIAVMRALGFTR
Q481M7_COLP3/705-820--------------------------------------------VIL.--.SSINALES.....KEKKKNSVIMSFGFLK
A4YKC0_BRASO/734-849--------------------------------------------VLG.--.GALAAGHR.....HRVYDAVILKTLGATR
Q0HRW4_SHESR/279-392--------------------------------------------GVT.--.GMVMFNIQ.....RRTKQIGTRRALGAKK
A7AZK1_RUMGN/757-876--------------------------------------------SAA.--.VAILNSLY.....QRRKEFAMLRSVGLDR
Q64W75_BACFR/294-427--------------------------------------------NLS.--.GMISSRMD.....DRLAEMGIRKAFGANR
A8AR20_CITK8/231-351--------------------------------------------VIG.--.NSVRLSIF.....ARRDTINVQKLIGATD
A3UCF7_9RHOB/264-386--------------------------------------------GAW.--.NAMYASVD.....SRVREIATLRTLGFSG
Y684_MYCPN/989-1110--------------------------------------------LTI.--.LLIKSFIK.....KNQTEFSIIRAGGFST
Q2RPK1_RHORT/279-403--------------------------------------------GGV.--.AAIQWSMA....ARRRRTIAILGLIGFGK
A6H1M7_FLAPJ/284-410--------------------------------------------NMV.--.VALLVLVL.....ERTQMIGILKSLGANN
A8G4C7_PROM2/272-386--------------------------------------------VVY.--.QILYSDVT.....DHLPEYATLLAMGYRL
A0PQZ2_MYCUA/174-295--------------------------------------------LIA.--.NMVQVAAY.....TRRTEIGIMRLVGASR
Q4QBC9_LEIMA/977-1097--------------------------------------------MMW.--.TTFISNVQ.....LNAWTFGVLRSLGFRT
Q025M3_SOLUE/351-471--------------------------------------------NVS.--.NLLLARWL.....QRDRELAIRSALGGSR
Q54MT9_DICDI/545-666--------------------------------------------LIY.--.TTLMIDVD.....SMTFNNGVFRMLGAKF
Q6MGV4_BDEBA/659-778--------------------------------------------VLF.--.NMVRIDVS.....EKSWELASLRILGFEI
A6L8W9_PARD8/653-767--------------------------------------------GLL.--.AMSTYFIQ.....QRLQEVSVRKVFGSSN
Q4A9N5_MYCHJ/2523-2644--------------------------------------------ILV.--.IIASSIIN.....ENQQNIAILDVLGYAN
A4CDR0_9GAMM/687-801--------------------------------------------SLA.--.VLVSQTVL.....SQQKELAIKKVLGATV
Q01VW7_SOLUE/1278-1396--------------------------------------------GIY.--.GAVSFAVN.....QRTREMGIRLALGAQR
A3I5H5_9BACI/646-767--------------------------------------------IIF.--.SVSRINVR.....KESSTYGIYKSIGMTS
A5USK7_ROSS1/311-433--------------------------------------------FVL.--.QVAGMTVA.....RQQQEMAILRSRGSSR
Q9A6K3_CAUCR/352-465--------------------------------------------ITW.--.QTLRGAIM.....ANIKEFASLRALGVSM
Q72UY4_LEPIC/260-379--------------------------------------------SIL.--.LVSRAGIR.....EKSGAIAVLKCLGASP
Q5V3A9_HALMA/874-995--------------------------------------------STT.--.ATFAQGVH.....ARRQAIGIHRSTGATQ
Q8NS27_CORGL/613-739--------------------------------------------IVV.--.VSLVIVLA.....NRKLQQHALIAIGATP
B1JTM3_BURCC/259-376--------------------------------------------VMA.--.NAMAMSAR.....ERTAEYATLKALGFGP
A7AFS2_9PORP/465-579--------------------------------------------GLI.--.GYTNDEVN.....RRRKELAIRKVNGATM
A8F9W5_BACP2/316-420--------------------------------------------TIY.--.FVLRTKLK.....LNMKKYAIYLISGLTM
A8HA97_SHEPA/673-786--------------------------------------------TLY.--.NKFSYAVK.....SEQMKWAIMLAVGGKK
Q97DB8_CLOAB/716-835--------------------------------------------GVI.--.NNFFISFI.....ERKRHLAVYASVGMNR
A6F274_9ALTE/258-378--------------------------------------------AVA.--.VASRQYAL.....SQRDTVALLKTLGVRS
A7HK62_FERNB/257-383--------------------------------------------FIA.--.SFFGILAE.....ERKISLGVLRAIGYSR
B8FRQ9_DESHD/291-412--------------------------------------------GLI.--.TVSVSTVL.....ARKREFGIRMVTGASK
A1TXE6_MARAV/183-306--------------------------------------------LLR.--.SVFLLGLA.....QRRESLALLYRYGVNR
Q93H51_STRAW/242-364--------------------------------------------VVA.--.STFAFAVA.....QRRREFGLLRTAGATP
Q54290_STRHY/294-451--------------------------------------------VLT.--.LLVNLAVK.....QRHKEYGVLLAMGEKK
Q830M8_ENTFA/579-698--------------------------------------------ITGS--ILMLRQLFSA...VSERQDYVTLKRMGVSS
Q81N14_BACAN/248-369--------------------------------------------LLV.--.SNFEVFLY.....KYKSQFAIMRSMGATT
A7B7J6_RUMGN/273-419--------------------------------------------VIY.--.SLFQVSVR.....KRMSQYSVMQTLGMES
Q5LCL1_BACFN/272-387--------------------------------------------NYL.--.TLFVSRLR.....MRGRELGLRKVCGSTN
Q9KF85_BACHD/539-650--------------------------------------------YLA.--.NRFHFRRH.....TKKEEQELLLDLGWKK
A3D8C2_SHEB5/283-407--------------------------------------------IAY.--.NGVRYSLM.....KRQELLVQLLQQGIER
A1SKN4_NOCSJ/300-416--------------------------------------------VLW.--.LTLLAVTE.....QRRPEVALARLRGRGR
A7VFS5_9CLOT/263-395--------------------------------------------VIY.--.NIFQVGIA.....NKIQEYGKIKALGATK
Q5JEM5_PYRKO/203-318--------------------------------------------IEV.--.LVTVAHLR.....GSTREVGTLKALGLPD
A7VIB2_9CLOT/622-743--------------------------------------------MVY.--.LLTKLIIE.....RNTISISMVKILGYEN
Q8G7P9_BIFLO/320-438--------------------------------------------LLLI--LVLSGVWAS.....KRDDEIGMALVSGVTR
Q735D4_BACC1/728-843--------------------------------------------TIG.--.NQVVIRLM.....QQTRDVAIMKTVGMSS
A6BFN6_9FIRM/685-806--------------------------------------------NMA.--.NTMIMNIT.....TKKQEYGVLQAVGMTN
A4CAI1_9GAMM/683-798--------------------------------------------GLF.--.SVLRYAVT.....LRRTEIGIHMAVGAPL
A3ZPC9_9PLAN/633-758--------------------------------------------TVV.--.SVLLDSTD.....RKRGTIGILRVMGVSR
A9KQT2_CLOPH/343-506--------------------------------------------ILL.--.LLTSISIR.....ERKYEIGVLRAMGMKK
A1ZGZ7_9BACT/274-392--------------------------------------------IFM.--.MSFRVVLA.....ESKNEIKLLIQLGYTA
Q6F1V8_MESFL/1691-1810--------------------------------------------IIT.--.IISDVYIM.....KYHRFMVTMKALGYSN
Q601V9_MYCH2/401-522--------------------------------------------TFS.--.VLFSKNLV....RLKTKSIGILKSLGLKK
B8G588_CHLAD/255-383--------------------------------------------ALVA--SSFLSINTISAILNQQTRQLGIMAAIGAGP
Q04L09_STRP2/60-182--------------------------------------------IVL.--.YANSFVMK.....NRSKELGIYGMLGLEK
Q048H0_LACDB/280-404--------------------------------------------IIV.--.WNTWNCLS.....EEQSEIALRISLGMRQ
A4BXN0_9FLAO/168-283--------------------------------------------LIN.--.SAIRLTIY.....SKRFNIKTMQMVGATK
Q9PPU7_UREPA/163-284--------------------------------------------FVT.--.SSIKNMIN.....KNKVMFGAMQAQGVSR
A5LLD1_STRPN/291-413--------------------------------------------VTF.--.TTMTRFVD.....EERTHAGIFKALGYRS
A6TSQ0_ALKMQ/264-387--------------------------------------------IIY.--.STFKVIAV.....ERLPVIGTFRSIGATK
A7VD43_9CLOT/805-930--------------------------------------------GFL.--.IYWITSIK.....QRELLFGIYRAMGMSM
Q8RTI8_9GAMM/277-411--------------------------------------------GIL.--.NTVLMSTF.....RRQKEFSMMIAVGARA
A5N346_CLOK5/473-593--------------------------------------------NIM.--.NSISMSVS.....ARIKQYGAMRAVGMDE
Q053J3_LEPBL/252-373--------------------------------------------MVS.--.NTMSGLYV.....SREKELGILKTMGLSA
A7H957_ANADF/284-394--------------------------------------------VVA.--.FIIYTMTA.....GKIREIAVLKLIGARN
A1SH34_NOCSJ/769-890--------------------------------------------AAT.--.LVTGLQLA.....ERRRTFAIASALGARR
A6LCJ9_PARD8/285-395--------------------------------------------NFI.--.NFTMALVP.....ARIKSINIRKILGDSV
B8I8J6_CLOCE/296-424--------------------------------------------GLR.--.SSIRMNLF.....ERMREFGTLRAIGYSR
Q6AA47_PROAC/602-722--------------------------------------------ACT.--.AAFVELRW.....GMRRTIAVQQAVGTPA
Q4MWW1_BACCE/235-351--------------------------------------------SGI.--.SAVLFWIY.....KKEREISLKKAVGASN
A6NZ14_9FIRM/176-297--------------------------------------------IIA.--.NTIKLGTF.....TRRDEIAIMKMCGATN
Q6MT15_MYCMS/562-682--------------------------------------------FIN.--.FALKKEMN.....ETRRQIGIFKSFGYKV
A4VW57_STRSY/998-1117--------------------------------------------ILY.--.NLTIINMS.....ERIRELSTIKVLGFHN
Q18EP9_HALWD/299-419--------------------------------------------FTA.--.TTMGLEIT.....HDRQFIAILSAVGYTE
Q8EUA2_MYCPE/1360-1480--------------------------------------------IIV.--.IVSSLIIN.....DSFKLAAILKCLGLDD
A5MD01_STRPN/302-451--------------------------------------------LLA.--.LLLSLWIN.....ARRKEVGILLSIGLKQ
Q47EZ3_DECAR/243-372--------------------------------------------LAW.--.EKASGLSA.....EEKREIGILKAIGWET
Q034M7_LACC3/404-519--------------------------------------------ALT.--.ILFSMNNR.....QRLREVGILKAVGFTT
A3I2Y5_9BACT/746-861--------------------------------------------GLF.--.GLVSLNMT.....AHIKDYCVRKVFGANT
Q0RJL1_FRAAA/639-753--------------------------------------------SLA.--.VSVVAGLN.....DRRRPFSLLRLAGAPL
Q7UPA2_RHOBA/581-706--------------------------------------------LIA.--.LLLRLGVI.....QRLSEFGTLLAVGFTP
Q8A9F6_BACTN/266-381--------------------------------------------NFM.--.SLYTVILL.....KRGKEFGLKKIFGSTP
A4C0M9_9FLAO/275-395--------------------------------------------TIF.--.ISLYKMVK.....ERAFDLAILRTYGASN
Q14QM1_SPICI/154-274--------------------------------------------ILS.--.VLIAMVLD.....ENRRTILILKVLGYPT
Q97LN0_CLOAB/737-854--------------------------------------------NVF.--.NTISTNIK.....LRRRELAMLRSVGMSD
A3ZPB7_9PLAN/791-914--------------------------------------------GVL.--.NVILASVR.....ARQWEMGVLRSIGISR
Q737Y3_BACC1/256-376--------------------------------------------CIR.--.FTIITSME.....EDYREIGVMKAIGITS
A7VDT8_9CLOT/311-424--------------------------------------------TVI.--.RLMAEWIT.....TYKKEITVLWLCGMPK
Q4A9N5_MYCHJ/1802-1923--------------------------------------------AIA.--.FIIKRYIS.....TNNKVLGILRAQGYSL
Q899W1_CLOTE/250-369--------------------------------------------NIS.--.ILIFYLML.....KNKKNILISIALGANR
Q4DFN5_TRYCC/444-565--------------------------------------------LFY.--.ALLNTNAE.....ERRFEFAMIRAQGLNK
A7ADY9_9PORP/281-400--------------------------------------------NFT.--.NLLLNRIY.....LRNKEMKLRNAIGADK
A7ADZ2_9PORP/274-398--------------------------------------------NFL.--.KFCIQSFY.....NRTRELSLRKCLGSDA
Q2SRI5_MYCCT/367-490--------------------------------------------LYTT--FLITKKQIL.....NSRGQIGTMRAIGYKK
Q71YS2_LISMF/59-181--------------------------------------------FIF.--.YSNGFFLK.....RRKREIGLYSLLGLRK
Q638M9_BACCZ/706-820--------------------------------------------GVC.--.NTLINNIQ.....SKRKEFAILRAITVKK
Q8KD33_CHLTE/268-389--------------------------------------------LLN.--.IVLQRLVS.....TQREQIAVLKANGYDD
A7GNK2_BACCN/187-299--------------------------------------------CLY.--.IAIAHYLI.....NRLKELSIIRVFGYSI
A3JAL8_9ALTE/692-813--------------------------------------------ALL.--.IMGWVFFS.....TRAWYFRLLQVWGLTK
Q6F163_MESFL/1281-1400--------------------------------------------ILV.--.VIIGIIVE.....EAKIVILTLQALGYKD
Q6AMB4_DESPS/278-415--------------------------------------------FIMA--MSIVLWNVGLIGGLRRYGEMGLRLAIGENK
A7K544_VIBSE/291-411--------------------------------------------GML.--.SSLLTSLQ.....ERRREMAILRAMGARP
Q2SSK7_MYCCT/644-765--------------------------------------------AVF.--.VGVIKSIQ.....ANAKQIGILKANGVYS
A3QAU8_SHELP/312-429--------------------------------------------NIL.--.GLMLTKFL.....KRAPEVGVRRAIGASR
Q6F1W1_MESFL/1301-1420--------------------------------------------IIL.--.LTTSIIIT.....DNIRFISTMRVLGYHD
A6LZM8_CLOB8/286-398--------------------------------------------SII.--.TTINYKIA.....EDVDRIGILYSFGISK
A7VI29_9CLOT/290-409--------------------------------------------SLT.--.CYQSMNIL.....TRKYEYGILYANGWNQ
Q6UCA9_BACFG/30-146--------------------------------------------NYV.--.LIFVSSLS.....QRAKGIGIHKCNGASD
Q2ST97_MYCCT/1669-1788--------------------------------------------LIM.--.LITDIYIS.....QYKSFMIMLRSMGYTN
A7AE18_9PORP/286-404--------------------------------------------NYI.--.NLSFSRIL.....QQIRIIHTQKLMGATQ
A7V9H5_BACUN/291-408--------------------------------------------GLM.--.GTFWFRTR.....HRRSEIALRMAMGSSR
Q6GDI1_STAAR/59-180--------------------------------------------FIF.--.YANHFMMS.....QRRKEFSIFMTLGMTK
A8FMY2_CAMJ8/150-267--------------------------------------------LFL.--.KQMRIWLY.....EHTDRIEIMCLFGAPF
A7ZGQ8_ECO24/256-370--------------------------------------------ISK.--.SMSKKMFQ.....CRSTEFALKMLNGING
A7VI30_9CLOT/297-409--------------------------------------------NCI.--.MLSKIWIL.....RRRKDYLIMRIYGMSS

PF03739

Q3ATU7_CHLCH/6-355...............ALEIARYYL.LSIPSI----------FL.VTSP..VSALLASILVAGKLATQNELPAIRSAGVSM
Q1CSH4_HELPH/4-343...............FLDLVQLFL.YSLPGT----------IF.FILP..ITFFAACALGLSRLSYDHELLVFFSLGVSP
A5TUK8_FUSNP/11-360...............GGEIFDYIL.NLLPKM----------FV.ETAP..LSVLLAGLITVSIMASNLEIVSLKTSGIRF
Q4UQP7_XANC8/6-349...............ARLLLSQVG.LQFVAY----------LP.IILP..LALMLGLLLALARLYRDSEMAVITAIGIGP
A4N619_HAEIF/7-355...............IWQAVIFTG.LTMPKD----------IE.TFFP..MAALLGALIALGNLASRSELVVMQSAGFSR
A4JGZ3_BURVG/5-348...............PRDVLVLIG.LTVIGY----------LA.VMLV..VTLFVSILFVLTRWYRDSEMVVWLASGVSL
Q118T4_TRIEI/24-389...............ISIAIQVFL.LKMPEF----------IG.LAFP..MAMILTTLMVYSQMSGHSEIVALRSCGISI
A0LEN9_SYNFM/39-391...............LGDLMALVA.LAMPKL----------ML.FALP..MASLLGVLLAFVRLNSDNELIALRAAGIGF
A6EGW2_9SPHI/13-364...............FWQVVSLYYAGSIPFY----------VN.MLSP..LINFIAVIFFTAKMADQTEIVPILSGGVSF
Q72LM8_THET2/4-334...............AREVGLLVL.YRLPWT----------LS.LALP..LGLVFAVLVGLAGLIRRSELKAAYAAGVPP
A3UJ93_9RHOB/6-356...............ALVLITITV.LAMPQV----------IA.LLLP..IAVFLAVAIALNRLTSDSELTVAAAAGMSR
Q66F08_YERPS/5-354...............TNVVLSLLG.LGVPEM----------AQ.LILP..LSLFLGLLMTLGKLYTESEITVMNACGMGK
Q4HT94_CAMUP/6-348.................LILLYVL.FVGFSA----------VT.YILP..ISLIFALVLSFLTMIRNNEFVSLYALGLSK
Q92FY2_RICCN/24-375...............VMDFFSLIV.LVLPTL----------LF.ILLP..VIMVITVIYIYNNLKVERQLIILQASGVNN
A3ZYQ2_9PLAN/6-385...............PGPIARIIP.YMIPDA----------LR.FSIP..GTILFASCSVYGRLASGNELAALKAAGVSP
A8A4E0_ECOHS/6-354...............WTQAVLVVL.MTLPRT----------LV.ELSP..FIALLGGIVGLGQLSKNSELTAIRSTGFSI
A7HYF9_PARL1/7-370...............LLTFFELTV.LALPST----------LM.IVLP..ISLFCAVLYSLHKLISDSEIVVMFAAGVSR
Q8DIL4_THEEB/18-374...............LTILLQLIG.YQLPAV----------LV.LVFP..MAVLLAVVGAMSRLSEEGEWIALRSVGICL
Q82W93_NITEU/6-348...............TAAMFKLVG.LKTIIA----------LE.VLVP..IAFYVAVIYGLSRMNRDQEINVLRTAGYGD
A0LB31_MAGSM/6-364...............WQDMVELIF.LRMPHF----------FT.QFLP..PIALLTTLFVVTRLTRLNELTVIRSGGVSL
Q6MKD0_BDEBA/11-364...............MKTIAEIIG.YVIISM----------LP.ILFP..MALLFSVLLTYGRLSQDSEIVAMKASGLPM
Q4HIC5_CAMCO/6-341...............FADLLKLYG.FMLPRI----------LI.FTLP..IAFFIALTLALFRLSRENESIVLFTLGFSP
Q6FFD6_ACIAD/9-354...............AWQAFLYVL.WGAPRY----------LY.EILP..ISALIGAILGLGTLASNSELIVMRSVGISL
A7ADX1_9PORP/9-487...............IPVLAEMFM.YAALFL----------VP.MALP..LAILLASLMTFGNLGERLELLAMKSAGVSL
Q0C1U6_HYPNA/7-346...............FEGQMRYMW.LRLPAL----------FD.RIVV..FAFLLAALLTYASLIRRNELVAISAAGISV
Q11U59_CYTH3/9-455...............YLDYAELMM.YFSMNI----------LP.VALP..LAILLSSLMTFGNLGQFNELTAIKSSGISL
Q7P2I8_FUSNV/6-353...............VFDVLRLLS.FYIPPI----------LT.QTIP..IGMFLGIMICFTKFSRNSESVAMVSTGMSI
A1AWC7_RUTMC/20-369...............IADLLPLVG.LNMIRD----------VV.LILS..LSLLLAIILSVSKLYKASEAIVMNSLGLGD
Q73NV9_TREDE/13-373...............TKDVLLLLF.YSLPFI----------IA.TTAP..YAALIGTLMCLGRFSADHEFISMNALGIST
A3SQ70_9RHOB/5-359...............FFDVLEIVL.LNLPHA----------NY.EILP..LVMILATVALFVRLARSSELVVLRASGRSA
Q1PXZ0_9BACT/7-354...............SFGVASRYYAYLFPVI----------IT.QFFP..AITLVAVGIVLVRLSRNKEILAMQVAGISL
Q1VZU1_9FLAO/6-482...............LEIISRFLL.FLLPNL----------IP.MVLP..LTILLTSIMTFGSFAEQYEFAAMKSAGISL
Q1GR36_SPHAL/14-363...............DSDVWRYVG.MRMPQI----------IE.TFLP..FSVLLGTILTMVTLNQNSEVVAMKAAGMSA
Q8G1M6_BRUSU/6-359...............FQTIVQFSS.LLIPSA----------IP.LVMP..FALIIAITQTLSTMNQDSELVVINASGAPR
A5EXI6_DICNV/8-348...............LAAIGQLLI.FQTANI----------VV.ILLP..VAFILASVMTLSRLYGDCEINALFAGGCSK
Q7VQS8_BLOFL/9-358...............VFEIFFCIF.LNIIKD----------FE.LFLS..LSTLLGGVLGLGILELRNELIIMKVFGLSN
Q85G79_CYAME/6-326...............LDMACQILC.LQLVLS----------IH.LGLP..ASCVFGGIFAYANL....DLMALRTSGIGV
A6C004_9PLAN/10-385DLNGLEVDQNASTSLLWIMLEFYF.YQSSLF----------FD.MISP..ILSVLAGVVVFSLMVRHGELNPVLSAGIPT
Q2PY37_9BACT/6-356...............LATILLDYY.LNFIAF----------YGNTFSA..LILFLSTVFFTARMANQGEISAMLTGGLSF
Q310A0_DESDG/6-352...............LKVILTYFA.VKIPLI----------IS.QILP..AVFLLSAVIQLCVMARDRELVALQAGGISF
A3XBE3_9RHOB/6-359...............AIVFLEFTA.LALPNL----------IR.MVLP..VAVFASAVWVTNRLQSESELTVLRATGTSP
Q1NXF0_9DELT/6-358...............TGGAVRYLL.LKIPLI----------IE.QLLP..VALLLAGIITLGLLNRRHELMALQAAGLST
Q2JVE3_SYNJA/13-373...............PLTVLRLLI.LDLPEM----------VL.LGMP..IAAFFATMLTLGKLSGNSEITAMRAAGIPF
Q5SL96_THET8/6-344...............PYTLLRYLL.FRTPEA----------LA.RGAP..VAYLFALLVLLSRLGEDAELKALLALGVRR
A6EIS0_9SPHI/6-447...............WYVILELMY.YASAAN----------VS.MALP..LSILLSSIMTFGTLGENYELVAIKSAGISL
A7NDI7_FRATF/5-351...............IDSIVKFVI.LTIPEN----------VS.LVAP..IAIFLAIIICFGKYFANNEMFVTIAGGITW
Q6MJL5_BDEBA/6-356...............PSALVNYYL.YSFPGI----------IS.QLLP..VACLLGVILTLTSLNKANELVALFASGMSL
Q0F2Q6_9PROT/5-349...............WSLIVDLLA.LTMPFF----------LL.QIVP..MAFFLSLQNTITGLQQSSEMDVLRGSGLSY
A5WBH3_PSYWF/27-466...............VGLLFSIIG.YNLPYF----------LE.LVLP..LSFFIGLMLVFGRLYVDHEMAVLNGSGISR
E0TCF8_PARBH/6-360...............PIAALRLTL.LRTPQL----------IL.SLSP..FIFLFGTLWAYGQMARMSEIAVLRAAGLSV
Q984S3_RHILO/7-356...............YGTAVAISG.LRMPMI----------ML.QTVP..FVGLFSAMATLVSLNRRYELVIARSAGVSA
Q2S3I0_SALRD/55-410...............IWEVFTVFYPNYVPEI----------IR.LTSP..LALFLSCIYLTGTLAQELQLVALQTSGVSL
Q1IRI3_KORVE/435-789...............VVMLGDYLL.NLSPSL----------IY.LMTP..LSVLLAVLVTFGLMQRSNEITAMKATGISI
A3ZKX1_9PLAN/6-376...............GRGAFPILFDYYTPRI----------FTFFNMTGGILTLIAAMFTVTWLQRHNEMTALMAAGITK
Q8FDM9_ECOL6/6-352...............LDVVLDIVF.YKVLIA----------LE.MLLP..VGLYVSVGVTLGQMYTDSEITAISAAGGSP
Q054H5_LEPBL/30-383...............RYHVALFLV.YSLPKI----------ISTTVVS..MSLMFSICFTVGQFSVNKELVSMMAAGVSF
A1WAC0_ACISJ/11-359...............IASVLLLAA.DLVPHY----------LG.LALP..VAFTAAIFMAAARMGDDSELDAMLATGRSI
Q1CRE0_HELPH/5-350...............SANMIILFFTYDILFA----------LN.YTLP..ISLLLAMVLFYISFIKSNQYTALLSIGFSK
A3YF37_9GAMM/6-351...............ISNLLEVLL.LRLPSK----------FA.EYIP..IASLIGTLVGLGALASTSELTVIRAAGIPI
Q8D296_WIGBR/5-350...............KKIIFFLLI.LYIPEI----------IK.LILP..LSLFISIALVMQKLHNSNEIISIKTCGIGN
Q6MDI9_PARUW/8-358...............IRELIRYYL.FILASR----------AE.ILIP..LALLIAFIKTVCTLNTHQELVALMAGGIKL
Q9A939_CAUCR/5-350...............MAGVGYYAA.LRLPRL----------FE.QVAP..IAVLAGGLFAFSQLARESAIVAMRASGISG
Q0SM43_BORAP/5-351...............LKDIFYIYY.LYLPKA----------FS.DGVA..LSFLFAISNLIGNLSMRNEIIGLFSCGVPL
Q1D894_MYXXD/7-356...............VWDAAELYF.YKAMMS----------VQ.QLGP..AALLLAAGTTVSALRKQGEVTAIRALTFGP
A6CDW2_9PLAN/6-388...............VILVLKILP.FIVPSM----------LP.FTIP..ATLLLTVCVVYGRIAGDQEITAAKAAGINV
A4BIX3_9GAMM/5-349...............DNALWVVIG.FQVPIL----------LQ.EILP..AAFFLACLTTLHRLSQDSERAILHAIGISD
Q1QKW5_NITHX/6-356...............ILTFLGITS.LAIPVL----------VL.IISP..IALMIAISHTLHKLATDSEIIVMNAAGLSP
Q5H4N0_XANOR/38-393...............FGHAVAYVA.YTVPRR----------AY.TLFP..TAAVIGALMGLGQLAATSELTALRALGVSR
A6DAN3_9PROT/6-318...............FIELLKFYI.LSMPQI----------LL.ITLA..ISFFISAINLYSKLSETQELIALFSLGFKP
Q143Z1_BURXL/6-377...............FQYAVLRVA.LQTPSR----------FY.EIIP..VAALISAIYVFAQMAANSEYTIFRVSGLAT
Q68VX9_RICTY/9-358...............FSFFWRFIL.YKIPYL----------LT.QVSS..LISFTSMLFFLRNLTKSNELIAILSSGIHI
A5PCY0_9SPHN/10-365...............VGVVFKMLA.TLLPEY----------AS.LAIP..LGLLLGILLAFRKLATTSELDVFRAVGMSY
Q0FGB6_9RHOB/5-362...............IWNALILSL.LRTTTY----------LS.LAMP..LIIMLSALAFSVSLSRSNEFIVLRASGVSA
B5EBA8_GEOBB/11-361...............FSDVVRMVA.YLLPPF----------WL.FTIP..MALLLAMLLAFGRLSGDSEITAMKSCGISL
A4BIX2_9GAMM/6-351...............LQSAVIYKF.STLSAE----------VY.EYIG..VIVMLGTLITVASFNKHQELTIIQLSAASA
A6DH34_9BACT/8-357...............TKDIIIYYF.LLIPDK----------FT.YIAP..MSLLLATIYCFSSLNRNHEVIAMRSAGLSL
A3I2C6_9BACT/6-354...............SGEIMKYM..INYGLY----------LNNLLTP..ITVFISVIFITSKMAGRTEIIAILSSGVSF
Q2RQ55_RHORT/8-372...............VATFLRLTL.LLMPGF----------LT.VFIP..IALFAVVLFTYNRLAADRELIVMRAAGMGP
A1WUU9_HALHL/6-348...............TTTMLLKAL.LGAPAL----------AY.EAFP..FATLIGALMGLGGLAARQELTAMRAAGVSV
A3ZM39_9PLAN/6-376...............PSIILGMMP.YFVPEM----------LR.FTIP..GCLLFSICTVFGRMSASNEIVALKSAGINP
Q0AH24_NITEC/6-352...............TRDAFLYTA.MLMPRR----------FI.QIAP..FIALLGTVGALGGLAVSLELVAMRVAGFSP
A5G1T7_ACICJ/24-378...............PVVFLHLTG.LLVPSF----------VA.VILP..ITCFIVILFVYARLAADRELTVMRASGMSD
Q1NXE9_9DELT/10-360...............LGDFLRVVA.YITPSM----------LL.FSLP..MAAMMAVIIAFTRLAGDLEIMALKASGISL
Q3B4Y3_PELLD/6-432...............FMSLIELLA.LQSAWM----------VG.LAAP..MAVLIGVVMAFGSLTTTSEMTVFRASGLSL
Q0BZX3_HYPNA/9-369...............LLDALRLSL.MKLPMI----------IE.QTLP..FALLAATMMAFTRLNRRSELSIIRASGLSA
A2U291_9FLAO/6-450...............VIFILKFLY.YTTLMI----------IP.QALP..IGVLLSSIMALGNLGENYEFAAAKSAGVSL
Q0BKY7_FRATO/8-349...............NFELIINTL.IQLPGI----------LY.TLLP..ACAMVGALMGLSLLANNSEIIVLRSFGRST
A0LB30_MAGSM/6-357...............VSVLGKMVL.LIMPKF----------LV.ASLP..MALLVGILIGLGRLAQDSELIVIKASGISL
E0TCF9_PARBH/51-404...............LLSFLRVTV.LLIPSL----------VG.VILP..FAVFAAVLYALNLFVTDSELPAMRAAGASR
Q1K323_DESAC/6-357...............AHLYIAYFA.WKIPLI----------VS.QMLP..LTILLGTFLTLGGFTKTNELTAMRAGGIGL
A5EXI7_DICNV/7-348...............FWLMLSILL.LNVPAR----------IV.EFMP..AAVLVGTITALGQLNKQQELTVIRTSGISR
B8CYZ1_HALOH/12-360...............VAVVLKLLL.YQLPEI----------IV.QTFP..IAILFATMSGMGRLNRENEFTALRMGGISL
Q1MPZ1_LAWIP/7-360...............ILDVLILFS.YMVPLF----------LI.LVIP..IACMLGVFLTFLRMNLDKELIALKASGISI
A3EV76_9BACT/6-358...............LPLIGQYFF.YRSIEV----------SF.RVLP..MSGLLATLLTLGILSKNHELTAIRAAGISL
Q5X1R0_LEGPA/5-353...............GFVIMKLLM.LELPNL----------MG.LLLP..LGFYVALLLAYGRLYAESEMTVLRACGYGP
A8ZZ83_DESOH/6-356...............LSRMAVFFL.FKIPLI----------VV.QTAP..VGVLIASLVVFGLMNRRNEVTALKSSGIGP
A8EWU1_ARCB4/5-331...............FFELFRIFS.YTIPDI----------IF.YTMP..ISFFISMVITLSKLSSEYELTVITSFGLNP
Q0F2D4_9PROT/6-348...............GRLMVEYML.LKIPFM----------LS.EFMP..VIMLIGASLYLIELSRNQEVVALRAAGLGI
Q04UA4_LEPBJ/109-561...............PLRLLDYFG.YLLANT----------LP.MTIP..MACLMSGIMAAGRLSGDSEITAIRSAGVSF
Q1PWZ7_9BACT/56-571...............IIALKALIP.HMFIQV----------AP.YSIP..SALLTATTLTYGRLSADREIIAIQASGIHL
Q31ET4_THICR/6-346...............STVIMQVLL.YKIPPA----------LE.VILP..LVALLSVMLAVGRLYQDQEMVVLQSCGIAT
A3EV77_9BACT/6-356...............IPTVLRLVM.MIFPQF----------LT.MIIP..VSVLAASTATFNRLASDGEITALKASGIGL
Q1IZ54_DEIGD/6-380...............VGLIGQWIG.YQLPDT----------LV.KVLP..MAVVLMTVVAFGRLATERELVAVQSGGIGL
Q1J2D3_DEIGD/10-350...............PLEALSVFG.AIAPDK----------LN.RSLV..LAVPFAVLLTFGRLQGDSELKAMFAAGVSP
Q2S0T8_SALRD/7-449...............VSVIVELIA.YNLAYM----------VV.LAVP..MSVLLAALMAFGELAESQYYTVIKSTGISF
A4A3Y2_9GAMM/5-358...............AEILLPVMF.YRLPGF----------LE.LLLP..LGLFIGILMSYGRLYVESEMVILSACGVGP
Q6MDI8_PARUW/7-377...............ISYILLFAF.YQIPYI----------LP.IALP..LSCLIASLIFVQRLSNTHELTALRACGFAL
B8CYX9_HALOH/6-362...............FTTLVQLFF.LKLPPI----------IV.LTFP..MATLMGTLMSFGRLSGDGEITAFRAGGVSV
Q1IRI3_KORVE/8-376...............LPSVAEIFF.LTLPTA----------LT.VTLP..MAVLVGILIGLSRLSADSEVTAMRSSGLGS
O83854_TREPA/1-358...............AADVVRLLL.YSIPAA----------LI.YVTP..FAVLVGSLLGLGRLRNNLELLALQVLGVSP
Q8D297_WIGBR/7-348...............IFYLISTIL.LSVPKD----------IE.EFFN..ISILIGILWSIGILEKNRELIIIESSGISR
Q9AA49_CAUCR/9-364...............LRYLAELLV.NLTPHY----------VG.LTLP..GGFFIGLFVVVNGLNKSSEIDAILASGTSL
Q3J9X2_NITOC/9-352...............GEAILALSG.YEAIGA----------LV.LLLP..LASFLAVLLALGRMGADNEVIALFACGVSR
A7IJ85_XANP2/6-384...............IIAFVAITS.LTMPTL----------VL.VIAP..AALFIATAYTLLKLNGDSEIVVMASAGMGP
Q9TLY0_CYACA/27-394...............LEISLQILL.LYLPLY----------AY.FALP..ITSFFSGLISFRIKNYSNQLLGVYITSISF
Q0C1U7_HYPNA/7-360...............FASASLLVA.NLIPHY----------LN.LALP..GAFLISMILTIDRLSRSGEIVALMAAGVSL
Q0BVK4_GRABC/5-352...............MLDAAIYVA.LTIPYR----------LL.QVFP..VSMLIGTLLGLGGLARNGELTALRGLGMSE
Q5FU64_GLUOX/35-392...............ASLIVKIAA.LHVPYY----------II.YVLP..FGILLGGIVCFSRLTRSSELIVARAAGISA
Q5FPA9_GLUOX/26-376...............FRGILTFAF.LHLPAL----------SI.DILP..LAFMVGALFLLTQMTLSSEISALRAAGLST
Q1D895_MYXXD/6-362...............LVDMARLLA.YLAPHF----------LM.MALP..IAFLLAILLGLGRLGEDRELVALQALGIGP
Q9PL80_CHLMU/6-348...............YATVFRVTA.YQIPYL----------LP.FILP..ASCFISAFTLFRKLSDNNQITFLKASGASQ
A1AXG9_RUTMC/6-356...............VFEVTKYVI.SDIPAV----------VY.SYSS..VIILLGSLLALGHLASTSQLVVIRSAGVSI
Q0G6N0_9RHIZ/6-358...............AGNILWIAL.MLLPDL----------AA.GVVP..FAILIGAIQVLNGLNADSERAVIAASGASM
A6QBC8_SULNB/6-335...............FLELLLLYS.YSLPNI----------IF.YTIP..LSFIAAVTNTLMKLSQDNELIALYALGLKA
A6QBZ1_SULNB/12-355...................ILYIF.YMWQEA----------LG.LLYP..LAIVFAVIMTKLTFVKQNTMGALHAFGYTK
Q7VQS9_BLOFL/5-358...............IYWIFLYLF.LSIPDL----------GK.LIIP..FSLFLSVLISCYRLHMHNEILAMYSCAVNK
Q319A3_PROM9/28-396...............VLKALQALI.YSLPSF----------LV.LSFP..MAVLLSTLLSYGKLSANSELLALRSLGIKT
Q0SM44_BORAP/10-425...............FFKAFIFII.YSLPMV----------IA.LSPP..FASLISVILTIHKFKIHNEILAFRSIGISI
A5ILH5_THEP1/6-352...............IEKLFLMLY.YYLPYF----------VA.MGVP..VGVLLAIFWTFSRLSEERELMAIQVHGISQ
A6DC21_9PROT/4-336...................TLYIF.YVFIDS----------IF.ILYP..LALVFAFLLTLNKMIKFNELVSFYSLGFKP
Q73NV8_TREDE/6-354...............FKDIVKVMW.LYIPKC----------IA.YSVP..LAILFAGSYTMGNLYAQNELTSIFSAGISL

PF00528

YQGH_BACSU/107-309........................FKSSGTG.HSLLA.G..TIVLSVMILPTITSISADAMA.SLPKSLREGSYALGATR
YQGI_BACSU/80-293........................VNLTGWG.YTIIG.G..ALALTVFNLPVMVRVTEDAIR.SVPKDLKEASLALGVSR
NIKB_ECOLI/116-308...................QWLPAMGYGGWQ.HIILP.A..VSIAFMSLAINARLLRASMLD.VAGQRHVTWARLRGLND
Q97UG4_SULSO/116-318..............FPSKINTSPNSIMALSR.FYTLP.I..IALMFTSLSGFVLGMRNNMLH.TIRDNYVTYAEILGLDH
YCKA_BACSU/41-224........................PYIGIEF.SAVTA.A..LIGFSLNSAAYIAEINRSAIS.SVEKGQWEAASSLGLSY
Q97VK6_SULSO/120-341LTP..PKSITPFPLLNAMLAGDWPYFSSLVH.HMVLP.V..IAIALVSFGIVTRIARASMLD.YMESDFAKLSLMKGLSR
Q9FAT0_VIBPA/116-319..............GATSLSIVNSTWQGNLQ.HMILP.I..VCLVLVGIGPLILHTKEKVVS.LLDSDYVKYAQMHQIPK
Q44374_RHIRD/87-266...........................TILP.RSVAFIV..AIIALVEATRFFRLARLLAAD.IAALDY.SGRFLRGETT
Q9KB56_BACHD/117-308...................DLLPTSGLDSYQ.SYILP.V..TVITASYVGIYFRSVRNSMLS.HLNEDFVLYGRACGISE
OPUBD_BACSU/40-211...........................LVMG.LGANT.V..ILSLFLYSLLPIIRNTYTGII.SIEHAYLESGKAMGMTK
Q9LAT6_LISMN/112-304...................QIFPVAGWGTFA.DTILP.A..FALAMFPLATAARFMRTELID.VFASDYVLLAKAKGNSR
LACF_RHIRD/87-298...............AIGIIGEPIGWLTDPF.WAKVL.I..IIAITWRWTGYNMIFYLAALQ.NIDRSIYEAAKIDGVPS
Y355_HAEIN/68-243...........................LWFG.YGMAS.K..IVMSVLIIYFPVTAACYDGLR.NTPQAWLDLAKTFNISP
Q982M9_RHILO/75-250...........................LIFG.LGMTP.K..IVIAAVICFFPTLVNMIRGLD.SASDNEHELFRVLSATR
GLNP_RICPR/33-217.....................INIKFN......VFMA.G..VISFALNSGAYVSEVIRAGIN.TVDKGQFEAAEALAIPK
AMIC_STRR6/298-492..................PDSFPILGAGDWR.SYVLP.A..VILGLLGAPGTAIWIRRYMID.LQSQDFVRFARAKGLSE
TCYB_BACSU/46-230.......................PAFN.VTL.DPFPS.A..VIAFSLNVGAYASEIIRASIL.SVPKGQWEAGYTIGMTH
AMID_STRR6/125-308...........................YSIG.AGFWNLI..FAMSVTTWIGIAFMIRVQILR.YRDLEYNLASRTLGTPT
NRTB_SYNE7/98-276...........................MVFQ.DANTS.A..IFVIFITAIWPIIINTAVGIN.QIPDDYNNVARVLKLSK
Q9HIL1_THEAC/131-337............YGVNVNMGFNVPFIISVIY.HAVLP.V..LTIILTSLGGWVLGMRNNIIP.NLNSDFINYSENLGFKD
Q9X0U9_THEMA/119-323............YSFGITPSFSWDFILDFLH.HWVLP.F..GSLFLVMLGGWAIGMRNMIIY.ELEANYSRYLEALGSSQ
UGPA_ECOLI/90-294................LAEFGYDWNHAQNSG.QAMFL.V..VFASVWKQISYNFLFFYAALQ.SIPRSLIEAAAIDGAGP
SAPB_HAEIN/93-316YEIKSITGFPVIDMWFMEVPYRTKIVQNILQ.HLALP.T..LVLCILPTMEIIRIIHQRAEY.ILNQNFSKVATTRGWSK
MSMG_STRMU/87-273.........................MMSKLG.LANMWGL..IILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK
OPPC_LACLS/106-293...........................TIIPRFNSWSLI..GIISIFSWIGTTRLIRARTMT.EVNRDYVQASKTSGTSD
Q57M02_SALCH/27-221..................VVTDSLGIDQIDI.DPMVA.G..IITLGFIYGAYFTETFRGAFM.AVPKGHIEAATAFGFTH
NIKC_ECOLI/89-273...........................GVLG.TGLTNVI..IAIALSHWAWYARMVRSLVIS.LRQREFVLASRLSGAGH
Q9WYD8_THEMA/94-282...........................SLIK.NYLSLPILGLIIGVFGWAGDARVIRSMILS.LREREFVVTSKFSGMRT
POTH_ECOLI/117-315......................VIDQPLTIL.HTNLA.V..YIGIVYAYVPFMVLPIYTALI.RIDYSLVEAALDLGARP
LPLC_BACSU/93-290...........................KSLG.LLDTY.W..ALILPMAINPFNLIIIKNFFQ.QLPRELEESAKIDGCSE
CYST_ECOLI/74-276.........................FDIKVT.YTWLG.I..AVAMAFTSIPFVVRTVQPVLE.ELGPEYEEAAETLGATR
Q9ZBG1_STRCO/128-331..............GLTDTASQQVTPGQVAG.HIVLP.A..GVLAVSQLPWFTLYVRQGVGD.ALAEDPVRGARARGLAE
Q97UH1_SULSO/128-336...........NTFQFLKPTMSLPFIWSVIY.HAILP.T..LTLILFSLAGWIMGMRNNMIP.ILQEDYMNYYRLMGVSE
Q97VF6_SULSO/101-289...........................SAFKTSNPIFLS..LILSITSWAGLARAVRSQVLV.IRNSPAVEVLRVLGLSR
LACG_RHIRD/89-270.........................LMGQAG.LLNTH.I..AIMLPMIASAFIIFYFRQASK.AFPTELRDAAKVDGLKE
Q9HLG4_THEAC/81-265...........................VLFH.ETLGGVI..LALVIVWWPIYARFFRAQTLR.IKNLDFVQAAKLGNVSF
MALD_STRR6/87-275.............................AL.NHNWF.L..IFLYVGGGIPMNAWLMKGYFD.TVPMSLDESAKLDGAGH
GLTJ_ECOLI/43-239.....................WFKAELDPNI.QFFLS.S..MLCLGLFTAARVCEQVRAAIQ.SLPRGQKNAALAMGLTL
YEHW_ECOLI/68-240...........................PVIG.FGLQP.A..IIALILYGVLPVLQATLAGLG.AIDASVTEVAKGMGMSR
Q9FAT1_VIBPA/84-268...........................VSFG.SGSQGVM..FAIALSHWPKLTRLCKSEIQS.LMCSDYMSHALNFGHKK
Q9A534_CAUCR/67-247...........................IWAGIDHPERAV..IGLAAVVAFFPIFSGALSGLK.SVDPDLARLFDLYGATP
YEJB_ECOLI/151-361...........LVSANFDSLPWYQKITDYLW.HITLP.V..LATVIGGFAALTMLTKNSFLD.EVRKQYVVTARAKGVSE
YOR2_CALSR/83-265.......................NKIK..LY.DTVFA.L..IGPYVALSLPMSIFILTEFMR.EIPLELEEAAKIDGCSM
O66777_AQUAE/114-319............QSPNFEQLSIPEKVLDILK.HLIIP.S..LTLGLVSLASLTRLVRSSVLE.ILSSPMVTMLKAKGVGT
YEHY_ECOLI/195-381...................AFPWLGTLGIAG.TGMTP.A..LIALVLYALLPLVRGVVVGLN.QIPRDVLESARAMGMSG
Q9WXN6_THEMA/92-279...........................SYLKVRSVEMVA..VILGLFQWPWFARAIRAQLMS.VMSREYVYLSVMAGYSD
Q9Y9N0_AERPE/121-339VN...LDVVTGLYVLDSIITANPAALVSAVE.HLILP.S..LTLGIVLSGVYTRLVRIHVAE.ALRSEVAVAYRARGLRE
Q9WY46_THEMA/67-238...........................FLWG.IGWQG.P..VVISSLSLIPVAIFTTVSGVR.SVDRKLLEVMKVYRVPR
Q9Z6P7_CHLPN/68-243...........................LWFG.WGIGA.V..IVPTALTIFFPLTLTIYQGIL.STPEELIEQFVLCGATK
GLNP_SHIFL/33-218.....................FNDLRI.....DPFTA.A..VVTIMINSGAYIAEITRGAVL.SIHKGFREAGLALGLSR
Q98K60_RHILO/105-289.........................VLAAIG.VTGLIPK..AMISTYLSFFPVTVGMVKGLR.SPEIMHLDLMHTYNASA
UGPE_ECOLI/91-278.........................LDSYAG...........LTLPLMASATATFLFRQFFM.TLPDELVEAARIDGASP
OPPB_LACLS/113-318.............TVSPDAMGIIPVFFSKIY.HMILP.A..FSLAVFGTVGIFTYFRSGILD.EQTQDYVRTARAKGVKE
Q49553_MYCHO/234-419...........................SIIG.ANEWSLV..LTLTIVGWPGFVGITRMFIIT.VKDEEFIIAAKAIGVGT
FBPB_SERMA/341-526.......................IHSFRPIY.QTEIT.L..LLAYLLMFMPRALINLRAGIA.QAPVELENVARSLGKSP
Q987J0_RHILO/100-280...........................AAVG.SSIPALI..LTLAVIYIPGAYRFARALAVN.INSMDFMTVARVRGEST
Q9CLG9_PASMU/73-248...........................LWFG.YGLAS.K..IVMTILIIYFPVTAACYDGLR.NTSMQWLELAKTMQVSA
Q9PPS8_UREPA/183-374....................LPFTFDINNFV.TYILP.G..LALSLGSIIVYVQYIKVEMNR.ELNSMHAKFAYLKGATV
PSTA_ECOLI/101-295...........................QMEH.FSGWA.G..VIALALLQVPIVIRTTENMLK.LVPYSLREAAYALGTPK
Q98QF6_MYCPU/174-365....................IPFIYDIKDFT.TYILP.A..IALAMPSVTAYIKYIRYELNN.ELNSMHAKFAYVKGVSR
MALC_STRR6/209-434..............FLPFLDGALIPWKTDPT.WTKIA.L..IMMQGWLGFPYIYVLTLGILQ.SIPNDLYEAAYIDGANA
LPLB_BACSU/104-314................MSLTGEQISFLSDAD.WFRPM.I..VMQSIWKETGWGTILFLAALA.TVDQEQYEAAIMDGAGR
YHDY_ECOLI/173-362.....................IDKLIR...........A..LVGVILFQSAYVAEVVRGGLQ.ALPKGQYEAAESLALGY
B3XCM3_ECOLX/104-273...........................VAVG.LGPFA.G..VLALFIHTTGVLSKLLSEAVE.AIEPGPVEGIRATGANK
Q9AKQ9_RHIML/112-306..................WLPAGGWGDGSLR.FLILP.M..IALALPQLAVFARLTRGSMIE.ALNTDHIRTAKAYGLPS
Q97YP1_SULSO/131-332...............SGIQVLHLNDIVSILK.VYWLPWI..IQVFIFGFPVRGILMRNTMVD.VLDSDFVKYARLSGLKE
O28506_ARCFU/135-354NT...PETITGLYVLDSILTLNFNSLIDALA.HLALP.A..ITLGIVLSGAYTRLLRNNLID.VLSQDFIKAYRARGVRN
Q98K61_RHILO/75-251...........................MWFG.FDWQS.K..AAVVIIMTFFPMLVNTVAGLA.ASGHMERDLMRTYASGY
AMYC_THETU/83-269.........................EFGKFH.FLTRSGL..VFMYLGFGSSLGVFLYYGALK.GIPTSLDEAALIDGCSR
Q9ZGP1_STAAU/117-308...................NILPTSGLTGPE.SYILP.V..IVITIAYAGIYFRNVRRSMVE.QLNEDYVLYLRASGVKS
Q9EWP8_STRCO/101-281...........................AGFP.GSDAALV..TAVALATAPFSTRVLRAAADT.VLHSGYVEAALARGDTR
Q9KKK5_VIBCH/118-310...................NWLPVAGFGHPK.FLILP.A..LALALGMAAMSSRMIRNATAQ.VLQSPYYAFARLKGLNH
YEJE_ECOLI/158-341...........................SVVQ.PNFWWLL..AITVLFGWMSLVGVVRAEFLR.TRNFDYIRAAQALGVSD
O86691_STRCO/402-574...........................AVAG.SGAATPA..LAVGAVAWAPLAAHTSSLLRQ.ERATLHITATKGLGAGP
Q98QS7_MYCPU/195-382...........................QILG.TDYLSIG..IILIVLGWTNPTYVARSYTSI.IKDEEFLYASKVVGASK
AMYD_THETU/85-290.................THIGWLGGWLSTTN.TGFWG.L..VIVTSWQMIGYVMVIYIAYIE.SIPTDLIEASKIDGANS
O34157_SALTM/115-319.............AWDPGNNAGTALLSERLR.HLVLP.V..CALSLLGMGQIALHTREKIAS.VMKSEFIRFARAQGDKG
Q9PL65_CHLMU/67-242...........................LWFG.WGARA.V..IIPTALSIFFPLALTIHQGIK.NPPEELLEQFTLCQATT
Q9RX04_DEIRA/318-494...........................SWLG.FGSLP.A..VLVSALSALYPVLVSTLIGVR.EVDHAYHELFHSLRATP
SSUC_BACSU/94-269...........................LWFG.FDEVS.K..ILLIALGAFFPVYINTFNGIR.GVDAKLFEVARVLEFKW
Q9UYG7_PYRAB/121-325............YSQNLVPSFSITFIVDFLK.HWILP.F..LSLFIVMIGSWAIGMRNMIIY.ELEADYVRYLEALGASE

PF07242

A7GQL2_BACCN/621-721FKRHKLYLMFTNFV-------------W-FVS------------------------------------------------
A5MAB6_STRPN/576-675YELHGKYLLAQGGV-------------L-LLG------------------------------------------------
Q9L651_LACLL/549-647FTTHKTYLIQLFII-------------I-IFA------------------------------------------------
A5M6X5_STRPN/166-265FETHAQYMVSQFAS-------------F-VFG------------------------------------------------
Q931U7_STAAM/555-653LRANYQYLLINNIV-------------V-VFI------------------------------------------------
Q8CY97_STRR6/155-254LEIHRTYLFAQLGV-------------F-LLG------------------------------------------------
Q6GIZ0_STAAR/545-643FSSNVRYLTISILL-------------S-IML------------------------------------------------
Q926X5_LISIN/619-718WKSSKWFIISNLAV-------------C-AFS------------------------------------------------
Q93MD9_CLOPE/619-718IYRYMNYFIMVLIT-------------W-TCP------------------------------------------------
Q9KG35_BACHD/612-712FRAYRNVLFWTLAT-------------W-VVI------------------------------------------------
B9WU46_STRSU/561-660IELHGSYLGEQVGS-------------A-LVG------------------------------------------------
Q9CJI4_LACLA/565-662FVTYKTLFAIVLVQ-------------G-SLY------------------------------------------------
Q8Y3Q8_LISMO/620-718WKSSKWFIISNLFV-------------S-VFS------------------------------------------------
Q896P1_CLOTE/604-706LSNYKEYFYLILIS-------------W-IIV------------------------------------------------
Q892J9_CLOTE/609-706FDKYKEYLWIIIIS-------------W-VAI------------------------------------------------
A8AXA7_STRGC/592-691LKIHQSMLISEIAM-------------L-LLG------------------------------------------------
Q9CE29_LACLA/560-659LRIHRRFIFVELGL-------------L-LIL------------------------------------------------
Q181M6_CLOD6/617-718TARSMLLIVSLILT-------------N-IIP------------------------------------------------
A7GNK2_BACCN/616-716FARNTSLILLLFAI-------------N-FIP------------------------------------------------

PF02687

O50782_BORBU/276-402LELFYSLFLEIVII....SVVNIVVG.V-ILA------------------------------------------------
A3I1M1_9BACT/289-407AQLFGQFVSESFIL....TLGAAVLS.V-LAL------------------------------------------------
A7VH46_9CLOT/421-541KNLMAHYVTLPTVI....TFVSGLIG.T-LLG------------------------------------------------
A8ABZ3_IGNH4/248-373KDMTLYLSGVWGSR....VFLGTLLA.L-LFG------------------------------------------------
Q9F443_STRSL/517-633KMINRIVGYEIGIL....FLIPVLIG.I-ING------------------------------------------------
A7H0E4_CAMC5/307-422FEIYTLFASESLVV....AFVAGICG.A-FLG------------------------------------------------
A3UQ03_VIBSP/269-395GQVMGIFMVQGASS....GVIGALSG.G-VLG------------------------------------------------
A5Z5I3_9FIRM/662-784KQLCKMNICEGLCY....AFFATLAI.L-IVG------------------------------------------------
A8H349_SHEPA/695-810WLLRAATGLEFALL....GTIAGILA.V-VVA------------------------------------------------
Q9WZG5_THEMA/725-844NQLVASFLIEHLFFLFGGILIGTVSG.V-LMG------------------------------------------------
Q9FBP3_STRCO/657-772RTLSLSVLWQTAIP....IVLGLLLA.S-VVG------------------------------------------------
Q2CDR4_9RHOB/175-297SYIARAFVRRFTLR....ALTGALAG.T-AAG------------------------------------------------
A6DHZ0_9BACT/321-438SKVFLIFLSRSCLS....GLLASCLCLF-LVL------------------------------------------------
A5ZCK7_9BACE/250-369FHLAMMLFVQLFLV....IVIASLFMFG-LIE------------------------------------------------
O28455_ARCFU/275-396NEIMLHYLQYPLLM....GFFASTAG.L-VAG------------------------------------------------
Q481M7_COLP3/705-820NTCLQLNIIEWLITA.LIIAIGAIAGTY-ITG------------------------------------------------
A4YKC0_BRASO/734-849LRLLGAYALEYLMI....GFATAAFG.V-IAG------------------------------------------------
Q0HRW4_SHESR/279-392RDIISYFLVENYLL....CLLGGGIG.V-LLA------------------------------------------------
A7AZK1_RUMGN/757-876KGLDRLLHIEGFFL....GGKPLVIG.L-PIL------------------------------------------------
Q64W75_BACFR/294-427KQLLNQVLWENLLL....TCIGGLMG.L-IVS------------------------------------------------
A8AR20_CITK8/231-351GFILRPFLYGGALL....GFSGAFLS.L-ILS------------------------------------------------
A3UCF7_9RHOB/264-386FAAFVGTLVESLML....AFIGGLVGAL-ITY------------------------------------------------
Y684_MYCPN/989-1110AKFIAGMSVFAGIV....ALASSFFG.V-LFA------------------------------------------------
Q2RPK1_RHORT/279-403STLIGLPVVQAALV....GLMGAIAS.L-GAA------------------------------------------------
A6H1M7_FLAPJ/284-410WTVRKIFLYNAVHLITKGLLWGNTIG..-.IG------------------------------------------------
A8G4C7_PROM2/272-386KSLFFVVAREGFLL....ALFGYLPA.Y-FSG------------------------------------------------
A0PQZ2_MYCUA/174-295WYTQLPFLMEAMLA....ATLGVVIAIG-GLI------------------------------------------------
Q4QBC9_LEIMA/977-1097AQLMRCAVYESLCI....VISAFTWG.L-VVG------------------------------------------------
Q025M3_SOLUE/351-471ARLVCQLLTESALL....GVLACSAG.I-ALA------------------------------------------------
Q54MT9_DICDI/545-666SFIIELIVSKTIIF....TVPSIILG.L-IIS------------------------------------------------
Q6MGV4_BDEBA/659-778SAVFQVLFFQMGLQ....VLVSIFPG.L-LLG------------------------------------------------
A6L8W9_PARD8/653-767RQILVKLVFTFLNY....VLIAFVIAIP-IIM------------------------------------------------
Q4A9N5_MYCHJ/2523-2644KTKVRLFYSIYLPI....LLISSLIS.I-PFV------------------------------------------------
A4CDR0_9GAMM/687-801AQLVTAVSVSYLKL....VSLSLLVS.I-PLA------------------------------------------------
Q01VW7_SOLUE/1278-1396LHIVREVFLSGGRP....VVRGLFLG.L-WLS------------------------------------------------
A3I5H5_9BACI/646-767PNIRWSITSGILIL....SIFGAIGG.F-IIG------------------------------------------------
A5USK7_ROSS1/311-433WQVLGLALGEVLLL....GAAAWAAG.L-PLG------------------------------------------------
Q9A6K3_CAUCR/352-465GDLRNIVMELSFWV....GIVGVFAA.G-LLT------------------------------------------------
Q72UY4_LEPIC/260-379NAVSWIVLGELFLF....SLIGSVFG.I-LFG------------------------------------------------
Q5V3A9_HALMA/874-995WRVLRTILADIARI....AIPATGLA.L-GLS------------------------------------------------
Q8NS27_CORGL/613-739GTIYKVNALNAALL....ALVGGIMG.L-VSG------------------------------------------------
B1JTM3_BURCC/259-376WFLALIVFGESVVI....AVAGGGLG.I-LAT------------------------------------------------
A7AFS2_9PORP/465-579KDILRIFLKDVLRI....ALPAILLG.C-GIS------------------------------------------------
A8F9W5_BACP2/316-420KHIFAFIFSEVLLL....SLTSFGLTAL-GVS------------------------------------------------
A8HA97_SHEPA/673-786EALMAQMVWANALL....AMVSILLT.L-GVF------------------------------------------------
Q97DB8_CLOAB/716-835HQTRKMLFIEALSI....GLIGSIGG.I-VGG------------------------------------------------
A6F274_9ALTE/258-378QGIGRLYLRRLALW....GVVGAVGG.L-LVA------------------------------------------------
A7HK62_FERNB/257-383AQMFWILFLEGLAYLILSEIVGAIAG.V-GFG------------------------------------------------
B8FRQ9_DESHD/291-412AYIRSLIIKENFII....IAISALLASL-AIL------------------------------------------------
A1TXE6_MARAV/183-306SQLSRLLLVENLLL....ALVCILPG.V-WLG------------------------------------------------
Q93H51_STRAW/242-364GQIRRMVISEAFLV....GVLASAAG.C-VFG------------------------------------------------
Q54290_STRHY/294-451RKLIAQQALEILVV....GALAIGLS.S-LFA------------------------------------------------
Q830M8_ENTFA/579-698KAITKQIYRQNSLI....FFPPMVIG.I-LHT------------------------------------------------
Q81N14_BACAN/248-369KQMFKVIFIQCSVI....NFFGGISG.L-LLA------------------------------------------------
A7B7J6_RUMGN/273-419KRTFGVLTSELWMI....FAVAYPVG.C-VLG------------------------------------------------
Q5LCL1_BACFN/272-387RSLFALLSVEYLIV....LLAGSLLGMA-FIE------------------------------------------------
Q9KF85_BACHD/539-650RHIRWLYLMENSSL....IFLSAAIASL-ILL------------------------------------------------
A3D8C2_SHEB5/283-407RALMTALMLELILL....VVIGSSLG.F-ISG------------------------------------------------
A1SKN4_NOCSJ/300-416RGARGLLAGELLPV....ALAGVVPG.A-VLA------------------------------------------------
A7VFS5_9CLOT/263-395KQMKQLIFREGIFL....TFFSIPVG.L-LFG------------------------------------------------
Q5JEM5_PYRKO/203-318SFIFTLFAGDYLIV....ALLGYAIG.I-VPG------------------------------------------------
A7VIB2_9CLOT/622-743KEINKLYLSATTWV....MAVCVILG.I-ILS------------------------------------------------
Q8G7P9_BIFLO/320-438GRLGWQFMLEVFIV....TLPFYVIG.L-VGG------------------------------------------------
Q735D4_BACC1/728-843SNLMKSILLENTII....SLSAGLVG.A-GIA------------------------------------------------
A6BFN6_9FIRM/685-806KQLNLCLQLQGLIF....TVGTICVA.L-IIG------------------------------------------------
A4CAI1_9GAMM/683-798NRLFILVFKDNSIA......LSMGCGLS-ALG------------------------------------------------
A3ZPC9_9PLAN/633-758AGVFYMVFLRSAII....GVLAAAVT.V-GFG------------------------------------------------
A9KQT2_CLOPH/343-506AKVALGIWTEIFAI....TCVCLVIG.L-GVG------------------------------------------------
A1ZGZ7_9BACT/274-392QMIGKNLIY.........FFIAFVCGLS-VLT------------------------------------------------
Q6F1V8_MESFL/1691-1810KETIINTILIPAVISTIFVLIGYLVGKW-LLG------------------------------------------------
Q601V9_MYCH2/401-522RKIFIIHLLNILVI....CGLMLTSG.L-ILT------------------------------------------------
B8G588_CHLAD/255-383KTLATMYMATAALF....GLLALVLA.V-PAG------------------------------------------------
Q04L09_STRP2/60-182RHLISMTFKELVVF....GILTVGAG.I-GIG------------------------------------------------
Q048H0_LACDB/280-404KDVLSAAIIYQLLI....DILAIVPVLL-YVG------------------------------------------------
A4BXN0_9FLAO/168-283SFIRKPFIWQGVKL....GLIGAFLA.L-VGM------------------------------------------------
Q9PPU7_UREPA/163-284WQVWFSFAPFYTIP....SLIVLIIG.Y-SIS------------------------------------------------
A5LLD1_STRPN/291-413KDIIAKFLLYGLVA....GTVGTALGSI-LGH------------------------------------------------
A6TSQ0_ALKMQ/264-387RMTDTVLIGESLTY....GLLGGVLG.N-FVG------------------------------------------------
A7VD43_9CLOT/805-930HEINKMLINEQMFS....SVLASLAG.Y-GVG------------------------------------------------
Q8RTI8_9GAMM/277-411STVTKVVLLEAVYL....SAFSLLLG.L-GFG------------------------------------------------
A5N346_CLOK5/473-593HQITKMIAAEAFTY....SISGCIVG.V-VVG------------------------------------------------
Q053J3_LEPBL/252-373GHTFFLFISQALFL....GISGSFLG.L-GLG------------------------------------------------
A7H957_ANADF/284-394RTIAAMIVQQALAL....GAIAFVVG.K-LAA------------------------------------------------
A1SH34_NOCSJ/769-890RQLVKLAVSEAAVT....SAIGLAAG.G-LIG------------------------------------------------
A6LCJ9_PARD8/285-395WRLRGFLWLESFLF....ALLSYAIS.L-LLL------------------------------------------------
B8I8J6_CLOCE/296-424RQCFSIIFLEVFFL....SIIALSIA.C-GIA------------------------------------------------
Q6AA47_PROAC/602-722RILRRSFLMQMIVT....ILPAQTMS.L-VVG------------------------------------------------
Q4MWW1_BACCE/235-351ISIYCELYIQILFI....SLAAMFLV.F-ITL------------------------------------------------
A6NZ14_9FIRM/176-297SFVRWPFVVEGMIL....GLVGAVVA.F-LLQ------------------------------------------------
Q6MT15_MYCMS/562-682VELSWIFALKTWLT....MFFGLIIG.Y-ILS------------------------------------------------
A4VW57_STRSY/998-1117REVTMYIYRETIAL....SLIGMLVG.L-VGG------------------------------------------------
Q18EP9_HALWD/299-419RSVGFVVALQVVTV....CFIGGTVG.A-LLG------------------------------------------------
Q8EUA2_MYCPE/1360-1480KKNAASFLSVYLPV....FFFGLLIS.V-PIT------------------------------------------------
A5MD01_STRPN/302-451ASILGQFITESILI....AIPALVSA.Y-FLA------------------------------------------------
Q47EZ3_DECAR/243-372GDVIRMKTWEGLLI....SLTAFLLG.F-IAA------------------------------------------------
Q034M7_LACC3/404-519KDVRRILFWNAMKY....GCYCFGGAAL-LIV------------------------------------------------
A3I2Y5_9BACT/746-861NDLSKKLLKRYLII....WGIAAVIG.S-TFS------------------------------------------------
Q0RJL1_FRAAA/639-753GMLRRVIVLESALP....LLVLTVVS.I-ATG------------------------------------------------
Q7UPA2_RHOBA/581-706RRVMKLALGETAVT....AAFGTLIG.I-AGG------------------------------------------------
Q8A9F6_BACTN/266-381IHLFVQLYIENLFL....IAIALCLSWF-LIE------------------------------------------------
A4C0M9_9FLAO/275-395FQLMKMVFYEGLIV....AFSSFLLGFL-LLK------------------------------------------------
Q14QM1_SPICI/154-274WKIITIVLGFYLFA....IILGYVLS.Y-VIA------------------------------------------------
Q97LN0_CLOAB/737-854RDFKKMMNFECVFY....GMKALLLG.L-PLS------------------------------------------------
A3ZPB7_9PLAN/791-914SAILRAIVAEGAMI....GIAASLLS.V-SFG------------------------------------------------
Q737Y3_BACC1/256-376KDIQKLYVTKYVVI....SAGGCICG.Y-ILS------------------------------------------------
A7VDT8_9CLOT/311-424VRCMLLIYGHWLLY....YGVGSIIA.I-ILQ------------------------------------------------
Q4A9N5_MYCHJ/1802-1923FEIASSFLSIGFII....AFLGGSLG.F-LSG------------------------------------------------
Q899W1_CLOTE/250-369KMIWKQIFIELMLV....SLCAIISA.L-IVV------------------------------------------------
Q4DFN5_TRYCC/444-565THLVILLLTQSLAF....IIPGLATG.A-AFL------------------------------------------------
A7ADY9_9PORP/281-400KNLVIQLLLELTLL....VGISFLLA.S-CLL------------------------------------------------
A7ADZ2_9PORP/274-398KGLFRLLFSEIAVL....FILSALAS.L-VLT------------------------------------------------
Q2SRI5_MYCCT/367-490RQMVFNYVMMPFFT....SIVGGILG.Y-ILS------------------------------------------------
Q71YS2_LISMF/59-181SQIVLVLFFENAML....YMLATIFG.V-LIG------------------------------------------------
Q638M9_BACCZ/706-820KGIVQIILTQVNLY....VFIGIVLG.A-VIG------------------------------------------------
Q8KD33_CHLTE/268-389EAVGLHVLGFALAP....TVAGVLLG.T-GLG------------------------------------------------
A7GNK2_BACCN/187-299SRIIAHVFLLLTKP....IVLASFTG.Y-LLA------------------------------------------------
A3JAL8_9ALTE/692-813RQVLAQLGWLALTL....TLSITLLA.L-PLG------------------------------------------------
Q6F163_MESFL/1281-1400KEINWVVMGSYAIG....ALISFIAA.Y-IAS------------------------------------------------
Q6AMB4_DESPS/278-415HHVYASIIIEALII....GVIGSIIG.T-LLG------------------------------------------------
A7K544_VIBSE/291-411RHVFSLLISEASLL....TAAGIVTG.V-AGL------------------------------------------------
Q2SSK7_MYCCT/644-765KTIASSYIWYALIL....VFIPIPIG.W-MLG------------------------------------------------
A3QAU8_SHELP/312-429AQIFSQYMVEVGVI....GLFGGLVG.L-LWA------------------------------------------------
Q6F1W1_MESFL/1301-1420AYVVKTVMGMYLIVISTMFAVGFAAGWF-IFA------------------------------------------------
A6LZM8_CLOB8/286-398KDIFKTFSSEFLIN....ILVGIIGGSL-FYL------------------------------------------------
A7VI29_9CLOT/290-409KDIISIILIENIWK....MLIAIILVIP-VVA------------------------------------------------
Q6UCA9_BACFG/30-146KAIFSMFIYETALI....IGVSLVLM.I-IFL------------------------------------------------
Q2ST97_MYCCT/1669-1788TQVMFYTLGVATIF....SLLISFIT.T-IIV------------------------------------------------
A7AE18_9PORP/286-404AEMNYQLFLDTFLT....VGIAFLLS.L-LIA------------------------------------------------
A7V9H5_BACUN/291-408GRIRWQLLGEGLLL....LALASIPA.L-MIC------------------------------------------------
Q6GDI1_STAAR/59-180KSMRLIVVMETILQ....FMIISVIS.I-AGG------------------------------------------------
A8FMY2_CAMJ8/150-267..WFRSFMLYKVVV......VDCFIAFV-ILL------------------------------------------------
A7ZGQ8_ECO24/256-370KTVCIVIFVESSIV....ALLSIFVS.L-LIS------------------------------------------------
A7VI30_9CLOT/297-409WKILSMSFKEICLM....AGIGLGLA.T-VIS------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355RQLLTPFAWGALLL----FLFNFFNAGW.LAP...TTYSHNRTFEQLYLGKNAGD..........QETRNLHLLDSGN..
Q1CSH4_HELPH/4-343KTMTKAFVPLSLLV----SAILLVFSLI.LIP...TSKSAYYGFLRQKKDKIDIN..........IRAGEFGQKLGD...
A5TUK8_FUSNP/11-360LRIVRAPLIIAFVI----SLFVFFINNS.IYT...KSLAKINFYRRGEVDETLKL........PTTKENAFFINNTDG..
Q4UQP7_XANC8/6-349RRMLRPILWLVVPV----VVVIGACSLW.LGP...WASRTAELMLEDANRSVVMA..........GLESGKFTPLSGG..
A4N619_HAEIF/7-355FKIGMAVMKTALPL----VVFTMIIGEW.GIP...QTEQFARDMRAKALSGGSIL..........SIKNGVWAKDGH...
A4JGZ3_BURVG/5-348TRLIKPIGVFATPI----ILLIAFFAFV.GWP...WSNQQSKMIKARFQQRDEIS..........LLAPGQFRESASNH.
Q118T4_TRIEI/24-389YRMIIPTIILSLTV----TTLSFALNEI.IVP...SANYQASLILEKTLEQENPP..........FKEENIFYPEFGKVK
A0LEN9_SYNFM/39-391HQFFPAVVSLLLGV----TLISFVNMIF.VIP...PTGKAFEVKLRSMARSGLPV..........LMKEGTFITAIPK..
A6EGW2_9SPHI/13-364NRFLLPYFISASII----FAANLGANLY.VLP...YTNTLKNTFENTYVKKNDPS...........SKSDIHMKLDAR..
Q72LM8_THET2/4-334LALLRPLVLLALAV----SLLNLLNLAE.LRP...RSQEAYDRLLGRILYGEGGA........SGVLRRQVYAPPGL...
A3UJ93_9RHOB/6-356FQRVSPFLRLAIYV----VLVNLVINLF.VQP...ASFRLMRQQLFEIRTDLAAS..........FMREGEFVPLGDQ..
Q66F08_YERPS/5-354KSLIMAALILALFT----SGLAAINTIW.LGP...WSSKHQDVVLNDAKANPSLA..........ALGGGQFKSSNDGN.
Q4HT94_CAMUP/6-348NRVIIYPFLWALLF----CFIYIGLNFT.SFA...YANEYKRSILKNGVLNKKSS..............DIFLKFNE...
Q92FY2_RICCN/24-375VQLALPALYVALIV----MLLAYYISSN.ILP...LSHINLKSRLNFIKNNYISS..........MIEEKTFNKVTKD..
A3ZYQ2_9PLAN/6-385LAALWPGYAIALVL----SIACVWLNDI.GVS...WGSQGVRRVLVQSFEEIAYG..........MLRTHKSFSSDK...
A8A4E0_ECOHS/6-354FRIALVALVAGILW----TVSLGAIDEW.VAS...PLQQQALQIKSTATALGEDD.........DITGNMLWARRGN...
A7HYF9_PARL1/7-370WVVALPLLAIAMGT----SVIILAFSIY.IAP...AGMRELKSRLVEIRSDVATA..........MIREGTFSNPATG..
Q8DIL4_THEEB/18-374GRVLIPVVVFALLV----SGLTLALNET.AVP...IAKYESKKLMGELLQQERSL..........GSGTDIFYPEYDRHG
Q82W93_NITEU/6-348NRIIRTVFVIALPI----AILSGILSVY.ARP...WAYAESYIMDAQAEAELNTN..........RFQPGRFYGSEKSG.
A0LB31_MAGSM/6-364VRILIPFLLGGVMV----AGVQMLLLDQ.IVP...RTNAAAERSIFRMNLPEQAALYESMVSLEGVRKDNLWIRDGG...
Q6MKD0_BDEBA/11-364GTLLLPALILATLV----GVISAQMSFN.IAP...WGNRQFEVLYSRLANTKAAA..........IIKEGTFAEGFFD..
Q4HIC5_CAMCO/6-341KILAKFFLKIAALV----SALMLIIALV.MIP...IVFELQDNFVNFKKTQVKFN..........YKTGEFGQRFLE...
Q6FFD6_ACIAD/9-354WRIVGWVIRSALVL----VLLSFALSEW.VVP...YTNERANSVKSHQSVAALGE............VRGYWSREGQ...
A7ADX1_9PORP/9-487VHIMRPLIITISII----SIGAFFFQNY.AMP...VVQVKLYTLLWSMRQKSPEL..........DIPEGVFYSEITG..
Q0C1U6_HYPNA/7-346FGQMRTLIPVVFLT----AVAAAFIIDT.VGP...PASRSLLAWLGPEALQEDAQ...........VPEELWLSDGK...
Q11U59_CYTH3/9-455IRVMVPIAIWVLGC----TVGLYFFNNY.VVP...KANLKAFSLLYDLRQKKPSL..........DLKPGVFYNGIPG..
Q7P2I8_FUSNV/6-353RDILKPILAIAIGA----SIFIIFLQES.IIP...RSFIKLKYVGAKIAYENPVF..........QLKEKTFIDNLDE..
A1AWC7_RUTMC/20-369KHFMVFIQPLVIVI----VIFIFILTTV.VVP...WSKQQRGLIMERSENTPEFS..........FIKKNEFQEFKNN..
Q73NV9_TREDE/13-373SFILIPVFALGVFV----SVGSFITNDI.LIP...RGTIKFNEVLYNIASSTPAL..........ELESYSVKRNE....
A3SQ70_9RHOB/5-359LAGLAGPVAVAALV----GLVGVTMFNP.VVA...ASAKRYNDLVNGHSGLGDNV........LAISSEGLWLRQGTEEG
Q1PXZ0_9BACT/7-354YRILLPIFVVTVFM----GFASFGDQEW.IVP...RFAEKLEAMQQNTFDSDVQR..............NLLVHDDENN.
Q1VZU1_9FLAO/6-482QRAMRSLIVFILLL----GAVTFYFANT.VIP...YAEGKVLNMRKNIAQVKPSL..........AIIEGAFNDMGN...
Q1GR36_SPHAL/14-363HQVLAPLFLAALLV----AGISFAFNER.IVT...RSTAALGAWQKVEYKRVPVD.........SGVRSNIWVRDGD...
Q8G1M6_BRUSU/6-359SAVMRPILILAATV----SVTSFLIANY.VEP...YARINMRAMIANASADLMHV..........IIQEGTFRKLADN..
A5EXI6_DICNV/8-348KHLMQPILYLVLPL----AVILVINTLY.LLP...HVFERWDQLMAQSRQEALYS..........FFTPNQFQHLNAH..
Q7VQS8_BLOFL/9-358LQINLSVIKTSIFI----VLLYVIYNIW.LLP...YSQYLLCSHQHYKQYNVYLF.........PEKNKNLWLMDSGN..
Q85G79_CYAME/6-326ARWLKPSLIFGCMV----GWLAWQWNEW.ALP...LANYSLHKLQDQIQNQITSK..............ALVNQINH...
A6C004_9PLAN/10-385YRLAIPLAMATIIV----NCVMCLNQEV.IIP...SIADKLQAERGDMASSAQFV......EPVYDFSTRIMINGQE...
Q2PY37_9BACT/6-356GRLMRPYLIGAAVI----CLASASLSHF.IIP...GTNSSRIAFEEAYIQHRVTS...........RPIHLHRQVLPG..
Q310A0_DESDG/6-352LRLARFFIIYALIW----SAVQLGFSQV.LGI...YGEREASRIWKEQVRNREID.........EVQLTNLWFTEHG...
A3XBE3_9RHOB/6-359WQMARPALAFGVIT----ALMMSVLTHF.LLP...SSISQLALREQEVSRNVTAK..........LLTEGHFLHPVKG..
Q1NXF0_9DELT/6-358RRIIRPLLLAAFAC----TLLGMASSQW.LLP...PTMSELNRLWHQEVRQQENR........GIERQGRIYYRGQE...
Q2JVE3_SYNJA/13-373TRIFRPLLLVGLLM----SLSAFWISNV.LLP...ASKREIRQIDQQALLARATT..........PVQYDVFFRTARVGG
Q5SL96_THET8/6-344ERLLLPFLLLGTAI----ALAAFLLGEG.LVP...QALAKGQDLLRREVLERPRA..........LLTPGATFQDAQG..
A6EIS0_9SPHI/6-447QKAMMPLLVLITCI----SISSFFFSDY.MLP...KANLKFGSLLWDIRNKKLSF..........LIKEGVFNSSIPN..
A7NDI7_FRATF/5-351MQIVKNTLKPVVAL----TIITLITVMY.LNP...LSKQTLDIYRASLSAKALLS..........SITDQKIIKAPDG..
Q6MJL5_BDEBA/6-356IRIAVPMLLLVAVI----SALGYMAADR.VLP...RATKQKNYILYYDLKKEPHR.......FSTIRTDRIWYRSKN...
Q0F2Q6_9PROT/5-349GRMFRVFFIVVPLL----WLGLTYIAMV.QLP...QGQLGFNNILAKIYAMKGAI..........SFAPQRFTRGLDG..
A5WBH3_PSYWF/27-466GRLARLIIPLILVL----FVLEAGLSLY.GKP...WGVKNSESIWQQQSLSSAFD..........LIRPQTFINSDD...
E0TCF8_PARBH/6-360WRLIFPPVILAVAA----GLLIATTLDP.LAA...RLAETAQTVKNEARSGEEAA..........AKRPHLWLRQNEIGS
Q984S3_RHILO/7-356WQFLLPCCIGALLF----GFVSVGLINP.LAA...HAFSLSEQIETQLRSGKSNT.........VSADAAPWIRQKTSTG
Q2S3I0_SALRD/55-410YQLMRPYLGVGLLV----TVFMFGFNGW.VVP...KTNEVVVRYENEYLPGNQKS..........VQTSEIHRRNGPN..
Q1IRI3_KORVE/435-789YRVAFPVIAIAGVV----AASLFVFDQL.YIP...KANKRQETLRNEIKGKPPQT.........YLRPDRKWIFGSNN..
A3ZKX1_9PLAN/6-376ERIVRPVIIAVGLI----AILGALNREF.VVP...EYSDALSRNAQDWLGESAKQ............LQPKYDNLTD...
Q8FDM9_ECOL6/6-352GRLYKAVLYLAIPL----SIFVTLLSMY.GRP...WAYAQIYQLEQQSQSELDVR..........QLRAKKFNTNDNG..
Q054H5_LEPBL/30-383FRIVAPLILFGILM----WIVMLFVTELIVRP.....VNKLAKIEHDILTEGMGT...........LANSVYQFHVKGKE
A1WAC0_ACISJ/11-359ARIAAPYFILALFV----CVFNLYLFGR.LQP...LARYDYHVKMDAVLQTNWDA..........KIEENRFIDIAHG..
Q1CRE0_HELPH/5-350CQILSPIFLISLFF----TAVYVGLN...ATP.....FVYMEEKTQNLIYKDNSL..........SVSEHLLVKYND...
A3YF37_9GAMM/6-351WRIGWSAIKPILII----SLIGVGISEF.IAP...NADQRANLIENLKKQQTSDN..........IISGGVWIRSEE...
Q8D296_WIGBR/5-350ECFIKVILFLNLLV----MSFSFVNVMW.ISP...LALNYKHKIISYNLSNIDKL..........KLNEKQFKFIKDKN.
Q6MDI9_PARUW/8-358KTLMRPFLMIALAF----VCLLYLNEQF.VLP...STLKKLRHLENATKHQKKRQ.......LPEITVKHVVLEDRS...
Q9A939_CAUCR/5-350YRIVGMAVPAAVAV----MLLDALCGQV.LAP...RADPTLADWWRNTTPVAERK..........EPVPRTFRAGAD...
Q0SM43_BORAP/5-351TRILRPIILISVFI----SVVLFFFDNY.LVI...DTVAKRDLLIKNSIGNNGSI............DKTIIIRDLAR..
Q1D894_MYXXD/7-356SALYLPILVASFVA----CVGLVAFDER.VAT...YSGRRVDEITTQRFNKWGDW........RFYYTPKQWFRRGD...
A6CDW2_9PLAN/6-388LSLLWPSFILGGFL----SLGSLILSDQ.IIP...WAEKNIENTIACELETIFLE..........KLRSQNQIHDPTSG.
A4BIX3_9GAMM/5-349GDLLRFLLVFAALP----AMLLVLALNHYITP...KAQENLELYVTEQLNRPITD..........IIDANSFYNIGAIN.
Q1QKW5_NITHX/6-356FRLFRPFIYATVVV----ALLVAFIAAY.LAP...DGMRRLKRWDAEITADVLAN..........VLQPGRFAQLDPN..
Q5H4N0_XANOR/38-393KRMSASVVAAMALL----TASMVISGET.IGP...WAQNQADTLKASARYNSDMA.........ASLYAGLWAREGD...
A6DAN3_9PROT/6-318KTLLNPILLLAILL----TFINLFILFI.SIP...YAKMNFNNLKNEKKQEAKFN..........FQSSQVSQQFGD...
Q143Z1_BURXL/6-377NQSLRSLLKIGIPL----VLLTYLIGEV.VGP...YTDQLSERVRLEALGSSVSS..........NFESGVWVKDTLTAR
Q68VX9_RICTY/9-358WQVLIIPCIVTLIL----GIICTTLLNP.IST...IGLQKYAILEAKLTKKALSG.......GLISESGLLFFESLNEHN
A5PCY0_9SPHN/10-365GRLLRVPFLITGVL----MTLNVALVFF.IQP...VSRFTYERLEYELRSGALGA..........SIKVGEFTTLADR..
Q0FGB6_9RHOB/5-362LKGLFPVISSAFFL----GLISIFMLDPLAGKMIGYYNIKLDKLRSKEQSQVLIN............DNGYWMRQATLNG
B5EBA8_GEOBB/11-361YGLLPPPMLFAACA----TLACLWVTVY.AVP...WGNSGFKKLMVEIAQSSAGI..........AIKEKIFNNAFPG..
A4BIX2_9GAMM/6-351PALLLRLLLPALIL----LPIVYGIGEF.AAP...SWQNNAEQARALLRGEKNPT............LRGQWYKANN...
A6DH34_9BACT/8-357TKLSAPIYLFSVLV----GISLYLSSQY.LEP...YCRLKTFELNTRAESMDRSH............EFHIFTAFDGKQ.
A3I2C6_9BACT/6-354PRMLRPFIFAAMLI----GGVSFLLNGW.VLP...VATEGVTKFKLTYIDKTRTA...........SDPNVHIKVGTD..
Q2RQ55_RHORT/8-372WQLARPALALCAVL----TGVGYWLTLS.VVP...AMEGAFEAIKYEVRGEVSSL..........VIKEGQFNQMKDG..
A1WUU9_HALHL/6-348VQIAGAVLVGGVIL----ALLATAVGEL.VVP...PAERQAAAVRGLSEADELRT..........GPDGALWARDGR...
A3ZM39_9PLAN/6-376IEIIWPVLVATYAL----SFVTFGLYDV.CAG...WSRPNMHRIIIQSLDDTAYS..........MLRTQKSFSMQG...
Q0AH24_NITEC/6-352LMISLAPIGIGGGL----ITSTIALEYL.VAP...QFQQQAIVLRAVALEQSAEL..........GKGLGIWTRNEQ...
A5G1T7_ACICJ/24-378AAIARPALALAMLT----MLACWGLNVW.LVP...STLARFTHFESIIRNQVAAF..........LLEPGVFTPIPGH..
Q1NXE9_9DELT/10-360PRMLPPVVFFGLLT----GLMTLATATV.LIP...RGMTAMDQLMIHLAKEHIEE..........GIREKTFSEGLGD..
Q3B4Y3_PELLD/6-432YRLMLPVVIVGFLL----SLLVERFNNV.VQP...QVKYKARSLMSDIAKAKPTF..........GITENAFSPLVDG..
Q0BZX3_HYPNA/9-369WRFLTPVIVLGVAL----GIFSSLALNP.LAA...RLSQSFEAERARLLDVGREV........VQVAETGVWLRQGDDSS
A2U291_9FLAO/6-450QRLVRPIGILAIAL----SGLNFLFLNN.VFP...YANLKQRNLYLNIKKKKPAL..........ALVPGSFNADIPG..
Q0BKY7_FRATO/8-349AQIAKGVILVGLIG----SVTTMVFGGY.IAP...........ILQRQVDTNMVT..........YNTHDLWFKTPD...
A0LB30_MAGSM/6-357LRIFYPLSVPIVVV----TACSLYLNWF.LVP...DSHTLFQNIRVALLSQNTFS...........IKTQTFNNTIPG..
E0TCF9_PARBH/51-404LRLARPVLVLSILA----ALVSLYINAD.LQP...KTYRQLRQTVEDVRSDIAQS..........LIREGVFVQPTAQ..
Q1K323_DESAC/6-357QRIVTPFLVTAVLL----TGINFALNEF.LVP...VGTQRSNHIFRTEVKGKTQM.........LAKRNDLWFREAN...
A5EXI7_DICNV/7-348LRLSLSGLMIAFFL----GCALIVLAEYGVAP....AQNRAQWLHHHALNTTAPQ...........TDHGIWLRDGD...
B8CYZ1_HALOH/12-360YRLILPLLILGIVI----SGMTYLLNEE.IVP...WTKHRAQNIIRKSVLKEVPP..........DIKENVFFKGPDG..
Q1MPZ1_LAWIP/7-360YQMLPAPLAFSFFC----TLLTLWISLF.WIA...WGMEQFKTTLLDIARTKVKI..........SIQPGVFNNNFPG..
A3EV76_9BACT/6-358VKATKPFLALGVLI----SLISIAMNYQ.LVP...YAYQMTDYIKDVRIDQGKSG.......NVTFELNNVWFRHGNQ..
Q5X1R0_LEGPA/5-353KQLLKHSFAMATVV----LVVVAVVMIW.ASP...VIAVERTKLIRSTGIKTLVQ..........TIMPGRFHAINSGQ.
A8ZZ83_DESOH/6-356ASLFKPAAVVGVGC----CVLLLIVSEI.VVP...RTISRANYIWLQQVRQKTSS.........VDQKNNIWLKDDR...
A8EWU1_ARCB4/5-331FKILKIFLPLTLLL----TLLLLVVSVG.LIP...KSDFERKQFVNIKKNEANFN..........IKSGEFGQKFGD...
Q0F2D4_9PROT/6-348NKVLLPLSSVALLA----ALASFIIGEW.VTP...VTNTRLDQIEQVHIQHKKSS...........QPGVQWLKDGH...
Q04UA4_LEPBJ/109-561PRIYINFLAFGFVM----ALVVAYLNFY.LSP...ENTRKMNEFNKWVLAYNPLL..........AITPGQFSGDKTQDL
Q1PWZ7_9BACT/56-571RKIITPVLVIGIIF----SFFTLVLSAE.ILP...RSLYQIKLLQERAINNILAG.......RLATFQKKVLMEP.....
Q31ET4_THICR/6-346SFFQKRVFWFLVPL----AFLTAWVSLV.VTP...WSYEQERKLIMEAQTTSPLA..........ALVPGKFNPLPNGE.
A3EV77_9BACT/6-356SRLLWPLVLFAFLG----YVGSFYMSLK.AEE...TQGMSLQEMISTVLKKKMSL..........GIRPQVFNNFMDR..
Q1IZ54_DEIGD/6-380GQVARPVAVVAALV----TALAVWLSLW.VAP...RANVETRGLYWDVLTGAGLS..........QVVGKTVDLGDN...
Q1J2D3_DEIGD/10-350LRLVWPLAVPFVLV----GVLAFVNTGY.VVP...GGLARWDRAWYTIYGTVPPA..........PSQDNYTFAPPG...
Q2S0T8_SALRD/7-449GQIVWPALVVAALL----MGGMLYFNNV.MLP...EANHRARQLWSDIRGKRPGF..........ELRPGIFYEDMED..
A4A3Y2_9GAMM/5-358AKLASFTLAPALLI----MLVVAGLSLL.VTP...QGVARSEALLNDPQALQGLQ..........LLAAGRFQPRGDDG.
Q6MDI8_PARUW/7-377KDLLAPILLTAAFL----TIFNFWIVSE.VAT...QTHLQTNILKSELRSINPLL..........LLNNKHLMRL.....
B8CYX9_HALOH/6-362YKIVIPSLLVGLIM----SVTTIMVNEM.VVP...RANYLYDQIVWEIKNGRKMP..........ATQYDLTLTPLDRKY
Q1IRI3_KORVE/8-376LFFVRIVSIFSVAL----WILALVNNLY.VAP...RSAAALAHLQDKLKSSQASF..........EVQPRVFYEDFKN..
O83854_TREPA/1-358RFLIFPLLSIGLCS----ALFVFVFSDV.VVP...ASFIRLRQVYWRVLSSVPSL..........GFESHTTRKHNG...
Q8D297_WIGBR/7-348IKICILIIKTIIIF----LFIYSIILEW.IIP...IEKKIKSKYFFNFISENKKN...............LWIKINN...
Q9AA49_CAUCR/9-364TRFTAPFVAMGVLL----MVLSVILFGF.VQP...YSRYAYHAVLHAAENAGWNG..........DVRPKALLSAGSD..
Q3J9X2_NITOC/9-352GHLLRVVLTFGLAL----AIGVGGISLY.LGP...AASAEGYRLKQQALLAAETS..........GLVAGNFKEAQHGQ.
A7IJ85_XANP2/6-384WRLLRPLIILALLV----SAFCALLAIK.VVP...ASLATFREQVTKVRADVVSF..........VAQPGRFVNLSQG..
Q9TLY0_CYACA/27-394SRLFRSVLIFTSAI----CGTTWCISEI.IIP...VSSNSLQVLHRKASLCARNS.......ICSETSSGIFTNYYNSQS
Q0C1U7_HYPNA/7-360YRIVLPFVQFSLVL----AAASLLISGF.LQP...LSRYSYREIVYNLQHQSVLS..........VFQEQKFVQYDN...
Q0BVK4_GRABC/5-352RRIILSVIAFSIPL----MVILFLMAQF.VIP...PAQREAQTWRSNALPDTTAL..........RSQDSFWAYGDR...
Q5FU64_GLUOX/35-392WQFLASPLACALLT----GLLTTTGISA.LSS...TMFRSAEMLDQTYLRTGGGP........LTLNGGALWLRQSDDGL
Q5FPA9_GLUOX/26-376PALYRLLLPAVLIA----GIGGTCAQYW.LVP...ACENALTTWWNRTDPLAGQD........GQPEDNILWFRAGP...
Q1D895_MYXXD/6-362VRLLAAPMGIAVAL----SVLMLVITST.AQP...WGLTGLKVLVSEVIRKNAVG..........DVKSGVFYEDLSN..
Q9PL80_CHLMU/6-348GMIIFPILITSGIL----CCFNFYTCSE.LAS...ICRFQTGKEIANIAMTSPAL...........LLQTLQKKENDR..
A1AXG9_RUTMC/6-356MQISNIVVRAALMF----IAIVIFIGEL.VTP...ITIEYAESLRAKALGENITF..........KNQQGFWLKDSE...
Q0G6N0_9RHIZ/6-358RVILRPIIYLGLAG----GILVLTVAHG.IGP...LASSAFYNGIRSINVDTITL..........FLRPGRFERVSPD..
A6QBC8_SULNB/6-335KKVLRSILLLGILF----SVLLSTLSFL.GIP...ISKQLYNAFKEKKKTEATLN..........IIPGKLGQKFGD...
A6QBZ1_SULNB/12-355KRLFSPVFVIASLT----YAVFIYLHTT.EFS...YAKDKANMLLKNQVHAYNVN..............DMFFKYND...
Q7VQS9_BLOFL/5-358YVLIQSICMYSTVI----AILSLINLAY.LAP...HCEQYKENIFFKMKKNTYFI.........ELIEKKFYLLFDEH..
Q319A3_PROM9/28-396SRIIAPAIAVSIFM----TGLTFYFNDN.LVP...NSNKLAELTLRSGVGSSFNR.........EKSKNNIIFSRKGSRI
Q0SM44_BORAP/10-425FDLLIPFFKLGIII----VFISFISNDI.LLP...LGSIGRLKIFNEIKEEVPHL..........VLKPYSSKQYG....
A5ILH5_THEP1/6-352KNLIVPFLILGALL----SIAVFFLSDQ.IVP...EYQSKAEEAMSKYVLKKPEV..........FVVENVISKIGDD..
A6DC21_9PROT/4-336FKILKPIIYFSLFF----FILIMYLQST.KIA...YVNQYAKAIKNNMQLKNK................NLFLKYNN...
Q73NV8_TREDE/6-354GRFTLPLLVLGFFF----SVGMIFFEDN.VVI...KYFYEKTQLSKKLLQEEESL..........DTQDLVILSELGK..

PF00528

YQGH_BACSU/107-309WQTIRKVLVPAAFP----TLMTAVVLGM-ARA------------------------------------------------
YQGI_BACSU/80-293WHTVKTVLIPSAIP----SIITGAILAS-GRV------------------------------------------------
NIKB_ECOLI/116-308KQTERRHILRNASL----PMITAVGMHI-GEL------------------------------------------------
Q97UG4_SULSO/116-318NR.IRKMVYKNSLL----PNITAFAIIL-GLA------------------------------------------------
YCKA_BACSU/41-224WQTMRGIILPQSIR----IALPPLANVL-LDL------------------------------------------------
Q97VK6_SULSO/120-341RRVVYGVVLRNASI----PLVTLIALLF-GYS------------------------------------------------
Q9FAT0_VIBPA/116-319KRLICQYLIKGSLV----PTVTLHFAAF-AEL------------------------------------------------
Q44374_RHIRD/87-266QWIIRHEILPNAIT----PLLAELALRF-IFS------------------------------------------------
Q9KB56_BACHD/117-308KK.VTIHILRNSLQ----VAISIFCMGI-PTI------------------------------------------------
OPUBD_BACSU/40-211FQVLRMVELPLALS----VIMAGLRTAL-VIA------------------------------------------------
Q9LAT6_LISMN/112-304TEVAVKHAIRNALI----PLITVLGPLS-VAL------------------------------------------------
LACF_RHIRD/87-298WGRFAFLTIPMLKP----VILFTTITST-IGT------------------------------------------------
Y355_HAEIN/68-243LRLLLKVRLPAALP----AFASGLRIAV-SVA------------------------------------------------
Q982M9_RHILO/75-250AEIFWSLRLPRALP----MLFSSLRIAS-ATA------------------------------------------------
GLNP_RICPR/33-217FLIMKDIILPQAIN----NIFPSLVNEL-VNL------------------------------------------------
AMIC_STRR6/298-492KEISNKHIFKNAMV----PLVSGIPAAI-IGV------------------------------------------------
TCYB_BACSU/46-230QKTLFRVILPQAFR----VSIPPLSNTF-ISL------------------------------------------------
AMID_STRR6/125-308LKIVAKNIMPQLVS----VIVTTMTQML-PSF------------------------------------------------
NRTB_SYNE7/98-276KDYILNILIPSTVP----YVFAGLRIAV-GLA------------------------------------------------
Q9HIL1_THEAC/131-337YQ.IKSIAYKNALL----PNLTGFAMSI-GLS------------------------------------------------
Q9X0U9_THEMA/119-323RL.IRKYAYRNAIL----PQITGLAIQL-GTV------------------------------------------------
UGPA_ECOLI/90-294IRRFFKIALPLIAP----VSFFLLVVNL-VYA------------------------------------------------
SAPB_HAEIN/93-316WKILHQYVFRNTFP----LLVPQVPRVF-TLV------------------------------------------------
MSMG_STRMU/87-273LTTYRKIIFPMLKP----MHATTLIINA-LWF------------------------------------------------
OPPC_LACLS/106-293FKIMFREIWPNLST----LVIAEATLVF-AGN------------------------------------------------
Q57M02_SALCH/27-221GQTFRRIMFPAMMR----YALPGIGNNW-QVI------------------------------------------------
NIKC_ECOLI/89-273VRVFVDHLAGAVIP----SLLVLATLDI-GHM------------------------------------------------
Q9WYD8_THEMA/94-282FEVVFGDFVPYLIP----VISGGFIGSM-MGA------------------------------------------------
POTH_ECOLI/117-315LKTFFTVIVPLTKG----GIIAGSMLVF-IPA------------------------------------------------
LPLC_BACSU/93-290IGVFWRIALPLSKP----VIATFALFYA-VGI------------------------------------------------
CYST_ECOLI/74-276WQSFCKVVLPELSP----ALVAGVALSF-TRS------------------------------------------------
Q9ZBG1_STRCO/128-331GTVLVGHALRSGLL----PVLTLIGSRV-PEL------------------------------------------------
Q97UH1_SULSO/128-336KM.VASKAYRLALL----PNFTSFSISL-GYS------------------------------------------------
Q97VF6_SULSO/101-289KYIIFREVVPTLGS----YIAIHYIFNV-EAA------------------------------------------------
LACG_RHIRD/89-270WQIFFYIYVPVMRS----TYAAAFVIVF-MLN------------------------------------------------
Q9HLG4_THEAC/81-265AKLFFSYLFINSID----PVVAYAALDF-GNV------------------------------------------------
MALD_STRR6/87-275FRRFWQIVLPLVRP----MVAVQALWAF-MGP------------------------------------------------
GLTJ_ECOLI/43-239PQAYRYVLLPNAYR----VIVPPMTSEM-MNL------------------------------------------------
YEHW_ECOLI/68-240GQRVRKVELPLAAP----VILAGVRTSV-IIN------------------------------------------------
Q9FAT1_VIBPA/84-268IHVILQHAFPHLLP----QWMTGMLLLL-PHG------------------------------------------------
Q9A534_CAUCR/67-247LQRLVRLRLPSAVP----ALLEGHKVAA-GLA------------------------------------------------
YEJB_ECOLI/151-361KNILWKHVFRNAML----LVIAGFPATF-ISM------------------------------------------------
YOR2_CALSR/83-265FRLYSDILLPLSAP----ALITVGIYNG-TYL------------------------------------------------
O66777_AQUAE/114-319FT.LVRHVLKNAMN----PFTTLLGYEI-ASL------------------------------------------------
YEHY_ECOLI/195-381AQRFLHVQLPLALP----VFLRSLRVVM-VQT------------------------------------------------
Q9WXN6_THEMA/92-279LRLVIEDLIPTIAT----YAFMSFVLFI-NGG------------------------------------------------
Q9Y9N0_AERPE/121-339SRIAV.HMLRISLI----PTITMMGLQF-AIL------------------------------------------------
Q9WY46_THEMA/67-238RMILKEVYLGSIWP----FVLSILEVSS-GNV------------------------------------------------
Q9Z6P7_CHLPN/68-243FQLLIKLRIPHALP----HIFSGLKIAI-GSA------------------------------------------------
GLNP_SHIFL/33-218WETIRYVILPLALR----RMLPPLGNQW-IIS------------------------------------------------
Q98K60_RHILO/105-289SQTFWKLRVPASVP----FLFTSMKVAV-AAS------------------------------------------------
UGPE_ECOLI/91-278MRFFCDIVFPLSKT----NLAALFVITF-IYG------------------------------------------------
OPPB_LACLS/113-318KVIFRRHILRNASL----PIASNFGFVI-TGL------------------------------------------------
Q49553_MYCHO/234-419PRRIFVHALPTIIG----KIANNIVRSV-PGV------------------------------------------------
FBPB_SERMA/341-526AQALWSTTLRLAAP----GVAAGAALVF-LAI------------------------------------------------
Q987J0_RHILO/100-280AYLIGSEILPNIIR----PVLADFGLRF-VFI------------------------------------------------
Q9CLG9_PASMU/73-248SAMLFKVRLPAALP----SFASGLRIAV-SVA------------------------------------------------
Q9PPS8_UREPA/183-374NRFVWLHALKPSLF----PIATFFPFVI-LGS------------------------------------------------
PSTA_ECOLI/101-295WKMISAITLKASVS----GIMTGILLAI-ARI------------------------------------------------
Q98QF6_MYCPU/174-365NGFVWKHALKASLF----PIATFFPAVV-LGS------------------------------------------------
MALC_STRR6/209-434WQKFRNITFPMILA----VAAPTLISQY-TFN------------------------------------------------
LPLB_BACSU/104-314FRRMWHITLPAIRS----TIIVLLILRI-GSF------------------------------------------------
YHDY_ECOLI/173-362WKTQGLVILPQALK----LVIPGLVNTI-IAL------------------------------------------------
B3XCM3_ECOLX/104-273LEEILYGVLPQVMP----LLISYSLYRF-ESN------------------------------------------------
Q9AKQ9_RHIML/112-306RAVVVTHAMRGAML----PVVSYLAPCA-AAL------------------------------------------------
Q97YP1_SULSO/131-332ST.VRAIARRNSII----PVITRTGIDL-AFI------------------------------------------------
O28506_ARCFU/135-354RKVVF.HAMKNAFI----PVVTLMGLQF-AIL------------------------------------------------
Q98K61_RHILO/75-251WPTLIKLRLPAAAP----FIFNALKINS-TLA------------------------------------------------
AMYC_THETU/83-269FRIYWNIILPLLNP----TTITLAVLDI-MWI------------------------------------------------
Q9ZGP1_STAAU/117-308IT.LMLHVLRNALQ----VAVSIFCMSI-PMI------------------------------------------------
Q9EWP8_STRCO/101-281RAVLRHDVLPNIAG----PALMDTALRL-VAS------------------------------------------------
Q9KKK5_VIBCH/118-310EQAFTRHAQRNIAL----PVMAFVGIQA-VSL------------------------------------------------
YEJE_ECOLI/158-341RSIILRHMLPNAMV----ATLTFLPFIL-CSS------------------------------------------------
O86691_STRCO/402-574VHLLRHELLPAVVP----PVLRHALLRL-PGV------------------------------------------------
Q98QS7_MYCPU/195-382LRIIYLEALPQIIG----KLTNVYLNRI-IGG------------------------------------------------
AMYD_THETU/85-290WQQFRNVVFPLIAP----AFTVSLFITL-SNS------------------------------------------------
O34157_SALTM/115-319WSLLRHQVLRHAIT----PALCLQFASL-GEL------------------------------------------------
Q9PL65_CHLMU/67-242WQTLIKLRIPHGLP----HIFSGLKIAM-SAA------------------------------------------------
Q9RX04_DEIRA/318-494WQRLTRLELPGALP----VMLGGLRLAA-SLA------------------------------------------------
SSUC_BACSU/94-269HQQISKVILPAALP----NILLGIRLSL-GIA------------------------------------------------
Q9UYG7_PYRAB/121-325KL.LTKHAYRNAIL----PQVTGLALQL-GLM------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------MLILCI------------------------------------------------------------
A5MAB6_STRPN/576-675--------------LVLSSI------------------------------------------------------------
Q9L651_LACLL/549-647--------------IGMIFI------------------------------------------------------------
A5M6X5_STRPN/166-265--------------ASLFIL------------------------------------------------------------
Q931U7_STAAM/555-653--------------GILTNV------------------------------------------------------------
Q8CY97_STRR6/155-254--------------FVASVF------------------------------------------------------------
Q6GIZ0_STAAR/545-643--------------AYTTHI------------------------------------------------------------
Q926X5_LISIN/619-718--------------GVVTFI------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------LAIASL------------------------------------------------------------
Q9KG35_BACHD/612-712--------------LGIALY------------------------------------------------------------
B9WU46_STRSU/561-660--------------MGLAMF------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------FAFALS------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------GILIFI------------------------------------------------------------
Q896P1_CLOTE/604-706--------------ATSVFI------------------------------------------------------------
Q892J9_CLOTE/609-706--------------VITSII------------------------------------------------------------
A8AXA7_STRGC/592-691--------------SVLIFF------------------------------------------------------------
Q9CE29_LACLA/560-659--------------LPTLTI------------------------------------------------------------
Q181M6_CLOD6/617-718--------------IGIIST------------------------------------------------------------
A7GNK2_BACCN/616-716--------------TISMYV------------------------------------------------------------

PF02687

O50782_BORBU/276-402--------------YFAKLF------------------------------------------------------------
A3I1M1_9BACT/289-407--------------YLFAPK------------------------------------------------------------
A7VH46_9CLOT/421-541--------------YSSLGV------------------------------------------------------------
A8ABZ3_IGNH4/248-373--------------TAVAIS------------------------------------------------------------
Q9F443_STRSL/517-633--------------SMLLIF------------------------------------------------------------
A7H0E4_CAMC5/307-422--------------YALSYV------------------------------------------------------------
A3UQ03_VIBSP/269-395--------------VALAMN------------------------------------------------------------
A5Z5I3_9FIRM/662-784--------------FPISIV------------------------------------------------------------
A8H349_SHEPA/695-810--------------EFTLYL------------------------------------------------------------
Q9WZG5_THEMA/725-844--------------YFVSEA------------------------------------------------------------
Q9FBP3_STRCO/657-772--------------LTLGTV------------------------------------------------------------
Q2CDR4_9RHOB/175-297--------------MLGIFL------------------------------------------------------------
A6DHZ0_9BACT/321-438--------------SCFNTP------------------------------------------------------------
A5ZCK7_9BACE/250-369--------------ILSSGM------------------------------------------------------------
O28455_ARCFU/275-396--------------FFASQL------------------------------------------------------------
Q481M7_COLP3/705-820--------------MLIY..------------------------------------------------------------
A4YKC0_BRASO/734-849--------------SVSAWL------------------------------------------------------------
Q0HRW4_SHESR/279-392--------------IQLGQQ------------------------------------------------------------
A7AZK1_RUMGN/757-876--------------FLIAAV------------------------------------------------------------
Q64W75_BACFR/294-427--------------WGLLVL------------------------------------------------------------
A8AR20_CITK8/231-351--------------EILVMR------------------------------------------------------------
A3UCF7_9RHOB/264-386--------------FVFDGV------------------------------------------------------------
Y684_MYCPN/989-1110--------------FLLERQ------------------------------------------------------------
Q2RPK1_RHORT/279-403--------------LAFQAL------------------------------------------------------------
A6H1M7_FLAPJ/284-410--------------LLLIQK------------------------------------------------------------
A8G4C7_PROM2/272-386--------------QILYSV------------------------------------------------------------
A0PQZ2_MYCUA/174-295--------------FVRAMF------------------------------------------------------------
Q4QBC9_LEIMA/977-1097--------------TAVGVT------------------------------------------------------------
Q025M3_SOLUE/351-471--------------FWARRP------------------------------------------------------------
Q54MT9_DICDI/545-666--------------QIFLFI------------------------------------------------------------
Q6MGV4_BDEBA/659-778--------------YGLSYL------------------------------------------------------------
A6L8W9_PARD8/653-767--------------YFMKDW------------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644--------------IIAMEI------------------------------------------------------------
A4CDR0_9GAMM/687-801--------------YWLTDN------------------------------------------------------------
Q01VW7_SOLUE/1278-1396--------------VAVAAT------------------------------------------------------------
A3I5H5_9BACI/646-767--------------IKLIPL------------------------------------------------------------
A5USK7_ROSS1/311-433--------------LLLAHV------------------------------------------------------------
Q9A6K3_CAUCR/352-465--------------WGVSLL------------------------------------------------------------
Q72UY4_LEPIC/260-379--------------NILLKW------------------------------------------------------------
Q5V3A9_HALMA/874-995--------------VLALQL------------------------------------------------------------
Q8NS27_CORGL/613-739--------------WIAALL------------------------------------------------------------
B1JTM3_BURCC/259-376--------------PPAASL------------------------------------------------------------
A7AFS2_9PORP/465-579--------------YFVAEH------------------------------------------------------------
A8F9W5_BACP2/316-420--------------FILG..------------------------------------------------------------
A8HA97_SHEPA/673-786--------------ILLESY------------------------------------------------------------
Q97DB8_CLOAB/716-835--------------SLMIHV------------------------------------------------------------
A6F274_9ALTE/258-378--------------LPLYWL------------------------------------------------------------
A7HK62_FERNB/257-383--------------RYLLYK------------------------------------------------------------
B8FRQ9_DESHD/291-412--------------TMNYLA------------------------------------------------------------
A1TXE6_MARAV/183-306--------------RALSLV------------------------------------------------------------
Q93H51_STRAW/242-364--------------AYGAPR------------------------------------------------------------
Q54290_STRHY/294-451--------------PRLTQS------------------------------------------------------------
Q830M8_ENTFA/579-698--------------TFAIYL------------------------------------------------------------
Q81N14_BACAN/248-369--------------VISKRF------------------------------------------------------------
A7B7J6_RUMGN/273-419--------------NAAAWG------------------------------------------------------------
Q5LCL1_BACFN/272-387--------------ACLPHF------------------------------------------------------------
Q9KF85_BACHD/539-650--------------AYI...------------------------------------------------------------
A3D8C2_SHEB5/283-407--------------LQLSHW------------------------------------------------------------
A1SKN4_NOCSJ/300-416--------------LLGVWA------------------------------------------------------------
A7VFS5_9CLOT/263-395--------------FLIAKC------------------------------------------------------------
Q5JEM5_PYRKO/203-318--------------ILLGSR------------------------------------------------------------
A7VIB2_9CLOT/622-743--------------QVAISG------------------------------------------------------------
Q8G7P9_BIFLO/320-438--------------AFAANP------------------------------------------------------------
Q735D4_BACC1/728-843--------------LAFSGI------------------------------------------------------------
A6BFN6_9FIRM/685-806--------------LPLGYA------------------------------------------------------------
A4CAI1_9GAMM/683-798--------------LVMAYY------------------------------------------------------------
A3ZPC9_9PLAN/633-758--------------ILMALL------------------------------------------------------------
A9KQT2_CLOPH/343-506--------------TVVAQP------------------------------------------------------------
A1ZGZ7_9BACT/274-392--------------FGLVYY------------------------------------------------------------
Q6F1V8_MESFL/1691-1810--------------SMMIQA------------------------------------------------------------
Q601V9_MYCH2/401-522--------------LGTMPY------------------------------------------------------------
B8G588_CHLAD/255-383--------------LLASQG------------------------------------------------------------
Q04L09_STRP2/60-182--------------ALFDKL------------------------------------------------------------
Q048H0_LACDB/280-404--------------SYSKML------------------------------------------------------------
A4BXN0_9FLAO/168-283--------------SVVVYY------------------------------------------------------------
Q9PPU7_UREPA/163-284--------------YEIQPL------------------------------------------------------------
A5LLD1_STRPN/291-413--------------YLLASV------------------------------------------------------------
A6TSQ0_ALKMQ/264-387--------------IGILYL------------------------------------------------------------
A7VD43_9CLOT/805-930--------------AAATAL------------------------------------------------------------
Q8RTI8_9GAMM/277-411--------------LWGHYY------------------------------------------------------------
A5N346_CLOK5/473-593--------------LFISKF------------------------------------------------------------
Q053J3_LEPBL/252-373--------------FLFSKL------------------------------------------------------------
A7H957_ANADF/284-394--------------TAWAPV------------------------------------------------------------
A1SH34_NOCSJ/769-890--------------WAMSRM------------------------------------------------------------
A6LCJ9_PARD8/285-395--------------LVYEGC------------------------------------------------------------
B8I8J6_CLOCE/296-424--------------AVLVNM------------------------------------------------------------
Q6AA47_PROAC/602-722--------------VLAGWA------------------------------------------------------------
Q4MWW1_BACCE/235-351--------------EIFSGT------------------------------------------------------------
A6NZ14_9FIRM/176-297--------------WGVYSL------------------------------------------------------------
Q6MT15_MYCMS/562-682--------------IPIQIY------------------------------------------------------------
A4VW57_STRSY/998-1117--------------IYLHKL------------------------------------------------------------
Q18EP9_HALWD/299-419--------------IGGIYA------------------------------------------------------------
Q8EUA2_MYCPE/1360-1480--------------FAMTSV------------------------------------------------------------
A5MD01_STRPN/302-451--------------NYTARA------------------------------------------------------------
Q47EZ3_DECAR/243-372--------------YVHVFH------------------------------------------------------------
Q034M7_LACC3/404-519--------------VAATIM------------------------------------------------------------
A3I2Y5_9BACT/746-861--------------LILISS------------------------------------------------------------
Q0RJL1_FRAAA/639-753--------------FLAAGL------------------------------------------------------------
Q7UPA2_RHOBA/581-706--------------VAYAWA------------------------------------------------------------
Q8A9F6_BACTN/266-381--------------ISTGFI------------------------------------------------------------
A4C0M9_9FLAO/275-395--------------IGLGFM------------------------------------------------------------
Q14QM1_SPICI/154-274--------------QLLWNV------------------------------------------------------------
Q97LN0_CLOAB/737-854--------------IIFSWL------------------------------------------------------------
A3ZPB7_9PLAN/791-914--------------VMAGWC------------------------------------------------------------
Q737Y3_BACC1/256-376--------------LFVTKI------------------------------------------------------------
A7VDT8_9CLOT/311-424--------------YLTFPL------------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923--------------FFGKIP------------------------------------------------------------
Q899W1_CLOTE/250-369--------------HLLIPF------------------------------------------------------------
Q4DFN5_TRYCC/444-565--------------VGLNAL------------------------------------------------------------
A7ADY9_9PORP/281-400--------------ELTAGG------------------------------------------------------------
A7ADZ2_9PORP/274-398--------------EWIVPV------------------------------------------------------------
Q2SRI5_MYCCT/367-490--------------CLISII------------------------------------------------------------
Q71YS2_LISMF/59-181--------------IFSSKL------------------------------------------------------------
Q638M9_BACCZ/706-820--------------ALLTYM------------------------------------------------------------
Q8KD33_CHLTE/268-389--------------AWLGSA------------------------------------------------------------
A7GNK2_BACCN/187-299--------------SIYSLL------------------------------------------------------------
A3JAL8_9ALTE/692-813--------------VWLTWV------------------------------------------------------------
Q6F163_MESFL/1281-1400--------------VIFWKI------------------------------------------------------------
Q6AMB4_DESPS/278-415--------------LLIAWY------------------------------------------------------------
A7K544_VIBSE/291-411--------------YAILAI------------------------------------------------------------
Q2SSK7_MYCCT/644-765--------------TILQVP------------------------------------------------------------
A3QAU8_SHELP/312-429--------------WGALYA------------------------------------------------------------
Q6F1W1_MESFL/1301-1420--------------KAVNIM------------------------------------------------------------
A6LZM8_CLOB8/286-398--------------ENCG..------------------------------------------------------------
A7VI29_9CLOT/290-409--------------LLAKYF------------------------------------------------------------
Q6UCA9_BACFG/30-146--------------FQFQEK------------------------------------------------------------
Q2ST97_MYCCT/1669-1788--------------FSSTTI------------------------------------------------------------
A7AE18_9PORP/286-404--------------HDLIPV------------------------------------------------------------
A7V9H5_BACUN/291-408--------------INMVMA------------------------------------------------------------
Q6GDI1_STAAR/59-180--------------YLLGAI------------------------------------------------------------
A8FMY2_CAMJ8/150-267--------------AFFTQI------------------------------------------------------------
A7ZGQ8_ECO24/256-370--------------FVILVV------------------------------------------------------------
A7VI30_9CLOT/297-409--------------FIYIR.------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355..............RFISIG..AFNPINE.....SLNNV..SIERL...........SG..ATMIS..............
Q1CSH4_HELPH/4-343..............WLVYVD..KAENN.......SYDNL..VLFSN...........KS..LSQES..............
A5TUK8_FUSNP/11-360..............YLYLMG..KINRETG.....VAENI..EIVKFE..........NE.ISKPKE..............
Q4UQP7_XANC8/6-349..............GVVYLT..TISPDGK.....GLGKV..FMQRQ...........KD..DRID...............
A4N619_HAEIF/7-355..............HFVFVR..RVTDDTK......LDDI..YIYTFD..........QQ..HNLIK..............
A4JGZ3_BURVG/5-348..............RVFFIE..KMSPDQS.....KVQNV..FVTSTE..............NGKVN..............
Q118T4_TRIEI/24-389QPDGSQDDTLT...RLFYAE..KFDGK.......YMQGV..TILDR...........SQ..YGVDQ..............
A0LEN9_SYNFM/39-391..............LTFFFQ..SVNPTEL.....SVRGI..FVQDR...........RE..EKVRL..............
A6EGW2_9SPHI/13-364..............TYIYMR..SFDNKNKTGAQFSLDNF..................NG..DEMTR..............
Q72LM8_THET2/4-334..............GVYFAE..EVYPEPE...GNRLRGV..RVVDER..........GR.....................
A3UJ93_9RHOB/6-356..............VTFYVR..EISDDSV......LNDV..FIMD............DR..TGQSA..............
Q66F08_YERPS/5-354..............SALFIG..NVAGK.......EFNRV..FLAQLRP.........NG..NQRPS..............
Q4HT94_CAMUP/6-348..............EFVYVK..SLDEGLA.......KEL..KIFSL...........KD..GNLSH..............
Q92FY2_RICCN/24-375..............ITVFID..KKSAGNI......MNGV..IIFDN...........RN..ADNPS..............
A3ZYQ2_9PLAN/6-385..............LSILVR..EVDGRRL......MRPQ..IVAAA...........TP..TSPQL..............
A8A4E0_ECOHS/6-354..............EFVTVK..SLNEQGQ......PVGV..EIFHYR..........DD..LSLES..............
A7HYF9_PARL1/7-370..............LTVFVR..ERAADGT......TYGV..LVHDG...........RI..PSAPV..............
Q8DIL4_THEEB/18-374NVR...........RLYYGH..RFDGS.......RIQGI..TVLDF...........SQ..PQVTQ..............
Q82W93_NITEU/6-348..............RVIFIR..GKDDLEK.....RMEGV..FHYI............RT..TEDRE..............
A0LB31_MAGSM/6-364..............QILHAK..RAYGDKR.....LLLEV..TIFRFT..........PE..HDLLM..............
Q6MKD0_BDEBA/11-364..............MVIYAN..EVNTDKG.....LLKKV..FIYDE...........KN..GDVPL..............
Q4HIC5_CAMCO/6-341..............WMIFIE..KQESD.......RYENI..IMYHPKR.........NI..EDKEQ..............
Q6FFD6_ACIAD/9-354..............RFIYVD..YANSQGQ......LKRI..QVVDFD..........DN..YRLKS..............
A7ADX1_9PORP/9-487..............FNVYVK..HKDTETG.....LLRDM..MIYDYS..........EG..FNKVS..............
Q0C1U6_HYPNA/7-346..............FLIELK..SMQAE.......ELTGI..TIFERN..........AE..GAVVA..............
Q11U59_CYTH3/9-455..............YSIKIV..QKFDNDS.....SIKGV..IIYDHT..........QS..RGNTD..............
Q7P2I8_FUSNV/6-353..............YSIYVD..KVSSDGK......AKNI..IAFEKPE.........DK..NKFPM..............
A1AWC7_RUTMC/20-369..............DIVFYA..SKVSDADNAKEQNMEEI..FIYTLV..........NN..EPVIT..............
Q73NV9_TREDE/13-373..............NSIVVS..GLIKDNS......IHDL..LIIDS...........SQ..RGAKR..............
A3SQ70_9RHOB/5-359Q.............TVIHAK..SATPDLS.....TLFGA..TFTSFT..........PE..GDPMR..............
Q1PXZ0_9BACT/7-354..............ALIRIW..KYSNKTQ.....KMDSV..FILSRD..........EN..GKKRF..............
Q1VZU1_9FLAO/6-482..............INIKVN.KKSGPDGR.....NLDDV..IIHKKSE.........NR..VGNYT..............
Q1GR36_SPHAL/14-363..............DLINAE..TVETSGP...AVVLRGV..TIYER...........TR..GVLSS..............
Q8G1M6_BRUSU/6-359..............LYIQVA..ERRADGS......IGGL..FIADS...........RD..PTLDL..............
A5EXI6_DICNV/8-348..............NTLYTG..DKINNG.......FQPF..IIIQ............ND..NNEYS..............
Q7VQS8_BLOFL/9-358..............SFIHVN..YMLTTQD......LLGI..NLYHFT..........EE..RQLKR..............
Q85G79_CYAME/6-326..............KLIYVK..EWKPL.......HMNHC..VMWD................SEMNQ..............
A6C004_9PLAN/10-385..............VFLTEQ..KMKNAEF.....VLSKP..MVHDFV.................................
Q2PY37_9BACT/6-356..............HFIYVE..TWSPDRMGGYNFTYEHF..................EQ..GRMVD..............
Q310A0_DESDG/6-352..............RIIHLE..TLHPAAQ.....KGSGI..TVYELTP.........DE..LSVQR..............
A3XBE3_9RHOB/6-359..............VTFYIR..QIDSNGT......LNDV..FLSDR...........RD..PNQTM..............
Q1NXF0_9DELT/6-358..............GIYSFR..PAADSEN.....RLADF..SYLTWD..........RD..YRLAQ..............
Q2JVE3_SYNJA/13-373TEDN..........LWFFIR..QVDPRLN.....TMQDV..TILQVDPLPG......GK..YQLAE..............
Q5SL96_THET8/6-344..............RVVYVG..KVEGE.......AIGAL..RVLSR...........EE.....................
A6EIS0_9SPHI/6-447..............YSIRVD..KKGADGV.....TLHNV..MIYDHT..........SN..NGIAK..............
A7NDI7_FRATF/5-351..............KIIHIG....NKSGN.....TLSDV..FLYQNT..........PQ..DGEYK..............
Q6MJL5_BDEBA/6-356..............SIFNIK..TLNAKGD.....GAQGL..TMYFFS..........DE..WDLVQ..............
Q0F2Q6_9PROT/5-349..............ITVYVD..GEDSEGT......YHGL..ILEDHR..............GGVSV..............
A5WBH3_PSYWF/27-466..............YHLYVG..SMNDNKT.....ELQDV..ILIQTAKDAAKSVKPGATVPEATTNAPAVRLGQQELEGS
E0TCF8_PARBH/6-360DGI...........ALLHAE..RYRENDP.....VLEEV..TVWRRT..........QD..GAFIE..............
Q984S3_RHILO/7-356D.............TIIGAR..AILNQGL.....EMSDAVFFVLD............QQ..GNIVE..............
Q2S3I0_SALRD/55-410..............SILSVG..YYDADRE.....RAHTV..SLQQLA..........GD..ARLAR..............
Q1IRI3_KORVE/435-789..............TIYYYE..VYDADQN.....RFGGI..SIFQFDP.........KT..FALQS..............
A3ZKX1_9PLAN/6-376..............VLISGN..HTFANEL.....RIEAPKFRLPR............SQ..PGVGT..............
Q8FDM9_ECOL6/6-352..............RMILSQ..TVDQDNN.....RLTDA..LIYTST..............ANRTR..............
Q054H5_LEPBL/30-383..............GFYYLY..FYDPNKD.....EINGGFNYIRLR...........ND..GSPET..............
A1WAC0_ACISJ/11-359..............FSFSAD..RVEDGGR.....RFIGV..FMER............RQ..NGIEE..............
Q1CRE0_HELPH/5-350..............DYVYFD..KINPLLQ.....KAQNI..KVFRL...........KD..RTLES..............
A3YF37_9GAMM/6-351..............KYIFIG..AADQKGT......LYNV..KVFNS...........KN..QTLQS..............
Q8D296_WIGBR/5-350..............IILFVD..NIKDK.......NLKNI..FIVKFILK........NK..EYIPV..............
Q6MDI9_PARUW/8-358..............LLLYQN..YDSEKEEFFDVYWIESI..................DS.....................
Q9A939_CAUCR/5-350..............LVIGAN...ASADGR.....TITGV..TIFRRD..........SK..GILVE..............
Q0SM43_BORAP/5-351..............EIYNIK..SYDIDEN.....AFSNL..MIIIKD..........SK..DEFQT..............
Q1D894_MYXXD/7-356..............NIFFLR..GGSAQEG......FQDV..SVFTVT..........ES..FDLQR..............
A6CDW2_9PLAN/6-388..............ISITVM..GVRNKTLLVPTFRYSPP..................NK..KPVHL..............
A4BIX3_9GAMM/5-349..............ATFYAA..RNNSQTQ.....SLEDV..FTIAKS..............QSSYT..............
Q1QKW5_NITHX/6-356..............LTIRVR..ERQPGGL......LVGI..FIDDR...........RN..PNERL..............
Q5H4N0_XANOR/38-393..............TFLNALSGEEKLLDGGDTALDLHDV..RLYHLD..........SS..GRMQQ..............
A6DAN3_9PROT/6-318..............WVIFAN..KGKNN.......SFTKI..YLYSPKE.........NK.....................
Q143Z1_BURXL/6-377ADGEQVT.......RFVNVG..ELKPDAT......ISNV..RIYEFD..........SK..FRLSN..............
Q68VX9_RICTY/9-358..............QIIQTQ..FIDVAEQ.....KLNNI..TILFID..........NN..NSFLK..............
A5PCY0_9SPHN/10-365..............MALRIE..ESEDDGR.....QLKGI..FARVA...........ND..KGQVL..............
Q0FGB6_9RHOB/5-362H.............QIIKAV..NVSNNGQ.....RLHQV..TIFNYD..........EN..GLVTE..............
B5EBA8_GEOBB/11-361..............MVVYTQ..SLDTKAQ.....TMGGV..IVHDE...........RD..PRTPT..............
A4BIX2_9GAMM/6-351..............EYVNVE..FISNETE......LTGI..TRFQMN..........PQ..KQLMA..............
A6DH34_9BACT/8-357..............KRKWAV..SSDEDNN......FSAI..QILEYD..........EN..NNLTR..............
A3I2C6_9BACT/6-354..............SYAYLS..RFYKTGNTGYHFTLETI..................RD..GRLIN..............
Q2RQ55_RHORT/8-372..............LIVYAG..ERAKDGR......LIDL..MIHDT...........TG..KTSDL..............
A1WUU9_HALHL/6-348..............DFLRAE..RPRSASH......LESV..TLYRF...........VE..GQLTE..............
A3ZM39_9PLAN/6-376..............FSVRVK..GVDDRRL......IEPF..ITVQT...........PN..GGPEF..............
Q0AH24_NITEC/6-352..............NILRIG..EMLHKGR......AIDI..EVMHFD..........KQ..GLMTA..............
A5G1T7_ACICJ/24-378..............ITVYVQ..RRDHDQV......LHGI..VIQDA...........RQ..KGEPA..............
Q1NXE9_9DELT/10-360..............VVLYVD..DISPDQR.....FWHGV..YLSDL...........RD..KDNPL..............
Q3B4Y3_PELLD/6-432..............YSILVQ..HADEKTG.....SIGDI..IIYDA...........TR..KDYRS..............
Q0BZX3_HYPNA/9-369Q.............YVIHAR..RVEDGGR.....TLLDV..KIIEEQRLYNGRQPT.ND..FAFVR..............
A2U291_9FLAO/6-450..............YQIKFD.EKYGEEEN.....LLKKV..WIYDLT..........SN..RGNQK..............
Q0BKY7_FRATO/8-349..............GFMNIA..NIEPTNG.....KAYGIRKFMV.............QD..NKVRE..............
A0LB30_MAGSM/6-357..............LTIYVN..RQSHGGK.....LLEGL..LIHDE...........RD..PDMPV..............
E0TCF9_PARBH/51-404..............ITVFAQ..EVRPGGQ......FIGL..FINDS...........SD..PRETK..............
Q1K323_DESAC/6-357..............TLYHIQ..LALPEKK.....QLRGI..SLYLVD..........SQ..LNLLT..............
A5EXI7_DICNV/7-348..............NIVYIG..AFQADGS......LEKI..RFYRP...........HE..HDLE...............
B8CYZ1_HALOH/12-360..............RLFYVG..RFDKEDN.....IMKKI..VVYTFK..........GD..NGYPL..............
Q1MPZ1_LAWIP/7-360..............FVLFAR..QVDPLSG.....ELHQI..LLEDR...........SQ..KDRHL..............
A3EV76_9BACT/6-358..............DIYGAR..TIRDGGN.....ELDKV..VLYHLD..........RT..FHLSW..............
Q5X1R0_LEGPA/5-353..............QIFYVQ..SMNRDHS.....QAEQI..FMAKHSVQ........DN..RLLWD..............
A8ZZ83_DESOH/6-356..............TIVHIR..HYQPREK.....KAFDV..VLHDLD..........EG..FRVTR..............
A8EWU1_ARCB4/5-331..............WLIFIN..DKKNN.......LYEDV..KLLKVQ..............KDNDQ..............
Q0F2D4_9PROT/6-348..............RFFRLT..PLTNHQF........AL..LMLKTA..........PD..GAWLQ..............
Q04UA4_LEPBJ/109-561FEKRA.........RTMYTD..GMNSDTG.....QLKGV..QIREWEIFLEGNEYFNLG..GKMIPMGGSRIIQ......
Q1PWZ7_9BACT/56-571..............YQIYIG..NVVDNIN.......KDV..TVIQY...........AD..DYVTD..............
Q31ET4_THICR/6-346..............GIFYTR..SIKSNGD......LESV..WVRLNT..........DE..RDILL..............
A3EV77_9BACT/6-356..............FVIYVD..RMPTFSR......MQGV..FIYQEG..........KG..KSPST..............
Q1IZ54_DEIGD/6-380..............LTLWLG..GYDAAGR.....KLQNV..RVERWAK.........DD..PQRTT..............
Q1J2D3_DEIGD/10-350..............ALFYAG..RVRNGAE.SGVAQLDGV..LIERG...........GE.....................
Q2S0T8_SALRD/7-449..............YSILVQ..DRPPGTN.....KLIDV..TIYDYT..........QG..RDRQA..............
A4A3Y2_9GAMM/5-358..............TVTYAA..DIDPEAG.....ELDQV..FLYAPEDRT.......AD..TEVAG..............
Q6MDI8_PARUW/7-377..............KGLYFD..SLGPSRV...GEMATDAVFAIPSQHHQRINLFIAKQL..KASSS..............
B8CYX9_HALOH/6-362RRPD..........YILYTH..RFNGETG.....IMNDV..YLQDY...........EK..GVPVT..............
Q1IRI3_KORVE/8-376..............YVLYVE..DSKSGSG...SALWRGV..FLADV...........ST..PSQPK..............
O83854_TREPA/1-358..............VILSVG..EVFHS.......VMYQL..LIVDK...........SD..SRSLK..............
Q8D297_WIGBR/7-348..............NFILIK..KIVDFDF......IQGI..YIYEFN..........KF..NEIKY..............
Q9AA49_CAUCR/9-364..............FFLTAD..RTDASGR.....YLQQV..FIRRI...........DP..NGRED..............
Q3J9X2_NITOC/9-352..............RVFYAE..SLTEDGL.....GMKNV..FIQVWE..............PTQKT..............
A7IJ85_XANP2/6-384..............LVFHVR..ERAPNGV......MRGI..FINDA...........RD..DGVS...............
Q9TLY0_CYACA/27-394KKAPLKELK.....GVLYIK..HFNHLNA.......YQL..IYLDF...........NN..ENLKQ..............
Q0C1U7_HYPNA/7-360..............RIIWTD..SVLPGGR......LGQT..FILES...........EP..DGART..............
Q0BVK4_GRABC/5-352..............HFLNIQ..HFEHHDE......PYNI..DIFSFA..........PD..GELHR..............
Q5FU64_GLUOX/35-392VPHGV.........AILHAQDVHLIDGAL.....KVSGV..SIFRLD..........DR..DRLIV..............
Q5FPA9_GLUOX/26-376..............TLVRIG..QIAQGGT.....FLRDV..TIYHRD..........NT..GLLTG..............
Q1D895_MYXXD/6-362..............LTLYAE..QVSADGK......WTNV..LLHDD...........RE..ANSPL..............
Q9PL80_CHLMU/6-348..............IFIAID..HCGKS.......KFDNVIIALKHNQEI........SN..IGFVE..............
A1AXG9_RUTMC/6-356..............LFIHVK..KNFDGKS......FQDV..TLIKLR..........AP..DTLDS..............
Q0G6N0_9RHIZ/6-358..............LVISVG....ESNGS.....IIESL..FIQDT...........RD..PNLDL..............
A6QBC8_SULNB/6-335..............YYIYVK..EKDEKSK.....LFHDM..VIYNR...........TK..KDAEQ..............
A6QBZ1_SULNB/12-355..............TFVYIK..KLNPIVK.....KIKGI..TIFKV...........AG..YQVRY..............
Q7VQS9_BLOFL/5-358..............LVLFID..NIKNG.......MLNHV..FILKRV..........QNIDKNVFS..............
Q319A3_PROM9/28-396DTNNKPTKTNTFLTHIFYAS..RFENN.......TMREV..TVLDF...........SR..VNIKQ..............
Q0SM44_BORAP/10-425..............DLIFVS..GEKSENG......YKNV..TFFDNT..........RL..KGFDR..............
A5ILH5_THEP1/6-352..............QYFYVE..KYDERTS.....TMWNV..VIFRY...............GHEET..............
A6DC21_9PROT/4-336..............SVVYIK..ELNPILK.....EAYDV..KIFVV...........KD..NKLIK..............
Q73NV8_TREDE/6-354..............IVYTAD..YFNAENQ.....TLANA..YIIVRD..........ED..GNLSL..............

PF00528

YQGH_BACSU/107-309--------------.FGEAL------------------------------------------------------------
YQGI_BACSU/80-293--------------.FGEAA------------------------------------------------------------
NIKB_ECOLI/116-308--------------.IGGTM------------------------------------------------------------
Q97UG4_SULSO/116-318--------------.ISQSL------------------------------------------------------------
YCKA_BACSU/41-224--------------.IKASS------------------------------------------------------------
Q97VK6_SULSO/120-341--------------.VAGAV------------------------------------------------------------
Q9FAT0_VIBPA/116-319--------------.LGNAV------------------------------------------------------------
Q44374_RHIRD/87-266--------------.VLFLS------------------------------------------------------------
Q9KB56_BACHD/117-308--------------.LGGTV------------------------------------------------------------
OPUBD_BACSU/40-211--------------.IGITA------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------.MTGSL------------------------------------------------------------
LACF_RHIRD/87-298--------------.LQLFD------------------------------------------------------------
Y355_HAEIN/68-243--------------.PIGAV------------------------------------------------------------
Q982M9_RHILO/75-250--------------.VIGAI------------------------------------------------------------
GLNP_RICPR/33-217--------------.IKESA------------------------------------------------------------
AMIC_STRR6/298-492--------------.IGGAT------------------------------------------------------------
TCYB_BACSU/46-230--------------.IKDTS------------------------------------------------------------
AMID_STRR6/125-308--------------.ISYEA------------------------------------------------------------
NRTB_SYNE7/98-276--------------.WLAIV------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------.VSGVI------------------------------------------------------------
Q9X0U9_THEMA/119-323--------------.VAGAL------------------------------------------------------------
UGPA_ECOLI/90-294--------------FFDTFP------------------------------------------------------------
SAPB_HAEIN/93-316--------------.LTQCM------------------------------------------------------------
MSMG_STRMU/87-273--------------.WNDFM------------------------------------------------------------
OPPC_LACLS/106-293--------------.IGLET------------------------------------------------------------
Q57M02_SALCH/27-221--------------.LKATA------------------------------------------------------------
NIKC_ECOLI/89-273--------------.MLHVA------------------------------------------------------------
Q9WYD8_THEMA/94-282--------------.IGFEI------------------------------------------------------------
POTH_ECOLI/117-315--------------.VGEFV------------------------------------------------------------
LPLC_BACSU/93-290--------------.WNDFF------------------------------------------------------------
CYST_ECOLI/74-276--------------.LGEFG------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------.ITGAL------------------------------------------------------------
Q97UH1_SULSO/128-336--------------.VLGAV------------------------------------------------------------
Q97VF6_SULSO/101-289--------------.VYAEV------------------------------------------------------------
LACG_RHIRD/89-270--------------.WNNYL------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------.ILTYS------------------------------------------------------------
MALD_STRR6/87-275--------------.FGDYI------------------------------------------------------------
GLTJ_ECOLI/43-239--------------.VKNSA------------------------------------------------------------
YEHW_ECOLI/68-240--------------.IGTAT------------------------------------------------------------
Q9FAT1_VIBPA/84-268--------------.LLHSA------------------------------------------------------------
Q9A534_CAUCR/67-247--------------.VIGAV------------------------------------------------------------
YEJB_ECOLI/151-361--------------FFTGSL------------------------------------------------------------
YOR2_CALSR/83-265--------------.WNEFV------------------------------------------------------------
O66777_AQUAE/114-319--------------.ISGAA------------------------------------------------------------
YEHY_ECOLI/195-381--------------.VGMAV------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------.IMGEA------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------.LGGAV------------------------------------------------------------
Q9WY46_THEMA/67-238--------------.WKAVV------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------.GFAAI------------------------------------------------------------
GLNP_SHIFL/33-218--------------.IKDTS------------------------------------------------------------
Q98K60_RHILO/105-289--------------.LVGAI------------------------------------------------------------
UGPE_ECOLI/91-278--------------.WNQYL------------------------------------------------------------
OPPB_LACLS/113-318--------------.LGGAI------------------------------------------------------------
Q49553_MYCHO/234-419--------------.ILWIA------------------------------------------------------------
FBPB_SERMA/341-526--------------.ANELT------------------------------------------------------------
Q987J0_RHILO/100-280--------------.VLLLS------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------.PIGAI------------------------------------------------------------
Q9PPS8_UREPA/183-374--------------.FVGAL------------------------------------------------------------
PSTA_ECOLI/101-295--------------.AGETA------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------.FIGSL------------------------------------------------------------
MALC_STRR6/209-434--------------.FNNFS------------------------------------------------------------
LPLB_BACSU/104-314--------------.LNLGF------------------------------------------------------------
YHDY_ECOLI/173-362--------------.FKDTS------------------------------------------------------------
B3XCM3_ECOLX/104-273--------------.VRSAT------------------------------------------------------------
Q9AKQ9_RHIML/112-306--------------.LTGSA------------------------------------------------------------
Q97YP1_SULSO/131-332--------------.LGGIY------------------------------------------------------------
O28506_ARCFU/135-354--------------.LAGAV------------------------------------------------------------
Q98K61_RHILO/75-251--------------.LIGAI------------------------------------------------------------
AMYC_THETU/83-269--------------.WNDYL------------------------------------------------------------
Q9ZGP1_STAAU/117-308--------------.MGGLV------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------.LHLTA------------------------------------------------------------
Q9KKK5_VIBCH/118-310--------------.VEGIV------------------------------------------------------------
YEJE_ECOLI/158-341--------------.ITTLT------------------------------------------------------------
O86691_STRCO/402-574--------------.ALALA------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------.IFALS------------------------------------------------------------
AMYD_THETU/85-290--------------.FKLFD------------------------------------------------------------
O34157_SALTM/115-319--------------.MGGAL------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------.GFATI------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------.LIGAV------------------------------------------------------------
SSUC_BACSU/94-269--------------.WLGLV------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------.VAGAI------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------LE----------------------------------
A5MAB6_STRPN/576-675--------------------------------------------LT----------------------------------
Q9L651_LACLL/549-647--------------------------------------------WH----------------------------------
A5M6X5_STRPN/166-265--------------------------------------------SS----------------------------------
Q931U7_STAAM/555-653--------------------------------------------IL----------------------------------
Q8CY97_STRR6/155-254--------------------------------------------LQ----------------------------------
Q6GIZ0_STAAR/545-643--------------------------------------------LF----------------------------------
Q926X5_LISIN/619-718--------------------------------------------IT----------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------IT----------------------------------
Q9KG35_BACHD/612-712--------------------------------------------RH----------------------------------
B9WU46_STRSU/561-660--------------------------------------------MT----------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------QR----------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------LS----------------------------------
Q896P1_CLOTE/604-706--------------------------------------------SK----------------------------------
Q892J9_CLOTE/609-706--------------------------------------------LN----------------------------------
A8AXA7_STRGC/592-691--------------------------------------------LT----------------------------------
Q9CE29_LACLA/560-659--------------------------------------------IS----------------------------------
Q181M6_CLOD6/617-718--------------------------------------------RV----------------------------------
A7GNK2_BACCN/616-716--------------------------------------------YL----------------------------------

PF02687

O50782_BORBU/276-402--------------------------------------------IQ----------------------------------
A3I1M1_9BACT/289-407--------------------------------------------FS----------------------------------
A7VH46_9CLOT/421-541--------------------------------------------PI----------------------------------
A8ABZ3_IGNH4/248-373--------------------------------------------SV----------------------------------
Q9F443_STRSL/517-633--------------------------------------------YK----------------------------------
A7H0E4_CAMC5/307-422--------------------------------------------MA----------------------------------
A3UQ03_VIBSP/269-395--------------------------------------------LN----------------------------------
A5Z5I3_9FIRM/662-784--------------------------------------------AS----------------------------------
A8H349_SHEPA/695-810--------------------------------------------LK----------------------------------
Q9WZG5_THEMA/725-844--------------------------------------------MS----------------------------------
Q9FBP3_STRCO/657-772--------------------------------------------LL----------------------------------
Q2CDR4_9RHOB/175-297--------------------------------------------LP----------------------------------
A6DHZ0_9BACT/321-438--------------------------------------------FD----------------------------------
A5ZCK7_9BACE/250-369--------------------------------------------HI----------------------------------
O28455_ARCFU/275-396--------------------------------------------LT----------------------------------
Q481M7_COLP3/705-820--------------------------------------------..----------------------------------
A4YKC0_BRASO/734-849--------------------------------------------IV----------------------------------
Q0HRW4_SHESR/279-392--------------------------------------------LM----------------------------------
A7AZK1_RUMGN/757-876--------------------------------------------LM----------------------------------
Q64W75_BACFR/294-427--------------------------------------------GR----------------------------------
A8AR20_CITK8/231-351--------------------------------------------LS----------------------------------
A3UCF7_9RHOB/264-386--------------------------------------------SA----------------------------------
Y684_MYCPN/989-1110--------------------------------------------VK----------------------------------
Q2RPK1_RHORT/279-403--------------------------------------------IN----------------------------------
A6H1M7_FLAPJ/284-410--------------------------------------------HT----------------------------------
A8G4C7_PROM2/272-386--------------------------------------------IR----------------------------------
A0PQZ2_MYCUA/174-295--------------------------------------------LE----------------------------------
Q4QBC9_LEIMA/977-1097--------------------------------------------MA----------------------------------
Q025M3_SOLUE/351-471--------------------------------------------LL----------------------------------
Q54MT9_DICDI/545-666--------------------------------------------II----------------------------------
Q6MGV4_BDEBA/659-778--------------------------------------------ST----------------------------------
A6L8W9_PARD8/653-767--------------------------------------------LS----------------------------------
Q4A9N5_MYCHJ/2523-2644--------------------------------------------FN----------------------------------
A4CDR0_9GAMM/687-801--------------------------------------------WL----------------------------------
Q01VW7_SOLUE/1278-1396--------------------------------------------LH----------------------------------
A3I5H5_9BACI/646-767--------------------------------------------AL----------------------------------
A5USK7_ROSS1/311-433--------------------------------------------IS----------------------------------
Q9A6K3_CAUCR/352-465--------------------------------------------AT----------------------------------
Q72UY4_LEPIC/260-379--------------------------------------------IP----------------------------------
Q5V3A9_HALMA/874-995--------------------------------------------LE----------------------------------
Q8NS27_CORGL/613-739--------------------------------------------TG----------------------------------
B1JTM3_BURCC/259-376--------------------------------------------FK----------------------------------
A7AFS2_9PORP/465-579--------------------------------------------WQ----------------------------------
A8F9W5_BACP2/316-420--------------------------------------------..----------------------------------
A8HA97_SHEPA/673-786--------------------------------------------..----------------------------------
Q97DB8_CLOAB/716-835--------------------------------------------IP----------------------------------
A6F274_9ALTE/258-378--------------------------------------------LS----------------------------------
A7HK62_FERNB/257-383--------------------------------------------VN----------------------------------
B8FRQ9_DESHD/291-412--------------------------------------------VK----------------------------------
A1TXE6_MARAV/183-306--------------------------------------------LA----------------------------------
Q93H51_STRAW/242-364--------------------------------------------LA----------------------------------
Q54290_STRHY/294-451--------------------------------------------AG----------------------------------
Q830M8_ENTFA/579-698--------------------------------------------LS----------------------------------
Q81N14_BACAN/248-369--------------------------------------------LQ----------------------------------
A7B7J6_RUMGN/273-419--------------------------------------------IY----------------------------------
Q5LCL1_BACFN/272-387--------------------------------------------IE----------------------------------
Q9KF85_BACHD/539-650--------------------------------------------..----------------------------------
A3D8C2_SHEB5/283-407--------------------------------------------LQ----------------------------------
A1SKN4_NOCSJ/300-416--------------------------------------------AR----------------------------------
A7VFS5_9CLOT/263-395--------------------------------------------GF----------------------------------
Q5JEM5_PYRKO/203-318--------------------------------------------SS----------------------------------
A7VIB2_9CLOT/622-743--------------------------------------------IY----------------------------------
Q8G7P9_BIFLO/320-438--------------------------------------------IG----------------------------------
Q735D4_BACC1/728-843--------------------------------------------TL----------------------------------
A6BFN6_9FIRM/685-806--------------------------------------------LF----------------------------------
A4CAI1_9GAMM/683-798--------------------------------------------WQ----------------------------------
A3ZPC9_9PLAN/633-758--------------------------------------------LE----------------------------------
A9KQT2_CLOPH/343-506--------------------------------------------VS----------------------------------
A1ZGZ7_9BACT/274-392--------------------------------------------GI----------------------------------
Q6F1V8_MESFL/1691-1810--------------------------------------------QK----------------------------------
Q601V9_MYCH2/401-522--------------------------------------------FY----------------------------------
B8G588_CHLAD/255-383--------------------------------------------LA----------------------------------
Q04L09_STRP2/60-182--------------------------------------------IF----------------------------------
Q048H0_LACDB/280-404--------------------------------------------AD----------------------------------
A4BXN0_9FLAO/168-283--------------------------------------------LD----------------------------------
Q9PPU7_UREPA/163-284--------------------------------------------IM----------------------------------
A5LLD1_STRPN/291-413--------------------------------------------IS----------------------------------
A6TSQ0_ALKMQ/264-387--------------------------------------------IT----------------------------------
A7VD43_9CLOT/805-930--------------------------------------------FV----------------------------------
Q8RTI8_9GAMM/277-411--------------------------------------------FA----------------------------------
A5N346_CLOK5/473-593--------------------------------------------LY----------------------------------
Q053J3_LEPBL/252-373--------------------------------------------DF----------------------------------
A7H957_ANADF/284-394--------------------------------------------..----------------------------------
A1SH34_NOCSJ/769-890--------------------------------------------LV----------------------------------
A6LCJ9_PARD8/285-395--------------------------------------------..----------------------------------
B8I8J6_CLOCE/296-424--------------------------------------------LG----------------------------------
Q6AA47_PROAC/602-722--------------------------------------------IN----------------------------------
Q4MWW1_BACCE/235-351--------------------------------------------IH----------------------------------
A6NZ14_9FIRM/176-297--------------------------------------------IG----------------------------------
Q6MT15_MYCMS/562-682--------------------------------------------SS----------------------------------
A4VW57_STRSY/998-1117--------------------------------------------LL----------------------------------
Q18EP9_HALWD/299-419--------------------------------------------TN----------------------------------
Q8EUA2_MYCPE/1360-1480--------------------------------------------YI----------------------------------
A5MD01_STRPN/302-451--------------------------------------------IG----------------------------------
Q47EZ3_DECAR/243-372--------------------------------------------FG----------------------------------
Q034M7_LACC3/404-519--------------------------------------------AL----------------------------------
A3I2Y5_9BACT/746-861--------------------------------------------FL----------------------------------
Q0RJL1_FRAAA/639-753--------------------------------------------F.----------------------------------
Q7UPA2_RHOBA/581-706--------------------------------------------VL----------------------------------
Q8A9F6_BACTN/266-381--------------------------------------------EI----------------------------------
A4C0M9_9FLAO/275-395--------------------------------------------FH----------------------------------
Q14QM1_SPICI/154-274--------------------------------------------IA----------------------------------
Q97LN0_CLOAB/737-854--------------------------------------------VH----------------------------------
A3ZPB7_9PLAN/791-914--------------------------------------------GC----------------------------------
Q737Y3_BACC1/256-376--------------------------------------------FT----------------------------------
A7VDT8_9CLOT/311-424--------------------------------------------LQ----------------------------------
Q4A9N5_MYCHJ/1802-1923--------------------------------------------LY----------------------------------
Q899W1_CLOTE/250-369--------------------------------------------VK----------------------------------
Q4DFN5_TRYCC/444-565--------------------------------------------IE----------------------------------
A7ADY9_9PORP/281-400--------------------------------------------FS----------------------------------
A7ADZ2_9PORP/274-398--------------------------------------------YY----------------------------------
Q2SRI5_MYCCT/367-490--------------------------------------------II----------------------------------
Q71YS2_LISMF/59-181--------------------------------------------FA----------------------------------
Q638M9_BACCZ/706-820--------------------------------------------VS----------------------------------
Q8KD33_CHLTE/268-389--------------------------------------------LL----------------------------------
A7GNK2_BACCN/187-299--------------------------------------------HN----------------------------------
A3JAL8_9ALTE/692-813--------------------------------------------LV----------------------------------
Q6F163_MESFL/1281-1400--------------------------------------------LL----------------------------------
Q6AMB4_DESPS/278-415--------------------------------------------FQ----------------------------------
A7K544_VIBSE/291-411--------------------------------------------VQ----------------------------------
Q2SSK7_MYCCT/644-765--------------------------------------------FV----------------------------------
A3QAU8_SHELP/312-429--------------------------------------------LS----------------------------------
Q6F1W1_MESFL/1301-1420--------------------------------------------LL----------------------------------
A6LZM8_CLOB8/286-398--------------------------------------------..----------------------------------
A7VI29_9CLOT/290-409--------------------------------------------FE----------------------------------
Q6UCA9_BACFG/30-146--------------------------------------------IE----------------------------------
Q2ST97_MYCCT/1669-1788--------------------------------------------ID----------------------------------
A7AE18_9PORP/286-404--------------------------------------------FN----------------------------------
A7V9H5_BACUN/291-408--------------------------------------------DV----------------------------------
Q6GDI1_STAAR/59-180--------------------------------------------FF----------------------------------
A8FMY2_CAMJ8/150-267--------------------------------------------FD----------------------------------
A7ZGQ8_ECO24/256-370--------------------------------------------VS----------------------------------
A7VI30_9CLOT/297-409--------------------------------------------..----------------------------------

PF03739

Q3ATU7_CHLCH/6-355............................................RI..DADSMHYNRR.......TKRWTMWRVTERYFS
Q1CSH4_HELPH/4-343............................................FI..LAQKGNINNQNG.....VFELNLYSGHAYFTQ
A5TUK8_FUSNP/11-360............................................II..TAKSAKFDTE.......ENKWIFSNANIYNVD
Q4UQP7_XANC8/6-349............................................VV..TAERGAMFFEGKT....DRYLRLEDGHRIEGP
A4N619_HAEIF/7-355............................................LK..HANQASYSED.......EAKWTLRQVNHSTIT
A4JGZ3_BURVG/5-348............................................VV..VSHAGHTETRDG.....DRFVVLEDGRRYDGT
Q118T4_TRIEI/24-389............................................IV..SSESATWNSA.......ENIWDLFNGTIYLVS
A0LEN9_SYNFM/39-391............................................AI..VAESARIVYQRDSN...HLTFKIANGSITRVA
A6EGW2_9SPHI/13-364............................................KI..VADEIKWDSL.......KRSWKLTNYSIRDIK
Q72LM8_THET2/4-334............................................VY..SAEEGLWD.........EEGWRLKGYVVEG..
A3UJ93_9RHOB/6-356............................................AY..AARRGRIAATDR.....GPVMLLEDGVRTQVD
Q66F08_YERPS/5-354............................................VV..VADSGHMSELPDG....SQMVILNKGTRYEGT
Q4HT94_CAMUP/6-348............................................LI..QAKRALFN.........ENSWLLEEGNITYIP
Q92FY2_RICCN/24-375............................................VV..FAGSGTLNIYDN.....SPIFELNKGIRQEYD
A3ZYQ2_9PLAN/6-385............................................LI..SAAEAELHSDENH....QLIISLIDSRIESDG
A8A4E0_ECOHS/6-354............................................YI..YARSATIKD........DKTWILHGVNHKKWL
A7HYF9_PARL1/7-370............................................TY..MAETGSLVRGPN.....GPLLVMFNGNIQRAS
Q8DIL4_THEEB/18-374............................................VI..SAESAEWNVR.......ESRWLLSQGIAYLIS
Q82W93_NITEU/6-348............................................II..ISREGYQQPMTAEQ...WPHIELREGQIYRLS
A0LB31_MAGSM/6-364............................................RA..DAHKATWE.........NEGWVLHNGQIYRFN
Q6MKD0_BDEBA/11-364............................................TI..IAKAGEIVPDPTRPGH.EILLQLNQGEIHRQA
Q4HIC5_CAMCO/6-341............................................LI..IAKEATAQRNED.....SFAFKLSNGKMYNFE
Q6FFD6_ACIAD/9-354............................................VT..NAEQGQFVK........DGQWLLNHSQQMAIQ
A7ADX1_9PORP/9-487............................................VM..VADSGRLKTSADKM...FLVLSLFNGESFRSL
Q0C1U6_HYPNA/7-346............................................IT..TAETARPA.........DGGWALSGTGQRRFD
Q11U59_CYTH3/9-455............................................VI..IADSGSMYLFNQSQ...YLALELFRGNSYNEF
Q7P2I8_FUSNV/6-353............................................VL..TGEEAFWK.........DSAIILKESQFVSFD
A1AWC7_RUTMC/20-369................................................LAKQAQKYTNFNTN...SVYLRLKNGTRYHGF
Q73NV9_TREDE/13-373............................................FL..SSSQTDVKKSNDRSI..IMQLEMLNPRLLNL.
A3SQ70_9RHOB/5-359............................................RL..TAESAELG.........QGQWHLSDVKIWDLA
Q1PXZ0_9BACT/7-354............................................TL..NAKKAEWIG........NNTWVLSKILKHVYD
Q1VZU1_9FLAO/6-482............................................VI..KADHGVLESAETSS...VLSLVLYDGNYYDEV
Q1GR36_SPHAL/14-363............................................ML..SADSARALP........GGGWEMANARRFSRR
Q8G1M6_BRUSU/6-359............................................IY..YAADGAIASTPS.....GDMLLMENGEVQRRN
A5EXI6_DICNV/8-348............................................ML..WSKRGEIQKNQP.....EHFLHLTQGNRAAWR
Q7VQS8_BLOFL/9-358............................................II..YIEKATYI.........DNSWSVSNINELEFV
Q85G79_CYAME/6-326............................................LW..MAKQIDWD.........GARWIAKQVVHYQWD
A6C004_9PLAN/10-385............................................TV..KSDTAIYQTPTQTR...PGGWLLKQATPSYQ.
Q2PY37_9BACT/6-356............................................RL..KASFIKYDSA.......KTSWHMDNWTLRQWQ
Q310A0_DESDG/6-352............................................VI..RGKSFRAD.........SSGWTLDGCDILIPG
A3XBE3_9RHOB/6-359............................................TY..TGARAFLVRDGE.....NTHLIMVNGMAQRLE
Q1NXF0_9DELT/6-358............................................LI..FAARATWD.........GRKWLLEEGQLKEKA
Q2JVE3_SYNJA/13-373............................................VT..LAAQAVWN.........GLDWTLSEGVTHRYG
Q5SL96_THET8/6-344............................................VL..LAERGSFR.........GGVLHVEEGTR....
A6EIS0_9SPHI/6-447............................................II..IAKEGKMASDDK.....YLLLKLKDGVRYEES
A7NDI7_FRATF/5-351............................................VM..TAPTAKIVSDKT.....AAYIDFMNVNIYTKN
Q6MJL5_BDEBA/6-356............................................MI..TAAQVKIQ.........GAQWLLEQGTVTIFN
Q0F2Q6_9PROT/5-349............................................IY..TAKSARFDMGGE.....YLLLKLKDGVRLEGE
A5WBH3_PSYWF/27-466NSANQSVSSIDKDKAITAVTNPVAASQDKPAAKPAITADDDRDIIV..LAKRAVQVKGSEESG..KTQLDLFQGRRYEVG
E0TCF8_PARBH/6-360............................................RL..DAPRALID.........AQVLRLMQARRSTSI
Q984S3_RHILO/7-356............................................RK..DAAHAYLR.........DGYWELQDVKTFR..
Q2S3I0_SALRD/55-410............................................RV..DANRMEWDDS.......LEVWRLDDVTRRTFV
Q1IRI3_KORVE/435-789............................................RI..YAQHAHWEDG.......LQKWVFEQGWMRKLN
A3ZKX1_9PLAN/6-376............................................KI..NAVNAFFKPAEADR...PSGYLLDEVTEPEN.
Q8FDM9_ECOL6/6-352............................................IF..RARSVDVVDPSPE....KPTVMLHNGTAYLID
Q054H5_LEPBL/30-383............................................VI..SSLKAKYNYE.......TKLWKMKKVEEWHFD
A1WAC0_ACISJ/11-359............................................IT..TAVRGQLESNPDTR...KMRLKLEDGLRVRQT
Q1CRE0_HELPH/5-350............................................YA..EAKEAFFE.........DKYWILHDTTIYEMP
A3YF37_9GAMM/6-351............................................TQ..IAKTAQYKT........ADEWTLNQVTNTQFL
Q8D296_WIGBR/5-350............................................VF..VSKHGSLYKDLLKN...KNVINLNYGEYYEID
Q6MDI9_PARUW/8-358............................................IY..RAKYLCPNKEIPVGYFVDHLLRQPNGE.....
Q9A939_CAUCR/5-350............................................KV..EAPAARYD.........GKAWTLEQPKTTRFA
Q0SM43_BORAP/5-351............................................RY..DINKAEWK.........DNKWKLYGIREFVKV
Q1D894_MYXXD/7-356............................................RL..DASGMFPVE........GMRWRLTDVVERTFD
A6CDW2_9PLAN/6-388................................................QAEEATLEFDLTNQ...QVILHISKGHIDFPG
A4BIX3_9GAMM/5-349............................................VT..AAKEVRTQGAEN.....AQYFQFFEGEQTQFS
Q1QKW5_NITHX/6-356............................................SI..VADHGTVMKNDN.....GSFLILEDGHLERLE
Q5H4N0_XANOR/38-393............................................LT..YASVAEHR.........DGRWTLRQVRRDTFQ
A6DAN3_9PROT/6-318............................................FI..ISQNAQLQNKNS.....VLNFALTIGNIYDFN
Q143Z1_BURXL/6-377............................................VR..TAKSGKYQP........PGHWQLTGVTDTQLI
Q68VX9_RICTY/9-358............................................RI..DALYGIIK.........NKKLYLNRVKVSM..
A5PCY0_9SPHN/10-365............................................SI..SAKEGNFLATTDDPD..TIILRLTEGTIVQDT
Q0FGB6_9RHOB/5-362............................................RF..FSESAALG.........NNELLLTNAIKWSDT
B5EBA8_GEOBB/11-361............................................TI..FASTGALVSDPKSN...SMEFQLRNGSIHRAE
A4BIX2_9GAMM/6-351............................................AS..YSKRAVYS.........DGSWVLINTIEVKRT
A6DH34_9BACT/8-357............................................EI..EALSGEFNS........EIGWNFKNVSIAEFS
A3I2C6_9BACT/6-354............................................KL..SSDRIQWDTA.......KNVWTLKNWRFRELN
Q2RQ55_RHORT/8-372............................................TV..MAESGALVREGE.....GARILLINGNRQERN
A1WUU9_HALHL/6-348............................................RI..DADGAHYE.........DGQWRLEGVVKTVYA
A3ZM39_9PLAN/6-376............................................TL..TAEEAELESNPETG...ALQVVCRNSFM....
Q0AH24_NITEC/6-352............................................HI..HAQYADIFD........KSMWKLHDVTVRMFA
A5G1T7_ACICJ/24-378............................................TI..LARSGRLIDGPD.....GPEVLLLDGSREQVD
Q1NXE9_9DELT/10-360............................................TI..SAQGGNLRADPAAG...RVVLSLSDGSLHRSA
Q3B4Y3_PELLD/6-432............................................VI..TAKDGVIDFSADGR...YLVMMLSDGQIHEVQ
Q0BZX3_HYPNA/9-369............................................RI..DAEKAVLN.........EGFWQLENLVENLP.
A2U291_9FLAO/6-450............................................VI..TAESGKIVTEEGSR...YMTFILYNGNYYEEH
Q0BKY7_FRATO/8-349............................................IR..YAESATYINDAS.....ANVFNIRKIIFPASD
A0LB30_MAGSM/6-357............................................TV..IAKSGMLHRGSTG....ETALLLKEGSRHQMA
E0TCF9_PARBH/51-404............................................TY..TAERGLFQMAET.....GPKLLLIEGTVQYRD
Q1K323_DESAC/6-357............................................RI..EAQAATFK.........EDQWQAEHVTVRHFD
A5EXI7_DICNV/7-348............................................IQ..ESQRATFM.........QTHWQLDDNRALCIG
B8CYZ1_HALOH/12-360............................................IV..TANLGEVY.........KEKWVLKKGFIHRYN
Q1MPZ1_LAWIP/7-360............................................VI..LAPTGTIETNPTKG...ELIFNLTNGNIYTMS
A3EV76_9BACT/6-358............................................QV..DAKTLRYH.........QGLWSFQDGHLTRFL
Q5X1R0_LEGPA/5-353............................................VL..WADKAFAEVNPQTG...EEYIVLQNGKEYQGV
A8ZZ83_DESOH/6-356............................................RI..DAARGLYD.........GGQWTLRNVLDQQFD
A8EWU1_ARCB4/5-331............................................FV..ISKNAVLDNDNG.....VLSIRLDEGKAFLID
Q0F2D4_9PROT/6-348............................................RI..DSPRAHYS.........QGVWSLSDARVSTPS
Q04UA4_LEPBJ/109-561............................................II..NAGKGNLVEKIGPDGEYEKSIRLKDGWILEWS
Q1PWZ7_9BACT/56-571............................................II..IAEEGSIEVNNEKN...TIFLTLRKGEFIKPN
Q31ET4_THICR/6-346................................................MAPKGKFEWING.....KLVLVLLNGRSYEGL
A3EV77_9BACT/6-356............................................VI..MAREGSLLNEENGRP..GIRIQLRSGTLLQGG
Q1IZ54_DEIGD/6-380............................................VI..FADSGTFE.........NNRLSLRGYQVYTVN
Q1J2D3_DEIGD/10-350............................................TV..TAQSGIWDTQ.......ARTWTVSDAWITRPG
Q2S0T8_SALRD/7-449............................................VI..KAERGVIESSAGGA...RLTLTLRNGEMHRPL
A4A3Y2_9GAMM/5-358............................................VT..VARRGSVVVDPESG...VRYLELRDGYRFSGT
Q6MDI8_PARUW/7-377............................................IF..TAQGATLLTTTSL....NQENTFDDLLIENMK
B8CYX9_HALOH/6-362............................................LI..KARKAVWQ.........GDKWHFYNGNIYYFK
Q1IRI3_KORVE/8-376............................................IT..MAERGVVVAEGPN....SLHLHLENGTQQETN
O83854_TREPA/1-358............................................VV..SSRKSVLESSADQTV..PFTIRMHDPCMLIV.
Q8D297_WIGBR/7-348............................................IK..SSKYAIFK.........NKEWIMFDVKTIKFN
Q9AA49_CAUCR/9-364............................................IL..TAVSAVVHKNPADS...HIALELTNGRQ....
Q3J9X2_NITOC/9-352............................................LL..RAARGHLQTDEATG...DKYLILEDGYRYELM
A7IJ85_XANP2/6-384............................................TY..LADRGQIIESDA.....GIFLVLENGSIQRRG
Q9TLY0_CYACA/27-394............................................LF..LADSAKFDHF.......SRNWLFENMHIFSFD
Q0C1U7_HYPNA/7-360............................................LL..TGGSGKLREIRAGEW..EITLLGGAGASYRDA
Q0BVK4_GRABC/5-352............................................YL..HAQSADILP........NDRWVLHDVLSRTLV
Q5FU64_GLUOX/35-392............................................RV..EAPQGALG.........DHQWILHGTSVLHP.
Q5FPA9_GLUOX/26-376............................................TE..HTNVLTYR.........DGQWHPDGAQDLSLS
Q1D895_MYXXD/6-362............................................LV..LAQRGQVGTSTSGE...VLRFALEAGEVHRSA
Q9PL80_CHLMU/6-348............................................TIIPDVNKDSVQA........KNVLVISKVPLFSEA
A1AXG9_RUTMC/6-356............................................IV..HSDSAISN.........GDNLELSQSIHYQFG
Q0G6N0_9RHIZ/6-358............................................TY..FAAEASILDQGD.....QSVLMLFDGQLHRKP
A6QBC8_SULNB/6-335............................................FF..SSKQGQLNRDKL.....VASLLLKEGYGYTYT
A6QBZ1_SULNB/12-355............................................TI..KAPVAVFN.........GEEWIAQNATVKTHI
Q7VQS9_BLOFL/5-358............................................II..TADQGSIHYNFNDK...SQLIILQSGMYYEIH
Q319A3_PROM9/28-396............................................IL..TAKSAVFDKK.......NSSWVFADGSIVSTD
Q0SM44_BORAP/10-425............................................IF..MAKNLDIRKENF.....QVYFILNDVLSIALT
A5ILH5_THEP1/6-352............................................II..TAKRVQKK.........GNDWYLFNGNYYTVD
A6DC21_9PROT/4-336............................................II..YTKKAKFF.........KNHWISNKAVITTLS
Q73NV8_TREDE/6-354............................................VI..KSSHMVWN.........EDRWTTDSAEVYRFD

PF00528

YQGH_BACSU/107-309--------------------------------------------AV----------------------------------
YQGI_BACSU/80-293--------------------------------------------AL----------------------------------
NIKB_ECOLI/116-308--------------------------------------------II----------------------------------
Q97UG4_SULSO/116-318--------------------------------------------TV----------------------------------
YCKA_BACSU/41-224--------------------------------------------LA----------------------------------
Q97VK6_SULSO/120-341--------------------------------------------VI----------------------------------
Q9FAT0_VIBPA/116-319--------------------------------------------LI----------------------------------
Q44374_RHIRD/87-266--------------------------------------------TL----------------------------------
Q9KB56_BACHD/117-308--------------------------------------------VV----------------------------------
OPUBD_BACSU/40-211--------------------------------------------IG----------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------VI----------------------------------
LACF_RHIRD/87-298--------------------------------------------EV----------------------------------
Y355_HAEIN/68-243--------------------------------------------VG----------------------------------
Q982M9_RHILO/75-250--------------------------------------------VG----------------------------------
GLNP_RICPR/33-217--------------------------------------------II----------------------------------
AMIC_STRR6/298-492--------------------------------------------LT----------------------------------
TCYB_BACSU/46-230--------------------------------------------LA----------------------------------
AMID_STRR6/125-308--------------------------------------------FL----------------------------------
NRTB_SYNE7/98-276--------------------------------------------AA----------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------IE----------------------------------
Q9X0U9_THEMA/119-323--------------------------------------------TT----------------------------------
UGPA_ECOLI/90-294--------------------------------------------VI----------------------------------
SAPB_HAEIN/93-316--------------------------------------------LV----------------------------------
MSMG_STRMU/87-273--------------------------------------------LP----------------------------------
OPPC_LACLS/106-293--------------------------------------------GL----------------------------------
Q57M02_SALCH/27-221--------------------------------------------LV----------------------------------
NIKC_ECOLI/89-273--------------------------------------------GM----------------------------------
Q9WYD8_THEMA/94-282--------------------------------------------VL----------------------------------
POTH_ECOLI/117-315--------------------------------------------IP----------------------------------
LPLC_BACSU/93-290--------------------------------------------HA----------------------------------
CYST_ECOLI/74-276--------------------------------------------AV----------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------LV----------------------------------
Q97UH1_SULSO/128-336--------------------------------------------AI----------------------------------
Q97VF6_SULSO/101-289--------------------------------------------GL----------------------------------
LACG_RHIRD/89-270--------------------------------------------WP----------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------TL----------------------------------
MALD_STRR6/87-275--------------------------------------------LS----------------------------------
GLTJ_ECOLI/43-239--------------------------------------------IA----------------------------------
YEHW_ECOLI/68-240--------------------------------------------IA----------------------------------
Q9FAT1_VIBPA/84-268--------------------------------------------AL----------------------------------
Q9A534_CAUCR/67-247--------------------------------------------VA----------------------------------
YEJB_ECOLI/151-361--------------------------------------------LI----------------------------------
YOR2_CALSR/83-265--------------------------------------------FA----------------------------------
O66777_AQUAE/114-319--------------------------------------------LI----------------------------------
YEHY_ECOLI/195-381--------------------------------------------IA----------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------GL----------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------LT----------------------------------
Q9WY46_THEMA/67-238--------------------------------------------MG----------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------AG----------------------------------
GLNP_SHIFL/33-218--------------------------------------------LF----------------------------------
Q98K60_RHILO/105-289--------------------------------------------VG----------------------------------
UGPE_ECOLI/91-278--------------------------------------------WP----------------------------------
OPPB_LACLS/113-318--------------------------------------------FA----------------------------------
Q49553_MYCHO/234-419--------------------------------------------SL----------------------------------
FBPB_SERMA/341-526--------------------------------------------AT----------------------------------
Q987J0_RHILO/100-280--------------------------------------------GL----------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------VG----------------------------------
Q9PPS8_UREPA/183-374--------------------------------------------FI----------------------------------
PSTA_ECOLI/101-295--------------------------------------------PL----------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------FV----------------------------------
MALC_STRR6/209-434--------------------------------------------IM----------------------------------
LPLB_BACSU/104-314--------------------------------------------EQ----------------------------------
YHDY_ECOLI/173-362--------------------------------------------LV----------------------------------
B3XCM3_ECOLX/104-273--------------------------------------------VV----------------------------------
Q9AKQ9_RHIML/112-306--------------------------------------------VV----------------------------------
Q97YP1_SULSO/131-332--------------------------------------------FI----------------------------------
O28506_ARCFU/135-354--------------------------------------------LT----------------------------------
Q98K61_RHILO/75-251--------------------------------------------VA----------------------------------
AMYC_THETU/83-269--------------------------------------------LP----------------------------------
Q9ZGP1_STAAU/117-308--------------------------------------------VI----------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------TA----------------------------------
Q9KKK5_VIBCH/118-310--------------------------------------------MI----------------------------------
YEJE_ECOLI/158-341--------------------------------------------SL----------------------------------
O86691_STRCO/402-574--------------------------------------------SL----------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------SL----------------------------------
AMYD_THETU/85-290--------------------------------------------QN----------------------------------
O34157_SALTM/115-319--------------------------------------------LA----------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------AG----------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------VW----------------------------------
SSUC_BACSU/94-269--------------------------------------------VA----------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------AT----------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STRPN/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STRPN/166-265--------------------------------------------------------------------------------
Q931U7_STAAM/555-653--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
Q6GIZ0_STAAR/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_CLOD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402-----------------------------------------------------------------------FQKISFTP.
A3I1M1_9BACT/289-407-----------------------------------------------------------------------SLS......
A7VH46_9CLOT/421-541-----------------------------------------------------------------------QMQDCY...
A8ABZ3_IGNH4/248-373-----------------------------------------------------------------------NVAL.....
Q9F443_STRSL/517-633-----------------------------------------------------------------------Y........
A7H0E4_CAMC5/307-422-----------------------------------------------------------------------YTI......
A3UQ03_VIBSP/269-395-----------------------------------------------------------------------TILEA....
A5Z5I3_9FIRM/662-784-----------------------------------------------------------------------REISIA...
A8H349_SHEPA/695-810-----------------------------------------------------------------------.........
Q9WZG5_THEMA/725-844-----------------------------------------------------------------------ESL......
Q9FBP3_STRCO/657-772-----------------------------------------------------------------------KM.......
Q2CDR4_9RHOB/175-297-----------------------------------------------------------------------EADA.....
A6DHZ0_9BACT/321-438-----------------------------------------------------------------------PVLN.....
A5ZCK7_9BACE/250-369-----------------------------------------------------------------------SL.......
O28455_ARCFU/275-396-----------------------------------------------------------------------SQYIT....
Q481M7_COLP3/705-820-----------------------------------------------------------------------.........
A4YKC0_BRASO/734-849-----------------------------------------------------------------------TRL......
Q0HRW4_SHESR/279-392-----------------------------------------------------------------------S........
A7AZK1_RUMGN/757-876-----------------------------------------------------------------------WMQD.....
Q64W75_BACFR/294-427-----------------------------------------------------------------------NWVFSLFDK
A8AR20_CITK8/231-351-----------------------------------------------------------------------SAVTE....
A3UCF7_9RHOB/264-386-----------------------------------------------------------------------STMGG....
Y684_MYCPN/989-1110-----------------------------------------------------------------------GIISR....
Q2RPK1_RHORT/279-403-----------------------------------------------------------------------HKLAAT...
A6H1M7_FLAPJ/284-410-----------------------------------------------------------------------GIIKLNP..
A8G4C7_PROM2/272-386-----------------------------------------------------------------------SS.......
A0PQZ2_MYCUA/174-295-----------------------------------------------------------------------NALNQ....
Q4QBC9_LEIMA/977-1097-----------------------------------------------------------------------IELCQ....
Q025M3_SOLUE/351-471-----------------------------------------------------------------------ALSRY....
Q54MT9_DICDI/545-666-----------------------------------------------------------------------DQLKR....
Q6MGV4_BDEBA/659-778-----------------------------------------------------------------------KWIH.....
A6L8W9_PARD8/653-767-----------------------------------------------------------------------D........
Q4A9N5_MYCHJ/2523-2644-----------------------------------------------------------------------SYILL....
A4CDR0_9GAMM/687-801-----------------------------------------------------------------------SS.......
Q01VW7_SOLUE/1278-1396-----------------------------------------------------------------------HGM......
A3I5H5_9BACI/646-767-----------------------------------------------------------------------HSIIL....
A5USK7_ROSS1/311-433-----------------------------------------------------------------------WTVSFL...
Q9A6K3_CAUCR/352-465-----------------------------------------------------------------------M........
Q72UY4_LEPIC/260-379-----------------------------------------------------------------------DLAG.....
Q5V3A9_HALMA/874-995-----------------------------------------------------------------------RAGWL....
Q8NS27_CORGL/613-739-----------------------------------------------------------------------TTDEI....
B1JTM3_BURCC/259-376-----------------------------------------------------------------------QA.......
A7AFS2_9PORP/465-579-----------------------------------------------------------------------RQ.......
A8F9W5_BACP2/316-420-----------------------------------------------------------------------.........
A8HA97_SHEPA/673-786-----------------------------------------------------------------------.........
Q97DB8_CLOAB/716-835-----------------------------------------------------------------------AMLD.....
A6F274_9ALTE/258-378-----------------------------------------------------------------------SVLGD....
A7HK62_FERNB/257-383-----------------------------------------------------------------------SFQRTDE..
B8FRQ9_DESHD/291-412-----------------------------------------------------------------------QAIND....
A1TXE6_MARAV/183-306-----------------------------------------------------------------------DGFGQA...
Q93H51_STRAW/242-364-----------------------------------------------------------------------QWVVDN...
Q54290_STRHY/294-451-----------------------------------------------------------------------QALLGREAT
Q830M8_ENTFA/579-698-----------------------------------------------------------------------QFI......
Q81N14_BACAN/248-369-----------------------------------------------------------------------SCLEH....
A7B7J6_RUMGN/273-419-----------------------------------------------------------------------QKIGSIFVR
Q5LCL1_BACFN/272-387-----------------------------------------------------------------------LA.......
Q9KF85_BACHD/539-650-----------------------------------------------------------------------.........
A3D8C2_SHEB5/283-407-----------------------------------------------------------------------PMVAMTL..
A1SKN4_NOCSJ/300-416-----------------------------------------------------------------------TTLL.....
A7VFS5_9CLOT/263-395-----------------------------------------------------------------------NWLVEQGNL
Q5JEM5_PYRKO/203-318-----------------------------------------------------------------------.........
A7VIB2_9CLOT/622-743-----------------------------------------------------------------------YVMMK....
Q8G7P9_BIFLO/320-438-----------------------------------------------------------------------SALA.....
Q735D4_BACC1/728-843-----------------------------------------------------------------------RFL......
A6BFN6_9FIRM/685-806-----------------------------------------------------------------------SYAKH....
A4CAI1_9GAMM/683-798-----------------------------------------------------------------------P........
A3ZPC9_9PLAN/633-758-----------------------------------------------------------------------WSPPVDS..
A9KQT2_CLOPH/343-506-----------------------------------------------------------------------DVLLKSQVA
A1ZGZ7_9BACT/274-392-----------------------------------------------------------------------QLTQRF...
Q6F1V8_MESFL/1691-1810-----------------------------------------------------------------------FG.......
Q601V9_MYCH2/401-522-----------------------------------------------------------------------TLITN....
B8G588_CHLAD/255-383-----------------------------------------------------------------------GFLAG....
Q04L09_STRP2/60-182-----------------------------------------------------------------------AFLLKL...
Q048H0_LACDB/280-404-----------------------------------------------------------------------SSVGSS...
A4BXN0_9FLAO/168-283-----------------------------------------------------------------------.........
Q9PPU7_UREPA/163-284-----------------------------------------------------------------------RLFSS....
A5LLD1_STRPN/291-413-----------------------------------------------------------------------SVITK....
A6TSQ0_ALKMQ/264-387-----------------------------------------------------------------------RMMASD...
A7VD43_9CLOT/805-930-----------------------------------------------------------------------KLVAV....
Q8RTI8_9GAMM/277-411-----------------------------------------------------------------------TEGLNFKEV
A5N346_CLOK5/473-593-----------------------------------------------------------------------DNLIT....
Q053J3_LEPBL/252-373-----------------------------------------------------------------------.........
A7H957_ANADF/284-394-----------------------------------------------------------------------.........
A1SH34_NOCSJ/769-890-----------------------------------------------------------------------KVLSG....
A6LCJ9_PARD8/285-395-----------------------------------------------------------------------.........
B8I8J6_CLOCE/296-424-----------------------------------------------------------------------KSGVYLGTG
Q6AA47_PROAC/602-722-----------------------------------------------------------------------AAIGST...
Q4MWW1_BACCE/235-351-----------------------------------------------------------------------TYFE.....
A6NZ14_9FIRM/176-297-----------------------------------------------------------------------QAIAT....
Q6MT15_MYCMS/562-682-----------------------------------------------------------------------SNFVN....
A4VW57_STRSY/998-1117-----------------------------------------------------------------------AMIG.....
Q18EP9_HALWD/299-419-----------------------------------------------------------------------TILAQ....
Q8EUA2_MYCPE/1360-1480-----------------------------------------------------------------------TFIFN....
A5MD01_STRPN/302-451-----------------------------------------------------------------------NTVLANVTS
Q47EZ3_DECAR/243-372-----------------------------------------------------------------------AAIFEPVLK
Q034M7_LACC3/404-519-----------------------------------------------------------------------RL.......
A3I2Y5_9BACT/746-861-----------------------------------------------------------------------.........
Q0RJL1_FRAAA/639-753-----------------------------------------------------------------------.........
Q7UPA2_RHOBA/581-706-----------------------------------------------------------------------WALKSWW..
Q8A9F6_BACTN/266-381-----------------------------------------------------------------------QF.......
A4C0M9_9FLAO/275-395-----------------------------------------------------------------------FMEY.....
Q14QM1_SPICI/154-274-----------------------------------------------------------------------NIVFK....
Q97LN0_CLOAB/737-854-----------------------------------------------------------------------KV.......
A3ZPB7_9PLAN/791-914-----------------------------------------------------------------------GIAQYV...
Q737Y3_BACC1/256-376-----------------------------------------------------------------------SNITL....
A7VDT8_9CLOT/311-424-----------------------------------------------------------------------Y........
Q4A9N5_MYCHJ/1802-1923-----------------------------------------------------------------------NLISQ....
Q899W1_CLOTE/250-369-----------------------------------------------------------------------DNFT.....
Q4DFN5_TRYCC/444-565-----------------------------------------------------------------------YLLSR....
A7ADY9_9PORP/281-400-----------------------------------------------------------------------HLFD.....
A7ADZ2_9PORP/274-398-----------------------------------------------------------------------QYMASKE..
Q2SRI5_MYCCT/367-490-----------------------------------------------------------------------NKFAN....
Q71YS2_LISMF/59-181-----------------------------------------------------------------------MVLFWI...
Q638M9_BACCZ/706-820-----------------------------------------------------------------------II.......
Q8KD33_CHLTE/268-389-----------------------------------------------------------------------RLYGD....
A7GNK2_BACCN/187-299-----------------------------------------------------------------------G........
A3JAL8_9ALTE/692-813-----------------------------------------------------------------------HRINP....
Q6F163_MESFL/1281-1400-----------------------------------------------------------------------TWIAN....
Q6AMB4_DESPS/278-415-----------------------------------------------------------------------AYGLDIGSM
A7K544_VIBSE/291-411-----------------------------------------------------------------------PIIQQ....
Q2SSK7_MYCCT/644-765-----------------------------------------------------------------------GIFKD....
A3QAU8_SHELP/312-429-----------------------------------------------------------------------ARFGV....
Q6F1W1_MESFL/1301-1420-----------------------------------------------------------------------SG.......
A6LZM8_CLOB8/286-398-----------------------------------------------------------------------.........
A7VI29_9CLOT/290-409-----------------------------------------------------------------------AVY......
Q6UCA9_BACFG/30-146-----------------------------------------------------------------------ELAE.....
Q2ST97_MYCCT/1669-1788-----------------------------------------------------------------------KAFS.....
A7AE18_9PORP/286-404-----------------------------------------------------------------------RIMSG....
A7V9H5_BACUN/291-408-----------------------------------------------------------------------TF.......
Q6GDI1_STAAR/59-180-----------------------------------------------------------------------LFIQK....
A8FMY2_CAMJ8/150-267-----------------------------------------------------------------------LSIIQ....
A7ZGQ8_ECO24/256-370-----------------------------------------------------------------------RA.......
A7VI30_9CLOT/297-409-----------------------------------------------------------------------.........

PF03739

Q3ATU7_CHLCH/6-355NG.....................................................................YQSFTTKPT
Q1CSH4_HELPH/4-343GD.....................................................................KMRKVDFEE
A5TUK8_FUSNP/11-360TK.....................................................................ETVTKTEYK
Q4UQP7_XANC8/6-349AGAQGL.................................................................DYRLMTFAS
A4N619_HAEIF/7-355KD.....................................................................EIITTNHLS
A4JGZ3_BURVG/5-348PGQP...................................................................NFKIMEFQR
Q118T4_TRIEI/24-389PDGS...................................................................YRNIVKFDH
A0LEN9_SYNFM/39-391DDMK...................................................................NAQAVSFKA
A6EGW2_9SPHI/13-364GLKE...................................................................TMTNGAGKT
Q72LM8_THET2/4-334.......................................................................EEVRPFEGV
A3UJ93_9RHOB/6-356QSG....................................................................VLTNLSFDS
Q66F08_YERPS/5-354ALLR...................................................................DFRITDFVD
Q4HT94_CAMUP/6-348KEFVLGEN...............................................................GYKSENFAN
Q92FY2_RICCN/24-375VNG....................................................................NLTQLTFDS
A3ZYQ2_9PLAN/6-385SQQGVFEHPGRMDHVV.......................................................SLSDELSPE
A8A4E0_ECOHS/6-354NG.....................................................................KETLETSDN
A7HYF9_PARL1/7-370RSGTETS................................................................AATFLYFDK
Q8DIL4_THEEB/18-374HTGV...................................................................SRNLLQFDQ
Q82W93_NITEU/6-348FDTV...................................................................KDSAIRFEK
A0LB31_MAGSM/6-364GH.....................................................................TTQSEPFTR
Q6MKD0_BDEBA/11-364K......................................................................THTKISFDT
Q4HIC5_CAMCO/6-341NGQ....................................................................TLFIGNFDK
Q6FFD6_ACIAD/9-354GQG....................................................................DAVLANAAK
A7ADX1_9PORP/9-487DKQPSTAGTKSSV..........................................................PYQRETFKS
Q0C1U6_HYPNA/7-346.........................................................................GEPPTDM
Q11U59_CYTH3/9-455KGEGGMSYINPE...........................................................EFVRNSFDK
Q7P2I8_FUSNV/6-353ETGK...................................................................KNLVGTFDE
A1AWC7_RUTMC/20-369PSNKNK.................................................................KILNFKLYD
Q73NV9_TREDE/13-373.......................................................................DLNNRSKFD
A3SQ70_9RHOB/5-359NTDNP..................................................................EASARTQDR
Q1PXZ0_9BACT/7-354ERGRW..................................................................VAPVHRLDT
Q1VZU1_9FLAO/6-482PTKTYQQKLKA............................................................PFVKSAFDK
Q1GR36_SPHAL/14-363.......................................................................SGTLEPLGT
Q8G1M6_BRUSU/6-359VSDG...................................................................TVSIIKFDS
A5EXI6_DICNV/8-348DDF....................................................................QPQNCLFSQ
Q7VQS8_BLOFL/9-358DKM....................................................................QFLNRKILS
Q85G79_CYAME/6-326DQFQ...................................................................LQLQSHVAK
A6C004_9PLAN/10-385.......................................................................ELEIAEFAR
Q2PY37_9BACT/6-356SNG....................................................................HMSLTSGVR
Q310A0_DESDG/6-352SY.....................................................................EVATSESIV
A3XBE3_9RHOB/6-359HRTQ...................................................................QLSTTNFSD
Q1NXF0_9DELT/6-358NGDD...................................................................DFVVDYFER
Q2JVE3_SYNJA/13-373PDGL...................................................................SLAEEPFDR
Q5SL96_THET8/6-344.......................................................................ITYEGSRPR
A6EIS0_9SPHI/6-447SGKNASYNPRQ............................................................ELTRMRFKE
A7NDI7_FRATF/5-351SQN....................................................................SEYSYDNAK
Q6MJL5_BDEBA/6-356KDSS...................................................................FPLTSPFKT
Q0F2Q6_9PROT/5-349GA.....................................................................DQRMLAFDR
A5WBH3_PSYWF/27-466ADSL...................................................................VYSQIGFER
E0TCF8_PARBH/6-360A......................................................................TTAPQIEAE
Q984S3_RHILO/7-356.......................................................................NGTIQPSAS
Q2S3I0_SALRD/55-410KGE....................................................................TQRKRTIAS
Q1IRI3_KORVE/435-789GSA....................................................................IEEFKPFEV
A3ZKX1_9PLAN/6-376.......................................................................LAEIPSLTD
Q8FDM9_ECOL6/6-352HQGR...................................................................DDNEQIYRN
Q054H5_LEPBL/30-383NDLK...................................................................LSSQESFEE
A1WAC0_ACISJ/11-359PDGA...................................................................IATTRFVDG
Q1CRE0_HELPH/5-350LKFELGTN...............................................................ALNATRLKT
A3YF37_9GAMM/6-351AD.....................................................................KIESNNTNF
Q8D296_WIGBR/5-350FKSN...................................................................YFFIASFER
Q6MDI9_PARUW/8-358.......................................................................LLQQQAYSQ
Q9A939_CAUCR/5-350GD.....................................................................LSQASTAAA
Q0SM43_BORAP/5-351GRKI...................................................................KENAYDVLD
Q1D894_MYXXD/7-356GEG....................................................................KTSVRQLPE
A6CDW2_9PLAN/6-388KPRFFVEKDTFPFPL........................................................PSQTTMAKP
A4BIX3_9GAMM/5-349FDESE..................................................................PLQTQRFGM
Q1QKW5_NITHX/6-356AGKR...................................................................EPNMVAFRR
Q5H4N0_XANOR/38-393ER.....................................................................SVQRETFPE
A6DAN3_9PROT/6-318.......................................................................KSMQIKFNK
Q143Z1_BURXL/6-377DVPPPPGTPADALNPVY......................................................RAKEVAVPE
Q68VX9_RICTY/9-358.......................................................................KDETKSYNN
A5PCY0_9SPHN/10-365GSQ....................................................................TPRVLTFTR
Q0FGB6_9RHOB/5-362KIKKNP.................................................................IIANEKIKK
B5EBA8_GEOBB/11-361EQG....................................................................GYRMVQFQE
A4BIX2_9GAMM/6-351ERG....................................................................FERKTMGIS
A6DH34_9BACT/8-357EDHRI..................................................................KKIEKHDNY
A3I2C6_9BACT/6-354EF.....................................................................GEDYSVGEE
Q2RQ55_RHORT/8-372RQTG...................................................................KVNFLYFDS
A1WUU9_HALHL/6-348DH.....................................................................RLERRELEA
A3ZM39_9PLAN/6-376.......................................................................EYGDGTNFS
Q0AH24_NITEC/6-352PD.....................................................................RIFSRKVHA
A5G1T7_ACICJ/24-378PKTG...................................................................RLNILSFRR
Q1NXE9_9DELT/10-360GA.....................................................................KSQTIFFKH
Q3B4Y3_PELLD/6-432VPGHR..................................................................LYRKMEFDR
Q0BZX3_HYPNA/9-369.......................................................................NQAPERRAT
A2U291_9FLAO/6-450VKSARTTIKRK............................................................KMAASSATF
Q0BKY7_FRATO/8-349GQKH...................................................................IDIVTNMTN
A0LB30_MAGSM/6-357PGN....................................................................AYRRLNFST
E0TCF9_PARBH/51-404RETG...................................................................RVDVFRYIE
Q1K323_DESAC/6-357PQSR...................................................................QLTAQKEEN
A5EXI7_DICNV/7-348S......................................................................QSSMPITPT
B8CYZ1_HALOH/12-360GEGH...................................................................LTMETRFDV
Q1MPZ1_LAWIP/7-360LN.....................................................................KTSFLSFDQ
A3EV76_9BACT/6-358PDG....................................................................SLKIESFQK
Q5X1R0_LEGPA/5-353PGHA...................................................................DYQIAEFAS
A8ZZ83_DESOH/6-356VAGN...................................................................VQLVEFRER
A8EWU1_ARCB4/5-331KE.....................................................................EFNQINYEA
Q0F2D4_9PROT/6-348SDQ....................................................................VMHVEKLKN
Q04UA4_LEPBJ/109-561DDRK...................................................................SFSVTDFRN
Q1PWZ7_9BACT/56-571YKKAEEVPRLGVFTETTFEIPMGKDKADFSTKHMTIFQLFKYNNEIDRELANSKEIPDNFEEARVEASRKLAEHQNQLQQ
Q31ET4_THICR/6-346K......................................................................KGDDFTVRE
A3EV77_9BACT/6-356A......................................................................AQQFVRFSS
Q1IZ54_DEIGD/6-380YAAAARLARV.............................................................PENDPAAFR
Q1J2D3_DEIGD/10-350QDPRQ..................................................................VAGPLVFPQ
Q2S0T8_SALRD/7-449PPDANNQSE..............................................................RYERLTFDR
A4A3Y2_9GAMM/5-358PGRA...................................................................DYRIVRFGT
Q6MDI8_PARUW/7-377KSTTHVEDFS.............................................................QILQKKVWT
B8CYX9_HALOH/6-362EGE....................................................................RVPALKFNE
Q1IRI3_KORVE/8-376PKDPT..................................................................QYQVSTFDQ
O83854_TREPA/1-358.......................................................................YRTRPRICD
Q8D297_WIGBR/7-348NNK....................................................................KIEINSFDK
Q9AA49_CAUCR/9-364.......................................................................ISTVAGAQS
Q3J9X2_NITOC/9-352GEEV...................................................................GVRIFSFER
A7IJ85_XANP2/6-384GAAKEAEKDASEANKDAGKDKGKSS..............................................NSSVVEFQR
Q9TLY0_CYACA/27-394YDKELFVDSFNINM.........................................................NLCNLSILD
Q0C1U7_HYPNA/7-360DPPE...................................................................EYDRIEYGE
Q0BVK4_GRABC/5-352DG.....................................................................QLRKAHLDR
Q5FU64_GLUOX/35-392.......................................................................DHLPQQIGD
Q5FPA9_GLUOX/26-376DDK....................................................................SYVNVTKGD
Q1D895_MYXXD/6-362GRETE..................................................................EYSIIRFDQ
Q9PL80_CHLMU/6-348R......................................................................TSNPNEFYL
A1AXG9_RUTMC/6-356KDGNLT.................................................................TFSENNFEK
Q0G6N0_9RHIZ/6-358KTGN...................................................................SVSVIEFQT
A6QBC8_SULNB/6-335KN.....................................................................KLQQAKYKS
A6QBZ1_SULNB/12-355YQNGELV................................................................RYSMDQKES
Q7VQS9_BLOFL/5-358NTQLLCI................................................................PRFVTYFNQ
Q319A3_PROM9/28-396STG....................................................................QTTSINFKQ
Q0SM44_BORAP/10-425DSESGFYDYFYA...........................................................DKMKYSIDQ
A5ILH5_THEP1/6-352KDGF...................................................................LKLDVHFSE
A6DC21_9PROT/4-336K......................................................................DRWDKEEKK
Q73NV8_TREDE/6-354EKN....................................................................SVSCLNNIP

PF00528

YQGH_BACSU/107-309-----------------------------------------------------------------------QMVI.....
YQGI_BACSU/80-293-----------------------------------------------------------------------LFTA...G.
NIKB_ECOLI/116-308-----------------------------------------------------------------------ENIFAWPG.
Q97UG4_SULSO/116-318-----------------------------------------------------------------------EGLLTTPG.
YCKA_BACSU/41-224-----------------------------------------------------------------------AMIT.....
Q97VK6_SULSO/120-341-----------------------------------------------------------------------EDIFQYHG.
Q9FAT0_VIBPA/116-319-----------------------------------------------------------------------ESVFNYPG.
Q44374_RHIRD/87-266-----------------------------------------------------------------------SFLG.....
Q9KB56_BACHD/117-308-----------------------------------------------------------------------ENVFAWPG.
OPUBD_BACSU/40-211-----------------------------------------------------------------------TFVGAGG..
Q9LAT6_LISMN/112-304-----------------------------------------------------------------------ENIYSIPG.
LACF_RHIRD/87-298-----------------------------------------------------------------------YNFTEGTGG
Y355_HAEIN/68-243-----------------------------------------------------------------------EWVGSSEG.
Q982M9_RHILO/75-250-----------------------------------------------------------------------EWIGSDKG.
GLNP_RICPR/33-217-----------------------------------------------------------------------SMLG.....
AMIC_STRR6/298-492-----------------------------------------------------------------------ETVFAFPG.
TCYB_BACSU/46-230-----------------------------------------------------------------------SQIL.....
AMID_STRR6/125-308-----------------------------------------------------------------------SFFG.....
NRTB_SYNE7/98-276-----------------------------------------------------------------------EMLKADGG.
Q9HIL1_THEAC/131-337-----------------------------------------------------------------------ESIFSYPG.
Q9X0U9_THEMA/119-323-----------------------------------------------------------------------EIVFSYPG.
UGPA_ECOLI/90-294-----------------------------------------------------------------------DAATSGGP.
SAPB_HAEIN/93-316-----------------------------------------------------------------------ETALGWPG.
MSMG_STRMU/87-273-----------------------------------------------------------------------LLILNK...
OPPC_LACLS/106-293-----------------------------------------------------------------------SFLG.....
Q57M02_SALCH/27-221-----------------------------------------------------------------------SLLG.....
NIKC_ECOLI/89-273-----------------------------------------------------------------------SFLG.....
Q9WYD8_THEMA/94-282-----------------------------------------------------------------------AILG.....
POTH_ECOLI/117-315-----------------------------------------------------------------------ELLGGP...
LPLC_BACSU/93-290-----------------------------------------------------------------------LLYINDSAK
CYST_ECOLI/74-276-----------------------------------------------------------------------IFIAGNIAW
Q9ZBG1_STRCO/128-331-----------------------------------------------------------------------ETVFSWPG.
Q97UH1_SULSO/128-336-----------------------------------------------------------------------EYLFNYAG.
Q97VF6_SULSO/101-289-----------------------------------------------------------------------YYLG.....
LACG_RHIRD/89-270-----------------------------------------------------------------------LIVLQSNDT
Q9HLG4_THEAC/81-265-----------------------------------------------------------------------AFLG.....
MALD_STRR6/87-275-----------------------------------------------------------------------SFLLREK..
GLTJ_ECOLI/43-239-----------------------------------------------------------------------STIG.....
YEHW_ECOLI/68-240-----------------------------------------------------------------------STVGAST..
Q9FAT1_VIBPA/84-268-----------------------------------------------------------------------SFLG.....
Q9A534_CAUCR/67-247-----------------------------------------------------------------------EFVAGSGGA
YEJB_ECOLI/151-361-----------------------------------------------------------------------EVMFSLNG.
YOR2_CALSR/83-265-----------------------------------------------------------------------LVLTSSP..
O66777_AQUAE/114-319-----------------------------------------------------------------------EIIVGWPG.
YEHY_ECOLI/195-381-----------------------------------------------------------------------ALIGAGG..
Q9WXN6_THEMA/92-279-----------------------------------------------------------------------SLIG.....
Q9Y9N0_AERPE/121-339-----------------------------------------------------------------------EATFSWPG.
Q9WY46_THEMA/67-238-----------------------------------------------------------------------EYLCGDSG.
Q9Z6P7_CHLPN/68-243-----------------------------------------------------------------------EWVASQSG.
GLNP_SHIFL/33-218-----------------------------------------------------------------------IVIG.....
Q98K60_RHILO/105-289-----------------------------------------------------------------------ELPTGAVA.
UGPE_ECOLI/91-278-----------------------------------------------------------------------LLIITDVD.
OPPB_LACLS/113-318-----------------------------------------------------------------------ETIFGYPG.
Q49553_MYCHO/234-419-----------------------------------------------------------------------AFLG.....
FBPB_SERMA/341-526-----------------------------------------------------------------------LLLAP....
Q987J0_RHILO/100-280-----------------------------------------------------------------------SFLG.....
Q9CLG9_PASMU/73-248-----------------------------------------------------------------------EWVGSSQG.
Q9PPS8_UREPA/183-374-----------------------------------------------------------------------EQIFQIPG.
PSTA_ECOLI/101-295-----------------------------------------------------------------------LFTA.....
Q98QF6_MYCPU/174-365-----------------------------------------------------------------------EKIFLITG.
MALC_STRR6/209-434-----------------------------------------------------------------------YLFNGGGPG
LPLB_BACSU/104-314-----------------------------------------------------------------------VYLMTNS..
YHDY_ECOLI/173-362-----------------------------------------------------------------------IIIG.....
B3XCM3_ECOLX/104-273-----------------------------------------------------------------------GMVGAGG..
Q9AKQ9_RHIML/112-306-----------------------------------------------------------------------ETIFTIPG.
Q97YP1_SULSO/131-332-----------------------------------------------------------------------EYIFGIPG.
O28506_ARCFU/135-354-----------------------------------------------------------------------ESTFSWPG.
Q98K61_RHILO/75-251-----------------------------------------------------------------------EFFGTPVV.
AMYC_THETU/83-269-----------------------------------------------------------------------SLVINK...
Q9ZGP1_STAAU/117-308-----------------------------------------------------------------------EYIFAWPG.
Q9EWP8_STRCO/101-281-----------------------------------------------------------------------GFLG.....
Q9KKK5_VIBCH/118-310-----------------------------------------------------------------------ESLFSWPG.
YEJE_ECOLI/158-341-----------------------------------------------------------------------DFLG.....
O86691_STRCO/402-574-----------------------------------------------------------------------GFLG.....
Q98QS7_MYCPU/195-382-----------------------------------------------------------------------AFLQLI...
AMYD_THETU/85-290-----------------------------------------------------------------------LSLTAGAP.
O34157_SALTM/115-319-----------------------------------------------------------------------EKVFAYPG.
Q9PL65_CHLMU/67-242-----------------------------------------------------------------------EWVAAQSG.
Q9RX04_DEIRA/318-494-----------------------------------------------------------------------EFTDPNQK.
SSUC_BACSU/94-269-----------------------------------------------------------------------ELMGSSSG.
Q9UYG7_PYRAB/121-325-----------------------------------------------------------------------EIVFNYPG.

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STRPN/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STRPN/166-265--------------------------------------------------------------------------------
Q931U7_STAAM/555-653--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
Q6GIZ0_STAAR/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_CLOD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402......--------------------------------------------------------------------------
A3I1M1_9BACT/289-407......--------------------------------------------------------------------------
A7VH46_9CLOT/421-541......--------------------------------------------------------------------------
A8ABZ3_IGNH4/248-373......--------------------------------------------------------------------------
Q9F443_STRSL/517-633......--------------------------------------------------------------------------
A7H0E4_CAMC5/307-422......--------------------------------------------------------------------------
A3UQ03_VIBSP/269-395......--------------------------------------------------------------------------
A5Z5I3_9FIRM/662-784......--------------------------------------------------------------------------
A8H349_SHEPA/695-810......--------------------------------------------------------------------------
Q9WZG5_THEMA/725-844......--------------------------------------------------------------------------
Q9FBP3_STRCO/657-772......--------------------------------------------------------------------------
Q2CDR4_9RHOB/175-297......--------------------------------------------------------------------------
A6DHZ0_9BACT/321-438......--------------------------------------------------------------------------
A5ZCK7_9BACE/250-369......--------------------------------------------------------------------------
O28455_ARCFU/275-396......--------------------------------------------------------------------------
Q481M7_COLP3/705-820......--------------------------------------------------------------------------
A4YKC0_BRASO/734-849......--------------------------------------------------------------------------
Q0HRW4_SHESR/279-392......--------------------------------------------------------------------------
A7AZK1_RUMGN/757-876......--------------------------------------------------------------------------
Q64W75_BACFR/294-427YP....--------------------------------------------------------------------------
A8AR20_CITK8/231-351......--------------------------------------------------------------------------
A3UCF7_9RHOB/264-386......--------------------------------------------------------------------------
Y684_MYCPN/989-1110......--------------------------------------------------------------------------
Q2RPK1_RHORT/279-403......--------------------------------------------------------------------------
A6H1M7_FLAPJ/284-410......--------------------------------------------------------------------------
A8G4C7_PROM2/272-386......--------------------------------------------------------------------------
A0PQZ2_MYCUA/174-295......--------------------------------------------------------------------------
Q4QBC9_LEIMA/977-1097......--------------------------------------------------------------------------
Q025M3_SOLUE/351-471......--------------------------------------------------------------------------
Q54MT9_DICDI/545-666......--------------------------------------------------------------------------
Q6MGV4_BDEBA/659-778......--------------------------------------------------------------------------
A6L8W9_PARD8/653-767......--------------------------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644......--------------------------------------------------------------------------
A4CDR0_9GAMM/687-801......--------------------------------------------------------------------------
Q01VW7_SOLUE/1278-1396......--------------------------------------------------------------------------
A3I5H5_9BACI/646-767......--------------------------------------------------------------------------
A5USK7_ROSS1/311-433......--------------------------------------------------------------------------
Q9A6K3_CAUCR/352-465......--------------------------------------------------------------------------
Q72UY4_LEPIC/260-379......--------------------------------------------------------------------------
Q5V3A9_HALMA/874-995......--------------------------------------------------------------------------
Q8NS27_CORGL/613-739......--------------------------------------------------------------------------
B1JTM3_BURCC/259-376......--------------------------------------------------------------------------
A7AFS2_9PORP/465-579......--------------------------------------------------------------------------
A8F9W5_BACP2/316-420......--------------------------------------------------------------------------
A8HA97_SHEPA/673-786......--------------------------------------------------------------------------
Q97DB8_CLOAB/716-835......--------------------------------------------------------------------------
A6F274_9ALTE/258-378......--------------------------------------------------------------------------
A7HK62_FERNB/257-383......--------------------------------------------------------------------------
B8FRQ9_DESHD/291-412......--------------------------------------------------------------------------
A1TXE6_MARAV/183-306......--------------------------------------------------------------------------
Q93H51_STRAW/242-364......--------------------------------------------------------------------------
Q54290_STRHY/294-451SAQHKI--------------------------------------------------------------------------
Q830M8_ENTFA/579-698......--------------------------------------------------------------------------
Q81N14_BACAN/248-369......--------------------------------------------------------------------------
A7B7J6_RUMGN/273-419TKGIQH--------------------------------------------------------------------------
Q5LCL1_BACFN/272-387......--------------------------------------------------------------------------
Q9KF85_BACHD/539-650......--------------------------------------------------------------------------
A3D8C2_SHEB5/283-407......--------------------------------------------------------------------------
A1SKN4_NOCSJ/300-416......--------------------------------------------------------------------------
A7VFS5_9CLOT/263-395VS....--------------------------------------------------------------------------
Q5JEM5_PYRKO/203-318......--------------------------------------------------------------------------
A7VIB2_9CLOT/622-743......--------------------------------------------------------------------------
Q8G7P9_BIFLO/320-438......--------------------------------------------------------------------------
Q735D4_BACC1/728-843......--------------------------------------------------------------------------
A6BFN6_9FIRM/685-806......--------------------------------------------------------------------------
A4CAI1_9GAMM/683-798......--------------------------------------------------------------------------
A3ZPC9_9PLAN/633-758......--------------------------------------------------------------------------
A9KQT2_CLOPH/343-506AAETNT--------------------------------------------------------------------------
A1ZGZ7_9BACT/274-392......--------------------------------------------------------------------------
Q6F1V8_MESFL/1691-1810......--------------------------------------------------------------------------
Q601V9_MYCH2/401-522......--------------------------------------------------------------------------
B8G588_CHLAD/255-383......--------------------------------------------------------------------------
Q04L09_STRP2/60-182......--------------------------------------------------------------------------
Q048H0_LACDB/280-404......--------------------------------------------------------------------------
A4BXN0_9FLAO/168-283......--------------------------------------------------------------------------
Q9PPU7_UREPA/163-284......--------------------------------------------------------------------------
A5LLD1_STRPN/291-413......--------------------------------------------------------------------------
A6TSQ0_ALKMQ/264-387......--------------------------------------------------------------------------
A7VD43_9CLOT/805-930......--------------------------------------------------------------------------
Q8RTI8_9GAMM/277-411......--------------------------------------------------------------------------
A5N346_CLOK5/473-593......--------------------------------------------------------------------------
Q053J3_LEPBL/252-373......--------------------------------------------------------------------------
A7H957_ANADF/284-394......--------------------------------------------------------------------------
A1SH34_NOCSJ/769-890......--------------------------------------------------------------------------
A6LCJ9_PARD8/285-395......--------------------------------------------------------------------------
B8I8J6_CLOCE/296-424......--------------------------------------------------------------------------
Q6AA47_PROAC/602-722......--------------------------------------------------------------------------
Q4MWW1_BACCE/235-351......--------------------------------------------------------------------------
A6NZ14_9FIRM/176-297......--------------------------------------------------------------------------
Q6MT15_MYCMS/562-682......--------------------------------------------------------------------------
A4VW57_STRSY/998-1117......--------------------------------------------------------------------------
Q18EP9_HALWD/299-419......--------------------------------------------------------------------------
Q8EUA2_MYCPE/1360-1480......--------------------------------------------------------------------------
A5MD01_STRPN/302-451GVAKQA--------------------------------------------------------------------------
Q47EZ3_DECAR/243-372......--------------------------------------------------------------------------
Q034M7_LACC3/404-519......--------------------------------------------------------------------------
A3I2Y5_9BACT/746-861......--------------------------------------------------------------------------
Q0RJL1_FRAAA/639-753......--------------------------------------------------------------------------
Q7UPA2_RHOBA/581-706......--------------------------------------------------------------------------
Q8A9F6_BACTN/266-381......--------------------------------------------------------------------------
A4C0M9_9FLAO/275-395......--------------------------------------------------------------------------
Q14QM1_SPICI/154-274......--------------------------------------------------------------------------
Q97LN0_CLOAB/737-854......--------------------------------------------------------------------------
A3ZPB7_9PLAN/791-914......--------------------------------------------------------------------------
Q737Y3_BACC1/256-376......--------------------------------------------------------------------------
A7VDT8_9CLOT/311-424......--------------------------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923......--------------------------------------------------------------------------
Q899W1_CLOTE/250-369......--------------------------------------------------------------------------
Q4DFN5_TRYCC/444-565......--------------------------------------------------------------------------
A7ADY9_9PORP/281-400......--------------------------------------------------------------------------
A7ADZ2_9PORP/274-398......--------------------------------------------------------------------------
Q2SRI5_MYCCT/367-490......--------------------------------------------------------------------------
Q71YS2_LISMF/59-181......--------------------------------------------------------------------------
Q638M9_BACCZ/706-820......--------------------------------------------------------------------------
Q8KD33_CHLTE/268-389......--------------------------------------------------------------------------
A7GNK2_BACCN/187-299......--------------------------------------------------------------------------
A3JAL8_9ALTE/692-813......--------------------------------------------------------------------------
Q6F163_MESFL/1281-1400......--------------------------------------------------------------------------
Q6AMB4_DESPS/278-415T.....--------------------------------------------------------------------------
A7K544_VIBSE/291-411......--------------------------------------------------------------------------
Q2SSK7_MYCCT/644-765......--------------------------------------------------------------------------
A3QAU8_SHELP/312-429......--------------------------------------------------------------------------
Q6F1W1_MESFL/1301-1420......--------------------------------------------------------------------------
A6LZM8_CLOB8/286-398......--------------------------------------------------------------------------
A7VI29_9CLOT/290-409......--------------------------------------------------------------------------
Q6UCA9_BACFG/30-146......--------------------------------------------------------------------------
Q2ST97_MYCCT/1669-1788......--------------------------------------------------------------------------
A7AE18_9PORP/286-404......--------------------------------------------------------------------------
A7V9H5_BACUN/291-408......--------------------------------------------------------------------------
Q6GDI1_STAAR/59-180......--------------------------------------------------------------------------
A8FMY2_CAMJ8/150-267......--------------------------------------------------------------------------
A7ZGQ8_ECO24/256-370......--------------------------------------------------------------------------
A7VI30_9CLOT/297-409......--------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355ATIRLA.LRPKALHEMRLQP............................................................
Q1CSH4_HELPH/4-343LHLRNK.LKSFNSNDAAYLQGT..........................................................
A5TUK8_FUSNP/11-360SNLYKD.DPSNFIRASAEDP............................................................
Q4UQP7_XANC8/6-349NDVALP.DRTKAHDANDP..............................................................
A4N619_HAEIF/7-355ETWETS.LTPDKLGAVSLRP............................................................
A4JGZ3_BURVG/5-348YGVKIT.STPVTNVPTT...............................................................
Q118T4_TRIEI/24-389KKLKLS.TAPLDLAGKRRTY............................................................
A0LEN9_SYNFM/39-391YDLSLS.LDELIGSARGSKMNK..........................................................
A6EGW2_9SPHI/13-364KDTILD.MRPDDFSAYDNIF............................................................
Q72LM8_THET2/4-334LPFPAR.FRPKESLGSRDPY............................................................
A3UJ93_9RHOB/6-356TKVELT.LFVDNTASLFFKE............................................................
Q66F08_YERPS/5-354YQAVIG.HKQVQQSSNGA..............................................................
Q4HT94_CAMUP/6-348LETLEG.FKPKLAKSVASG.............................................................
Q92FY2_RICCN/24-375LMIKLQ.NDNPLVSQRTKHNKEA.........................................................
A3ZYQ2_9PLAN/6-385HRSPSK.ILSSRIPQVLREERQIVQTQKEADIAWSAF...........................................
A8A4E0_ECOHS/6-354LAWQSA.FTSMDLDELSMPG............................................................
A7HYF9_PARL1/7-370YTYDLS.QYMEDEPTLSYEG............................................................
Q8DIL4_THEEB/18-374QEIRLP.RPAQSQPLRPTDV............................................................
Q82W93_NITEU/6-348M.IYFN.ENDQAQNYRR...............................................................
A0LB31_MAGSM/6-364MPWAIN.LEKEQIKRATPQP............................................................
Q6MKD0_BDEBA/11-364YDVRFS..EPQNIEEKAKSP............................................................
Q4HIC5_CAMCO/6-341LIVNTQ.FNDQNLQTKKFYEYW..........................................................
Q6FFD6_ACIAD/9-354QPFSLA.LQPKYVHMVTIDP............................................................
A7ADX1_9PORP/9-487RDILIE..FDANFSRTDESFMQNQFMGKNMHDLQIFIDSVSVRLDSIQNVNAKNVYETSYKKTLKKPQDIKQNNVKDDSN
Q0C1U6_HYPNA/7-346TFWTSP.QTPESLQLLLSPP............................................................
Q11U59_CYTH3/9-455TKIVFN.LSSFDLKKTKEELFMGSRQMKGVDELDHHIDSIQRMFVSVNKNSSGMLQPFYYYTTVNPLDSTKNKAVEH...
Q7P2I8_FUSNV/6-353KKVVLT.AYFQDLNIKIKDV............................................................
A1AWC7_RUTMC/20-369LQIIDG.KMQKSISTVTKV.............................................................
Q73NV9_TREDE/13-373VVYGES.ITYNVLAKDVAPKFISSSGP.....................................................
A3SQ70_9RHOB/5-359LTIRAA.LTRDRIIDSFGKP............................................................
Q1PXZ0_9BACT/7-354LEFVSS.VTPLELGKKKLDS............................................................
Q1VZU1_9FLAO/6-482YILNID.LSGFNDVDLDDESLKHPYKMLNTSELRIQLDSFSIDYVKGRERLNRLINQRSGLQRTLNSAIKLDSSSRRKIN
Q1GR36_SPHAL/14-363IVAAPN.VRPDQFTLADVDG............................................................
Q8G1M6_BRUSU/6-359YAFDLN.QFASAGDDFVIFA............................................................
A5EXI6_DICNV/8-348FAHGSL.HLSQSPPSAQQRL............................................................
Q7VQS8_BLOFL/9-358YEWNTT.LTPAILSMITVNP............................................................
Q85G79_CYAME/6-326MEWPTAWISQQQWQPMWMNV............................................................
A6C004_9PLAN/10-385EIIQPG.PEPNEIFIVTDVGCDQLCNRNFS..................................................
Q2PY37_9BACT/6-356LDSSFA.FLPQQFSSNNRGI............................................................
Q310A0_DESDG/6-352LPIEQD.VKAFSIVDPRGDP............................................................
A3XBE3_9RHOB/6-359FSYDIS.SLANQSTAAIRNI............................................................
Q1NXF0_9DELT/6-358RQLALP.EEPADFFIPPYAL............................................................
Q2JVE3_SYNJA/13-373KPLEVS.QDLAALMQPPVPP............................................................
Q5SL96_THET8/6-344TLARFQ.RGELVLKDLTFDPWQNPA.......................................................
A6EIS0_9SPHI/6-447TDQKFD.ISSFNMKRTDEQGFRNNTQMLNLKGLTKKQDSLTKDLDSTNKYNATVINNYFKQNTYVKGYTRVKAIPKVIKG
A7NDI7_FRATF/5-351KAIYTI.FDNSDRDYNHNRV............................................................
Q6MJL5_BDEBA/6-356KSIVMA.EDSKDLQSAGQTA............................................................
Q0F2Q6_9PROT/5-349YQVSIA.LPAGNRKILHSNDHV..........................................................
A5WBH3_PSYWF/27-466YRISIN.QPPADVLTEENV.............................................................
E0TCF8_PARBH/6-360IEVPVA.IDLRLLDQDRQTA............................................................
Q984S3_RHILO/7-356DRVPTN.LKPEFVQERLARP............................................................
Q2S3I0_SALRD/55-410LDTTLQ.VYPRDLARSKNDV............................................................
Q1IRI3_KORVE/435-789ETIALAAEPPAYFKKEVRQS............................................................
A3ZKX1_9PLAN/6-376RDGSVFVLMPQDNAWLAPNQCFVV........................................................
Q8FDM9_ECOL6/6-352LQLHLN.PLDQSPNVKR...............................................................
Q054H5_LEPBL/30-383KEYELP.EDPTYFKIPAGSV............................................................
A1WAC0_ACISJ/11-359YVEDFS.KTRAPYRDRGETA............................................................
Q1CRE0_HELPH/5-350FKTLKN.FRPKVLDTIYQNK............................................................
A3YF37_9GAMM/6-351ESLTMT.FKPEHLYLATQEP............................................................
Q8D296_WIGBR/5-350YQIELF.NTFSRLKEPSS..............................................................
Q6MDI9_PARUW/8-358YEFKNLLFNQELLQSAILDP............................................................
Q9A939_CAUCR/5-350TSWPTA.LRPQDVQGLFGD.............................................................
Q0SM43_BORAP/5-351GTGIIK.LEPDYIRTVMLSS............................................................
Q1D894_MYXXD/7-356AEYDLG.VAVTAFRIRPGRP............................................................
A6CDW2_9PLAN/6-388RHMSVK.SIKSELVDLSEKK............................................................
A4BIX3_9GAMM/5-349MQLRIE..........................................................................
Q1QKW5_NITHX/6-356NAFDMS.KFSNRGHDVVYGI............................................................
Q5H4N0_XANOR/38-393LPWQSQ.LNPAALAAGLAKP............................................................
A6DAN3_9PROT/6-318MEINQL.IPKVKISIFNFKD............................................................
Q143Z1_BURXL/6-377YSLRSE.LTPQILSVLLVSP............................................................
Q68VX9_RICTY/9-358LTIQTN.LSINSLVNKFMRP............................................................
A5PCY0_9SPHN/10-365HDLPIDLPAIEEFRARGEDE............................................................
Q0FGB6_9RHOB/5-362LKIKTE.ITPTQLLDGYASP............................................................
B5EBA8_GEOBB/11-361YNLRVALADGSNKATRKV..............................................................
A4BIX2_9GAMM/6-351SWENAV.FTPELVRNLALES............................................................
A6DH34_9BACT/8-357LRNDIK.DDPIILSNIDELK............................................................
A3I2C6_9BACT/6-354MDTTLS.ITPDDFDLPENHH............................................................
Q2RQ55_RHORT/8-372YAVDLG.GKAASTEMRFREE............................................................
A1WUU9_HALHL/6-348WAWQGA.LSPDVLAVVVADP............................................................
A3ZM39_9PLAN/6-376QVEPFV.HQITQLGTLDQDLNSASP.......................................................
Q0AH24_NITEC/6-352LQWHSF.LGPEDIATLTKPP............................................................
A5G1T7_ACICJ/24-378NLISLA.KPTGVTRKLAPKT............................................................
Q1NXE9_9DELT/10-360YNLEIP.LDSPTLGPPGR..............................................................
Q3B4Y3_PELLD/6-432HRFVFE.STGFGFSRSSENRARSGGHELSARELLSVAEEYRQQVEVAE................................
Q0BZX3_HYPNA/9-369LAIPTS.LDAVRLLDEYASP............................................................
A2U291_9FLAO/6-450KEYEFN.IDIGDTLDEGQLDSINSATIPMMLTLDQIKDTIPMLKDNYDEILGLRAKNIFISTSAKDLYEYPDSLKNKSLD
Q0BKY7_FRATO/8-349AVWSNP.LPISVAKVITINDN...........................................................
A0LB30_MAGSM/6-357YDLELGIAFETESSSGDRAI............................................................
E0TCF9_PARBH/51-404TAVDLA.AFDRGSGGRSLDE............................................................
Q1K323_DESAC/6-357LRLLPLKKTPEDFGTVSGKN............................................................
A5EXI7_DICNV/7-348THWQNR.ILPATIAQLMQLK............................................................
B8CYZ1_HALOH/12-360MEIKIN.TEVHNFFADQKTP............................................................
Q1MPZ1_LAWIP/7-360YLVRIP.LTTLLKNINFNELRP..........................................................
A3EV76_9BACT/6-358MDTTLT.RRPVDFTYEKTRM............................................................
Q5X1R0_LEGPA/5-353YKSKLP.NPTVVMHDDA...............................................................
A8ZZ83_DESOH/6-356LKIELD.LLPEDLDRAAESA............................................................
A8EWU1_ARCB4/5-331MYINDS.ISTAKTTVFTTTY............................................................
Q0F2D4_9PROT/6-348MEVKSA.IGPETADLPKP..............................................................
Q04UA4_LEPBJ/109-561GEMDYNIPKGKEKKTLELNVKPETFSMPVLFQIRNNIESEGLEKIPGLETLKEMGVEIKGLIGLKQMV............
Q1PWZ7_9BACT/56-571LNKKQK.HLESELKKSKQNLERQKSKIDGLANESKLANNYILVATENLMQLKRENKAGYYIADDIDLKLMEIKETIEREK
Q31ET4_THICR/6-346FDRFEG.FLPEIQSTSTAQQV...........................................................
A3EV77_9BACT/6-356YDLTIFGKSAGTTA..................................................................
Q1IZ54_DEIGD/6-380TAVQEV.FPNVVLPEDASSTLNLDTGLS....................................................
Q1J2D3_DEIGD/10-350TDTLRPPQPPA.....................................................................
Q2S0T8_SALRD/7-449HRIRFT.LSNVVFRRSESEETARSTRTMRTPRLLDTLDSLKTERDARYQTLYERTQ........................
A4A3Y2_9GAMM/5-358FGQRL