Sequence alignment for CL0404

PF07242

A7GQL2_BACCN/621-721--------------VLFVALLGYLF-------------------------------------------------------
A5MAB6_STREE/576-675--------------ILTLSTA..IL-------------------------------------------------------
Q9L651_LACLL/549-647--------------SIALISS..TF-------------------------------------------------------
A5M6X5_STREE/166-265--------------IVGIASS..LL-------------------------------------------------------
A7X0R3_STAA1/555-653--------------IIIAIIL..II-------------------------------------------------------
G6KLU1_STREE/155-254--------------VLGIATS..IL-------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------IINVFIL..LI-------------------------------------------------------
Q926X5_LISIN/619-718--------------IILAISS..YS-------------------------------------------------------
B1BGL8_CLOPF/619-718--------------VILLAVI..SI-------------------------------------------------------
Q9KG35_BACHD/612-712--------------VLTATIA..LF-------------------------------------------------------
B9WU46_STRSU/561-660--------------ILGIFTS..IL-------------------------------------------------------
Q9CJI4_LACLA/565-662--------------VILIFLS....-------------------------------------------------------
G2KCB9_LISMN/620-718--------------ILALCLC...S-------------------------------------------------------
Q896P1_CLOTE/604-706--------------LLLLVSI..SI-------------------------------------------------------
Q892J9_CLOTE/609-706--------------IML......VI-------------------------------------------------------
A8AXA7_STRGC/592-691--------------IFGMATS..IL-------------------------------------------------------
Q9CE29_LACLA/560-659--------------IITIIVI..SF-------------------------------------------------------
Q181M6_PEPD6/617-718--------------IIIIAIS.NLM-------------------------------------------------------
A7GNK2_BACCN/616-716--------------IVTLILS.NLL-------------------------------------------------------

PF02687

O50782_BORBU/276-402------------MFILVLISLLIFI-------------------------------------------------------
A3I1M1_9BACT/289-407------------GIVALLLIAIGVI-------------------------------------------------------
A8ABZ3_IGNH4/248-373------------EVMSEISWAVVTI-------------------------------------------------------
Q9WZG5_THEMA/725-844------------KFIFLFGFLSASS-------------------------------------------------------
Q9FBP3_STRCO/657-772------------FVGAACVLALIGA-------------------------------------------------------
O28455_ARCFU/275-396------------VLFPAFFILVSIF-------------------------------------------------------
Q481M7_COLP3/705-820------------SGFAVMIILLAII-------------------------------------------------------
A4YKC0_BRASO/734-849------------RGASAVTLISAIL-------------------------------------------------------
A8AR20_CITK8/231-351------------AMIGVLMVAAVFL-------------------------------------------------------
Y684_MYCPN/989-1110------------VVIAAFLSILALY-------------------------------------------------------
Q2RPK1_RHORT/279-403------------VSAVGGLGAFGLM-------------------------------------------------------
A6H1M7_FLAPJ/284-410------------IVILVIMIVVSTI-------------------------------------------------------
Q4QBC9_LEIMA/977-1097------------YFTSVICITLCAF-------------------------------------------------------
Q025M3_SOLUE/351-471------------VAAAGFLLVIACA-------------------------------------------------------
Q54MT9_DICDI/545-666------------NLIVFVFLLLSIL-------------------------------------------------------
Q6MGV4_BDEBA/659-778------------AILLLFAVTISGA-------------------------------------------------------
A6L8W9_PARD8/653-767------------IVFSIIAILISLL-------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644------------NIVVIIFLVVSLI-------------------------------------------------------
Q01VW7_SOLUE/1278-1396------------LLLGVVATVLATT-------------------------------------------------------
A5USK7_ROSS1/311-433------------ALFAVPLLVVIGY-------------------------------------------------------
Q9A6K3_CAUCR/352-465------------GFSAFLGLLIGVA-------------------------------------------------------
Q5V3A9_HALMA/874-995------------GVLVVLSALSTVG-------------------------------------------------------
Q8NS27_CORGL/613-739------------SSLASSAALTAVA-------------------------------------------------------
Q97DB8_CLOAB/716-835------------KAFPIIALIIGAF-------------------------------------------------------
A7HK62_FERNB/257-383------------SGFSILS...SFL-------------------------------------------------------
A1TXE6_MARAV/183-306------------DALGVLVLLITSL-------------------------------------------------------
Q830M8_ENTFA/579-698------------LYVSMFVAILALF-------------------------------------------------------
Q5LCL1_BACFN/272-387------------AMAGVLVIVCSLF-------------------------------------------------------
Q9KF85_BACHD/539-650------------VLIAGLFLFVSIS-------------------------------------------------------
A1SKN4_NOCSJ/300-416------------PLLMAQLGLLALV-------------------------------------------------------
Q5JEM5_THEKO/203-318------------MSFFYLLLGTALL-------------------------------------------------------
Q8G7P9_BIFLO/320-438------------KTGTIVLVAVGGV-------------------------------------------------------
A9KQT2_CLOPH/343-506------------ITFMIVVMVLGGV-------------------------------------------------------
Q6F1V8_MESFL/1691-1810------------LFLITGIIIISVL-------------------------------------------------------
Q9PPU7_UREPA/163-284------------LSLIVLILLLGIY-------------------------------------------------------
A6TSQ0_ALKMQ/264-387------------FMMTTMVLFISIF-------------------------------------------------------
A5N346_CLOK5/473-593------------YGFLAIITLVTVL-------------------------------------------------------
A7H957_ANADF/284-394------------AMFLVILSVVSAA-------------------------------------------------------
A1SH34_NOCSJ/769-890------------RVELALAAILVLA-------------------------------------------------------
A6LCJ9_PARD8/285-395------------FSASFLVVLIAVI-------------------------------------------------------
B8I8J6_CLOCE/296-424------------NLFILIFLVVISI-------------------------------------------------------
Q6AA47_PROAC/602-722------------LAAGFLL...ILV-------------------------------------------------------
Q6MT15_MYCMS/562-682------------IVIGIFVLLLSFV-------------------------------------------------------
A4VW57_STRSY/998-1117------------TILVILSILLGLV-------------------------------------------------------
Q18EP9_HALWD/299-419------------IAAFVVALIVGVL-------------------------------------------------------
Q8EUA2_MYCPE/1360-1480------------VSFLSILLIITVL-------------------------------------------------------
Q47EZ3_DECAR/243-372------------LTVLAGAILAFVI-------------------------------------------------------
Q034M7_LACC3/404-519------------RQIALLFIMASMI-------------------------------------------------------
A3I2Y5_9BACT/746-861------------LFSATLSVILALL-------------------------------------------------------
Q0RJL1_FRAAA/639-753------------NVVILTSLPIAGC-------------------------------------------------------
Q7UPA2_RHOBA/581-706------------LALSFFVILAAMM-------------------------------------------------------
Q8A9F6_BACTN/266-381------------SLVAILVLLIGIF-------------------------------------------------------
Q97LN0_CLOAB/737-854------------YTFIIMISLIAVA-------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923------------IYLSLFLSILVLF-------------------------------------------------------
Q899W1_CLOTE/250-369------------VFVSCLIILVSVS-------------------------------------------------------
Q4DFN5_TRYCC/444-565------------TCFVIGIVALCAL-------------------------------------------------------
Q8KD33_CHLTE/268-389------------TVLPTIFLAVAVF-------------------------------------------------------
Q6F163_MESFL/1281-1400------------LIFVLLTTVLLAI-------------------------------------------------------
Q6AMB4_DESPS/278-415------------DLANYISLIASAV-------------------------------------------------------
A3QAU8_SHELP/312-429------------VGLSALFLSVCLV-------------------------------------------------------
Q6F1W1_MESFL/1301-1420------------AIAIVLILSLTFV-------------------------------------------------------
A6LZM8_CLOB8/286-398------------IFRIIIITIIASA-------------------------------------------------------
A7ZBR0_CAMC1/308-420------------.IVSIIALVVSAI-------------------------------------------------------
B2HGJ6_MYCMM/176-292------------..VALVQAVGAIL-------------------------------------------------------
B4EEB5_BURCJ/260-374------------.LVSYVVILIIMA-------------------------------------------------------
B7VH43_VIBSL/274-399------------.LMLGLIIGVAAF-------------------------------------------------------
D4K997_9FIRM/663-783------------.VLSWLVFLFGVI-------------------------------------------------------
D4KYJ1_9FIRM/264-395------------.ILILAIVLFSVV-------------------------------------------------------
D4KYJ2_9FIRM/263-378------------.LFMAVVGLIGFM-------------------------------------------------------
M1FFQ7_9ALTE/689-801------------..MTFVTLVLAAV-------------------------------------------------------
Q0P8Y0_CAMJE/151-262------------.LFLFIIILLAFV-------------------------------------------------------
Q1G8P7_LACDA/281-403------------.IFSLAIMVIAVL-------------------------------------------------------
Q2FUZ2_STAA8/60-179------------.IANFFMALLTFI-------------------------------------------------------
Q5LDA1_BACFN/283-392------------.LLGFAILFAATM-------------------------------------------------------
Q5LFF2_BACFN/296-426------------..ALLALLLVPAI-------------------------------------------------------
Q6MSQ5_MYCMS/371-490------------..FIVLLAVISVV-------------------------------------------------------
Q6MUJ8_MYCMS/1674-1786------------.......MLCASL-------------------------------------------------------
Q79Z83_STRAW/244-362------------..AGGVTAFVSVF-------------------------------------------------------
Q7V1V4_PROMP/275-384------------..GALMGFVVGCV-------------------------------------------------------
Q81HP3_BACCR/241-351------------......FILVAIV-------------------------------------------------------
Q81QE5_BACAN/261-379------------.IISGLLMLIAML-------------------------------------------------------
Q87SX2_VIBPA/293-410------------..VSGFVVIAGLL-------------------------------------------------------
Q8CYG6_STRR6/404-522------------.IFPVVLYAVAAM-------------------------------------------------------
Q8DQ76_STRR6/61-181------------.FGMFVVTLASAI-------------------------------------------------------
Q8DQS2_STRR6/302-451------------NLLFWGSLSFSVL-------------------------------------------------------
Q8EZY9_LEPIN/261-379------------.LLGLSAFFLGGI-------------------------------------------------------
Q8Y6E1_LISMO/60-180------------.SASLMLILFIIF-------------------------------------------------------
R5K905_9CLOT/806-926------------.LSFLVAVILCTV-------------------------------------------------------
R5KJ88_9CLOT/349-467------------....AILLILISY-------------------------------------------------------
R5TSZ9_9FIRM/275-417------------..VLAAIGVFGTF-------------------------------------------------------
R5UPZ8_9BACE/294-410------------.IVAVLILLVALL-------------------------------------------------------
R6WL88_9PORP/155-267------------..GGLITLIISLI-------------------------------------------------------
R6WLH2_9PORP/283-392------------..TGLLLLLCVFF-------------------------------------------------------
R6WYF0_9PORP/288-402------------..SALLILLIACS-------------------------------------------------------
R6X6U4_9PORP/275-397------------.LIGLLILIAAMI-------------------------------------------------------
R7EAJ1_9BACE/292-408------------.LIVIFFVFNVFI-------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355RYIFQQFIKAFLFTALVFVSLFIII.NMIEK-----LGNF.MDHH..VSALEI---------------------------
Q118T4_TRIEI/24-389RYIIAELIGPFLFGVGLFSSLGITVGAMFEL-----VRKV.TESG..LPISIA---------------------------
A0LEN9_SYNFM/39-391RYLIKEQMVPLGVCLMGVSLVLITG.RLFQL-----LKVL.FTSS..FTLGDL---------------------------
A7HYF9_PARL1/7-370RYLFFQTLGPFVVASVVLSGIIWLT.QALRM-----LDVL.ITQG..QTLLTF---------------------------
Q8DIL4_THEEB/18-374QYLLSLLLPGFVLGLTVFTTLALTVGTIFDL-----VRQI.ADAQ..LPLTIL---------------------------
Q82W93_NITEU/6-348RYITRELLFPFIVVTVILIGLFVSF.SVARF-----LTSA.VTET..LGTAAM---------------------------
A0LB31_MAGSM/6-364RYLLQLFLQGFVKVFSIFIALFFLM.DGAEQ-----IRRFGGRDH..VIWQDM---------------------------
Q6MKD0_BDEBA/11-364QYIFFEMLPSFILGLLVFVSIILMF.QVLRL-----TEFA.LVHG..VAMKTI---------------------------
Q6FFD6_ACIAD/9-354KHVTKTTALAMLGTTIVLVILQVLF.TYLGE-----LSNL..KAD..YSAWQA---------------------------
Q0C1U6_HYPNA/7-346RYLSWLFLQRLLVTVFALVALLGVL.DALSN-----ADKL..PAG..AGFEGQ---------------------------
Q11U59_CYTH3/9-455LLVLKAFFGPFILTVFVVTFIFLMQ.TILKY-----IDEL.VGKG..LSYLDY---------------------------
A1AWC7_RUTMC/20-369RYLMRNVSVLLSVVFIVISLVVFGN.QLVLI-----IKET.SKEG..IPIADL---------------------------
Q73NV9_TREDE/13-373VYVFKELLLYFIVSFLFFFFIFFVN.QILLM-----AEEI.LSKK..APTKDV---------------------------
Q1GR36_SPHAL/14-363LYVGRLFLFRTFAILFALVLILQTL.DLLGE-----SGKILAVPG..NGDSDV---------------------------
A5EXI6_DICNV/8-348RYMMREISALFLAITMILLTIIISF.RFSSL-----LSRA.LDGS..VSLAAI---------------------------
Q7VQS8_BLOFL/9-358RYIKKYVLLNIFMIFLIFISLSSII.RLVDE-----LRNF.QKQT..YSVFEI---------------------------
Q310A0_DESAG/6-352RYLLRTNLFLTMLTLTIGTGIYLLS.DLFDR-----LDDF.LGAG..LGLKVI---------------------------
Q5SL96_THET8/6-344RYLLRETLPLFGGGLLVIVLLFLGG.AVYEV-----LAPL.VAKG..ADPYTL---------------------------
Q6MJL5_BDEBA/6-356RYTAWLFVGYFVGGLLVFLTLFTAV.DAMST-----MVNY...KD..VAPSAL---------------------------
A5WBH3_PSYWF/27-466RYMTRQVASTTALVLGFLVVLLLGG.RMIRY-----FGIA.AEGR..LDVGLL---------------------------
E0TCF8_PARBH/6-360GYLAKRTLGGVLGLLLVIWLIVVSV.DLIEA-----MRDIARIPG..AGPIAA---------------------------
Q984S3_RHILO/7-356RYFFFRYVTITIWFFLGLLALVFLI.DFTEL-----SGRTTGLPG..FTYGTA---------------------------
Q2S3I0_SALRD/55-410RHIIKRLLKGFVLFVGALLVFFIVL.HWVEY-----SDDF.LDGG..ATIWEV---------------------------
Q1IRI3_KORVE/435-789DMILRDFLLYFVMVLTTFVMLALVF.TFFEL-----LGDI.VKNR..VSVVML---------------------------
A1WAC0_ACISJ/11-359RYAVRLFAVPLLTALATMLLATMLQ.RLLRL-----FDIA.ASTG..ASIASV---------------------------
Q8D296_WIGBR/5-350KYLIKKILKSQFHILCILFLIFFCQ.KLVRI-----LSSM.SEEL..IPKKII---------------------------
Q6MDI9_PARUW/8-358RYFVSEFIKVFLLFLVCFYGLYVLI.DYASH-----TSAL.PHHHIQLRIREL---------------------------
Q9A939_CAUCR/5-350LYVLRTVATRILGAALILMSVLQIL.DLLDV-----TSDI.LDRG..LGMAGV---------------------------
Q1D894_MYXXD/7-356IYVLRTYLRFALGILAGLVLVFVVV.DFVDR-----AKLY.TGPG...WVWDA---------------------------
Q1QKW5_NITHX/6-356KYIFRTTLASFVVVLVSLTGVIWIT.QALRG-----IDLM.TSQG..QTILTF---------------------------
Q143Z1_BURXL/6-377RYFARQIYLTFIFILFAFSGLFFFF.DLINE-----LNSV.GHGN..YKFQYA---------------------------
B5EBA8_GEOBB/11-361AYIFKEIPTPFLVGMVTFTFVLLMG.RFLKL-----AEMV.VEKG..IPFSDV---------------------------
A3I2C6_9BACT/6-354KLIIKDFLKTYFFVVLMLILIVLVL.DFTEK-----NDSY.IRND..VPSGEI---------------------------
Q2RQ55_RHORT/8-372RYILRNLLVGLAVGSVALIVLIWLI.NSLKF-----LDWF.VNKG..LSVATF---------------------------
A1WUU9_HALHL/6-348GYLARTVIAASLVALAAILALDFVF.SMVDG-----V....ADDG..LDTTTM---------------------------
A5G1T7_ACICJ/24-378RYVFRQLLIGLAVSTLGLVALVWLT.QSLRF-----IQLI.IQHG..LSPVVF---------------------------
Q3B4Y3_PELLD/6-432RYILKSLVGPFFLAFLTIMFVLILQ.FFANF-----ADRF.IGRG..IDFMSL---------------------------
Q0BZX3_HYPNA/9-369RYILRECLSGLVLVLGILLLAILMI.DVVEQ-----MRTIGGDVE..ITLLDA---------------------------
A2U291_9FLAO/6-450KYILKSFLVPFIATFLIVLFVLVMQ.ALWQA-----FENI.AGKG..ISVIFI---------------------------
A0LB30_MAGSM/6-357RYLLTECALTSFTALVVLTTLVLLP.QILML-----VDLW.VNKS..VSVSVL---------------------------
E0TCF9_PARBH/51-404RYIFKQVAVPFLLILACTTAVIWFT.QMLQR-----VDLM.VEDG..GSLLSF---------------------------
A5EXI7_DICNV/7-348RHIARIITAHIIIVLIFLLGIDFLV.QSAEE-----SDNI.GRGN..YHFWLM---------------------------
B8CYZ1_HALOH/12-360VYIIKEVLYPFLIGVSIIGVIMLS..GLLRQ-----LSDLIIIKK..IPVAVV---------------------------
Q1MPZ1_LAWIP/7-360RQIFRESTYIFFLVVGALLTLIIIN.RAIQM-----RDLF.IGLK..LEILDV---------------------------
A8ZZ83_DESOH/6-356RYIIAEILKALAVVMAVVIVIYVAV.DFFEK-----IDDF.LGAG..VPLSRM---------------------------
A8EWU1_ARCB4/5-331RYLYSQLAITFFPIFFGLFFITAVI.FLVKI-----SALT.AIIT..VNFFEL---------------------------
Q31ET4_THICR/6-346KYLYKELFATFFAVLSVLLLITFGT.EATKL-----LAVA.VEGA..IPSTVI---------------------------
Q1IZ54_DEIGD/6-380RYVTRELLPPLVAGTLLFTAILSFG.YFFIS-----SQWL...RG..VPVGLI---------------------------
Q1J2D3_DEIGD/10-350RSVLREVLRWYAAGVALFLILQLTD.ALSTT-----VGVL.LLYH..ATPLEA---------------------------
Q2S0T8_SALRD/7-449WIVLRRLPGPFFGWLGTLMFLLLMQ.FLIRW-----LPEI.AGKG..IPVSVI---------------------------
Q6MDI8_PARUW/7-377RYSINHFLKIVFACVFAFISILLTM..RLDE-----IANF.AALG..APISYI---------------------------
B8CYX9_HALOH/6-362RYLTRELIMPFLFGVAAFTAIFIGT.DILFT-----LTRLYNNFG..VEFTTL---------------------------
Q1IRI3_KORVE/8-376RYILGEVLSHGAIGLALFTFVIFMR.DLGRL-----LELI.VRNS..APLPSV---------------------------
O83854_TREPA/1-358MYVCEVVFKHILVGVLCFFLVFFVN.NVLLF-----AQTL.LTKH..VSAADV---------------------------
Q8D297_WIGBR/7-348RYIRSLIFKTTIVALFILLTISGII.KFSEK-----IQSI.DNSY..ISIFYL---------------------------
Q9AA49_CAUCR/9-364RYLLRRTLAPMSAVLISTMVAFLME.RLMRS-----FDLL.SQTT..EGLRYL---------------------------
Q3J9X2_NITOC/9-352RYILKELSLNATAITLVLLLIFGGI.RFIRF-----LSQA.TEGK..VPGEAI---------------------------
A7IJ85_XANP2/6-384RYIFSTAAVAFLGVVVVLAGMIWAT.QALRQ-----LDLV.TSQG..QTIIAF---------------------------
Q0C1U7_HYPNA/7-360RYLIRSFLGMFAGLTVLAMALLLLE.RLIRI-----TEIV.SGSG..SAFASA---------------------------
Q0BVK4_GRABC/5-352RYAAMAALKAVGLSAIALTALFSLL.EFVQQ-----LASV.GQGR..YGMLDA---------------------------
Q5FU64_GLUOX/35-392IYIARQFMLSTLSMVLALTGLVSLF.DFIDL-----LRRAATRPN..VPASLI---------------------------
Q5FPA9_GLUOX/26-376KALNRALLGRFLLCGAVLVSLLEIL.ALLEK-----TTPI.LNRH..LGFRGI---------------------------
Q1D895_MYXXD/6-362RYLLGELLVPLGVWVAFMFLLLFVM.QFLRG-----TDVL.LGSS..VTLVDM---------------------------
A1AXG9_RUTMC/6-356RYIVKTMAFYTSAVMLVWLGIYAFF.NFLEE-----VTFI.GQAN..YTVFEV---------------------------
A6QBC8_SULNB/6-335GYISSNFTKAFLTIFIPFFLIISLV.YLVKI-----SSLT.AQIQ..INFLEL---------------------------
A6QBZ1_SULNB/12-355RYLAKHYIKNLLAILFGLSFAFAAI.DYFQY-----TEELQGSWN..YK....---------------------------
Q7VQS9_BLOFL/5-358KYIMKEICKNQLIILILLLLACFCQ.KSIKV-----LS...LSNN..IPIYWI---------------------------
Q73NV8_TREDE/6-354RYLLKLFIPTFVVAMLFFILLLQLG.DLFAN-----IVAY.LQNG..AQFKDI---------------------------
B4E8H0_BURCJ/7-345..LQRELAYTAGAVFMVLLTIMLTT.MMIRI-----VGYA.ASGE..IDPRDV---------------------------
J9ZCA2_LEPFM/6-351RYLFVELLPPFVIGLLVLVVLILTQ.QTLMI-----MNLL.VNKG..LSIPTV---------------------------
J9ZCM7_LEPFM/6-356RYIASELFKIFLLCFISLEAIYGVI.DSVEK-----IKDF.LSHH..AALPLI---------------------------
O26028_HELPY/5-350RFVGWYYFKYFLIVLLALELFFVGI.DSLKY-----ADKM.......PDSANM---------------------------
O51747_BORBU/11-425.YIIAEFFKYFLITFLFFFFVFFIN.QILFF-----MRIL.LQNY..VPFFKA---------------------------
O51748_BORBU/7-350..FIKSIILTFLSMNLLFMILIMLG.DLFVN-----LLNY.LEKN..IGLKDI---------------------------
O84846_CHLTR/8-346..LIFRYLKTTVFCTLSLICISIIS.SLQEI-----VSYI..AKD..VPYATV---------------------------
LPTG_HAEIN/7-355RYIGKSILGAIFATLMTLVGLSAII.KFVEQ-----FRSV.GKGT..YDIWQA---------------------------
Q2JLS4_SYNJB/13-367RYLFGEMLTPVLAGVAGGTLLLLVG.RLFTL-----AERL.VEGS..VPPLTV---------------------------
Q2YN46_BRUA2/7-357.YILRRVAIMFFAVLGAAVGITWAV.QVLQR-----INFL.TTSG..QTFQTI---------------------------
Q5NFB9_FRATT/8-349RYIFRTVFSSFLIVSIIFCILFFIF.TYLAQ-----VSNN..TAN..VSNFEL---------------------------
Q5NFC0_FRATT/6-350.YYNKDIVNTFTSITLFIISIVSAN.LLIRL-----FQEA.YSQG..LGIDSI---------------------------
Q5SL95_THET8/4-334RYVLREVLVPYLVGVFLFAALLTFD.LLSSL-----SGVL.LSRG..VGAREV---------------------------
Q7CKF4_YERPE/5-345RYLVRETLKSQIAILFILLLIFFSQ.KLVRI-----LGAA.VDGE..IPTNVV---------------------------
Q8F742_LEPIN/134-585RYILREIFSPFLVSLAFFTMVYMVL.ALQKM-----IGLF.VGKG..VDPFRL---------------------------
Q8F8T0_LEPIN/30-383KYLFGEFFKIFIGTVILLTGIMLLS.LVNDN-----LRNF.TATK..APRYHV---------------------------
Q8PCR2_XANCP/10-365WYVGRAVLFTVLLTWAVLLGLDVVN.AFASE-----AKSI.GQGS..YSFGHA---------------------------
Q8PCR3_XANCP/6-349RYLLSDFTQSFLATLIVLLVVSVGG.VLVDI-----LGNI.ADGR..IPARLL---------------------------
Q8RER6_FUSNN/12-360.....YFIKFFLMNIIGFMGVFLLA.QTFKI-----IKYI.NQGK..LAGGEI---------------------------
Q9X257_THEMA/19-363KYLLKLSVVPFLIGLGGFIVFVSLE.ILYQL-----SDLI.VRHR..VGIEKL---------------------------
Q9ZCH3_RICPR/10-357.YLTKLYSKCFFIILFLLIGLLIIS.NIFDL-----LQKF.KNIY..VPFSFF---------------------------
R6X2Y4_9PORP/1-468..MLQTFLPLFLMTFGICLFIVLMQ.FLWRY-----IDDM.VGKG..LGIPVL---------------------------

PF00528

J7JQQ0_BACIU/107-309GIAGAIFMT...EIAPNWGKKVLQPVIELLV.....GIPSVVYGFIGLTVLVP......FIAQ.................
D4FYT7_BACNB/80-293GVGGGVFMA..EYAPNNKVTDFIRTCIEVLS.....SLPSIV.......IGMF......GLLMF................
A0A017I3G0_ECOLX/116-308SVPLGIWAA...RHRDRLPDFAVRFIAFLGV.....SMPNFW.......LAFL......LVMAFSVYL............
D0KQN4_SULS9/116-318GSYLGSIAG...FNRRSRKDLVILIITSILA.....ALPSFV.......ILMY......LEMWLSVQHGIFLIS......
E8VKF3_BACST/41-224GTVIGLFISLARMSKLALLRWPAKLYISFMR.....GVPILV.......ILFI......LYFGF................
D0KNU1_SULS9/120-341GLFTGAIAA...SNRNKPLDYLVRGVYLVTW.....ASPPFL.......IAVI......LQLVIAYYLRLLPPTGTVNPV
Q9FAT0_VIBPH/116-319GYALGLVAG...LKNKSTLGKCLYYGSWILS.....CLPSFW.......VGII......LIAIFALKLHWFPVG......
Q44374_RHIRD/87-266GSGLGLLAG....LRKGWLDMALSRFVDLVM.....SMPTLI.......LAMM......LL...................
Q9KB56_BACHD/117-308SILLGVICA...MKGGKAIDKSIRGFSFLLM.....GIPSYL.......LASF......MIWYFSVKL............
G4ER62_BACIU/40-211GVPAGILIA.....HFRRLSAWVFAVTNVIQ.....TIPALA.......MLAV......LM...................
Q9LAT6_LISMN/112-304GILLGVIAA...MYQNRWPDYTSTFIAILGK.....SVPSFV.......FATV......LQYWLGAKL............
LACF_RHIRD/87-298MITMALILAAMLNNPKLRYSGLFRTMIF.........LPCVSSLVAYSILFKS......MFSLDGVVNNTLL........
C9MHH9_HAEIF/68-243GFLFGLISAL.LLSFSRQISAVLLPILVISQ.....AIPVFA.......IAPL......LV...................
Q982M9_RHILO/75-250GNLAAVLLAV.LFVHNRILQATYFPIVLFFN.....TIPILA.......LSPI......II...................
D5AW50_RICPP/33-217GLVIGMLLAICKVNKNRVLRLFANFYTSIFR.....GTPLLV.......QLSI......IYFAAPYI.............
G6NR23_STREE/298-492AVPLGSAMA...RFKNTWIDSLSTGALTFLL.....ALPTIA.......LVYI......VRLIGSSIAL...........
D4G528_BACNB/46-230GMILALITALARMSKVRPLRWVFSVYVSAIR.....GTPLLV.......QLFI......IFYLF................
A0A034X2L6_STREE/125-308GVFVGGIWG.....ISKSVDRVMMEVYNVIS.....NIPPLL.......IVIV......LT...................
NRTB_SYNE7/98-276AACTGILVGG.VLGMSKFLGKGLDPVIQVLR.....TVPPLA.......WFPI......SL...................
Q9HIL1_THEAC/131-337GNRLGRYAG...INRNTSKDLAIDVFAMFMA.....SFPAFV.......LAFI......VLDIFSVYGHIFPLGGA....
A5IMY1_THEP1/119-323GNRFGAFVA.....RKKRLDNFALPVFYTLT.....ASPYFW.......FGIL......LAWIFGVVIPLFPLAGA....
A0A017I1I1_ECOLX/90-294SLFFAALVEYIVRGS.........RFYQTLM.....LLPYAVAPAVAAVLWIF......LFNPGRGLITHF.........
C9MH14_HAEIF/93-316GLPLGIISA...VNSEQVFAKSLQILSYVGL.....SIPIFW.......LAPI......LLYVAALSHWEIAAIGQYNLL
C6SR18_STRMN/87-273IPAAAYSIA..RNMSRRKAFNIMYSLLILGI.....FVPFQV.......IMIP......ITV..................
G8PA36_LACLC/106-293GNILGVITG....YFGGRFDLIFMRFTDFVM.....ILPSMM.......IIIV......FV...................
A0A017R3L7_SALET/27-221AVLIGLVGAGAKLSQNRVTGLIFEGYTTLIR.....GVPDLV.......LMLL......IFYGLQIALN...........
A0A017I1V8_ECOLX/89-273GLVIGGSAG....LIGGRVDQATMRVADMFM.....TFPTSI.......LSFF......MV...................
B1L9I4_THESQ/94-282AITIGMLSG....YLGGTTDRILMALTDTFM.....VMPVFP.......LLLL......LS...................
A0A017IYA5_ECOLX/117-315GYPLAWAVA....HSKPSTRNILLLLVILPS.....WTSFLIRVYAWMGILKNNGVLNNFLLWLG...............
E8VDJ2_BACST/93-290QLFFTFTMAYPLAKRHVKGRNLLLNLVIFSMLFSGGMIPTYL.................VV...................
A0A017IAJ7_ECOLX/74-276NGVFGLLMAWILTRYRFPGRTLLDALMDLPF.....ALPTAVAGLTLASLFSVNGFYGEWLAK.................
Q9ZBG1_STRCO/128-331GLLLGVLAA...RRPGSVLDRAVTSLSYTLE.....AAPVFW.......IALL......AVWLFALQWDVLPAG......
Q97UH1_SULSO/128-336GNLLGRVAA...LSRGKISDYAILGLMMFLY.....TFPVFV.......TGEI......LIEVLAIDLHIFPTGGQY...
D0KNZ4_SULS9/101-289GIVVGIIAG....YLGGIIDNILMGITDIIL.....TLPSLI.......LIII......IV...................
LACG_RHIRD/89-270SSLAGYGFE....MFRSKLRERVYTVILLTL.....MVPFAA.......LMIP......LFM..................
Q9HLG4_THEAC/81-265GGLFGIIAG....YRGGYLDEVIMRITDAFL.....SLPALI.......LVIA......LS...................
A0A034X6C1_STREE/87-275QTSIIVLAGYAYSRYNFLARKQSLVFFLIIQ.....MVPTMAALTAFFVMALM......LN...................
A0A009EAC3_ECOLX/43-239AFLVGSFFGILRTVPNRFLSGLGTLYVELFR.....NVPLIVQFFTWYLVIPE......LLPEKIGM.............
B1X7L7_ECODH/68-240GTGAGIAVT...RPWGAEFRPLVETIAAVGQ.....TFPPVA.......VLAI......AV...................
Q9FAT1_VIBPH/84-268ALMLAIIAN.....LNRRWNMLIDFIVDCAL.....SLPSLL.......LLMI......LT...................
B8H0V5_CAUCN/67-247ASLIACGLAL.LVSLNGFLEDAVRPIAVTLQ.....VTPLVA.......IAPL......VT...................
A0A009EN06_ECOLX/151-361SIPLGIRKA...VYNGSRFDVWSSAFIIIGY.....AIPAFL.......FAIL......LIVFFAGGSYFDLFPLRG...
YOR2_CALSR/83-265ILIISSMAAFAFSRFKFALNNLLYSLIIAGM.....AIPIHV.......TLIP......IYVLT................
O66777_AQUAE/114-319SIPLGTLAA...FKENSLFDRFVVGFSYTFM.....SVPSFF.......LAFL......LLFFASKTGILPVGGM.....
A0A017IH56_ECOLX/195-381GVPLGIWCY.....FSTARQGAIFSLLNVIQ.....TVPSVA.......LFGL......LIAPLAALVT...........
Q9WXN6_THEMA/92-279GTIIGSFSA....VKRGIVDDVLMGITNIVL.....TTPSIL.......IAIL......IA...................
Q9Y9N0_AERPE/121-339GVGSGVVAA....FRGGLVDRLLRTSSIVAY.....TLFIPW.......LGLM......LKYVFSIKLGILPTGGRIDPR
J9H1N9_9THEM/67-238GLPVGFFMG.....ISDRVYEFLRPLVTVVQ.....AVPVVS.......WLVV......VI...................
Q9Z6P7_CHLPN/68-243AITLSIVLAT.IMLSYKSAKDLLQPLFILLQ.....CTPMFA.......LAPL......IV...................
A0A009ESA2_ECOLX/33-218GLVIGLLAGFARTFGGWIANHVALVFIEVIR.....GTPIVV.......QVMF......IYFALPMA.............
Q98K60_RHILO/105-289GTALGIIIAV.GIVHVATLDRSLMPWIIASQ.....TIPILA.......VAPM......IIV..................
B1X7Q9_ECODH/91-278KITVSMLSAFAIVWFRFPLRNLFFWMIFITL.....MLPVEVRIFPTVEVIAN......LQM..................
A2RJ51_LACLM/113-318AIPMSIVAA...RNEGKWQDQLWLTYNSITF.....GIPPYV.......FYLL......IIFIFGYSLNWFPTGG.....
Q49553_MYCHO/234-419GISIGAFLG...FYAGKLIDTIIMRVIEIFL.....APPTLI.......WILL......FV...................
FBPB_SERMA/341-526ITLCAIPMAWLSVRYPARLYRVLEGCNYVTS.....SLPGIV.......VALA......LVTIT................
Q987J0_RHILO/100-280GVVLGMTAA....VIGGWVDTCLSRFLDAMN.....SIPSKL.......FGLV......VV...................
Q9CLG9_PASMU/73-248GVSLGLISAL.LLSASDYLSKLLLPLLVISQ.....AIPVFA.......IAPL......LV...................
A0A024F9P0_UREPR/183-374GIPLGIFVG...RKPGGILDSVSTVIISVIS.....AVPSLV.......FGLI......LLLIGKEVG............
A0A017I1M5_ECOLX/101-295GIMAGIYLA..EYGRKSWLAEVIRFINDILL.....SAPSIVVGLFVYTIVVA...........................
Q98QF6_MYCPU/174-365GVPLGIWVG...KNPGKFLDNASTVVVSIFS.....SIPSLV.......FSLL......LLLIGRAFG............
B2IN26_STRPS/209-434QIVIGIFTAIIANQPFIKGKRIFGVIFLLPW.....AVPAFITILTFSNMFND......SVGAINTQVLPILAK......
J7JKK3_BACIU/104-314AFPAPLILA...LLLNEVRKAVYKRCIQTFI.....YVPHFVSWTIVVSITFV......FFTVDTGVINKLI........
A0A017I2Z6_ECOLX/173-362ALPWGILLALGRRSHMPIVRILSVIFIEFWR.....GVPLIT.......VLFMSSVMLPLFMAEGTS.............
A0A023YPW1_ECOLX/104-273SIPFGLMSA..ENLVPWWVYQPVRRLMDACR.....AINEMV.......FAML......FV...................
F6C4B4_SINMB/112-306GVITGTIAA...LRQNSFLDFAVMSVSTIGV.....TVPNFV.......VGPV......LTLIFAIVLA...........
Q97YP1_SULSO/131-332AIVVGAYAA...LKRNKAVDHIISNYMILQY.....NIPGFF.......ILAV......LWVVFAVYIKAIPI.......
O28506_ARCFU/135-354GVATGSIAA...FRRGSKVDSGMRIYSIVAY.....TLFIPW.......FGML......LQMLFGVYLKVLPIGGRITPG
Q98K61_RHILO/75-251GSGAGFITAI.LADRVPFLRRGLLPIGNMVS.....ALPIIG.......VAPI......MV...................
AMYC_THETU/83-269IAIFSSMTAYALQRVKRKSSVIIYMIFTVAM.....LIPFQS.......VMIP......LVA..................
A0A008AYP3_STAAU/117-308SIILGVVSA...LKRGKFTDRAIRSVAFFLT.....ALPSYW.......IASI......LIIYVSVKL............
Q9EWP8_STRCO/101-281GMTAGVLAA....MVSRRLGDLTVRCVDALA.....VLPALL.......VVLV......LA...................
A0A016X6V1_VIBCL/118-310AIPIGVYCG...KRTDRWADNLALLTSIMIK.....AQPVFL.......IGLG......LVILFALQL............
B1X877_ECODH/158-341GVLAGALQG....YYGGKVDLWGQRFIEVWS.....GMPTLF.......LIIL......LS...................
O86691_STRCO/402-574GVLLGLVPR............VSAPLVDTVN.....AVPPVL.......VALL......VT...................
Q98QS7_MYCPU/195-382GIIVGTYMG...FHIGKKVDNILMRVIEIIN.....SIPWFL.......IFII......LV...................
I3VV06_THESW/85-290INVVGLSLA.....MLVTRKIFARNFMRTAF.....YLPNLIGGLILGFIWNF......IFVDVFQTISDA.........
O34157_SALTM/115-319GVTLGFLAG...RFLHRWPDKMICRISYLLS.....SLPTFW.......IAML......SGAVCRPLAVLPVCC......
Q9PL65_CHLMU/67-242ALLLSISLSV.TMLLFPSIQGVLHPLCVLVQ.....CLPMFT.......LTPL......IV...................
Q9RX04_DEIRA/318-494GGLGGLLLGY.PIAKSRALERFLSPFIVASQ.....STPIVV.......LAPL......LV...................
J7JPW1_BACIU/94-269GAGLGLMIGI.LAGFSKRTELYLDPSLQMLR.....TVPHLA.......VTPL......FI...................
Q9UYG7_PYRAB/121-325GNWLGALAG.....KNKKYDKYLMPVFYFLA.....SIPYFW.......FAMV......LVYFLGVKLNIFPYQGA....

PF07242

A7GQL2_BACCN/621-721----------------------------------------------ISM--FTTLNYLE-----QYKLKHTIKIIHGYSY
A5MAB6_STREE/576-675----------------------------------------------LFD--SMNLLYFE-----QFRRELMIKRLAGMTI
Q9L651_LACLL/549-647----------------------------------------------LFY--LMNKIYLY-----QNRKKFAVARISGESL
A5M6X5_STREE/166-265----------------------------------------------LFY--SVNLLYFE-----QFRRDILIKRISGLRF
A7X0R3_STAA1/555-653----------------------------------------------IIL--FDVKYYFE-----QHRKLLVIKKLYGYST
G6KLU1_STREE/155-254----------------------------------------------LFN--TMNRLYFE-----EFRRAIFIKRIAGLRF
A0A028VRZ0_STAAU/545-643----------------------------------------------ATV--FETIQYFS-----WNKKQLLLRKIHGYSL
Q926X5_LISIN/619-718----------------------------------------------FMI--LLVLSYYR-----ENLYKQLIYHVFGYSF
B1BGL8_CLOPF/619-718----------------------------------------------IIL--QNTSLYFN-----QNKNKIIVKKLHGYRL
Q9KG35_BACHD/612-712----------------------------------------------MIV--QSSHLLFA-----QHKKRFLLRRLFGHSL
B9WU46_STRSU/561-660----------------------------------------------LFN--TMNLLYFE-----TFKREIAIKRIAGMRF
Q9CJI4_LACLA/565-662----------------------------------------------MIL--TTTVFYFE-----TYKKKIAVKRLYGISF
G2KCB9_LISMN/620-718----------------------------------------------FMV--LLVLSYYR-----ENLYKQLIYHVFGYSF
Q896P1_CLOTE/604-706----------------------------------------------III--QNIYTFFE-----QFKVYLAIKQLHGYKK
Q892J9_CLOTE/609-706----------------------------------------------IVT--QSVLSFFE-----QYKKIISIRSFHGYKS
A8AXA7_STRGC/592-691----------------------------------------------LFN--TMNFLYFE-----EFRKPIFLKKIAGMDF
Q9CE29_LACLA/560-659----------------------------------------------FYI--LLHVLYFT-----HFRRTIVIKFISGMPN
Q181M6_PEPD6/617-718----------------------------------------------ITY--NIVASYYE-----RNKYKLYIKKIFGYST
A7GNK2_BACCN/616-716----------------------------------------------LTY--NVVATYYQ-----KNKFKLYVQKLFGYSA

PF02687

O50782_BORBU/276-402----------------------------------------------AFF..QIMTALSI.....ERTRELGTLRAIGLTK
A3I1M1_9BACT/289-407----------------------------------------------NYV..NLATAEAT.....ERNKEVGLRKVMGAGR
A8ABZ3_IGNH4/248-373----------------------------------------------VLL..IVSVIYIE.....RNVREVATLRSIGASL
Q9WZG5_THEMA/725-844----------------------------------------------GLL..LFVLKSYF.....SRIKIMGTLRAVGMKI
Q9FBP3_STRCO/657-772----------------------------------------------SLL..VSQLEQLR.....ERKKLLSALVAFGTRR
O28455_ARCFU/275-396----------------------------------------------MTY..ALLSRIFR.....LQLGNIAVMRALGFTR
Q481M7_COLP3/705-820----------------------------------------------VIL..SSINALES.....KEKKKNSVIMSFGFLK
A4YKC0_BRASO/734-849----------------------------------------------VLG..GALAAGHR.....HRVYDAVILKTLGATR
A8AR20_CITK8/231-351----------------------------------------------VIG..NSVRLSIF.....ARRDTINVQKLIGATD
Y684_MYCPN/989-1110----------------------------------------------LTI..LLIKSFIK.....KNQTEFSIIRAGGFST
Q2RPK1_RHORT/279-403----------------------------------------------GGV..AAIQWSMA....ARRRRTIAILGLIGFGK
A6H1M7_FLAPJ/284-410----------------------------------------------NMV..VALLVLVL.....ERTQMIGILKSLGANN
Q4QBC9_LEIMA/977-1097----------------------------------------------MMW..TTFISNVQ.....LNAWTFGVLRSLGFRT
Q025M3_SOLUE/351-471----------------------------------------------NVS..NLLLARWL.....QRDRELAIRSALGGSR
Q54MT9_DICDI/545-666----------------------------------------------LIY..TTLMIDVD.....SMTFNNGVFRMLGAKF
Q6MGV4_BDEBA/659-778----------------------------------------------VLF..NMVRIDVS.....EKSWELASLRILGFEI
A6L8W9_PARD8/653-767----------------------------------------------GLL..AMSTYFIQ.....QRLQEVSVRKVFGSSN
Q4A9N5_MYCHJ/2523-2644----------------------------------------------ILV..IIASSIIN.....ENQQNIAILDVLGYAN
Q01VW7_SOLUE/1278-1396----------------------------------------------GIY..GAVSFAVN.....QRTREMGIRLALGAQR
A5USK7_ROSS1/311-433----------------------------------------------FVL..QVAGMTVA.....RQQQEMAILRSRGSSR
Q9A6K3_CAUCR/352-465----------------------------------------------ITW..QTLRGAIM.....ANIKEFASLRALGVSM
Q5V3A9_HALMA/874-995----------------------------------------------STT..ATFAQGVH.....ARRQAIGIHRSTGATQ
Q8NS27_CORGL/613-739----------------------------------------------IVV..VSLVIVLA.....NRKLQQHALIAIGATP
Q97DB8_CLOAB/716-835----------------------------------------------GVI..NNFFISFI.....ERKRHLAVYASVGMNR
A7HK62_FERNB/257-383----------------------------------------------FIA..SFFGILAE.....ERKISLGVLRAIGYSR
A1TXE6_MARAV/183-306----------------------------------------------LLR..SVFLLGLA.....QRRESLALLYRYGVNR
Q830M8_ENTFA/579-698----------------------------------------------ITGSILMLRQLFSA...VSERQDYVTLKRMGVSS
Q5LCL1_BACFN/272-387----------------------------------------------NYL..TLFVSRLR.....MRGRELGLRKVCGSTN
Q9KF85_BACHD/539-650----------------------------------------------YLA..NRFHFRRH.....TKKEEQELLLDLGWKK
A1SKN4_NOCSJ/300-416----------------------------------------------VLW..LTLLAVTE.....QRRPEVALARLRGRGR
Q5JEM5_THEKO/203-318----------------------------------------------IEV..LVTVAHLR.....GSTREVGTLKALGLPD
Q8G7P9_BIFLO/320-438----------------------------------------------LLLILVLSGVWAS.....KRDDEIGMALVSGVTR
A9KQT2_CLOPH/343-506----------------------------------------------ILL..LLTSISIR.....ERKYEIGVLRAMGMKK
Q6F1V8_MESFL/1691-1810----------------------------------------------IIT..IISDVYIM.....KYHRFMVTMKALGYSN
Q9PPU7_UREPA/163-284----------------------------------------------FVT..SSIKNMIN.....KNKVMFGAMQAQGVSR
A6TSQ0_ALKMQ/264-387----------------------------------------------IIY..STFKVIAV.....ERLPVIGTFRSIGATK
A5N346_CLOK5/473-593----------------------------------------------NIM..NSISMSVS.....ARIKQYGAMRAVGMDE
A7H957_ANADF/284-394----------------------------------------------VVA..FIIYTMTA.....GKIREIAVLKLIGARN
A1SH34_NOCSJ/769-890----------------------------------------------AAT..LVTGLQLA.....ERRRTFAIASALGARR
A6LCJ9_PARD8/285-395----------------------------------------------NFI..NFTMALVP.....ARIKSINIRKILGDSV
B8I8J6_CLOCE/296-424----------------------------------------------GLR..SSIRMNLF.....ERMREFGTLRAIGYSR
Q6AA47_PROAC/602-722----------------------------------------------ACT..AAFVELRW.....GMRRTIAVQQAVGTPA
Q6MT15_MYCMS/562-682----------------------------------------------FIN..FALKKEMN.....ETRRQIGIFKSFGYKV
A4VW57_STRSY/998-1117----------------------------------------------ILY..NLTIINMS.....ERIRELSTIKVLGFHN
Q18EP9_HALWD/299-419----------------------------------------------FTA..TTMGLEIT.....HDRQFIAILSAVGYTE
Q8EUA2_MYCPE/1360-1480----------------------------------------------IIV..IVSSLIIN.....DSFKLAAILKCLGLDD
Q47EZ3_DECAR/243-372----------------------------------------------LAW..EKASGLSA.....EEKREIGILKAIGWET
Q034M7_LACC3/404-519----------------------------------------------ALT..ILFSMNNR.....QRLREVGILKAVGFTT
A3I2Y5_9BACT/746-861----------------------------------------------GLF..GLVSLNMT.....AHIKDYCVRKVFGANT
Q0RJL1_FRAAA/639-753----------------------------------------------SLA..VSVVAGLN.....DRRRPFSLLRLAGAPL
Q7UPA2_RHOBA/581-706----------------------------------------------LIA..LLLRLGVI.....QRLSEFGTLLAVGFTP
Q8A9F6_BACTN/266-381----------------------------------------------NFM..SLYTVILL.....KRGKEFGLKKIFGSTP
Q97LN0_CLOAB/737-854----------------------------------------------NVF..NTISTNIK.....LRRRELAMLRSVGMSD
Q4A9N5_MYCHJ/1802-1923----------------------------------------------AIA..FIIKRYIS.....TNNKVLGILRAQGYSL
Q899W1_CLOTE/250-369----------------------------------------------NIS..ILIFYLML.....KNKKNILISIALGANR
Q4DFN5_TRYCC/444-565----------------------------------------------LFY..ALLNTNAE.....ERRFEFAMIRAQGLNK
Q8KD33_CHLTE/268-389----------------------------------------------LLN..IVLQRLVS.....TQREQIAVLKANGYDD
Q6F163_MESFL/1281-1400----------------------------------------------ILV..VIIGIIVE.....EAKIVILTLQALGYKD
Q6AMB4_DESPS/278-415----------------------------------------------FIMAMSIVLWNVGLIGGLRRYGEMGLRLAIGENK
A3QAU8_SHELP/312-429----------------------------------------------NIL..GLMLTKFL.....KRAPEVGVRRAIGASR
Q6F1W1_MESFL/1301-1420----------------------------------------------IIL..LTTSIIIT.....DNIRFISTMRVLGYHD
A6LZM8_CLOB8/286-398----------------------------------------------SII..TTINYKIA.....EDVDRIGILYSFGISK
A7ZBR0_CAMC1/308-420----------------------------------------------GIT..SLMTSEIY.....RRKKEIGLLKAIGASN
B2HGJ6_MYCMM/176-292----------------------------------------------LIA..NMVQVAAY.....TRRTEIGIMRLVGASR
B4EEB5_BURCJ/260-374----------------------------------------------VMA..NAMAMSAR.....ERTAEYATLKALGFGP
B7VH43_VIBSL/274-399----------------------------------------------NII..SALIMVVM.....EKQSEVAILKTQGMRD
D4K997_9FIRM/663-783----------------------------------------------NLI..NTTLSNQM.....SRKQENSVLRSIGLTQ
D4KYJ1_9FIRM/264-395----------------------------------------------VIY..NIFQVGIA.....NKIQEYGKIKALGATK
D4KYJ2_9FIRM/263-378----------------------------------------------NMA..NTMIMNIT.....TKKQEYGVLQAVGMTN
M1FFQ7_9ALTE/689-801----------------------------------------------ALL..IMGWVFFS.....TRAWYFRLLQVWGLTK
Q0P8Y0_CAMJE/151-262----------------------------------------------LFL..KQMRIWLY.....EHTDRIEIMCLFGAPF
Q1G8P7_LACDA/281-403----------------------------------------------IIV..WNTWNCLS.....EEQSEIALRISLGMRQ
Q2FUZ2_STAA8/60-179----------------------------------------------FIF..YANHFMMS.....QRRKEFSIFMTLGMTK
Q5LDA1_BACFN/283-392----------------------------------------------NYV..LIFVSSLS.....QRAKGIGIHKCNGASD
Q5LFF2_BACFN/296-426----------------------------------------------NLS..GMISSRMD.....DRLAEMGIRKAFGANR
Q6MSQ5_MYCMS/371-490----------------------------------------------LYTTFLITKKQIL.....NSRGQIGTMRAIGYKK
Q6MUJ8_MYCMS/1674-1786----------------------------------------------LIM..LITDIYIS.....QYKSFMIMLRSMGYTN
Q79Z83_STRAW/244-362----------------------------------------------VVA..STFAFAVA.....QRRREFGLLRTAGATP
Q7V1V4_PROMP/275-384----------------------------------------------VVY..QILYSDVT.....DHLPEYATLLAMGYRL
Q81HP3_BACCR/241-351----------------------------------------------SGI..SAVLFWIY.....KKEREISLKKAVGASN
Q81QE5_BACAN/261-379----------------------------------------------CIR..FTIITSME.....EDYREIGVMKAIGIHN
Q87SX2_VIBPA/293-410----------------------------------------------GML..SSLLTSLQ.....ERRREMAILRAMGARP
Q8CYG6_STRR6/404-522----------------------------------------------VTF..TTMTRFVD.....EERTHAGIFKALGYRS
Q8DQ76_STRR6/61-181----------------------------------------------IVL..YANSFVMK.....NRSKELGIYGMLGLEK
Q8DQS2_STRR6/302-451----------------------------------------------LLA..LLLSLWIN.....ARRKEVGILLSIGLKQ
Q8EZY9_LEPIN/261-379----------------------------------------------SIL..LVSRAGIR.....EKSGAIAVLKCLGASP
Q8Y6E1_LISMO/60-180----------------------------------------------FIF..YSNSFFLK.....RRKREIGLYSLLGLRK
R5K905_9CLOT/806-926----------------------------------------------GFL..IYWITSIK.....QRELLFGIYRAMGMSM
R5KJ88_9CLOT/349-467----------------------------------------------VLS..VFVVHSID.....QESAVIGALYALGVKR
R5TSZ9_9FIRM/275-417----------------------------------------------VIY..SLFQVSVR.....KRMSQYSVMQTLGMES
R5UPZ8_9BACE/294-410----------------------------------------------NFF..HFQIGSII.....NRQREFTIRKIIGNDM
R6WL88_9PORP/155-267----------------------------------------------GLI..GYTNDEVN.....RRRKELAIRKVNGATM
R6WLH2_9PORP/283-392----------------------------------------------NFT..NLLLNRIY.....LRNKEMKLRNAIGADK
R6WYF0_9PORP/288-402----------------------------------------------NYI..NLSFSRIL.....QQIRIIHTQKLMGATQ
R6X6U4_9PORP/275-397----------------------------------------------NFL..KFCIQSFY.....NRTRELSLRKCLGSDA
R7EAJ1_9BACE/292-408----------------------------------------------GLM..GTFWFRTR.....HRRSEIALRMAMGSSR

PF03739

Q3ATU7_CHLCH/6-355---------------------------ARYYL.LSIP----SIFL.VTSPVSALLASILVAGKLATQNELPAIRSAGVSM
Q118T4_TRIEI/24-389---------------------------IQVFL.LKMP----EFIG.LAFPMAMILTTLMVYSQMSGHSEIVALRSCGISI
A0LEN9_SYNFM/39-391---------------------------MALVA.LAMP----KLML.FALPMASLLGVLLAFVRLNSDNELIALRAAGIGF
A7HYF9_PARL1/7-370---------------------------FELTV.LALP----STLM.IVLPISLFCAVLYSLHKLISDSEIVVMFAAGVSR
Q8DIL4_THEEB/18-374---------------------------LQLIG.YQLP----AVLV.LVFPMAVLLAVVGAMSRLSEEGEWIALRSVGICL
Q82W93_NITEU/6-348---------------------------FKLVG.LKTI----IALE.VLVPIAFYVAVIYGLSRMNRDQEINVLRTAGYGD
A0LB31_MAGSM/6-364---------------------------VELIF.LRMP----HFFT.QFLPPIALLTTLFVVTRLTRLNELTVIRSGGVSL
Q6MKD0_BDEBA/11-364---------------------------AEIIG.YVII----SMLP.ILFPMALLFSVLLTYGRLSQDSEIVAMKASGLPM
Q6FFD6_ACIAD/9-354---------------------------FLYVL.WGAP----RYLY.EILPISALIGAILGLGTLASNSELIVMRSVGISL
Q0C1U6_HYPNA/7-346---------------------------MRYMW.LRLP----ALFD.RIVVFAFLLAALLTYASLIRRNELVAISAAGISV
Q11U59_CYTH3/9-455---------------------------AELMM.YFSM----NILP.VALPLAILLSSLMTFGNLGQFNELTAIKSSGISL
A1AWC7_RUTMC/20-369---------------------------LPLVG.LNMI----RDVV.LILSLSLLLAIILSVSKLYKASEAIVMNSLGLGD
Q73NV9_TREDE/13-373---------------------------LLLLF.YSLP----FIIA.TTAPYAALIGTLMCLGRFSADHEFISMNALGIST
Q1GR36_SPHAL/14-363---------------------------WRYVG.MRMP----QIIE.TFLPFSVLLGTILTMVTLNQNSEVVAMKAAGMSA
A5EXI6_DICNV/8-348---------------------------GQLLI.FQTA----NIVV.ILLPVAFILASVMTLSRLYGDCEINALFAGGCSK
Q7VQS8_BLOFL/9-358---------------------------FFCIF.LNII----KDFE.LFLSLSTLLGGVLGLGILELRNELIIMKVFGLSN
Q310A0_DESAG/6-352---------------------------LTYFA.VKIP----LIIS.QILPAVFLLSAVIQLCVMARDRELVALQAGGISF
Q5SL96_THET8/6-344---------------------------LRYLL.FRTP----EALA.RGAPVAYLFALLVLLSRLGEDAELKALLALGVRR
Q6MJL5_BDEBA/6-356---------------------------VNYYL.YSFP----GIIS.QLLPVACLLGVILTLTSLNKANELVALFASGMSL
A5WBH3_PSYWF/27-466---------------------------FSIIG.YNLP----YFLE.LVLPLSFFIGLMLVFGRLYVDHEMAVLNGSGISR
E0TCF8_PARBH/6-360---------------------------LRLTL.LRTP----QLIL.SLSPFIFLFGTLWAYGQMARMSEIAVLRAAGLSV
Q984S3_RHILO/7-356---------------------------VAISG.LRMP----MIML.QTVPFVGLFSAMATLVSLNRRYELVIARSAGVSA
Q2S3I0_SALRD/55-410---------------------------FTVFYPNYVP----EIIR.LTSPLALFLSCIYLTGTLAQELQLVALQTSGVSL
Q1IRI3_KORVE/435-789---------------------------GDYLL.NLSP----SLIY.LMTPLSVLLAVLVTFGLMQRSNEITAMKATGISI
A1WAC0_ACISJ/11-359---------------------------LLLAA.DLVP----HYLG.LALPVAFTAAIFMAAARMGDDSELDAMLATGRSI
Q8D296_WIGBR/5-350---------------------------FFLLI.LYIP----EIIK.LILPLSLFISIALVMQKLHNSNEIISIKTCGIGN
Q6MDI9_PARUW/8-358---------------------------IRYYL.FILA----SRAE.ILIPLALLIAFIKTVCTLNTHQELVALMAGGIKL
Q9A939_CAUCR/5-350---------------------------GYYAA.LRLP----RLFE.QVAPIAVLAGGLFAFSQLARESAIVAMRASGISG
Q1D894_MYXXD/7-356---------------------------AELYF.YKAM----MSVQ.QLGPAALLLAAGTTVSALRKQGEVTAIRALTFGP
Q1QKW5_NITHX/6-356---------------------------LGITS.LAIP----VLVL.IISPIALMIAISHTLHKLATDSEIIVMNAAGLSP
Q143Z1_BURXL/6-377---------------------------VLRVA.LQTP----SRFY.EIIPVAALISAIYVFAQMAANSEYTIFRVSGLAT
B5EBA8_GEOBB/11-361---------------------------VRMVA.YLLP----PFWL.FTIPMALLLAMLLAFGRLSGDSEITAMKSCGISL
A3I2C6_9BACT/6-354---------------------------MKYM..INYG----LYLNNLLTPITVFISVIFITSKMAGRTEIIAILSSGVSF
Q2RQ55_RHORT/8-372---------------------------LRLTL.LLMP----GFLT.VFIPIALFAVVLFTYNRLAADRELIVMRAAGMGP
A1WUU9_HALHL/6-348---------------------------LLKAL.LGAP----ALAY.EAFPFATLIGALMGLGGLAARQELTAMRAAGVSV
A5G1T7_ACICJ/24-378---------------------------LHLTG.LLVP----SFVA.VILPITCFIVILFVYARLAADRELTVMRASGMSD
Q3B4Y3_PELLD/6-432---------------------------IELLA.LQSA----WMVG.LAAPMAVLIGVVMAFGSLTTTSEMTVFRASGLSL
Q0BZX3_HYPNA/9-369---------------------------LRLSL.MKLP----MIIE.QTLPFALLAATMMAFTRLNRRSELSIIRASGLSA
A2U291_9FLAO/6-450---------------------------LKFLY.YTTL----MIIP.QALPIGVLLSSIMALGNLGENYEFAAAKSAGVSL
A0LB30_MAGSM/6-357---------------------------GKMVL.LIMP----KFLV.ASLPMALLVGILIGLGRLAQDSELIVIKASGISL
E0TCF9_PARBH/51-404---------------------------LRVTV.LLIP----SLVG.VILPFAVFAAVLYALNLFVTDSELPAMRAAGASR
A5EXI7_DICNV/7-348---------------------------LSILL.LNVP----ARIV.EFMPAAVLVGTITALGQLNKQQELTVIRTSGISR
B8CYZ1_HALOH/12-360---------------------------LKLLL.YQLP----EIIV.QTFPIAILFATMSGMGRLNRENEFTALRMGGISL
Q1MPZ1_LAWIP/7-360---------------------------LILFS.YMVP----LFLI.LVIPIACMLGVFLTFLRMNLDKELIALKASGISI
A8ZZ83_DESOH/6-356---------------------------AVFFL.FKIP----LIVV.QTAPVGVLIASLVVFGLMNRRNEVTALKSSGIGP
A8EWU1_ARCB4/5-331---------------------------FRIFS.YTIP----DIIF.YTMPISFFISMVITLSKLSSEYELTVITSFGLNP
Q31ET4_THICR/6-346---------------------------MQVLL.YKIP----PALE.VILPLVALLSVMLAVGRLYQDQEMVVLQSCGIAT
Q1IZ54_DEIGD/6-380---------------------------GQWIG.YQLP----DTLV.KVLPMAVVLMTVVAFGRLATERELVAVQSGGIGL
Q1J2D3_DEIGD/10-350---------------------------LSVFG.AIAP----DKLN.RSLVLAVPFAVLLTFGRLQGDSELKAMFAAGVSP
Q2S0T8_SALRD/7-449---------------------------VELIA.YNLA----YMVV.LAVPMSVLLAALMAFGELAESQYYTVIKSTGISF
Q6MDI8_PARUW/7-377---------------------------LLFAF.YQIP----YILP.IALPLSCLIASLIFVQRLSNTHELTALRACGFAL
B8CYX9_HALOH/6-362---------------------------VQLFF.LKLP----PIIV.LTFPMATLMGTLMSFGRLSGDGEITAFRAGGVSV
Q1IRI3_KORVE/8-376---------------------------AEIFF.LTLP----TALT.VTLPMAVLVGILIGLSRLSADSEVTAMRSSGLGS
O83854_TREPA/1-358---------------------------VRLLL.YSIP----AALI.YVTPFAVLVGSLLGLGRLRNNLELLALQVLGVSP
Q8D297_WIGBR/7-348---------------------------ISTIL.LSVP----KDIE.EFFNISILIGILWSIGILEKNRELIIIESSGISR
Q9AA49_CAUCR/9-364---------------------------AELLV.NLTP----HYVG.LTLPGGFFIGLFVVVNGLNKSSEIDAILASGTSL
Q3J9X2_NITOC/9-352---------------------------LALSG.YEAI----GALV.LLLPLASFLAVLLALGRMGADNEVIALFACGVSR
A7IJ85_XANP2/6-384---------------------------VAITS.LTMP----TLVL.VIAPAALFIATAYTLLKLNGDSEIVVMASAGMGP
Q0C1U7_HYPNA/7-360---------------------------SLLVA.NLIP----HYLN.LALPGAFLISMILTIDRLSRSGEIVALMAAGVSL
Q0BVK4_GRABC/5-352---------------------------AIYVA.LTIP----YRLL.QVFPVSMLIGTLLGLGGLARNGELTALRGLGMSE
Q5FU64_GLUOX/35-392---------------------------VKIAA.LHVP----YYII.YVLPFGILLGGIVCFSRLTRSSELIVARAAGISA
Q5FPA9_GLUOX/26-376---------------------------LTFAF.LHLP----ALSI.DILPLAFMVGALFLLTQMTLSSEISALRAAGLST
Q1D895_MYXXD/6-362---------------------------ARLLA.YLAP----HFLM.MALPIAFLLAILLGLGRLGEDRELVALQALGIGP
A1AXG9_RUTMC/6-356---------------------------TKYVI.SDIP----AVVY.SYSSVIILLGSLLALGHLASTSQLVVIRSAGVSI
A6QBC8_SULNB/6-335---------------------------LLLYS.YSLP----NIIF.YTIPLSFIAAVTNTLMKLSQDNELIALYALGLKA
A6QBZ1_SULNB/12-355---------------------------ILYIF.YMWQ----EALG.LLYPLAIVFAVIMTKLTFVKQNTMGALHAFGYTK
Q7VQS9_BLOFL/5-358---------------------------FLYLF.LSIP----DLGK.LIIPFSLFLSVLISCYRLHMHNEILAMYSCAVNK
Q73NV8_TREDE/6-354---------------------------VKVMW.LYIP----KCIA.YSVPLAILFAGSYTMGNLYAQNELTSIFSAGISL
B4E8H0_BURCJ/7-345---------------------------LVLIG.LTVI----GYLA.VMLVVTLFVSILFVLTRWYRDSEMVVWLASGVSL
J9ZCA2_LEPFM/6-351---------------------------LRLVM.MIFP----QFLT.MIIPVSVLAASTATFNRLASDGEITALKASGIGL
J9ZCM7_LEPFM/6-356---------------------------GQYFF.YRSI----EVSF.RVLPMSGLLATLLTLGILSKNHELTAIRAAGISL
O26028_HELPY/5-350---------------------------IILFFTYDIL----FALN.YTLPISLLLAMVLFYIAFIKSNQYTALLSIGFSK
O51747_BORBU/11-425---------------------------FIFII.YSLP----MVIA.LSPPFASLISVILTIHKFKLHNEILAFRSIGISI
O51748_BORBU/7-350---------------------------LYIYY.LYLP----KAFS.DGVALSFLFAISNLIGNLSMRNEIIGLFSCGVPL
O84846_CHLTR/8-346---------------------------FKVTA.YQIP----YLLP.FILPASCFISAFTLFRKLSDNNQITFLKASGASQ
LPTG_HAEIN/7-355---------------------------VIFTG.LTIP----KDIE.TFFPMAALLGALIALGNLASRSELVIMQSAGFSR
Q2JLS4_SYNJB/13-367---------------------------LRLLV.LDLP----EMVV.LGMPIAAFFATMLTLGKLSGNSEITAMRAAGIPF
Q2YN46_BRUA2/7-357---------------------------VQFSS.LLIP----SAIP.LVMPFALIIAITQTLSTMNQDSELVVINASGAPR
Q5NFB9_FRATT/8-349---------------------------IINTL.IQLP----GILY.TLLPACAMVGALMGLSLLANNSEIIVLRSFGRST
Q5NFC0_FRATT/6-350---------------------------VKFVI.LTIP----ENVS.LVAPIAIFLAIVICFGKYFANNEMFVTIAGGITW
Q5SL95_THET8/4-334---------------------------GLLVL.YRLP----WTLS.LALPLGLVFAVLVGLAGLIRRSELKAAYAAGVPP
Q7CKF4_YERPE/5-345---------------------------LSLLG.LGVP----EMAQ.LILPLSLFLGLLMTLGKLYTESEITVMNACGMGK
Q8F742_LEPIN/134-585---------------------------LDYFG.YLLA----NTLP.MTIPMACLMSGIMAAGRLSGDSEITAIRSAGVSF
Q8F8T0_LEPIN/30-383---------------------------ALFLV.YSIP----KIISTTVVSMSLMFSICFTVGQFSVNKELVSMMAAGVSF
Q8PCR2_XANCP/10-365---------------------------IAFVA.YTVP----RRAY.TLFPTAAVIGALMGLGQLAATSELTALRALGVSR
Q8PCR3_XANCP/6-349---------------------------LSQVG.LQFV----AYLP.IILPLALMLGLLLALARLYRDSEMAVITAIGIGP
Q8RER6_FUSNN/12-360---------------------------FDYIL.NLLP----KMFV.ETAPLSVLLAGLITISIMASNLEIVSLKTSGIRF
Q9X257_THEMA/19-363---------------------------FLMLY.YYLP----YFVA.MGVPVGVLLAIFWTFSRLSEERELMAIQVHGISQ
Q9ZCH3_RICPR/10-357---------------------------WRFIL.YKIP----YLLS.QVSSLISFTSMLFFLRNLTKSNELTAILSSGIHI
R6X2Y4_9PORP/1-468---------------------------AEMFM.YAAL----FLVP.MALPLAILLASLMTFGNLGERLELLAMKSAGVSL

PF00528

J7JQQ0_BACIU/107-309........................FKSSGTG.HSLLA.G..TIVLSVMILPTITSISADAMA.SLPKSLREGSYALGATR
D4FYT7_BACNB/80-293........................VNLTGWG.YTIIG.G..ALALTVFNLPVMVRVTEDAIR.SVPKDLKEASLALGVSR
A0A017I3G0_ECOLX/116-308...................QWLPAMGYGGWQ.HIILP.A..VSIAFMSLAINARLLRASMLD.VAGQRHVTWARLRGLND
D0KQN4_SULS9/116-318..............FPSKINTSPNSIMALSR.FYTLP.I..IALMFTSLSGFVLGMRNNMLH.TIRDNYVTYAEILGLDH
E8VKF3_BACST/41-224........................PYIGIEF.SAVTA.A..LIGFSLNSAAYIAEINRSAIS.SVEKGQWEAASSLGLSY
D0KNU1_SULS9/120-341LTP..PKSITPFPLLNAMLAGDWPYFSSLVH.HMVLP.V..IAIALVSFGIVTRIARASMLD.YMESDFAKLSLMKGLSR
Q9FAT0_VIBPH/116-319..............GATSLSIVNSTWQGNLQ.HMILP.I..VCLVLVGIGPLILHTKEKVVS.LLDSDYVKYAQMHQIPK
Q44374_RHIRD/87-266...........................TILP.RSVAFIV..AIIALVEATRFFRLARLLAAD.IAALDY.SGRFLRGETT
Q9KB56_BACHD/117-308...................DLLPTSGLDSYQ.SYILP.V..TVITASYVGIYFRSVRNSMLS.HLNEDFVLYGRACGISE
G4ER62_BACIU/40-211...........................LVMG.LGANT.V..ILSLFLYSLLPIIRNTYTGII.SIEHAYLESGKAMGMTK
Q9LAT6_LISMN/112-304...................QIFPVAGWGTFA.DTILP.A..FALAMFPLATAARFMRTELID.VFASDYVLLAKAKGNSR
LACF_RHIRD/87-298...............AIGIIGEPIGWLTDPF.WAKVL.I..IIAITWRWTGYNMIFYLAALQ.NIDRSIYEAAKIDGVPS
C9MHH9_HAEIF/68-243...........................LWFG.YGMAS.K..IVMSVLIIYFPVTAACYDGLR.NTPQAWLDLAKTFNISP
Q982M9_RHILO/75-250...........................LIFG.LGMTP.K..IVIAAVICFFPTLVNMIRGLD.SASDNEHELFRVLSATR
D5AW50_RICPP/33-217.....................INIKFN......VFMA.G..VISFALNSGAYVSEVIRAGIN.TVDKGQFEAAEALAIPK
G6NR23_STREE/298-492..................PDSFPILGAGDWR.SYVLP.A..VILGLLGAPGTAIWIRRYMID.LQSQDFVRFARAKGLSE
D4G528_BACNB/46-230.......................PAFN.VTL.DPFPS.A..VIAFSLNVGAYASEIIRASIL.SVPKGQWEAGYTIGMTH
A0A034X2L6_STREE/125-308...........................YSIG.AGFWNLI..FAMSVTTWIGIAFMIRVQILR.YRDLEYNLASRTLGTPT
NRTB_SYNE7/98-276...........................MVFQ.DANTS.A..IFVIFITAIWPIIINTAVGIN.QIPDDYNNVARVLKLSK
Q9HIL1_THEAC/131-337............YGVNVNMGFNVPFIISVIY.HAVLP.V..LTIILTSLGGWVLGMRNNIIP.NLNSDFINYSENLGFKD
A5IMY1_THEP1/119-323............YSFGITPSFSWDFILDFLH.HWVLP.F..GSLFLVMLGGWAIGMRNMIIY.ELEANYSRYLEALGSSQ
A0A017I1I1_ECOLX/90-294................LAEFGYDWNHAQNSG.QAMFL.V..VFASVWKQISYNFLFFYAALQ.SIPRSLIEAAAIDGAGP
C9MH14_HAEIF/93-316YEIKSITGFPVIDMWFMEVPYRTKIVQNILQ.HLALP.T..LVLCILPTMEIIRIIHQRAEY.ILNQNFSKVATTRGWSK
C6SR18_STRMN/87-273.........................MMSKLG.LANMWGL..IILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK
G8PA36_LACLC/106-293...........................TIIPRFNSWSLI..GIISIFSWIGTTRLIRARTMT.EVNRDYVQASKTSGTSD
A0A017R3L7_SALET/27-221..................VVTDSLGIDQIDI.DPMVA.G..IITLGFIYGAYFTETFRGAFM.AVPKGHIEAATAFGFTH
A0A017I1V8_ECOLX/89-273...........................GVLG.TGLTNVI..IAIALSHWAWYARMVRSLVIS.LRQREFVLASRLSGAGH
B1L9I4_THESQ/94-282...........................SLIK.NYLSLPILGLIIGVFGWAGDARVIRSMILS.LREREFVVTSKFSGMRT
A0A017IYA5_ECOLX/117-315......................VIDQPLTIL.HTNLA.V..YIGIVYAYVPFMVLPIYTALI.RIDYSLVEAALDLGARP
E8VDJ2_BACST/93-290...........................KSLG.LLDTY.W..ALILPMAINPFNLIIIKNFFQ.QLPRELEESAKIDGCSE
A0A017IAJ7_ECOLX/74-276.........................FDIKVT.YTWLG.I..AVAMAFTSIPFVVRTVQPVLE.ELGPEYEEAAETLGATR
Q9ZBG1_STRCO/128-331..............GLTDTASQQVTPGQVAG.HIVLP.A..GVLAVSQLPWFTLYVRQGVGD.ALAEDPVRGARARGLAE
Q97UH1_SULSO/128-336...........NTFQFLKPTMSLPFIWSVIY.HAILP.T..LTLILFSLAGWIMGMRNNMIP.ILQEDYMNYYRLMGVSE
D0KNZ4_SULS9/101-289...........................SAFKTSNPIFLS..LILSITSWAGLARAVRSQVLV.IRNSPAVEVLRVLGLSR
LACG_RHIRD/89-270.........................LMGQAG.LLNTH.I..AIMLPMIASAFIIFYFRQASK.AFPTELRDAAKVDGLKE
Q9HLG4_THEAC/81-265...........................VLFH.ETLGGVI..LALVIVWWPIYARFFRAQTLR.IKNLDFVQAAKLGNVSF
A0A034X6C1_STREE/87-275.............................AL.NHNWF.L..IFLYVGGGIPMNAWLMKGYFD.TVPMSLDESAKLDGAGH
A0A009EAC3_ECOLX/43-239.....................WFKAELDPNI.QFFLS.S..MLCLGLFTAARVCEQVRAAIQ.SLPRGQKNAALAMGLTL
B1X7L7_ECODH/68-240...........................PVIG.FGLQP.A..IIALILYGVLPVLQATLAGLG.AIDASVTEVAKGMGMSR
Q9FAT1_VIBPH/84-268...........................VSFG.SGSQGVM..FAIALSHWPKLTRLCKSEIQS.LMCSDYMSHALNFGHKK
B8H0V5_CAUCN/67-247...........................IWAGIDHPERAV..IGLAAVVAFFPIFSGALSGLK.SVDPDLARLFDLYGATP
A0A009EN06_ECOLX/151-361...........LVSANFDSLPWYQKITDYLW.HITLP.V..LATVIGGFAALTMLTKNSFLD.EVRKQYVVTARAKGVSE
YOR2_CALSR/83-265.......................NKIK..LY.DTVFA.L..IGPYVALSLPMSIFILTEFMR.EIPLELEEAAKIDGCSM
O66777_AQUAE/114-319............QSPNFEQLSIPEKVLDILK.HLIIP.S..LTLGLVSLASLTRLVRSSVLE.ILSSPMVTMLKAKGVGT
A0A017IH56_ECOLX/195-381...................AFPWLGTLGIAG.TGMTP.A..LIALVLYALLPLVRGVVVGLN.QIPRDVLESARAMGMSG
Q9WXN6_THEMA/92-279...........................SYLKVRSVEMVA..VILGLFQWPWFARAIRAQLMS.VMSREYVYLSVMAGYSD
Q9Y9N0_AERPE/121-339VN...LDVVTGLYVLDSIITANPAALVSAVE.HLILP.S..LTLGIVLSGVYTRLVRIHVAE.ALRSEVAVAYRARGLRE
J9H1N9_9THEM/67-238...........................FLWG.IGWQG.P..VVISSLSLIPVAIFTTVSGVR.SVDRKLLEVMKVYRVPR
Q9Z6P7_CHLPN/68-243...........................LWFG.WGIGA.V..IVPTALTIFFPLTLTIYQGIL.STPEELIEQFVLCGATK
A0A009ESA2_ECOLX/33-218.....................FNDLRI.....DPFTA.A..VVTIMINSGAYIAEITRGAVL.SIHKGFREAGLALGLSR
Q98K60_RHILO/105-289.........................VLAAIG.VTGLIPK..AMISTYLSFFPVTVGMVKGLR.SPEIMHLDLMHTYNASA
B1X7Q9_ECODH/91-278.........................LDSYAG...........LTLPLMASATATFLFRQFFM.TLPDELVEAARIDGASP
A2RJ51_LACLM/113-318.............TVSPDAMGIIPVFFSKIY.HMILP.A..FSLAVFGTVGIFTYFRSGILD.EQTQDYVRTARAKGVKE
Q49553_MYCHO/234-419...........................SIIG.ANEWSLV..LTLTIVGWPGFVGITRMFIIT.VKDEEFIIAAKAIGVGT
FBPB_SERMA/341-526.......................IHSFRPIY.QTEIT.L..LLAYLLMFMPRALINLRAGIA.QAPVELENVARSLGKSP
Q987J0_RHILO/100-280...........................AAVG.SSIPALI..LTLAVIYIPGAYRFARALAVN.INSMDFMTVARVRGEST
Q9CLG9_PASMU/73-248...........................LWFG.YGLAS.K..IVMTILIIYFPVTAACYDGLR.NTSMQWLELAKTMQVSA
A0A024F9P0_UREPR/183-374....................LPFTFDINNFV.TYILP.G..LALSLGSIIVYVQYIKVEMNR.ELNSMHAKFAYLKGATV
A0A017I1M5_ECOLX/101-295...........................QMEH.FSGWA.G..VIALALLQVPIVIRTTENMLK.LVPYSLREAAYALGTPK
Q98QF6_MYCPU/174-365....................IPFIYDIKDFT.TYILP.A..IALAMPSVTAYIKYIRYELNN.ELNSMHAKFAYVKGVSR
B2IN26_STRPS/209-434..............FLPFLDGALIPWKTDPT.WTKIA.L..IMMQGWLGFPYIYVLTLGILQ.SIPNDLYEAAYIDGANA
J7JKK3_BACIU/104-314................MSLTGEQISFLSDAD.WFRPM.I..VMQSIWKETGWGTILFLAALA.TVDQEQYEAAIMDGAGR
A0A017I2Z6_ECOLX/173-362.....................IDKLIR...........A..LVGVILFQSAYVAEVVRGGLQ.ALPKGQYEAAESLALGY
A0A023YPW1_ECOLX/104-273...........................VAVG.LGPFA.G..VLALFIHTTGVLSKLLSEAVE.AIEPGPVEGIRATGANK
F6C4B4_SINMB/112-306..................WLPAGGWGDGSLR.FLILP.M..IALALPQLAVFARLTRGSMIE.ALNTDHIRTAKAYGLPS
Q97YP1_SULSO/131-332...............SGIQVLHLNDIVSILK.VYWLPWI..IQVFIFGFPVRGILMRNTMVD.VLDSDFVKYARLSGLKE
O28506_ARCFU/135-354NT...PETITGLYVLDSILTLNFNSLIDALA.HLALP.A..ITLGIVLSGAYTRLLRNNLID.VLSQDFIKAYRARGVRN
Q98K61_RHILO/75-251...........................MWFG.FDWQS.K..AAVVIIMTFFPMLVNTVAGLA.ASGHMERDLMRTYASGY
AMYC_THETU/83-269.........................EFGKFH.FLTRSGL..VFMYLGFGSSLGVFLYYGALK.GIPTSLDEAALIDGCSR
A0A008AYP3_STAAU/117-308...................NILPTSGLTGPE.SYILP.V..IVITIAYAGIYFRNVRRSMVE.QLNEDYVLYLRASGVKS
Q9EWP8_STRCO/101-281...........................AGFP.GSDAALV..TAVALATAPFSTRVLRAAADT.VLHSGYVEAALARGDTR
A0A016X6V1_VIBCL/118-310...................NWLPVAGFGHPK.FLILP.A..LALALGMAAMSSRMIRNATAQ.VLQSPYYAFARLKGLNH
B1X877_ECODH/158-341...........................SVVQ.PNFWWLL..AITVLFGWMSLVGVVRAEFLR.TRNFDYIRAAQALGVSD
O86691_STRCO/402-574...........................AVAG.SGAATPA..LAVGAVAWAPLAAHTSSLLRQ.ERATLHITATKGLGAGP
Q98QS7_MYCPU/195-382...........................QILG.TDYLSIG..IILIVLGWTNPTYVARSYTSI.IKDEEFLYASKVVGASK
I3VV06_THESW/85-290.................THIGWLGGWLSTTN.TGFWG.L..VIVTSWQMIGYVMVIYIAYIE.SIPTDLIEASKIDGANS
O34157_SALTM/115-319.............AWDPGNNAGTALLSERLR.HLVLP.V..CALSLLGMGQIALHTREKIAS.VMKSEFIRFARAQGDKG
Q9PL65_CHLMU/67-242...........................LWFG.WGARA.V..IIPTALSIFFPLALTIHQGIK.NPPEELLEQFTLCQATT
Q9RX04_DEIRA/318-494...........................SWLG.FGSLP.A..VLVSALSALYPVLVSTLIGVR.EVDHAYHELFHSLRATP
J7JPW1_BACIU/94-269...........................LWFG.FDEVS.K..ILLIALGAFFPVYINTFNGIR.GVDAKLFEVARVLEFKW
Q9UYG7_PYRAB/121-325............YSQNLVPSFSITFIVDFLK.HWILP.F..LSLFIVMIGSWAIGMRNMIIY.ELEADYVRYLEALGASE

PF07242

A7GQL2_BACCN/621-721FKRHKLYLMFTNFV-------------WFVSMLILCILE-----------------------------------------
A5MAB6_STREE/576-675YELHGKYLLAQGGV-------------LLLGLVLSSILT-----------------------------------------
Q9L651_LACLL/549-647FTTHKTYLIQLFII-------------IIFAIGMIFIWH-----------------------------------------
A5M6X5_STREE/166-265FETHAQYMVSQFAS-------------FVFGASLFILSS-----------------------------------------
A7X0R3_STAA1/555-653LRANYQYLLINNIV-------------VVFIGILTNVIL-----------------------------------------
G6KLU1_STREE/155-254LEIHRTYLFAQLGV-------------FLLGFVASVFLQ-----------------------------------------
A0A028VRZ0_STAAU/545-643FSSNVRYLTISILL-------------SIMLAYTTHILF-----------------------------------------
Q926X5_LISIN/619-718WKSSKWFIISNLAV-------------CAFSGVVTFIIT-----------------------------------------
B1BGL8_CLOPF/619-718IYRYMNYFIMVLIT-------------WTCPLAIASLIT-----------------------------------------
Q9KG35_BACHD/612-712FRAYRNVLFWTLAT-------------WVVILGIALYRH-----------------------------------------
B9WU46_STRSU/561-660IELHGSYLGEQVGS-------------ALVGMGLAMFMT-----------------------------------------
Q9CJI4_LACLA/565-662FVTYKTLFAIVLVQ-------------GSLYFAFALSQR-----------------------------------------
G2KCB9_LISMN/620-718WKSSKWFIISNLFV-------------SVFSGILIFILS-----------------------------------------
Q896P1_CLOTE/604-706LSNYKEYFYLILIS-------------WIIVATSVFISK-----------------------------------------
Q892J9_CLOTE/609-706FDKYKEYLWIIIIS-------------WVAIVITSIILN-----------------------------------------
A8AXA7_STRGC/592-691LKIHQSMLISEIAM-------------LLLGSVLIFFLT-----------------------------------------
Q9CE29_LACLA/560-659LRIHRRFIFVELGL-------------LLILLPTLTIIS-----------------------------------------
Q181M6_PEPD6/617-718TARSMLLIVSLILT-------------NIIPIGIISTRV-----------------------------------------
A7GNK2_BACCN/616-716FARNTSLILLLFAI-------------NFIPTISMYVYL-----------------------------------------

PF02687

O50782_BORBU/276-402LELFYSLFLEIVII....SVVNIVVG.VILAYFAKLFIQFQKISFTP.....----------------------------
A3I1M1_9BACT/289-407AQLFGQFVSESFIL....TLGAAVLS.VLALYLFAPKFSSLS..........----------------------------
A8ABZ3_IGNH4/248-373KDMTLYLSGVWGSR....VFLGTLLA.LLFGTAVAISSVNVAL.........----------------------------
Q9WZG5_THEMA/725-844NQLVASFLIEHLFFLFGGILIGTVSG.VLMGYFVSEAMSESL..........----------------------------
Q9FBP3_STRCO/657-772RTLSLSVLWQTAIP....IVLGLLLA.SVVGLTLGTVLLKM...........----------------------------
O28455_ARCFU/275-396NEIMLHYLQYPLLM....GFFASTAG.LVAGFFASQLLTSQYIT........----------------------------
Q481M7_COLP3/705-820NTCLQLNIIEWLITA.LIIAIGAIAGTYITGMLIY.................----------------------------
A4YKC0_BRASO/734-849LRLLGAYALEYLMI....GFATAAFG.VIAGSVSAWLIVTRL..........----------------------------
A8AR20_CITK8/231-351GFILRPFLYGGALL....GFSGAFLS.LILSEILVMRLSSAVTE........----------------------------
Y684_MYCPN/989-1110AKFIAGMSVFAGIV....ALASSFFG.VLFAFLLERQVKGIISR........----------------------------
Q2RPK1_RHORT/279-403STLIGLPVVQAALV....GLMGAIAS.LGAALAFQALINHKLAAT.......----------------------------
A6H1M7_FLAPJ/284-410WTVRKIFLYNAVHLITKGLLWGNTIG...IGLLLIQKHTGIIKLNP......----------------------------
Q4QBC9_LEIMA/977-1097AQLMRCAVYESLCI....VISAFTWG.LVVGTAVGVTMAIELCQ........----------------------------
Q025M3_SOLUE/351-471ARLVCQLLTESALL....GVLACSAG.IALAFWARRPLLALSRY........----------------------------
Q54MT9_DICDI/545-666SFIIELIVSKTIIF....TVPSIILG.LIISQIFLFIIIDQLKR........----------------------------
Q6MGV4_BDEBA/659-778SAVFQVLFFQMGLQ....VLVSIFPG.LLLGYGLSYLSTKWIH.........----------------------------
A6L8W9_PARD8/653-767RQILVKLVFTFLNY....VLIAFVIAIPIIMYFMKDWLSD............----------------------------
Q4A9N5_MYCHJ/2523-2644KTKVRLFYSIYLPI....LLISSLIS.IPFVIIAMEIFNSYILL........----------------------------
Q01VW7_SOLUE/1278-1396LHIVREVFLSGGRP....VVRGLFLG.LWLSVAVAATLHHGM..........----------------------------
A5USK7_ROSS1/311-433WQVLGLALGEVLLL....GAAAWAAG.LPLGLLLAHVISWTVSFL.......----------------------------
Q9A6K3_CAUCR/352-465GDLRNIVMELSFWV....GIVGVFAA.GLLTWGVSLLATM............----------------------------
Q5V3A9_HALMA/874-995WRVLRTILADIARI....AIPATGLA.LGLSVLALQLLERAGWL........----------------------------
Q8NS27_CORGL/613-739GTIYKVNALNAALL....ALVGGIMG.LVSGWIAALLTGTTDEI........----------------------------
Q97DB8_CLOAB/716-835HQTRKMLFIEALSI....GLIGSIGG.IVGGSLMIHVIPAMLD.........----------------------------
A7HK62_FERNB/257-383AQMFWILFLEGLAYLILSEIVGAIAG.VGFGRYLLYKVNSFQRTDE......----------------------------
A1TXE6_MARAV/183-306SQLSRLLLVENLLL....ALVCILPG.VWLGRALSLVLADGFGQA.......----------------------------
Q830M8_ENTFA/579-698KAITKQIYRQNSLI....FFPPMVIG.ILHTTFAIYLLSQFI..........----------------------------
Q5LCL1_BACFN/272-387RSLFALLSVEYLIV....LLAGSLLGMAFIEACLPHFIELA...........----------------------------
Q9KF85_BACHD/539-650RHIRWLYLMENSSL....IFLSAAIASLILLAYI..................----------------------------
A1SKN4_NOCSJ/300-416RGARGLLAGELLPV....ALAGVVPG.AVLALLGVWAARTTLL.........----------------------------
Q5JEM5_THEKO/203-318SFIFTLFAGDYLIV....ALLGYAIG.IVPGILLGSRSS.............----------------------------
Q8G7P9_BIFLO/320-438GRLGWQFMLEVFIV....TLPFYVIG.LVGGAFAANPIGSALA.........----------------------------
A9KQT2_CLOPH/343-506AKVALGIWTEIFAI....TCVCLVIG.LGVGTVVAQPVSDVLLKSQVAAAET----------------------------
Q6F1V8_MESFL/1691-1810KETIINTILIPAVISTIFVLIGYLVGKWLLGSMMIQAQKFG...........----------------------------
Q9PPU7_UREPA/163-284WQVWFSFAPFYTIP....SLIVLIIG.YSISYEIQPLIMRLFSS........----------------------------
A6TSQ0_ALKMQ/264-387RMTDTVLIGESLTY....GLLGGVLG.NFVGIGILYLITRMMASD.......----------------------------
A5N346_CLOK5/473-593HQITKMIAAEAFTY....SISGCIVG.VVVGLFISKFLYDNLIT........----------------------------
A7H957_ANADF/284-394RTIAAMIVQQALAL....GAIAFVVG.KLAATAWAPV...............----------------------------
A1SH34_NOCSJ/769-890RQLVKLAVSEAAVT....SAIGLAAG.GLIGWAMSRMLVKVLSG........----------------------------
A6LCJ9_PARD8/285-395WRLRGFLWLESFLF....ALLSYAIS.LLLLLVYEGC...............----------------------------
B8I8J6_CLOCE/296-424RQCFSIIFLEVFFL....SIIALSIA.CGIAAVLVNMLGKSGVYLGTG....----------------------------
Q6AA47_PROAC/602-722RILRRSFLMQMIVT....ILPAQTMS.LVVGVLAGWAINAAIGST.......----------------------------
Q6MT15_MYCMS/562-682VELSWIFALKTWLT....MFFGLIIG.YILSIPIQIYSSSNFVN........----------------------------
A4VW57_STRSY/998-1117REVTMYIYRETIAL....SLIGMLVG.LVGGIYLHKLLLAMIG.........----------------------------
Q18EP9_HALWD/299-419RSVGFVVALQVVTV....CFIGGTVG.ALLGIGGIYATNTILAQ........----------------------------
Q8EUA2_MYCPE/1360-1480KKNAASFLSVYLPV....FFFGLLIS.VPITFAMTSVYITFIFN........----------------------------
Q47EZ3_DECAR/243-372GDVIRMKTWEGLLI....SLTAFLLG.FIAAYVHVFHFGAAIFEPVLK....----------------------------
Q034M7_LACC3/404-519KDVRRILFWNAMKY....GCYCFGGAALLIVVAATIMALRL...........----------------------------
A3I2Y5_9BACT/746-861NDLSKKLLKRYLII....WGIAAVIG.STFSLILISSFL.............----------------------------
Q0RJL1_FRAAA/639-753GMLRRVIVLESALP....LLVLTVVS.IATGFLAAGLF..............----------------------------
Q7UPA2_RHOBA/581-706RRVMKLALGETAVT....AAFGTLIG.IAGGVAYAWAVLWALKSWW......----------------------------
Q8A9F6_BACTN/266-381IHLFVQLYIENLFL....IAIALCLSWFLIEISTGFIEIQF...........----------------------------
Q97LN0_CLOAB/737-854RDFKKMMNFECVFY....GMKALLLG.LPLSIIFSWLVHKV...........----------------------------
Q4A9N5_MYCHJ/1802-1923FEIASSFLSIGFII....AFLGGSLG.FLSGFFGKIPLYNLISQ........----------------------------
Q899W1_CLOTE/250-369KMIWKQIFIELMLV....SLCAIISA.LIVVHLLIPFVKDNFT.........----------------------------
Q4DFN5_TRYCC/444-565THLVILLLTQSLAF....IIPGLATG.AAFLVGLNALIEYLLSR........----------------------------
Q8KD33_CHLTE/268-389EAVGLHVLGFALAP....TVAGVLLG.TGLGAWLGSALLRLYGD........----------------------------
Q6F163_MESFL/1281-1400KEINWVVMGSYAIG....ALISFIAA.YIASVIFWKILLTWIAN........----------------------------
Q6AMB4_DESPS/278-415HHVYASIIIEALII....GVIGSIIG.TLLGLLIAWYFQAYGLDIGSMT...----------------------------
A3QAU8_SHELP/312-429AQIFSQYMVEVGVI....GLFGGLVG.LLWAWGALYALSARFGV........----------------------------
Q6F1W1_MESFL/1301-1420AYVVKTVMGMYLIVISTMFAVGFAAGWFIFAKAVNIMLLSG...........----------------------------
A6LZM8_CLOB8/286-398KDIFKTFSSEFLIN....ILVGIIGGSLFYLENCG.................----------------------------
A7ZBR0_CAMC1/308-420FEIYALFASESLVV....AFFAGITG.AFLGYALSYVMSYII..........----------------------------
B2HGJ6_MYCMM/176-292WYTQLPFLMEAMLA....ATLGVVIAIGGLIFVRAMFLENALNQ........----------------------------
B4EEB5_BURCJ/260-374GFLALIVFGESVVI....AVAGGGLG.ILATPPAASLFKQA...........----------------------------
B7VH43_VIBSL/274-399GQVMGIFMVQGASS....GVIGALSG.GILGVILASNLNTILEAMGV.....----------------------------
D4K997_9FIRM/663-783KQLCKMNICEGLCY....AFFATLAI.LIVGFPISIVASREISIA.......----------------------------
D4KYJ1_9FIRM/264-395KQMKQLIFREGIFL....TFFSIPVG.LLFGFLIAKCGFNWLVEQGNLVS..----------------------------
D4KYJ2_9FIRM/263-378KQLNLCLQLQGLIF....TVGTICVA.LIIGLPLGYALFSYAKH........----------------------------
M1FFQ7_9ALTE/689-801RQVLAQLGRLALTL....TLTITLLA.LPLGVWLTWVLVHRINP........----------------------------
Q0P8Y0_CAMJE/151-262W..FRSFMLYKVVV......VDCFIAFVILLAFFTQIFDLSIIQ........----------------------------
Q1G8P7_LACDA/281-403KDVLSAAIIYQLLI....DILAIVPVLLYAGSYSKMLADSSVGSS.......----------------------------
Q2FUZ2_STAA8/60-179KSMRLIVVMETILQ....FVIISVVS.IAGGYLLGAIFFLFIQK........----------------------------
Q5LDA1_BACFN/283-392KAIFSMFIYETALI....IGVSLVLM.IIFLFQFQEKIEELAE.........----------------------------
Q5LFF2_BACFN/296-426KQLLNQVLWENLLL....TCIGGLMG.LIVSWGLLVLGRNWVFSLFDKYP..----------------------------
Q6MSQ5_MYCMS/371-490RQMALNYVMMPFFT....SIVGGILG.YILSCLVSIIIINRFSN........----------------------------
Q6MUJ8_MYCMS/1674-1786TQVMFYTLGIATIF....SLLISFIT.TIIVFSSTSIIDKVFS.........----------------------------
Q79Z83_STRAW/244-362GQIRRMVISEAFLV....GVLASAAG.CVFGAYGAPRLAQWVVDN.......----------------------------
Q7V1V4_PROMP/275-384KTLFFVVAREGFLL....ALFGYLPA.YFSGQILYSIIRNS...........----------------------------
Q81HP3_BACCR/241-351ISIYCELYIQILFI....SLVAMLLV.FLVLEMFSGTIHTYFQ.........----------------------------
Q81QE5_BACAN/261-379KDIQKLYIIKYIFI....SAGGCICG.YILSLFVTKIFTSNITL........----------------------------
Q87SX2_VIBPA/293-410RHVFSLLISEASLL....TAAGIVTG.VLGLYAILALLQPLIQQ........----------------------------
Q8CYG6_STRR6/404-522KDIIAKFLLYGLVA....GTVGTALGSILGHYLLASVISSVITK........----------------------------
Q8DQ76_STRR6/61-181RHLISMTFKELVVF....GILTVGAG.IGIGALFDKLIFAFLLKL.......----------------------------
Q8DQS2_STRR6/302-451ASILGQFITESILI....AIPALVSA.YFLANYTARAIGNTVLANVTSGVAK----------------------------
Q8EZY9_LEPIN/261-379NAVSWIVLGELFLF....SLIGSVFG.ILFGNILLKWIPDLAG.........----------------------------
Q8Y6E1_LISMO/60-180SQIVLVLFFENAML....YMLATIFG.VLIGIFSSKLFAMVLFWI.......----------------------------
R5K905_9CLOT/806-926KEINKMLINEQMFS....SVLASLAG.YGVGAAATALFVKLVAIVY......----------------------------
R5KJ88_9CLOT/349-467KNLMAHYVTLPTVI....TFVSGLIG.TLLGYSSLGVPIQMQDCY.......----------------------------
R5TSZ9_9FIRM/275-417KCTFGVLTSELWMI....FAVAYPVG.CVLGNAAAWGIYQKIGSIFVRTKGI----------------------------
R5UPZ8_9BACE/294-410FHLAMMLFVQLFLV....IVIASLFM.FGLIEILSSGMHISLSDL.......----------------------------
R6WL88_9PORP/155-267KDILRIFLKDVLRI....ALPAILLG.CGISYFVAEHWQRQ...........----------------------------
R6WLH2_9PORP/283-392KNLVIQLLLELTLL....VGISFLLA.SCLLELTVGGFSHLFE.........----------------------------
R6WYF0_9PORP/288-402AEMNYQLFLDTFLT....VGIAFLLS.LLIAHDLIPVFNRIMS.........----------------------------
R6X6U4_9PORP/275-397KGLFRLLFSEIAVL....FILSALAS.LVLTEWIVPVYYQYMAS........----------------------------
R7EAJ1_9BACE/292-408GRIRWQLLGEGLLL....LALASIPA.LIICINMVMADVTF...........----------------------------

PF03739

Q3ATU7_CHLCH/6-355RQLLTPFAWGALLL----FLFNFFNAGW.LAPTTYSHNRTFEQLYLGKNAGD..........QETRNLHLLDSGN.....
Q118T4_TRIEI/24-389YRMIIPTIILSLTV----TTLSFALNEI.IVPSANYQASLILEKTLEQENPP..........FKEENIFYPEFGKVKQPD
A0LEN9_SYNFM/39-391HQFFPAVVSLLLGV----TLISFVNMIF.VIPPTGKAFEVKLRSMARSGLPV..........LMKEGTFITAIPK.....
A7HYF9_PARL1/7-370WVVALPLLAIAMGT----SVIILAFSIY.IAPAGMRELKSRLVEIRSDVATA..........MIREGTFSNPATG.....
Q8DIL4_THEEB/18-374GRVLIPVVVFALLV----SGLTLALNET.AVPIAKYESKKLMGELLQQERSL..........GSGTDIFYPEYDRHG...
Q82W93_NITEU/6-348NRIIRTVFVIALPI----AILSGILSVY.ARPWAYAESYIMDAQAEAELNTN..........RFQPGRFYGSEKS.....
A0LB31_MAGSM/6-364VRILIPFLLGGVMV----AGVQMLLLDQ.IVPRTNAAAERSIFRMNLPEQAALYESMVSLEGVRKDNLWIRDGG......
Q6MKD0_BDEBA/11-364GTLLLPALILATLV----GVISAQMSFN.IAPWGNRQFEVLYSRLANTKAAA..........IIKEGTFAEGFFD.....
Q6FFD6_ACIAD/9-354WRIVGWVIRSALVL----VLLSFALSEW.VVPYTNERANSVKSHQSVAALGE............VRGYWSREGQ......
Q0C1U6_HYPNA/7-346FGQMRTLIPVVFLT----AVAAAFIIDT.VGPPASRSLLAWLGPEALQEDAQ...........VPEELWLSDGK......
Q11U59_CYTH3/9-455IRVMVPIAIWVLGC----TVGLYFFNNY.VVPKANLKAFSLLYDLRQKKPSL..........DLKPGVFYNGIPG.....
A1AWC7_RUTMC/20-369KHFMVFIQPLVIVI----VIFIFILTTV.VVPWSKQQRGLIMERSENTPEFS..........FIKKNEFQEFKNN.....
Q73NV9_TREDE/13-373SFILIPVFALGVFV----SVGSFITNDI.LIPRGTIKFNEVLYNIASSTPAL..........ELESYSVKRNE.......
Q1GR36_SPHAL/14-363HQVLAPLFLAALLV----AGISFAFNER.IVTRSTAALGAWQKVEYKRVPVD.........SGVRSNIWVRDGD......
A5EXI6_DICNV/8-348KHLMQPILYLVLPL----AVILVINTLY.LLPHVFERWDQLMAQSRQEALYS..........FFTPNQFQHLNAH.....
Q7VQS8_BLOFL/9-358LQINLSVIKTSIFI----VLLYVIYNIW.LLPYSQYLLCSHQHYKQYNVYLF.........PEKNKNLWLMDSGN.....
Q310A0_DESAG/6-352LRLARFFIIYALIW----SAVQLGFSQV.LGIYGEREASRIWKEQVRNREID.........EVQLTNLWFTEHG......
Q5SL96_THET8/6-344ERLLLPFLLLGTAI----ALAAFLLGEG.LVPQALAKGQDLLRREVLERPRA..........LLTPGATFQDAQG.....
Q6MJL5_BDEBA/6-356IRIAVPMLLLVAVI----SALGYMAADR.VLPRATKQKNYILYYDLKKEPHRF.......STIRTDRIWYRSKN......
A5WBH3_PSYWF/27-466GRLARLIIPLILVL----FVLEAGLSLY.GKPWGVKNSESIWQQQSLSSAFD..........LIRPQTFINSDD......
E0TCF8_PARBH/6-360WRLIFPPVILAVAA----GLLIATTLDP.LAARLAETAQTVKNEARSGEEAA..........AKRPHLWLRQNEIGS...
Q984S3_RHILO/7-356WQFLLPCCIGALLF----GFVSVGLINP.LAAHAFSLSEQIETQLRSGKSNT.........VSADAAPWIRQKTST....
Q2S3I0_SALRD/55-410YQLMRPYLGVGLLV----TVFMFGFNGW.VVPKTNEVVVRYENEYLPGNQKS..........VQTSEIHRRNGPN.....
Q1IRI3_KORVE/435-789YRVAFPVIAIAGVV----AASLFVFDQL.YIPKANKRQETLRNEIKGKPPQT.........YLRPDRKWIFGSNN.....
A1WAC0_ACISJ/11-359ARIAAPYFILALFV----CVFNLYLFGR.LQPLARYDYHVKMDAVLQTNWDA..........KIEENRFIDIAHG.....
Q8D296_WIGBR/5-350ECFIKVILFLNLLV----MSFSFVNVMW.ISPLALNYKHKIISYNLSNIDKL..........KLNEKQFKFIKDK.....
Q6MDI9_PARUW/8-358KTLMRPFLMIALAF----VCLLYLNEQF.VLPSTLKKLRHLENATKHQKKRQL.......PEITVKHVVLEDRS......
Q9A939_CAUCR/5-350YRIVGMAVPAAVAV----MLLDALCGQV.LAPRADPTLADWWRNTTPVAERK..........EPVPRTFRAGAD......
Q1D894_MYXXD/7-356SALYLPILVASFVA----CVGLVAFDER.VATYSGRRVDEITTQRFNKWGDWR........FYYTPKQWFRRGD......
Q1QKW5_NITHX/6-356FRLFRPFIYATVVV----ALLVAFIAAY.LAPDGMRRLKRWDAEITADVLAN..........VLQPGRFAQLDPN.....
Q143Z1_BURXL/6-377NQSLRSLLKIGIPL----VLLTYLIGEV.VGPYTDQLSERVRLEALGSSVSS..........NFESGVWVKDTLTARAD.
B5EBA8_GEOBB/11-361YGLLPPPMLFAACA----TLACLWVTVY.AVPWGNSGFKKLMVEIAQSSAGI..........AIKEKIFNNAFPG.....
A3I2C6_9BACT/6-354PRMLRPFIFAAMLI----GGVSFLLNGW.VLPVATEGVTKFKLTYIDKTRTA...........SDPNVHIKVGTD.....
Q2RQ55_RHORT/8-372WQLARPALALCAVL----TGVGYWLTLS.VVPAMEGAFEAIKYEVRGEVSSL..........VIKEGQFNQMKDG.....
A1WUU9_HALHL/6-348VQIAGAVLVGGVIL----ALLATAVGEL.VVPPAERQAAAVRGLSEADELRT..........GPDGALWARDGR......
A5G1T7_ACICJ/24-378AAIARPALALAMLT----MLACWGLNVW.LVPSTLARFTHFESIIRNQVAAF..........LLEPGVFTPIPGH.....
Q3B4Y3_PELLD/6-432YRLMLPVVIVGFLL----SLLVERFNNV.VQPQVKYKARSLMSDIAKAKPTF..........GITENAFSPLVDG.....
Q0BZX3_HYPNA/9-369WRFLTPVIVLGVAL----GIFSSLALNP.LAARLSQSFEAERARLLDVGREVV........QVAETGVWLRQGDDS....
A2U291_9FLAO/6-450QRLVRPIGILAIAL----SGLNFLFLNN.VFPYANLKQRNLYLNIKKKKPAL..........ALVPGSFNADIPG.....
A0LB30_MAGSM/6-357LRIFYPLSVPIVVV----TACSLYLNWF.LVPDSHTLFQNIRVALLSQNTFS...........IKTQTFNNTIPG.....
E0TCF9_PARBH/51-404LRLARPVLVLSILA----ALVSLYINAD.LQPKTYRQLRQTVEDVRSDIAQS..........LIREGVFVQPTAQ.....
A5EXI7_DICNV/7-348LRLSLSGLMIAFFL----GCALIVLAEYGVAP.AQNRAQWLHHHALNTTAPQ...........TDHGIWLRDGD......
B8CYZ1_HALOH/12-360YRLILPLLILGIVI----SGMTYLLNEE.IVPWTKHRAQNIIRKSVLKEVPP..........DIKENVFFKGPDG.....
Q1MPZ1_LAWIP/7-360YQMLPAPLAFSFFC----TLLTLWISLF.WIAWGMEQFKTTLLDIARTKVKI..........SIQPGVFNNNFPG.....
A8ZZ83_DESOH/6-356ASLFKPAAVVGVGC----CVLLLIVSEI.VVPRTISRANYIWLQQVRQKTSS.........VDQKNNIWLKDDR......
A8EWU1_ARCB4/5-331FKILKIFLPLTLLL----TLLLLVVSVG.LIPKSDFERKQFVNIKKNEANFN..........IKSGEFGQKFGD......
Q31ET4_THICR/6-346SFFQKRVFWFLVPL----AFLTAWVSLV.VTPWSYEQERKLIMEAQTTSPLA..........ALVPGKFNPLPNG.....
Q1IZ54_DEIGD/6-380GQVARPVAVVAALV----TALAVWLSLW.VAPRANVETRGLYWDVLTGAGLS..........QVVGKTVDLGDN......
Q1J2D3_DEIGD/10-350LRLVWPLAVPFVLV----GVLAFVNTGY.VVPGGLARWDRAWYTIYGTVPPA..........PSQDNYTFAPPG......
Q2S0T8_SALRD/7-449GQIVWPALVVAALL----MGGMLYFNNV.MLPEANHRARQLWSDIRGKRPGF..........ELRPGIFYEDMED.....
Q6MDI8_PARUW/7-377KDLLAPILLTAAFL----TIFNFWIVSE.VATQTHLQTNILKSELRSINPLL..........LLNNKHLMRL........
B8CYX9_HALOH/6-362YKIVIPSLLVGLIM----SVTTIMVNEM.VVPRANYLYDQIVWEIKNGRKMP..........ATQYDLTLTPLDRKYR..
Q1IRI3_KORVE/8-376LFFVRIVSIFSVAL----WILALVNNLY.VAPRSAAALAHLQDKLKSSQASF..........EVQPRVFYEDFKN.....
O83854_TREPA/1-358RFLIFPLLSIGLCS----ALFVFVFSDV.VVPASFIRLRQVYWRVLSSVPSL..........GFESHTTRKHNG......
Q8D297_WIGBR/7-348IKICILIIKTIIIF----LFIYSIILEW.IIPIEKKIKSKYFFNFISENKKN...............LWIKINN......
Q9AA49_CAUCR/9-364TRFTAPFVAMGVLL----MVLSVILFGF.VQPYSRYAYHAVLHAAENAGWNG..........DVRPKALLSAGSD.....
Q3J9X2_NITOC/9-352GHLLRVVLTFGLAL----AIGVGGISLY.LGPAASAEGYRLKQQALLAAETS..........GLVAGNFKEAQHG.....
A7IJ85_XANP2/6-384WRLLRPLIILALLV----SAFCALLAIK.VVPASLATFREQVTKVRADVVSF..........VAQPGRFVNLSQG.....
Q0C1U7_HYPNA/7-360YRIVLPFVQFSLVL----AAASLLISGF.LQPLSRYSYREIVYNLQHQSVLS..........VFQEQKFVQYDN......
Q0BVK4_GRABC/5-352RRIILSVIAFSIPL----MVILFLMAQF.VIPPAQREAQTWRSNALPDTTAL..........RSQDSFWAYGDR......
Q5FU64_GLUOX/35-392WQFLASPLACALLT----GLLTTTGISA.LSSTMFRSAEMLDQTYLRTGGGPL........TLNGGALWLRQSDDGLV..
Q5FPA9_GLUOX/26-376PALYRLLLPAVLIA----GIGGTCAQYW.LVPACENALTTWWNRTDPLAGQDG........QPEDNILWFRAGP......
Q1D895_MYXXD/6-362VRLLAAPMGIAVAL----SVLMLVITST.AQPWGLTGLKVLVSEVIRKNAVG..........DVKSGVFYEDLSN.....
A1AXG9_RUTMC/6-356MQISNIVVRAALMF----IAIVIFIGEL.VTPITIEYAESLRAKALGENITF..........KNQQGFWLKDSE......
A6QBC8_SULNB/6-335KKVLRSILLLGILF----SVLLSTLSFL.GIPISKQLYNAFKEKKKTEATLN..........IIPGKLGQKFGD......
A6QBZ1_SULNB/12-355KRLFSPVFVIASLT----YAVFIYLHTT.EFSYAKDKANMLLKNQVHAYNVN..............DMFFKYND......
Q7VQS9_BLOFL/5-358YVLIQSICMYSTVI----AILSLINLAY.LAPHCEQYKENIFFKMKKNTYFI.........ELIEKKFYLLFDEH.....
Q73NV8_TREDE/6-354GRFTLPLLVLGFFF----SVGMIFFEDN.VVIKYFYEKTQLSKKLLQEEESL..........DTQDLVILSELGK.....
B4E8H0_BURCJ/7-345TRLIKPIGVFAAPI----ILLITFFAFV.GWPWSNQQSKMIKARFQQRDEIS..........LLAPGQFRESAAN.....
J9ZCA2_LEPFM/6-351SRLLWPLVLFAFLG----YVGSFYMSLK.AEETQGMSLQEMISTVLKKKMSL..........GIRPQVFNNFMDR.....
J9ZCM7_LEPFM/6-356VKATKPFLALGVLI----SLISIAMNYQ.LVPYAYQMTDYIKDVRIDQGKSGN.......VTFELNNVWFRHGNQ.....
O26028_HELPY/5-350CQILSPIFLISLFF----TAIYVGLNAT.PFVYMEEKTQNLIYK....DNSL..........SVSEHLLVKYND......
O51747_BORBU/11-425FDLLVPFFKLGIVI----AFVSFISNDI.LLPLGSIGRLKIFNEIKEEVPHL..........VLKPYSSKQYGD......
O51748_BORBU/7-350TRILKPIILISIFI----SVVLFFFDNY.LVIDTIARRDVLIKNSIGDSRSG............DKTIIIRDFAR.....
O84846_CHLTR/8-346GMIIFPVLIASGVL----CCFNFYTCSE.LASICRFQTGKEIANIAMTSPAL..........LLQTLQ.KKENDR.....
LPTG_HAEIN/7-355FKIGIAVMKTALPL----VVFTMIIGEW.GIPQTEQFARDTRAKALSGGSIL..........SIKNGVWAKDGH......
Q2JLS4_SYNJB/13-367SRIFRPLLLVGLAM----SLSAFFISNV.LLPASKQQIRQIDQQALLAQATT..........PVQYDVFFKTEDN.....
Q2YN46_BRUA2/7-357SAVMRPILILAATV----SVTSFLIANY.VEPYARINMRAMIANASADLMHV..........IIQEGTFRKLADN.....
Q5NFB9_FRATT/8-349AQIAKGVILVGLIG----SVTTMVFGGY.IAP........ILQRQVDTNMVT..........YNTHDLWFKTPD......
Q5NFC0_FRATT/6-350MQIVKNTLKPVVAL----TIITLITVMY.LNPLSKQTLDIYRASLSAKALLS..........SITDQKIIKAPDG.....
Q5SL95_THET8/4-334LALLRPLVLLALAV----SLLNLLNLAE.LRPRSQEAYDGLLGRILYGEGGAS........GVLRRQVYAPPGL......
Q7CKF4_YERPE/5-345KSLIMAALILALFT----SGLAAINTIW.LGPWSSKHQDVVLNDAKANPSLA..........ALGGGQFKSSNDG.....
Q8F742_LEPIN/134-585PRIYINFLAFGFVM----ALLVGYLNFY.LSPENTRKMNEFNKWILAYNPLL..........AITPGQFSGDKTQDLF..
Q8F8T0_LEPIN/30-383FRIVTPLILFGILM----WIIMLLATEL.IVRPVN.KLAKIEHDTLTEGMGTL........ANSVYQFHVKGKE......
Q8PCR2_XANCP/10-365KRMSASVVVAMALL----TATMVISGET.VGPWAQSQADTLKTSARYQSDMT.........SARYSGLWAREGD......
Q8PCR3_XANCP/6-349RRMLRPILWLVVPV----VVVIGACSLW.LGPWASRTAELMLEDANRSVVMA..........GLESGKFTPLSGG.....
Q8RER6_FUSNN/12-360LRIVRAPLIIAFVI----SLFVFFVNNS.IYTKSLAKINFYRRGEIDETLKLP........TTKENAFFINNTEG.....
Q9X257_THEMA/19-363KNLIVPFLILGALL----SIAVFFLSDQ.IVPEYQSKAEEAMSKYVLKKPEV..........FVVENVISKIGDD.....
Q9ZCH3_RICPR/10-357WQVLIIPCIVTLIL----GIICTTILNP.ISTIGLQKYSLLEAKLTKKALSEC.......LISESGLLFFESLNEH....
R6X2Y4_9PORP/1-468VHIMRPLIITISII----SIGAFFFQNY.AMPVVQVKLYTLLWSMRQKSPEL..........DIPEGVFYSEITG.....

PF00528

J7JQQ0_BACIU/107-309WQTIRKVLVPAAFP----TLMTAVVLGMARA.FGEALAVQMVI.........----------------------------
D4FYT7_BACNB/80-293WHTVKTVLIPSAIP----SIITGAILASGRV.FGEAAALLFTA...G.....----------------------------
A0A017I3G0_ECOLX/116-308KQTERRHILRNASL----PMITAVGMHIGEL.IGGTMIIENIFAWPG.....----------------------------
D0KQN4_SULS9/116-318NR.IRKMVYKNSLL----PNITAFAIILGLA.ISQSLTVEGLLTTPG.....----------------------------
E8VKF3_BACST/41-224WQTMRGIILPQSIR----IALPPLANVLLDL.IKASSLAAMIT.........----------------------------
D0KNU1_SULS9/120-341RRVVYGVVLRNASI----PLVTLIALLFGYS.VAGAVVIEDIFQYHG.....----------------------------
Q9FAT0_VIBPH/116-319KRLICQYLIKGSLV----PTVTLHFAAFAEL.LGNAVLIESVFNYPG.....----------------------------
Q44374_RHIRD/87-266QWIIRHEILPNAIT----PLLAELALRFIFS.VLFLSTLSFLG.........----------------------------
Q9KB56_BACHD/117-308KK.VTIHILRNSLQ----VAISIFCMGIPTI.LGGTVVVENVFAWPG.....----------------------------
G4ER62_BACIU/40-211FQVLRMVELPLALS----VIMAGLRTALVIA.IGITAIGTFVGAGG......----------------------------
Q9LAT6_LISMN/112-304TEVAVKHAIRNALI----PLITVLGPLSVAL.MTGSLVIENIYSIPG.....----------------------------
LACF_RHIRD/87-298WGRFAFLTIPMLKP----VILFTTITSTIGT.LQLFDEVYNFTEGTGG....----------------------------
C9MHH9_HAEIF/68-243LRLLLKVRLPAALP----AFASGLRIAVSVA.PIGAVVGEWVGSSEG.....----------------------------
Q982M9_RHILO/75-250AEIFWSLRLPRALP----MLFSSLRIASATA.VIGAIVGEWIGSDKG.....----------------------------
D5AW50_RICPP/33-217FLIMKDIILPQAIN----NIFPSLVNELVNL.IKESAIISMLG.........----------------------------
G6NR23_STREE/298-492KEISNKHIFKNAMV----PLVSGIPAAIIGV.IGGATLTETVFAFPG.....----------------------------
D4G528_BACNB/46-230QKTLFRVILPQAFR----VSIPPLSNTFISL.IKDTSLASQIL.........----------------------------
A0A034X2L6_STREE/125-308LKIVAKNIMPQLVS----VIVTTMTQMLPSF.ISYEAFLSFFG.........----------------------------
NRTB_SYNE7/98-276KDYILNILIPSTVP----YVFAGLRIAVGLA.WLAIVAAEMLKADGG.....----------------------------
Q9HIL1_THEAC/131-337YQ.IKSIAYKNALL----PNLTGFAMSIGLS.VSGVIIEESIFSYPG.....----------------------------
A5IMY1_THEP1/119-323RL.IRKYAYRNAIL----PQITGLAIQLGTV.VAGALTTEIVFSYPG.....----------------------------
A0A017I1I1_ECOLX/90-294IRRFFKIALPLIAP----VSFFLLVVNLVYAFFDTFPVIDAATSGGP.....----------------------------
C9MH14_HAEIF/93-316WKILHQYVFRNTFP----LLVPQVPRVFTLV.LTQCMLVETALGWPG.....----------------------------
C6SR18_STRMN/87-273LTTYRKIIFPMLKP----MHATTLIINALWF.WNDFMLPLLILNK.......----------------------------
G8PA36_LACLC/106-293FKIMFREIWPNLST----LVIAEATLVFAGN.IGLETGLSFLG.........----------------------------
A0A017R3L7_SALET/27-221GQTFRRIMFPAMMR----YALPGIGNNWQVI.LKATALVSLLG.........----------------------------
A0A017I1V8_ECOLX/89-273VRVFVDHLAGAVIP----SLLVLATLDIGHM.MLHVAGMSFLG.........----------------------------
B1L9I4_THESQ/94-282FEVVFGDFVPYLIP----VISGGFIGSMMGA.IGFEIVLAILG.........----------------------------
A0A017IYA5_ECOLX/117-315LKTFFTVIVPLTKG----GIIAGSMLVFIPA.VGEFVIPELLGGP.......----------------------------
E8VDJ2_BACST/93-290IGVFWRIALPLSKP----VIATFALFYAVGI.WNDFFHALLYINDSAK...W----------------------------
A0A017IAJ7_ECOLX/74-276WQSFCKVVLPELSP----ALVAGVALSFTRS.LGEFGAVIFIAGNIAWK.TE----------------------------
Q9ZBG1_STRCO/128-331GTVLVGHALRSGLL----PVLTLIGSRVPEL.ITGALLVETVFSWPG.....----------------------------
Q97UH1_SULSO/128-336KM.VASKAYRLALL----PNFTSFSISLGYS.VLGAVAIEYLFNYAG.....----------------------------
D0KNZ4_SULS9/101-289KYIIFREVVPTLGS----YIAIHYIFNVEAA.VYAEVGLYYLG.........----------------------------
LACG_RHIRD/89-270WQIFFYIYVPVMRS----TYAAAFVIVFMLN.WNNYLWPLIVLQSNDT...K----------------------------
Q9HLG4_THEAC/81-265AKLFFSYLFINSID----PVVAYAALDFGNV.ILTYSTLAFLG.........----------------------------
A0A034X6C1_STREE/87-275FRRFWQIVLPLVRP----MVAVQALWAFMGP.FGDYILSSFLLREK......----------------------------
A0A009EAC3_ECOLX/43-239PQAYRYVLLPNAYR----VIVPPMTSEMMNL.VKNSAIASTIG.........----------------------------
B1X7L7_ECODH/68-240GQRVRKVELPLAAP----VILAGVRTSVIIN.IGTATIASTVGAST......----------------------------
Q9FAT1_VIBPH/84-268IHVILQHAFPHLLP----QWMTGMLLLLPHG.LLHSAALSFLG.........----------------------------
B8H0V5_CAUCN/67-247LQRLVRLRLPSAVP----ALLEGHKVAAGLA.VIGAVVAEFVAGSGGA...Q----------------------------
A0A009EN06_ECOLX/151-361KNILWKHVFRNAML----LVIAGFPATFISMFFTGSLLIEVMFSLNG.....----------------------------
YOR2_CALSR/83-265FRLYSDILLPLSAP----ALITVGIYNGTYL.WNEFVFALVLTSSP......----------------------------
O66777_AQUAE/114-319FT.LVRHVLKNAMN----PFTTLLGYEIASL.ISGAALIEIIVGWPG.....----------------------------
A0A017IH56_ECOLX/195-381AQRFLHVQLPLALP----VFLRSLRVVMVQT.VGMAVIAALIGAGG......----------------------------
Q9WXN6_THEMA/92-279LRLVIEDLIPTIAT----YAFMSFVLFINGG.IMGEAGLSLIG.........----------------------------
Q9Y9N0_AERPE/121-339SRIAV.HMLRISLI----PTITMMGLQFAIL.LGGAVLTEATFSWPG.....----------------------------
J9H1N9_9THEM/67-238RMILKEVYLGSIWP----FVLSILEVSSGNV.WKAVVMGEYLCGDSG.....----------------------------
Q9Z6P7_CHLPN/68-243FQLLIKLRIPHALP----HIFSGLKIAIGSA.GFAAIAGEWVASQSG.....----------------------------
A0A009ESA2_ECOLX/33-218WETIRYVILPLALR----RMLPPLGNQWIIS.IKDTSLFIVIG.........----------------------------
Q98K60_RHILO/105-289SQTFWKLRVPASVP----FLFTSMKVAVAAS.LVGAIVGELPTGAVA.....----------------------------
B1X7Q9_ECODH/91-278MRFFCDIVFPLSKT----NLAALFVITFIYG.WNQYLWPLLIITDVD.....----------------------------
A2RJ51_LACLM/113-318KVIFRRHILRNASL----PIASNFGFVITGL.LGGAIFAETIFGYPG.....----------------------------
Q49553_MYCHO/234-419PRRIFVHALPTIIG----KIANNIVRSVPGV.ILWIASLAFLG.........----------------------------
FBPB_SERMA/341-526AQALWSTTLRLAAP----GVAAGAALVFLAI.ANELTATLLLAP........----------------------------
Q987J0_RHILO/100-280AYLIGSEILPNIIR----PVLADFGLRFVFI.VLLLSGLSFLG.........----------------------------
Q9CLG9_PASMU/73-248SAMLFKVRLPAALP----SFASGLRIAVSVA.PIGAIVGEWVGSSQG.....----------------------------
A0A024F9P0_UREPR/183-374NRFVWLHALKPSLF----PIATFFPFVILGS.FVGALFIEQIFQIPG.....----------------------------
A0A017I1M5_ECOLX/101-295WKMISAITLKASVS----GIMTGILLAIARI.AGETAPLLFTA.........----------------------------
Q98QF6_MYCPU/174-365NGFVWKHALKASLF----PIATFFPAVVLGS.FIGSLFVEKIFLITG.....----------------------------
B2IN26_STRPS/209-434WQKFRNITFPMILA----VAAPTLISQYTFN.FNNFSIMYLFNGGGPGSVGG----------------------------
J7JKK3_BACIU/104-314FRRMWHITLPAIRS----TIIVLLILRIGSF.LNLGFEQVYLMTNS......----------------------------
A0A017I2Z6_ECOLX/173-362WKTQGLVILPQALK----LVIPGLVNTIIAL.FKDTSLVIIIG.........----------------------------
A0A023YPW1_ECOLX/104-273LEEILYGVLPQVMP----LLISYSLYRFESN.VRSATVVGMVGAGG......----------------------------
F6C4B4_SINMB/112-306RAVVVTHAMRGAML----PVVSYLAPCAAAL.LTGSAVVETIFTIPG.....----------------------------
Q97YP1_SULSO/131-332ST.VRAIARRNSII----PVITRTGIDLAFI.LGGIYFIEYIFGIPG.....----------------------------
O28506_ARCFU/135-354RKVVF.HAMKNAFI----PVVTLMGLQFAIL.LAGAVLTESTFSWPG.....----------------------------
Q98K61_RHILO/75-251WPTLIKLRLPAAAP----FIFNALKINSTLA.LIGAIVAEFFGTPVV.....----------------------------
AMYC_THETU/83-269FRIYWNIILPLLNP----TTITLAVLDIMWI.WNDYLLPSLVINK.......----------------------------
A0A008AYP3_STAAU/117-308IT.LMLHVLRNALQ----VAVSIFCMSIPMI.MGGLVVIEYIFAWPG.....----------------------------
Q9EWP8_STRCO/101-281RAVLRHDVLPNIAG----PALMDTALRLVAS.LHLTATAGFLG.........----------------------------
A0A016X6V1_VIBCL/118-310EQAFTRHAQRNIAL----PVMAFVGIQAVSL.VEGIVMIESLFSWPG.....----------------------------
B1X877_ECODH/158-341RSIILRHMLPNAMV----ATLTFLPFILCSS.ITTLTSLDFLG.........----------------------------
O86691_STRCO/402-574VHLLRHELLPAVVP----PVLRHALLRLPGV.ALALASLGFLG.........----------------------------
Q98QS7_MYCPU/195-382LRIIYLEALPQIIG----KLTNVYLNRIIGG.IFALSSLAFLQLI.......----------------------------
I3VV06_THESW/85-290WQQFRNVVFPLIAP----AFTVSLFITLSNS.FKLFDQNLSLTAGAP.....----------------------------
O34157_SALTM/115-319WSLLRHQVLRHAIT----PALCLQFASLGEL.MGGALLAEKVFAYPG.....----------------------------
Q9PL65_CHLMU/67-242WQTLIKLRIPHGLP----HIFSGLKIAMSAA.GFATIAGEWVAAQSG.....----------------------------
Q9RX04_DEIRA/318-494WQRLTRLELPGALP----VMLGGLRLAASLA.LIGAVVWEFTDPNQK.....----------------------------
J7JPW1_BACIU/94-269HQQISKVILPAALP----NILLGIRLSLGIA.WLGLVVAELMGSSSG.....----------------------------
Q9UYG7_PYRAB/121-325KL.LTKHAYRNAIL----PQVTGLALQLGLM.VAGAIATEIVFNYPG.....----------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
A7X0R3_STAA1/555-653--------------------------------------------------------------------------------
G6KLU1_STREE/155-254--------------------------------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
B1BGL8_CLOPF/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
G2KCB9_LISMN/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402--------------------.................-------------------------------------------
A3I1M1_9BACT/289-407--------------------.................-------------------------------------------
A8ABZ3_IGNH4/248-373--------------------.................-------------------------------------------
Q9WZG5_THEMA/725-844--------------------.................-------------------------------------------
Q9FBP3_STRCO/657-772--------------------.................-------------------------------------------
O28455_ARCFU/275-396--------------------.................-------------------------------------------
Q481M7_COLP3/705-820--------------------.................-------------------------------------------
A4YKC0_BRASO/734-849--------------------.................-------------------------------------------
A8AR20_CITK8/231-351--------------------.................-------------------------------------------
Y684_MYCPN/989-1110--------------------.................-------------------------------------------
Q2RPK1_RHORT/279-403--------------------.................-------------------------------------------
A6H1M7_FLAPJ/284-410--------------------.................-------------------------------------------
Q4QBC9_LEIMA/977-1097--------------------.................-------------------------------------------
Q025M3_SOLUE/351-471--------------------.................-------------------------------------------
Q54MT9_DICDI/545-666--------------------.................-------------------------------------------
Q6MGV4_BDEBA/659-778--------------------.................-------------------------------------------
A6L8W9_PARD8/653-767--------------------.................-------------------------------------------
Q4A9N5_MYCHJ/2523-2644--------------------.................-------------------------------------------
Q01VW7_SOLUE/1278-1396--------------------.................-------------------------------------------
A5USK7_ROSS1/311-433--------------------.................-------------------------------------------
Q9A6K3_CAUCR/352-465--------------------.................-------------------------------------------
Q5V3A9_HALMA/874-995--------------------.................-------------------------------------------
Q8NS27_CORGL/613-739--------------------.................-------------------------------------------
Q97DB8_CLOAB/716-835--------------------.................-------------------------------------------
A7HK62_FERNB/257-383--------------------.................-------------------------------------------
A1TXE6_MARAV/183-306--------------------.................-------------------------------------------
Q830M8_ENTFA/579-698--------------------.................-------------------------------------------
Q5LCL1_BACFN/272-387--------------------.................-------------------------------------------
Q9KF85_BACHD/539-650--------------------.................-------------------------------------------
A1SKN4_NOCSJ/300-416--------------------.................-------------------------------------------
Q5JEM5_THEKO/203-318--------------------.................-------------------------------------------
Q8G7P9_BIFLO/320-438--------------------.................-------------------------------------------
A9KQT2_CLOPH/343-506--------------------NTDTHQGQNGMFTGGGR-------------------------------------------
Q6F1V8_MESFL/1691-1810--------------------.................-------------------------------------------
Q9PPU7_UREPA/163-284--------------------.................-------------------------------------------
A6TSQ0_ALKMQ/264-387--------------------.................-------------------------------------------
A5N346_CLOK5/473-593--------------------.................-------------------------------------------
A7H957_ANADF/284-394--------------------.................-------------------------------------------
A1SH34_NOCSJ/769-890--------------------.................-------------------------------------------
A6LCJ9_PARD8/285-395--------------------.................-------------------------------------------
B8I8J6_CLOCE/296-424--------------------.................-------------------------------------------
Q6AA47_PROAC/602-722--------------------.................-------------------------------------------
Q6MT15_MYCMS/562-682--------------------.................-------------------------------------------
A4VW57_STRSY/998-1117--------------------.................-------------------------------------------
Q18EP9_HALWD/299-419--------------------.................-------------------------------------------
Q8EUA2_MYCPE/1360-1480--------------------.................-------------------------------------------
Q47EZ3_DECAR/243-372--------------------.................-------------------------------------------
Q034M7_LACC3/404-519--------------------.................-------------------------------------------
A3I2Y5_9BACT/746-861--------------------.................-------------------------------------------
Q0RJL1_FRAAA/639-753--------------------.................-------------------------------------------
Q7UPA2_RHOBA/581-706--------------------.................-------------------------------------------
Q8A9F6_BACTN/266-381--------------------.................-------------------------------------------
Q97LN0_CLOAB/737-854--------------------.................-------------------------------------------
Q4A9N5_MYCHJ/1802-1923--------------------.................-------------------------------------------
Q899W1_CLOTE/250-369--------------------.................-------------------------------------------
Q4DFN5_TRYCC/444-565--------------------.................-------------------------------------------
Q8KD33_CHLTE/268-389--------------------.................-------------------------------------------
Q6F163_MESFL/1281-1400--------------------.................-------------------------------------------
Q6AMB4_DESPS/278-415--------------------.................-------------------------------------------
A3QAU8_SHELP/312-429--------------------.................-------------------------------------------
Q6F1W1_MESFL/1301-1420--------------------.................-------------------------------------------
A6LZM8_CLOB8/286-398--------------------.................-------------------------------------------
A7ZBR0_CAMC1/308-420--------------------.................-------------------------------------------
B2HGJ6_MYCMM/176-292--------------------.................-------------------------------------------
B4EEB5_BURCJ/260-374--------------------.................-------------------------------------------
B7VH43_VIBSL/274-399--------------------.................-------------------------------------------
D4K997_9FIRM/663-783--------------------.................-------------------------------------------
D4KYJ1_9FIRM/264-395--------------------.................-------------------------------------------
D4KYJ2_9FIRM/263-378--------------------.................-------------------------------------------
M1FFQ7_9ALTE/689-801--------------------.................-------------------------------------------
Q0P8Y0_CAMJE/151-262--------------------.................-------------------------------------------
Q1G8P7_LACDA/281-403--------------------.................-------------------------------------------
Q2FUZ2_STAA8/60-179--------------------.................-------------------------------------------
Q5LDA1_BACFN/283-392--------------------.................-------------------------------------------
Q5LFF2_BACFN/296-426--------------------.................-------------------------------------------
Q6MSQ5_MYCMS/371-490--------------------.................-------------------------------------------
Q6MUJ8_MYCMS/1674-1786--------------------.................-------------------------------------------
Q79Z83_STRAW/244-362--------------------.................-------------------------------------------
Q7V1V4_PROMP/275-384--------------------.................-------------------------------------------
Q81HP3_BACCR/241-351--------------------.................-------------------------------------------
Q81QE5_BACAN/261-379--------------------.................-------------------------------------------
Q87SX2_VIBPA/293-410--------------------.................-------------------------------------------
Q8CYG6_STRR6/404-522--------------------.................-------------------------------------------
Q8DQ76_STRR6/61-181--------------------.................-------------------------------------------
Q8DQS2_STRR6/302-451--------------------QASKAA........QAS-------------------------------------------
Q8EZY9_LEPIN/261-379--------------------.................-------------------------------------------
Q8Y6E1_LISMO/60-180--------------------.................-------------------------------------------
R5K905_9CLOT/806-926--------------------.................-------------------------------------------
R5KJ88_9CLOT/349-467--------------------.................-------------------------------------------
R5TSZ9_9FIRM/275-417--------------------QHTNM...........Y-------------------------------------------
R5UPZ8_9BACE/294-410--------------------.................-------------------------------------------
R6WL88_9PORP/155-267--------------------.................-------------------------------------------
R6WLH2_9PORP/283-392--------------------.................-------------------------------------------
R6WYF0_9PORP/288-402--------------------.................-------------------------------------------
R6X6U4_9PORP/275-397--------------------.................-------------------------------------------
R7EAJ1_9BACE/292-408--------------------.................-------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355........RFISIG..AF..NPINE.......SLNNV..SIERL...................SG..ATMIS........
Q118T4_TRIEI/24-389GSQDDTLTRLFYAE..KF..DGK.........YMQGV..TILDR...................SQ..YGVDQ........
A0LEN9_SYNFM/39-391........LTFFFQ..SV..NPTEL.......SVRGI..FVQDR...................RE..EKVRL........
A7HYF9_PARL1/7-370........LTVFVR..ER..AADGT........TYGV..LVHDG...................RI..PSAPV........
Q8DIL4_THEEB/18-374.....NVRRLYYGH..RF..DGS.........RIQGI..TVLDF...................SQ..PQVTQ........
Q82W93_NITEU/6-348.......GRVIFIR..GK..DDLEK.......RMEGV..FHYI....................RT..TEDRE........
A0LB31_MAGSM/6-364........QILHAK..RA..YGDKR.......LLLEV..TIFRFT..................PE..HDLLM........
Q6MKD0_BDEBA/11-364........MVIYAN..EV..NTDKG.......LLKKV..FIYDE...................KN..GDVPL........
Q6FFD6_ACIAD/9-354........RFIYVD..YA..NSQGQ........LKRI..QVVDFD..................DN..YRLKS........
Q0C1U6_HYPNA/7-346........FLIELK..SM..QAE.........ELTGI..TIFERN..................AE..GAVVA........
Q11U59_CYTH3/9-455........YSIKIV..QK..FDNDS.......SIKGV..IIYDHT..................QS..RGNTD........
A1AWC7_RUTMC/20-369........DIVFYA..SK..VSDADNA..KEQNMEEI..FIYTLV..................NN..EPVIT........
Q73NV9_TREDE/13-373........NSIVVS..GL..IKDNS........IHDL..LIIDS...................SQ..RGAKR........
Q1GR36_SPHAL/14-363........DLINAE..TV..ETSGPA.....VVLRGV..TIYER...................TR..GVLSS........
A5EXI6_DICNV/8-348........NTLYTG..DK..INNG.........FQPF..IIIQ....................ND..NNEYS........
Q7VQS8_BLOFL/9-358........SFIHVN..YM..LTTQD........LLGI..NLYHFT..................EE..RQLKR........
Q310A0_DESAG/6-352........RIIHLE..TL..HPAAQ.......KGSGI..TVYELT.................PDE..LSVQR........
Q5SL96_THET8/6-344........RVVYVG..KV..EGE.........AIGAL..RVLSR...................EE...............
Q6MJL5_BDEBA/6-356........SIFNIK..TL..NAKGD.......GAQGL..TMYFFS..................DE..WDLVQ........
A5WBH3_PSYWF/27-466........YHLYVG..SM..NDNKT.......ELQDV..ILIQTAKDAAK........SVKPGATVPEATTNAPAVRLGQ
E0TCF8_PARBH/6-360.....DGIALLHAE..RY..RENDP.......VLEEV..TVWRRT..................QD..GAFIE........
Q984S3_RHILO/7-356......GDTIIGAR..AI..LNQGL.......EMSDAVFFVLD....................QQ..GNIVE........
Q2S3I0_SALRD/55-410........SILSVG..YY..DADRE.......RAHTV..SLQQLA..................GD..ARLAR........
Q1IRI3_KORVE/435-789........TIYYYE..VY..DADQN.......RFGGI..SIFQFD.................PKT..FALQS........
A1WAC0_ACISJ/11-359........FSFSAD..RV..EDGGR.......RFIGV..FMER....................RQ..NGIEE........
Q8D296_WIGBR/5-350.......NIILFVD..NI..KDK.........NLKNI..FIVKFIL................KNK..EYIPV........
Q6MDI9_PARUW/8-358........LLLYQN..YD..SEKEEFF..DVYWIESI..........................DS...............
Q9A939_CAUCR/5-350........LVIGAN...A..SADGR.......TITGV..TIFRRD..................SK..GILVE........
Q1D894_MYXXD/7-356........NIFFLR..GG..SAQEG........FQDV..SVFTVT..................ES..FDLQR........
Q1QKW5_NITHX/6-356........LTIRVR..ER..QPGGL........LVGI..FIDDR...................RN..PNERL........
Q143Z1_BURXL/6-377...GEQVTRFVNVG..EL..KPDAT........ISNV..RIYEFD..................SK..FRLSN........
B5EBA8_GEOBB/11-361........MVVYTQ..SL..DTKAQ.......TMGGV..IVHDE...................RD..PRTPT........
A3I2C6_9BACT/6-354........SYAYLS..RF..YKTGNTG..YHFTLETI..........................RD..GRLIN........
Q2RQ55_RHORT/8-372........LIVYAG..ER..AKDGR........LIDL..MIHDT...................TG..KTSDL........
A1WUU9_HALHL/6-348........DFLRAE..RP..RSASH........LESV..TLYRF...................VE..GQLTE........
A5G1T7_ACICJ/24-378........ITVYVQ..RR..DHDQV........LHGI..VIQDA...................RQ..KGEPA........
Q3B4Y3_PELLD/6-432........YSILVQ..HA..DEKTG.......SIGDI..IIYDA...................TR..KDYRS........
Q0BZX3_HYPNA/9-369......SQYVIHAR..RV..EDGGR.......TLLDV..KIIEEQRLYN.........GRQPTND..FAFVR........
A2U291_9FLAO/6-450........YQIKFD.EKY..GEEEN.......LLKKV..WIYDLT..................SN..RGNQK........
A0LB30_MAGSM/6-357........LTIYVN..RQ..SHGGK.......LLEGL..LIHDE...................RD..PDMPV........
E0TCF9_PARBH/51-404........ITVFAQ..EV..RPGGQ........FIGL..FINDS...................SD..PRETK........
A5EXI7_DICNV/7-348........NIVYIG..AF..QADGS........LEKI..RFYRP...................HE..HDLE.........
B8CYZ1_HALOH/12-360........RLFYVG..RF..DKEDN.......IMKKI..VVYTFK..................GD..NGYPL........
Q1MPZ1_LAWIP/7-360........FVLFAR..QV..DPLSG.......ELHQI..LLEDR...................SQ..KDRHL........
A8ZZ83_DESOH/6-356........TIVHIR..HY..QPREK.......KAFDV..VLHDLD..................EG..FRVTR........
A8EWU1_ARCB4/5-331........WLIFIN..DK..KNN.........LYEDV..KLLKVQ......................KDNDQ........
Q31ET4_THICR/6-346.......EGIFYTR..SI..KSNGD........LESV..WVRLNT..................DE..RDILL........
Q1IZ54_DEIGD/6-380........LTLWLG..GY..DAAGR.......KLQNV..RVERWA.................KDD..PQRTT........
Q1J2D3_DEIGD/10-350........ALFYAG..RV..RNGAESG...VAQLDGV..LIERG...................GE...............
Q2S0T8_SALRD/7-449........YSILVQ..DR..PPGTN.......KLIDV..TIYDYT..................QG..RDRQA........
Q6MDI8_PARUW/7-377........KGLYFD..SL..GPSRVG.....EMATDAVFAIPSQHHQRIN........LFIAKQL..KASSS........
B8CYX9_HALOH/6-362.....RPDYILYTH..RF..NGETG.......IMNDV..YLQDY...................EK..GVPVT........
Q1IRI3_KORVE/8-376........YVLYVE..DS..KSGSGS.....ALWRGV..FLADV...................ST..PSQPK........
O83854_TREPA/1-358........VILSVG..EV..FHS.........VMYQL..LIVDK...................SD..SRSLK........
Q8D297_WIGBR/7-348........NFILIK..KI..VDFDF........IQGI..YIYEFN..................KF..NEIKY........
Q9AA49_CAUCR/9-364........FFLTAD..RT..DASGR.......YLQQV..FIRRI...................DP..NGRED........
Q3J9X2_NITOC/9-352.......QRVFYAE..SL..TEDGL.......GMKNV..FIQVWE......................PTQKT........
A7IJ85_XANP2/6-384........LVFHVR..ER..APNGV........MRGI..FINDA...................RD..DGVS.........
Q0C1U7_HYPNA/7-360........RIIWTD..SV..LPGGR........LGQT..FILES...................EP..DGART........
Q0BVK4_GRABC/5-352........HFLNIQ..HF..EHHDE........PYNI..DIFSFA..................PD..GELHR........
Q5FU64_GLUOX/35-392....PHGVAILHAQDVHL..IDGAL.......KVSGV..SIFRLD..................DR..DRLIV........
Q5FPA9_GLUOX/26-376........TLVRIG..QI..AQGGT.......FLRDV..TIYHRD..................NT..GLLTG........
Q1D895_MYXXD/6-362........LTLYAE..QV..SADGK........WTNV..LLHDD...................RE..ANSPL........
A1AXG9_RUTMC/6-356........LFIHVK..KN..FDGKS........FQDV..TLIKLR..................AP..DTLDS........
A6QBC8_SULNB/6-335........YYIYVK..EK..DEKSK.......LFHDM..VIYNR...................TK..KDAEQ........
A6QBZ1_SULNB/12-355........TFVYIK..KL..NPIVK.......KIKGI..TIFKV...................AG..YQVRY........
Q7VQS9_BLOFL/5-358........LVLFID..NI..KNG.........MLNHV..FILKRV..................QNIDKNVFS........
Q73NV8_TREDE/6-354........IVYTAD..YF..NAENQ.......TLANA..YIIVRD..................ED..GNLSL........
B4E8H0_BURCJ/7-345.......HRVFFIE..KM..SPDQS.......KVQNV..FVTST....................E..NGKVN........
J9ZCA2_LEPFM/6-351........FVIYVD..RM..PTFSR........MQGV..FIYQEG..................KG..KSPST........
J9ZCM7_LEPFM/6-356........DIYGAR..TI..RDGGN.......ELDKV..VLYHLD..................RT..FHLSW........
O26028_HELPY/5-350........DYVYFD..KI..NPLLQ.......KAQNI..KVFRL...................KD..KTLES........
O51747_BORBU/11-425.........LIFVS..GE..KSENG........YKNV..TFFDNT..................GL..KGFDR........
O51748_BORBU/7-350........EIYNIK..SY..DIDEN.......TFANL..MIIIKD..................NK..DEFQT........
O84846_CHLTR/8-346........IFIAID..HC..GKS.........KFDNV..VIALK...................HN..QEISN........
LPTG_HAEIN/7-355........HFVFVR..RV..TDDTK........LDDI..YIYTFD..................QQ..HNLIK........
Q2JLS4_SYNJB/13-367........LWFFIR..QV..DPRLN.......TMQDV..TILRVDPL..............PGGK..YQLVE........
Q2YN46_BRUA2/7-357........LYIQVA..ER..RADGS........IGGL..FIADS...................RD..PTLDL........
Q5NFB9_FRATT/8-349........GFMNIA..NI..EPTNG.......KAYGI..RKFMV...................QD..NKVRE........
Q5NFC0_FRATT/6-350........KIIYIG..NK..SGN.........TLSDV..FLYQNT..................PQ..DGEYK........
Q5SL95_THET8/4-334........GVYFAE..EVYPEPEGN.......RLRGV..RVVDE...................RG......R........
Q7CKF4_YERPE/5-345.......NSALFIG..NV..AGK.........EFNRV..FLAQLR.................PNG..NQRPS........
Q8F742_LEPIN/134-585....EKRARTMYTE..GM..NSNTG.......ELKGV..QIREWEIFLEGNEYFHIGGKMIPMGG..SRIIQ........
Q8F8T0_LEPIN/30-383........GFYYLY..FY..DPDKD.......EINGG.FNYIRLR..................PD..GSPET........
Q8PCR2_XANCP/10-365........TFLNAL..SG..EEQLLDNGGTALTLHDV..RLYHLD..................AN..GQMQQ........
Q8PCR3_XANCP/6-349........GVVYLT..TI..SPDGK.......GLGKV..FMQRQ....................K..DDRID........
Q8RER6_FUSNN/12-360........YLYLMG..KI..NRETG.......LAENI..EVVKFN..................TE.ISKPKE........
Q9X257_THEMA/19-363........QYFYVE..KY..DERTS.......TMWNV..VIFRY.......................GHEET........
Q9ZCH3_RICPR/10-357.......NQIIQTK..FI..DVAEK.......KLNNI..TILFID..................NN..NSFLK........
R6X2Y4_9PORP/1-468........FNVYVK..HK..DTETG.......LLRDM..MIYDYS..................EG..FNKVS........

PF00528

J7JQQ0_BACIU/107-309--------------------------------------------------------------------------------
D4FYT7_BACNB/80-293--------------------------------------------------------------------------------
A0A017I3G0_ECOLX/116-308--------------------------------------------------------------------------------
D0KQN4_SULS9/116-318--------------------------------------------------------------------------------
E8VKF3_BACST/41-224--------------------------------------------------------------------------------
D0KNU1_SULS9/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
G4ER62_BACIU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
C9MHH9_HAEIF/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
D5AW50_RICPP/33-217--------------------------------------------------------------------------------
G6NR23_STREE/298-492--------------------------------------------------------------------------------
D4G528_BACNB/46-230--------------------------------------------------------------------------------
A0A034X2L6_STREE/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
A5IMY1_THEP1/119-323--------------------------------------------------------------------------------
A0A017I1I1_ECOLX/90-294--------------------------------------------------------------------------------
C9MH14_HAEIF/93-316--------------------------------------------------------------------------------
C6SR18_STRMN/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
A0A017R3L7_SALET/27-221--------------------------------------------------------------------------------
A0A017I1V8_ECOLX/89-273--------------------------------------------------------------------------------
B1L9I4_THESQ/94-282--------------------------------------------------------------------------------
A0A017IYA5_ECOLX/117-315--------------------------------------------------------------------------------
E8VDJ2_BACST/93-290--------------------------------------------------------------------------------
A0A017IAJ7_ECOLX/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
D0KNZ4_SULS9/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
A0A034X6C1_STREE/87-275--------------------------------------------------------------------------------
A0A009EAC3_ECOLX/43-239--------------------------------------------------------------------------------
B1X7L7_ECODH/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
B8H0V5_CAUCN/67-247--------------------------------------------------------------------------------
A0A009EN06_ECOLX/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
A0A017IH56_ECOLX/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
J9H1N9_9THEM/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
A0A009ESA2_ECOLX/33-218--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
B1X7Q9_ECODH/91-278--------------------------------------------------------------------------------
A2RJ51_LACLM/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
A0A024F9P0_UREPR/183-374--------------------------------------------------------------------------------
A0A017I1M5_ECOLX/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
B2IN26_STRPS/209-434--------------------------------------------------------------------------------
J7JKK3_BACIU/104-314--------------------------------------------------------------------------------
A0A017I2Z6_ECOLX/173-362--------------------------------------------------------------------------------
A0A023YPW1_ECOLX/104-273--------------------------------------------------------------------------------
F6C4B4_SINMB/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
A0A008AYP3_STAAU/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
A0A016X6V1_VIBCL/118-310--------------------------------------------------------------------------------
B1X877_ECODH/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
J7JPW1_BACIU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
A7X0R3_STAA1/555-653--------------------------------------------------------------------------------
G6KLU1_STREE/155-254--------------------------------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
B1BGL8_CLOPF/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
G2KCB9_LISMN/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402--------------------------------------------------------------------------------
A3I1M1_9BACT/289-407--------------------------------------------------------------------------------
A8ABZ3_IGNH4/248-373--------------------------------------------------------------------------------
Q9WZG5_THEMA/725-844--------------------------------------------------------------------------------
Q9FBP3_STRCO/657-772--------------------------------------------------------------------------------
O28455_ARCFU/275-396--------------------------------------------------------------------------------
Q481M7_COLP3/705-820--------------------------------------------------------------------------------
A4YKC0_BRASO/734-849--------------------------------------------------------------------------------
A8AR20_CITK8/231-351--------------------------------------------------------------------------------
Y684_MYCPN/989-1110--------------------------------------------------------------------------------
Q2RPK1_RHORT/279-403--------------------------------------------------------------------------------
A6H1M7_FLAPJ/284-410--------------------------------------------------------------------------------
Q4QBC9_LEIMA/977-1097--------------------------------------------------------------------------------
Q025M3_SOLUE/351-471--------------------------------------------------------------------------------
Q54MT9_DICDI/545-666--------------------------------------------------------------------------------
Q6MGV4_BDEBA/659-778--------------------------------------------------------------------------------
A6L8W9_PARD8/653-767--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644--------------------------------------------------------------------------------
Q01VW7_SOLUE/1278-1396--------------------------------------------------------------------------------
A5USK7_ROSS1/311-433--------------------------------------------------------------------------------
Q9A6K3_CAUCR/352-465--------------------------------------------------------------------------------
Q5V3A9_HALMA/874-995--------------------------------------------------------------------------------
Q8NS27_CORGL/613-739--------------------------------------------------------------------------------
Q97DB8_CLOAB/716-835--------------------------------------------------------------------------------
A7HK62_FERNB/257-383--------------------------------------------------------------------------------
A1TXE6_MARAV/183-306--------------------------------------------------------------------------------
Q830M8_ENTFA/579-698--------------------------------------------------------------------------------
Q5LCL1_BACFN/272-387--------------------------------------------------------------------------------
Q9KF85_BACHD/539-650--------------------------------------------------------------------------------
A1SKN4_NOCSJ/300-416--------------------------------------------------------------------------------
Q5JEM5_THEKO/203-318--------------------------------------------------------------------------------
Q8G7P9_BIFLO/320-438--------------------------------------------------------------------------------
A9KQT2_CLOPH/343-506--------------------------------------------------------------------------------
Q6F1V8_MESFL/1691-1810--------------------------------------------------------------------------------
Q9PPU7_UREPA/163-284--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/264-387--------------------------------------------------------------------------------
A5N346_CLOK5/473-593--------------------------------------------------------------------------------
A7H957_ANADF/284-394--------------------------------------------------------------------------------
A1SH34_NOCSJ/769-890--------------------------------------------------------------------------------
A6LCJ9_PARD8/285-395--------------------------------------------------------------------------------
B8I8J6_CLOCE/296-424--------------------------------------------------------------------------------
Q6AA47_PROAC/602-722--------------------------------------------------------------------------------
Q6MT15_MYCMS/562-682--------------------------------------------------------------------------------
A4VW57_STRSY/998-1117--------------------------------------------------------------------------------
Q18EP9_HALWD/299-419--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1360-1480--------------------------------------------------------------------------------
Q47EZ3_DECAR/243-372--------------------------------------------------------------------------------
Q034M7_LACC3/404-519--------------------------------------------------------------------------------
A3I2Y5_9BACT/746-861--------------------------------------------------------------------------------
Q0RJL1_FRAAA/639-753--------------------------------------------------------------------------------
Q7UPA2_RHOBA/581-706--------------------------------------------------------------------------------
Q8A9F6_BACTN/266-381--------------------------------------------------------------------------------
Q97LN0_CLOAB/737-854--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923--------------------------------------------------------------------------------
Q899W1_CLOTE/250-369--------------------------------------------------------------------------------
Q4DFN5_TRYCC/444-565--------------------------------------------------------------------------------
Q8KD33_CHLTE/268-389--------------------------------------------------------------------------------
Q6F163_MESFL/1281-1400--------------------------------------------------------------------------------
Q6AMB4_DESPS/278-415--------------------------------------------------------------------------------
A3QAU8_SHELP/312-429--------------------------------------------------------------------------------
Q6F1W1_MESFL/1301-1420--------------------------------------------------------------------------------
A6LZM8_CLOB8/286-398--------------------------------------------------------------------------------
A7ZBR0_CAMC1/308-420--------------------------------------------------------------------------------
B2HGJ6_MYCMM/176-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/260-374--------------------------------------------------------------------------------
B7VH43_VIBSL/274-399--------------------------------------------------------------------------------
D4K997_9FIRM/663-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/264-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/263-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/689-801--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/151-262--------------------------------------------------------------------------------
Q1G8P7_LACDA/281-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/60-179--------------------------------------------------------------------------------
Q5LDA1_BACFN/283-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/296-426--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/371-490--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1674-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/244-362--------------------------------------------------------------------------------
Q7V1V4_PROMP/275-384--------------------------------------------------------------------------------
Q81HP3_BACCR/241-351--------------------------------------------------------------------------------
Q81QE5_BACAN/261-379--------------------------------------------------------------------------------
Q87SX2_VIBPA/293-410--------------------------------------------------------------------------------
Q8CYG6_STRR6/404-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/61-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/302-451--------------------------------------------------------------------------------
Q8EZY9_LEPIN/261-379--------------------------------------------------------------------------------
Q8Y6E1_LISMO/60-180--------------------------------------------------------------------------------
R5K905_9CLOT/806-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/349-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/275-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/294-410--------------------------------------------------------------------------------
R6WL88_9PORP/155-267--------------------------------------------------------------------------------
R6WLH2_9PORP/283-392--------------------------------------------------------------------------------
R6WYF0_9PORP/288-402--------------------------------------------------------------------------------
R6X6U4_9PORP/275-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/292-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355..................................................RIDADSMHYNRR.......TKRWTMWRVTE
Q118T4_TRIEI/24-389..................................................IVSSESATWNSA.......ENIWDLFNGTI
A0LEN9_SYNFM/39-391..................................................AIVAESARIVYQRDS...NHLTFKIANGSI
A7HYF9_PARL1/7-370..................................................TYMAETGSLVRGPN.....GPLLVMFNGNI
Q8DIL4_THEEB/18-374..................................................VISAESAEWNVR.......ESRWLLSQGIA
Q82W93_NITEU/6-348..................................................IIISREGYQQPMTAE...QWPHIELREGQI
A0LB31_MAGSM/6-364..................................................RADAHKATWE.........NEGWVLHNGQI
Q6MKD0_BDEBA/11-364..................................................TIIAKAGEIVPDPTRP.GHEILLQLNQGEI
Q6FFD6_ACIAD/9-354..................................................VTNAEQGQFVK........DGQWLLNHSQQ
Q0C1U6_HYPNA/7-346..................................................ITTAETARPA.........DGGWALSGTGQ
Q11U59_CYTH3/9-455..................................................VIIADSGSMYLFNQS...QYLALELFRGNS
A1AWC7_RUTMC/20-369....................................................LAKQAQKYTNFNT...NSVYLRLKNGTR
Q73NV9_TREDE/13-373..................................................FLSSSQTDVKKSNDR..SIIMQLEMLNPRL
Q1GR36_SPHAL/14-363..................................................MLSADSARALP........GGGWEMANARR
A5EXI6_DICNV/8-348..................................................MLWSKRGEIQKNQP.....EHFLHLTQGNR
Q7VQS8_BLOFL/9-358..................................................IIYIEKATYI.........DNSWSVSNINE
Q310A0_DESAG/6-352..................................................VIRGKSFRAD.........SSGWTLDGCDI
Q5SL96_THET8/6-344..................................................VLLAERGSFR.........GGVLHVEEGTR
Q6MJL5_BDEBA/6-356..................................................MITAAQVKIQ.........GAQWLLEQGTV
A5WBH3_PSYWF/27-466QELEGSNSANQSVSSIDKDKAITAVTNPVAASQDKPAAKPAITADDDRDIIVLAKRAVQVKGSEE..SGKTQLDLFQGRR
E0TCF8_PARBH/6-360..................................................RLDAPRALID.........AQVLRLMQARR
Q984S3_RHILO/7-356..................................................RKDAAHAYLR.........DGYWELQDVKT
Q2S3I0_SALRD/55-410..................................................RVDANRMEWDDS.......LEVWRLDDVTR
Q1IRI3_KORVE/435-789..................................................RIYAQHAHWEDG.......LQKWVFEQGWM
A1WAC0_ACISJ/11-359..................................................ITTAVRGQLESNPDT...RKMRLKLEDGLR
Q8D296_WIGBR/5-350..................................................VFVSKHGSLYKDLLK...NKNVINLNYGEY
Q6MDI9_PARUW/8-358..................................................IYRAKYLCPNKEIPVGYFVDHLLRQPNGE.
Q9A939_CAUCR/5-350..................................................KVEAPAARYD.........GKAWTLEQPKT
Q1D894_MYXXD/7-356..................................................RLDASGMFPVE........GMRWRLTDVVE
Q1QKW5_NITHX/6-356..................................................SIVADHGTVMKNDN.....GSFLILEDGHL
Q143Z1_BURXL/6-377..................................................VRTAKSGKYQP........PGHWQLTGVTD
B5EBA8_GEOBB/11-361..................................................TIFASTGALVSDPKS...NSMEFQLRNGSI
A3I2C6_9BACT/6-354..................................................KLSSDRIQWDTA.......KNVWTLKNWRF
Q2RQ55_RHORT/8-372..................................................TVMAESGALVREGE.....GARILLINGNR
A1WUU9_HALHL/6-348..................................................RIDADGAHYE.........DGQWRLEGVVK
A5G1T7_ACICJ/24-378..................................................TILARSGRLIDGPD.....GPEVLLLDGSR
Q3B4Y3_PELLD/6-432..................................................VITAKDGVIDFSADG...RYLVMMLSDGQI
Q0BZX3_HYPNA/9-369..................................................RIDAEKAVLN.........EGFWQLENLVE
A2U291_9FLAO/6-450..................................................VITAESGKIVTEEGS...RYMTFILYNGNY
A0LB30_MAGSM/6-357..................................................TVIAKSGMLHRGST....GETALLLKEGSR
E0TCF9_PARBH/51-404..................................................TYTAERGLFQMAET.....GPKLLLIEGTV
A5EXI7_DICNV/7-348..................................................IQESQRATFM.........QTHWQLDDNRA
B8CYZ1_HALOH/12-360..................................................IVTANLGEVY.........KEKWVLKKGFI
Q1MPZ1_LAWIP/7-360..................................................VILAPTGTIETNPTK...GELIFNLTNGNI
A8ZZ83_DESOH/6-356..................................................RIDAARGLYD.........GGQWTLRNVLD
A8EWU1_ARCB4/5-331..................................................FVISKNAVLDNDNG.....VLSIRLDEGKA
Q31ET4_THICR/6-346....................................................MAPKGKFEWING.....KLVLVLLNGRS
Q1IZ54_DEIGD/6-380..................................................VIFADSGTFE.........NNRLSLRGYQV
Q1J2D3_DEIGD/10-350..................................................TVTAQSGIWDTQ.......ARTWTVSDAWI
Q2S0T8_SALRD/7-449..................................................VIKAERGVIESSAGG...ARLTLTLRNGEM
Q6MDI8_PARUW/7-377..................................................IFTAQGATLLTTTS....LNQENTFDDLLI
B8CYX9_HALOH/6-362..................................................LIKARKAVWQ.........GDKWHFYNGNI
Q1IRI3_KORVE/8-376..................................................ITMAERGVVVAEGP....NSLHLHLENGTQ
O83854_TREPA/1-358..................................................VVSSRKSVLESSADQ..TVPFTIRMHDPCM
Q8D297_WIGBR/7-348..................................................IKSSKYAIFK.........NKEWIMFDVKT
Q9AA49_CAUCR/9-364..................................................ILTAVSAVVHKNPAD...SHIALELTNGRQ
Q3J9X2_NITOC/9-352..................................................LLRAARGHLQTDEAT...GDKYLILEDGYR
A7IJ85_XANP2/6-384..................................................TYLADRGQIIESDA.....GIFLVLENGSI
Q0C1U7_HYPNA/7-360..................................................LLTGGSGKLREIRAG..EWEITLLGGAGAS
Q0BVK4_GRABC/5-352..................................................YLHAQSADILP........NDRWVLHDVLS
Q5FU64_GLUOX/35-392..................................................RVEAPQGALG.........DHQWILHGTSV
Q5FPA9_GLUOX/26-376..................................................TEHTNVLTYR.........DGQWHPDGAQD
Q1D895_MYXXD/6-362..................................................LVLAQRGQVGTSTSG...EVLRFALEAGEV
A1AXG9_RUTMC/6-356..................................................IVHSDSAISN.........GDNLELSQSIH
A6QBC8_SULNB/6-335..................................................FFSSKQGQLNRDKL.....VASLLLKEGYG
A6QBZ1_SULNB/12-355..................................................TIKAPVAVFN.........GEEWIAQNATV
Q7VQS9_BLOFL/5-358..................................................IITADQGSIHYNFND...KSQLIILQSGMY
Q73NV8_TREDE/6-354..................................................VIKSSHMVWN.........EDRWTTDSAEV
B4E8H0_BURCJ/7-345..................................................VVVSQTGHTETSKD....GDRFVVLEDGRR
J9ZCA2_LEPFM/6-351..................................................VIMAREGSLLNEENG..RPGIRIQLRSGTL
J9ZCM7_LEPFM/6-356..................................................QVDAKTLRYH.........QGLWSFQDGHL
O26028_HELPY/5-350..................................................YAEAKEAFFE.........DKYWILHDTTI
O51747_BORBU/11-425..................................................IFMAKNLDIRKENF.....QVYFILNDVLS
O51748_BORBU/7-350..................................................RYDINKAEWK.........DNKWRLYGIRE
O84846_CHLTR/8-346..................................................IGFIETIIPDVNKDSV.QAKNVLVISKIPL
LPTG_HAEIN/7-355..................................................LKHANQASYSED.......EAKWTLRQVNH
Q2JLS4_SYNJB/13-367..................................................VTLAAQAVWN.........GLEWSLSEGAT
Q2YN46_BRUA2/7-357..................................................IYYAADGAIASTPS.....GDMLLMENGEV
Q5NFB9_FRATT/8-349..................................................IRYAESATYINDAS.....ANVFNIRKIIF
Q5NFC0_FRATT/6-350..................................................VMTAPTAKIVSDKT.....AAYIDFMNVNI
Q5SL95_THET8/4-334..................................................VYSAEEGLWD.........EEGWRLKGYVV
Q7CKF4_YERPE/5-345..................................................VVVADSGHMSELPD....GSQMVILNKGTR
Q8F742_LEPIN/134-585..................................................IINAAKGNLVEKLGPDGEYEKSIRLKDGWI
Q8F8T0_LEPIN/30-383..................................................VISSLKAKYNYE.......TKLWKMKKVEE
Q8PCR2_XANCP/10-365..................................................LTYAAVAEHR.........EGRWTLRQVRR
Q8PCR3_XANCP/6-349..................................................VVTAERGAMFFEGK....TDRYLRLEDGHR
Q8RER6_FUSNN/12-360..................................................IITAKSAKFDTE.......ENKWIFSNVNI
Q9X257_THEMA/19-363..................................................IVTAKRVQKK.........GNDWYLFDGNY
Q9ZCH3_RICPR/10-357..................................................RIDALYGIID.........NKKLYLNRVKV
R6X2Y4_9PORP/1-468..................................................VMVADSGRLKTSADK...MFLVLSLFNGES

PF00528

J7JQQ0_BACIU/107-309--------------------------------------------------------------------------------
D4FYT7_BACNB/80-293--------------------------------------------------------------------------------
A0A017I3G0_ECOLX/116-308--------------------------------------------------------------------------------
D0KQN4_SULS9/116-318--------------------------------------------------------------------------------
E8VKF3_BACST/41-224--------------------------------------------------------------------------------
D0KNU1_SULS9/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
G4ER62_BACIU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
C9MHH9_HAEIF/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
D5AW50_RICPP/33-217--------------------------------------------------------------------------------
G6NR23_STREE/298-492--------------------------------------------------------------------------------
D4G528_BACNB/46-230--------------------------------------------------------------------------------
A0A034X2L6_STREE/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
A5IMY1_THEP1/119-323--------------------------------------------------------------------------------
A0A017I1I1_ECOLX/90-294--------------------------------------------------------------------------------
C9MH14_HAEIF/93-316--------------------------------------------------------------------------------
C6SR18_STRMN/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
A0A017R3L7_SALET/27-221--------------------------------------------------------------------------------
A0A017I1V8_ECOLX/89-273--------------------------------------------------------------------------------
B1L9I4_THESQ/94-282--------------------------------------------------------------------------------
A0A017IYA5_ECOLX/117-315--------------------------------------------------------------------------------
E8VDJ2_BACST/93-290--------------------------------------------------------------------------------
A0A017IAJ7_ECOLX/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
D0KNZ4_SULS9/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
A0A034X6C1_STREE/87-275--------------------------------------------------------------------------------
A0A009EAC3_ECOLX/43-239--------------------------------------------------------------------------------
B1X7L7_ECODH/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
B8H0V5_CAUCN/67-247--------------------------------------------------------------------------------
A0A009EN06_ECOLX/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
A0A017IH56_ECOLX/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
J9H1N9_9THEM/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
A0A009ESA2_ECOLX/33-218--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
B1X7Q9_ECODH/91-278--------------------------------------------------------------------------------
A2RJ51_LACLM/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
A0A024F9P0_UREPR/183-374--------------------------------------------------------------------------------
A0A017I1M5_ECOLX/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
B2IN26_STRPS/209-434--------------------------------------------------------------------------------
J7JKK3_BACIU/104-314--------------------------------------------------------------------------------
A0A017I2Z6_ECOLX/173-362--------------------------------------------------------------------------------
A0A023YPW1_ECOLX/104-273--------------------------------------------------------------------------------
F6C4B4_SINMB/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
A0A008AYP3_STAAU/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
A0A016X6V1_VIBCL/118-310--------------------------------------------------------------------------------
B1X877_ECODH/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
J7JPW1_BACIU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
A7X0R3_STAA1/555-653--------------------------------------------------------------------------------
G6KLU1_STREE/155-254--------------------------------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
B1BGL8_CLOPF/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
G2KCB9_LISMN/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402--------------------------------------------------------------------------------
A3I1M1_9BACT/289-407--------------------------------------------------------------------------------
A8ABZ3_IGNH4/248-373--------------------------------------------------------------------------------
Q9WZG5_THEMA/725-844--------------------------------------------------------------------------------
Q9FBP3_STRCO/657-772--------------------------------------------------------------------------------
O28455_ARCFU/275-396--------------------------------------------------------------------------------
Q481M7_COLP3/705-820--------------------------------------------------------------------------------
A4YKC0_BRASO/734-849--------------------------------------------------------------------------------
A8AR20_CITK8/231-351--------------------------------------------------------------------------------
Y684_MYCPN/989-1110--------------------------------------------------------------------------------
Q2RPK1_RHORT/279-403--------------------------------------------------------------------------------
A6H1M7_FLAPJ/284-410--------------------------------------------------------------------------------
Q4QBC9_LEIMA/977-1097--------------------------------------------------------------------------------
Q025M3_SOLUE/351-471--------------------------------------------------------------------------------
Q54MT9_DICDI/545-666--------------------------------------------------------------------------------
Q6MGV4_BDEBA/659-778--------------------------------------------------------------------------------
A6L8W9_PARD8/653-767--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644--------------------------------------------------------------------------------
Q01VW7_SOLUE/1278-1396--------------------------------------------------------------------------------
A5USK7_ROSS1/311-433--------------------------------------------------------------------------------
Q9A6K3_CAUCR/352-465--------------------------------------------------------------------------------
Q5V3A9_HALMA/874-995--------------------------------------------------------------------------------
Q8NS27_CORGL/613-739--------------------------------------------------------------------------------
Q97DB8_CLOAB/716-835--------------------------------------------------------------------------------
A7HK62_FERNB/257-383--------------------------------------------------------------------------------
A1TXE6_MARAV/183-306--------------------------------------------------------------------------------
Q830M8_ENTFA/579-698--------------------------------------------------------------------------------
Q5LCL1_BACFN/272-387--------------------------------------------------------------------------------
Q9KF85_BACHD/539-650--------------------------------------------------------------------------------
A1SKN4_NOCSJ/300-416--------------------------------------------------------------------------------
Q5JEM5_THEKO/203-318--------------------------------------------------------------------------------
Q8G7P9_BIFLO/320-438--------------------------------------------------------------------------------
A9KQT2_CLOPH/343-506--------------------------------------------------------------------------------
Q6F1V8_MESFL/1691-1810--------------------------------------------------------------------------------
Q9PPU7_UREPA/163-284--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/264-387--------------------------------------------------------------------------------
A5N346_CLOK5/473-593--------------------------------------------------------------------------------
A7H957_ANADF/284-394--------------------------------------------------------------------------------
A1SH34_NOCSJ/769-890--------------------------------------------------------------------------------
A6LCJ9_PARD8/285-395--------------------------------------------------------------------------------
B8I8J6_CLOCE/296-424--------------------------------------------------------------------------------
Q6AA47_PROAC/602-722--------------------------------------------------------------------------------
Q6MT15_MYCMS/562-682--------------------------------------------------------------------------------
A4VW57_STRSY/998-1117--------------------------------------------------------------------------------
Q18EP9_HALWD/299-419--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1360-1480--------------------------------------------------------------------------------
Q47EZ3_DECAR/243-372--------------------------------------------------------------------------------
Q034M7_LACC3/404-519--------------------------------------------------------------------------------
A3I2Y5_9BACT/746-861--------------------------------------------------------------------------------
Q0RJL1_FRAAA/639-753--------------------------------------------------------------------------------
Q7UPA2_RHOBA/581-706--------------------------------------------------------------------------------
Q8A9F6_BACTN/266-381--------------------------------------------------------------------------------
Q97LN0_CLOAB/737-854--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923--------------------------------------------------------------------------------
Q899W1_CLOTE/250-369--------------------------------------------------------------------------------
Q4DFN5_TRYCC/444-565--------------------------------------------------------------------------------
Q8KD33_CHLTE/268-389--------------------------------------------------------------------------------
Q6F163_MESFL/1281-1400--------------------------------------------------------------------------------
Q6AMB4_DESPS/278-415--------------------------------------------------------------------------------
A3QAU8_SHELP/312-429--------------------------------------------------------------------------------
Q6F1W1_MESFL/1301-1420--------------------------------------------------------------------------------
A6LZM8_CLOB8/286-398--------------------------------------------------------------------------------
A7ZBR0_CAMC1/308-420--------------------------------------------------------------------------------
B2HGJ6_MYCMM/176-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/260-374--------------------------------------------------------------------------------
B7VH43_VIBSL/274-399--------------------------------------------------------------------------------
D4K997_9FIRM/663-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/264-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/263-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/689-801--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/151-262--------------------------------------------------------------------------------
Q1G8P7_LACDA/281-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/60-179--------------------------------------------------------------------------------
Q5LDA1_BACFN/283-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/296-426--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/371-490--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1674-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/244-362--------------------------------------------------------------------------------
Q7V1V4_PROMP/275-384--------------------------------------------------------------------------------
Q81HP3_BACCR/241-351--------------------------------------------------------------------------------
Q81QE5_BACAN/261-379--------------------------------------------------------------------------------
Q87SX2_VIBPA/293-410--------------------------------------------------------------------------------
Q8CYG6_STRR6/404-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/61-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/302-451--------------------------------------------------------------------------------
Q8EZY9_LEPIN/261-379--------------------------------------------------------------------------------
Q8Y6E1_LISMO/60-180--------------------------------------------------------------------------------
R5K905_9CLOT/806-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/349-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/275-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/294-410--------------------------------------------------------------------------------
R6WL88_9PORP/155-267--------------------------------------------------------------------------------
R6WLH2_9PORP/283-392--------------------------------------------------------------------------------
R6WYF0_9PORP/288-402--------------------------------------------------------------------------------
R6X6U4_9PORP/275-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/292-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355RYFSNG..................................YQSFTTKPTATIRLA.LRPKALHEMRLQP...........
Q118T4_TRIEI/24-389YLVSPDGS................................YRNIVKFDHKKLKLS.TAPLDLAGKRRTY...........
A0LEN9_SYNFM/39-391TRVADDMK................................NAQAVSFKAYDLSLS.LDELIGSARGSKMN..........
A7HYF9_PARL1/7-370QRASRSGTE.............................TSAATFLYFDKYTYDLS.QYMEDEPTLSYEG...........
Q8DIL4_THEEB/18-374YLISHTGV................................SRNLLQFDQQEIRLP.RPAQSQPLRPTDV...........
Q82W93_NITEU/6-348YRLSFDTV................................KDSAIRFEKM.IYFN.ENDQAQNYRR..............
A0LB31_MAGSM/6-364YRFNGH..................................TTQSEPFTRMPWAIN.LEKEQIKRATPQP...........
Q6MKD0_BDEBA/11-364HRQAK...................................THTKISFDTYDVRFS..EPQNIEEKAKSP...........
Q6FFD6_ACIAD/9-354MAIQGQG.................................DAVLANAAKQPFSLA.LQPKYVHMVTIDP...........
Q0C1U6_HYPNA/7-346RRFD......................................GEPPTDMTFWTSP.QTPESLQLLLSPP...........
Q11U59_CYTH3/9-455YNEFKGEGGMSY........................INPEEFVRNSFDKTKIVFN.LSSFDLKKTKEELFMGSRQMKGVD
A1AWC7_RUTMC/20-369YHGFPSNKN..............................KKILNFKLYDLQIIDG.KMQKSISTVTKV............
Q73NV9_TREDE/13-373LNL.....................................DLNNRSKFDVVYGES.ITYNVLAKDVAPKFIS........
Q1GR36_SPHAL/14-363FSRR....................................SGTLEPLGTIVAAPN.VRPDQFTLADVDG...........
A5EXI6_DICNV/8-348AAWRDDF.................................QPQNCLFSQFAHGSL.HLSQSPPSAQQRL...........
Q7VQS8_BLOFL/9-358LEFVDKM.................................QFLNRKILSYEWNTT.LTPAILSMITVNP...........
Q310A0_DESAG/6-352LIPGSY..................................EVATSESIVLPIEQD.VKAFSIVDPRGDP...........
Q5SL96_THET8/6-344........................................ITYEGSRPRTLARFQ.RGELVLKDLTFDPWQ.........
Q6MJL5_BDEBA/6-356TIFNKDSS................................FPLTSPFKTKSIVMA.EDSKDLQSAGQTA...........
A5WBH3_PSYWF/27-466YEVGADSL................................VYSQIGFERYRISIN.QPPADVLTEENV............
E0TCF8_PARBH/6-360STSIA...................................TTAPQIEAEIEVPVA.IDLRLLDQDRQTA...........
Q984S3_RHILO/7-356FR......................................NGTIQPSASDRVPTN.LKPEFVQERLARP...........
Q2S3I0_SALRD/55-410RTFVKGE.................................TQRKRTIASLDTTLQ.VYPRDLARSKNDV...........
Q1IRI3_KORVE/435-789RKLNGSA.................................IEEFKPFEVETIALAAEPPAYFKKEVRQS...........
A1WAC0_ACISJ/11-359VRQTPDGA................................IATTRFVDGYVEDFS.KTRAPYRDRGETA...........
Q8D296_WIGBR/5-350YEIDFKSN................................YFFIASFERYQIELF.NTFSRLKEPSS.............
Q6MDI9_PARUW/8-358........................................LLQQQAYSQYEFKNLLFNQELLQSAILDP...........
Q9A939_CAUCR/5-350TRFAGD..................................LSQASTAAATSWPTA.LRPQDVQGLFGD............
Q1D894_MYXXD/7-356RTFDGEG.................................KTSVRQLPEAEYDLG.VAVTAFRIRPGRP...........
Q1QKW5_NITHX/6-356ERLEAGKR................................EPNMVAFRRNAFDMS.KFSNRGHDVVYGI...........
Q143Z1_BURXL/6-377TQLIDVPPPPGTPA...................DALNPVYRAKEVAVPEYSLRSE.LTPQILSVLLVSP...........
B5EBA8_GEOBB/11-361HRAEEQG.................................GYRMVQFQEYNLRVALADGSNKATRKV.............
A3I2C6_9BACT/6-354RELNEF..................................GEDYSVGEEMDTTLS.ITPDDFDLPENHH...........
Q2RQ55_RHORT/8-372QERNRQTG................................KVNFLYFDSYAVDLG.GKAASTEMRFREE...........
A1WUU9_HALHL/6-348TVYADH..................................RLERRELEAWAWQGA.LSPDVLAVVVADP...........
A5G1T7_ACICJ/24-378EQVDPKTG................................RLNILSFRRNLISLA.KPTGVTRKLAPKT...........
Q3B4Y3_PELLD/6-432HEVQVPGH...............................RLYRKMEFDRHRFVFE.STGFGFSRSSENRARSGGHELSAR
Q0BZX3_HYPNA/9-369NLP.....................................NQAPERRATLAIPTS.LDAVRLLDEYASP...........
A2U291_9FLAO/6-450YEEHVKSARTT.........................IKRKKMAASSATFKEYEFN.IDIGDTLDEGQLDSINSATIPMML
A0LB30_MAGSM/6-357HQMAPGN.................................AYRRLNFSTYDLELGIAFETESSSGDRAI...........
E0TCF9_PARBH/51-404QYRDRETG................................RVDVFRYIETAVDLA.AFDRGSGGRSLDE...........
A5EXI7_DICNV/7-348LCIGS...................................QSSMPITPTTHWQNR.ILPATIAQLMQLK...........
B8CYZ1_HALOH/12-360HRYNGEGH................................LTMETRFDVMEIKIN.TEVHNFFADQKTP...........
Q1MPZ1_LAWIP/7-360YTMSLN..................................KTSFLSFDQYLVRIP.LTTLLKNINFNELR..........
A8ZZ83_DESOH/6-356QQFDVAGN................................VQLVEFRERLKIELD.LLPEDLDRAAESA...........
A8EWU1_ARCB4/5-331FLIDKE..................................EFNQINYEAMYINDS.ISTAKTTVFTTTY...........
Q31ET4_THICR/6-346YEGLK...................................KGDDFTVREFDRFEG.FLPEIQSTSTAQQ...........
Q1IZ54_DEIGD/6-380YTVNYAAAARL..........................ARVPENDPAAFRTAVQEV.FPNVVLPEDASSTLNLD.......
Q1J2D3_DEIGD/10-350TRPGQDPR...............................QVAGPLVFPQTDTLRPPQPPA....................
Q2S0T8_SALRD/7-449HRPLPPDANN...........................QSERYERLTFDRHRIRFT.LSNVVFRRSESEETARSTRTMRTP
Q6MDI8_PARUW/7-377ENMKKSTTHVE..........................DFSQILQKKVWTVNNDYL.KLPLLLIRAQEQK...........
B8CYX9_HALOH/6-362YYFKEGE.................................RVPALKFNEYVIKQPIYTPRRIGKMNKDI...........
Q1IRI3_KORVE/8-376QETNPKDP...............................TQYQVSTFDQTDIPIQLPETNDKPAPELVP...........
O83854_TREPA/1-358LIV.....................................YRTRPRICDLIYGGR.ADYHVHTQQTQPEYFM........
Q8D297_WIGBR/7-348IKFNNNK.................................KIEINSFDKQIYTNI.ITPKEINLILFPT...........
Q9AA49_CAUCR/9-364........................................ISTVAGAQSYVVNFS.RLMFDVPSGDAGLLRLR.......
Q3J9X2_NITOC/9-352YELMGEEV................................GVRIFSFERHGILVK.KGGAQEFRIRH.............
A7IJ85_XANP2/6-384QRRGGAAKEAEKDASEAN...........KDAGKDKGKSSNSSVVEFQRYAFDLS.SLAPNSQGQDVKP...........
Q0C1U7_HYPNA/7-360YRDADPPE................................EYDRIEYGELSWPVI.AETGQYRARGGDE...........
Q0BVK4_GRABC/5-352RTLVDG..................................QLRKAHLDRLDWTPF.LTPQQTQFLRLRP...........
Q5FU64_GLUOX/35-392LHP.....................................DHLPQQIGDMTLPSD.LTVGRVQESFASP...........
Q5FPA9_GLUOX/26-376LSLSDDK.................................SYVNVTKGDSTFVIP.ATPSVIMTLSQNG...........
Q1D895_MYXXD/6-362HRSAGRET...............................EEYSIIRFDQAEISVGVGASMGKRSRFSYS...........
A1AXG9_RUTMC/6-356YQFGKDGNL..............................TTFSENNFEKYSVQVS.FNKKLIENLKKDP...........
A6QBC8_SULNB/6-335YTYTKN..................................KLQQAKYKSLEVFDS.KQKYRFHFQ...............
A6QBZ1_SULNB/12-355KTHIYQNGE.............................LVRYSMDQKESIATLHG.YKPKIIESLYEG............
Q7VQS9_BLOFL/5-358YEIHNTQLL.............................CIPRFVTYFNQYRTLVH.DKYQFLRDVNKSV...........
Q73NV8_TREDE/6-354YRFDEKN.................................SVSCLNNIPDNIILS.EPPANFQKNLSSV...........
B4E8H0_BURCJ/7-345YDGTPGQP................................NFKIMEFERYGVKIT.SKPVTNVQTTN.............
J9ZCA2_LEPFM/6-351LQGGA...................................AQQFVRFSSYDLTIF.GKSAGTTAKPP.............
J9ZCM7_LEPFM/6-356TRFLPDG.................................SLKIESFQKMDTTLT.RRPVDFTYEKTRM...........
O26028_HELPY/5-350YEMPLSFELG............................ANALSTTRLKTFKTLKN.FRPKVLDTIYQNK...........
O51747_BORBU/11-425IALTDSESGFYDYFYADKMKYSIDQVTFSDSFLLNYVTPSQ.........................MSMRDVIKLIKKQN
O51748_BORBU/7-350FVKVGKKI................................KENAYDVLDGTGIIK.LAPDYIRTVMLSS...........
O84846_CHLTR/8-346FSEAR...................................TSNPNEFYLETLDEF.LIPKITATLFAGK...........
LPTG_HAEIN/7-355STIMKD..................................EIITTNHLSETWETS.LTPDKLGAVSLRP...........
Q2JLS4_SYNJB/13-367HLYGPTGL................................SIAEQTFHRKPLQVS.QDLAALMQPPVPP...........
Q2YN46_BRUA2/7-357QRRNVSDG................................TVSIIKFDSYAFDLN.QFASAGDDFVIFA...........
Q5NFB9_FRATT/8-349PASDGQKH................................IDIVTNMTNAVWSNP.LPISVAKVITIND...........
Q5NFC0_FRATT/6-350YTKNSQNS................................EYSYDNAKKAIYTIF..DNSDRDYNHDRV...........
Q5SL95_THET8/4-334.EG.....................................EEVRPFEGVLPFPAR.FRPKESLGSRDPY...........
Q7CKF4_YERPE/5-345YEGTALLR................................DFRITDFVDYQAVIG.HKQVQQSSNG..A...........
Q8F742_LEPIN/134-585LEWSDDRK................................TFSITDFRNGEMDYNIPKGKEKKTLELNVKPETFSMPVLF
Q8F8T0_LEPIN/30-383WHFDNDLK................................LSSQETYEEKEYELP.EEPSYFKVPAGSV...........
Q8PCR2_XANCP/10-365DTFQAR..................................SVQRETFPELPWQSQ.LNPKALAAGLAKP...........
Q8PCR3_XANCP/6-349IEGPAGAQG..............................LDYRLMTFASNDVALP.DRTKAHDA..NDP...........
Q8RER6_FUSNN/12-360YNVETKE.................................TTAKIEYKSNLYKDD..PSNFIKASAEDP...........
Q9X257_THEMA/19-363YTVDKDGF................................LKLDVHFSEMKLDIT.EDIEKLLRVGKTP...........
Q9ZCH3_RICPR/10-357ST......................................KDEIKSYSNLTIQTN.LSINSLVNKFMRP...........
R6X2Y4_9PORP/1-468FRSLDKQPSTAG.......................TKSSVPYQRETFKSRDILIE.FD.ANFSRTDESFMQNQFMGKNMH

PF00528

J7JQQ0_BACIU/107-309--------------------------------------------------------------------------------
D4FYT7_BACNB/80-293--------------------------------------------------------------------------------
A0A017I3G0_ECOLX/116-308--------------------------------------------------------------------------------
D0KQN4_SULS9/116-318--------------------------------------------------------------------------------
E8VKF3_BACST/41-224--------------------------------------------------------------------------------
D0KNU1_SULS9/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
G4ER62_BACIU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
C9MHH9_HAEIF/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
D5AW50_RICPP/33-217--------------------------------------------------------------------------------
G6NR23_STREE/298-492--------------------------------------------------------------------------------
D4G528_BACNB/46-230--------------------------------------------------------------------------------
A0A034X2L6_STREE/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
A5IMY1_THEP1/119-323--------------------------------------------------------------------------------
A0A017I1I1_ECOLX/90-294--------------------------------------------------------------------------------
C9MH14_HAEIF/93-316--------------------------------------------------------------------------------
C6SR18_STRMN/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
A0A017R3L7_SALET/27-221--------------------------------------------------------------------------------
A0A017I1V8_ECOLX/89-273--------------------------------------------------------------------------------
B1L9I4_THESQ/94-282--------------------------------------------------------------------------------
A0A017IYA5_ECOLX/117-315--------------------------------------------------------------------------------
E8VDJ2_BACST/93-290--------------------------------------------------------------------------------
A0A017IAJ7_ECOLX/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
D0KNZ4_SULS9/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
A0A034X6C1_STREE/87-275--------------------------------------------------------------------------------
A0A009EAC3_ECOLX/43-239--------------------------------------------------------------------------------
B1X7L7_ECODH/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
B8H0V5_CAUCN/67-247--------------------------------------------------------------------------------
A0A009EN06_ECOLX/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
A0A017IH56_ECOLX/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
J9H1N9_9THEM/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
A0A009ESA2_ECOLX/33-218--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
B1X7Q9_ECODH/91-278--------------------------------------------------------------------------------
A2RJ51_LACLM/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
A0A024F9P0_UREPR/183-374--------------------------------------------------------------------------------
A0A017I1M5_ECOLX/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
B2IN26_STRPS/209-434--------------------------------------------------------------------------------
J7JKK3_BACIU/104-314--------------------------------------------------------------------------------
A0A017I2Z6_ECOLX/173-362--------------------------------------------------------------------------------
A0A023YPW1_ECOLX/104-273--------------------------------------------------------------------------------
F6C4B4_SINMB/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
A0A008AYP3_STAAU/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
A0A016X6V1_VIBCL/118-310--------------------------------------------------------------------------------
B1X877_ECODH/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
J7JPW1_BACIU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
A7X0R3_STAA1/555-653--------------------------------------------------------------------------------
G6KLU1_STREE/155-254--------------------------------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
B1BGL8_CLOPF/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
G2KCB9_LISMN/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402--------------------------------------------------------------------------------
A3I1M1_9BACT/289-407--------------------------------------------------------------------------------
A8ABZ3_IGNH4/248-373--------------------------------------------------------------------------------
Q9WZG5_THEMA/725-844--------------------------------------------------------------------------------
Q9FBP3_STRCO/657-772--------------------------------------------------------------------------------
O28455_ARCFU/275-396--------------------------------------------------------------------------------
Q481M7_COLP3/705-820--------------------------------------------------------------------------------
A4YKC0_BRASO/734-849--------------------------------------------------------------------------------
A8AR20_CITK8/231-351--------------------------------------------------------------------------------
Y684_MYCPN/989-1110--------------------------------------------------------------------------------
Q2RPK1_RHORT/279-403--------------------------------------------------------------------------------
A6H1M7_FLAPJ/284-410--------------------------------------------------------------------------------
Q4QBC9_LEIMA/977-1097--------------------------------------------------------------------------------
Q025M3_SOLUE/351-471--------------------------------------------------------------------------------
Q54MT9_DICDI/545-666--------------------------------------------------------------------------------
Q6MGV4_BDEBA/659-778--------------------------------------------------------------------------------
A6L8W9_PARD8/653-767--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2523-2644--------------------------------------------------------------------------------
Q01VW7_SOLUE/1278-1396--------------------------------------------------------------------------------
A5USK7_ROSS1/311-433--------------------------------------------------------------------------------
Q9A6K3_CAUCR/352-465--------------------------------------------------------------------------------
Q5V3A9_HALMA/874-995--------------------------------------------------------------------------------
Q8NS27_CORGL/613-739--------------------------------------------------------------------------------
Q97DB8_CLOAB/716-835--------------------------------------------------------------------------------
A7HK62_FERNB/257-383--------------------------------------------------------------------------------
A1TXE6_MARAV/183-306--------------------------------------------------------------------------------
Q830M8_ENTFA/579-698--------------------------------------------------------------------------------
Q5LCL1_BACFN/272-387--------------------------------------------------------------------------------
Q9KF85_BACHD/539-650--------------------------------------------------------------------------------
A1SKN4_NOCSJ/300-416--------------------------------------------------------------------------------
Q5JEM5_THEKO/203-318--------------------------------------------------------------------------------
Q8G7P9_BIFLO/320-438--------------------------------------------------------------------------------
A9KQT2_CLOPH/343-506--------------------------------------------------------------------------------
Q6F1V8_MESFL/1691-1810--------------------------------------------------------------------------------
Q9PPU7_UREPA/163-284--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/264-387--------------------------------------------------------------------------------
A5N346_CLOK5/473-593--------------------------------------------------------------------------------
A7H957_ANADF/284-394--------------------------------------------------------------------------------
A1SH34_NOCSJ/769-890--------------------------------------------------------------------------------
A6LCJ9_PARD8/285-395--------------------------------------------------------------------------------
B8I8J6_CLOCE/296-424--------------------------------------------------------------------------------
Q6AA47_PROAC/602-722--------------------------------------------------------------------------------
Q6MT15_MYCMS/562-682--------------------------------------------------------------------------------
A4VW57_STRSY/998-1117--------------------------------------------------------------------------------
Q18EP9_HALWD/299-419--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1360-1480--------------------------------------------------------------------------------
Q47EZ3_DECAR/243-372--------------------------------------------------------------------------------
Q034M7_LACC3/404-519--------------------------------------------------------------------------------
A3I2Y5_9BACT/746-861--------------------------------------------------------------------------------
Q0RJL1_FRAAA/639-753--------------------------------------------------------------------------------
Q7UPA2_RHOBA/581-706--------------------------------------------------------------------------------
Q8A9F6_BACTN/266-381--------------------------------------------------------------------------------
Q97LN0_CLOAB/737-854--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1802-1923--------------------------------------------------------------------------------
Q899W1_CLOTE/250-369--------------------------------------------------------------------------------
Q4DFN5_TRYCC/444-565--------------------------------------------------------------------------------
Q8KD33_CHLTE/268-389--------------------------------------------------------------------------------
Q6F163_MESFL/1281-1400--------------------------------------------------------------------------------
Q6AMB4_DESPS/278-415--------------------------------------------------------------------------------
A3QAU8_SHELP/312-429--------------------------------------------------------------------------------
Q6F1W1_MESFL/1301-1420--------------------------------------------------------------------------------
A6LZM8_CLOB8/286-398--------------------------------------------------------------------------------
A7ZBR0_CAMC1/308-420--------------------------------------------------------------------------------
B2HGJ6_MYCMM/176-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/260-374--------------------------------------------------------------------------------
B7VH43_VIBSL/274-399--------------------------------------------------------------------------------
D4K997_9FIRM/663-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/264-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/263-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/689-801--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/151-262--------------------------------------------------------------------------------
Q1G8P7_LACDA/281-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/60-179--------------------------------------------------------------------------------
Q5LDA1_BACFN/283-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/296-426--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/371-490--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1674-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/244-362--------------------------------------------------------------------------------
Q7V1V4_PROMP/275-384--------------------------------------------------------------------------------
Q81HP3_BACCR/241-351--------------------------------------------------------------------------------
Q81QE5_BACAN/261-379--------------------------------------------------------------------------------
Q87SX2_VIBPA/293-410--------------------------------------------------------------------------------
Q8CYG6_STRR6/404-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/61-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/302-451--------------------------------------------------------------------------------
Q8EZY9_LEPIN/261-379--------------------------------------------------------------------------------
Q8Y6E1_LISMO/60-180--------------------------------------------------------------------------------
R5K905_9CLOT/806-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/349-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/275-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/294-410--------------------------------------------------------------------------------
R6WL88_9PORP/155-267--------------------------------------------------------------------------------
R6WLH2_9PORP/283-392--------------------------------------------------------------------------------
R6WYF0_9PORP/288-402--------------------------------------------------------------------------------
R6X6U4_9PORP/275-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/292-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355................................................................................
Q118T4_TRIEI/24-389................................................................................
A0LEN9_SYNFM/39-391................................................................................
A7HYF9_PARL1/7-370................................................................................
Q8DIL4_THEEB/18-374................................................................................
Q82W93_NITEU/6-348................................................................................
A0LB31_MAGSM/6-364................................................................................
Q6MKD0_BDEBA/11-364................................................................................
Q6FFD6_ACIAD/9-354................................................................................
Q0C1U6_HYPNA/7-346................................................................................
Q11U59_CYTH3/9-455ELDHHIDSIQRMFVSVN.............................................KNSSGMLQPFYYYTTVNP
A1AWC7_RUTMC/20-369................................................................................
Q73NV9_TREDE/13-373................................................................................
Q1GR36_SPHAL/14-363................................................................................
A5EXI6_DICNV/8-348................................................................................
Q7VQS8_BLOFL/9-358................................................................................
Q310A0_DESAG/6-352................................................................................
Q5SL96_THET8/6-344................................................................................
Q6MJL5_BDEBA/6-356................................................................................
A5WBH3_PSYWF/27-466................................................................................
E0TCF8_PARBH/6-360................................................................................
Q984S3_RHILO/7-356................................................................................
Q2S3I0_SALRD/55-410................................................................................
Q1IRI3_KORVE/435-789................................................................................
A1WAC0_ACISJ/11-359................................................................................
Q8D296_WIGBR/5-350................................................................................
Q6MDI9_PARUW/8-358................................................................................
Q9A939_CAUCR/5-350................................................................................
Q1D894_MYXXD/7-356................................................................................
Q1QKW5_NITHX/6-356................................................................................
Q143Z1_BURXL/6-377................................................................................
B5EBA8_GEOBB/11-361................................................................................
A3I2C6_9BACT/6-354................................................................................
Q2RQ55_RHORT/8-372................................................................................
A1WUU9_HALHL/6-348................................................................................
A5G1T7_ACICJ/24-378................................................................................
Q3B4Y3_PELLD/6-432ELL..........................................................................SVA
Q0BZX3_HYPNA/9-369................................................................................
A2U291_9FLAO/6-450TLDQIKDTIPMLKDNYDEILG......................................LRAKNIFISTSAKDLYEYPDS
A0LB30_MAGSM/6-357................................................................................
E0TCF9_PARBH/51-404................................................................................
A5EXI7_DICNV/7-348................................................................................
B8CYZ1_HALOH/12-360................................................................................
Q1MPZ1_LAWIP/7-360................................................................................
A8ZZ83_DESOH/6-356................................................................................
A8EWU1_ARCB4/5-331................................................................................
Q31ET4_THICR/6-346................................................................................
Q1IZ54_DEIGD/6-380................................................................................
Q1J2D3_DEIGD/10-350................................................................................
Q2S0T8_SALRD/7-449RLLDTLD..................................................................SLKTERD
Q6MDI8_PARUW/7-377................................................................................
B8CYX9_HALOH/6-362................................................................................
Q1IRI3_KORVE/8-376................................................................................
O83854_TREPA/1-358................................................................................
Q8D297_WIGBR/7-348................................................................................
Q9AA49_CAUCR/9-364................................................................................
Q3J9X2_NITOC/9-352................................................................................
A7IJ85_XANP2/6-384................................................................................
Q0C1U7_HYPNA/7-360................................................................................
Q0BVK4_GRABC/5-352................................................................................
Q5FU64_GLUOX/35-392................................................................................
Q5FPA9_GLUOX/26-376................................................................................
Q1D895_MYXXD/6-362................................................................................
A1AXG9_RUTMC/6-356................................................................................
A6QBC8_SULNB/6-335................................................................................
A6QBZ1_SULNB/12-355................................................................................
Q7VQS9_BLOFL/5-358................................................................................
Q73NV8_TREDE/6-354................................................................................
B4E8H0_BURCJ/7-345................................................................................
J9ZCA2_LEPFM/6-351................................................................................
J9ZCM7_LEPFM/6-356................................................................................
O26028_HELPY/5-350................................................................................
O51747_BORBU/11-425NLIADSNIKNNLEGDFL..............................................SLNFSNLYLNYLYNQNY
O51748_BORBU/7-350................................................................................
O84846_CHLTR/8-346................................................................................
LPTG_HAEIN/7-355................................................................................
Q2JLS4_SYNJB/13-367................................................................................
Q2YN46_BRUA2/7-357................................................................................
Q5NFB9_FRATT/8-349................................................................................
Q5NFC0_FRATT/6-350................................................................................
Q5SL95_THET8/4-334................................................................................
Q7CKF4_YERPE/5-345................................................................................
Q8F742_LEPIN/134-585QIRNNIESEGLEKIPGLETLQE....................................MGVQIKGLIGLKQMVEQMKIEL
Q8F8T0_LEPIN/30-383................................................................................
Q8PCR2_XANCP/10-365................................................................................
Q8PCR3_XANCP/6-349................................................................................
Q8RER6_FUSNN/12-360................................................................................
Q9X257_THEMA/19-363................................................................................
Q9ZCH3_RICPR/10-357................................................................................
R6X2Y4_9PORP/1-468DLQIFIDSVSVRLDSIQNVNAKNVYETSYKKTLKKPQDIKQNNVKDDSNSEKSDTKTTLETPKTDEPVIVMNFDSLYQAE

PF00528

J7JQQ0_BACIU/107-309--------------------------------------------------------------------------------
D4FYT7_BACNB/80-293--------------------------------------------------------------------------------
A0A017I3G0_ECOLX/116-308--------------------------------------------------------------------------------
D0KQN4_SULS9/116-318--------------------------------------------------------------------------------
E8VKF3_BACST/41-224--------------------------------------------------------------------------------
D0KNU1_SULS9/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
G4ER62_BACIU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
C9MHH9_HAEIF/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
D5AW50_RICPP/33-217--------------------------------------------------------------------------------
G6NR23_STREE/298-492--------------------------------------------------------------------------------
D4G528_BACNB/46-230--------------------------------------------------------------------------------
A0A034X2L6_STREE/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
A5IMY1_THEP1/119-323--------------------------------------------------------------------------------
A0A017I1I1_ECOLX/90-294--------------------------------------------------------------------------------
C9MH14_HAEIF/93-316--------------------------------------------------------------------------------
C6SR18_STRMN/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
A0A017R3L7_SALET/27-221--------------------------------------------------------------------------------
A0A017I1V8_ECOLX/89-273--------------------------------------------------------------------------------
B1L9I4_THESQ/94-282--------------------------------------------------------------------------------
A0A017IYA5_ECOLX/117-315--------------------------------------------------------------------------------
E8VDJ2_BACST/93-290--------------------------------------------------------------------------------
A0A017IAJ7_ECOLX/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
D0KNZ4_SULS9/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
A0A034X6C1_STREE/87-275--------------------------------------------------------------------------------
A0A009EAC3_ECOLX/43-239--------------------------------------------------------------------------------
B1X7L7_ECODH/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
B8H0V5_CAUCN/67-247--------------------------------------------------------------------------------
A0A009EN06_ECOLX/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
A0A017IH56_ECOLX/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
J9H1N9_9THEM/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
A0A009ESA2_ECOLX/33-218--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
B1X7Q9_ECODH/91-278--------------------------------------------------------------------------------
A2RJ51_LACLM/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
A0A024F9P0_UREPR/183-374--------------------------------------------------------------------------------
A0A017I1M5_ECOLX/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
B2IN26_STRPS/209-434--------------------------------------------------------------------------------
J7JKK3_BACIU/104-314--------------------------------------------------------------------------------
A0A017I2Z6_ECOLX/173-362--------------------------------------------------------------------------------
A0A023YPW1_ECOLX/104-273--------------------------------------------------------------------------------
F6C4B4_SINMB/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
A0A008AYP3_STAAU/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
A0A016X6V1_VIBCL/118-310--------------------------------------------------------------------------------
B1X877_ECODH/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
J7JPW1_BACIU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
A7X0R3_STAA1/555-653--------------------------------------------------------------------------------
G6KLU1_STREE/155-254--------------------------------------------------------------------------------
A0A028VRZ0_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
B1BGL8_CLOPF/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
B9WU46_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
G2KCB9_LISMN/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

O50782_BORBU/276-402---------------------------------------------------------------------------.....
A3I1M1_9BACT/289-407---------------------------------------------------------------------------.....
A8ABZ3_IGNH4/248-373---------------------------------------------------------------------------.....
Q9WZG5_THEMA/725-844---------------------------------------------------------------------------.....
Q9FBP3_STRCO/657-772---------------------------------------------------------------------------.....
O28455_ARCFU/275-396---------------------------------------------------------------------------.....
Q481M7_COLP3/705-820---------------------------------------------------------------------------.....
A4YKC0_BRASO/734-849---------------------------------------------------------------------------.....
A8AR20_CITK8/231-351---------------------------------------------------------------------------.....
Y684_MYCPN/989-1110---------------------------------------------------------------------------.....
Q2RPK1_RHORT/279-403---------------------------------------------------------------------------.....
A6H1M7_FLAPJ/284-410---------------------------------------------------------------------------.....
Q4QBC9_LEIMA/977-1097---------------------------------------------------------------------------.....
Q025M3_SOLUE/351-471---------------------------------------------------------------------------.....
Q54MT9_DICDI/545-666---------------------------------------------------------------------------.....
Q6MGV4_BDEBA/659-778---------------------------------------------------------------------------.....
A6L8W9_PARD8/653-767---------------------------------------------------------------------------.....
Q4A9N5_MYCHJ/2523-2644---------------------------------------------------------------------------.....
Q01VW7_SOLUE/1278-1396---------------------------------------------------------------------------.....
A5USK7_ROSS1/311-433---------------------------------------------------------------------------.....
Q9A6K3_CAUCR/352-465---------------------------------------------------------------------------.....
Q5V3A9_HALMA/874-995---------------------------------------------------------------------------.....
Q8NS27_CORGL/613-739---------------------------------------------------------------------------.....
Q97DB8_CLOAB/716-835---------------------------------------------------------------------------.....
A7HK62_FERNB/257-383---------------------------------------------------------------------------.....
A1TXE6_MARAV/183-306---------------------------------------------------------------------------.....
Q830M8_ENTFA/579-698---------------------------------------------------------------------------.....
Q5LCL1_BACFN/272-387---------------------------------------------------------------------------.....
Q9KF85_BACHD/539-650---------------------------------------------------------------------------.....
A1SKN4_NOCSJ/300-416---------------------------------------------------------------------------.....
Q5JEM5_THEKO/203-318---------------------------------------------------------------------------.....
Q8G7P9_BIFLO/320-438---------------------------------------------------------------------------.....
A9KQT2_CLOPH/343-506---------------------------------------------------------------------------TAGAF
Q6F1V8_MESFL/1691-1810---------------------------------------------------------------------------.....
Q9PPU7_UREPA/163-284---------------------------------------------------------------------------.....
A6TSQ0_ALKMQ/264-387---------------------------------------------------------------------------.....
A5N346_CLOK5/473-593---------------------------------------------------------------------------.....
A7H957_ANADF/284-394---------------------------------------------------------------------------.....
A1SH34_NOCSJ/769-890---------------------------------------------------------------------------.....
A6LCJ9_PARD8/285-395---------------------------------------------------------------------------.....
B8I8J6_CLOCE/296-424---------------------------------------------------------------------------.....
Q6AA47_PROAC/602-722---------------------------------------------------------------------------.....
Q6MT15_MYCMS/562-682---------------------------------------------------------------------------.....
A4VW57_STRSY/998-1117---------------------------------------------------------------------------.....
Q18EP9_HALWD/299-419---------------------------------------------------------------------------.....
Q8EUA2_MYCPE/1360-1480---------------------------------------------------------------------------.....
Q47EZ3_DECAR/243-372---------------------------------------------------------------------------.....
Q034M7_LACC3/404-519---------------------------------------------------------------------------.....
A3I2Y5_9BACT/746-861---------------------------------------------------------------------------.....
Q0RJL1_FRAAA/639-753---------------------------------------------------------------------------.....
Q7UPA2_RHOBA/581-706---------------------------------------------------------------------------.....
Q8A9F6_BACTN/266-381---------------------------------------------------------------------------.....
Q97LN0_CLOAB/737-854---------------------------------------------------------------------------.....
Q4A9N5_MYCHJ/1802-1923---------------------------------------------------------------------------.....
Q899W1_CLOTE/250-369---------------------------------------------------------------------------.....
Q4DFN5_TRYCC/444-565---------------------------------------------------------------------------.....
Q8KD33_CHLTE/268-389---------------------------------------------------------------------------.....
Q6F163_MESFL/1281-1400---------------------------------------------------------------------------.....
Q6AMB4_DESPS/278-415---------------------------------------------------------------------------.....
A3QAU8_SHELP/312-429---------------------------------------------------------------------------.....
Q6F1W1_MESFL/1301-1420---------------------------------------------------------------------------.....
A6LZM8_CLOB8/286-398---------------------------------------------------------------------------.....
A7ZBR0_CAMC1/308-420---------------------------------------------------------------------------.....
B2HGJ6_MYCMM/176-292---------------------------------------------------------------------------.....
B4EEB5_BURCJ/260-374---------------------------------------------------------------------------.....
B7VH43_VIBSL/274-399---------------------------------------------------------------------------.....
D4K997_9FIRM/663-783---------------------------------------------------------------------------.....
D4KYJ1_9FIRM/264-395---------------------------------------------------------------------------.....
D4KYJ2_9FIRM/263-378---------------------------------------------------------------------------.....
M1FFQ7_9ALTE/689-801---------------------------------------------------------------------------.....
Q0P8Y0_CAMJE/151-262---------------------------------------------------------------------------.....
Q1G8P7_LACDA/281-403---------------------------------------------------------------------------.....
Q2FUZ2_STAA8/60-179---------------------------------------------------------------------------.....
Q5LDA1_BACFN/283-392---------------------------------------------------------------------------.....
Q5LFF2_BACFN/296-426---------------------------------------------------------------------------.....
Q6MSQ5_MYCMS/371-490---------------------------------------------------------------------------.....
Q6MUJ8_MYCMS/1674-1786---------------------------------------------------------------------------.....
Q79Z83_STRAW/244-362---------------------------------------------------------------------------.....
Q7V1V4_PROMP/275-384---------------------------------------------------------------------------.....
Q81HP3_BACCR/241-351---------------------------------------------------------------------------.....
Q81QE5_BACAN/261-379---------------------------------------------------------------------------.....
Q87SX2_VIBPA/293-410---------------------------------------------------------------------------.....
Q8CYG6_STRR6/404-522---------------------------------------------------------------------------.....
Q8DQ76_STRR6/61-181---------------------------------------------------------------------------.....
Q8DQS2_STRR6/302-451---------------------------------------------------------------------------NLGGG
Q8EZY9_LEPIN/261-379---------------------------------------------------------------------------.....
Q8Y6E1_LISMO/60-180---------------------------------------------------------------------------.....
R5K905_9CLOT/806-926---------------------------------------------------------------------------.....
R5KJ88_9CLOT/349-467---------------------------------------------------------------------------.....
R5TSZ9_9FIRM/275-417---------------------------------------------------------------------------VAAEA
R5UPZ8_9BACE/294-410---------------------------------------------------------------------------.....
R6WL88_9PORP/155-267---------------------------------------------------------------------------.....
R6WLH2_9PORP/283-392---------------------------------------------------------------------------.....
R6WYF0_9PORP/288-402---------------------------------------------------------------------------.....
R6X6U4_9PORP/275-397---------------------------------------------------------------------------.....
R7EAJ1_9BACE/292-408---------------------------------------------------------------------------.....

PF03739

Q3ATU7_CHLCH/6-355...........DEITL.........................PRH..................YQFLREK......EEAGF
Q118T4_TRIEI/24-389...........KQMNI.........................SQS..................YEYLELM......RLSGN
A0LEN9_SYNFM/39-391..........KREMTL.........................REL.................YRVIVEKT......GDVGH
A7HYF9_PARL1/7-370...........RERYF.........................HEL..................VNPASDD......LYGQQ
Q8DIL4_THEEB/18-374...........NELSI.........................TQA..................RRALQRL......DPDRE
Q82W93_NITEU/6-348...........KAAST.........................RSL.................................WDS
A0LB31_MAGSM/6-364...........EELSL.........................QAL..................WKHADRL......AREGY
Q6MKD0_BDEBA/11-364...........PSLTL.........................EEV.....................RNRL......KEDIK
Q6FFD6_ACIAD/9-354...........EDLSF.........................SQL..................VSFMNYM......REYSQ
Q0C1U6_HYPNA/7-346...........RDLAI.........................SNL..................IALSEMR......GSGSR
Q11U59_CYTH3/9-455LDSTKNKAVEHDSIKL.........................SKKALLAESPGKEVAQRAANQARSIKSYLQGNVERDERF
A1AWC7_RUTMC/20-369...........ESKST.........................FEL..................LF....S......NKLTE
Q73NV9_TREDE/13-373.......SSGPDKMTS.........................YDL.................IKDIKQKK......EAGDT
Q1GR36_SPHAL/14-363...........DELPF.........................LKL..................KAAIDDL......EAAGR
A5EXI6_DICNV/8-348...........RSIAT.........................GAL........................N......QSLAH
Q7VQS8_BLOFL/9-358...........HFLSI.........................SKL..................ICCIKYF......DVLGQ
Q310A0_DESAG/6-352...........SRLPL.........................WQL..................QDAIARL......TESGS
Q5SL96_THET8/6-344........NPANRMTL.........................AEL..................RKEVQRL......RQMGV
Q6MJL5_BDEBA/6-356...........DMMSQ.........................KEL..................EHFIDKN......KAAGL
A5WBH3_PSYWF/27-466...........TTQSV.........................PALWKA...........ATGQKVATKAD......GSTEP
E0TCF8_PARBH/6-360...........DTLSV.........................WAL..................PETIRLM......GDAGM
Q984S3_RHILO/7-356...........ETIPF.........................YDL..................PGKIEVA......RSFGL
Q2S3I0_SALRD/55-410...........AAMTI.........................PAA..................AEYLAAL......RRSGV
Q1IRI3_KORVE/435-789...........QEMDY.........................QEL..................LRYIHDL......QQSGF
A1WAC0_ACISJ/11-359...........TERTL.........................PEL..................WLAMCKT......CDPDS
Q8D296_WIGBR/5-350...........EYVYF.........................KNL...................................F
Q6MDI9_PARUW/8-358...........DILPL.........................TNL.................FFQQPSLF......ANLSE
Q9A939_CAUCR/5-350...........DSMPT..............................................AASARRA......LENGG
Q1D894_MYXXD/7-356...........EQMRA.........................SEL..................REQIVAR......RDVGL
Q1QKW5_NITHX/6-356...........RERYL.........................WEL..................IAPEPTD......PLVQQ
Q143Z1_BURXL/6-377...........DRMSM.........................FNL..................FRYIQHL......TENHQ
B5EBA8_GEOBB/11-361...........SEMTL.........................DEL.......................LH......PPKGT
A3I2C6_9BACT/6-354...........ETLKL.........................PEL..................SRQIRVL......EDRGA
Q2RQ55_RHORT/8-372...........RERPL.........................SELISLK..........AGDRIDPDYPF......TYEER
A1WUU9_HALHL/6-348...........STLPV.........................PEL..................WTYIQYL......DANEL
A5G1T7_ACICJ/24-378...........SEATM.........................TQL.....................FHAG......AAHVP
Q3B4Y3_PELLD/6-432EEYRQQVEVAERKISMPIDMFEQAISLVAPSNAVNYPEVRGGSNVRAVTAVAGYIDRQLGLVESELKVI......DMNQM
Q0BZX3_HYPNA/9-369...........NTVGF.........................WEL..................PRFIFET......RAAGL
A2U291_9FLAO/6-450LKNKSLDSNIIDNFEL.........................QEKITILNSAVTKTTRVVSTINNNLDSI......KWNRK
A0LB30_MAGSM/6-357...........RSYSI.........................ADL......................EQA......RIAQD
E0TCF9_PARBH/51-404...........TERTV.........................SQL..................LNPDLSD......PSIAR
A5EXI7_DICNV/7-348...........NAYTL.........................REL..................YTITGFL......RAHQL
B8CYZ1_HALOH/12-360...........DEMSR.........................EEL..................KKEIDLF......QNSGI
Q1MPZ1_LAWIP/7-360..........PKEMSW.........................ERL.....................IKEY......NITNT
A8ZZ83_DESOH/6-356...........DEMGF.........................VQL..................LDRIRQV......ERQGY
A8EWU1_ARCB4/5-331...........DYWK..........................NNI....................................
Q31ET4_THICR/6-346..........VFEIPT.........................STL......................WQS......DKPEH
Q1IZ54_DEIGD/6-380.......TGLSRKQTI.........................AQYADAIG.......ADAEGWPELITKL......TAPGV
Q1J2D3_DEIGD/10-350...........AQVST.........................PVL..................RARLAAD......EYATP
Q2S0T8_SALRD/7-449ARYQTLYERTQDELSPSVAADTSAPAPVAPAHPSSYLALADLDADARRSVVSPAVQRARSAQSAIQNIR......RDTEW
Q6MDI8_PARUW/7-377...........QALRQ.........................AKL...................ENKKPV......IVKDL
B8CYX9_HALOH/6-362...........EDMSF.........................KEL..................GEYIQFL......EEQGK
Q1IRI3_KORVE/8-376..........VAELST.........................QELWRLA..........HSGGVSAGHYL......GNSIA
O83854_TREPA/1-358.......GLGPGGFST.........................CSL.................YREIQEKI......KAKEN
Q8D297_WIGBR/7-348...........EELSI.........................SEL..................YFYIKFL......KKNNL
Q9AA49_CAUCR/9-364.......GEDVSELTL.........................IEL..................ARQGFGL......EPAAL
Q3J9X2_NITOC/9-352...........QTLPT.........................LTL.................................WEM
A7IJ85_XANP2/6-384...........MERPL.........................SYV..................MNPPQDD......LYVRF
Q0C1U7_HYPNA/7-360...........RELFL.........................PEL.....................LAKA......GAAMP
Q0BVK4_GRABC/5-352...........DAMPP.........................LAL..................WRYVHSL......KQRGL
Q5FU64_GLUOX/35-392...........DTLSV.........................FAL..................PGFISLL......ERSGF
Q5FPA9_GLUOX/26-376...........ATVTP.........................AQV..................SAILHKG......APASL
Q1D895_MYXXD/6-362..........REELTP.........................GEL..................MEAAREA......EAQGE
A1AXG9_RUTMC/6-356...........RELST.........................WHL..................YQQIRFL......TINHL
A6QBC8_SULNB/6-335...........DIVSY.........................WAL....................................
A6QBZ1_SULNB/12-355...........KALNI.........................IDA..................YNTWKLL......EIQHL
Q7VQS9_BLOFL/5-358...........KHMNI.........................NQL........................L......ISSEL
Q73NV8_TREDE/6-354...........DEMRI.........................SEA..................KEFIAAL......KKNGL
B4E8H0_BURCJ/7-345............STPT.........................PDL.................................LRN
J9ZCA2_LEPFM/6-351..............TI.........................REL..................ENKIAGS......PKPDV
J9ZCM7_LEPFM/6-356...........THLSY.........................PEL..................DRYIALL......EKSHL
O26028_HELPY/5-350...........PAVSI.........................TDA..................LLSLHAL......VRQNA
O51747_BORBU/11-425YVDESYVFENLNYMYN.........................LNL..................NFKPYQD......RSMKQ
O51748_BORBU/7-350...........KALNF.........................TKL..................INWISFL......KAERL
O84846_CHLTR/8-346...........SYMKT................................................RTDYL......PWKQL
LPTG_HAEIN/7-355...........TSLSI.........................SGL..................YHYISFL......RETGQ
Q2JLS4_SYNJB/13-367...........SELSL.........................PEL..................AERISRL......ARSNL
Q2YN46_BRUA2/7-357...........KDRPL.........................TYL..................LNPDSND......PMLQT
Q5NFB9_FRATT/8-349..........NNYLNF.........................SQL.....................TSYM......LSNSQ
Q5NFC0_FRATT/6-350...........DRLYM.........................HTL.....................IENF......NDKNN
Q5SL95_THET8/4-334...........DSTPL.........................EEL..................WARAQV............
Q7CKF4_YERPE/5-345...........DQMSM.........................KEL........................W......RSQEP
Q8F742_LEPIN/134-585AMGAANGTLTPDQ..............................MTQ..............QYSVLTQLM......ALMQQ
Q8F8T0_LEPIN/30-383...........EEMNL.........................FQL..................KEEEKRR......IQKGL
Q8PCR2_XANCP/10-365...........RNLSV.........................HDL..................GQSIEYR......RRNGL
Q8PCR3_XANCP/6-349...........EVMST.........................FKL........................I......GDARP
Q8RER6_FUSNN/12-360...........RMLTI.........................KEL..................KKTIKEQ......KNIGE
Q9X257_THEMA/19-363...........KEMTG.........................KEL..................KEKIEFF......KKVGV
Q9ZCH3_RICPR/10-357...........EMVSI.........................WAL..................PKLINEL......LNSGL
R6X2Y4_9PORP/1-468NPGKKATILTRA...............................KSSIEN........MKADYFFKAATI......GDEAY

PF00528

J7JQQ0_BACIU/107-309--------------------------------------------------------------------------------
D4FYT7_BACNB/80-293--------------------------------------------------------------------------------
A0A017I3G0_ECOLX/116-308--------------------------------------------------------------------------------
D0KQN4_SULS9/116-318--------------------------------------------------------------------------------
E8VKF3_BACST/41-224--------------------------------------------------------------------------------
D0KNU1_SULS9/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
G4ER62_BACIU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
C9MHH9_HAEIF/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
D5AW50_RICPP/33-217--------------------------------------------------------------------------------
G6NR23_STREE/298-492--------------------------------------------------------------------------------
D4G528_BACNB/46-230--------------------------------------------------------------------------------
A0A034X2L6_STREE/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
A5IMY1_THEP1/119-323--------------------------------------------------------------------------------
A0A017I1I1_ECOLX/90-294--------------------------------------------------------------------------------
C9MH14_HAEIF/93-316--------------------------------------------------------------------------------
C6SR18_STRMN/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
A0A017R3L7_SALET/27-221--------------------------------------------------------------------------------
A0A017I1V8_ECOLX/89-273--------------------------------------------------------------------------------
B1L9I4_THESQ/94-282--------------------------------------------------------------------------------
A0A017IYA5_ECOLX/117-315--------------------------------------------------------------------------------
E8VDJ2_BACST/93-290--------------------------------------------------------------------------------
A0A017IAJ7_ECOLX/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
D0KNZ4_SULS9/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
A0A034X6C1_STREE/87-275--------------------------------------------------------------------------------
A0A009EAC3_ECOLX/43-239--------------------------------------------------------------------------------
B1X7L7_ECODH/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
B8H0V5_CAUCN/67-247--------------------------------------------------------------------------------
A0A009EN06_ECOLX/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
A0A017IH56_ECOLX/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
J9H1N9_9THEM/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
A0A009ESA2_ECOLX/33-218--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
B1X7Q9_ECODH/91-278--------------------------------------------------------------------------------
A2RJ51_LACLM/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
A0A024F9P0_UREPR/183-374--------------------------------------------------------------------------------
A0A017I1M5_ECOLX/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
B2IN26_STRPS/209-434--------------------------------------------------------------------------------
J7JKK3_BACIU/104-314--------------------------------------------------------------------------------
A0A017I2Z6_ECOLX/173-362--------------------------------------------------------------------------------
A0A023YPW1_ECOLX/104-273--------------------------------------------------------------------------------
F6C4B4_SINMB/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
A0A008AYP3_STAAU/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
A0A016X6V1_VIBCL/118-310--------------------------------------------------------------------------------
B1X877_ECODH/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
J7JPW1_BACIU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721----------------K..FDF-IYLVFCI----LL-------------------LE---NLFIYLLI------------
A5MAB6_STREE/576-675----------------R..DGL-ISALVVA----LF-------------------TL---NALLILVR------------
Q9L651_LACLL/549-647----------------L..NPL-TLIIPPI----LG-------------------GL---QLIL.LTR------------
A5M6X5_STREE/166-265----------------R..DLV-IGLLTLL----VF-------------------LA---SAVLTLYR------------
A7X0R3_STAA1/555-653----------------H..SQY-IMMIFAT----IL-------------------VV---QILLQICS------------
G6KLU1_STREE/155-254----------------V..EIG-VAFLVLL----LF-------------------TG---LSLLQLHV------------
A0A028VRZ0_STAAU/545-643----------------G..SKI-LLFIIMS----IA-------------------II---QHLLQIAY------------
Q926X5_LISIN/619-718----------------K..EPI-ALYFSVV----IL-------------------LI---ELCVIYFL------------
B1BGL8_CLOPF/619-718----------------K..DIN-IIYFTLI----LV-------------------VI---ELVFIIFN------------
Q9KG35_BACHD/612-712----------------SG.TQY-LAIVVLV----LF-------------------LT---EVVVTSVV------------
B9WU46_STRSU/561-660----------------K..SVI-VSLGVVV----AL-------------------LI---NSWMLLNK------------
Q9CJI4_LACLA/565-662----------------D..VNI-TLEGLGI----YF-------------------VL---EILIIILI------------
G2KCB9_LISMN/620-718----------------K..EPV-ALYFSVV----IL-------------------II---ELCAIYFI------------
Q896P1_CLOTE/604-706----------------IAISKV-ILITSIV----GL-------------------IT---ESIVSFLM------------
Q892J9_CLOTE/609-706----------------KASLNI-ILSVALA----GL-------------------IF---ECLLSIIF------------
A8AXA7_STRGC/592-691----------------Q..EWW-IALVTLL----LF-------------------AT---NAWLILLY------------
Q9CE29_LACLA/560-659----------------N..EFL-YSLFVVS----AL-------------------WF---ISLIILLV------------
Q181M6_PEPD6/617-718----------------DL.SNN-IILFGLL----IL-------------------VI---EVIVSIVL------------
A7GNK2_BACCN/616-716----------------G..NIL-PFLTGLF----VI-------------------LL---EFVFGTVF------------

PF02687

O50782_BORBU/276-402....PGYSET......YYINIF.YYASDII....YV-------------------SI...FMLILAIF------------
A3I1M1_9BACT/289-407.......GVP......LDLNLV.ISPVGLL....LL-------------------AG...FVAVIGVL------------
A8ABZ3_IGNH4/248-373.......SHPRLEPLKAFVTLT.VSPKTVL....AV-------------------FA...MSALTTVL------------
Q9WZG5_THEMA/725-844................GTFMVS.VPTASIL....LS-------------------LL...TVIALASA------------
Q9FBP3_STRCO/657-772................TSTPVS.VDWTGVL....AM-------------------TG...IGAAVVLV------------
O28455_ARCFU/275-396......FLNL......PYYVSK.PHLEVYS....LS-------------------LM...AGTLTPTI------------
Q481M7_COLP3/705-820.......QSQ......FSLSYQ.PDLFILF....IT-------------------LA...IILSTVTL------------
A4YKC0_BRASO/734-849................MTLSFV.WQAGSAA....LV-------------------VL...AALVVTVG------------
A8AR20_CITK8/231-351......VAQV......FGTKFD.INGLSF.....DE-------------------CL...LLLLVCSM------------
Y684_MYCPN/989-1110......YWFI......ALPANS.FNWISFF....GS-------------------ML...LIFVIFQF------------
Q2RPK1_RHORT/279-403.....VFAHA......QGVPCV.ITLPLAL....AA-------------------IG...GILVLSIV------------
A6H1M7_FLAPJ/284-410.....ENYYV......NQAPVN.INIAHIL....LL-------------------NL...GTITVCLL------------
Q4QBC9_LEIMA/977-1097.......IMV......IPFHFN.FPYALVI....IV-------------------FG...MALAAAVV------------
Q025M3_SOLUE/351-471.......QLS......GLKELP.FDGRVLG....FA-------------------VA...LGMLTTLL------------
Q54MT9_DICDI/545-666......FTNS......DEISNY.LTVDSIV....YS-------------------IL...LGFLIPMV------------
Q6MGV4_BDEBA/659-778.......TDA......FIFPLV.VDTRTYA....LA-------------------VA...IMVLCYLM------------
A6L8W9_PARD8/653-767................YSYRIG.LSPLIFI....AA-------------------GL...FCLMISFV------------
Q4A9N5_MYCHJ/2523-2644.......TNS......IFLSLG.LSISTFF....LA-------------------FG...IILVVFIF------------
Q01VW7_SOLUE/1278-1396................SGTPLR.LDNEDPL....LY-------------------GGAALLLAGAAAV------------
A5USK7_ROSS1/311-433......RFAP......LDAPAP.TLLPASP....WH-------------------AL...ATVLLALP------------
Q9A6K3_CAUCR/352-465................GGVPMY.FPPVLVA....IV-------------------AG...FLVAIAML------------
Q5V3A9_HALMA/874-995......VFFG......FRLSAR.TPPAILT....AI-------------------FV...GGVSLALF------------
Q8NS27_CORGL/613-739.......VDGAILNYGTLEHMM.LPWPLLV....SL-------------------LV...VAPLVCAV------------
Q97DB8_CLOAB/716-835.......ISN......FPMEIY.YSSGAFI....TS-------------------VI...LGVLITVI------------
A7HK62_FERNB/257-383....LFAFVQ......DKIPFN.IKFLSVI....FG-------------------IF...IAAIVPMI------------
A1TXE6_MARAV/183-306......LEGL......FDRPLY.AGGGEDW....WL-------------------PT...LTMVAVIV------------
Q830M8_ENTFA/579-698................KSPGYL.LVYLSCG....IL-------------------II...VYLIFYIL------------
Q5LCL1_BACFN/272-387................QISEAT.PLYTEVI....IY-------------------IL...AVIVLSFG------------
Q9KF85_BACHD/539-650.......WLY......QADWFI.LIFFVAV....VV-------------------LT...FLFSLIYV------------
A1SKN4_NOCSJ/300-416................PGHAPF.ETGVRLL....GA-------------------VG...LAVLALVL------------
Q5JEM5_THEKO/203-318.......LFG......VSIPLR.PNYAYPF....KF-------------------DV...LITMAIVL------------
Q8G7P9_BIFLO/320-438................SGHATP.VTSGLIW....TM-------------------VW...YGLGSILI------------
A9KQT2_CLOPH/343-506MMGSGGGINSSNEKPLSEMKIT.LDLITVL....EI-------------------IA...ISILLASL------------
Q6F1V8_MESFL/1691-1810................IFIPLI.TNWWATP....LI-------------------LL...GIIIMFVL------------
Q9PPU7_UREPA/163-284......YWLI......PIPDQF.VSVGWIF....AI-------------------PI...ALTLILGF------------
A6TSQ0_ALKMQ/264-387.....PYSGQ......MNVAIE.FSFSHML....IA-------------------FL...LAIGVALI------------
A5N346_CLOK5/473-593.......AHF......SYATWS.IPIMPII....IV-------------------LL...VVAITASA------------
A7H957_ANADF/284-394................FPKYVL.LLPGDAV....RG-------------------FA...AVMVICVL------------
A1SH34_NOCSJ/769-890......VFDP......PPAALA.IPWAYLT....SI-------------------AV...AALAAVAA------------
A6LCJ9_PARD8/285-395................IGGGFH.MKGIVFW....GG-------------------LF...MALCAGLL------------
B8I8J6_CLOCE/296-424...PLSYFGG......ERLYPS.MKPMDIS....TT-------------------FG...IITLFTLL------------
Q6AA47_PROAC/602-722.....DANQS......FDPTIA.ALPVTMW....AV-------------------SV...LAIMVTAF------------
Q6MT15_MYCMS/562-682......SVTF......TFNSIY.ISPLLII....FL-------------------IL...IIPFIFLM------------
A4VW57_STRSY/998-1117.......SDS......IRFNPS.VGLEVYL....IP-------------------IL...AISGILSV------------
Q18EP9_HALWD/299-419.......TLS......LPAPGI.IDPRLIP....YG-------------------IM...TAVLIGIL------------
Q8EUA2_MYCPE/1360-1480.......FAG......ILIVSN.NSFWHFL....AA-------------------SL...GIIVIFFL------------
Q47EZ3_DECAR/243-372..GWSVLYPK......FRLVPT.VDGLQIA....TL-------------------FF...FTVFPYTA------------
Q034M7_LACC3/404-519................GVHFIA.IILAAFI....TN-------------------LA...LSFGVTIF------------
A3I2Y5_9BACT/746-861.......DSF......FAFHSG.VGFIPLG....VA-------------------LF...ILLGVIVG------------
Q0RJL1_FRAAA/639-753.......LRS......QLHETL.QPPGGEY....YL-------------------IV...AAGLLAAL------------
Q7UPA2_RHOBA/581-706....VGAVTV......PFLQFY.ATPLSIA....LG-------------------GI...LGWLVCMF------------
Q8A9F6_BACTN/266-381................GMAQQK.EIAFDGL....LS-------------------VL...FLLLLPGI------------
Q97LN0_CLOAB/737-854.......MSG......DSTHFV.LPWSSIG....IS-------------------VF...GVLFIVFI------------
Q4A9N5_MYCHJ/1802-1923......FWEF......DINIYN.FEPISFV....FS-------------------LI...IPFFVISV------------
Q899W1_CLOTE/250-369.......HIL......NVENIQ.FSYFNII....AT-------------------SL...APIIMSFL------------
Q4DFN5_TRYCC/444-565......FTAA......TPRILF.VPLIPLF....VS-------------------LG...LGLVLPLL------------
Q8KD33_CHLTE/268-389......VYNF......PRLLYV.FRMENAL....GA-------------------VL...LSFGAAVG------------
Q6F163_MESFL/1281-1400.......KFS......VYIFMT.VDLKTIL....IT-------------------LS....VMSVVLL------------
Q6AMB4_DESPS/278-415..KNSSMMIS......NIIRAE.ISYRTYY....IG-------------------FI...PGIASTLL------------
A3QAU8_SHELP/312-429................AEGLTH.LSMSMWL....IT-------------------PT...IAVGTALL------------
Q6F1W1_MESFL/1301-1420................VVLPIA.FPIWLPI....VV-------------------FL...GIVGIYAI------------
A6LZM8_CLOB8/286-398................SVYEFF.INENLLF....NL-------------------YISMGILLLTIIL------------
A7ZBR0_CAMC1/308-420................FSHGIG.IAWIVLP....IS-------------------VA...FALLISVV------------
B2HGJ6_MYCMM/176-292.......FYQ......ANLIAR.IDYADIF....FI-------------------SP...ALLALGVA------------
B4EEB5_BURCJ/260-374.......AGG......IFPVFK.VSTETIV....LQ-------------------AA...CSVAVGLA------------
B7VH43_VIBSL/274-399....ALFSFG......GQLPIL.INPIQIA....VV-------------------VV...LAIALSLI------------
D4K997_9FIRM/663-783......TFGG......NVVPYK.FPVLEMG....LF-------------------IL...VLFGMELI------------
D4KYJ1_9FIRM/264-395.TGTGSMGVQ......NQQVPL.FSLPVML....LC-------------------IF...VSFLTVAL------------
D4KYJ2_9FIRM/263-378.......NGI......FGMNIYHVPIVPIF....IM-------------------IF...LVGLLQIV------------
M1FFQ7_9ALTE/689-801......LAFG......WSLPMA.IYPEFWL....QL-------------------GA...VSVLIGLS------------
Q0P8Y0_CAMJE/151-262.......ESL......KAVDII.FPPINFI....LH-------------------LT...LIFLATLF------------
Q1G8P7_LACDA/281-403.....SQIVL......NGLLPR.AETVSLL....IS-------------------FI...LMLLITVL------------
Q2FUZ2_STAA8/60-179......IMGS......EVATLR.YYPFDSV....AM-------------------FI...TLIIIAVL------------
Q5LDA1_BACFN/283-392................VSLSSL.FTWHNLW....AP-------------------LS...VVTFLFVI------------
Q5LFF2_BACFN/296-426TVISDGVDVA......INPQML.FSPLMFC....VT-------------------FA...FCLILNLL------------
Q6MSQ5_MYCMS/371-490......YFSL......DYGVFS.FDWIGLL....NN-------------------LI...FMWLIISA------------
Q6MUJ8_MYCMS/1674-1786.......ANG......FSIPIN.VYWVSVV....FC-------------------IL...LILVSFFT------------
Q79Z83_STRAW/244-362......ELAP......SWFTIG.DYTWPYY....MA-------------------FW...TGLLVALC------------
Q7V1V4_PROMP/275-384................TKLPIV.MDANKTI....LI-------------------FI...LVLVMCMG------------
Q81HP3_BACCR/241-351................TYLLKP.LTPYVLV....CN-------------------IV...FIIFLTMF------------
Q81QE5_BACAN/261-379.......YMG......AANKSI.LHNIVPF....II-------------------TT...LLFLVVIL------------
Q87SX2_VIBPA/293-410.......HYG......INLTLS.TLSAYEW....ML-------------------LS...FVQCAGIV------------
Q8CYG6_STRR6/404-522......GMVV......GETQIQ.FYWTYSL....LA-------------------LV...LSWLASVL------------
Q8DQ76_STRR6/61-181......MKLK......VELVAT.FQTKVVI....TV-------------------LV...VFGLIFLG------------
Q8DQS2_STRR6/302-451AEVDGFSKTL......SSLDIS.IQTSDFI....II-------------------FV...LALVLVVL------------
Q8EZY9_LEPIN/261-379.......EEI......LSFQPT.IGFSSLL....WG-------------------LL...IGVLIPFF------------
Q8Y6E1_LISMO/60-180......VGLA......IDAEFI.ISFKAII....DT-------------------ML...VFFGIMLF------------
R5K905_9CLOT/806-926....LPESHN......IAISIA.VNPFDIL....KL-------------------T....IVVVAMFI------------
R5KJ88_9CLOT/349-467.....NYYSL......PDLDVI.YMPYLFI....YG-------------------IV...VPPVISII------------
R5TSZ9_9FIRM/275-417AREAAQAGRA......QAGAFQ.VSGEAIF....FG-------------------AV...FLLCLLTF------------
R5UPZ8_9BACE/294-410......NLSI......DRERLM.LQAGQYI....II-------------------LL...IATFVICF------------
R6WL88_9PORP/155-267................FVEKIP.LSAWIFL....AG-------------------AL...FVCLVVLI------------
R6WLH2_9PORP/283-392................TTLQRK.LLFSHLC....II-------------------TG...ISWLILTI------------
R6WYF0_9PORP/288-402........GR......ITTGFF.LNRQVLP....VI-------------------CG...LILILSVI------------
R6X6U4_9PORP/275-397.......KET......INENLF.IHTPTLIQQEMEY-------------------LC...FLFVLCAL------------
R7EAJ1_9BACE/292-408.......TEA......TDATWG.RFVICVS....IV-------------------WI...LMALMVIA------------

PF03739

Q3ATU7_CHLCH/6-355S...GLERSAVKFHNKIAMPFASLIITLIGVP..LA..ARK.KRGGIAAE.....IA---ITLFIGFL.YLGIQRTIAIA
Q118T4_TRIEI/24-389YR.KVVKTQ.VRIQQKLALPFVCLVMGLVGAA..LG..IRPQRKANRGTS.....FG---ISVIIIFA.YYLLSFITGAM
A0LEN9_SYNFM/39-391A.........LEFHQRLAFPSGCLLLGLIGAP..LG..AVF.RQRGRIAG.....IT---IGLVVFLA.YYVILSAGKGL
A7HYF9_PARL1/7-370N...RDKLL.ADAHERLVEGFYPVMLTLIGLAALLP..APF.NRRGYASRMA.TAAA---MALTVRILGFALSNAVGNNL
Q8DIL4_THEEB/18-374PE.LVRALK.VHLAQSYAQPFLAVVFALLGVG..FG..LSPSQRRGRQG......FG---ISVAVVFG.QYVLTFFLGAL
Q82W93_NITEU/6-348E...EPREI.AELQWRLSRPVATVLLALIAVS..FT..RTA.PRKDKTDR....TFL---VAALVFAV.YYNLSGLAKTW
A0LB31_MAGSM/6-364D...ATPYW.VTLYRKLADPLTTLAAILLAFP..FA..LRL.HRMGGTFR....SML---MGFITGFF.MFVVVDLFTAL
Q6MKD0_BDEBA/11-364DK.EVRRTLQSEYHKRWAISVLCIVFAMIGVG..LG..TTT.NRRAAKAG....GMI---LCIGIIIF.YWILYVAAEGA
Q6FFD6_ACIAD/9-354V...PKTYQ.LAFWKKVASPFALITLVLVACS..FI..FGP....LRQQSMGFRLVI---.ALFIGLG.FYYLQDFLGYA
Q0C1U6_HYPNA/7-346P...SGAYE.LWALNRFLLPLTAVGFLLLAVP..VM..QVY....GRRSNADIAVAA---.GVAVGFF.YMVVDGILKTL
Q11U59_CYTH3/9-455IK.EIHEFE.VTKYQKFTQAVACFVLFLIGAP..LG..AII.KKGGLGIP.....VL---ICIIFFIF.YYVFSITGEKW
A1AWC7_RUTMC/20-369I.........AEFQWRISQPLSILILSVLGVL..LG..KTS.PRSGKNLG.....VL---VGVVMFIV.YNNVLLIAKST
Q73NV9_TREDE/13-373SP.RLLNIYIMELHRKFSVPFGAFFFVLLAFA..IS..RAG.KTYDQSTG.....FI---VGLLISVA.YWAFLIGGQML
Q1GR36_SPHAL/14-363P...VDALK.GVLWHKISGPLSAILMPLLGAV..AA..FGL.ARSGKLFV....RAI---IGMALGFA.YFVADNFALAM
A5EXI6_DICNV/8-348R.........AEFQKRLNPALAVVIFSFAVPL..LA..HTR.PRQGRYQR.....LL---PAFILFGI.YINLLDIALKM
Q7VQS8_BLOFL/9-358N...SKYYQ.LIFWDKIFSPIFGVMMLTIALL..YS..YGP.FYKKKISF....RLF---FGGIIGFV.FYVLHQIFEIL
Q310A0_DESAG/6-352N...VEALR.TAWHMKLSYAFSLVTMALLA....LA..LIT.WRDSIYIN.....VG---TSLLLVFV.FYTLFTVGGSL
Q5SL96_THET8/6-344R...AGLEA.TTYYRRFAEPLAAPVFALFAVG..LA..FYL.LGGSRSLG.....LV---GVAVLTFF.YYATWSVGRIM
Q6MJL5_BDEBA/6-356D...TVAYE.VDYHSKISFAFAGLVMCLLGIP..FS..VGR.ARSGGTML....NVG---ICLALVFA.YYVFYSSGITL
A5WBH3_PSYWF/27-466EP.QQILSAQAELGYRLALPWLIILAPMLAVP..LA..QVK.PRQGRWLR.....LL---PAILIFTSCVLVIISLKNAI
E0TCF8_PARBH/6-360T...TTKFR.LRYHALWSLPLKLAAMVILACA..FA..LGMNARGGGTAL....LMG---MGILAGFL.LFILSELSAAI
Q984S3_RHILO/7-356K...ANAFA.MQFDSLVALPFLLVAMTLIAAT..VS..MRF.ARMGQSAT....MIL---GGVVAGFL.LYVVSVLVKAF
Q2S3I0_SALRD/55-410GG.LTRPL..VAYYNKFAYPFANLLLVLIGVP..IA..STR.RRGGQAVR.....FA---IGLLIAFV.YLSVQKLAEPL
Q1IRI3_KORVE/435-789D...VVRFR.VQLYKKLAYPIITLVMAILAIP..FS..VYRQRRGGPLAG.....VA---TAIGIAIL.YWVSAGLFEAM
A1WAC0_ACISJ/11-359A.........AEFHSRLARALLPLLLPLLALP..LG..MAS.KRGRRTPG.....VV---FASLALLL.LNHTLQFGKSL
Q8D296_WIGBR/5-350NS.CIEEYK.LEYNWRITIVFSVLIMSIISFA..LN..IKK.LGSGQFFN.....LF---LGIFFYLI.FFISQTFIYSN
Q6MDI9_PARUW/8-358K...ESKIA.TAFYWKLLMPWLCLLAILAPAP..SC..VRF.SRQIPIFF.....IY---IYSLFGLIAFYMLMDAAQVL
Q9A939_CAUCR/5-350SD.RPESFYATHLQAAFASPFVSLVMLLLSAP..VA..LAN.FRSGQGAV....LLT---GGLAAGLM.FLVANGMLTAL
Q1D894_MYXXD/7-356A...TKQFE.LALHNRFAYPMAAFPAALLGVG..LA..LRA.NRRGHLTA....AII---EGLLTAVA.MWGLMMVCRTL
Q1QKW5_NITHX/6-356L...PGQFR.AELHDRFTAPIYPFAFAALTFA..FL..GTP.RTTRQSRN....FSM---GAAIVTVFGLRMAGFALSVM
Q143Z1_BURXL/6-377D...TQRYE.IALWRKLLYPFAVFVMLVLSLP..FA..YLH.TRAGVVGM....KVF---GGIMLGMS.FQLFNTLFSHI
B5EBA8_GEOBB/11-361QQ.KEIISRDLEYHSRLALPFSCFVFTLLAIP..LG..IQN.RRSGKAAG.....FS---LSIGVILL.YYVTLSAFDTL
A3I2C6_9BACT/6-354D..NVAFYK.IERYVRFMSPFAAIILTFIGVI..MS..AKK.SRGGSGFQ.....IA---MGFLLAFI.YILLFILSRTF
Q2RQ55_RHORT/8-372H...IRRMR.MEAHLRLLRPLAHIGFLLIGLA..AV..LTG.EFDRRGGNK...RVI---LAVALVVL.FQAGSLGAATV
A1WUU9_HALHL/6-348D...SGPYR.LALWEKVATPLATLAMLLVTIP..LV..FTA.VRSSGAGQ....RIV---IGVLVGVA.FFLLNRALGQA
A5G1T7_ACICJ/24-378PP.VQRRWR.EEAWRRIASPFAVLSYAVIALL..SV..LRS.PFRRQGGA....AAL---VAAVFIVMGLVALELGTENL
Q3B4Y3_PELLD/6-432L...YNRYM.AEYHKKYALAFACFVFVLIGAP..LG..VLA.RRGGFGIG.....AV---LSLLFFVL.YWVLMITGENM
Q0BZX3_HYPNA/9-369D...TSRYT.MRLFTLTATPVLFTAMALIGAL..AC..LRL.QRLGGTSR....LLA---TGVLAAIG.LYFFTQFSSSL
A2U291_9FLAO/6-450M...VNFYD.TEYYNRVAFSLSCVILFFIGAP..LG..SII.RKGGFGLP.....MI---LAIAVYVL.YFFTNTFGKNL
A0LB30_MAGSM/6-357PL.LASEAE.REWHRRFAIPLATLLLGFLAIP..LA..MQQ....NQRSGRG.FGFI---VAISVLIL.QFILLTLGEAM
E0TCF9_PARBH/51-404L...ADRYR.AAGHARLATPLYCPALAVVALC..FL..LSP.PISRRGYGQQVLMAI---GCALLLRTGGFLLQGLAADL
A5EXI7_DICNV/7-348N...DQQMS.LKLWQRIFLPITTITMVILALP..CV..FNT.RRDGNGAR.....LV---IGILLGAS.YYVVQGIVTKL
B8CYZ1_HALOH/12-360D...VHSLL.VDYHLKLSMPLAALIFILIGTP..LS..LTS.KDSRSFS......II---FTIVVVFL.YYFVMSLSRSF
Q1MPZ1_LAWIP/7-360MQ.YQNKIS.VELHKRWAYPAACIALTIFALP..LA..IMF.EGIHRQFG.....LI---LALIMFFI.YYGLMSFGFST
A8ZZ83_DESOH/6-356S...VVSHR.VDLHAKLSFPFVCLLMGLIGAA..LG..IMGRTRGGITAN.....AA---YGVGASFV.YWIFHSFCISL
A8EWU1_ARCB4/5-331....KNKVDLDDLTFFILTSFFPLMSLFLVIT..FG..YFN.PRYEKNRA.....IM---YSLISIVLYYVLIKSIGDKI
Q31ET4_THICR/6-346E.........ALLQWRIVTPFSILVLGLLGLK..MS..KSG.PREGRFAK.....VF---FALVLYVI.YNQLLVTFRES
Q1IZ54_DEIGD/6-380SV.QERQDARVNLNRKLALPFGNLVLALAALP..FA..LRF....GRTLGVSLGI..---.ALLIAVA.YYLVFFVGLTL
Q1J2D3_DEIGD/10-350E...QRRVDEHQLATRYADPCTPIVFALVAGV..VG..LLL.RNRAGA.......FA---ATLLVILV.FYVLWTTAPQL
Q2S0T8_SALRD/7-449QT.RRIRSYQVEFYKKFSIALACLIFMVVGAP..LG..LAL.RRGGLATI.....GA---VALGIFML.YWITLVQGEKL
Q6MDI8_PARUW/7-377KG.QFHKSL.SEIAKRSSIAFAVISFTLMGTA..FG..MNI.SRQRKHKN.....LL---IVIILTTF.YLTTFFLAKGL
B8CYX9_HALOH/6-362D...TFEER.VKYHQKIAIPFASFIFALLAAP..LG..IKP.RRSGGTAT....GMG---LSIIVIFI.YYTIMTLGSAL
Q1IRI3_KORVE/8-376QV.KARWYA.VEFQRRIALPTACLVLTLVGIP..LG..LSS.RRGGKSMG.....FV---LTIILVFA.YYVVSLIGVSL
O83854_TREPA/1-358PR.HIATYQ.LEFQKKFSHPISVVLFIFLSFG..LS..TLS.NISSQGKG.....FV---GGLIVVLG.YWIISIGGQEL
Q8D297_WIGBR/7-348Y...YKKQY.LVFWNKIFSPISILIITIIILQLLFG..ILY.SYDIKIK......VV---FVISLGFI.FYFINNIFNSL
Q9AA49_CAUCR/9-364P...RETLL.AALYARLARALILPLLPLIAVP..FG..LSA.KRAGSGAA.....VA---AGGVLLFA.FEILMVLGQAT
Q3J9X2_NITOC/9-352G...APKDI.AEVQWRISMPIITLLLVMLAVP..LA..RSG.PRQGRYAG.....LV---PAVLVYVI.YSNMLGIARNW
A7IJ85_XANP2/6-384F...PGRYR.EELHKRLSAGLYPMAFFAIAAA..AL..ASP.RTTRQSQVAALGAII---PAMGLVQIGNFAIAGQLKTQ
Q0C1U7_HYPNA/7-360GD.IAPAVAAATFHDRTSRAALLLAMPLIAII..LG..LNL.GRVARSSG.....VV---LGILFLLG.VQKVLEYTLVQ
Q0BVK4_GRABC/5-352Q...AIRYE.QELWAKISIPLTMMAMVIAATP..FV..FGG.GRVQNTGA....FIA---LGAAIGVV.FTLVQQISGHL
Q5FU64_GLUOX/35-392P...SIRHR.LHFQSLLALPILAGTMALVSAG..FS..MRP.TRRGGVAR....MLG---SGIAAGFA.LFTISKVAEQF
Q5FPA9_GLUOX/26-376P...RATYR.MALFSGMILPVEIAVMLLLTLP..VI..YIP.PRAGLRNP....LPV---YVLAAGMG.FVILQGMISAL
Q1D895_MYXXD/6-362D...ARMYR.MALHSRLGNALAPIAFALLGTP..LA..MGR.RQSGRAWG.....YL---LTLGGYVL.YYLLSRVFEQM
A1AXG9_RUTMC/6-356A...ADIFE.VEIYKRLMKPITLIAMILFSML..FV..FGS.LRDASLGK....NIF---LGLMMSLF.FELASRIGGVL
A6QBC8_SULNB/6-335.I.KTDKHRMGRALFYLFVSLIPILSVYLVAA..FA..MIN.PRYQANYS.....FI---IIFSITLSLYLIASSLEKWG
A6QBZ1_SULNB/12-355D...SDKIR.ATIYNKVIVPLFALALLLI.....LF..FKL.PFHARMMNFG.VVVA---FSLGVTFL.IWGVLFGLEQI
Q7VQS9_BLOFL/5-358E.......SYIELNWRLTLFISVFIMPMIAL...FV..MMN.IAYGYLSN.....FL---LAVVLYVF.FYMLHIMLYTC
Q73NV8_TREDE/6-354P...YYEAL.SKYHRRFSFPFTIFIVLFFSIS..LG..GKF.KKNILLMS.....IL---FSLGIATL.FYVTEMVTMLS
B4E8H0_BURCJ/7-345P...TRDNL.AEFAWRAGLPLIAINLMVLGIP..LS..YQN.PRRSRTIN.....LV---MAVLIYLT.YSNLLNVVQAQ
J9ZCA2_LEPFM/6-351S...LLREL.EDRYKNYTYPFSCLIFAFLGIP..FG..IYA.KRSGKLAG.....FV---FATASVIF.FYILNTVDDLM
J9ZCM7_LEPFM/6-356P...REKYE.VTRDAMIAFPIAAFLMVLMAIP..FG..IRE.GRQVGIAK....GFG---ISLLLSMS.YWTIYSLGLAL
O26028_HELPY/5-350D...TKKVR.SFLYVFAILPFFVPFLSVLIAY..FS..PSL.ARYENLAL....LGL---KFIIITLV.VWGLFFALGKF
O51747_BORBU/11-425N...LALFN.LEFYQKISLPLSVLFFIFLAFS..MG..MYSNRKYSIILE.....LV---ISIIVCVF.YWVMFIGGKVY
O51748_BORBU/7-350N...YSDAF.FDLLNRIFFSFRLILLSFTVGF..IA..LAL.KKNIFILS.....LL---NSIAFAVV.YVISIVIFNFL
O84846_CHLTR/8-346IQ.DARLHL.AEILRRIAIGLLCSTMTFSGLA..LG..TYK.PRFRK..P.....VL---IYALFPIL.NLIFLIVGKNT
LPTG_HAEIN/7-355D...VSRFE.LTFWRKIFQPVSVGVMMLLALS..FI..FGS.LRSVTAGA....RIV---TGICVGFL.FYVVNEILGQT
Q2JLS4_SYNJB/13-367N...TQALR.TEFHMRFSLPLASFFAVLISLP..LG..STTARRVGRYGG.....VV---FGILLVFG.YYVVLSVSRSL
Q2YN46_BRUA2/7-357R...PLTYK.AELHRRFTQWIYPLIFAMIALA..IAGDSRS.HREARVSA.....SF---SAISTALL.VYWAGYFASDR
Q5NFB9_FRATT/8-349A...KDSIS.LKFWQEVFQPLSLMILILLAVP..LS..IGS.TRSSTLIL....KLL---LGAFFGFA.FFIINQIFGPI
Q5NFC0_FRATT/6-350G....TAYK.AEFLGRINNAISVIVSSLLALA..LC..RLR.PRQNKYAK.....LL---PSVVVLAI.YLCTNMFINTL
Q5SL95_THET8/4-334....EPEAR.FAFHRRLADALGGLVLGAAAAA..LG..LSL..REAAWA......FL---GVVLLIFG.YYVLWTLAAQL
Q7CKF4_YERPE/5-345......DAR.AEFHWRLTLIVSVVIMALLVVP..LS..VVN.PRQGRVLS.....ML---PAMLLYLI.FFLLQSSLRSK
Q8F742_LEPIN/134-585GKKVLTDFN.VEIHRRIAMPISCLIFFFISFP..LG..LVV.KRSGKGMS.....FT---LAVVFLMI.YFTFFTLGSTI
Q8F8T0_LEPIN/30-383A...YGDVL.TEKHSVFALPMMTIIVTLIGTI..AG..YFT.KKTAGVAS.....LG---ITIGVVLI.YYIFNSAGKSL
Q8PCR2_XANCP/10-365D...ASDYE.DQYWSRWFYPLNVL<