Sequence alignment for CL0404

PF02687

A0A0S8DDF8_9BACT/110-205--------------------------------------------------------------------------------
A1SH34_NOCSJ/795-890--------------------------------------------------------------------------------
A1SKN4_NOCSJ/326-416--------------------------------------------------------------------------------
A1TXE6_MARHV/209-306--------------------------------------------------------------------------------
A3I1M1_9BACT/315-407--------------------------------------------------------------------------------
A3I2Y5_9BACT/772-861--------------------------------------------------------------------------------
A3QAU8_SHELP/338-429--------------------------------------------------------------------------------
A4VW57_STRSY/1024-1117--------------------------------------------------------------------------------
A4YKC0_BRASO/760-849--------------------------------------------------------------------------------
A5N346_CLOK5/499-593--------------------------------------------------------------------------------
A5USK7_ROSS1/337-433--------------------------------------------------------------------------------
A6H1M7_FLAPJ/310-410--------------------------------------------------------------------------------
A6L8W9_PARD8/679-767--------------------------------------------------------------------------------
A6LCJ9_PARD8/311-395--------------------------------------------------------------------------------
A6LZM8_CLOB8/312-398--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/290-387--------------------------------------------------------------------------------
A7H957_ANADF/310-394--------------------------------------------------------------------------------
A7HK62_FERNB/280-383--------------------------------------------------------------------------------
A8ABZ3_IGNH4/274-373--------------------------------------------------------------------------------
A8AR20_CITK8/257-351--------------------------------------------------------------------------------
A9KQT2_CLOPH/369-506--------------------------------------------------------------------------------
B2HGJ6_MYCMM/200-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/285-374--------------------------------------------------------------------------------
B7VH43_VIBTL/299-399--------------------------------------------------------------------------------
B8I8J6_CLOCE/322-424--------------------------------------------------------------------------------
D4K997_9FIRM/688-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/289-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/288-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/713-801--------------------------------------------------------------------------------
O28455_ARCFU/301-396--------------------------------------------------------------------------------
O50782_BORBU/302-402--------------------------------------------------------------------------------
Y684_MYCPN/1015-1110--------------------------------------------------------------------------------
Q01VW7_SOLUE/1304-1396--------------------------------------------------------------------------------
Q025M3_SOLUE/377-471--------------------------------------------------------------------------------
Q034M7_LACC3/430-519--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/176-262--------------------------------------------------------------------------------
Q0RJL1_FRAAA/665-753--------------------------------------------------------------------------------
Q18EP9_HALWD/325-419--------------------------------------------------------------------------------
Q1G8P7_LACDA/306-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/85-179--------------------------------------------------------------------------------
Q2RPK1_RHORT/306-403--------------------------------------------------------------------------------
Q47EZ3_DECAR/269-372--------------------------------------------------------------------------------
Q481M7_COLP3/731-820--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1828-1923--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2549-2644--------------------------------------------------------------------------------
Q4DFN5_TRYCC/470-565--------------------------------------------------------------------------------
Q4QBC9_LEIMA/1003-1097--------------------------------------------------------------------------------
Q54MT9_DICDI/571-666--------------------------------------------------------------------------------
Q5JEM5_THEKO/229-318--------------------------------------------------------------------------------
Q5LCL1_BACFN/298-387--------------------------------------------------------------------------------
Q5LDA1_BACFN/308-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/320-426--------------------------------------------------------------------------------
Q5V3A9_HALMA/900-995--------------------------------------------------------------------------------
Q6AA47_PROAC/625-722--------------------------------------------------------------------------------
Q6AMB4_DESPS/311-415--------------------------------------------------------------------------------
Q6F163_MESFL/1307-1400--------------------------------------------------------------------------------
Q6F1V8_MESFL/1717-1810--------------------------------------------------------------------------------
Q6F1W1_MESFL/1327-1420--------------------------------------------------------------------------------
Q6MGV4_BDEBA/685-778--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/397-490--------------------------------------------------------------------------------
Q6MT15_MYCMS/588-682--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1693-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/268-362--------------------------------------------------------------------------------
Q7UPA2_RHOBA/607-706--------------------------------------------------------------------------------
Q7V1V4_PROMP/299-384--------------------------------------------------------------------------------
Q81HP3_BACCR/261-351--------------------------------------------------------------------------------
Q81QE5_BACAN/286-379--------------------------------------------------------------------------------
Q830M8_ENTFA/609-698--------------------------------------------------------------------------------
Q87SX2_VIBPA/317-410--------------------------------------------------------------------------------
Q899W1_CLOTE/276-369--------------------------------------------------------------------------------
Q8A9F6_BACTN/292-381--------------------------------------------------------------------------------
Q8CYG6_STRR6/429-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/86-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/328-451--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1386-1480--------------------------------------------------------------------------------
Q8EZY9_LEPIN/286-379--------------------------------------------------------------------------------
Q8G7P9_BIFLO/348-438--------------------------------------------------------------------------------
Q8KD33_CHLTE/294-389--------------------------------------------------------------------------------
Q8NS27_CORGL/639-739--------------------------------------------------------------------------------
Q8Y6E1_LISMO/85-180--------------------------------------------------------------------------------
Q97DB8_CLOAB/742-835--------------------------------------------------------------------------------
Q97LN0_CLOAB/763-854--------------------------------------------------------------------------------
Q9A6K3_CAUCR/378-465--------------------------------------------------------------------------------
Q9FBP3_STRCO/683-772--------------------------------------------------------------------------------
Q9KF85_BACHD/565-650--------------------------------------------------------------------------------
Q9PPU7_UREPA/189-284--------------------------------------------------------------------------------
Q9WZG5_THEMA/751-844--------------------------------------------------------------------------------
R5K905_9CLOT/831-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/371-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/299-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/319-410--------------------------------------------------------------------------------
R6WL88_9PORP/179-267--------------------------------------------------------------------------------
R6WLH2_9PORP/307-392--------------------------------------------------------------------------------
R6WYF0_9PORP/312-402--------------------------------------------------------------------------------
R6X6U4_9PORP/300-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/317-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355RYIFQQFIKAFLFTALVFVSLFIII.NMIEK-----LGNF.MDHH..VSALEI---------------------------
Q118T4_TRIEI/24-389RYIIAELIGPFLFGVGLFSSLGITVGAMFEL-----VRKV.TESG..LPISIA---------------------------
A0LEN9_SYNFM/39-391RYLIKEQMVPLGVCLMGVSLVLITG.RLFQL-----LKVL.FTSS..FTLGDL---------------------------
A7HYF9_PARL1/7-370RYLFFQTLGPFVVASVVLSGIIWLT.QALRM-----LDVL.ITQG..QTLLTF---------------------------
Q8DIL4_THEEB/18-374QYLLSLLLPGFVLGLTVFTTLALTVGTIFDL-----VRQI.ADAQ..LPLTIL---------------------------
Q82W93_NITEU/6-348RYITRELLFPFIVVTVILIGLFVSF.SVARF-----LTSA.VTET..LGTAAM---------------------------
A0LB31_MAGMM/6-364RYLLQLFLQGFVKVFSIFIALFFLM.DGAEQ-----IRRFGGRDH..VIWQDM---------------------------
Q6MKD0_BDEBA/11-364QYIFFEMLPSFILGLLVFVSIILMF.QVLRL-----TEFA.LVHG..VAMKTI---------------------------
Q6FFD6_ACIAD/9-354KHVTKTTALAMLGTTIVLVILQVLF.TYLGE-----LSNL..KAD..YSAWQA---------------------------
Q0C1U6_HYPNA/7-346RYLSWLFLQRLLVTVFALVALLGVL.DALSN-----ADKL..PAG..AGFEGQ---------------------------
Q11U59_CYTH3/9-455LLVLKAFFGPFILTVFVVTFIFLMQ.TILKY-----IDEL.VGKG..LSYLDY---------------------------
A1AWC7_RUTMC/20-369RYLMRNVSVLLSVVFIVISLVVFGN.QLVLI-----IKET.SKEG..IPIADL---------------------------
Q73NV9_TREDE/13-373VYVFKELLLYFIVSFLFFFFIFFVN.QILLM-----AEEI.LSKK..APTKDV---------------------------
Q1GR36_SPHAL/14-363LYVGRLFLFRTFAILFALVLILQTL.DLLGE-----SGKILAVPG..NGDSDV---------------------------
A5EXI6_DICNV/8-348RYMMREISALFLAITMILLTIIISF.RFSSL-----LSRA.LDGS..VSLAAI---------------------------
Q7VQS8_BLOFL/9-358RYIKKYVLLNIFMIFLIFISLSSII.RLVDE-----LRNF.QKQT..YSVFEI---------------------------
Q310A0_DESAG/6-352RYLLRTNLFLTMLTLTIGTGIYLLS.DLFDR-----LDDF.LGAG..LGLKVI---------------------------
Q5SL96_THET8/6-344RYLLRETLPLFGGGLLVIVLLFLGG.AVYEV-----LAPL.VAKG..ADPYTL---------------------------
Q6MJL5_BDEBA/6-356RYTAWLFVGYFVGGLLVFLTLFTAV.DAMST-----MVNY...KD..VAPSAL---------------------------
A5WBH3_PSYWF/27-466RYMTRQVASTTALVLGFLVVLLLGG.RMIRY-----FGIA.AEGR..LDVGLL---------------------------
E0TCF8_PARBH/6-360GYLAKRTLGGVLGLLLVIWLIVVSV.DLIEA-----MRDIARIPG..AGPIAA---------------------------
Q984S3_RHILO/7-356RYFFFRYVTITIWFFLGLLALVFLI.DFTEL-----SGRTTGLPG..FTYGTA---------------------------
Q2S3I0_SALRD/55-410RHIIKRLLKGFVLFVGALLVFFIVL.HWVEY-----SDDF.LDGG..ATIWEV---------------------------
Q1IRI3_KORVE/435-789DMILRDFLLYFVMVLTTFVMLALVF.TFFEL-----LGDI.VKNR..VSVVML---------------------------
A1WAC0_ACISJ/11-359RYAVRLFAVPLLTALATMLLATMLQ.RLLRL-----FDIA.ASTG..ASIASV---------------------------
Q8D296_WIGBR/5-350KYLIKKILKSQFHILCILFLIFFCQ.KLVRI-----LSSM.SEEL..IPKKII---------------------------
Q6MDI9_PARUW/8-358RYFVSEFIKVFLLFLVCFYGLYVLI.DYASH-----TSAL.PHHHIQLRIREL---------------------------
Q9A939_CAUCR/5-350LYVLRTVATRILGAALILMSVLQIL.DLLDV-----TSDI.LDRG..LGMAGV---------------------------
Q1D894_MYXXD/7-356IYVLRTYLRFALGILAGLVLVFVVV.DFVDR-----AKLY.TGPG...WVWDA---------------------------
Q1QKW5_NITHX/6-356KYIFRTTLASFVVVLVSLTGVIWIT.QALRG-----IDLM.TSQG..QTILTF---------------------------
Q143Z1_BURXL/6-377RYFARQIYLTFIFILFAFSGLFFFF.DLINE-----LNSV.GHGN..YKFQYA---------------------------
B5EBA8_GEOBB/11-361AYIFKEIPTPFLVGMVTFTFVLLMG.RFLKL-----AEMV.VEKG..IPFSDV---------------------------
A3I2C6_9BACT/6-354KLIIKDFLKTYFFVVLMLILIVLVL.DFTEK-----NDSY.IRND..VPSGEI---------------------------
Q2RQ55_RHORT/8-372RYILRNLLVGLAVGSVALIVLIWLI.NSLKF-----LDWF.VNKG..LSVATF---------------------------
A1WUU9_HALHL/6-348GYLARTVIAASLVALAAILALDFVF.SMVDG-----V....ADDG..LDTTTM---------------------------
A5G1T7_ACICJ/24-378RYVFRQLLIGLAVSTLGLVALVWLT.QSLRF-----IQLI.IQHG..LSPVVF---------------------------
Q3B4Y3_CHLL7/6-432RYILKSLVGPFFLAFLTIMFVLILQ.FFANF-----ADRF.IGRG..IDFMSL---------------------------
Q0BZX3_HYPNA/9-369RYILRECLSGLVLVLGILLLAILMI.DVVEQ-----MRTIGGDVE..ITLLDA---------------------------
A2U291_9FLAO/6-450KYILKSFLVPFIATFLIVLFVLVMQ.ALWQA-----FENI.AGKG..ISVIFI---------------------------
A0LB30_MAGMM/6-357RYLLTECALTSFTALVVLTTLVLLP.QILML-----VDLW.VNKS..VSVSVL---------------------------
E0TCF9_PARBH/51-404RYIFKQVAVPFLLILACTTAVIWFT.QMLQR-----VDLM.VEDG..GSLLSF---------------------------
A5EXI7_DICNV/7-348RHIARIITAHIIIVLIFLLGIDFLV.QSAEE-----SDNI.GRGN..YHFWLM---------------------------
B8CYZ1_HALOH/12-360VYIIKEVLYPFLIGVSIIGVIMLS..GLLRQ-----LSDLIIIKK..IPVAVV---------------------------
Q1MPZ1_LAWIP/7-360RQIFRESTYIFFLVVGALLTLIIIN.RAIQM-----RDLF.IGLK..LEILDV---------------------------
A8ZZ83_DESOH/6-356RYIIAEILKALAVVMAVVIVIYVAV.DFFEK-----IDDF.LGAG..VPLSRM---------------------------
A8EWU1_ARCB4/5-331RYLYSQLAITFFPIFFGLFFITAVI.FLVKI-----SALT.AIIT..VNFFEL---------------------------
Q31ET4_THICR/6-346KYLYKELFATFFAVLSVLLLITFGT.EATKL-----LAVA.VEGA..IPSTVI---------------------------
Q1IZ54_DEIGD/6-380RYVTRELLPPLVAGTLLFTAILSFG.YFFIS-----SQWL...RG..VPVGLI---------------------------
Q1J2D3_DEIGD/10-350RSVLREVLRWYAAGVALFLILQLTD.ALSTT-----VGVL.LLYH..ATPLEA---------------------------
Q2S0T8_SALRD/7-449WIVLRRLPGPFFGWLGTLMFLLLMQ.FLIRW-----LPEI.AGKG..IPVSVI---------------------------
Q6MDI8_PARUW/7-377RYSINHFLKIVFACVFAFISILLTM..RLDE-----IANF.AALG..APISYI---------------------------
B8CYX9_HALOH/6-362RYLTRELIMPFLFGVAAFTAIFIGT.DILFT-----LTRLYNNFG..VEFTTL---------------------------
Q1IRI3_KORVE/8-376RYILGEVLSHGAIGLALFTFVIFMR.DLGRL-----LELI.VRNS..APLPSV---------------------------
O83854_TREPA/1-358MYVCEVVFKHILVGVLCFFLVFFVN.NVLLF-----AQTL.LTKH..VSAADV---------------------------
Q8D297_WIGBR/7-348RYIRSLIFKTTIVALFILLTISGII.KFSEK-----IQSI.DNSY..ISIFYL---------------------------
Q9AA49_CAUCR/9-364RYLLRRTLAPMSAVLISTMVAFLME.RLMRS-----FDLL.SQTT..EGLRYL---------------------------
Q3J9X2_NITOC/9-352RYILKELSLNATAITLVLLLIFGGI.RFIRF-----LSQA.TEGK..VPGEAI---------------------------
A7IJ85_XANP2/6-384RYIFSTAAVAFLGVVVVLAGMIWAT.QALRQ-----LDLV.TSQG..QTIIAF---------------------------
Q0C1U7_HYPNA/7-360RYLIRSFLGMFAGLTVLAMALLLLE.RLIRI-----TEIV.SGSG..SAFASA---------------------------
Q0BVK4_GRABC/5-352RYAAMAALKAVGLSAIALTALFSLL.EFVQQ-----LASV.GQGR..YGMLDA---------------------------
Q5FU64_GLUOX/35-392IYIARQFMLSTLSMVLALTGLVSLF.DFIDL-----LRRAATRPN..VPASLI---------------------------
Q5FPA9_GLUOX/26-376KALNRALLGRFLLCGAVLVSLLEIL.ALLEK-----TTPI.LNRH..LGFRGI---------------------------
Q1D895_MYXXD/6-362RYLLGELLVPLGVWVAFMFLLLFVM.QFLRG-----TDVL.LGSS..VTLVDM---------------------------
A1AXG9_RUTMC/6-356RYIVKTMAFYTSAVMLVWLGIYAFF.NFLEE-----VTFI.GQAN..YTVFEV---------------------------
A6QBC8_SULNB/6-335GYISSNFTKAFLTIFIPFFLIISLV.YLVKI-----SSLT.AQIQ..INFLEL---------------------------
A6QBZ1_SULNB/12-355RYLAKHYIKNLLAILFGLSFAFAAI.DYFQY-----TEELQGSWN..YK....---------------------------
Q7VQS9_BLOFL/5-358KYIMKEICKNQLIILILLLLACFCQ.KSIKV-----LS...LSNN..IPIYWI---------------------------
Q73NV8_TREDE/6-354RYLLKLFIPTFVVAMLFFILLLQLG.DLFAN-----IVAY.LQNG..AQFKDI---------------------------
B4E8H0_BURCJ/7-345..LQRELAYTAGAVFMVLLTIMLTT.MMIRI-----VGYA.ASGE..IDPRDV---------------------------
J9ZCA2_LEPFM/6-351RYLFVELLPPFVIGLLVLVVLILTQ.QTLMI-----MNLL.VNKG..LSIPTV---------------------------
J9ZCM7_LEPFM/6-356RYIASELFKIFLLCFISLEAIYGVI.DSVEK-----IKDF.LSHH..AALPLI---------------------------
O26028_HELPY/5-350RFVGWYYFKYFLIVLLALELFFVGI.DSLKY-----ADKM.......PDSANM---------------------------
O51747_BORBU/11-425.YIIAEFFKYFLITFLFFFFVFFIN.QILFF-----MRIL.LQNY..VPFFKA---------------------------
O51748_BORBU/7-350..FIKSIILTFLSMNLLFMILIMLG.DLFVN-----LLNY.LEKN..IGLKDI---------------------------
O84846_CHLTR/8-346..LIFRYLKTTVFCTLSLICISIIS.SLQEI-----VSYI..AKD..VPYATV---------------------------
LPTG_HAEIN/7-355RYIGKSILGAIFATLMTLVGLSAII.KFVEQ-----FRSV.GKGT..YDIWQA---------------------------
Q2JLS4_SYNJB/13-367RYLFGEMLTPVLAGVAGGTLLLLVG.RLFTL-----AERL.VEGS..VPPLTV---------------------------
Q2YN46_BRUA2/7-357.YILRRVAIMFFAVLGAAVGITWAV.QVLQR-----INFL.TTSG..QTFQTI---------------------------
Q5NFB9_FRATT/8-349RYIFRTVFSSFLIVSIIFCILFFIF.TYLAQ-----VSNN..TAN..VSNFEL---------------------------
Q5NFC0_FRATT/6-350.YYNKDIVNTFTSITLFIISIVSAN.LLIRL-----FQEA.YSQG..LGIDSI---------------------------
Q5SL95_THET8/4-334RYVLREVLVPYLVGVFLFAALLTFD.LLSSL-----SGVL.LSRG..VGAREV---------------------------
Q7CKF4_YERPE/5-345RYLVRETLKSQIAILFILLLIFFSQ.KLVRI-----LGAA.VDGE..IPTNVV---------------------------
Q8F742_LEPIN/134-585RYILREIFSPFLVSLAFFTMVYMVL.ALQKM-----IGLF.VGKG..VDPFRL---------------------------
Q8F8T0_LEPIN/30-383KYLFGEFFKIFIGTVILLTGIMLLS.LVNDN-----LRNF.TATK..APRYHV---------------------------
Q8PCR2_XANCP/10-365WYVGRAVLFTVLLTWAVLLGLDVVN.AFASE-----AKSI.GQGS..YSFGHA---------------------------
Q8PCR3_XANCP/6-349RYLLSDFTQSFLATLIVLLVVSVGG.VLVDI-----LGNI.ADGR..IPARLL---------------------------
Q8RER6_FUSNN/12-360.....YFIKFFLMNIIGFMGVFLLA.QTFKI-----IKYI.NQGK..LAGGEI---------------------------
Q9X257_THEMA/19-363KYLLKLSVVPFLIGLGGFIVFVSLE.ILYQL-----SDLI.VRHR..VGIEKL---------------------------
Q9ZCH3_RICPR/10-357.YLTKLYSKCFFIILFLLIGLLIIS.NIFDL-----LQKF.KNIY..VPFSFF---------------------------
R6X2Y4_9PORP/1-468..MLQTFLPLFLMTFGICLFIVLMQ.FLWRY-----IDDM.VGKG..LGIPVL---------------------------

PF00528

GLNP_ECOLI/33-218GLVIGLLAGFARTFGGWIANHVALVFIEVIR.....GTPIVV.......QVMF......IYFALP...............
YQGH_BACSU/107-309GIAGAIFMT...EIAPNWGKKVLQPVIELLV.....GIPSVVYGFIGLTVLVP......FIAQ.................
YQGI_BACSU/80-293GVGGGVFMA..EYAPNNKVTDFIRTCIEVLS.....SLPSIV.......IGMF......GLLMF................
NIKB_ECOLI/116-308SVPLGIWAA...RHRDRLPDFAVRFIAFLGV.....SMPNFW.......LAFL......LVMAFSVYL............
Q97UG4_SULSO/116-318GSYLGSIAG...FNRRSRKDLVILIITSILA.....ALPSFV.......ILMY......LEMWLSVQHGIFLIS......
YCKA_BACSU/41-224GTVIGLFISLARMSKLALLRWPAKLYISFMR.....GVPILV.......ILFI......LYFGF................
Q97VK6_SULSO/120-341GLFTGAIAA...SNRNKPLDYLVRGVYLVTW.....ASPPFL.......IAVI......LQLVIAYYLRLLPPTGTVNPV
Q9FAT0_VIBPH/116-319GYALGLVAG...LKNKSTLGKCLYYGSWILS.....CLPSFW.......VGII......LIAIFALKLHWFPVG......
Q44374_RHIRD/87-266GSGLGLLAG....LRKGWLDMALSRFVDLVM.....SMPTLI.......LAMM......LL...................
Q9KB56_BACHD/117-308SILLGVICA...MKGGKAIDKSIRGFSFLLM.....GIPSYL.......LASF......MIWYFSVKL............
OPUBD_BACSU/40-211GVPAGILIA.....HFRRLSAWVFAVTNVIQ.....TIPALA.......MLAV......LM...................
Q9LAT6_LISMN/112-304GILLGVIAA...MYQNRWPDYTSTFIAILGK.....SVPSFV.......FATV......LQYWLGAKL............
LACF_RHIRD/87-298MITMALILAAMLNNPKLRYSGLFRTMIF.........LPCVSSLVAYSILFKS......MFSLDGVVNNTLL........
Y355_HAEIN/68-243GFLFGLISAL.LLSFSRQISAVLLPILVISQ.....AIPVFA.......IAPL......LV...................
Q982M9_RHILO/75-250GNLAAVLLAV.LFVHNRILQATYFPIVLFFN.....TIPILA.......LSPI......II...................
GLNP_RICPR/33-217GLVIGMLLAICKVNKNRVLRLFANFYTSIFR.....GTPLLV.......QLSI......IYFAAPYI.............
AMIC_STRR6/298-492AVPLGSAMA...RFKNTWIDSLSTGALTFLL.....ALPTIA.......LVYI......VRLIGSSIAL...........
TCYB_BACSU/46-230GMILALITALARMSKVRPLRWVFSVYVSAIR.....GTPLLV.......QLFI......IFYLF................
AMID_STRR6/125-308GVFVGGIWG.....ISKSVDRVMMEVYNVIS.....NIPPLL.......IVIV......LT...................
NRTB_SYNE7/98-276AACTGILVGG.VLGMSKFLGKGLDPVIQVLR.....TVPPLA.......WFPI......SL...................
Q9HIL1_THEAC/131-337GNRLGRYAG...INRNTSKDLAIDVFAMFMA.....SFPAFV.......LAFI......VLDIFSVYGHIFPLGGA....
Q9X0U9_THEMA/119-323GNRFGAFVA.....RKKRLDNFALPVFYTLT.....ASPYFW.......FGIL......LAWIFGVVIPLFPLAGA....
UGPA_ECOLI/90-294SLFFAALVEYIVRGS.........RFYQTLM.....LLPYAVAPAVAAVLWIF......LFNPGRGLITHF.........
SAPB_HAEIN/93-316GLPLGIISA...VNSEQVFAKSLQILSYVGL.....SIPIFW.......LAPI......LLYVAALSHWEIAAIGQYNLL
MSMG_STRMU/87-273IPAAAYSIA..RNMSRRKAFNIMYSLLILGI.....FVPFQV.......IMIP......ITV..................
G8PA36_LACLC/106-293GNILGVITG....YFGGRFDLIFMRFTDFVM.....ILPSMM.......IIIV......FV...................
HISQ_SALTY/27-221AVLIGLVGAGAKLSQNRVTGLIFEGYTTLIR.....GVPDLV.......LMLL......IFYGLQIALN...........
NIKC_ECOLI/89-273GLVIGGSAG....LIGGRVDQATMRVADMFM.....TFPTSI.......LSFF......MV...................
Q9WYD8_THEMA/94-282AITIGMLSG....YLGGTTDRILMALTDTFM.....VMPVFP.......LLLL......LS...................
POTH_ECOLI/117-315GYPLAWAVA....HSKPSTRNILLLLVILPS.....WTSFLIRVYAWMGILKNNGVLNNFLLWLG...............
LPLC_BACSU/93-290QLFFTFTMAYPLAKRHVKGRNLLLNLVIFSMLFSGGMIPTYL.................VV...................
CYST_ECOLI/74-276NGVFGLLMAWILTRYRFPGRTLLDALMDLPF.....ALPTAVAGLTLASLFSVNGFYGEWLAK.................
Q9ZBG1_STRCO/128-331GLLLGVLAA...RRPGSVLDRAVTSLSYTLE.....AAPVFW.......IALL......AVWLFALQWDVLPAG......
Q97UH1_SULSO/128-336GNLLGRVAA...LSRGKISDYAILGLMMFLY.....TFPVFV.......TGEI......LIEVLAIDLHIFPTGGQY...
Q97VF6_SULSO/101-289GIVVGIIAG....YLGGIIDNILMGITDIIL.....TLPSLI.......LIII......IV...................
LACG_RHIRD/89-270SSLAGYGFE....MFRSKLRERVYTVILLTL.....MVPFAA.......LMIP......LFM..................
Q9HLG4_THEAC/81-265GGLFGIIAG....YRGGYLDEVIMRITDAFL.....SLPALI.......LVIA......LS...................
MALD_STRR6/87-275QTSIIVLAGYAYSRYNFLARKQSLVFFLIIQ.....MVPTMAALTAFFVMALM......LN...................
GLTJ_ECOLI/43-239AFLVGSFFGILRTVPNRFLSGLGTLYVELFR.....NVPLIVQFFTWYLVIPE......LLPEKIGM.............
YEHW_ECOLI/68-240GTGAGIAVT...RPWGAEFRPLVETIAAVGQ.....TFPPVA.......VLAI......AV...................
Q9FAT1_VIBPH/84-268ALMLAIIAN.....LNRRWNMLIDFIVDCAL.....SLPSLL.......LLMI......LT...................
Q9A534_CAUCR/67-247ASLIACGLAL.LVSLNGFLEDAVRPIAVTLQ.....VTPLVA.......IAPL......VT...................
YEJB_ECOLI/151-361SIPLGIRKA...VYNGSRFDVWSSAFIIIGY.....AIPAFL.......FAIL......LIVFFAGGSYFDLFPLRG...
YOR2_CALSR/83-265ILIISSMAAFAFSRFKFALNNLLYSLIIAGM.....AIPIHV.......TLIP......IYVLT................
O66777_AQUAE/114-319SIPLGTLAA...FKENSLFDRFVVGFSYTFM.....SVPSFF.......LAFL......LLFFASKTGILPVGGM.....
YEHY_ECOLI/195-381GVPLGIWCY.....FSTARQGAIFSLLNVIQ.....TVPSVA.......LFGL......LIAPLAALVT...........
Q9WXN6_THEMA/92-279GTIIGSFSA....VKRGIVDDVLMGITNIVL.....TTPSIL.......IAIL......IA...................
Q9Y9N0_AERPE/121-339GVGSGVVAA....FRGGLVDRLLRTSSIVAY.....TLFIPW.......LGLM......LKYVFSIKLGILPTGGRIDPR
Q9WY46_THEMA/67-238GLPVGFFMG.....ISDRVYEFLRPLVTVVQ.....AVPVVS.......WLVV......VI...................
Q9Z6P7_CHLPN/68-243AITLSIVLAT.IMLSYKSAKDLLQPLFILLQ.....CTPMFA.......LAPL......IV...................
Q98K60_RHILO/105-289GTALGIIIAV.GIVHVATLDRSLMPWIIASQ.....TIPILA.......VAPM......IIV..................
UGPE_ECOLI/91-278KITVSMLSAFAIVWFRFPLRNLFFWMIFITL.....MLPVEVRIFPTVEVIAN......LQM..................
OPPB_LACLA/113-318AIPMSIVAA...RNEGKWQDQLWLTYNSITF.....GIPPYV.......FYLL......IIFIFGYSLNWFPTGG.....
Q49553_MYCHO/234-419GISIGAFLG...FYAGKLIDTIIMRVIEIFL.....APPTLI.......WILL......FV...................
FBPB_SERMA/341-526ITLCAIPMAWLSVRYPARLYRVLEGCNYVTS.....SLPGIV.......VALA......LVTIT................
Q987J0_RHILO/100-280GVVLGMTAA....VIGGWVDTCLSRFLDAMN.....SIPSKL.......FGLV......VV...................
Q9CLG9_PASMU/73-248GVSLGLISAL.LLSASDYLSKLLLPLLVISQ.....AIPVFA.......IAPL......LV...................
Q9PPS8_UREPA/183-374GIPLGIFVG...RKPGGILDSVSTVIISVIS.....AVPSLV.......FGLI......LLLIGKEVG............
PSTA_ECOLI/101-295GIMAGIYLA..EYGRKSWLAEVIRFINDILL.....SAPSIVVGLFVYTIVVA...........................
Q98QF6_MYCPU/174-365GVPLGIWVG...KNPGKFLDNASTVVVSIFS.....SIPSLV.......FSLL......LLLIGRAFG............
MALC_STRR6/209-434QIVIGIFTAIIANQPFIKGKRIFGVIFLLPW.....AVPAFITILTFSNMFND......SVGAINTQVLPILAK......
LPLB_BACSU/104-314AFPAPLILA...LLLNEVRKAVYKRCIQTFI.....YVPHFVSWTIVVSITFV......FFTVDTGVINKLI........
YHDY_ECOLI/173-362ALPWGILLALGRRSHMPIVRILSVIFIEFWR.....GVPLIT.......VLFMSSVMLPLFMAEGTS.............
A0A023Z6E4_ECOLX/104-273SIPFGLMSA..ENLVPWWVYQPVRRLMDACR.....AINEMV.......FAML......FV...................
Q7ANQ9_RHIME/112-306GVITGTIAA...LRQNSFLDFAVMSVSTIGV.....TVPNFV.......VGPV......LTLIFAIVLA...........
Q97YP1_SULSO/131-332AIVVGAYAA...LKRNKAVDHIISNYMILQY.....NIPGFF.......ILAV......LWVVFAVYIKAIPI.......
O28506_ARCFU/135-354GVATGSIAA...FRRGSKVDSGMRIYSIVAY.....TLFIPW.......FGML......LQMLFGVYLKVLPIGGRITPG
Q98K61_RHILO/75-251GSGAGFITAI.LADRVPFLRRGLLPIGNMVS.....ALPIIG.......VAPI......MV...................
AMYC_THETU/83-269IAIFSSMTAYALQRVKRKSSVIIYMIFTVAM.....LIPFQS.......VMIP......LVA..................
Q2FVE8_STAA8/117-308SIILGVVSA...LKRGKFTDRAIRSVAFFLT.....ALPSYW.......IASI......LIIYVSVKL............
Q9EWP8_STRCO/101-281GMTAGVLAA....MVSRRLGDLTVRCVDALA.....VLPALL.......VVLV......LA...................
Q9KKK5_VIBCH/118-310AIPIGVYCG...KRTDRWADNLALLTSIMIK.....AQPVFL.......IGLG......LVILFALQL............
YEJE_ECOLI/158-341GVLAGALQG....YYGGKVDLWGQRFIEVWS.....GMPTLF.......LIIL......LS...................
O86691_STRCO/402-574GVLLGLVPR............VSAPLVDTVN.....AVPPVL.......VALL......VT...................
Q98QS7_MYCPU/195-382GIIVGTYMG...FHIGKKVDNILMRVIEIIN.....SIPWFL.......IFII......LV...................
I3VV06_THESW/85-290INVVGLSLA.....MLVTRKIFARNFMRTAF.....YLPNLIGGLILGFIWNF......IFVDVFQTISDA.........
O34157_SALTM/115-319GVTLGFLAG...RFLHRWPDKMICRISYLLS.....SLPTFW.......IAML......SGAVCRPLAVLPVCC......
Q9PL65_CHLMU/67-242ALLLSISLSV.TMLLFPSIQGVLHPLCVLVQ.....CLPMFT.......LTPL......IV...................
Q9RX04_DEIRA/318-494GGLGGLLLGY.PIAKSRALERFLSPFIVASQ.....STPIVV.......LAPL......LV...................
SSUC_BACSU/94-269GAGLGLMIGI.LAGFSKRTELYLDPSLQMLR.....TVPHLA.......VTPL......FI...................
Q9UYG7_PYRAB/121-325GNWLGALAG.....KNKKYDKYLMPVFYFLA.....SIPYFW.......FAMV......LVYFLGVKLNIFPYQGA....

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205------------------------------------------------------------------RDEIGILRTLGVSA
A1SH34_NOCSJ/795-890------------------------------------------------------------------RRTFAIASALGARR
A1SKN4_NOCSJ/326-416------------------------------------------------------------------RPEVALARLRGRGR
A1TXE6_MARHV/209-306------------------------------------------------------------------RESLALLYRYGVNR
A3I1M1_9BACT/315-407------------------------------------------------------------------NKEVGLRKVMGAGR
A3I2Y5_9BACT/772-861------------------------------------------------------------------IKDYCVRKVFGANT
A3QAU8_SHELP/338-429------------------------------------------------------------------APEVGVRRAIGASR
A4VW57_STRSY/1024-1117------------------------------------------------------------------IRELSTIKVLGFHN
A4YKC0_BRASO/760-849------------------------------------------------------------------VYDAVILKTLGATR
A5N346_CLOK5/499-593------------------------------------------------------------------IKQYGAMRAVGMDE
A5USK7_ROSS1/337-433------------------------------------------------------------------QQEMAILRSRGSSR
A6H1M7_FLAPJ/310-410------------------------------------------------------------------TQMIGILKSLGANN
A6L8W9_PARD8/679-767------------------------------------------------------------------LQEVSVRKVFGSSN
A6LCJ9_PARD8/311-395------------------------------------------------------------------IKSINIRKILGDSV
A6LZM8_CLOB8/312-398------------------------------------------------------------------VDRIGILYSFGISK
A6TSQ0_ALKMQ/290-387------------------------------------------------------------------LPVIGTFRSIGATK
A7H957_ANADF/310-394------------------------------------------------------------------IREIAVLKLIGARN
A7HK62_FERNB/280-383------------------------------------------------------------------KISLGVLRAIGYSR
A8ABZ3_IGNH4/274-373------------------------------------------------------------------VREVATLRSIGASL
A8AR20_CITK8/257-351------------------------------------------------------------------RDTINVQKLIGATD
A9KQT2_CLOPH/369-506------------------------------------------------------------------KYEIGVLRAMGMKK
B2HGJ6_MYCMM/200-292------------------------------------------------------------------RTEIGIMRLVGASR
B4EEB5_BURCJ/285-374------------------------------------------------------------------TAEYATLKALGFGP
B7VH43_VIBTL/299-399------------------------------------------------------------------QSEVAILKTQGMRD
B8I8J6_CLOCE/322-424------------------------------------------------------------------MREFGTLRAIGYSR
D4K997_9FIRM/688-783------------------------------------------------------------------KQENSVLRSIGLTQ
D4KYJ1_9FIRM/289-395------------------------------------------------------------------IQEYGKIKALGATK
D4KYJ2_9FIRM/288-378------------------------------------------------------------------KQEYGVLQAVGMTN
M1FFQ7_9ALTE/713-801------------------------------------------------------------------AWYFRLLQVWGLTK
O28455_ARCFU/301-396------------------------------------------------------------------LGNIAVMRALGFTR
O50782_BORBU/302-402------------------------------------------------------------------TRELGTLRAIGLTK
Y684_MYCPN/1015-1110------------------------------------------------------------------QTEFSIIRAGGFST
Q01VW7_SOLUE/1304-1396------------------------------------------------------------------TREMGIRLALGAQR
Q025M3_SOLUE/377-471------------------------------------------------------------------DRELAIRSALGGSR
Q034M7_LACC3/430-519------------------------------------------------------------------LREVGILKAVGFTT
Q0P8Y0_CAMJE/176-262------------------------------------------------------------------TDRIEIMCLFGAPF
Q0RJL1_FRAAA/665-753------------------------------------------------------------------RRPFSLLRLAGAPL
Q18EP9_HALWD/325-419------------------------------------------------------------------RQFIAILSAVGYTE
Q1G8P7_LACDA/306-403------------------------------------------------------------------QSEIALRISLGMRQ
Q2FUZ2_STAA8/85-179------------------------------------------------------------------RKEFSIFMTLGMTK
Q2RPK1_RHORT/306-403------------------------------------------------------------------RRTIAILGLIGFGK
Q47EZ3_DECAR/269-372------------------------------------------------------------------KREIGILKAIGWET
Q481M7_COLP3/731-820------------------------------------------------------------------KKKNSVIMSFGFLK
Q4A9N5_MYCHJ/1828-1923------------------------------------------------------------------NKVLGILRAQGYSL
Q4A9N5_MYCHJ/2549-2644------------------------------------------------------------------QQNIAILDVLGYAN
Q4DFN5_TRYCC/470-565------------------------------------------------------------------RFEFAMIRAQGLNK
Q4QBC9_LEIMA/1003-1097------------------------------------------------------------------AWTFGVLRSLGFRT
Q54MT9_DICDI/571-666------------------------------------------------------------------TFNNGVFRMLGAKF
Q5JEM5_THEKO/229-318------------------------------------------------------------------TREVGTLKALGLPD
Q5LCL1_BACFN/298-387------------------------------------------------------------------GRELGLRKVCGSTN
Q5LDA1_BACFN/308-392------------------------------------------------------------------AKGIGIHKCNGASD
Q5LFF2_BACFN/320-426------------------------------------------------------------------LAEMGIRKAFGANR
Q5V3A9_HALMA/900-995------------------------------------------------------------------RQAIGIHRSTGATQ
Q6AA47_PROAC/625-722------------------------------------------------------------------RRTIAVQQAVGTPA
Q6AMB4_DESPS/311-415------------------------------------------------------------------YGEMGLRLAIGENK
Q6F163_MESFL/1307-1400------------------------------------------------------------------KIVILTLQALGYKD
Q6F1V8_MESFL/1717-1810------------------------------------------------------------------HRFMVTMKALGYSN
Q6F1W1_MESFL/1327-1420------------------------------------------------------------------IRFISTMRVLGYHD
Q6MGV4_BDEBA/685-778------------------------------------------------------------------SWELASLRILGFEI
Q6MSQ5_MYCMS/397-490------------------------------------------------------------------RGQIGTMRAIGYKK
Q6MT15_MYCMS/588-682------------------------------------------------------------------RRQIGIFKSFGYKV
Q6MUJ8_MYCMS/1693-1786------------------------------------------------------------------KSFMIMLRSMGYTN
Q79Z83_STRAW/268-362------------------------------------------------------------------RREFGLLRTAGATP
Q7UPA2_RHOBA/607-706------------------------------------------------------------------LSEFGTLLAVGFTP
Q7V1V4_PROMP/299-384------------------------------------------------------------------LPEYATLLAMGYRL
Q81HP3_BACCR/261-351------------------------------------------------------------------EREISLKKAVGASN
Q81QE5_BACAN/286-379------------------------------------------------------------------YREIGVMKAIGIHN
Q830M8_ENTFA/609-698------------------------------------------------------------------RQDYVTLKRMGVSS
Q87SX2_VIBPA/317-410------------------------------------------------------------------RREMAILRAMGARP
Q899W1_CLOTE/276-369------------------------------------------------------------------KKNILISIALGANR
Q8A9F6_BACTN/292-381------------------------------------------------------------------GKEFGLKKIFGSTP
Q8CYG6_STRR6/429-522------------------------------------------------------------------RTHAGIFKALGYRS
Q8DQ76_STRR6/86-181------------------------------------------------------------------SKELGIYGMLGLEK
Q8DQS2_STRR6/328-451------------------------------------------------------------------RKEVGILLSIGLKQ
Q8EUA2_MYCPE/1386-1480------------------------------------------------------------------FKLAAILKCLGLDD
Q8EZY9_LEPIN/286-379------------------------------------------------------------------SGAIAVLKCLGASP
Q8G7P9_BIFLO/348-438------------------------------------------------------------------DDEIGMALVSGVTR
Q8KD33_CHLTE/294-389------------------------------------------------------------------REQIAVLKANGYDD
Q8NS27_CORGL/639-739------------------------------------------------------------------KLQQHALIAIGATP
Q8Y6E1_LISMO/85-180------------------------------------------------------------------KREIGLYSLLGLRK
Q97DB8_CLOAB/742-835------------------------------------------------------------------KRHLAVYASVGMNR
Q97LN0_CLOAB/763-854------------------------------------------------------------------RRELAMLRSVGMSD
Q9A6K3_CAUCR/378-465------------------------------------------------------------------IKEFASLRALGVSM
Q9FBP3_STRCO/683-772------------------------------------------------------------------KKLLSALVAFGTRR
Q9KF85_BACHD/565-650------------------------------------------------------------------KEEQELLLDLGWKK
Q9PPU7_UREPA/189-284------------------------------------------------------------------KVMFGAMQAQGVSR
Q9WZG5_THEMA/751-844------------------------------------------------------------------IKIMGTLRAVGMKI
R5K905_9CLOT/831-926------------------------------------------------------------------ELLFGIYRAMGMSM
R5KJ88_9CLOT/371-467------------------------------------------------------------------SAVIGALYALGVKR
R5TSZ9_9FIRM/299-417------------------------------------------------------------------MSQYSVMQTLGMES
R5UPZ8_9BACE/319-410------------------------------------------------------------------QREFTIRKIIGNDM
R6WL88_9PORP/179-267------------------------------------------------------------------RKELAIRKVNGATM
R6WLH2_9PORP/307-392------------------------------------------------------------------NKEMKLRNAIGADK
R6WYF0_9PORP/312-402------------------------------------------------------------------IRIIHTQKLMGATQ
R6X6U4_9PORP/300-397------------------------------------------------------------------TRELSLRKCLGSDA
R7EAJ1_9BACE/317-408------------------------------------------------------------------RSEIALRMAMGSSR

PF03739

Q3ATU7_CHLCH/6-355---------------------------ARYYL.LSIP----SIFL.VTSPVSALLASILVAGKLATQNELPAIRSAGVSM
Q118T4_TRIEI/24-389---------------------------IQVFL.LKMP----EFIG.LAFPMAMILTTLMVYSQMSGHSEIVALRSCGISI
A0LEN9_SYNFM/39-391---------------------------MALVA.LAMP----KLML.FALPMASLLGVLLAFVRLNSDNELIALRAAGIGF
A7HYF9_PARL1/7-370---------------------------FELTV.LALP----STLM.IVLPISLFCAVLYSLHKLISDSEIVVMFAAGVSR
Q8DIL4_THEEB/18-374---------------------------LQLIG.YQLP----AVLV.LVFPMAVLLAVVGAMSRLSEEGEWIALRSVGICL
Q82W93_NITEU/6-348---------------------------FKLVG.LKTI----IALE.VLVPIAFYVAVIYGLSRMNRDQEINVLRTAGYGD
A0LB31_MAGMM/6-364---------------------------VELIF.LRMP----HFFT.QFLPPIALLTTLFVVTRLTRLNELTVIRSGGVSL
Q6MKD0_BDEBA/11-364---------------------------AEIIG.YVII----SMLP.ILFPMALLFSVLLTYGRLSQDSEIVAMKASGLPM
Q6FFD6_ACIAD/9-354---------------------------FLYVL.WGAP----RYLY.EILPISALIGAILGLGTLASNSELIVMRSVGISL
Q0C1U6_HYPNA/7-346---------------------------MRYMW.LRLP----ALFD.RIVVFAFLLAALLTYASLIRRNELVAISAAGISV
Q11U59_CYTH3/9-455---------------------------AELMM.YFSM----NILP.VALPLAILLSSLMTFGNLGQFNELTAIKSSGISL
A1AWC7_RUTMC/20-369---------------------------LPLVG.LNMI----RDVV.LILSLSLLLAIILSVSKLYKASEAIVMNSLGLGD
Q73NV9_TREDE/13-373---------------------------LLLLF.YSLP----FIIA.TTAPYAALIGTLMCLGRFSADHEFISMNALGIST
Q1GR36_SPHAL/14-363---------------------------WRYVG.MRMP----QIIE.TFLPFSVLLGTILTMVTLNQNSEVVAMKAAGMSA
A5EXI6_DICNV/8-348---------------------------GQLLI.FQTA----NIVV.ILLPVAFILASVMTLSRLYGDCEINALFAGGCSK
Q7VQS8_BLOFL/9-358---------------------------FFCIF.LNII----KDFE.LFLSLSTLLGGVLGLGILELRNELIIMKVFGLSN
Q310A0_DESAG/6-352---------------------------LTYFA.VKIP----LIIS.QILPAVFLLSAVIQLCVMARDRELVALQAGGISF
Q5SL96_THET8/6-344---------------------------LRYLL.FRTP----EALA.RGAPVAYLFALLVLLSRLGEDAELKALLALGVRR
Q6MJL5_BDEBA/6-356---------------------------VNYYL.YSFP----GIIS.QLLPVACLLGVILTLTSLNKANELVALFASGMSL
A5WBH3_PSYWF/27-466---------------------------FSIIG.YNLP----YFLE.LVLPLSFFIGLMLVFGRLYVDHEMAVLNGSGISR
E0TCF8_PARBH/6-360---------------------------LRLTL.LRTP----QLIL.SLSPFIFLFGTLWAYGQMARMSEIAVLRAAGLSV
Q984S3_RHILO/7-356---------------------------VAISG.LRMP----MIML.QTVPFVGLFSAMATLVSLNRRYELVIARSAGVSA
Q2S3I0_SALRD/55-410---------------------------FTVFYPNYVP----EIIR.LTSPLALFLSCIYLTGTLAQELQLVALQTSGVSL
Q1IRI3_KORVE/435-789---------------------------GDYLL.NLSP----SLIY.LMTPLSVLLAVLVTFGLMQRSNEITAMKATGISI
A1WAC0_ACISJ/11-359---------------------------LLLAA.DLVP----HYLG.LALPVAFTAAIFMAAARMGDDSELDAMLATGRSI
Q8D296_WIGBR/5-350---------------------------FFLLI.LYIP----EIIK.LILPLSLFISIALVMQKLHNSNEIISIKTCGIGN
Q6MDI9_PARUW/8-358---------------------------IRYYL.FILA----SRAE.ILIPLALLIAFIKTVCTLNTHQELVALMAGGIKL
Q9A939_CAUCR/5-350---------------------------GYYAA.LRLP----RLFE.QVAPIAVLAGGLFAFSQLARESAIVAMRASGISG
Q1D894_MYXXD/7-356---------------------------AELYF.YKAM----MSVQ.QLGPAALLLAAGTTVSALRKQGEVTAIRALTFGP
Q1QKW5_NITHX/6-356---------------------------LGITS.LAIP----VLVL.IISPIALMIAISHTLHKLATDSEIIVMNAAGLSP
Q143Z1_BURXL/6-377---------------------------VLRVA.LQTP----SRFY.EIIPVAALISAIYVFAQMAANSEYTIFRVSGLAT
B5EBA8_GEOBB/11-361---------------------------VRMVA.YLLP----PFWL.FTIPMALLLAMLLAFGRLSGDSEITAMKSCGISL
A3I2C6_9BACT/6-354---------------------------MKYM..INYG----LYLNNLLTPITVFISVIFITSKMAGRTEIIAILSSGVSF
Q2RQ55_RHORT/8-372---------------------------LRLTL.LLMP----GFLT.VFIPIALFAVVLFTYNRLAADRELIVMRAAGMGP
A1WUU9_HALHL/6-348---------------------------LLKAL.LGAP----ALAY.EAFPFATLIGALMGLGGLAARQELTAMRAAGVSV
A5G1T7_ACICJ/24-378---------------------------LHLTG.LLVP----SFVA.VILPITCFIVILFVYARLAADRELTVMRASGMSD
Q3B4Y3_CHLL7/6-432---------------------------IELLA.LQSA----WMVG.LAAPMAVLIGVVMAFGSLTTTSEMTVFRASGLSL
Q0BZX3_HYPNA/9-369---------------------------LRLSL.MKLP----MIIE.QTLPFALLAATMMAFTRLNRRSELSIIRASGLSA
A2U291_9FLAO/6-450---------------------------LKFLY.YTTL----MIIP.QALPIGVLLSSIMALGNLGENYEFAAAKSAGVSL
A0LB30_MAGMM/6-357---------------------------GKMVL.LIMP----KFLV.ASLPMALLVGILIGLGRLAQDSELIVIKASGISL
E0TCF9_PARBH/51-404---------------------------LRVTV.LLIP----SLVG.VILPFAVFAAVLYALNLFVTDSELPAMRAAGASR
A5EXI7_DICNV/7-348---------------------------LSILL.LNVP----ARIV.EFMPAAVLVGTITALGQLNKQQELTVIRTSGISR
B8CYZ1_HALOH/12-360---------------------------LKLLL.YQLP----EIIV.QTFPIAILFATMSGMGRLNRENEFTALRMGGISL
Q1MPZ1_LAWIP/7-360---------------------------LILFS.YMVP----LFLI.LVIPIACMLGVFLTFLRMNLDKELIALKASGISI
A8ZZ83_DESOH/6-356---------------------------AVFFL.FKIP----LIVV.QTAPVGVLIASLVVFGLMNRRNEVTALKSSGIGP
A8EWU1_ARCB4/5-331---------------------------FRIFS.YTIP----DIIF.YTMPISFFISMVITLSKLSSEYELTVITSFGLNP
Q31ET4_THICR/6-346---------------------------MQVLL.YKIP----PALE.VILPLVALLSVMLAVGRLYQDQEMVVLQSCGIAT
Q1IZ54_DEIGD/6-380---------------------------GQWIG.YQLP----DTLV.KVLPMAVVLMTVVAFGRLATERELVAVQSGGIGL
Q1J2D3_DEIGD/10-350---------------------------LSVFG.AIAP----DKLN.RSLVLAVPFAVLLTFGRLQGDSELKAMFAAGVSP
Q2S0T8_SALRD/7-449---------------------------VELIA.YNLA----YMVV.LAVPMSVLLAALMAFGELAESQYYTVIKSTGISF
Q6MDI8_PARUW/7-377---------------------------LLFAF.YQIP----YILP.IALPLSCLIASLIFVQRLSNTHELTALRACGFAL
B8CYX9_HALOH/6-362---------------------------VQLFF.LKLP----PIIV.LTFPMATLMGTLMSFGRLSGDGEITAFRAGGVSV
Q1IRI3_KORVE/8-376---------------------------AEIFF.LTLP----TALT.VTLPMAVLVGILIGLSRLSADSEVTAMRSSGLGS
O83854_TREPA/1-358---------------------------VRLLL.YSIP----AALI.YVTPFAVLVGSLLGLGRLRNNLELLALQVLGVSP
Q8D297_WIGBR/7-348---------------------------ISTIL.LSVP----KDIE.EFFNISILIGILWSIGILEKNRELIIIESSGISR
Q9AA49_CAUCR/9-364---------------------------AELLV.NLTP----HYVG.LTLPGGFFIGLFVVVNGLNKSSEIDAILASGTSL
Q3J9X2_NITOC/9-352---------------------------LALSG.YEAI----GALV.LLLPLASFLAVLLALGRMGADNEVIALFACGVSR
A7IJ85_XANP2/6-384---------------------------VAITS.LTMP----TLVL.VIAPAALFIATAYTLLKLNGDSEIVVMASAGMGP
Q0C1U7_HYPNA/7-360---------------------------SLLVA.NLIP----HYLN.LALPGAFLISMILTIDRLSRSGEIVALMAAGVSL
Q0BVK4_GRABC/5-352---------------------------AIYVA.LTIP----YRLL.QVFPVSMLIGTLLGLGGLARNGELTALRGLGMSE
Q5FU64_GLUOX/35-392---------------------------VKIAA.LHVP----YYII.YVLPFGILLGGIVCFSRLTRSSELIVARAAGISA
Q5FPA9_GLUOX/26-376---------------------------LTFAF.LHLP----ALSI.DILPLAFMVGALFLLTQMTLSSEISALRAAGLST
Q1D895_MYXXD/6-362---------------------------ARLLA.YLAP----HFLM.MALPIAFLLAILLGLGRLGEDRELVALQALGIGP
A1AXG9_RUTMC/6-356---------------------------TKYVI.SDIP----AVVY.SYSSVIILLGSLLALGHLASTSQLVVIRSAGVSI
A6QBC8_SULNB/6-335---------------------------LLLYS.YSLP----NIIF.YTIPLSFIAAVTNTLMKLSQDNELIALYALGLKA
A6QBZ1_SULNB/12-355---------------------------ILYIF.YMWQ----EALG.LLYPLAIVFAVIMTKLTFVKQNTMGALHAFGYTK
Q7VQS9_BLOFL/5-358---------------------------FLYLF.LSIP----DLGK.LIIPFSLFLSVLISCYRLHMHNEILAMYSCAVNK
Q73NV8_TREDE/6-354---------------------------VKVMW.LYIP----KCIA.YSVPLAILFAGSYTMGNLYAQNELTSIFSAGISL
B4E8H0_BURCJ/7-345---------------------------LVLIG.LTVI----GYLA.VMLVVTLFVSILFVLTRWYRDSEMVVWLASGVSL
J9ZCA2_LEPFM/6-351---------------------------LRLVM.MIFP----QFLT.MIIPVSVLAASTATFNRLASDGEITALKASGIGL
J9ZCM7_LEPFM/6-356---------------------------GQYFF.YRSI----EVSF.RVLPMSGLLATLLTLGILSKNHELTAIRAAGISL
O26028_HELPY/5-350---------------------------IILFFTYDIL----FALN.YTLPISLLLAMVLFYIAFIKSNQYTALLSIGFSK
O51747_BORBU/11-425---------------------------FIFII.YSLP----MVIA.LSPPFASLISVILTIHKFKLHNEILAFRSIGISI
O51748_BORBU/7-350---------------------------LYIYY.LYLP----KAFS.DGVALSFLFAISNLIGNLSMRNEIIGLFSCGVPL
O84846_CHLTR/8-346---------------------------FKVTA.YQIP----YLLP.FILPASCFISAFTLFRKLSDNNQITFLKASGASQ
LPTG_HAEIN/7-355---------------------------VIFTG.LTIP----KDIE.TFFPMAALLGALIALGNLASRSELVIMQSAGFSR
Q2JLS4_SYNJB/13-367---------------------------LRLLV.LDLP----EMVV.LGMPIAAFFATMLTLGKLSGNSEITAMRAAGIPF
Q2YN46_BRUA2/7-357---------------------------VQFSS.LLIP----SAIP.LVMPFALIIAITQTLSTMNQDSELVVINASGAPR
Q5NFB9_FRATT/8-349---------------------------IINTL.IQLP----GILY.TLLPACAMVGALMGLSLLANNSEIIVLRSFGRST
Q5NFC0_FRATT/6-350---------------------------VKFVI.LTIP----ENVS.LVAPIAIFLAIVICFGKYFANNEMFVTIAGGITW
Q5SL95_THET8/4-334---------------------------GLLVL.YRLP----WTLS.LALPLGLVFAVLVGLAGLIRRSELKAAYAAGVPP
Q7CKF4_YERPE/5-345---------------------------LSLLG.LGVP----EMAQ.LILPLSLFLGLLMTLGKLYTESEITVMNACGMGK
Q8F742_LEPIN/134-585---------------------------LDYFG.YLLA----NTLP.MTIPMACLMSGIMAAGRLSGDSEITAIRSAGVSF
Q8F8T0_LEPIN/30-383---------------------------ALFLV.YSIP----KIISTTVVSMSLMFSICFTVGQFSVNKELVSMMAAGVSF
Q8PCR2_XANCP/10-365---------------------------IAFVA.YTVP----RRAY.TLFPTAAVIGALMGLGQLAATSELTALRALGVSR
Q8PCR3_XANCP/6-349---------------------------LSQVG.LQFV----AYLP.IILPLALMLGLLLALARLYRDSEMAVITAIGIGP
Q8RER6_FUSNN/12-360---------------------------FDYIL.NLLP----KMFV.ETAPLSVLLAGLITISIMASNLEIVSLKTSGIRF
Q9X257_THEMA/19-363---------------------------FLMLY.YYLP----YFVA.MGVPVGVLLAIFWTFSRLSEERELMAIQVHGISQ
Q9ZCH3_RICPR/10-357---------------------------WRFIL.YKIP----YLLS.QVSSLISFTSMLFFLRNLTKSNELTAILSSGIHI
R6X2Y4_9PORP/1-468---------------------------AEMFM.YAAL----FLVP.MALPLAILLASLMTFGNLGERLELLAMKSAGVSL

PF00528

GLNP_ECOLI/33-218.......................MAFNDLRI.DPFTA.A..VVTIMINSGAYIAEITRGAVL.SIHKGFREAGLALGLSR
YQGH_BACSU/107-309........................FKSSGTG.HSLLA.G..TIVLSVMILPTITSISADAMA.SLPKSLREGSYALGATR
YQGI_BACSU/80-293........................VNLTGWG.YTIIG.G..ALALTVFNLPVMVRVTEDAIR.SVPKDLKEASLALGVSR
NIKB_ECOLI/116-308...................QWLPAMGYGGWQ.HIILP.A..VSIAFMSLAINARLLRASMLD.VAGQRHVTWARLRGLND
Q97UG4_SULSO/116-318..............FPSKINTSPNSIMALSR.FYTLP.I..IALMFTSLSGFVLGMRNNMLH.TIRDNYVTYAEILGLDH
YCKA_BACSU/41-224........................PYIGIEF.SAVTA.A..LIGFSLNSAAYIAEINRSAIS.SVEKGQWEAASSLGLSY
Q97VK6_SULSO/120-341LTP..PKSITPFPLLNAMLAGDWPYFSSLVH.HMVLP.V..IAIALVSFGIVTRIARASMLD.YMESDFAKLSLMKGLSR
Q9FAT0_VIBPH/116-319..............GATSLSIVNSTWQGNLQ.HMILP.I..VCLVLVGIGPLILHTKEKVVS.LLDSDYVKYAQMHQIPK
Q44374_RHIRD/87-266...........................TILP.RSVAFIV..AIIALVEATRFFRLARLLAAD.IAALDY.SGRFLRGETT
Q9KB56_BACHD/117-308...................DLLPTSGLDSYQ.SYILP.V..TVITASYVGIYFRSVRNSMLS.HLNEDFVLYGRACGISE
OPUBD_BACSU/40-211...........................LVMG.LGANT.V..ILSLFLYSLLPIIRNTYTGII.SIEHAYLESGKAMGMTK
Q9LAT6_LISMN/112-304...................QIFPVAGWGTFA.DTILP.A..FALAMFPLATAARFMRTELID.VFASDYVLLAKAKGNSR
LACF_RHIRD/87-298...............AIGIIGEPIGWLTDPF.WAKVL.I..IIAITWRWTGYNMIFYLAALQ.NIDRSIYEAAKIDGVPS
Y355_HAEIN/68-243...........................LWFG.YGMAS.K..IVMSVLIIYFPVTAACYDGLR.NTPQAWLDLAKTFNISP
Q982M9_RHILO/75-250...........................LIFG.LGMTP.K..IVIAAVICFFPTLVNMIRGLD.SASDNEHELFRVLSATR
GLNP_RICPR/33-217.....................INIKFN......VFMA.G..VISFALNSGAYVSEVIRAGIN.TVDKGQFEAAEALAIPK
AMIC_STRR6/298-492..................PDSFPILGAGDWR.SYVLP.A..VILGLLGAPGTAIWIRRYMID.LQSQDFVRFARAKGLSE
TCYB_BACSU/46-230.......................PAFN.VTL.DPFPS.A..VIAFSLNVGAYASEIIRASIL.SVPKGQWEAGYTIGMTH
AMID_STRR6/125-308...........................YSIG.AGFWNLI..FAMSVTTWIGIAFMIRVQILR.YRDLEYNLASRTLGTPT
NRTB_SYNE7/98-276...........................MVFQ.DANTS.A..IFVIFITAIWPIIINTAVGIN.QIPDDYNNVARVLKLSK
Q9HIL1_THEAC/131-337............YGVNVNMGFNVPFIISVIY.HAVLP.V..LTIILTSLGGWVLGMRNNIIP.NLNSDFINYSENLGFKD
Q9X0U9_THEMA/119-323............YSFGITPSFSWDFILDFLH.HWVLP.F..GSLFLVMLGGWAIGMRNMIIY.ELEANYSRYLEALGSSQ
UGPA_ECOLI/90-294................LAEFGYDWNHAQNSG.QAMFL.V..VFASVWKQISYNFLFFYAALQ.SIPRSLIEAAAIDGAGP
SAPB_HAEIN/93-316YEIKSITGFPVIDMWFMEVPYRTKIVQNILQ.HLALP.T..LVLCILPTMEIIRIIHQRAEY.ILNQNFSKVATTRGWSK
MSMG_STRMU/87-273.........................MMSKLG.LANMWGL..IILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK
G8PA36_LACLC/106-293...........................TIIPRFNSWSLI..GIISIFSWIGTTRLIRARTMT.EVNRDYVQASKTSGTSD
HISQ_SALTY/27-221..................VVTDSLGIDQIDI.DPMVA.G..IITLGFIYGAYFTETFRGAFM.AVPKGHIEAATAFGFTH
NIKC_ECOLI/89-273...........................GVLG.TGLTNVI..IAIALSHWAWYARMVRSLVIS.LRQREFVLASRLSGAGH
Q9WYD8_THEMA/94-282...........................SLIK.NYLSLPILGLIIGVFGWAGDARVIRSMILS.LREREFVVTSKFSGMRT
POTH_ECOLI/117-315......................VIDQPLTIL.HTNLA.V..YIGIVYAYVPFMVLPIYTALI.RIDYSLVEAALDLGARP
LPLC_BACSU/93-290...........................KSLG.LLDTY.W..ALILPMAINPFNLIIIKNFFQ.QLPRELEESAKIDGCSE
CYST_ECOLI/74-276.........................FDIKVT.YTWLG.I..AVAMAFTSIPFVVRTVQPVLE.ELGPEYEEAAETLGATR
Q9ZBG1_STRCO/128-331..............GLTDTASQQVTPGQVAG.HIVLP.A..GVLAVSQLPWFTLYVRQGVGD.ALAEDPVRGARARGLAE
Q97UH1_SULSO/128-336...........NTFQFLKPTMSLPFIWSVIY.HAILP.T..LTLILFSLAGWIMGMRNNMIP.ILQEDYMNYYRLMGVSE
Q97VF6_SULSO/101-289...........................SAFKTSNPIFLS..LILSITSWAGLARAVRSQVLV.IRNSPAVEVLRVLGLSR
LACG_RHIRD/89-270.........................LMGQAG.LLNTH.I..AIMLPMIASAFIIFYFRQASK.AFPTELRDAAKVDGLKE
Q9HLG4_THEAC/81-265...........................VLFH.ETLGGVI..LALVIVWWPIYARFFRAQTLR.IKNLDFVQAAKLGNVSF
MALD_STRR6/87-275.............................AL.NHNWF.L..IFLYVGGGIPMNAWLMKGYFD.TVPMSLDESAKLDGAGH
GLTJ_ECOLI/43-239.....................WFKAELDPNI.QFFLS.S..MLCLGLFTAARVCEQVRAAIQ.SLPRGQKNAALAMGLTL
YEHW_ECOLI/68-240...........................PVIG.FGLQP.A..IIALILYGVLPVLQATLAGLG.AIDASVTEVAKGMGMSR
Q9FAT1_VIBPH/84-268...........................VSFG.SGSQGVM..FAIALSHWPKLTRLCKSEIQS.LMCSDYMSHALNFGHKK
Q9A534_CAUCR/67-247...........................IWAGIDHPERAV..IGLAAVVAFFPIFSGALSGLK.SVDPDLARLFDLYGATP
YEJB_ECOLI/151-361...........LVSANFDSLPWYQKITDYLW.HITLP.V..LATVIGGFAALTMLTKNSFLD.EVRKQYVVTARAKGVSE
YOR2_CALSR/83-265.......................NKIK..LY.DTVFA.L..IGPYVALSLPMSIFILTEFMR.EIPLELEEAAKIDGCSM
O66777_AQUAE/114-319............QSPNFEQLSIPEKVLDILK.HLIIP.S..LTLGLVSLASLTRLVRSSVLE.ILSSPMVTMLKAKGVGT
YEHY_ECOLI/195-381...................AFPWLGTLGIAG.TGMTP.A..LIALVLYALLPLVRGVVVGLN.QIPRDVLESARAMGMSG
Q9WXN6_THEMA/92-279...........................SYLKVRSVEMVA..VILGLFQWPWFARAIRAQLMS.VMSREYVYLSVMAGYSD
Q9Y9N0_AERPE/121-339VN...LDVVTGLYVLDSIITANPAALVSAVE.HLILP.S..LTLGIVLSGVYTRLVRIHVAE.ALRSEVAVAYRARGLRE
Q9WY46_THEMA/67-238...........................FLWG.IGWQG.P..VVISSLSLIPVAIFTTVSGVR.SVDRKLLEVMKVYRVPR
Q9Z6P7_CHLPN/68-243...........................LWFG.WGIGA.V..IVPTALTIFFPLTLTIYQGIL.STPEELIEQFVLCGATK
Q98K60_RHILO/105-289.........................VLAAIG.VTGLIPK..AMISTYLSFFPVTVGMVKGLR.SPEIMHLDLMHTYNASA
UGPE_ECOLI/91-278.........................LDSYAG...........LTLPLMASATATFLFRQFFM.TLPDELVEAARIDGASP
OPPB_LACLA/113-318.............TVSPDAMGIIPVFFSKIY.HMILP.A..FSLAVFGTVGIFTYFRSGILD.EQTQDYVRTARAKGVKE
Q49553_MYCHO/234-419...........................SIIG.ANEWSLV..LTLTIVGWPGFVGITRMFIIT.VKDEEFIIAAKAIGVGT
FBPB_SERMA/341-526.......................IHSFRPIY.QTEIT.L..LLAYLLMFMPRALINLRAGIA.QAPVELENVARSLGKSP
Q987J0_RHILO/100-280...........................AAVG.SSIPALI..LTLAVIYIPGAYRFARALAVN.INSMDFMTVARVRGEST
Q9CLG9_PASMU/73-248...........................LWFG.YGLAS.K..IVMTILIIYFPVTAACYDGLR.NTSMQWLELAKTMQVSA
Q9PPS8_UREPA/183-374....................LPFTFDINNFV.TYILP.G..LALSLGSIIVYVQYIKVEMNR.ELNSMHAKFAYLKGATV
PSTA_ECOLI/101-295...........................QMEH.FSGWA.G..VIALALLQVPIVIRTTENMLK.LVPYSLREAAYALGTPK
Q98QF6_MYCPU/174-365....................IPFIYDIKDFT.TYILP.A..IALAMPSVTAYIKYIRYELNN.ELNSMHAKFAYVKGVSR
MALC_STRR6/209-434..............FLPFLDGALIPWKTDPT.WTKIA.L..IMMQGWLGFPYIYVLTLGILQ.SIPNDLYEAAYIDGANA
LPLB_BACSU/104-314................MSLTGEQISFLSDAD.WFRPM.I..VMQSIWKETGWGTILFLAALA.TVDQEQYEAAIMDGAGR
YHDY_ECOLI/173-362.....................IDKLIR...........A..LVGVILFQSAYVAEVVRGGLQ.ALPKGQYEAAESLALGY
A0A023Z6E4_ECOLX/104-273...........................VAVG.LGPFA.G..VLALFIHTTGVLSKLLSEAVE.AIEPGPVEGIRATGANK
Q7ANQ9_RHIME/112-306..................WLPAGGWGDGSLR.FLILP.M..IALALPQLAVFARLTRGSMIE.ALNTDHIRTAKAYGLPS
Q97YP1_SULSO/131-332...............SGIQVLHLNDIVSILK.VYWLPWI..IQVFIFGFPVRGILMRNTMVD.VLDSDFVKYARLSGLKE
O28506_ARCFU/135-354NT...PETITGLYVLDSILTLNFNSLIDALA.HLALP.A..ITLGIVLSGAYTRLLRNNLID.VLSQDFIKAYRARGVRN
Q98K61_RHILO/75-251...........................MWFG.FDWQS.K..AAVVIIMTFFPMLVNTVAGLA.ASGHMERDLMRTYASGY
AMYC_THETU/83-269.........................EFGKFH.FLTRSGL..VFMYLGFGSSLGVFLYYGALK.GIPTSLDEAALIDGCSR
Q2FVE8_STAA8/117-308...................NILPTSGLTGPE.SYILP.V..IVITIAYAGIYFRNVRRSMVE.QLNEDYVLYLRASGVKS
Q9EWP8_STRCO/101-281...........................AGFP.GSDAALV..TAVALATAPFSTRVLRAAADT.VLHSGYVEAALARGDTR
Q9KKK5_VIBCH/118-310...................NWLPVAGFGHPK.FLILP.A..LALALGMAAMSSRMIRNATAQ.VLQSPYYAFARLKGLNH
YEJE_ECOLI/158-341...........................SVVQ.PNFWWLL..AITVLFGWMSLVGVVRAEFLR.TRNFDYIRAAQALGVSD
O86691_STRCO/402-574...........................AVAG.SGAATPA..LAVGAVAWAPLAAHTSSLLRQ.ERATLHITATKGLGAGP
Q98QS7_MYCPU/195-382...........................QILG.TDYLSIG..IILIVLGWTNPTYVARSYTSI.IKDEEFLYASKVVGASK
I3VV06_THESW/85-290.................THIGWLGGWLSTTN.TGFWG.L..VIVTSWQMIGYVMVIYIAYIE.SIPTDLIEASKIDGANS
O34157_SALTM/115-319.............AWDPGNNAGTALLSERLR.HLVLP.V..CALSLLGMGQIALHTREKIAS.VMKSEFIRFARAQGDKG
Q9PL65_CHLMU/67-242...........................LWFG.WGARA.V..IIPTALSIFFPLALTIHQGIK.NPPEELLEQFTLCQATT
Q9RX04_DEIRA/318-494...........................SWLG.FGSLP.A..VLVSALSALYPVLVSTLIGVR.EVDHAYHELFHSLRATP
SSUC_BACSU/94-269...........................LWFG.FDEVS.K..ILLIALGAFFPVYINTFNGIR.GVDAKLFEVARVLEFKW
Q9UYG7_PYRAB/121-325............YSQNLVPSFSITFIVDFLK.HWILP.F..LSLFIVMIGSWAIGMRNMIIY.ELEADYVRYLEALGASE

PF07242

A7GQL2_BACCN/621-721------------------------------------------VLFVALLGYLFISMFTTLNYLEQYKLKHTIKIIHGYSY
A5MAB6_STREE/576-675------------------------------------------ILTLSTA..ILLFDSMNLLYFEQFRRELMIKRLAGMTI
Q9L651_LACLL/549-647------------------------------------------SIALISS..TFLFYLMNKIYLYQNRKKFAVARISGESL
A5M6X5_STREE/166-265------------------------------------------IVGIASS..LLLFYSVNLLYFEQFRRDILIKRISGLRF
Q8CY97_STRR6/155-254------------------------------------------VLGIATS..ILLFNTMNRLYFEEFRRAIFIKRIAGLRF
A0A0E1X7Q6_STAAU/545-643------------------------------------------IINVFIL..LIATVFETIQYFSWNKKQLLLRKIHGYSL
Q926X5_LISIN/619-718------------------------------------------IILAISS..YSFMILLVLSYYRENLYKQLIYHVFGYSF
Q93MD9_CLOPE/619-718------------------------------------------VILLAVI..SIIILQNTSLYFNQNKNKIIVKKLHGYRL
Q9KG35_BACHD/612-712------------------------------------------VLTATIA..LFMIVQSSHLLFAQHKKRFLLRRLFGHSL
A0A0Z8MBH7_STRSU/561-660------------------------------------------ILGIFTS..ILLFNTMNLLYFETFKREIAIKRIAGMRF
Q9CJI4_LACLA/565-662------------------------------------------VILIFLS....MILTTTVFYFETYKKKIAVKRLYGISF
Q8Y3Q8_LISMO/620-718------------------------------------------ILALCLC...SFMVLLVLSYYRENLYKQLIYHVFGYSF
Q896P1_CLOTE/604-706------------------------------------------LLLLVSI..SIIIIQNIYTFFEQFKVYLAIKQLHGYKK
Q892J9_CLOTE/609-706------------------------------------------IML......VIIVTQSVLSFFEQYKKIISIRSFHGYKS
A8AXA7_STRGC/592-691------------------------------------------IFGMATS..ILLFNTMNFLYFEEFRKPIFLKKIAGMDF
Q9CE29_LACLA/560-659------------------------------------------IITIIVI..SFFYILLHVLYFTHFRRTIVIKFISGMPN
Q181M6_PEPD6/617-718------------------------------------------IIIIAIS.NLMITYNIVASYYERNKYKLYIKKIFGYST
A7GNK2_BACCN/616-716------------------------------------------IVTLILS.NLLLTYNVVATYYQKNKFKLYVQKLFGYSA

PF02687

A0A0S8DDF8_9BACT/110-205KHVMVMFMSRHVLLGVLGGVLG..-FV-A....................-------------------------------
A1SH34_NOCSJ/795-890RQLVKLAVSEAAVTSAIGLAAG..-GL-I....................-------------------------------
A1SKN4_NOCSJ/326-416RGARGLLAGELLPVALAGVVPG..-AV-L....................-------------------------------
A1TXE6_MARHV/209-306SQLSRLLLVENLLLALVCILPG..-..-.....................-------------------------------
A3I1M1_9BACT/315-407AQLFGQFVSESFILTLGAAVLS..-VL-A....................-------------------------------
A3I2Y5_9BACT/772-861NDLSKKLLKRYLIIWGIAAVIG..-..-.....................-------------------------------
A3QAU8_SHELP/338-429AQIFSQYMVEVGVIGLFGGLVG..-..-.....................-------------------------------
A4VW57_STRSY/1024-1117REVTMYIYRETIALSLIGMLVG..-LV-G....................-------------------------------
A4YKC0_BRASO/760-849LRLLGAYALEYLMIGFATAAFG..-VI-A....................-------------------------------
A5N346_CLOK5/499-593HQITKMIAAEAFTYSISGCIVG..-VV-V....................-------------------------------
A5USK7_ROSS1/337-433WQVLGLALGEVLLLGAAAWAAG..-LP-L....................-------------------------------
A6H1M7_FLAPJ/310-410WTVRKIFLYNAVHLITKGLLWGNT-IG-I....................-------------------------------
A6L8W9_PARD8/679-767RQILVKLVFTFLNYVLIAFVIA..-..-.....................-------------------------------
A6LCJ9_PARD8/311-395WRLRGFLWLESFLFALLSYAIS..-LL-L....................-------------------------------
A6LZM8_CLOB8/312-398KDIFKTFSSEFLINILVGIIGG..-..-.....................-------------------------------
A6TSQ0_ALKMQ/290-387RMTDTVLIGESLTYGLLGGVLGNF-VG-I....................-------------------------------
A7H957_ANADF/310-394RTIAAMIVQQALALGAIAFVVG..-..-.....................-------------------------------
A7HK62_FERNB/280-383AQMFWILFLEGLAYLILSEIVG..-AI-A....................-------------------------------
A8ABZ3_IGNH4/274-373KDMTLYLSGVWGSRVFLGTLLALL-FG-T....................-------------------------------
A8AR20_CITK8/257-351GFILRPFLYGGALLGFSGAFLS..-LI-L....................-------------------------------
A9KQT2_CLOPH/369-506AKVALGIWTEIFAITCVCLVIG..-LG-V....................-------------------------------
B2HGJ6_MYCMM/200-292WYTQLPFLMEAMLAATLGVVIA..-IG-G....................-------------------------------
B4EEB5_BURCJ/285-374GFLALIVFGESVVIAVAGGGLG..-..-.....................-------------------------------
B7VH43_VIBTL/299-399GQVMGIFMVQGASSGVIGALSG..-GI-L....................-------------------------------
B8I8J6_CLOCE/322-424RQCFSIIFLEVFFLSIIALSIA..-CG-I....................-------------------------------
D4K997_9FIRM/688-783KQLCKMNICEGLCYAFFATLAI..-LI-V....................-------------------------------
D4KYJ1_9FIRM/289-395KQMKQLIFREGIFLTFFSIPVG..-LL-F....................-------------------------------
D4KYJ2_9FIRM/288-378KQLNLCLQLQGLIFTVGTICVA..-LI-I....................-------------------------------
M1FFQ7_9ALTE/713-801RQVLAQLGRLALTLTLTITLLA..-LP-L....................-------------------------------
O28455_ARCFU/301-396NEIMLHYLQYPLLMGFFASTAG..-LV-A....................-------------------------------
O50782_BORBU/302-402LELFYSLFLEIVIISVVNIVVG..-VI-L....................-------------------------------
Y684_MYCPN/1015-1110AKFIAGMSVFAGIVALASSFFG..-VL-F....................-------------------------------
Q01VW7_SOLUE/1304-1396LHIVREVFLSGGRPVVRGLFLG..-..-.....................-------------------------------
Q025M3_SOLUE/377-471ARLVCQLLTESALLGVLACSAG..-IA-L....................-------------------------------
Q034M7_LACC3/430-519KDVRRILFWNAMKYGCYCFGGA..-..-.....................-------------------------------
Q0P8Y0_CAMJE/176-262WFRSFMLYKVVVVDCFIAFVIL..-..-.....................-------------------------------
Q0RJL1_FRAAA/665-753GMLRRVIVLESALPLLVLTVVS..-IA-T....................-------------------------------
Q18EP9_HALWD/325-419RSVGFVVALQVVTVCFIGGTVG..-AL-L....................-------------------------------
Q1G8P7_LACDA/306-403KDVLSAAIIYQLLIDILAIVPV..-LL-Y.................AGS-------------------------------
Q2FUZ2_STAA8/85-179KSMRLIVVMETILQFVIISVVS..-IA-G....................-------------------------------
Q2RPK1_RHORT/306-403STLIGLPVVQAALVGLMGAIAS..-LG-A....................-------------------------------
Q47EZ3_DECAR/269-372GDVIRMKTWEGLLISLTAFLLG..-FI-A.............AYVHVFH-------------------------------
Q481M7_COLP3/731-820NTCLQLNIIEWLITALIIAI....-..-.....................-------------------------------
Q4A9N5_MYCHJ/1828-1923FEIASSFLSIGFIIAFLGGSLG..-FL-S....................-------------------------------
Q4A9N5_MYCHJ/2549-2644KTKVRLFYSIYLPILLISSLIS..-IP-F....................-------------------------------
Q4DFN5_TRYCC/470-565THLVILLLTQSLAFIIPGLATG..-AA-F....................-------------------------------
Q4QBC9_LEIMA/1003-1097AQLMRCAVYESLCIVISAFTWG..-LV-V....................-------------------------------
Q54MT9_DICDI/571-666SFIIELIVSKTIIFTVPSIILG..-LI-I....................-------------------------------
Q5JEM5_THEKO/229-318SFIFTLFAGDYLIVALLGYAIG..-IV-P....................-------------------------------
Q5LCL1_BACFN/298-387RSLFALLSVEYLIVLLAGSLLG..-..-.....................-------------------------------
Q5LDA1_BACFN/308-392KAIFSMFIYETALIIGVSLVLM..-..-.....................-------------------------------
Q5LFF2_BACFN/320-426KQLLNQVLWENLLLTCIGGLMG..-LI-V....................-------------------------------
Q5V3A9_HALMA/900-995WRVLRTILADIARIAIPATGLA..-LG-L....................-------------------------------
Q6AA47_PROAC/625-722RILRRSFLMQMIVTILPAQTMS..-LV-V....................-------------------------------
Q6AMB4_DESPS/311-415HHVYASIIIEALIIGVIGSIIG..-TL-L....................-------------------------------
Q6F163_MESFL/1307-1400KEINWVVMGSYAIGALISFIAA..-YI-A....................-------------------------------
Q6F1V8_MESFL/1717-1810KETIINTILIPAVISTIFVLIG..-YL-V....................-------------------------------
Q6F1W1_MESFL/1327-1420AYVVKTVMGMYLIVISTMFAVG..-FA-A....................-------------------------------
Q6MGV4_BDEBA/685-778SAVFQVLFFQMGLQVLVSIFPG..-LL-L....................-------------------------------
Q6MSQ5_MYCMS/397-490RQMALNYVMMPFFTSIVGGILG..-YI-L....................-------------------------------
Q6MT15_MYCMS/588-682VELSWIFALKTWLTMFFGLIIG..-YI-L....................-------------------------------
Q6MUJ8_MYCMS/1693-1786TQVMFYTLGIATIFSLLISFIT..-TI-I....................-------------------------------
Q79Z83_STRAW/268-362GQIRRMVISEAFLVGVLASAAG..-CV-F....................-------------------------------
Q7UPA2_RHOBA/607-706RRVMKLALGETAVTAAFGTLIGIA-GG-V...................A-------------------------------
Q7V1V4_PROMP/299-384KTLFFVVAREGFLLALFGYLPA..-..-.....................-------------------------------
Q81HP3_BACCR/261-351ISIYCELYIQILFISLVAMLLV..-FL-V....................-------------------------------
Q81QE5_BACAN/286-379KDIQKLYIIKYIFISAGGCICG..-YI-L....................-------------------------------
Q830M8_ENTFA/609-698KAITKQIYRQNSLIFFPPMVIG..-IL-H....................-------------------------------
Q87SX2_VIBPA/317-410RHVFSLLISEASLLTAAGIVTG..-VL-G....................-------------------------------
Q899W1_CLOTE/276-369KMIWKQIFIELMLVSLCAIISA..-LI-V....................-------------------------------
Q8A9F6_BACTN/292-381IHLFVQLYIENLFLIAIALCLS..-..-.....................-------------------------------
Q8CYG6_STRR6/429-522KDIIAKFLLYGLVAGTVGTALG..-SI-L....................-------------------------------
Q8DQ76_STRR6/86-181RHLISMTFKELVVFGILTVGAG..-IG-I....................-------------------------------
Q8DQS2_STRR6/328-451ASILGQFITESILIAIPALVSAYF-LA-NYTARAIGNTVLANVTSGVAK-------------------------------
Q8EUA2_MYCPE/1386-1480KKNAASFLSVYLPVFFFGLLIS..-VP-I....................-------------------------------
Q8EZY9_LEPIN/286-379NAVSWIVLGELFLFSLIGSVFG..-IL-F....................-------------------------------
Q8G7P9_BIFLO/348-438GRLGWQFMLEVFIVTLPFYVIG..-LV-G....................-------------------------------
Q8KD33_CHLTE/294-389EAVGLHVLGFALAPTVAGVLLG..-TG-L....................-------------------------------
Q8NS27_CORGL/639-739GTIYKVNALNAALLALVGGIMG..-LV-S....................-------------------------------
Q8Y6E1_LISMO/85-180SQIVLVLFFENAMLYMLATIFG..-VL-I....................-------------------------------
Q97DB8_CLOAB/742-835HQTRKMLFIEALSIGLIGSIGG..-IV-G....................-------------------------------
Q97LN0_CLOAB/763-854RDFKKMMNFECVFYGMKALLLG..-LP-L....................-------------------------------
Q9A6K3_CAUCR/378-465GDLRNIVMELSFWVGIVGVFAA..-..-.....................-------------------------------
Q9FBP3_STRCO/683-772RTLSLSVLWQTAIPIVLGLLLA..-SV-V....................-------------------------------
Q9KF85_BACHD/565-650RHIRWLYLMENSSLIFLSAAIA..-SL-I....................-------------------------------
Q9PPU7_UREPA/189-284WQVWFSFAPFYTIPSLIVLIIG..-YS-I....................-------------------------------
Q9WZG5_THEMA/751-844NQLVASFLIEHLFFLFGGILIG..-TV-S....................-------------------------------
R5K905_9CLOT/831-926KEINKMLINEQMFSSVLASLAG..-YG-V....................-------------------------------
R5KJ88_9CLOT/371-467KNLMAHYVTLPTVITFVSGLIG..-TL-L....................-------------------------------
R5TSZ9_9FIRM/299-417KCTFGVLTSELWMIFAVAYPVG..-CV-L....................-------------------------------
R5UPZ8_9BACE/319-410FHLAMMLFVQLFLVIVIASLFM..-FG-L....................-------------------------------
R6WL88_9PORP/179-267KDILRIFLKDVLRIALPAILLG..-CG-I....................-------------------------------
R6WLH2_9PORP/307-392KNLVIQLLLELTLLVGISFLLA..-..-.....................-------------------------------
R6WYF0_9PORP/312-402AEMNYQLFLDTFLTVGIAFLLS..-..-.....................-------------------------------
R6X6U4_9PORP/300-397KGLFRLLFSEIAVLFILSALAS..-LV-L....................-------------------------------
R7EAJ1_9BACE/317-408GRIRWQLLGEGLLLLALASIPA..-..-.....................-------------------------------

PF03739

Q3ATU7_CHLCH/6-355RQLLTPFAWGALLLFLFNFFNAGW.LA-PTTYSHNRTFEQLYLGKNAGD..........QETRNLHLLDSGN........
Q118T4_TRIEI/24-389YRMIIPTIILSLTVTTLSFALNEI.IV-PSANYQASLILEKTLEQENPP..........FKEENIFYPEFGKVKQPDGSQ
A0LEN9_SYNFM/39-391HQFFPAVVSLLLGVTLISFVNMIF.VI-PPTGKAFEVKLRSMARSGLPV..........LMKEGTFITAIPK........
A7HYF9_PARL1/7-370WVVALPLLAIAMGTSVIILAFSIY.IA-PAGMRELKSRLVEIRSDVATA..........MIREGTFSNPATG........
Q8DIL4_THEEB/18-374GRVLIPVVVFALLVSGLTLALNET.AV-PIAKYESKKLMGELLQQERSL..........GSGTDIFYPEYDRHG......
Q82W93_NITEU/6-348NRIIRTVFVIALPIAILSGILSVY.AR-PWAYAESYIMDAQAEAELNTN..........RFQPGRFYGSEKS........
A0LB31_MAGMM/6-364VRILIPFLLGGVMVAGVQMLLLDQ.IV-PRTNAAAERSIFRMNLPEQAALYESMVSLEGVRKDNLWIRDGG.........
Q6MKD0_BDEBA/11-364GTLLLPALILATLVGVISAQMSFN.IA-PWGNRQFEVLYSRLANTKAAA..........IIKEGTFAEGFFD........
Q6FFD6_ACIAD/9-354WRIVGWVIRSALVLVLLSFALSEW.VV-PYTNERANSVKSHQSVAALGE............VRGYWSREGQ.........
Q0C1U6_HYPNA/7-346FGQMRTLIPVVFLTAVAAAFIIDT.VG-PPASRSLLAWLGPEALQEDAQ...........VPEELWLSDGK.........
Q11U59_CYTH3/9-455IRVMVPIAIWVLGCTVGLYFFNNY.VV-PKANLKAFSLLYDLRQKKPSL..........DLKPGVFYNGIPG........
A1AWC7_RUTMC/20-369KHFMVFIQPLVIVIVIFIFILTTV.VV-PWSKQQRGLIMERSENTPEFS..........FIKKNEFQEFKNN........
Q73NV9_TREDE/13-373SFILIPVFALGVFVSVGSFITNDI.LI-PRGTIKFNEVLYNIASSTPAL..........ELESYSVKRNE..........
Q1GR36_SPHAL/14-363HQVLAPLFLAALLVAGISFAFNER.IV-TRSTAALGAWQKVEYKRVPVD.........SGVRSNIWVRDGD.........
A5EXI6_DICNV/8-348KHLMQPILYLVLPLAVILVINTLY.LL-PHVFERWDQLMAQSRQEALYS..........FFTPNQFQHLNAH........
Q7VQS8_BLOFL/9-358LQINLSVIKTSIFIVLLYVIYNIW.LL-PYSQYLLCSHQHYKQYNVYLF.........PEKNKNLWLMDSGN........
Q310A0_DESAG/6-352LRLARFFIIYALIWSAVQLGFSQV.LG-IYGEREASRIWKEQVRNREID.........EVQLTNLWFTEHG.........
Q5SL96_THET8/6-344ERLLLPFLLLGTAIALAAFLLGEG.LV-PQALAKGQDLLRREVLERPRA..........LLTPGATFQDAQG........
Q6MJL5_BDEBA/6-356IRIAVPMLLLVAVISALGYMAADR.VL-PRATKQKNYILYYDLKKEPHRF.......STIRTDRIWYRSKN.........
A5WBH3_PSYWF/27-466GRLARLIIPLILVLFVLEAGLSLY.GK-PWGVKNSESIWQQQSLSSAFD..........LIRPQTFINSDD.........
E0TCF8_PARBH/6-360WRLIFPPVILAVAAGLLIATTLDP.LA-ARLAETAQTVKNEARSGEEAA..........AKRPHLWLRQNEIGS......
Q984S3_RHILO/7-356WQFLLPCCIGALLFGFVSVGLINP.LA-AHAFSLSEQIETQLRSGKSNT.........VSADAAPWIRQKTST.......
Q2S3I0_SALRD/55-410YQLMRPYLGVGLLVTVFMFGFNGW.VV-PKTNEVVVRYENEYLPGNQKS..........VQTSEIHRRNGPN........
Q1IRI3_KORVE/435-789YRVAFPVIAIAGVVAASLFVFDQL.YI-PKANKRQETLRNEIKGKPPQT.........YLRPDRKWIFGSNN........
A1WAC0_ACISJ/11-359ARIAAPYFILALFVCVFNLYLFGR.LQ-PLARYDYHVKMDAVLQTNWDA..........KIEENRFIDIAHG........
Q8D296_WIGBR/5-350ECFIKVILFLNLLVMSFSFVNVMW.IS-PLALNYKHKIISYNLSNIDKL..........KLNEKQFKFIKDK........
Q6MDI9_PARUW/8-358KTLMRPFLMIALAFVCLLYLNEQF.VL-PSTLKKLRHLENATKHQKKRQL.......PEITVKHVVLEDRS.........
Q9A939_CAUCR/5-350YRIVGMAVPAAVAVMLLDALCGQV.LA-PRADPTLADWWRNTTPVAERK..........EPVPRTFRAGAD.........
Q1D894_MYXXD/7-356SALYLPILVASFVACVGLVAFDER.VA-TYSGRRVDEITTQRFNKWGDWR........FYYTPKQWFRRGD.........
Q1QKW5_NITHX/6-356FRLFRPFIYATVVVALLVAFIAAY.LA-PDGMRRLKRWDAEITADVLAN..........VLQPGRFAQLDPN........
Q143Z1_BURXL/6-377NQSLRSLLKIGIPLVLLTYLIGEV.VG-PYTDQLSERVRLEALGSSVSS..........NFESGVWVKDTLTARAD....
B5EBA8_GEOBB/11-361YGLLPPPMLFAACATLACLWVTVY.AV-PWGNSGFKKLMVEIAQSSAGI..........AIKEKIFNNAFPG........
A3I2C6_9BACT/6-354PRMLRPFIFAAMLIGGVSFLLNGW.VL-PVATEGVTKFKLTYIDKTRTA...........SDPNVHIKVGTD........
Q2RQ55_RHORT/8-372WQLARPALALCAVLTGVGYWLTLS.VV-PAMEGAFEAIKYEVRGEVSSL..........VIKEGQFNQMKDG........
A1WUU9_HALHL/6-348VQIAGAVLVGGVILALLATAVGEL.VV-PPAERQAAAVRGLSEADELRT..........GPDGALWARDGR.........
A5G1T7_ACICJ/24-378AAIARPALALAMLTMLACWGLNVW.LV-PSTLARFTHFESIIRNQVAAF..........LLEPGVFTPIPGH........
Q3B4Y3_CHLL7/6-432YRLMLPVVIVGFLLSLLVERFNNV.VQ-PQVKYKARSLMSDIAKAKPTF..........GITENAFSPLVDG........
Q0BZX3_HYPNA/9-369WRFLTPVIVLGVALGIFSSLALNP.LA-ARLSQSFEAERARLLDVGREVV........QVAETGVWLRQGDDS.......
A2U291_9FLAO/6-450QRLVRPIGILAIALSGLNFLFLNN.VF-PYANLKQRNLYLNIKKKKPAL..........ALVPGSFNADIPG........
A0LB30_MAGMM/6-357LRIFYPLSVPIVVVTACSLYLNWF.LV-PDSHTLFQNIRVALLSQNTFS...........IKTQTFNNTIPG........
E0TCF9_PARBH/51-404LRLARPVLVLSILAALVSLYINAD.LQ-PKTYRQLRQTVEDVRSDIAQS..........LIREGVFVQPTAQ........
A5EXI7_DICNV/7-348LRLSLSGLMIAFFLGCALIVLAEYGVA-P.AQNRAQWLHHHALNTTAPQ...........TDHGIWLRDGD.........
B8CYZ1_HALOH/12-360YRLILPLLILGIVISGMTYLLNEE.IV-PWTKHRAQNIIRKSVLKEVPP..........DIKENVFFKGPDG........
Q1MPZ1_LAWIP/7-360YQMLPAPLAFSFFCTLLTLWISLF.WI-AWGMEQFKTTLLDIARTKVKI..........SIQPGVFNNNFPG........
A8ZZ83_DESOH/6-356ASLFKPAAVVGVGCCVLLLIVSEI.VV-PRTISRANYIWLQQVRQKTSS.........VDQKNNIWLKDDR.........
A8EWU1_ARCB4/5-331FKILKIFLPLTLLLTLLLLVVSVG.LI-PKSDFERKQFVNIKKNEANFN..........IKSGEFGQKFGD.........
Q31ET4_THICR/6-346SFFQKRVFWFLVPLAFLTAWVSLV.VT-PWSYEQERKLIMEAQTTSPLA..........ALVPGKFNPLPNG........
Q1IZ54_DEIGD/6-380GQVARPVAVVAALVTALAVWLSLW.VA-PRANVETRGLYWDVLTGAGLS..........QVVGKTVDLGDN.........
Q1J2D3_DEIGD/10-350LRLVWPLAVPFVLVGVLAFVNTGY.VV-PGGLARWDRAWYTIYGTVPPA..........PSQDNYTFAPPG.........
Q2S0T8_SALRD/7-449GQIVWPALVVAALLMGGMLYFNNV.ML-PEANHRARQLWSDIRGKRPGF..........ELRPGIFYEDMED........
Q6MDI8_PARUW/7-377KDLLAPILLTAAFLTIFNFWIVSE.VA-TQTHLQTNILKSELRSINPLL..........LLNNKHLMRL...........
B8CYX9_HALOH/6-362YKIVIPSLLVGLIMSVTTIMVNEM.VV-PRANYLYDQIVWEIKNGRKMP..........ATQYDLTLTPLDRKYR.....
Q1IRI3_KORVE/8-376LFFVRIVSIFSVALWILALVNNLY.VA-PRSAAALAHLQDKLKSSQASF..........EVQPRVFYEDFKN........
O83854_TREPA/1-358RFLIFPLLSIGLCSALFVFVFSDV.VV-PASFIRLRQVYWRVLSSVPSL..........GFESHTTRKHNG.........
Q8D297_WIGBR/7-348IKICILIIKTIIIFLFIYSIILEW.II-PIEKKIKSKYFFNFISENKKN...............LWIKINN.........
Q9AA49_CAUCR/9-364TRFTAPFVAMGVLLMVLSVILFGF.VQ-PYSRYAYHAVLHAAENAGWNG..........DVRPKALLSAGSD........
Q3J9X2_NITOC/9-352GHLLRVVLTFGLALAIGVGGISLY.LG-PAASAEGYRLKQQALLAAETS..........GLVAGNFKEAQHG........
A7IJ85_XANP2/6-384WRLLRPLIILALLVSAFCALLAIK.VV-PASLATFREQVTKVRADVVSF..........VAQPGRFVNLSQG........
Q0C1U7_HYPNA/7-360YRIVLPFVQFSLVLAAASLLISGF.LQ-PLSRYSYREIVYNLQHQSVLS..........VFQEQKFVQYDN.........
Q0BVK4_GRABC/5-352RRIILSVIAFSIPLMVILFLMAQF.VI-PPAQREAQTWRSNALPDTTAL..........RSQDSFWAYGDR.........
Q5FU64_GLUOX/35-392WQFLASPLACALLTGLLTTTGISA.LS-STMFRSAEMLDQTYLRTGGGPL........TLNGGALWLRQSDDGLV.....
Q5FPA9_GLUOX/26-376PALYRLLLPAVLIAGIGGTCAQYW.LV-PACENALTTWWNRTDPLAGQDG........QPEDNILWFRAGP.........
Q1D895_MYXXD/6-362VRLLAAPMGIAVALSVLMLVITST.AQ-PWGLTGLKVLVSEVIRKNAVG..........DVKSGVFYEDLSN........
A1AXG9_RUTMC/6-356MQISNIVVRAALMFIAIVIFIGEL.VT-PITIEYAESLRAKALGENITF..........KNQQGFWLKDSE.........
A6QBC8_SULNB/6-335KKVLRSILLLGILFSVLLSTLSFL.GI-PISKQLYNAFKEKKKTEATLN..........IIPGKLGQKFGD.........
A6QBZ1_SULNB/12-355KRLFSPVFVIASLTYAVFIYLHTT.EF-SYAKDKANMLLKNQVHAYNVN..............DMFFKYND.........
Q7VQS9_BLOFL/5-358YVLIQSICMYSTVIAILSLINLAY.LA-PHCEQYKENIFFKMKKNTYFI.........ELIEKKFYLLFDEH........
Q73NV8_TREDE/6-354GRFTLPLLVLGFFFSVGMIFFEDN.VV-IKYFYEKTQLSKKLLQEEESL..........DTQDLVILSELGK........
B4E8H0_BURCJ/7-345TRLIKPIGVFAAPIILLITFFAFV.GW-PWSNQQSKMIKARFQQRDEIS..........LLAPGQFRESAAN........
J9ZCA2_LEPFM/6-351SRLLWPLVLFAFLGYVGSFYMSLK.AE-ETQGMSLQEMISTVLKKKMSL..........GIRPQVFNNFMDR........
J9ZCM7_LEPFM/6-356VKATKPFLALGVLISLISIAMNYQ.LV-PYAYQMTDYIKDVRIDQGKSGN.......VTFELNNVWFRHGNQ........
O26028_HELPY/5-350CQILSPIFLISLFFTAIYVGLNAT.PF-VYMEEKTQNLIYK....DNSL..........SVSEHLLVKYND.........
O51747_BORBU/11-425FDLLVPFFKLGIVIAFVSFISNDI.LL-PLGSIGRLKIFNEIKEEVPHL..........VLKPYSSKQYGD.........
O51748_BORBU/7-350TRILKPIILISIFISVVLFFFDNY.LV-IDTIARRDVLIKNSIGDSRSG............DKTIIIRDFAR........
O84846_CHLTR/8-346GMIIFPVLIASGVLCCFNFYTCSE.LA-SICRFQTGKEIANIAMTSPAL..........LLQTLQ.KKENDR........
LPTG_HAEIN/7-355FKIGIAVMKTALPLVVFTMIIGEW.GI-PQTEQFARDTRAKALSGGSIL..........SIKNGVWAKDGH.........
Q2JLS4_SYNJB/13-367SRIFRPLLLVGLAMSLSAFFISNV.LL-PASKQQIRQIDQQALLAQATT..........PVQYDVFFKTEDN........
Q2YN46_BRUA2/7-357SAVMRPILILAATVSVTSFLIANY.VE-PYARINMRAMIANASADLMHV..........IIQEGTFRKLADN........
Q5NFB9_FRATT/8-349AQIAKGVILVGLIGSVTTMVFGGY.IA-P........ILQRQVDTNMVT..........YNTHDLWFKTPD.........
Q5NFC0_FRATT/6-350MQIVKNTLKPVVALTIITLITVMY.LN-PLSKQTLDIYRASLSAKALLS..........SITDQKIIKAPDG........
Q5SL95_THET8/4-334LALLRPLVLLALAVSLLNLLNLAE.LR-PRSQEAYDGLLGRILYGEGGAS........GVLRRQVYAPPGL.........
Q7CKF4_YERPE/5-345KSLIMAALILALFTSGLAAINTIW.LG-PWSSKHQDVVLNDAKANPSLA..........ALGGGQFKSSNDG........
Q8F742_LEPIN/134-585PRIYINFLAFGFVMALLVGYLNFY.LS-PENTRKMNEFNKWILAYNPLL..........AITPGQFSGDKTQDLF.....
Q8F8T0_LEPIN/30-383FRIVTPLILFGILMWIIMLLATEL.IV-RPVN.KLAKIEHDTLTEGMGTL........ANSVYQFHVKGKE.........
Q8PCR2_XANCP/10-365KRMSASVVVAMALLTATMVISGET.VG-PWAQSQADTLKTSARYQSDMT.........SARYSGLWAREGD.........
Q8PCR3_XANCP/6-349RRMLRPILWLVVPVVVVIGACSLW.LG-PWASRTAELMLEDANRSVVMA..........GLESGKFTPLSGG........
Q8RER6_FUSNN/12-360LRIVRAPLIIAFVISLFVFFVNNS.IY-TKSLAKINFYRRGEIDETLKLP........TTKENAFFINNTEG........
Q9X257_THEMA/19-363KNLIVPFLILGALLSIAVFFLSDQ.IV-PEYQSKAEEAMSKYVLKKPEV..........FVVENVISKIGDD........
Q9ZCH3_RICPR/10-357WQVLIIPCIVTLILGIICTTILNP.IS-TIGLQKYSLLEAKLTKKALSEC.......LISESGLLFFESLNEH.......
R6X2Y4_9PORP/1-468VHIMRPLIITISIISIGAFFFQNY.AM-PVVQVKLYTLLWSMRQKSPEL..........DIPEGVFYSEITG........

PF00528

GLNP_ECOLI/33-218WETIRYVILPLALRRMLPPLGNQWIIS.IKDTSLFIVIG..........-------------------------------
YQGH_BACSU/107-309WQTIRKVLVPAAFPTLMTAVVLGMARA.FGEALAVQMVI..........-------------------------------
YQGI_BACSU/80-293WHTVKTVLIPSAIPSIITGAILASGRV.FGEAAALLFTA...G......-------------------------------
NIKB_ECOLI/116-308KQTERRHILRNASLPMITAVGMHIGEL.IGGTMIIENIFAWPG......-------------------------------
Q97UG4_SULSO/116-318NR.IRKMVYKNSLLPNITAFAIILGLA.ISQSLTVEGLLTTPG......-------------------------------
YCKA_BACSU/41-224WQTMRGIILPQSIRIALPPLANVLLDL.IKASSLAAMIT..........-------------------------------
Q97VK6_SULSO/120-341RRVVYGVVLRNASIPLVTLIALLFGYS.VAGAVVIEDIFQYHG......-------------------------------
Q9FAT0_VIBPH/116-319KRLICQYLIKGSLVPTVTLHFAAFAEL.LGNAVLIESVFNYPG......-------------------------------
Q44374_RHIRD/87-266QWIIRHEILPNAITPLLAELALRFIFS.VLFLSTLSFLG..........-------------------------------
Q9KB56_BACHD/117-308KK.VTIHILRNSLQVAISIFCMGIPTI.LGGTVVVENVFAWPG......-------------------------------
OPUBD_BACSU/40-211FQVLRMVELPLALSVIMAGLRTALVIA.IGITAIGTFVGAGG.......-------------------------------
Q9LAT6_LISMN/112-304TEVAVKHAIRNALIPLITVLGPLSVAL.MTGSLVIENIYSIPG......-------------------------------
LACF_RHIRD/87-298WGRFAFLTIPMLKPVILFTTITSTIGT.LQLFDEVYNFTEGTGG....P-------------------------------
Y355_HAEIN/68-243LRLLLKVRLPAALPAFASGLRIAVSVA.PIGAVVGEWVGSSEG......-------------------------------
Q982M9_RHILO/75-250AEIFWSLRLPRALPMLFSSLRIASATA.VIGAIVGEWIGSDKG......-------------------------------
GLNP_RICPR/33-217FLIMKDIILPQAINNIFPSLVNELVNL.IKESAIISMLG..........-------------------------------
AMIC_STRR6/298-492KEISNKHIFKNAMVPLVSGIPAAIIGV.IGGATLTETVFAFPG......-------------------------------
TCYB_BACSU/46-230QKTLFRVILPQAFRVSIPPLSNTFISL.IKDTSLASQIL..........-------------------------------
AMID_STRR6/125-308LKIVAKNIMPQLVSVIVTTMTQMLPSF.ISYEAFLSFFG..........-------------------------------
NRTB_SYNE7/98-276KDYILNILIPSTVPYVFAGLRIAVGLA.WLAIVAAEMLKADGG......-------------------------------
Q9HIL1_THEAC/131-337YQ.IKSIAYKNALLPNLTGFAMSIGLS.VSGVIIEESIFSYPG......-------------------------------
Q9X0U9_THEMA/119-323RL.IRKYAYRNAILPQITGLAIQLGTV.VAGALTTEIVFSYPG......-------------------------------
UGPA_ECOLI/90-294IRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSGGP......-------------------------------
SAPB_HAEIN/93-316WKILHQYVFRNTFPLLVPQVPRVFTLV.LTQCMLVETALGWPG......-------------------------------
MSMG_STRMU/87-273LTTYRKIIFPMLKPMHATTLIINALWF.WNDFMLPLLILNK........-------------------------------
G8PA36_LACLC/106-293FKIMFREIWPNLSTLVIAEATLVFAGN.IGLETGLSFLG..........-------------------------------
HISQ_SALTY/27-221GQTFRRIMFPAMMRYALPGIGNNWQVI.LKATALVSLLG..........-------------------------------
NIKC_ECOLI/89-273VRVFVDHLAGAVIPSLLVLATLDIGHM.MLHVAGMSFLG..........-------------------------------
Q9WYD8_THEMA/94-282FEVVFGDFVPYLIPVISGGFIGSMMGA.IGFEIVLAILG..........-------------------------------
POTH_ECOLI/117-315LKTFFTVIVPLTKGGIIAGSMLVFIPA.VGEFVIPELLGGP........-------------------------------
LPLC_BACSU/93-290IGVFWRIALPLSKPVIATFALFYAVGI.WNDFFHALLYINDSAK...WP-------------------------------
CYST_ECOLI/74-276WQSFCKVVLPELSPALVAGVALSFTRS.LGEFGAVIFIAGNIAWK.TEV-------------------------------
Q9ZBG1_STRCO/128-331GTVLVGHALRSGLLPVLTLIGSRVPEL.ITGALLVETVFSWPG......-------------------------------
Q97UH1_SULSO/128-336KM.VASKAYRLALLPNFTSFSISLGYS.VLGAVAIEYLFNYAG......-------------------------------
Q97VF6_SULSO/101-289KYIIFREVVPTLGSYIAIHYIFNVEAA.VYAEVGLYYLG..........-------------------------------
LACG_RHIRD/89-270WQIFFYIYVPVMRSTYAAAFVIVFMLN.WNNYLWPLIVLQSNDT...KT-------------------------------
Q9HLG4_THEAC/81-265AKLFFSYLFINSIDPVVAYAALDFGNV.ILTYSTLAFLG..........-------------------------------
MALD_STRR6/87-275FRRFWQIVLPLVRPMVAVQALWAFMGP.FGDYILSSFLLREK.......-------------------------------
GLTJ_ECOLI/43-239PQAYRYVLLPNAYRVIVPPMTSEMMNL.VKNSAIASTIG..........-------------------------------
YEHW_ECOLI/68-240GQRVRKVELPLAAPVILAGVRTSVIIN.IGTATIASTVGAST.......-------------------------------
Q9FAT1_VIBPH/84-268IHVILQHAFPHLLPQWMTGMLLLLPHG.LLHSAALSFLG..........-------------------------------
Q9A534_CAUCR/67-247LQRLVRLRLPSAVPALLEGHKVAAGLA.VIGAVVAEFVAGSGGA...QG-------------------------------
YEJB_ECOLI/151-361KNILWKHVFRNAMLLVIAGFPATFISMFFTGSLLIEVMFSLNG......-------------------------------
YOR2_CALSR/83-265FRLYSDILLPLSAPALITVGIYNGTYL.WNEFVFALVLTSSP.......-------------------------------
O66777_AQUAE/114-319FT.LVRHVLKNAMNPFTTLLGYEIASL.ISGAALIEIIVGWPG......-------------------------------
YEHY_ECOLI/195-381AQRFLHVQLPLALPVFLRSLRVVMVQT.VGMAVIAALIGAGG.......-------------------------------
Q9WXN6_THEMA/92-279LRLVIEDLIPTIATYAFMSFVLFINGG.IMGEAGLSLIG..........-------------------------------
Q9Y9N0_AERPE/121-339SRIAV.HMLRISLIPTITMMGLQFAIL.LGGAVLTEATFSWPG......-------------------------------
Q9WY46_THEMA/67-238RMILKEVYLGSIWPFVLSILEVSSGNV.WKAVVMGEYLCGDSG......-------------------------------
Q9Z6P7_CHLPN/68-243FQLLIKLRIPHALPHIFSGLKIAIGSA.GFAAIAGEWVASQSG......-------------------------------
Q98K60_RHILO/105-289SQTFWKLRVPASVPFLFTSMKVAVAAS.LVGAIVGELPTGAVA.....G-------------------------------
UGPE_ECOLI/91-278MRFFCDIVFPLSKTNLAALFVITFIYG.WNQYLWPLLIITDVD......-------------------------------
OPPB_LACLA/113-318KVIFRRHILRNASLPIASNFGFVITGL.LGGAIFAETIFGYPG......-------------------------------
Q49553_MYCHO/234-419PRRIFVHALPTIIGKIANNIVRSVPGV.ILWIASLAFLG..........-------------------------------
FBPB_SERMA/341-526AQALWSTTLRLAAPGVAAGAALVFLAI.ANELTATLLLAP.........-------------------------------
Q987J0_RHILO/100-280AYLIGSEILPNIIRPVLADFGLRFVFI.VLLLSGLSFLG..........-------------------------------
Q9CLG9_PASMU/73-248SAMLFKVRLPAALPSFASGLRIAVSVA.PIGAIVGEWVGSSQG......-------------------------------
Q9PPS8_UREPA/183-374NRFVWLHALKPSLFPIATFFPFVILGS.FVGALFIEQIFQIPG......-------------------------------
PSTA_ECOLI/101-295WKMISAITLKASVSGIMTGILLAIARI.AGETAPLLFTA..........-------------------------------
Q98QF6_MYCPU/174-365NGFVWKHALKASLFPIATFFPAVVLGS.FIGSLFVEKIFLITG......-------------------------------
MALC_STRR6/209-434WQKFRNITFPMILAVAAPTLISQYTFN.FNNFSIMYLFNGGGPGSVGGG-------------------------------
LPLB_BACSU/104-314FRRMWHITLPAIRSTIIVLLILRIGSF.LNLGFEQVYLMTNS.......-------------------------------
YHDY_ECOLI/173-362WKTQGLVILPQALKLVIPGLVNTIIAL.FKDTSLVIIIG..........-------------------------------
A0A023Z6E4_ECOLX/104-273LEEILYGVLPQVMPLLISYSLYRFESN.VRSATVVGMVGAGG.......-------------------------------
Q7ANQ9_RHIME/112-306RAVVVTHAMRGAMLPVVSYLAPCAAAL.LTGSAVVETIFTIPG......-------------------------------
Q97YP1_SULSO/131-332ST.VRAIARRNSIIPVITRTGIDLAFI.LGGIYFIEYIFGIPG......-------------------------------
O28506_ARCFU/135-354RKVVF.HAMKNAFIPVVTLMGLQFAIL.LAGAVLTESTFSWPG......-------------------------------
Q98K61_RHILO/75-251WPTLIKLRLPAAAPFIFNALKINSTLA.LIGAIVAEFFGTPVV.....G-------------------------------
AMYC_THETU/83-269FRIYWNIILPLLNPTTITLAVLDIMWI.WNDYLLPSLVINK........-------------------------------
Q2FVE8_STAA8/117-308IT.LMLHVLRNALQVAVSIFCMSIPMI.MGGLVVIEYIFAWPG......-------------------------------
Q9EWP8_STRCO/101-281RAVLRHDVLPNIAGPALMDTALRLVAS.LHLTATAGFLG..........-------------------------------
Q9KKK5_VIBCH/118-310EQAFTRHAQRNIALPVMAFVGIQAVSL.VEGIVMIESLFSWPG......-------------------------------
YEJE_ECOLI/158-341RSIILRHMLPNAMVATLTFLPFILCSS.ITTLTSLDFLG..........-------------------------------
O86691_STRCO/402-574VHLLRHELLPAVVPPVLRHALLRLPGV.ALALASLGFLG..........-------------------------------
Q98QS7_MYCPU/195-382LRIIYLEALPQIIGKLTNVYLNRIIGG.IFALSSLAFLQLI........-------------------------------
I3VV06_THESW/85-290WQQFRNVVFPLIAPAFTVSLFITLSNS.FKLFDQNLSLTAGAP......-------------------------------
O34157_SALTM/115-319WSLLRHQVLRHAITPALCLQFASLGEL.MGGALLAEKVFAYPG......-------------------------------
Q9PL65_CHLMU/67-242WQTLIKLRIPHGLPHIFSGLKIAMSAA.GFATIAGEWVAAQSG......-------------------------------
Q9RX04_DEIRA/318-494WQRLTRLELPGALPVMLGGLRLAASLA.LIGAVVWEFTDPNQK.....G-------------------------------
SSUC_BACSU/94-269HQQISKVILPAALPNILLGIRLSLGIA.WLGLVVAELMGSSSG......-------------------------------
Q9UYG7_PYRAB/121-325KL.LTKHAYRNAILPQVTGLALQLGLM.VAGAIATEIVFNYPG......-------------------------------

PF07242

A7GQL2_BACCN/621-721FKRHKLYLMFTNFVWFVSMLIL----------------------------------------------------------
A5MAB6_STREE/576-675YELHGKYLLAQGGVLLLGLVLS----------------------------------------------------------
Q9L651_LACLL/549-647FTTHKTYLIQLFIIIIFAIGMI----------------------------------------------------------
A5M6X5_STREE/166-265FETHAQYMVSQFASFVFGASLF----------------------------------------------------------
Q8CY97_STRR6/155-254LEIHRTYLFAQLGVFLLGFVAS----------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643FSSNVRYLTISILLSIMLAYTT----------------------------------------------------------
Q926X5_LISIN/619-718WKSSKWFIISNLAVCAFSGVVT----------------------------------------------------------
Q93MD9_CLOPE/619-718IYRYMNYFIMVLITWTCPLAIA----------------------------------------------------------
Q9KG35_BACHD/612-712FRAYRNVLFWTLATWVVILGIA----------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660IELHGSYLGEQVGSALVGMGLA----------------------------------------------------------
Q9CJI4_LACLA/565-662FVTYKTLFAIVLVQGSLYFAFA----------------------------------------------------------
Q8Y3Q8_LISMO/620-718WKSSKWFIISNLFVSVFSGILI----------------------------------------------------------
Q896P1_CLOTE/604-706LSNYKEYFYLILISWIIVATSV----------------------------------------------------------
Q892J9_CLOTE/609-706FDKYKEYLWIIIISWVAIVITS----------------------------------------------------------
A8AXA7_STRGC/592-691LKIHQSMLISEIAMLLLGSVLI----------------------------------------------------------
Q9CE29_LACLA/560-659LRIHRRFIFVELGLLLILLPTL----------------------------------------------------------
Q181M6_PEPD6/617-718TARSMLLIVSLILTNIIPIGII----------------------------------------------------------
A7GNK2_BACCN/616-716FARNTSLILLLFAINFIPTISM----------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205-----.GVLAG--GY-------------------------------------------------.....-----------
A1SH34_NOCSJ/795-890-----.GWAMS--RM-------------------------------------------------.....-----------
A1SKN4_NOCSJ/326-416-----.ALLGV--WA-------------------------------------------------.....-----------
A1TXE6_MARHV/209-306-----.VWLGR--AL-------------------------------------------------.....-----------
A3I1M1_9BACT/315-407-----.LYLFA--PK-------------------------------------------------.....-----------
A3I2Y5_9BACT/772-861-----.STFSL--IL-------------------------------------------------.....-----------
A3QAU8_SHELP/338-429-----.LLWAW--GA-------------------------------------------------.....-----------
A4VW57_STRSY/1024-1117-----.GIYLH--KL-------------------------------------------------.....-----------
A4YKC0_BRASO/760-849-----.GSVSA--WL-------------------------------------------------.....-----------
A5N346_CLOK5/499-593-----.GLFIS--KF-------------------------------------------------.....-----------
A5USK7_ROSS1/337-433-----.GLLLA--HV-------------------------------------------------ISW..-----------
A6H1M7_FLAPJ/310-410-----.GLLLI--QK-------------------------------------------------HTG..-----------
A6L8W9_PARD8/679-767-----.IPIIM--YF-------------------------------------------------.....-----------
A6LCJ9_PARD8/311-395-----.LLVYE--GC-------------------------------------------------.....-----------
A6LZM8_CLOB8/312-398-----.SLFYL--EN-------------------------------------------------.....-----------
A6TSQ0_ALKMQ/290-387-----.GILYL--IT-------------------------------------------------.....-----------
A7H957_ANADF/310-394-----......--KL-------------------------------------------------.....-----------
A7HK62_FERNB/280-383-----.GVGFG--RY-------------------------------------------------.....-----------
A8ABZ3_IGNH4/274-373-----.AVAIS--SV-------------------------------------------------.....-----------
A8AR20_CITK8/257-351-----.SEILV--MR-------------------------------------------------.....-----------
A9KQT2_CLOPH/369-506-----.GTVVA--QP-------------------------------------------------.....-----------
B2HGJ6_MYCMM/200-292-----.LIFVR--AM-------------------------------------------------.....-----------
B4EEB5_BURCJ/285-374-----..ILAT--PP-------------------------------------------------.....-----------
B7VH43_VIBTL/299-399-----.GVILA--SN-------------------------------------------------.....-----------
B8I8J6_CLOCE/322-424-----.AAVLV--NM-------------------------------------------------LGKSG-----------
D4K997_9FIRM/688-783-----.GFPIS--IV-------------------------------------------------.....-----------
D4KYJ1_9FIRM/289-395-----.GFLIA--KC-------------------------------------------------.....-----------
D4KYJ2_9FIRM/288-378-----.GLPLG--YA-------------------------------------------------.....-----------
M1FFQ7_9ALTE/713-801-----.GVWLT--WV-------------------------------------------------.....-----------
O28455_ARCFU/301-396-----.GFFAS--QL-------------------------------------------------.....-----------
O50782_BORBU/302-402-----.AYFAK--LF-------------------------------------------------.....-----------
Y684_MYCPN/1015-1110-----.AFLLE--RQ-------------------------------------------------.....-----------
Q01VW7_SOLUE/1304-1396-----.LWLSV--AV-------------------------------------------------.....-----------
Q025M3_SOLUE/377-471-----.AFWAR--RP-------------------------------------------------.....-----------
Q034M7_LACC3/430-519-----.ALLIV--VA-------------------------------------------------.....-----------
Q0P8Y0_CAMJE/176-262-----.LAFFT--QI-------------------------------------------------.....-----------
Q0RJL1_FRAAA/665-753-----.GFLAA--GL-------------------------------------------------.....-----------
Q18EP9_HALWD/325-419-----.GIGGI--YA-------------------------------------------------.....-----------
Q1G8P7_LACDA/306-403-----YSKMLA--DS-------------------------------------------------.....-----------
Q2FUZ2_STAA8/85-179-----.GYLLG--AI-------------------------------------------------.....-----------
Q2RPK1_RHORT/306-403-----.ALAFQ--AL-------------------------------------------------.....-----------
Q47EZ3_DECAR/269-372-----FGAAIF--EP-------------------------------------------------.....-----------
Q481M7_COLP3/731-820-----.GAIAG--TY-------------------------------------------------.....-----------
Q4A9N5_MYCHJ/1828-1923-----.GFFGK--IP-------------------------------------------------.....-----------
Q4A9N5_MYCHJ/2549-2644-----.VIIAM--EI-------------------------------------------------.....-----------
Q4DFN5_TRYCC/470-565-----.LVGLN--AL-------------------------------------------------.....-----------
Q4QBC9_LEIMA/1003-1097-----.GTAVG--VT-------------------------------------------------.....-----------
Q54MT9_DICDI/571-666-----.SQIFL--FI-------------------------------------------------.....-----------
Q5JEM5_THEKO/229-318-----.GILLG--SR-------------------------------------------------.....-----------
Q5LCL1_BACFN/298-387-----.MAFIE--AC-------------------------------------------------.....-----------
Q5LDA1_BACFN/308-392-----.IIFLF--Q.-------------------------------------------------.....-----------
Q5LFF2_BACFN/320-426-----.SWGLL--VL-------------------------------------------------GRNWV-----------
Q5V3A9_HALMA/900-995-----.SVLAL--QL-------------------------------------------------.....-----------
Q6AA47_PROAC/625-722-----.GVLAG--WA-------------------------------------------------.....-----------
Q6AMB4_DESPS/311-415-----.GLLIA--WY-------------------------------------------------.....-----------
Q6F163_MESFL/1307-1400-----.SVIFW--KI-------------------------------------------------.....-----------
Q6F1V8_MESFL/1717-1810-----.GKWLL--GS-------------------------------------------------.....-----------
Q6F1W1_MESFL/1327-1420-----.GWFI.--..-------------------------------------------------.....-----------
Q6MGV4_BDEBA/685-778-----.GYGLS--YL-------------------------------------------------.....-----------
Q6MSQ5_MYCMS/397-490-----.SCLVS--II-------------------------------------------------.....-----------
Q6MT15_MYCMS/588-682-----.SIPIQ--IY-------------------------------------------------S....-----------
Q6MUJ8_MYCMS/1693-1786-----.VFSST--SI-------------------------------------------------.....-----------
Q79Z83_STRAW/268-362-----.GAYGA--PR-------------------------------------------------.....-----------
Q7UPA2_RHOBA/607-706-----YAWAVL--WA-------------------------------------------------.....-----------
Q7V1V4_PROMP/299-384-----..YFSG--QI-------------------------------------------------.....-----------
Q81HP3_BACCR/261-351-----.LEMFS--GT-------------------------------------------------.....-----------
Q81QE5_BACAN/286-379-----.SLFVT--KI-------------------------------------------------.....-----------
Q830M8_ENTFA/609-698-----.TTFAI--YL-------------------------------------------------.....-----------
Q87SX2_VIBPA/317-410-----.LYAIL--AL-------------------------------------------------.....-----------
Q899W1_CLOTE/276-369-----.VHLLI--PF-------------------------------------------------.....-----------
Q8A9F6_BACTN/292-381-----..WFLI--EI-------------------------------------------------.....-----------
Q8CYG6_STRR6/429-522-----.GHYLL--AS-------------------------------------------------.....-----------
Q8DQ76_STRR6/86-181-----.GALFD--KL-------------------------------------------------.....-----------
Q8DQS2_STRR6/328-451-----QASKAA--QA-------------------------------------------------.....-----------
Q8EUA2_MYCPE/1386-1480-----.TFAMT--SV-------------------------------------------------.....-----------
Q8EZY9_LEPIN/286-379-----.GNILL--KW-------------------------------------------------.....-----------
Q8G7P9_BIFLO/348-438-----.GAFAA--NP-------------------------------------------------.....-----------
Q8KD33_CHLTE/294-389-----.GAWLG--SA-------------------------------------------------.....-----------
Q8NS27_CORGL/639-739-----.GWIAA--LL-------------------------------------------------.....-----------
Q8Y6E1_LISMO/85-180-----.GIFSS--KL-------------------------------------------------FA...-----------
Q97DB8_CLOAB/742-835-----.GSLMI--HV-------------------------------------------------.....-----------
Q97LN0_CLOAB/763-854-----.SIIFS--WL-------------------------------------------------.....-----------
Q9A6K3_CAUCR/378-465-----.GLLTW--GV-------------------------------------------------.....-----------
Q9FBP3_STRCO/683-772-----.GLTLG--TV-------------------------------------------------.....-----------
Q9KF85_BACHD/565-650-----.LLAYI--WL-------------------------------------------------.....-----------
Q9PPU7_UREPA/189-284-----.SYEIQ--PL-------------------------------------------------.....-----------
Q9WZG5_THEMA/751-844-----.GVLMG--YF-------------------------------------------------.....-----------
R5K905_9CLOT/831-926-----.GAAAT--AL-------------------------------------------------.....-----------
R5KJ88_9CLOT/371-467-----.GYSSL--GV-------------------------------------------------.....-----------
R5TSZ9_9FIRM/299-417-----.GNAAA--WG-------------------------------------------------.....-----------
R5UPZ8_9BACE/319-410-----IEILSS--GM-------------------------------------------------.....-----------
R6WL88_9PORP/179-267-----.SYFV.--..-------------------------------------------------.....-----------
R6WLH2_9PORP/307-392-----.SCLLE--LT-------------------------------------------------.....-----------
R6WYF0_9PORP/312-402-----.LLIAH--DL-------------------------------------------------.....-----------
R6X6U4_9PORP/300-397-----.TEWIV--PV-------------------------------------------------.....-----------
R7EAJ1_9BACE/317-408-----.LIICI--NM-------------------------------------------------.....-----------

PF03739

Q3ATU7_CHLCH/6-355.....RFISIG..AF..NPINE.......SLNNV..SIERL...................SG..ATMIS...........
Q118T4_TRIEI/24-389DDTLTRLFYAE..KF..DGK.........YMQGV..TILDR...................SQ..YGVDQ...........
A0LEN9_SYNFM/39-391.....LTFFFQ..SV..NPTEL.......SVRGI..FVQDR...................RE..EKVRL...........
A7HYF9_PARL1/7-370.....LTVFVR..ER..AADGT........TYGV..LVHDG...................RI..PSAPV...........
Q8DIL4_THEEB/18-374..NVRRLYYGH..RF..DGS.........RIQGI..TVLDF...................SQ..PQVTQ...........
Q82W93_NITEU/6-348....GRVIFIR..GK..DDLEK.......RMEGV..FHYI....................RT..TEDRE...........
A0LB31_MAGMM/6-364.....QILHAK..RA..YGDKR.......LLLEV..TIFRFT..................PE..HDLLM...........
Q6MKD0_BDEBA/11-364.....MVIYAN..EV..NTDKG.......LLKKV..FIYDE...................KN..GDVPL...........
Q6FFD6_ACIAD/9-354.....RFIYVD..YA..NSQGQ........LKRI..QVVDFD..................DN..YRLKS...........
Q0C1U6_HYPNA/7-346.....FLIELK..SM..QAE.........ELTGI..TIFERN..................AE..GAVVA...........
Q11U59_CYTH3/9-455.....YSIKIV..QK..FDNDS.......SIKGV..IIYDHT..................QS..RGNTD...........
A1AWC7_RUTMC/20-369.....DIVFYA..SK..VSDADNA..KEQNMEEI..FIYTLV..................NN..EPVIT...........
Q73NV9_TREDE/13-373.....NSIVVS..GL..IKDNS........IHDL..LIIDS...................SQ..RGAKR...........
Q1GR36_SPHAL/14-363.....DLINAE..TV..ETSGPA.....VVLRGV..TIYER...................TR..GVLSS...........
A5EXI6_DICNV/8-348.....NTLYTG..DK..INNG.........FQPF..IIIQ....................ND..NNEYS...........
Q7VQS8_BLOFL/9-358.....SFIHVN..YM..LTTQD........LLGI..NLYHFT..................EE..RQLKR...........
Q310A0_DESAG/6-352.....RIIHLE..TL..HPAAQ.......KGSGI..TVYELT.................PDE..LSVQR...........
Q5SL96_THET8/6-344.....RVVYVG..KV..EGE.........AIGAL..RVLSR...................EE..................
Q6MJL5_BDEBA/6-356.....SIFNIK..TL..NAKGD.......GAQGL..TMYFFS..................DE..WDLVQ...........
A5WBH3_PSYWF/27-466.....YHLYVG..SM..NDNKT.......ELQDV..ILIQTAKDAAK........SVKPGATVPEATTNAPAVRLGQQEL
E0TCF8_PARBH/6-360..DGIALLHAE..RY..RENDP.......VLEEV..TVWRRT..................QD..GAFIE...........
Q984S3_RHILO/7-356...GDTIIGAR..AI..LNQGL.......EMSDAVFFVLD....................QQ..GNIVE...........
Q2S3I0_SALRD/55-410.....SILSVG..YY..DADRE.......RAHTV..SLQQLA..................GD..ARLAR...........
Q1IRI3_KORVE/435-789.....TIYYYE..VY..DADQN.......RFGGI..SIFQFD.................PKT..FALQS...........
A1WAC0_ACISJ/11-359.....FSFSAD..RV..EDGGR.......RFIGV..FMER....................RQ..NGIEE...........
Q8D296_WIGBR/5-350....NIILFVD..NI..KDK.........NLKNI..FIVKFIL................KNK..EYIPV...........
Q6MDI9_PARUW/8-358.....LLLYQN..YD..SEKEEFF..DVYWIESI..........................DS..................
Q9A939_CAUCR/5-350.....LVIGAN...A..SADGR.......TITGV..TIFRRD..................SK..GILVE...........
Q1D894_MYXXD/7-356.....NIFFLR..GG..SAQEG........FQDV..SVFTVT..................ES..FDLQR...........
Q1QKW5_NITHX/6-356.....LTIRVR..ER..QPGGL........LVGI..FIDDR...................RN..PNERL...........
Q143Z1_BURXL/6-377GEQVTRFVNVG..EL..KPDAT........ISNV..RIYEFD..................SK..FRLSN...........
B5EBA8_GEOBB/11-361.....MVVYTQ..SL..DTKAQ.......TMGGV..IVHDE...................RD..PRTPT...........
A3I2C6_9BACT/6-354.....SYAYLS..RF..YKTGNTG..YHFTLETI..........................RD..GRLIN...........
Q2RQ55_RHORT/8-372.....LIVYAG..ER..AKDGR........LIDL..MIHDT...................TG..KTSDL...........
A1WUU9_HALHL/6-348.....DFLRAE..RP..RSASH........LESV..TLYRF...................VE..GQLTE...........
A5G1T7_ACICJ/24-378.....ITVYVQ..RR..DHDQV........LHGI..VIQDA...................RQ..KGEPA...........
Q3B4Y3_CHLL7/6-432.....YSILVQ..HA..DEKTG.......SIGDI..IIYDA...................TR..KDYRS...........
Q0BZX3_HYPNA/9-369...SQYVIHAR..RV..EDGGR.......TLLDV..KIIEEQRLYN.........GRQPTND..FAFVR...........
A2U291_9FLAO/6-450.....YQIKFD.EKY..GEEEN.......LLKKV..WIYDLT..................SN..RGNQK...........
A0LB30_MAGMM/6-357.....LTIYVN..RQ..SHGGK.......LLEGL..LIHDE...................RD..PDMPV...........
E0TCF9_PARBH/51-404.....ITVFAQ..EV..RPGGQ........FIGL..FINDS...................SD..PRETK...........
A5EXI7_DICNV/7-348.....NIVYIG..AF..QADGS........LEKI..RFYRP...................HE..HDLE............
B8CYZ1_HALOH/12-360.....RLFYVG..RF..DKEDN.......IMKKI..VVYTFK..................GD..NGYPL...........
Q1MPZ1_LAWIP/7-360.....FVLFAR..QV..DPLSG.......ELHQI..LLEDR...................SQ..KDRHL...........
A8ZZ83_DESOH/6-356.....TIVHIR..HY..QPREK.......KAFDV..VLHDLD..................EG..FRVTR...........
A8EWU1_ARCB4/5-331.....WLIFIN..DK..KNN.........LYEDV..KLLKVQ......................KDNDQ...........
Q31ET4_THICR/6-346....EGIFYTR..SI..KSNGD........LESV..WVRLNT..................DE..RDILL...........
Q1IZ54_DEIGD/6-380.....LTLWLG..GY..DAAGR.......KLQNV..RVERWA.................KDD..PQRTT...........
Q1J2D3_DEIGD/10-350.....ALFYAG..RV..RNGAESG...VAQLDGV..LIERG...................GE..................
Q2S0T8_SALRD/7-449.....YSILVQ..DR..PPGTN.......KLIDV..TIYDYT..................QG..RDRQA...........
Q6MDI8_PARUW/7-377.....KGLYFD..SL..GPSRVG.....EMATDAVFAIPSQHHQRIN........LFIAKQL..KASSS...........
B8CYX9_HALOH/6-362..RPDYILYTH..RF..NGETG.......IMNDV..YLQDY...................EK..GVPVT...........
Q1IRI3_KORVE/8-376.....YVLYVE..DS..KSGSGS.....ALWRGV..FLADV...................ST..PSQPK...........
O83854_TREPA/1-358.....VILSVG..EV..FHS.........VMYQL..LIVDK...................SD..SRSLK...........
Q8D297_WIGBR/7-348.....NFILIK..KI..VDFDF........IQGI..YIYEFN..................KF..NEIKY...........
Q9AA49_CAUCR/9-364.....FFLTAD..RT..DASGR.......YLQQV..FIRRI...................DP..NGRED...........
Q3J9X2_NITOC/9-352....QRVFYAE..SL..TEDGL.......GMKNV..FIQVWE......................PTQKT...........
A7IJ85_XANP2/6-384.....LVFHVR..ER..APNGV........MRGI..FINDA...................RD..DGVS............
Q0C1U7_HYPNA/7-360.....RIIWTD..SV..LPGGR........LGQT..FILES...................EP..DGART...........
Q0BVK4_GRABC/5-352.....HFLNIQ..HF..EHHDE........PYNI..DIFSFA..................PD..GELHR...........
Q5FU64_GLUOX/35-392.PHGVAILHAQDVHL..IDGAL.......KVSGV..SIFRLD..................DR..DRLIV...........
Q5FPA9_GLUOX/26-376.....TLVRIG..QI..AQGGT.......FLRDV..TIYHRD..................NT..GLLTG...........
Q1D895_MYXXD/6-362.....LTLYAE..QV..SADGK........WTNV..LLHDD...................RE..ANSPL...........
A1AXG9_RUTMC/6-356.....LFIHVK..KN..FDGKS........FQDV..TLIKLR..................AP..DTLDS...........
A6QBC8_SULNB/6-335.....YYIYVK..EK..DEKSK.......LFHDM..VIYNR...................TK..KDAEQ...........
A6QBZ1_SULNB/12-355.....TFVYIK..KL..NPIVK.......KIKGI..TIFKV...................AG..YQVRY...........
Q7VQS9_BLOFL/5-358.....LVLFID..NI..KNG.........MLNHV..FILKRV..................QNIDKNVFS...........
Q73NV8_TREDE/6-354.....IVYTAD..YF..NAENQ.......TLANA..YIIVRD..................ED..GNLSL...........
B4E8H0_BURCJ/7-345....HRVFFIE..KM..SPDQS.......KVQNV..FVTST....................E..NGKVN...........
J9ZCA2_LEPFM/6-351.....FVIYVD..RM..PTFSR........MQGV..FIYQEG..................KG..KSPST...........
J9ZCM7_LEPFM/6-356.....DIYGAR..TI..RDGGN.......ELDKV..VLYHLD..................RT..FHLSW...........
O26028_HELPY/5-350.....DYVYFD..KI..NPLLQ.......KAQNI..KVFRL...................KD..KTLES...........
O51747_BORBU/11-425......LIFVS..GE..KSENG........YKNV..TFFDNT..................GL..KGFDR...........
O51748_BORBU/7-350.....EIYNIK..SY..DIDEN.......TFANL..MIIIKD..................NK..DEFQT...........
O84846_CHLTR/8-346.....IFIAID..HC..GKS.........KFDNV..VIALK...................HN..QEISN...........
LPTG_HAEIN/7-355.....HFVFVR..RV..TDDTK........LDDI..YIYTFD..................QQ..HNLIK...........
Q2JLS4_SYNJB/13-367.....LWFFIR..QV..DPRLN.......TMQDV..TILRVDPL..............PGGK..YQLVE...........
Q2YN46_BRUA2/7-357.....LYIQVA..ER..RADGS........IGGL..FIADS...................RD..PTLDL...........
Q5NFB9_FRATT/8-349.....GFMNIA..NI..EPTNG.......KAYGI..RKFMV...................QD..NKVRE...........
Q5NFC0_FRATT/6-350.....KIIYIG..NK..SGN.........TLSDV..FLYQNT..................PQ..DGEYK...........
Q5SL95_THET8/4-334.....GVYFAE..EVYPEPEGN.......RLRGV..RVVDE...................RG......R...........
Q7CKF4_YERPE/5-345....NSALFIG..NV..AGK.........EFNRV..FLAQLR.................PNG..NQRPS...........
Q8F742_LEPIN/134-585.EKRARTMYTE..GM..NSNTG.......ELKGV..QIREWEIFLEGNEYFHIGGKMIPMGG..SRIIQ...........
Q8F8T0_LEPIN/30-383.....GFYYLY..FY..DPDKD.......EINGG.FNYIRLR..................PD..GSPET...........
Q8PCR2_XANCP/10-365.....TFLNAL..SG..EEQLLDNGGTALTLHDV..RLYHLD..................AN..GQMQQ...........
Q8PCR3_XANCP/6-349.....GVVYLT..TI..SPDGK.......GLGKV..FMQRQ....................K..DDRID...........
Q8RER6_FUSNN/12-360.....YLYLMG..KI..NRETG.......LAENI..EVVKFN..................TE.ISKPKE...........
Q9X257_THEMA/19-363.....QYFYVE..KY..DERTS.......TMWNV..VIFRY.......................GHEET...........
Q9ZCH3_RICPR/10-357....NQIIQTK..FI..DVAEK.......KLNNI..TILFID..................NN..NSFLK...........
R6X2Y4_9PORP/1-468.....FNVYVK..HK..DTETG.......LLRDM..MIYDYS..................EG..FNKVS...........

PF00528

GLNP_ECOLI/33-218-----VAELTR--QG-----------------------------------------------------------------
YQGH_BACSU/107-309-----.GNTRV--LP-----------------------------------------------------------------
YQGI_BACSU/80-293-----LTTPRL--NF-----------------------------------------------------------------
NIKB_ECOLI/116-308-----VGRYAV--SA-----------------------------------------------------------------
Q97UG4_SULSO/116-318-----VGFFFG--LA-----------------------------------------------------------------
YCKA_BACSU/41-224-----VPELLQ--HA-----------------------------------------------------------------
Q97VK6_SULSO/120-341-----MGYFIT--QA-----------------------------------------------------------------
Q9FAT0_VIBPH/116-319-----LGNAFV--YS-----------------------------------------------------------------
Q44374_RHIRD/87-266-----LGLQPP--MT-----------------------------------------------------------------
Q9KB56_BACHD/117-308-----LGSLSV--KS-----------------------------------------------------------------
OPUBD_BACSU/40-211-----LGDMIV--RG-----------------------------------------------------------------
Q9LAT6_LISMN/112-304-----IGSQFV--SS-----------------------------------------------------------------
LACF_RHIRD/87-298-----ANSTLT--LS-----------------------------------------------------------------
Y355_HAEIN/68-243-----LGYLMI--HA-----------------------------------------------------------------
Q982M9_RHILO/75-250-----LGALII--QA-----------------------------------------------------------------
GLNP_RICPR/33-217-----EMDLMR--RA-----------------------------------------------------------------
AMIC_STRR6/298-492-----MGKMLI--DS-----------------------------------------------------------------
TCYB_BACSU/46-230-----VAELFR--KA-----------------------------------------------------------------
AMID_STRR6/125-308-----LGLPIT--VP-----------------------------------------------------------------
NRTB_SYNE7/98-276-----IGYFIW--DA-----------------------------------------------------------------
Q9HIL1_THEAC/131-337-----VGLYMI--TA-----------------------------------------------------------------
Q9X0U9_THEMA/119-323-----IGYILM--QG-----------------------------------------------------------------
UGPA_ECOLI/90-294-----VQATTT--LI-----------------------------------------------------------------
SAPB_HAEIN/93-316-----IGRWLI--NA-----------------------------------------------------------------
MSMG_STRMU/87-273-----DSSMWT--LP-----------------------------------------------------------------
G8PA36_LACLC/106-293-----FGLPAG--TP-----------------------------------------------------------------
HISQ_SALTY/27-221-----LEDVVK--AT-----------------------------------------------------------------
NIKC_ECOLI/89-273-----LGVTAP--TA-----------------------------------------------------------------
Q9WYD8_THEMA/94-282-----.FTRVE--IP-----------------------------------------------------------------
POTH_ECOLI/117-315-----DSIMIG--RV-----------------------------------------------------------------
LPLC_BACSU/93-290-----LQMVLR--QV-----------------------------------------------------------------
CYST_ECOLI/74-276-----TSLMIF--VR-----------------------------------------------------------------
Q9ZBG1_STRCO/128-331-----IAAATV--EA-----------------------------------------------------------------
Q97UH1_SULSO/128-336-----LGYFFN--QA-----------------------------------------------------------------
Q97VF6_SULSO/101-289-----.VLPYN--PN-----------------------------------------------------------------
LACG_RHIRD/89-270-----ITLVVS--SL-----------------------------------------------------------------
Q9HLG4_THEAC/81-265-----IGLEPP--IP-----------------------------------------------------------------
MALD_STRR6/87-275-----EYFTVA--VG-----------------------------------------------------------------
GLTJ_ECOLI/43-239-----LVDMAA--QA-----------------------------------------------------------------
YEHW_ECOLI/68-240-----LGTPII--IG-----------------------------------------------------------------
Q9FAT1_VIBPH/84-268-----FGSDPT--RA-----------------------------------------------------------------
Q9A534_CAUCR/67-247-----LAWRIL--ES-----------------------------------------------------------------
YEJB_ECOLI/151-361-----LGLLGY--EA-----------------------------------------------------------------
YOR2_CALSR/83-265-----TRRTLP--LG-----------------------------------------------------------------
O66777_AQUAE/114-319-----MGMLML--NA-----------------------------------------------------------------
YEHY_ECOLI/195-381-----FGALVF--QG-----------------------------------------------------------------
Q9WXN6_THEMA/92-279-----LG.PTQ--GI-----------------------------------------------------------------
Q9Y9N0_AERPE/121-339-----LGSLLV--ER-----------------------------------------------------------------
Q9WY46_THEMA/67-238-----LGVLIS--WA-----------------------------------------------------------------
Q9Z6P7_CHLPN/68-243-----LGILML--ES-----------------------------------------------------------------
Q98K60_RHILO/105-289-----IGAKLL--AG-----------------------------------------------------------------
UGPE_ECOLI/91-278-----LGTTVA--GI-----------------------------------------------------------------
OPPB_LACLA/113-318-----LGQLFI--TS-----------------------------------------------------------------
Q49553_MYCHO/234-419-----FFKEKK--DT-----------------------------------------------------------------
FBPB_SERMA/341-526-----NGTRTL--AT-----------------------------------------------------------------
Q987J0_RHILO/100-280-----LGLQPP--LA-----------------------------------------------------------------
Q9CLG9_PASMU/73-248-----LGYLML--HA-----------------------------------------------------------------
Q9PPS8_UREPA/183-374-----SGSLFF--EA-----------------------------------------------------------------
PSTA_ECOLI/101-295-----LSNQFW--ST-----------------------------------------------------------------
Q98QF6_MYCPU/174-365-----SGGILI--NA-----------------------------------------------------------------
MALC_STRR6/209-434-----AGSTDI--LI-----------------------------------------------------------------
LPLB_BACSU/104-314-----LNRSVA--DI-----------------------------------------------------------------
YHDY_ECOLI/173-362-----LFDLFS--SV-----------------------------------------------------------------
A0A023Z6E4_ECOLX/104-273-----IGVTLW--EA-----------------------------------------------------------------
Q7ANQ9_RHIME/112-306-----VGRYFV--LG-----------------------------------------------------------------
Q97YP1_SULSO/131-332-----MGYLGI--IA-----------------------------------------------------------------
O28506_ARCFU/135-354-----MGTFLI--ER-----------------------------------------------------------------
Q98K61_RHILO/75-251-----MGFRIS--TE-----------------------------------------------------------------
AMYC_THETU/83-269-----VGSRTL--PL-----------------------------------------------------------------
Q2FVE8_STAA8/117-308-----LGQLSL--KA-----------------------------------------------------------------
Q9EWP8_STRCO/101-281-----LGRGGA--AP-----------------------------------------------------------------
Q9KKK5_VIBCH/118-310-----VGHALS--HA-----------------------------------------------------------------
YEJE_ECOLI/158-341-----FGLPLG--SP-----------------------------------------------------------------
O86691_STRCO/402-574-----LGAQPP--SP-----------------------------------------------------------------
Q98QS7_MYCPU/195-382-----FDNPSL--TP-----------------------------------------------------------------
I3VV06_THESW/85-290-----GNTTQM--IT-----------------------------------------------------------------
O34157_SALTM/115-319-----LGQATI--DA-----------------------------------------------------------------
Q9PL65_CHLMU/67-242-----LGILIL--ES-----------------------------------------------------------------
Q9RX04_DEIRA/318-494-----LGFRVQ--EA-----------------------------------------------------------------
SSUC_BACSU/94-269-----VGYMIM--DA-----------------------------------------------------------------
Q9UYG7_PYRAB/121-325-----VGVLLM--HA-----------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205--------------------------------------------------------------------------------
A1SH34_NOCSJ/795-890--------------------------------------------------------------------------------
A1SKN4_NOCSJ/326-416--------------------------------------------------------------------------------
A1TXE6_MARHV/209-306--------------------------------------------------------------------------------
A3I1M1_9BACT/315-407--------------------------------------------------------------------------------
A3I2Y5_9BACT/772-861--------------------------------------------------------------------------------
A3QAU8_SHELP/338-429--------------------------------------------------------------------------------
A4VW57_STRSY/1024-1117--------------------------------------------------------------------------------
A4YKC0_BRASO/760-849--------------------------------------------------------------------------------
A5N346_CLOK5/499-593--------------------------------------------------------------------------------
A5USK7_ROSS1/337-433--------------------------------------------------------------------------------
A6H1M7_FLAPJ/310-410--------------------------------------------------------------------------------
A6L8W9_PARD8/679-767--------------------------------------------------------------------------------
A6LCJ9_PARD8/311-395--------------------------------------------------------------------------------
A6LZM8_CLOB8/312-398--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/290-387--------------------------------------------------------------------------------
A7H957_ANADF/310-394--------------------------------------------------------------------------------
A7HK62_FERNB/280-383--------------------------------------------------------------------------------
A8ABZ3_IGNH4/274-373--------------------------------------------------------------------------------
A8AR20_CITK8/257-351--------------------------------------------------------------------------------
A9KQT2_CLOPH/369-506--------------------------------------------------------------------------------
B2HGJ6_MYCMM/200-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/285-374--------------------------------------------------------------------------------
B7VH43_VIBTL/299-399--------------------------------------------------------------------------------
B8I8J6_CLOCE/322-424--------------------------------------------------------------------------------
D4K997_9FIRM/688-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/289-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/288-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/713-801--------------------------------------------------------------------------------
O28455_ARCFU/301-396--------------------------------------------------------------------------------
O50782_BORBU/302-402--------------------------------------------------------------------------------
Y684_MYCPN/1015-1110--------------------------------------------------------------------------------
Q01VW7_SOLUE/1304-1396--------------------------------------------------------------------------------
Q025M3_SOLUE/377-471--------------------------------------------------------------------------------
Q034M7_LACC3/430-519--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/176-262--------------------------------------------------------------------------------
Q0RJL1_FRAAA/665-753--------------------------------------------------------------------------------
Q18EP9_HALWD/325-419--------------------------------------------------------------------------------
Q1G8P7_LACDA/306-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/85-179--------------------------------------------------------------------------------
Q2RPK1_RHORT/306-403--------------------------------------------------------------------------------
Q47EZ3_DECAR/269-372--------------------------------------------------------------------------------
Q481M7_COLP3/731-820--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1828-1923--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2549-2644--------------------------------------------------------------------------------
Q4DFN5_TRYCC/470-565--------------------------------------------------------------------------------
Q4QBC9_LEIMA/1003-1097--------------------------------------------------------------------------------
Q54MT9_DICDI/571-666--------------------------------------------------------------------------------
Q5JEM5_THEKO/229-318--------------------------------------------------------------------------------
Q5LCL1_BACFN/298-387--------------------------------------------------------------------------------
Q5LDA1_BACFN/308-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/320-426--------------------------------------------------------------------------------
Q5V3A9_HALMA/900-995--------------------------------------------------------------------------------
Q6AA47_PROAC/625-722--------------------------------------------------------------------------------
Q6AMB4_DESPS/311-415--------------------------------------------------------------------------------
Q6F163_MESFL/1307-1400--------------------------------------------------------------------------------
Q6F1V8_MESFL/1717-1810--------------------------------------------------------------------------------
Q6F1W1_MESFL/1327-1420--------------------------------------------------------------------------------
Q6MGV4_BDEBA/685-778--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/397-490--------------------------------------------------------------------------------
Q6MT15_MYCMS/588-682--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1693-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/268-362--------------------------------------------------------------------------------
Q7UPA2_RHOBA/607-706--------------------------------------------------------------------------------
Q7V1V4_PROMP/299-384--------------------------------------------------------------------------------
Q81HP3_BACCR/261-351--------------------------------------------------------------------------------
Q81QE5_BACAN/286-379--------------------------------------------------------------------------------
Q830M8_ENTFA/609-698--------------------------------------------------------------------------------
Q87SX2_VIBPA/317-410--------------------------------------------------------------------------------
Q899W1_CLOTE/276-369--------------------------------------------------------------------------------
Q8A9F6_BACTN/292-381--------------------------------------------------------------------------------
Q8CYG6_STRR6/429-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/86-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/328-451--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1386-1480--------------------------------------------------------------------------------
Q8EZY9_LEPIN/286-379--------------------------------------------------------------------------------
Q8G7P9_BIFLO/348-438--------------------------------------------------------------------------------
Q8KD33_CHLTE/294-389--------------------------------------------------------------------------------
Q8NS27_CORGL/639-739--------------------------------------------------------------------------------
Q8Y6E1_LISMO/85-180--------------------------------------------------------------------------------
Q97DB8_CLOAB/742-835--------------------------------------------------------------------------------
Q97LN0_CLOAB/763-854--------------------------------------------------------------------------------
Q9A6K3_CAUCR/378-465--------------------------------------------------------------------------------
Q9FBP3_STRCO/683-772--------------------------------------------------------------------------------
Q9KF85_BACHD/565-650--------------------------------------------------------------------------------
Q9PPU7_UREPA/189-284--------------------------------------------------------------------------------
Q9WZG5_THEMA/751-844--------------------------------------------------------------------------------
R5K905_9CLOT/831-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/371-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/299-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/319-410--------------------------------------------------------------------------------
R6WL88_9PORP/179-267--------------------------------------------------------------------------------
R6WLH2_9PORP/307-392--------------------------------------------------------------------------------
R6WYF0_9PORP/312-402--------------------------------------------------------------------------------
R6X6U4_9PORP/300-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/317-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355...............................................RIDADSMHYNRR.......TKRWTMWRVTERYF
Q118T4_TRIEI/24-389...............................................IVSSESATWNSA.......ENIWDLFNGTIYLV
A0LEN9_SYNFM/39-391...............................................AIVAESARIVYQRDS...NHLTFKIANGSITRV
A7HYF9_PARL1/7-370...............................................TYMAETGSLVRGPN.....GPLLVMFNGNIQRA
Q8DIL4_THEEB/18-374...............................................VISAESAEWNVR.......ESRWLLSQGIAYLI
Q82W93_NITEU/6-348...............................................IIISREGYQQPMTAE...QWPHIELREGQIYRL
A0LB31_MAGMM/6-364...............................................RADAHKATWE.........NEGWVLHNGQIYRF
Q6MKD0_BDEBA/11-364...............................................TIIAKAGEIVPDPTRP.GHEILLQLNQGEIHRQ
Q6FFD6_ACIAD/9-354...............................................VTNAEQGQFVK........DGQWLLNHSQQMAI
Q0C1U6_HYPNA/7-346...............................................ITTAETARPA.........DGGWALSGTGQRRF
Q11U59_CYTH3/9-455...............................................VIIADSGSMYLFNQS...QYLALELFRGNSYNE
A1AWC7_RUTMC/20-369.................................................LAKQAQKYTNFNT...NSVYLRLKNGTRYHG
Q73NV9_TREDE/13-373...............................................FLSSSQTDVKKSNDR..SIIMQLEMLNPRLLNL
Q1GR36_SPHAL/14-363...............................................MLSADSARALP........GGGWEMANARRFSR
A5EXI6_DICNV/8-348...............................................MLWSKRGEIQKNQP.....EHFLHLTQGNRAAW
Q7VQS8_BLOFL/9-358...............................................IIYIEKATYI.........DNSWSVSNINELEF
Q310A0_DESAG/6-352...............................................VIRGKSFRAD.........SSGWTLDGCDILIP
Q5SL96_THET8/6-344...............................................VLLAERGSFR.........GGVLHVEEGTR...
Q6MJL5_BDEBA/6-356...............................................MITAAQVKIQ.........GAQWLLEQGTVTIF
A5WBH3_PSYWF/27-466EGSNSANQSVSSIDKDKAITAVTNPVAASQDKPAAKPAITADDDRDIIVLAKRAVQVKGSEE..SGKTQLDLFQGRRYEV
E0TCF8_PARBH/6-360...............................................RLDAPRALID.........AQVLRLMQARRSTS
Q984S3_RHILO/7-356...............................................RKDAAHAYLR.........DGYWELQDVKTFR.
Q2S3I0_SALRD/55-410...............................................RVDANRMEWDDS.......LEVWRLDDVTRRTF
Q1IRI3_KORVE/435-789...............................................RIYAQHAHWEDG.......LQKWVFEQGWMRKL
A1WAC0_ACISJ/11-359...............................................ITTAVRGQLESNPDT...RKMRLKLEDGLRVRQ
Q8D296_WIGBR/5-350...............................................VFVSKHGSLYKDLLK...NKNVINLNYGEYYEI
Q6MDI9_PARUW/8-358...............................................IYRAKYLCPNKEIPVGYFVDHLLRQPNGE....
Q9A939_CAUCR/5-350...............................................KVEAPAARYD.........GKAWTLEQPKTTRF
Q1D894_MYXXD/7-356...............................................RLDASGMFPVE........GMRWRLTDVVERTF
Q1QKW5_NITHX/6-356...............................................SIVADHGTVMKNDN.....GSFLILEDGHLERL
Q143Z1_BURXL/6-377...............................................VRTAKSGKYQP........PGHWQLTGVTDTQL
B5EBA8_GEOBB/11-361...............................................TIFASTGALVSDPKS...NSMEFQLRNGSIHRA
A3I2C6_9BACT/6-354...............................................KLSSDRIQWDTA.......KNVWTLKNWRFREL
Q2RQ55_RHORT/8-372...............................................TVMAESGALVREGE.....GARILLINGNRQER
A1WUU9_HALHL/6-348...............................................RIDADGAHYE.........DGQWRLEGVVKTVY
A5G1T7_ACICJ/24-378...............................................TILARSGRLIDGPD.....GPEVLLLDGSREQV
Q3B4Y3_CHLL7/6-432...............................................VITAKDGVIDFSADG...RYLVMMLSDGQIHEV
Q0BZX3_HYPNA/9-369...............................................RIDAEKAVLN.........EGFWQLENLVENLP
A2U291_9FLAO/6-450...............................................VITAESGKIVTEEGS...RYMTFILYNGNYYEE
A0LB30_MAGMM/6-357...............................................TVIAKSGMLHRGST....GETALLLKEGSRHQM
E0TCF9_PARBH/51-404...............................................TYTAERGLFQMAET.....GPKLLLIEGTVQYR
A5EXI7_DICNV/7-348...............................................IQESQRATFM.........QTHWQLDDNRALCI
B8CYZ1_HALOH/12-360...............................................IVTANLGEVY.........KEKWVLKKGFIHRY
Q1MPZ1_LAWIP/7-360...............................................VILAPTGTIETNPTK...GELIFNLTNGNIYTM
A8ZZ83_DESOH/6-356...............................................RIDAARGLYD.........GGQWTLRNVLDQQF
A8EWU1_ARCB4/5-331...............................................FVISKNAVLDNDNG.....VLSIRLDEGKAFLI
Q31ET4_THICR/6-346.................................................MAPKGKFEWING.....KLVLVLLNGRSYEG
Q1IZ54_DEIGD/6-380...............................................VIFADSGTFE.........NNRLSLRGYQVYTV
Q1J2D3_DEIGD/10-350...............................................TVTAQSGIWDTQ.......ARTWTVSDAWITRP
Q2S0T8_SALRD/7-449...............................................VIKAERGVIESSAGG...ARLTLTLRNGEMHRP
Q6MDI8_PARUW/7-377...............................................IFTAQGATLLTTTS....LNQENTFDDLLIENM
B8CYX9_HALOH/6-362...............................................LIKARKAVWQ.........GDKWHFYNGNIYYF
Q1IRI3_KORVE/8-376...............................................ITMAERGVVVAEGP....NSLHLHLENGTQQET
O83854_TREPA/1-358...............................................VVSSRKSVLESSADQ..TVPFTIRMHDPCMLIV
Q8D297_WIGBR/7-348...............................................IKSSKYAIFK.........NKEWIMFDVKTIKF
Q9AA49_CAUCR/9-364...............................................ILTAVSAVVHKNPAD...SHIALELTNGRQ...
Q3J9X2_NITOC/9-352...............................................LLRAARGHLQTDEAT...GDKYLILEDGYRYEL
A7IJ85_XANP2/6-384...............................................TYLADRGQIIESDA.....GIFLVLENGSIQRR
Q0C1U7_HYPNA/7-360...............................................LLTGGSGKLREIRAG..EWEITLLGGAGASYRD
Q0BVK4_GRABC/5-352...............................................YLHAQSADILP........NDRWVLHDVLSRTL
Q5FU64_GLUOX/35-392...............................................RVEAPQGALG.........DHQWILHGTSVLHP
Q5FPA9_GLUOX/26-376...............................................TEHTNVLTYR.........DGQWHPDGAQDLSL
Q1D895_MYXXD/6-362...............................................LVLAQRGQVGTSTSG...EVLRFALEAGEVHRS
A1AXG9_RUTMC/6-356...............................................IVHSDSAISN.........GDNLELSQSIHYQF
A6QBC8_SULNB/6-335...............................................FFSSKQGQLNRDKL.....VASLLLKEGYGYTY
A6QBZ1_SULNB/12-355...............................................TIKAPVAVFN.........GEEWIAQNATVKTH
Q7VQS9_BLOFL/5-358...............................................IITADQGSIHYNFND...KSQLIILQSGMYYEI
Q73NV8_TREDE/6-354...............................................VIKSSHMVWN.........EDRWTTDSAEVYRF
B4E8H0_BURCJ/7-345...............................................VVVSQTGHTETSKD....GDRFVVLEDGRRYDG
J9ZCA2_LEPFM/6-351...............................................VIMAREGSLLNEENG..RPGIRIQLRSGTLLQG
J9ZCM7_LEPFM/6-356...............................................QVDAKTLRYH.........QGLWSFQDGHLTRF
O26028_HELPY/5-350...............................................YAEAKEAFFE.........DKYWILHDTTIYEM
O51747_BORBU/11-425...............................................IFMAKNLDIRKENF.....QVYFILNDVLSIAL
O51748_BORBU/7-350...............................................RYDINKAEWK.........DNKWRLYGIREFVK
O84846_CHLTR/8-346...............................................IGFIETIIPDVNKDSV.QAKNVLVISKIPLFSE
LPTG_HAEIN/7-355...............................................LKHANQASYSED.......EAKWTLRQVNHSTI
Q2JLS4_SYNJB/13-367...............................................VTLAAQAVWN.........GLEWSLSEGATHLY
Q2YN46_BRUA2/7-357...............................................IYYAADGAIASTPS.....GDMLLMENGEVQRR
Q5NFB9_FRATT/8-349...............................................IRYAESATYINDAS.....ANVFNIRKIIFPAS
Q5NFC0_FRATT/6-350...............................................VMTAPTAKIVSDKT.....AAYIDFMNVNIYTK
Q5SL95_THET8/4-334...............................................VYSAEEGLWD.........EEGWRLKGYVV.EG
Q7CKF4_YERPE/5-345...............................................VVVADSGHMSELPD....GSQMVILNKGTRYEG
Q8F742_LEPIN/134-585...............................................IINAAKGNLVEKLGPDGEYEKSIRLKDGWILEW
Q8F8T0_LEPIN/30-383...............................................VISSLKAKYNYE.......TKLWKMKKVEEWHF
Q8PCR2_XANCP/10-365...............................................LTYAAVAEHR.........EGRWTLRQVRRDTF
Q8PCR3_XANCP/6-349...............................................VVTAERGAMFFEGK....TDRYLRLEDGHRIEG
Q8RER6_FUSNN/12-360...............................................IITAKSAKFDTE.......ENKWIFSNVNIYNV
Q9X257_THEMA/19-363...............................................IVTAKRVQKK.........GNDWYLFDGNYYTV
Q9ZCH3_RICPR/10-357...............................................RIDALYGIID.........NKKLYLNRVKVST.
R6X2Y4_9PORP/1-468...............................................VMVADSGRLKTSADK...MFLVLSLFNGESFRS

PF00528

GLNP_ECOLI/33-218--------------------------------------------------------------------------------
YQGH_BACSU/107-309--------------------------------------------------------------------------------
YQGI_BACSU/80-293--------------------------------------------------------------------------------
NIKB_ECOLI/116-308--------------------------------------------------------------------------------
Q97UG4_SULSO/116-318--------------------------------------------------------------------------------
YCKA_BACSU/41-224--------------------------------------------------------------------------------
Q97VK6_SULSO/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
OPUBD_BACSU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
Y355_HAEIN/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
GLNP_RICPR/33-217--------------------------------------------------------------------------------
AMIC_STRR6/298-492--------------------------------------------------------------------------------
TCYB_BACSU/46-230--------------------------------------------------------------------------------
AMID_STRR6/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
Q9X0U9_THEMA/119-323--------------------------------------------------------------------------------
UGPA_ECOLI/90-294--------------------------------------------------------------------------------
SAPB_HAEIN/93-316--------------------------------------------------------------------------------
MSMG_STRMU/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
HISQ_SALTY/27-221--------------------------------------------------------------------------------
NIKC_ECOLI/89-273--------------------------------------------------------------------------------
Q9WYD8_THEMA/94-282--------------------------------------------------------------------------------
POTH_ECOLI/117-315--------------------------------------------------------------------------------
LPLC_BACSU/93-290--------------------------------------------------------------------------------
CYST_ECOLI/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
Q97VF6_SULSO/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
MALD_STRR6/87-275--------------------------------------------------------------------------------
GLTJ_ECOLI/43-239--------------------------------------------------------------------------------
YEHW_ECOLI/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
Q9A534_CAUCR/67-247--------------------------------------------------------------------------------
YEJB_ECOLI/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
YEHY_ECOLI/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
Q9WY46_THEMA/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
UGPE_ECOLI/91-278--------------------------------------------------------------------------------
OPPB_LACLA/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
Q9PPS8_UREPA/183-374--------------------------------------------------------------------------------
PSTA_ECOLI/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
MALC_STRR6/209-434--------------------------------------------------------------------------------
LPLB_BACSU/104-314--------------------------------------------------------------------------------
YHDY_ECOLI/173-362--------------------------------------------------------------------------------
A0A023Z6E4_ECOLX/104-273--------------------------------------------------------------------------------
Q7ANQ9_RHIME/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
Q2FVE8_STAA8/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
Q9KKK5_VIBCH/118-310--------------------------------------------------------------------------------
YEJE_ECOLI/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
SSUC_BACSU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205--------------------------------------------------------------------------------
A1SH34_NOCSJ/795-890--------------------------------------------------------------------------------
A1SKN4_NOCSJ/326-416--------------------------------------------------------------------------------
A1TXE6_MARHV/209-306--------------------------------------------------------------------------------
A3I1M1_9BACT/315-407--------------------------------------------------------------------------------
A3I2Y5_9BACT/772-861--------------------------------------------------------------------------------
A3QAU8_SHELP/338-429--------------------------------------------------------------------------------
A4VW57_STRSY/1024-1117--------------------------------------------------------------------------------
A4YKC0_BRASO/760-849--------------------------------------------------------------------------------
A5N346_CLOK5/499-593--------------------------------------------------------------------------------
A5USK7_ROSS1/337-433--------------------------------------------------------------------------------
A6H1M7_FLAPJ/310-410--------------------------------------------------------------------------------
A6L8W9_PARD8/679-767--------------------------------------------------------------------------------
A6LCJ9_PARD8/311-395--------------------------------------------------------------------------------
A6LZM8_CLOB8/312-398--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/290-387--------------------------------------------------------------------------------
A7H957_ANADF/310-394--------------------------------------------------------------------------------
A7HK62_FERNB/280-383--------------------------------------------------------------------------------
A8ABZ3_IGNH4/274-373--------------------------------------------------------------------------------
A8AR20_CITK8/257-351--------------------------------------------------------------------------------
A9KQT2_CLOPH/369-506--------------------------------------------------------------------------------
B2HGJ6_MYCMM/200-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/285-374--------------------------------------------------------------------------------
B7VH43_VIBTL/299-399--------------------------------------------------------------------------------
B8I8J6_CLOCE/322-424--------------------------------------------------------------------------------
D4K997_9FIRM/688-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/289-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/288-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/713-801--------------------------------------------------------------------------------
O28455_ARCFU/301-396--------------------------------------------------------------------------------
O50782_BORBU/302-402--------------------------------------------------------------------------------
Y684_MYCPN/1015-1110--------------------------------------------------------------------------------
Q01VW7_SOLUE/1304-1396--------------------------------------------------------------------------------
Q025M3_SOLUE/377-471--------------------------------------------------------------------------------
Q034M7_LACC3/430-519--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/176-262--------------------------------------------------------------------------------
Q0RJL1_FRAAA/665-753--------------------------------------------------------------------------------
Q18EP9_HALWD/325-419--------------------------------------------------------------------------------
Q1G8P7_LACDA/306-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/85-179--------------------------------------------------------------------------------
Q2RPK1_RHORT/306-403--------------------------------------------------------------------------------
Q47EZ3_DECAR/269-372--------------------------------------------------------------------------------
Q481M7_COLP3/731-820--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1828-1923--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2549-2644--------------------------------------------------------------------------------
Q4DFN5_TRYCC/470-565--------------------------------------------------------------------------------
Q4QBC9_LEIMA/1003-1097--------------------------------------------------------------------------------
Q54MT9_DICDI/571-666--------------------------------------------------------------------------------
Q5JEM5_THEKO/229-318--------------------------------------------------------------------------------
Q5LCL1_BACFN/298-387--------------------------------------------------------------------------------
Q5LDA1_BACFN/308-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/320-426--------------------------------------------------------------------------------
Q5V3A9_HALMA/900-995--------------------------------------------------------------------------------
Q6AA47_PROAC/625-722--------------------------------------------------------------------------------
Q6AMB4_DESPS/311-415--------------------------------------------------------------------------------
Q6F163_MESFL/1307-1400--------------------------------------------------------------------------------
Q6F1V8_MESFL/1717-1810--------------------------------------------------------------------------------
Q6F1W1_MESFL/1327-1420--------------------------------------------------------------------------------
Q6MGV4_BDEBA/685-778--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/397-490--------------------------------------------------------------------------------
Q6MT15_MYCMS/588-682--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1693-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/268-362--------------------------------------------------------------------------------
Q7UPA2_RHOBA/607-706--------------------------------------------------------------------------------
Q7V1V4_PROMP/299-384--------------------------------------------------------------------------------
Q81HP3_BACCR/261-351--------------------------------------------------------------------------------
Q81QE5_BACAN/286-379--------------------------------------------------------------------------------
Q830M8_ENTFA/609-698--------------------------------------------------------------------------------
Q87SX2_VIBPA/317-410--------------------------------------------------------------------------------
Q899W1_CLOTE/276-369--------------------------------------------------------------------------------
Q8A9F6_BACTN/292-381--------------------------------------------------------------------------------
Q8CYG6_STRR6/429-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/86-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/328-451--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1386-1480--------------------------------------------------------------------------------
Q8EZY9_LEPIN/286-379--------------------------------------------------------------------------------
Q8G7P9_BIFLO/348-438--------------------------------------------------------------------------------
Q8KD33_CHLTE/294-389--------------------------------------------------------------------------------
Q8NS27_CORGL/639-739--------------------------------------------------------------------------------
Q8Y6E1_LISMO/85-180--------------------------------------------------------------------------------
Q97DB8_CLOAB/742-835--------------------------------------------------------------------------------
Q97LN0_CLOAB/763-854--------------------------------------------------------------------------------
Q9A6K3_CAUCR/378-465--------------------------------------------------------------------------------
Q9FBP3_STRCO/683-772--------------------------------------------------------------------------------
Q9KF85_BACHD/565-650--------------------------------------------------------------------------------
Q9PPU7_UREPA/189-284--------------------------------------------------------------------------------
Q9WZG5_THEMA/751-844--------------------------------------------------------------------------------
R5K905_9CLOT/831-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/371-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/299-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/319-410--------------------------------------------------------------------------------
R6WL88_9PORP/179-267--------------------------------------------------------------------------------
R6WLH2_9PORP/307-392--------------------------------------------------------------------------------
R6WYF0_9PORP/312-402--------------------------------------------------------------------------------
R6X6U4_9PORP/300-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/317-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355SNG..................................YQSFTTKPTATIRLA.LRPKALHEMRLQP..............
Q118T4_TRIEI/24-389SPDGS................................YRNIVKFDHKKLKLS.TAPLDLAGKRRTY..............
A0LEN9_SYNFM/39-391ADDMK................................NAQAVSFKAYDLSLS.LDELIGSARGSKMN.............
A7HYF9_PARL1/7-370SRSGTE.............................TSAATFLYFDKYTYDLS.QYMEDEPTLSYEG..............
Q8DIL4_THEEB/18-374SHTGV................................SRNLLQFDQQEIRLP.RPAQSQPLRPTDV..............
Q82W93_NITEU/6-348SFDTV................................KDSAIRFEKM.IYFN.ENDQAQNYRR.................
A0LB31_MAGMM/6-364NGH..................................TTQSEPFTRMPWAIN.LEKEQIKRATPQP..............
Q6MKD0_BDEBA/11-364AK...................................THTKISFDTYDVRFS..EPQNIEEKAKSP..............
Q6FFD6_ACIAD/9-354QGQG.................................DAVLANAAKQPFSLA.LQPKYVHMVTIDP..............
Q0C1U6_HYPNA/7-346D......................................GEPPTDMTFWTSP.QTPESLQLLLSPP..............
Q11U59_CYTH3/9-455FKGEGGMSY........................INPEEFVRNSFDKTKIVFN.LSSFDLKKTKEELFMGSRQMKGVDELD
A1AWC7_RUTMC/20-369FPSNKN..............................KKILNFKLYDLQIIDG.KMQKSISTVTKV...............
Q73NV9_TREDE/13-373.....................................DLNNRSKFDVVYGES.ITYNVLAKDVAPKFIS...........
Q1GR36_SPHAL/14-363R....................................SGTLEPLGTIVAAPN.VRPDQFTLADVDG..............
A5EXI6_DICNV/8-348RDDF.................................QPQNCLFSQFAHGSL.HLSQSPPSAQQRL..............
Q7VQS8_BLOFL/9-358VDKM.................................QFLNRKILSYEWNTT.LTPAILSMITVNP..............
Q310A0_DESAG/6-352GSY..................................EVATSESIVLPIEQD.VKAFSIVDPRGDP..............
Q5SL96_THET8/6-344.....................................ITYEGSRPRTLARFQ.RGELVLKDLTFDPWQ............
Q6MJL5_BDEBA/6-356NKDSS................................FPLTSPFKTKSIVMA.EDSKDLQSAGQTA..............
A5WBH3_PSYWF/27-466GADSL................................VYSQIGFERYRISIN.QPPADVLTEENV...............
E0TCF8_PARBH/6-360IA...................................TTAPQIEAEIEVPVA.IDLRLLDQDRQTA..............
Q984S3_RHILO/7-356.....................................NGTIQPSASDRVPTN.LKPEFVQERLARP..............
Q2S3I0_SALRD/55-410VKGE.................................TQRKRTIASLDTTLQ.VYPRDLARSKNDV..............
Q1IRI3_KORVE/435-789NGSA.................................IEEFKPFEVETIALAAEPPAYFKKEVRQS..............
A1WAC0_ACISJ/11-359TPDGA................................IATTRFVDGYVEDFS.KTRAPYRDRGETA..............
Q8D296_WIGBR/5-350DFKSN................................YFFIASFERYQIELF.NTFSRLKEPSS................
Q6MDI9_PARUW/8-358.....................................LLQQQAYSQYEFKNLLFNQELLQSAILDP..............
Q9A939_CAUCR/5-350AGD..................................LSQASTAAATSWPTA.LRPQDVQGLFGD...............
Q1D894_MYXXD/7-356DGEG.................................KTSVRQLPEAEYDLG.VAVTAFRIRPGRP..............
Q1QKW5_NITHX/6-356EAGKR................................EPNMVAFRRNAFDMS.KFSNRGHDVVYGI..............
Q143Z1_BURXL/6-377IDVPPPPGTPA...................DALNPVYRAKEVAVPEYSLRSE.LTPQILSVLLVSP..............
B5EBA8_GEOBB/11-361EEQG.................................GYRMVQFQEYNLRVALADGSNKATRKV................
A3I2C6_9BACT/6-354NEF..................................GEDYSVGEEMDTTLS.ITPDDFDLPENHH..............
Q2RQ55_RHORT/8-372NRQTG................................KVNFLYFDSYAVDLG.GKAASTEMRFREE..............
A1WUU9_HALHL/6-348ADH..................................RLERRELEAWAWQGA.LSPDVLAVVVADP..............
A5G1T7_ACICJ/24-378DPKTG................................RLNILSFRRNLISLA.KPTGVTRKLAPKT..............
Q3B4Y3_CHLL7/6-432QVPGH...............................RLYRKMEFDRHRFVFE.STGFGFSRSSENRARSGGHELSARELL
Q0BZX3_HYPNA/9-369.....................................NQAPERRATLAIPTS.LDAVRLLDEYASP..............
A2U291_9FLAO/6-450HVKSARTT.........................IKRKKMAASSATFKEYEFN.IDIGDTLDEGQLDSINSATIPMMLTLD
A0LB30_MAGMM/6-357APGN.................................AYRRLNFSTYDLELGIAFETESSSGDRAI..............
E0TCF9_PARBH/51-404DRETG................................RVDVFRYIETAVDLA.AFDRGSGGRSLDE..............
A5EXI7_DICNV/7-348GS...................................QSSMPITPTTHWQNR.ILPATIAQLMQLK..............
B8CYZ1_HALOH/12-360NGEGH................................LTMETRFDVMEIKIN.TEVHNFFADQKTP..............
Q1MPZ1_LAWIP/7-360SLN..................................KTSFLSFDQYLVRIP.LTTLLKNINFNELR.............
A8ZZ83_DESOH/6-356DVAGN................................VQLVEFRERLKIELD.LLPEDLDRAAESA..............
A8EWU1_ARCB4/5-331DKE..................................EFNQINYEAMYINDS.ISTAKTTVFTTTY..............
Q31ET4_THICR/6-346LK...................................KGDDFTVREFDRFEG.FLPEIQSTSTAQQ..............
Q1IZ54_DEIGD/6-380NYAAAARL..........................ARVPENDPAAFRTAVQEV.FPNVVLPEDASSTLNLD..........
Q1J2D3_DEIGD/10-350GQDPR...............................QVAGPLVFPQTDTLRPPQPPA.......................
Q2S0T8_SALRD/7-449LPPDANN...........................QSERYERLTFDRHRIRFT.LSNVVFRRSESEETARSTRTMRTPRLL
Q6MDI8_PARUW/7-377KKSTTHVE..........................DFSQILQKKVWTVNNDYL.KLPLLLIRAQEQK..............
B8CYX9_HALOH/6-362KEGE.................................RVPALKFNEYVIKQPIYTPRRIGKMNKDI..............
Q1IRI3_KORVE/8-376NPKDP...............................TQYQVSTFDQTDIPIQLPETNDKPAPELVP..............
O83854_TREPA/1-358.....................................YRTRPRICDLIYGGR.ADYHVHTQQTQPEYFM...........
Q8D297_WIGBR/7-348NNNK.................................KIEINSFDKQIYTNI.ITPKEINLILFPT..............
Q9AA49_CAUCR/9-364.....................................ISTVAGAQSYVVNFS.RLMFDVPSGDAGLLRLR..........
Q3J9X2_NITOC/9-352MGEEV................................GVRIFSFERHGILVK.KGGAQEFRIRH................
A7IJ85_XANP2/6-384GGAAKEAEKDASEAN...........KDAGKDKGKSSNSSVVEFQRYAFDLS.SLAPNSQGQDVKP..............
Q0C1U7_HYPNA/7-360ADPPE................................EYDRIEYGELSWPVI.AETGQYRARGGDE..............
Q0BVK4_GRABC/5-352VDG..................................QLRKAHLDRLDWTPF.LTPQQTQFLRLRP..............
Q5FU64_GLUOX/35-392.....................................DHLPQQIGDMTLPSD.LTVGRVQESFASP..............
Q5FPA9_GLUOX/26-376SDDK.................................SYVNVTKGDSTFVIP.ATPSVIMTLSQNG..............
Q1D895_MYXXD/6-362AGRET...............................EEYSIIRFDQAEISVGVGASMGKRSRFSYS..............
A1AXG9_RUTMC/6-356GKDGNL..............................TTFSENNFEKYSVQVS.FNKKLIENLKKDP..............
A6QBC8_SULNB/6-335TKN..................................KLQQAKYKSLEVFDS.KQKYRFHFQ..................
A6QBZ1_SULNB/12-355IYQNGE.............................LVRYSMDQKESIATLHG.YKPKIIESLYEG...............
Q7VQS9_BLOFL/5-358HNTQLL.............................CIPRFVTYFNQYRTLVH.DKYQFLRDVNKSV..............
Q73NV8_TREDE/6-354DEKN.................................SVSCLNNIPDNIILS.EPPANFQKNLSSV..............
B4E8H0_BURCJ/7-345TPGQP................................NFKIMEFERYGVKIT.SKPVTNVQTTN................
J9ZCA2_LEPFM/6-351GA...................................AQQFVRFSSYDLTIF.GKSAGTTAKPP................
J9ZCM7_LEPFM/6-356LPDG.................................SLKIESFQKMDTTLT.RRPVDFTYEKTRM..............
O26028_HELPY/5-350PLSFELG............................ANALSTTRLKTFKTLKN.FRPKVLDTIYQNK..............
O51747_BORBU/11-425TDSESGFYDYFYADKMKYSIDQVTFSDSFLLNYVTPSQ.........................MSMRDVIKLIKKQNNLI
O51748_BORBU/7-350VGKKI................................KENAYDVLDGTGIIK.LAPDYIRTVMLSS..............
O84846_CHLTR/8-346AR...................................TSNPNEFYLETLDEF.LIPKITATLFAGK..............
LPTG_HAEIN/7-355MKD..................................EIITTNHLSETWETS.LTPDKLGAVSLRP..............
Q2JLS4_SYNJB/13-367GPTGL................................SIAEQTFHRKPLQVS.QDLAALMQPPVPP..............
Q2YN46_BRUA2/7-357NVSDG................................TVSIIKFDSYAFDLN.QFASAGDDFVIFA..............
Q5NFB9_FRATT/8-349DGQKH................................IDIVTNMTNAVWSNP.LPISVAKVITIND..............
Q5NFC0_FRATT/6-350NSQNS................................EYSYDNAKKAIYTIF..DNSDRDYNHDRV..............
Q5SL95_THET8/4-334.....................................EEVRPFEGVLPFPAR.FRPKESLGSRDPY..............
Q7CKF4_YERPE/5-345TALLR................................DFRITDFVDYQAVIG.HKQVQQSSNG..A..............
Q8F742_LEPIN/134-585SDDRK................................TFSITDFRNGEMDYNIPKGKEKKTLELNVKPETFSMPVLFQIR
Q8F8T0_LEPIN/30-383DNDLK................................LSSQETYEEKEYELP.EEPSYFKVPAGSV..............
Q8PCR2_XANCP/10-365QAR..................................SVQRETFPELPWQSQ.LNPKALAAGLAKP..............
Q8PCR3_XANCP/6-349PAGAQG..............................LDYRLMTFASNDVALP.DRTKAHDA..NDP..............
Q8RER6_FUSNN/12-360ETKE.................................TTAKIEYKSNLYKDD..PSNFIKASAEDP..............
Q9X257_THEMA/19-363DKDGF................................LKLDVHFSEMKLDIT.EDIEKLLRVGKTP..............
Q9ZCH3_RICPR/10-357.....................................KDEIKSYSNLTIQTN.LSINSLVNKFMRP..............
R6X2Y4_9PORP/1-468LDKQPSTAG.......................TKSSVPYQRETFKSRDILIE.FD.ANFSRTDESFMQNQFMGKNMHDLQ

PF00528

GLNP_ECOLI/33-218--------------------------------------------------------------------------------
YQGH_BACSU/107-309--------------------------------------------------------------------------------
YQGI_BACSU/80-293--------------------------------------------------------------------------------
NIKB_ECOLI/116-308--------------------------------------------------------------------------------
Q97UG4_SULSO/116-318--------------------------------------------------------------------------------
YCKA_BACSU/41-224--------------------------------------------------------------------------------
Q97VK6_SULSO/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
OPUBD_BACSU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
Y355_HAEIN/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
GLNP_RICPR/33-217--------------------------------------------------------------------------------
AMIC_STRR6/298-492--------------------------------------------------------------------------------
TCYB_BACSU/46-230--------------------------------------------------------------------------------
AMID_STRR6/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
Q9X0U9_THEMA/119-323--------------------------------------------------------------------------------
UGPA_ECOLI/90-294--------------------------------------------------------------------------------
SAPB_HAEIN/93-316--------------------------------------------------------------------------------
MSMG_STRMU/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
HISQ_SALTY/27-221--------------------------------------------------------------------------------
NIKC_ECOLI/89-273--------------------------------------------------------------------------------
Q9WYD8_THEMA/94-282--------------------------------------------------------------------------------
POTH_ECOLI/117-315--------------------------------------------------------------------------------
LPLC_BACSU/93-290--------------------------------------------------------------------------------
CYST_ECOLI/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
Q97VF6_SULSO/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
MALD_STRR6/87-275--------------------------------------------------------------------------------
GLTJ_ECOLI/43-239--------------------------------------------------------------------------------
YEHW_ECOLI/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
Q9A534_CAUCR/67-247--------------------------------------------------------------------------------
YEJB_ECOLI/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
YEHY_ECOLI/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
Q9WY46_THEMA/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
UGPE_ECOLI/91-278--------------------------------------------------------------------------------
OPPB_LACLA/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
Q9PPS8_UREPA/183-374--------------------------------------------------------------------------------
PSTA_ECOLI/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
MALC_STRR6/209-434--------------------------------------------------------------------------------
LPLB_BACSU/104-314--------------------------------------------------------------------------------
YHDY_ECOLI/173-362--------------------------------------------------------------------------------
A0A023Z6E4_ECOLX/104-273--------------------------------------------------------------------------------
Q7ANQ9_RHIME/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
Q2FVE8_STAA8/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
Q9KKK5_VIBCH/118-310--------------------------------------------------------------------------------
YEJE_ECOLI/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
SSUC_BACSU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205--------------------------------------------------------------------------------
A1SH34_NOCSJ/795-890--------------------------------------------------------------------------------
A1SKN4_NOCSJ/326-416--------------------------------------------------------------------------------
A1TXE6_MARHV/209-306--------------------------------------------------------------------------------
A3I1M1_9BACT/315-407--------------------------------------------------------------------------------
A3I2Y5_9BACT/772-861--------------------------------------------------------------------------------
A3QAU8_SHELP/338-429--------------------------------------------------------------------------------
A4VW57_STRSY/1024-1117--------------------------------------------------------------------------------
A4YKC0_BRASO/760-849--------------------------------------------------------------------------------
A5N346_CLOK5/499-593--------------------------------------------------------------------------------
A5USK7_ROSS1/337-433--------------------------------------------------------------------------------
A6H1M7_FLAPJ/310-410--------------------------------------------------------------------------------
A6L8W9_PARD8/679-767--------------------------------------------------------------------------------
A6LCJ9_PARD8/311-395--------------------------------------------------------------------------------
A6LZM8_CLOB8/312-398--------------------------------------------------------------------------------
A6TSQ0_ALKMQ/290-387--------------------------------------------------------------------------------
A7H957_ANADF/310-394--------------------------------------------------------------------------------
A7HK62_FERNB/280-383--------------------------------------------------------------------------------
A8ABZ3_IGNH4/274-373--------------------------------------------------------------------------------
A8AR20_CITK8/257-351--------------------------------------------------------------------------------
A9KQT2_CLOPH/369-506--------------------------------------------------------------------------------
B2HGJ6_MYCMM/200-292--------------------------------------------------------------------------------
B4EEB5_BURCJ/285-374--------------------------------------------------------------------------------
B7VH43_VIBTL/299-399--------------------------------------------------------------------------------
B8I8J6_CLOCE/322-424--------------------------------------------------------------------------------
D4K997_9FIRM/688-783--------------------------------------------------------------------------------
D4KYJ1_9FIRM/289-395--------------------------------------------------------------------------------
D4KYJ2_9FIRM/288-378--------------------------------------------------------------------------------
M1FFQ7_9ALTE/713-801--------------------------------------------------------------------------------
O28455_ARCFU/301-396--------------------------------------------------------------------------------
O50782_BORBU/302-402--------------------------------------------------------------------------------
Y684_MYCPN/1015-1110--------------------------------------------------------------------------------
Q01VW7_SOLUE/1304-1396--------------------------------------------------------------------------------
Q025M3_SOLUE/377-471--------------------------------------------------------------------------------
Q034M7_LACC3/430-519--------------------------------------------------------------------------------
Q0P8Y0_CAMJE/176-262--------------------------------------------------------------------------------
Q0RJL1_FRAAA/665-753--------------------------------------------------------------------------------
Q18EP9_HALWD/325-419--------------------------------------------------------------------------------
Q1G8P7_LACDA/306-403--------------------------------------------------------------------------------
Q2FUZ2_STAA8/85-179--------------------------------------------------------------------------------
Q2RPK1_RHORT/306-403--------------------------------------------------------------------------------
Q47EZ3_DECAR/269-372--------------------------------------------------------------------------------
Q481M7_COLP3/731-820--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/1828-1923--------------------------------------------------------------------------------
Q4A9N5_MYCHJ/2549-2644--------------------------------------------------------------------------------
Q4DFN5_TRYCC/470-565--------------------------------------------------------------------------------
Q4QBC9_LEIMA/1003-1097--------------------------------------------------------------------------------
Q54MT9_DICDI/571-666--------------------------------------------------------------------------------
Q5JEM5_THEKO/229-318--------------------------------------------------------------------------------
Q5LCL1_BACFN/298-387--------------------------------------------------------------------------------
Q5LDA1_BACFN/308-392--------------------------------------------------------------------------------
Q5LFF2_BACFN/320-426--------------------------------------------------------------------------------
Q5V3A9_HALMA/900-995--------------------------------------------------------------------------------
Q6AA47_PROAC/625-722--------------------------------------------------------------------------------
Q6AMB4_DESPS/311-415--------------------------------------------------------------------------------
Q6F163_MESFL/1307-1400--------------------------------------------------------------------------------
Q6F1V8_MESFL/1717-1810--------------------------------------------------------------------------------
Q6F1W1_MESFL/1327-1420--------------------------------------------------------------------------------
Q6MGV4_BDEBA/685-778--------------------------------------------------------------------------------
Q6MSQ5_MYCMS/397-490--------------------------------------------------------------------------------
Q6MT15_MYCMS/588-682--------------------------------------------------------------------------------
Q6MUJ8_MYCMS/1693-1786--------------------------------------------------------------------------------
Q79Z83_STRAW/268-362--------------------------------------------------------------------------------
Q7UPA2_RHOBA/607-706--------------------------------------------------------------------------------
Q7V1V4_PROMP/299-384--------------------------------------------------------------------------------
Q81HP3_BACCR/261-351--------------------------------------------------------------------------------
Q81QE5_BACAN/286-379--------------------------------------------------------------------------------
Q830M8_ENTFA/609-698--------------------------------------------------------------------------------
Q87SX2_VIBPA/317-410--------------------------------------------------------------------------------
Q899W1_CLOTE/276-369--------------------------------------------------------------------------------
Q8A9F6_BACTN/292-381--------------------------------------------------------------------------------
Q8CYG6_STRR6/429-522--------------------------------------------------------------------------------
Q8DQ76_STRR6/86-181--------------------------------------------------------------------------------
Q8DQS2_STRR6/328-451--------------------------------------------------------------------------------
Q8EUA2_MYCPE/1386-1480--------------------------------------------------------------------------------
Q8EZY9_LEPIN/286-379--------------------------------------------------------------------------------
Q8G7P9_BIFLO/348-438--------------------------------------------------------------------------------
Q8KD33_CHLTE/294-389--------------------------------------------------------------------------------
Q8NS27_CORGL/639-739--------------------------------------------------------------------------------
Q8Y6E1_LISMO/85-180--------------------------------------------------------------------------------
Q97DB8_CLOAB/742-835--------------------------------------------------------------------------------
Q97LN0_CLOAB/763-854--------------------------------------------------------------------------------
Q9A6K3_CAUCR/378-465--------------------------------------------------------------------------------
Q9FBP3_STRCO/683-772--------------------------------------------------------------------------------
Q9KF85_BACHD/565-650--------------------------------------------------------------------------------
Q9PPU7_UREPA/189-284--------------------------------------------------------------------------------
Q9WZG5_THEMA/751-844--------------------------------------------------------------------------------
R5K905_9CLOT/831-926--------------------------------------------------------------------------------
R5KJ88_9CLOT/371-467--------------------------------------------------------------------------------
R5TSZ9_9FIRM/299-417--------------------------------------------------------------------------------
R5UPZ8_9BACE/319-410--------------------------------------------------------------------------------
R6WL88_9PORP/179-267--------------------------------------------------------------------------------
R6WLH2_9PORP/307-392--------------------------------------------------------------------------------
R6WYF0_9PORP/312-402--------------------------------------------------------------------------------
R6X6U4_9PORP/300-397--------------------------------------------------------------------------------
R7EAJ1_9BACE/317-408--------------------------------------------------------------------------------

PF03739

Q3ATU7_CHLCH/6-355................................................................................
Q118T4_TRIEI/24-389................................................................................
A0LEN9_SYNFM/39-391................................................................................
A7HYF9_PARL1/7-370................................................................................
Q8DIL4_THEEB/18-374................................................................................
Q82W93_NITEU/6-348................................................................................
A0LB31_MAGMM/6-364................................................................................
Q6MKD0_BDEBA/11-364................................................................................
Q6FFD6_ACIAD/9-354................................................................................
Q0C1U6_HYPNA/7-346................................................................................
Q11U59_CYTH3/9-455HHIDSIQRMFVSVN.............................................KNSSGMLQPFYYYTTVNPLDS
A1AWC7_RUTMC/20-369................................................................................
Q73NV9_TREDE/13-373................................................................................
Q1GR36_SPHAL/14-363................................................................................
A5EXI6_DICNV/8-348................................................................................
Q7VQS8_BLOFL/9-358................................................................................
Q310A0_DESAG/6-352................................................................................
Q5SL96_THET8/6-344................................................................................
Q6MJL5_BDEBA/6-356................................................................................
A5WBH3_PSYWF/27-466................................................................................
E0TCF8_PARBH/6-360................................................................................
Q984S3_RHILO/7-356................................................................................
Q2S3I0_SALRD/55-410................................................................................
Q1IRI3_KORVE/435-789................................................................................
A1WAC0_ACISJ/11-359................................................................................
Q8D296_WIGBR/5-350................................................................................
Q6MDI9_PARUW/8-358................................................................................
Q9A939_CAUCR/5-350................................................................................
Q1D894_MYXXD/7-356................................................................................
Q1QKW5_NITHX/6-356................................................................................
Q143Z1_BURXL/6-377................................................................................
B5EBA8_GEOBB/11-361................................................................................
A3I2C6_9BACT/6-354................................................................................
Q2RQ55_RHORT/8-372................................................................................
A1WUU9_HALHL/6-348................................................................................
A5G1T7_ACICJ/24-378................................................................................
Q3B4Y3_CHLL7/6-432..........................................................................SVAEEY
Q0BZX3_HYPNA/9-369................................................................................
A2U291_9FLAO/6-450QIKDTIPMLKDNYDEILG......................................LRAKNIFISTSAKDLYEYPDSLKN
A0LB30_MAGMM/6-357................................................................................
E0TCF9_PARBH/51-404................................................................................
A5EXI7_DICNV/7-348................................................................................
B8CYZ1_HALOH/12-360................................................................................
Q1MPZ1_LAWIP/7-360................................................................................
A8ZZ83_DESOH/6-356................................................................................
A8EWU1_ARCB4/5-331................................................................................
Q31ET4_THICR/6-346................................................................................
Q1IZ54_DEIGD/6-380................................................................................
Q1J2D3_DEIGD/10-350................................................................................
Q2S0T8_SALRD/7-449DTLD..................................................................SLKTERDARY
Q6MDI8_PARUW/7-377................................................................................
B8CYX9_HALOH/6-362................................................................................
Q1IRI3_KORVE/8-376................................................................................
O83854_TREPA/1-358................................................................................
Q8D297_WIGBR/7-348................................................................................
Q9AA49_CAUCR/9-364................................................................................
Q3J9X2_NITOC/9-352................................................................................
A7IJ85_XANP2/6-384................................................................................
Q0C1U7_HYPNA/7-360................................................................................
Q0BVK4_GRABC/5-352................................................................................
Q5FU64_GLUOX/35-392................................................................................
Q5FPA9_GLUOX/26-376................................................................................
Q1D895_MYXXD/6-362................................................................................
A1AXG9_RUTMC/6-356................................................................................
A6QBC8_SULNB/6-335................................................................................
A6QBZ1_SULNB/12-355................................................................................
Q7VQS9_BLOFL/5-358................................................................................
Q73NV8_TREDE/6-354................................................................................
B4E8H0_BURCJ/7-345................................................................................
J9ZCA2_LEPFM/6-351................................................................................
J9ZCM7_LEPFM/6-356................................................................................
O26028_HELPY/5-350................................................................................
O51747_BORBU/11-425ADSNIKNNLEGDFL..............................................SLNFSNLYLNYLYNQNYYVD
O51748_BORBU/7-350................................................................................
O84846_CHLTR/8-346................................................................................
LPTG_HAEIN/7-355................................................................................
Q2JLS4_SYNJB/13-367................................................................................
Q2YN46_BRUA2/7-357................................................................................
Q5NFB9_FRATT/8-349................................................................................
Q5NFC0_FRATT/6-350................................................................................
Q5SL95_THET8/4-334................................................................................
Q7CKF4_YERPE/5-345................................................................................
Q8F742_LEPIN/134-585NNIESEGLEKIPGLETLQE....................................MGVQIKGLIGLKQMVEQMKIELAMG
Q8F8T0_LEPIN/30-383................................................................................
Q8PCR2_XANCP/10-365................................................................................
Q8PCR3_XANCP/6-349................................................................................
Q8RER6_FUSNN/12-360................................................................................
Q9X257_THEMA/19-363................................................................................
Q9ZCH3_RICPR/10-357................................................................................
R6X2Y4_9PORP/1-468IFIDSVSVRLDSIQNVNAKNVYETSYKKTLKKPQDIKQNNVKDDSNSEKSDTKTTLETPKTDEPVIVMNFDSLYQAENPG

PF00528

GLNP_ECOLI/33-218--------------------------------------------------------------------------------
YQGH_BACSU/107-309--------------------------------------------------------------------------------
YQGI_BACSU/80-293--------------------------------------------------------------------------------
NIKB_ECOLI/116-308--------------------------------------------------------------------------------
Q97UG4_SULSO/116-318--------------------------------------------------------------------------------
YCKA_BACSU/41-224--------------------------------------------------------------------------------
Q97VK6_SULSO/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
OPUBD_BACSU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
Y355_HAEIN/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
GLNP_RICPR/33-217--------------------------------------------------------------------------------
AMIC_STRR6/298-492--------------------------------------------------------------------------------
TCYB_BACSU/46-230--------------------------------------------------------------------------------
AMID_STRR6/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
Q9X0U9_THEMA/119-323--------------------------------------------------------------------------------
UGPA_ECOLI/90-294--------------------------------------------------------------------------------
SAPB_HAEIN/93-316--------------------------------------------------------------------------------
MSMG_STRMU/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
HISQ_SALTY/27-221--------------------------------------------------------------------------------
NIKC_ECOLI/89-273--------------------------------------------------------------------------------
Q9WYD8_THEMA/94-282--------------------------------------------------------------------------------
POTH_ECOLI/117-315--------------------------------------------------------------------------------
LPLC_BACSU/93-290--------------------------------------------------------------------------------
CYST_ECOLI/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
Q97VF6_SULSO/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
MALD_STRR6/87-275--------------------------------------------------------------------------------
GLTJ_ECOLI/43-239--------------------------------------------------------------------------------
YEHW_ECOLI/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
Q9A534_CAUCR/67-247--------------------------------------------------------------------------------
YEJB_ECOLI/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
YEHY_ECOLI/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
Q9WY46_THEMA/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
UGPE_ECOLI/91-278--------------------------------------------------------------------------------
OPPB_LACLA/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
Q9PPS8_UREPA/183-374--------------------------------------------------------------------------------
PSTA_ECOLI/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
MALC_STRR6/209-434--------------------------------------------------------------------------------
LPLB_BACSU/104-314--------------------------------------------------------------------------------
YHDY_ECOLI/173-362--------------------------------------------------------------------------------
A0A023Z6E4_ECOLX/104-273--------------------------------------------------------------------------------
Q7ANQ9_RHIME/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
Q2FVE8_STAA8/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
Q9KKK5_VIBCH/118-310--------------------------------------------------------------------------------
YEJE_ECOLI/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
SSUC_BACSU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205--------------------------------------..F---------------------------------------
A1SH34_NOCSJ/795-890--------------------------------------..L---------------------------------------
A1SKN4_NOCSJ/326-416--------------------------------------...---------------------------------------
A1TXE6_MARHV/209-306--------------------------------------..S---------------------------------------
A3I1M1_9BACT/315-407--------------------------------------..F---------------------------------------
A3I2Y5_9BACT/772-861--------------------------------------..I---------------------------------------
A3QAU8_SHELP/338-429--------------------------------------..L---------------------------------------
A4VW57_STRSY/1024-1117--------------------------------------..L---------------------------------------
A4YKC0_BRASO/760-849--------------------------------------..I---------------------------------------
A5N346_CLOK5/499-593--------------------------------------..L---------------------------------------
A5USK7_ROSS1/337-433--------------------------------------..T---------------------------------------
A6H1M7_FLAPJ/310-410--------------------------------------..I---------------------------------------
A6L8W9_PARD8/679-767--------------------------------------..M---------------------------------------
A6LCJ9_PARD8/311-395--------------------------------------...---------------------------------------
A6LZM8_CLOB8/312-398--------------------------------------..C---------------------------------------
A6TSQ0_ALKMQ/290-387--------------------------------------..R---------------------------------------
A7H957_ANADF/310-394--------------------------------------..A---------------------------------------
A7HK62_FERNB/280-383--------------------------------------..L---------------------------------------
A8ABZ3_IGNH4/274-373--------------------------------------..N---------------------------------------
A8AR20_CITK8/257-351--------------------------------------..L---------------------------------------
A9KQT2_CLOPH/369-506--------------------------------------..V---------------------------------------
B2HGJ6_MYCMM/200-292--------------------------------------..F---------------------------------------
B4EEB5_BURCJ/285-374--------------------------------------..A---------------------------------------
B7VH43_VIBTL/299-399--------------------------------------..L---------------------------------------
B8I8J6_CLOCE/322-424--------------------------------------VYL---------------------------------------
D4K997_9FIRM/688-783--------------------------------------..A---------------------------------------
D4KYJ1_9FIRM/289-395--------------------------------------..G---------------------------------------
D4KYJ2_9FIRM/288-378--------------------------------------..L---------------------------------------
M1FFQ7_9ALTE/713-801--------------------------------------..L---------------------------------------
O28455_ARCFU/301-396--------------------------------------..L---------------------------------------
O50782_BORBU/302-402--------------------------------------..I---------------------------------------
Y684_MYCPN/1015-1110--------------------------------------..V---------------------------------------
Q01VW7_SOLUE/1304-1396--------------------------------------..A---------------------------------------
Q025M3_SOLUE/377-471--------------------------------------..L---------------------------------------
Q034M7_LACC3/430-519--------------------------------------..A---------------------------------------
Q0P8Y0_CAMJE/176-262--------------------------------------..F---------------------------------------
Q0RJL1_FRAAA/665-753--------------------------------------...---------------------------------------
Q18EP9_HALWD/325-419--------------------------------------..T---------------------------------------
Q1G8P7_LACDA/306-403--------------------------------------..S---------------------------------------
Q2FUZ2_STAA8/85-179--------------------------------------..F---------------------------------------
Q2RPK1_RHORT/306-403--------------------------------------..I---------------------------------------
Q47EZ3_DECAR/269-372--------------------------------------..V---------------------------------------
Q481M7_COLP3/731-820--------------------------------------..I---------------------------------------
Q4A9N5_MYCHJ/1828-1923--------------------------------------..L---------------------------------------
Q4A9N5_MYCHJ/2549-2644--------------------------------------..F---------------------------------------
Q4DFN5_TRYCC/470-565--------------------------------------..I---------------------------------------
Q4QBC9_LEIMA/1003-1097--------------------------------------..M---------------------------------------
Q54MT9_DICDI/571-666--------------------------------------..I---------------------------------------
Q5JEM5_THEKO/229-318--------------------------------------..S---------------------------------------
Q5LCL1_BACFN/298-387--------------------------------------..L---------------------------------------
Q5LDA1_BACFN/308-392--------------------------------------..F---------------------------------------
Q5LFF2_BACFN/320-426--------------------------------------FSL---------------------------------------
Q5V3A9_HALMA/900-995--------------------------------------..L---------------------------------------
Q6AA47_PROAC/625-722--------------------------------------..I---------------------------------------
Q6AMB4_DESPS/311-415--------------------------------------..F---------------------------------------
Q6F163_MESFL/1307-1400--------------------------------------..L---------------------------------------
Q6F1V8_MESFL/1717-1810--------------------------------------..M---------------------------------------
Q6F1W1_MESFL/1327-1420--------------------------------------..F---------------------------------------
Q6MGV4_BDEBA/685-778--------------------------------------..S---------------------------------------
Q6MSQ5_MYCMS/397-490--------------------------------------..I---------------------------------------
Q6MT15_MYCMS/588-682--------------------------------------..S---------------------------------------
Q6MUJ8_MYCMS/1693-1786--------------------------------------..I---------------------------------------
Q79Z83_STRAW/268-362--------------------------------------..L---------------------------------------
Q7UPA2_RHOBA/607-706--------------------------------------..L---------------------------------------
Q7V1V4_PROMP/299-384--------------------------------------..L---------------------------------------
Q81HP3_BACCR/261-351--------------------------------------..I---------------------------------------
Q81QE5_BACAN/286-379--------------------------------------..F---------------------------------------
Q830M8_ENTFA/609-698--------------------------------------..L---------------------------------------
Q87SX2_VIBPA/317-410--------------------------------------..L---------------------------------------
Q899W1_CLOTE/276-369--------------------------------------..V---------------------------------------
Q8A9F6_BACTN/292-381--------------------------------------..S---------------------------------------
Q8CYG6_STRR6/429-522--------------------------------------..V---------------------------------------
Q8DQ76_STRR6/86-181--------------------------------------..I---------------------------------------
Q8DQS2_STRR6/328-451--------------------------------------..S---------------------------------------
Q8EUA2_MYCPE/1386-1480--------------------------------------..Y---------------------------------------
Q8EZY9_LEPIN/286-379--------------------------------------..I---------------------------------------
Q8G7P9_BIFLO/348-438--------------------------------------..I---------------------------------------
Q8KD33_CHLTE/294-389--------------------------------------..L---------------------------------------
Q8NS27_CORGL/639-739--------------------------------------..T---------------------------------------
Q8Y6E1_LISMO/85-180--------------------------------------..M---------------------------------------
Q97DB8_CLOAB/742-835--------------------------------------..I---------------------------------------
Q97LN0_CLOAB/763-854--------------------------------------..V---------------------------------------
Q9A6K3_CAUCR/378-465--------------------------------------...---------------------------------------
Q9FBP3_STRCO/683-772--------------------------------------..L---------------------------------------
Q9KF85_BACHD/565-650--------------------------------------...---------------------------------------
Q9PPU7_UREPA/189-284--------------------------------------..I---------------------------------------
Q9WZG5_THEMA/751-844--------------------------------------..V---------------------------------------
R5K905_9CLOT/831-926--------------------------------------..F---------------------------------------
R5KJ88_9CLOT/371-467--------------------------------------..P---------------------------------------
R5TSZ9_9FIRM/299-417--------------------------------------..I---------------------------------------
R5UPZ8_9BACE/319-410--------------------------------------..H---------------------------------------
R6WL88_9PORP/179-267--------------------------------------..A---------------------------------------
R6WLH2_9PORP/307-392--------------------------------------..V---------------------------------------
R6WYF0_9PORP/312-402--------------------------------------..I---------------------------------------
R6X6U4_9PORP/300-397--------------------------------------..Y---------------------------------------
R7EAJ1_9BACE/317-408--------------------------------------..V---------------------------------------

PF03739

Q3ATU7_CHLCH/6-355........DEITL.........................PRH..................YQFLREK......EEAGFS..
Q118T4_TRIEI/24-389........KQMNI.........................SQS..................YEYLELM......RLSGNYR.
A0LEN9_SYNFM/39-391.......KREMTL.........................REL.................YRVIVEKT......GDVGHA..
A7HYF9_PARL1/7-370........RERYF.........................HEL..................VNPASDD......LYGQQN..
Q8DIL4_THEEB/18-374........NELSI.........................TQA..................RRALQRL......DPDREPE.
Q82W93_NITEU/6-348........KAAST.........................RSL.................................WDSE..
A0LB31_MAGMM/6-364........EELSL.........................QAL..................WKHADRL......AREGYD..
Q6MKD0_BDEBA/11-364........PSLTL.........................EEV.....................RNRL......KEDIKDK.
Q6FFD6_ACIAD/9-354........EDLSF.........................SQL..................VSFMNYM......REYSQV..
Q0C1U6_HYPNA/7-346........RDLAI.........................SNL..................IALSEMR......GSGSRP..
Q11U59_CYTH3/9-455TKNKAVEHDSIKL.........................SKKALLAESPGKEVAQRAANQARSIKSYLQGNVERDERFIK.
A1AWC7_RUTMC/20-369........ESKST.........................FEL..................LF....S......NKLTEI..
Q73NV9_TREDE/13-373....SSGPDKMTS.........................YDL.................IKDIKQKK......EAGDTSP.
Q1GR36_SPHAL/14-363........DELPF.........................LKL..................KAAIDDL......EAAGRP..
A5EXI6_DICNV/8-348........RSIAT.........................GAL........................N......QSLAHR..
Q7VQS8_BLOFL/9-358........HFLSI.........................SKL..................ICCIKYF......DVLGQN..
Q310A0_DESAG/6-352........SRLPL.........................WQL..................QDAIARL......TESGSN..
Q5SL96_THET8/6-344.....NPANRMTL.........................AEL..................RKEVQRL......RQMGVR..
Q6MJL5_BDEBA/6-356........DMMSQ.........................KEL..................EHFIDKN......KAAGLD..
A5WBH3_PSYWF/27-466........TTQSV.........................PALWKA...........ATGQKVATKAD......GSTEPEP.
E0TCF8_PARBH/6-360........DTLSV.........................WAL..................PETIRLM......GDAGMT..
Q984S3_RHILO/7-356........ETIPF.........................YDL..................PGKIEVA......RSFGLK..
Q2S3I0_SALRD/55-410........AAMTI.........................PAA..................AEYLAAL......RRSGVGG.
Q1IRI3_KORVE/435-789........QEMDY.........................QEL..................LRYIHDL......QQSGFD..
A1WAC0_ACISJ/11-359........TERTL.........................PEL..................WLAMCKT......CDPDSA..
Q8D296_WIGBR/5-350........EYVYF.........................KNL...................................FNS.
Q6MDI9_PARUW/8-358........DILPL.........................TNL.................FFQQPSLF......ANLSEK..
Q9A939_CAUCR/5-350........DSMPT..............................................AASARRA......LENGGSD.
Q1D894_MYXXD/7-356........EQMRA.........................SEL..................REQIVAR......RDVGLA..
Q1QKW5_NITHX/6-356........RERYL.........................WEL..................IAPEPTD......PLVQQL..
Q143Z1_BURXL/6-377........DRMSM.........................FNL..................FRYIQHL......TENHQD..
B5EBA8_GEOBB/11-361........SEMTL.........................DEL.......................LH......PPKGTQQ.
A3I2C6_9BACT/6-354........ETLKL.........................PEL..................SRQIRVL......EDRGAD..
Q2RQ55_RHORT/8-372........RERPL.........................SELISLK..........AGDRIDPDYPF......TYEERH..
A1WUU9_HALHL/6-348........STLPV.........................PEL..................WTYIQYL......DANELD..
A5G1T7_ACICJ/24-378........SEATM.........................TQL.....................FHAG......AAHVPPP.
Q3B4Y3_CHLL7/6-432RQQVEVAERKISMPIDMFEQAISLVAPSNAVNYPEVRGGSNVRAVTAVAGYIDRQLGLVESELKVI......DMNQML..
Q0BZX3_HYPNA/9-369........NTVGF.........................WEL..................PRFIFET......RAAGLD..
A2U291_9FLAO/6-450KSLDSNIIDNFEL.........................QEKITILNSAVTKTTRVVSTINNNLDSI......KWNRKM..
A0LB30_MAGMM/6-357........RSYSI.........................ADL......................EQA......RIAQDPL.
E0TCF9_PARBH/51-404........TERTV.........................SQL..................LNPDLSD......PSIARL..
A5EXI7_DICNV/7-348........NAYTL.........................REL..................YTITGFL......RAHQLN..
B8CYZ1_HALOH/12-360........DEMSR.........................EEL..................KKEIDLF......QNSGID..
Q1MPZ1_LAWIP/7-360.......PKEMSW.........................ERL.....................IKEY......NITNTMQ.
A8ZZ83_DESOH/6-356........DEMGF.........................VQL..................LDRIRQV......ERQGYS..
A8EWU1_ARCB4/5-331........DYWK..........................NNI.......................................
Q31ET4_THICR/6-346.......VFEIPT.........................STL......................WQS......DKPEHE..
Q1IZ54_DEIGD/6-380....TGLSRKQTI.........................AQYADAIG.......ADAEGWPELITKL......TAPGVSV.
Q1J2D3_DEIGD/10-350........AQVST.........................PVL..................RARLAAD......EYATPE..
Q2S0T8_SALRD/7-449QTLYERTQDELSPSVAADTSAPAPVAPAHPSSYLALADLDADARRSVVSPAVQRARSAQSAIQNIR......RDTEWQT.
Q6MDI8_PARUW/7-377........QALRQ.........................AKL...................ENKKPV......IVKDLKG.
B8CYX9_HALOH/6-362........EDMSF.........................KEL..................GEYIQFL......EEQGKD..
Q1IRI3_KORVE/8-376.......VAELST.........................QELWRLA..........HSGGVSAGHYL......GNSIAQV.
O83854_TREPA/1-358....GLGPGGFST.........................CSL.................YREIQEKI......KAKENPR.
Q8D297_WIGBR/7-348........EELSI.........................SEL..................YFYIKFL......KKNNLY..
Q9AA49_CAUCR/9-364....GEDVSELTL.........................IEL..................ARQGFGL......EPAALP..
Q3J9X2_NITOC/9-352........QTLPT.........................LTL.................................WEMG..
A7IJ85_XANP2/6-384........MERPL.........................SYV..................MNPPQDD......LYVRFF..
Q0C1U7_HYPNA/7-360........RELFL.........................PEL.....................LAKA......GAAMPGD.
Q0BVK4_GRABC/5-352........DAMPP.........................LAL..................WRYVHSL......KQRGLQ..
Q5FU64_GLUOX/35-392........DTLSV.........................FAL..................PGFISLL......ERSGFP..
Q5FPA9_GLUOX/26-376........ATVTP.........................AQV..................SAILHKG......APASLP..
Q1D895_MYXXD/6-362.......REELTP.........................GEL..................MEAAREA......EAQGED..
A1AXG9_RUTMC/6-356........RELST.........................WHL..................YQQIRFL......TINHLA..
A6QBC8_SULNB/6-335........DIVSY.........................WAL.....................................I.
A6QBZ1_SULNB/12-355........KALNI.........................IDA..................YNTWKLL......EIQHLD..
Q7VQS9_BLOFL/5-358........KHMNI.........................NQL........................L......ISSELE..
Q73NV8_TREDE/6-354........DEMRI.........................SEA..................KEFIAAL......KKNGLP..
B4E8H0_BURCJ/7-345.........STPT.........................PDL.................................LRNP..
J9ZCA2_LEPFM/6-351...........TI.........................REL..................ENKIAGS......PKPDVS..
J9ZCM7_LEPFM/6-356........THLSY.........................PEL..................DRYIALL......EKSHLP..
O26028_HELPY/5-350........PAVSI.........................TDA..................LLSLHAL......VRQNAD..
O51747_BORBU/11-425ESYVFENLNYMYN.........................LNL..................NFKPYQD......RSMKQN..
O51748_BORBU/7-350........KALNF.........................TKL..................INWISFL......KAERLN..
O84846_CHLTR/8-346........SYMKT................................................RTDYL......PWKQLIQ.
LPTG_HAEIN/7-355........TSLSI.........................SGL..................YHYISFL......RETGQD..
Q2JLS4_SYNJB/13-367........SELSL.........................PEL..................AERISRL......ARSNLN..
Q2YN46_BRUA2/7-357........KDRPL.........................TYL..................LNPDSND......PMLQTR..
Q5NFB9_FRATT/8-349.......NNYLNF.........................SQL.....................TSYM......LSNSQA..
Q5NFC0_FRATT/6-350........DRLYM.........................HTL.....................IENF......NDKNNG..
Q5SL95_THET8/4-334........DSTPL.........................EEL..................WARAQV...............
Q7CKF4_YERPE/5-345........DQMSM.........................KEL........................W......RSQEP...
Q8F742_LEPIN/134-585AANGTLTPDQ..............................MTQ..............QYSVLTQLM......ALMQQGKK
Q8F8T0_LEPIN/30-383........EEMNL.........................FQL..................KEEEKRR......IQKGLA..
Q8PCR2_XANCP/10-365........RNLSV.........................HDL..................GQSIEYR......RRNGLD..
Q8PCR3_XANCP/6-349........EVMST.........................FKL........................I......GDARPI..
Q8RER6_FUSNN/12-360........RMLTI.........................KEL..................KKTIKEQ......KNIGED..
Q9X257_THEMA/19-363........KEMTG.........................KEL..................KEKIEFF......KKVGVK..
Q9ZCH3_RICPR/10-357........EMVSI.........................WAL..................PKLINEL......LNSGLS..
R6X2Y4_9PORP/1-468KKATILTRA...............................KSSIEN........MKADYFFKAATI......GDEAYR..

PF00528

GLNP_ECOLI/33-218--------------------------------------------------------------------------------
YQGH_BACSU/107-309--------------------------------------------------------------------------------
YQGI_BACSU/80-293--------------------------------------------------------------------------------
NIKB_ECOLI/116-308--------------------------------------------------------------------------------
Q97UG4_SULSO/116-318--------------------------------------------------------------------------------
YCKA_BACSU/41-224--------------------------------------------------------------------------------
Q97VK6_SULSO/120-341--------------------------------------------------------------------------------
Q9FAT0_VIBPH/116-319--------------------------------------------------------------------------------
Q44374_RHIRD/87-266--------------------------------------------------------------------------------
Q9KB56_BACHD/117-308--------------------------------------------------------------------------------
OPUBD_BACSU/40-211--------------------------------------------------------------------------------
Q9LAT6_LISMN/112-304--------------------------------------------------------------------------------
LACF_RHIRD/87-298--------------------------------------------------------------------------------
Y355_HAEIN/68-243--------------------------------------------------------------------------------
Q982M9_RHILO/75-250--------------------------------------------------------------------------------
GLNP_RICPR/33-217--------------------------------------------------------------------------------
AMIC_STRR6/298-492--------------------------------------------------------------------------------
TCYB_BACSU/46-230--------------------------------------------------------------------------------
AMID_STRR6/125-308--------------------------------------------------------------------------------
NRTB_SYNE7/98-276--------------------------------------------------------------------------------
Q9HIL1_THEAC/131-337--------------------------------------------------------------------------------
Q9X0U9_THEMA/119-323--------------------------------------------------------------------------------
UGPA_ECOLI/90-294--------------------------------------------------------------------------------
SAPB_HAEIN/93-316--------------------------------------------------------------------------------
MSMG_STRMU/87-273--------------------------------------------------------------------------------
G8PA36_LACLC/106-293--------------------------------------------------------------------------------
HISQ_SALTY/27-221--------------------------------------------------------------------------------
NIKC_ECOLI/89-273--------------------------------------------------------------------------------
Q9WYD8_THEMA/94-282--------------------------------------------------------------------------------
POTH_ECOLI/117-315--------------------------------------------------------------------------------
LPLC_BACSU/93-290--------------------------------------------------------------------------------
CYST_ECOLI/74-276--------------------------------------------------------------------------------
Q9ZBG1_STRCO/128-331--------------------------------------------------------------------------------
Q97UH1_SULSO/128-336--------------------------------------------------------------------------------
Q97VF6_SULSO/101-289--------------------------------------------------------------------------------
LACG_RHIRD/89-270--------------------------------------------------------------------------------
Q9HLG4_THEAC/81-265--------------------------------------------------------------------------------
MALD_STRR6/87-275--------------------------------------------------------------------------------
GLTJ_ECOLI/43-239--------------------------------------------------------------------------------
YEHW_ECOLI/68-240--------------------------------------------------------------------------------
Q9FAT1_VIBPH/84-268--------------------------------------------------------------------------------
Q9A534_CAUCR/67-247--------------------------------------------------------------------------------
YEJB_ECOLI/151-361--------------------------------------------------------------------------------
YOR2_CALSR/83-265--------------------------------------------------------------------------------
O66777_AQUAE/114-319--------------------------------------------------------------------------------
YEHY_ECOLI/195-381--------------------------------------------------------------------------------
Q9WXN6_THEMA/92-279--------------------------------------------------------------------------------
Q9Y9N0_AERPE/121-339--------------------------------------------------------------------------------
Q9WY46_THEMA/67-238--------------------------------------------------------------------------------
Q9Z6P7_CHLPN/68-243--------------------------------------------------------------------------------
Q98K60_RHILO/105-289--------------------------------------------------------------------------------
UGPE_ECOLI/91-278--------------------------------------------------------------------------------
OPPB_LACLA/113-318--------------------------------------------------------------------------------
Q49553_MYCHO/234-419--------------------------------------------------------------------------------
FBPB_SERMA/341-526--------------------------------------------------------------------------------
Q987J0_RHILO/100-280--------------------------------------------------------------------------------
Q9CLG9_PASMU/73-248--------------------------------------------------------------------------------
Q9PPS8_UREPA/183-374--------------------------------------------------------------------------------
PSTA_ECOLI/101-295--------------------------------------------------------------------------------
Q98QF6_MYCPU/174-365--------------------------------------------------------------------------------
MALC_STRR6/209-434--------------------------------------------------------------------------------
LPLB_BACSU/104-314--------------------------------------------------------------------------------
YHDY_ECOLI/173-362--------------------------------------------------------------------------------
A0A023Z6E4_ECOLX/104-273--------------------------------------------------------------------------------
Q7ANQ9_RHIME/112-306--------------------------------------------------------------------------------
Q97YP1_SULSO/131-332--------------------------------------------------------------------------------
O28506_ARCFU/135-354--------------------------------------------------------------------------------
Q98K61_RHILO/75-251--------------------------------------------------------------------------------
AMYC_THETU/83-269--------------------------------------------------------------------------------
Q2FVE8_STAA8/117-308--------------------------------------------------------------------------------
Q9EWP8_STRCO/101-281--------------------------------------------------------------------------------
Q9KKK5_VIBCH/118-310--------------------------------------------------------------------------------
YEJE_ECOLI/158-341--------------------------------------------------------------------------------
O86691_STRCO/402-574--------------------------------------------------------------------------------
Q98QS7_MYCPU/195-382--------------------------------------------------------------------------------
I3VV06_THESW/85-290--------------------------------------------------------------------------------
O34157_SALTM/115-319--------------------------------------------------------------------------------
Q9PL65_CHLMU/67-242--------------------------------------------------------------------------------
Q9RX04_DEIRA/318-494--------------------------------------------------------------------------------
SSUC_BACSU/94-269--------------------------------------------------------------------------------
Q9UYG7_PYRAB/121-325--------------------------------------------------------------------------------

PF07242

A7GQL2_BACCN/621-721--------------------------------------------------------------------------------
A5MAB6_STREE/576-675--------------------------------------------------------------------------------
Q9L651_LACLL/549-647--------------------------------------------------------------------------------
A5M6X5_STREE/166-265--------------------------------------------------------------------------------
Q8CY97_STRR6/155-254--------------------------------------------------------------------------------
A0A0E1X7Q6_STAAU/545-643--------------------------------------------------------------------------------
Q926X5_LISIN/619-718--------------------------------------------------------------------------------
Q93MD9_CLOPE/619-718--------------------------------------------------------------------------------
Q9KG35_BACHD/612-712--------------------------------------------------------------------------------
A0A0Z8MBH7_STRSU/561-660--------------------------------------------------------------------------------
Q9CJI4_LACLA/565-662--------------------------------------------------------------------------------
Q8Y3Q8_LISMO/620-718--------------------------------------------------------------------------------
Q896P1_CLOTE/604-706--------------------------------------------------------------------------------
Q892J9_CLOTE/609-706--------------------------------------------------------------------------------
A8AXA7_STRGC/592-691--------------------------------------------------------------------------------
Q9CE29_LACLA/560-659--------------------------------------------------------------------------------
Q181M6_PEPD6/617-718--------------------------------------------------------------------------------
A7GNK2_BACCN/616-716--------------------------------------------------------------------------------

PF02687

A0A0S8DDF8_9BACT/110-205-------SAASEGT.................KV....................Q.....MIGADFSLAGLLL--AS----
A1SH34_NOCSJ/795-890-------VKVLSGV.................FD....................P.....PPAALAIPWAYLT--SI----
A1SKN4_NOCSJ/326-416-------.ARTTLL.............................................PGHAPFETGVRLL--GA----
A1TXE6_MARHV/209-306-------LVLADGF.................GQ....................ALEGLFDRPLYAGGGEDWW--LP----
A3I1M1_9BACT/315-407-------SSLSGVP.............................................LDLNLVISPVGLL--LL----
A3I2Y5_9BACT/772-861-------SSFLDSF.................FA..........................FHSGVGFIPLGVA--LF----
A3QAU8_SHELP/338-429-------YALSARF.................GV..........................AEGLTHLSMSMWL--IT----
A4VW57_STRSY/1024-1117-------LAMIGSD.................S...........................IRFNPSVGLEVYL--IP----
A4YKC0_BRASO/760-849-------VTRL................................................MTLSFVWQAGSAA--LV----
A5N346_CLOK5/499-593-------YDNLITA.................HF..........................SYATWSIPIMPII--IV----
A5USK7_ROSS1/337-433-------VSFLRFA.................PL....................D.....APAPTLLPASPWH--AL----
A6H1M7_FLAPJ/310-410-------IKLNPEN.................YY....................V.....NQAPVNINIAHIL--LL----
A6L8W9_PARD8/679-767-------KDWLSDY..............................................SYRIGLSPLIFI--AA----
A6LCJ9_PARD8/311-395-------....................................................IGGGFHMKGIVFW--GG----
A6LZM8_CLOB8/312-398-------GSVYEFF.............................................INENLLFNLYISM--GI----
A6TSQ0_ALKMQ/290-387-------MMASDPY.................SG....................Q.....MNVAIEFSFSHML--IA----
A7H957_ANADF/310-394-------ATAWAPV.............................................FPKYVLLLPGDAV--RG----
A7HK62_FERNB/280-383-------LYKVNSF.................QR.................TDELFAFVQDKIPFNIKFLSVI--FG----
A8ABZ3_IGNH4/274-373-------VALSHPR.................LE....................PLK...AFVTLTVSPKTVL--AV----
A8AR20_CITK8/257-351-------SSAVTEV.................AQ....................V.....FGTKFDINGLSFD--EC----
A9KQT2_CLOPH/369-506-------SDVLLKSQVAAAETNTDTHQGQNGMFTGGGRTAGAFMMGSGGGINSSNEKPLSEMKITLDLITVL--EI----
B2HGJ6_MYCMM/200-292-------LENALNQ.................FY....................Q.....ANLIARIDYADIF--FI----
B4EEB5_BURCJ/285-374-------ASLFKQA.................AG....................G.....IFPVFKVSTETIV--LQ----
B7VH43_VIBTL/299-399-------NTILEAM.................GV....................ALFSFGGQLPILINPIQIA--VV----
B8I8J6_CLOCE/322-424-------GTGPLSY.................FG....................G.....ERLYPSMKPMDIS--TT----
D4K997_9FIRM/688-783-------SREISIA.................TF....................GG....NVVPYKFPVLEMG--LF----
D4KYJ1_9FIRM/289-395-------FNWLVEQ.................GN....................LVSTGTGSMGVQNQQVPLF--SL----
D4KYJ2_9FIRM/288-378-------FSYAKHN.............................................GIFGMNIYHVPIV--PI----
M1FFQ7_9ALTE/713-801-------VHRINPL.................AF....................G.....WSLPMAIYPEFWL--QL----
O28455_ARCFU/301-396-------TSQYITF.................LN....................L.....PYYVSKPHLEVYS--LS----
O50782_BORBU/302-402-------QFQKISF.................TP....................PGYSETYYINIFYYASDII--YV----
Y684_MYCPN/1015-1110-------KGIISRY.................WF....................I.....ALPANSFNWISFF--GS----
Q01VW7_SOLUE/1304-1396-------ATLHHGM.................SG....................T.....PLRLDNEDPLLYG--GA----
Q025M3_SOLUE/377-471-------LALSRYQ.................LS..........................GLKELPFDGRVLG--FA----
Q034M7_LACC3/430-519-------TIMALRL.............................................GVHFIAIILAAFI--TN----
Q0P8Y0_CAMJE/176-262-------DLSIIQE.................SL..........................KAVDIIFPPINFI--LH----
Q0RJL1_FRAAA/665-753-------..FLRSQ.............................................LHETLQPPGGEYY--LI----
Q18EP9_HALWD/325-419-------NTILAQT.................LS....................L.....PAPGIIDPRLIPY--GI----
Q1G8P7_LACDA/306-403-------VGSSSQI.................VL....................N.....GLLPRAETVSLLI--SF----
Q2FUZ2_STAA8/85-179-------FLFIQKI.................MG....................S.....EVATLRYYPFDSV--AM----
Q2RPK1_RHORT/306-403-------NHKLAAT.................VF....................AHAQ..GVPCVITLPLALA--AI----
Q47EZ3_DECAR/269-372-------LKGWSVL.................YP....................K.....FRLVPTVDGLQIA--TL----
Q481M7_COLP3/731-820-------TGMLIYQ.................SQ..........................FSLSYQPDLFILF--IT----
Q4A9N5_MYCHJ/1828-1923-------YNLISQF.................WE....................F.....DINIYNFEPISFV--FS----
Q4A9N5_MYCHJ/2549-2644-------NSYILLT.................NS..........................IFLSLGLSISTFF--LA----
Q4DFN5_TRYCC/470-565-------EYLLSRF.................TA....................A.....TPRILFVPLIPLF--VS----
Q4QBC9_LEIMA/1003-1097-------AIELCQI.................MV..........................IPFHFNFPYALVI--IV----
Q54MT9_DICDI/571-666-------IDQLKRF.................TN....................S.....DEISNYLTVDSIV--YS----
Q5JEM5_THEKO/229-318-------SLFGVSI.............................................PLRPNYAYPFKFD--VL----
Q5LCL1_BACFN/298-387-------PHFIELA.................QI....................S.....EATPLYTEVIIYI--LA----
Q5LDA1_BACFN/308-392-------QEKIEEL.................AE..........................VSLSSLFTWHNLW--AP----
Q5LFF2_BACFN/320-426-------FDKYPTV.................IS....................DGVDVAINPQMLFSPLMFC--VT----
Q5V3A9_HALMA/900-995-------ERAGWLV.................FF....................G.....FRLSARTPPAILT--AI----
Q6AA47_PROAC/625-722-------NAAIGST.................DA....................NQS...FDPTIAALPVTMW--AV----
Q6AMB4_DESPS/311-415-------QAYGLDI.................GS....................MTKNSSMMISNIIRAEISY--RT----
Q6F163_MESFL/1307-1400-------LTWIANK.................F...........................SVYIFMTVDLKTI--LI----
Q6F1V8_MESFL/1717-1810-------MIQAQKF.................GI....................F.....IPLITNWWATPLI--LL----
Q6F1W1_MESFL/1327-1420-------AKAVNIM.................LL....................S.....GVVLPIAFPIWLP--IV----
Q6MGV4_BDEBA/685-778-------TKWIHTD.................A...........................FIFPLVVDTRTYA--LA----
Q6MSQ5_MYCMS/397-490-------INRFSNY.................FS....................L.....DYGVFSFDWIGLL--NN----
Q6MT15_MYCMS/588-682-------SNFVNSV.................TF..........................TFNSIYISPLLII--FL----
Q6MUJ8_MYCMS/1693-1786-------DKVFSAN.................G...........................FSIPINVYWVSVV--FC----
Q79Z83_STRAW/268-362-------AQWVVDN.......................................E.....LAPSWFTIGDYTW--PY----
Q7UPA2_RHOBA/607-706-------KSWWVGA.................VT....................V.....PFLQFYATPLSIA--LG----
Q7V1V4_PROMP/299-384-------YSIIRNS.............................................TKLPIVMDANKTI--LI----
Q81HP3_BACCR/261-351-------HTYFQTY.................LL....................K.....PLTPYVLVCNIVF--II----
Q81QE5_BACAN/286-379-------TSNITLY.................MG..........................AANKSILHNIVPF--II----
Q830M8_ENTFA/609-698-------SQFI................................................KSPGYLLVYLSCG--IL----
Q87SX2_VIBPA/317-410-------QPLIQQH.................YG..........................INLTLSTLSAYEW--ML----
Q899W1_CLOTE/276-369-------KDNFTHI.................LN....................V.....ENIQFSYFNIIAT--SL----
Q8A9F6_BACTN/292-381-------TGFIEIQ.................FG..........................MAQQKEIAFDGLL--SV----
Q8CYG6_STRR6/429-522-------ISSVITK.............................................GMVVGETQIQFYW--TY----
Q8DQ76_STRR6/86-181-------FAFLLKL.................MK....................LK....VELVATFQTKVVI--TV----
Q8DQS2_STRR6/328-451-------NLGGGAE.................VD....................GFSKTLSSLDISIQTSDFI--II----
Q8EUA2_MYCPE/1386-1480-------ITFIFNF.......................................A.....GILIVSNNSFWHF--LA----
Q8EZY9_LEPIN/286-379-------PDLAGEE.................IL....................S.....FQPTIGFSSLLWG--LL----
Q8G7P9_BIFLO/348-438-------GSALASG.................HA....................T.....PVTSGLIWTMVWY--GL----
Q8KD33_CHLTE/294-389-------LRLYGDV.................YN....................F.....PRLLYVFRMENAL--GA----
Q8NS27_CORGL/639-739-------GTTDEIV.................DG....................AILNYGTLEHMMLPWPLLV--SL----
Q8Y6E1_LISMO/85-180-------VLFWIVG.................LA..........................IDAEFIISFKAII--DT----
Q97DB8_CLOAB/742-835-------PAMLDIS.......................................N.....FPMEIYYSSGAFI--TS----
Q97LN0_CLOAB/763-854-------HKVMSG..............................................DSTHFVLPWSSIG--IS----
Q9A6K3_CAUCR/378-465-------.SLLATM.............................................GGVPMYFPPVLVA--IV----
Q9FBP3_STRCO/683-772-------LKM.................................................TSTPVSVDWTGVL--AM----
Q9KF85_BACHD/565-650-------....................................................YQADWFILIFFVA--VV----
Q9PPU7_UREPA/189-284-------MRLFSSY.................WL....................I.....PIPDQFVSVGWIF--AI----
Q9WZG5_THEMA/751-844-------SEAMSES.................LG....................T.....FMVSVPTASILLS--LL----
R5K905_9CLOT/831-926-------VKLVAIV.................YL..........................PESHNIAISIAVN--PF----
R5KJ88_9CLOT/371-467-------IQMQDCY.................NY....................Y.....SLPDLDVIYMPYL--FI----
R5TSZ9_9FIRM/299-417-------YQKIGSI.................FVRTKGIQHTNMYVAAEAAREAAQAGRAQAGAFQVSGEAIF--FG----
R5UPZ8_9BACE/319-410-------ISLSDLN.................LS....................I.....DRERLMLQAGQYI--II----
R6WL88_9PORP/179-267-------EHWQRQF.............................................VEKIPLSAWIFLA--GA----
R6WLH2_9PORP/307-392-------GGFSHLF.......................................E.....TTLQRKLLFSHLC--II----
R6WYF0_9PORP/312-402-------PVFNRIM.................SG....................R.....ITTGFFLNRQVLP--VI----
R6X6U4_9PORP/300-397-------YQYMASK.................ET....................INENLFIHTPTLIQQEMEY--LC----
R7EAJ1_9BACE/317-408-------MADVTFT.................EA..........................TDATWGRFVICVS--IV----

PF03739

Q3ATU7_CHLCH/6-355.GLERSAVKFHNKI-----------------AM--------------------------PFASLIITLIGVP..LA..AR
Q118T4_TRIEI/24-389KVVKTQ.VRIQQKL-----------------AL--------------------------PFVCLVMGLVGAA..LG..IR
A0LEN9_SYNFM/39-391.......LEFHQRL-----------------AF--------------------------PSGCLLLGLIGAP..LG..AV
A7HYF9_PARL1/7-370.RDKLL.ADAHERL-----------------VE--------------------------GFYPVMLTLIGLAALLP..AP
Q8DIL4_THEEB/18-374LVRALK.VHLAQSY-----------------AQ--------------------------PFLAVVFALLGVG..FG..LS
Q82W93_NITEU/6-348.EPREI.AELQWRL-----------------SR--------------------------PVATVLLALIAVS..FT..RT
A0LB31_MAGMM/6-364.ATPYW.VTLYRKL-----------------AD--------------------------PLTTLAAILLAFP..FA..LR
Q6MKD0_BDEBA/11-364EVRRTLQSEYHKRW-----------------AI--------------------------SVLCIVFAMIGVG..LG..TT
Q6FFD6_ACIAD/9-354.PKTYQ.LAFWKKV-----------------AS--------------------------PFALITLVLVACS..FI..FG
Q0C1U6_HYPNA/7-346.SGAYE.LWALNRF-----------------LL--------------------------PLTAVGFLLLAVP..VM..QV
Q11U59_CYTH3/9-455EIHEFE.VTKYQKF-----------------TQ--------------------------AVACFVLFLIGAP..LG..AI
A1AWC7_RUTMC/20-369.......AEFQWRI-----------------SQ--------------------------PLSILILSVLGVL..LG..KT
Q73NV9_TREDE/13-373RLLNIYIMELHRKF-----------------SV--------------------------PFGAFFFVLLAFA..IS..RA
Q1GR36_SPHAL/14-363.VDALK.GVLWHKI-----------------SG--------------------------PLSAILMPLLGAV..AA..FG
A5EXI6_DICNV/8-348.......AEFQKRL-----------------NP--------------------------ALAVVIFSFAVPL..LA..HT
Q7VQS8_BLOFL/9-358.SKYYQ.LIFWDKI-----------------FS--------------------------PIFGVMMLTIALL..YS..YG
Q310A0_DESAG/6-352.VEALR.TAWHMKL-----------------SY--------------------------AFSLVTMALLA....LA..LI
Q5SL96_THET8/6-344.AGLEA.TTYYRRF-----------------AE--------------------------PLAAPVFALFAVG..LA..FY
Q6MJL5_BDEBA/6-356.TVAYE.VDYHSKI-----------------SF--------------------------AFAGLVMCLLGIP..FS..VG
A5WBH3_PSYWF/27-466QQILSAQAELGYRL-----------------AL--------------------------PWLIILAPMLAVP..LA..QV
E0TCF8_PARBH/6-360.TTKFR.LRYHALW-----------------SL--------------------------PLKLAAMVILACA..FA..LG
Q984S3_RHILO/7-356.ANAFA.MQFDSLV-----------------AL--------------------------PFLLVAMTLIAAT..VS..MR
Q2S3I0_SALRD/55-410LTRPL..VAYYNKF-----------------AY--------------------------PFANLLLVLIGVP..IA..ST
Q1IRI3_KORVE/435-789.VVRFR.VQLYKKL-----------------AY--------------------------PIITLVMAILAIP..FS..VY
A1WAC0_ACISJ/11-359.......AEFHSRL-----------------AR--------------------------ALLPLLLPLLALP..LG..MA
Q8D296_WIGBR/5-350CIEEYK.LEYNWRI-----------------TI--------------------------VFSVLIMSIISFA..LN..IK
Q6MDI9_PARUW/8-358.ESKIA.TAFYWKL-----------------LM--------------------------PWLCLLAILAPAP..SC..VR
Q9A939_CAUCR/5-350RPESFYATHLQAAF-----------------AS--------------------------PFVSLVMLLLSAP..VA..LA
Q1D894_MYXXD/7-356.TKQFE.LALHNRF-----------------AY--------------------------PMAAFPAALLGVG..LA..LR
Q1QKW5_NITHX/6-356.PGQFR.AELHDRF-----------------TA--------------------------PIYPFAFAALTFA..FL..GT
Q143Z1_BURXL/6-377.TQRYE.IALWRKL-----------------LY--------------------------PFAVFVMLVLSLP..FA..YL
B5EBA8_GEOBB/11-361KEIISRDLEYHSRL-----------------AL--------------------------PFSCFVFTLLAIP..LG..IQ
A3I2C6_9BACT/6-354NVAFYK.IERYVRF-----------------MS--------------------------PFAAIILTFIGVI..MS..AK
Q2RQ55_RHORT/8-372.IRRMR.MEAHLRL-----------------LR--------------------------PLAHIGFLLIGLA..AV..LT
A1WUU9_HALHL/6-348.SGPYR.LALWEKV-----------------AT--------------------------PLATLAMLLVTIP..LV..FT
A5G1T7_ACICJ/24-378VQRRWR.EEAWRRI-----------------AS--------------------------PFAVLSYAVIALL..SV..LR
Q3B4Y3_CHLL7/6-432.YNRYM.AEYHKKY-----------------AL--------------------------AFACFVFVLIGAP..LG..VL
Q0BZX3_HYPNA/9-369.TSRYT.MRLFTLT-----------------AT--------------------------PVLFTAMALIGAL..AC..LR
A2U291_9FLAO/6-450.VNFYD.TEYYNRV-----------------AF--------------------------SLSCVILFFIGAP..LG..SI
A0LB30_MAGMM/6-357LASEAE.REWHRRF-----------------AI--------------------------PLATLLLGFLAIP..LA..MQ
E0TCF9_PARBH/51-404.ADRYR.AAGHARL-----------------AT--------------------------PLYCPALAVVALC..FL..LS
A5EXI7_DICNV/7-348.DQQMS.LKLWQRI-----------------FL--------------------------PITTITMVILALP..CV..FN
B8CYZ1_HALOH/12-360.VHSLL.VDYHLKL-----------------SM--------------------------PLAALIFILIGTP..LS..LT
Q1MPZ1_LAWIP/7-360YQNKIS.VELHKRW-----------------AY--------------------------PAACIALTIFALP..LA..IM
A8ZZ83_DESOH/6-356.VVSHR.VDLHAKL-----------------SF--------------------------PFVCLLMGLIGAA..LG..IM
A8EWU1_ARCB4/5-331.KNKVDLDDLTFFI-----------------LT--------------------------SFFPLMSLFLVIT..FG..YF
Q31ET4_THICR/6-346.......ALLQWRI-----------------VT--------------------------PFSILVLGLLGLK..MS..KS
Q1IZ54_DEIGD/6-380QERQDARVNLNRKL-----------------AL--------------------------PFGNLVLALAALP..FA..LR
Q1J2D3_DEIGD/10-350.QRRVDEHQLATRY-----------------AD--------------------------PCTPIVFALVAGV..VG..LL
Q2S0T8_SALRD/7-449RRIRSYQVEFYKKF-----------------SI--------------------------ALACLIFMVVGAP..LG..LA
Q6MDI8_PARUW/7-377QFHKSL.SEIAKRS-----------------SI--------------------------AFAVISFTLMGTA..FG..MN
B8CYX9_HALOH/6-362.TFEER.VKYHQKI-----------------AI--------------------------PFASFIFALLAAP..LG..IK
Q1IRI3_KORVE/8-376KARWYA.VEFQRRI-----------------AL--------------------------PTACLVLTLVGIP..LG..LS
O83854_TREPA/1-358HIATYQ.LEFQKKF-----------------SH--------------------------PISVVLFIFLSFG..LS..TL
Q8D297_WIGBR/7-348.YKKQY.LVFWNKI-----------------FS--------------------------PISILIITIIILQLLFG..IL
Q9AA49_CAUCR/9-364.RETLL.AALYARL-----------------AR--------------------------ALILPLLPLIAVP..FG..LS
Q3J9X2_NITOC/9-352.APKDI.AEVQWRI-----------------SM--------------------------PIITLLLVMLAVP..LA..RS
A7IJ85_XANP2/6-384.PGRYR.EELHKRL-----------------SA--------------------------GLYPMAFFAIAAA..AL..AS
Q0C1U7_HYPNA/7-360IAPAVAAATFHDRT-----------------SR--------------------------AALLLAMPLIAII..LG..LN
Q0BVK4_GRABC/5-352.AIRYE.QELWAKI-----------------SI--------------------------PLTMMAMVIAATP..FV..FG
Q5FU64_GLUOX/35-392.SIRHR.LHFQSLL-----------------AL--------------------------PILAGTMALVSAG..FS..MR
Q5FPA9_GLUOX/26-376.RATYR.MALFSGM-----------------IL--------------------------PVEIAVMLLLTLP..VI..YI
Q1D895_MYXXD/6-362.ARMYR.MALHSRL-----------------GN--------------------------ALAPIAFALLGTP..LA..MG
A1AXG9_RUTMC/6-356.ADIFE.VEIYKRL-----------------MK--------------------------PITLIAMILFSML..FV..FG
A6QBC8_SULNB/6-335KTDKHRMGRALFYL-----------------FV--------------------------SLIPILSVYLVAA..FA..MI
A6QBZ1_SULNB/12-355.SDKIR.ATIYNKV-----------------IV--------------------------PLFALALLLI.....LF..FK
Q7VQS9_BLOFL/5-358.....SYIELNWRL-----------------TL--------------------------FISVFIMPMIAL...FV..MM
Q73NV8_TREDE/6-354.YYEAL.SKYHRRF-----------------SF--------------------------PFTIFIVLFFSIS..LG..GK
B4E8H0_BURCJ/7-345.TRDNL.AEFAWRA-----------------GL--------------------------PLIAINLMVLGIP..LS..YQ
J9ZCA2_LEPFM/6-351.LLREL.EDRYKNY-----------------TY--------------------------PFSCLIFAFLGIP..FG..IY
J9ZCM7_LEPFM/6-356.REKYE.VTRDAMI-----------------AF--------------------------PIAAFLMVLMAIP..FG..IR
O26028_HELPY/5-350.TKKVR.SFLYVFA-----------------IL--------------------------PFFVPFLSVLIAY..FS..PS
O51747_BORBU/11-425.LALFN.LEFYQKI-----------------SL--------------------------PLSVLFFIFLAFS..MG..MY
O51748_BORBU/7-350.YSDAF.FDLLNRI-----------------FF--------------------------SFRLILLSFTVGF..IA..LA
O84846_CHLTR/8-346DARLHL.AEILRRI-----------------AI--------------------------GLLCSTMTFSGLA..LG..TY
LPTG_HAEIN/7-355.VSRFE.LTFWRKI-----------------FQ--------------------------PVSVGVMMLLALS..FI..FG
Q2JLS4_SYNJB/13-367.TQALR.TEFHMRF-----------------SL--------------------------PLASFFAVLISLP..LG..ST
Q2YN46_BRUA2/7-357.PLTYK.AELHRRF-----------------TQ--------------------------WIYPLIFAMIALA..IAGDSR
Q5NFB9_FRATT/8-349.KDSIS.LKFWQEV-----------------FQ--------------------------PLSLMILILLAVP..LS..IG
Q5NFC0_FRATT/6-350..TAYK.AEFLGRI-----------------NN--------------------------AISVIVSSLLALA..LC..RL
Q5SL95_THET8/4-334.EPEAR.FAFHRRL-----------------AD--------------------------ALGGLVLGAAAAA..LG..LS
Q7CKF4_YERPE/5-345...DAR.AEFHWRL-----------------TL--------------------------IVSVVIMALLVVP..LS..VV
Q8F742_LEPIN/134-585VLTDFN.VEIHRRI-----------------AM--------------------------PISCLIFFFISFP..LG..LV
Q8F8T0_LEPIN/30-383.YGDVL.TEKHSVF-----------------AL--------------------------PMMTIIVTLIGTI..AG..YF
Q8PCR2_XANCP/10-365.ASDYE.DQYWSRW-----------------FY--------------------------PLNVLALCLAAIP..FS..FG
Q8PCR3_XANCP/6-349....AR.AELHRRL-----------------AP--------------------------PLLALAFALLTLP..LS..RS
Q8RER6_FUSNN/12-360.TRIYL.AELAKRY-----------------SF--------------------------PFASFIVAFIGLS..VS..SK
Q9X257_THEMA/19-363.PSPWV.VELHSRY-----------------AN--------------------------SLTPIVIVLVGVP..LS..LL
Q9ZCH3_RICPR/10-357.AINYQ.IYYYKQL-----------------FK--------------------------PIMMMATVILASC..FI..SL
R6X2Y4_9PORP/1-468.VRRHL.TEWHKKF-----------------TL--------------------------SFACMVFFFIGAP..LG..AI

PF00528

GLNP_ECOLI/33-218-------QEIIAGN-----------------FRA...............................LEIWSAV--------
YQGH_BACSU/107-309-------ESPFDTA-----------------GTLTTIITLNM..............GHTTYGSVENNTLWSM--------
YQGI_BACSU/80-293-------TEWNPFS-----------------ETSPLNIFRPAETLAVHIWNVNTQGMIPDAEAIANGGSAVL--------
NIKB_ECOLI/116-308-------IFNRDYP-----------------VIQ................................CFTLMM--------
Q97UG4_SULSO/116-318-------LTSKDLP-----------------LLQ................................GIFLFI--------
YCKA_BACSU/41-224-------KIIGGRE-----------------FDY...............................MTMYILT--------
Q97VK6_SULSO/120-341-------IESLDYT-----------------SIL................................GTTIIV--------
Q9FAT0_VIBPH/116-319-------GLTKDSH-----------------LLL................................ALSLCT--------
Q44374_RHIRD/87-266-------DWGSLIK-----------------ENKDGL.........................LFGITAALLP--------
Q9KB56_BACHD/117-308-------ILNRDFP-----------------IIQ................................AYVLIL--------
OPUBD_BACSU/40-211-------SNATNGT-----------------AII...................................LAG--------
Q9LAT6_LISMN/112-304-------IQTNDYP-----------------VIM................................GTTILF--------
LACF_RHIRD/87-298-------LYIYNLT-----------------FRFM.............................PSFSYAAT--------
Y355_HAEIN/68-243-------NARMQVD-----------------....................................LMFAA--------
Q982M9_RHILO/75-250-------SFNYQSD-----------------....................................RLYAA--------
GLNP_RICPR/33-217-------QIVSIET-----------------YNY...............................FFPMLIA--------
AMIC_STRR6/298-492-------VKASNNS-----------------MVV................................GLVFIF--------
TCYB_BACSU/46-230-------QEIGARN-----------------LDQ..............................ILVIYIEA--------
AMID_STRR6/125-308-------SLGRLIS-----------------DYSQNVTT.....................NAYLFWIPLTTL--------
NRTB_SYNE7/98-276-------YNAGGDG-----------------SSS.................................QIILA--------
Q9HIL1_THEAC/131-337-------INSLDYP-----------------LMQ................................GIFLMV--------
Q9X0U9_THEMA/119-323-------ILNQDYF-----------------LIQ................................GCFLFI--------
UGPA_ECOLI/90-294-------YKIYREG-----------------FTGL............................DLASSAAQS--------
SAPB_HAEIN/93-316-------VNEQDYN-----------------SIA................................AGVIVI--------
MSMG_STRMU/87-273-------LFQYNYS-----------------GQYFN...........................DYGPSFASY--------
G8PA36_LACLC/106-293-------SLGTMIN-----------------EATNPETMT...................DKPWTWVPATVVI--------
HISQ_SALTY/27-221-------QLAGKST-----------------WEP...............................FYFAVVC--------
NIKC_ECOLI/89-273-------EWGVMIN-----------------DARQYIWT.....................QPLQMFWPGLAL--------
Q9WYD8_THEMA/94-282-------TLGSMFH-----------------WMINFQAML..................LGYWWWVLTPIVTA--------
POTH_ECOLI/117-315-------LWQEFFN-----------------NRD..............................WPVASAVA--------
LPLC_BACSU/93-290-------TILSDLT-----------------ATNGDTMQN...................AVPPEQGIKLAVI--------
CYST_ECOLI/74-276-------LQEFDYP-----------------AAS................................AIASVI--------
Q9ZBG1_STRCO/128-331-------ATAVDFP-----------------LLA................................ALTVLA--------
Q97UH1_SULSO/128-336-------ITGLDYP-----------------LLS................................GIFFML--------
Q97VF6_SULSO/101-289-------NWGAMIQ-----------------QALSYGAAAG.................GKAIYYLAFPTIVV--------
LACG_RHIRD/89-270-------ASAYSPE-----------------YGT.................................VMIGT--------
Q9HLG4_THEAC/81-265-------ELGSMAS-----------------NGVGTLPT.....................GWWYAVFPGLAI--------
MALD_STRR6/87-275-------LQTFVNN-----------------AKNL............................KIAYFSAGA--------
GLTJ_ECOLI/43-239-------GKLLDYS-----------------AHA...............................WESFTAI--------
YEHW_ECOLI/68-240-------LSGFNTA-----------------....................................YVIQG--------
Q9FAT1_VIBPH/84-268-------SMGKIFD-----------------EANSYLLT....................GQWWLAVLPGLML--------
Q9A534_CAUCR/67-247-------YNRLQTA-----------------....................................KVFAA--------
YEJB_ECOLI/151-361-------TVSRDYP-----------------VMF................................GTLYIF--------
YOR2_CALSR/83-265-------IWDFQAR-----------------YGS..................................DIPA--------
O66777_AQUAE/114-319-------VLSQDLF-----------------LVM................................GGLYIG--------
YEHY_ECOLI/195-381-------LLSSAID-----------------....................................LVLLG--------
Q9WXN6_THEMA/92-279-------SLGIMLQ-----------------WAVLMEAVR..................RGLWWWFVPPGLAI--------
Q9Y9N0_AERPE/121-339-------ISYRDYS-----------------TIQ................................GVTVFF--------
Q9WY46_THEMA/67-238-------RQYVDVP-----------------....................................RVYAL--------
Q9Z6P7_CHLPN/68-243-------RRNYEME-----------------....................................LAFAG--------
Q98K60_RHILO/105-289-------AYYSQSI-----------------DIW................................SALVAG--------
UGPE_ECOLI/91-278-------KGMIATG-----------------EGTT............................EWNSVMVAM--------
OPPB_LACLA/113-318-------ISGRDYS-----------------MIT................................ALILLN--------
Q49553_MYCHO/234-419-------NLGQMLI-----------------EASQEVGS.....................NIWIIALPTIIL--------
FBPB_SERMA/341-526-------GFWALTS-----------------EID...............................YVAAAPY--------
Q987J0_RHILO/100-280-------DWGALVR-----------------ENIGGL.........................PFAAPAVIIP--------
Q9CLG9_PASMU/73-248-------NARMQVD-----------------....................................LMFSA--------
Q9PPS8_UREPA/183-374-------IISKDYN-----------------VIL................................LLVIIY--------
PSTA_ECOLI/101-295-------DMMQPIA-----------------NLPVTIFKFA.................MSPFAEWQQLAWAG--------
Q98QF6_MYCPU/174-365-------IESKDFN-----------------IIL................................FLVILY--------
MALC_STRR6/209-434-------SWIYRLT-----------------TGTSP..........................QYSMAAAVTL--------
LPLB_BACSU/104-314-------FDTYVYM-----------------MGITQ...........................GAYSYSTAV--------
YHDY_ECOLI/173-362-------QQATVDP-----------------AWLG............................MSTEGYVFA--------
A0A023Z6E4_ECOLX/104-273-------IRGFQFQ-----------------QTC......................................--------
Q7ANQ9_RHIME/112-306-------AINRDYT-----------------LVM................................GTVILI--------
Q97YP1_SULSO/131-332-------ATELNIP-----------------LLT................................GSFFFL--------
O28506_ARCFU/135-354-------IEYRDYT-----------------SVQ................................GAIVFY--------
Q98K61_RHILO/75-251-------VGRMNID-----------------....................................MVWAE--------
AMYC_THETU/83-269-------MIFYFFS-----------------QYTK............................QWNLGMAGL--------
Q2FVE8_STAA8/117-308-------ILEHDFP-----------------VIQ................................AYVLIV--------
Q9EWP8_STRCO/101-281-------DWGRMVS-----------------ENVPGA.........................TLAAAPFLAP--------
Q9KKK5_VIBCH/118-310-------IFQRDIP-----------------MIQ................................GSALVM--------
YEJE_ECOLI/158-341-------SLGELLL-----------------QGKNNLQ......................APWLGITAFLSV--------
O86691_STRCO/402-574-------EWGLLLA-----------------ENQPYA.........................ERAPWAVLAP--------
Q98QS7_MYCPU/195-382-------NLGLILN-----------------NSTRLIDE.....................NIWAIILPSSIL--------
I3VV06_THESW/85-290-------LNIYQTA-----------------FSAQ.............................EMAVGQAK--------
O34157_SALTM/115-319-------GLRGDVP-----------------LLM................................GIVLFC--------
Q9PL65_CHLMU/67-242-------RRNYDMA-----------------....................................MALAG--------
Q9RX04_DEIRA/318-494-------GIYQDKA-----------------....................................GQFAA--------
SSUC_BACSU/94-269-------RQFSQTN-----------------....................................KVFAG--------
Q9UYG7_PYRAB/121-325-------ALSQDYF-----------------LLQ................................GGFLMV--------

PF07242

A7GQL2_BACCN/621-721-------CILEK..---------------------------------------------FDFIYLVFCILLL--------
A5MAB6_STREE/576-675-------SILTR..---------------------------------------------DGLISALVVALFT--------
Q9L651_LACLL/549-647-------FIWHL..---------------------------------------------NPLTLIIPPILGG--------
A5M6X5_STREE/166-265-------ILSSR..---------------------------------------------DLVIGLLTLLVFL--------
Q8CY97_STRR6/155-254-------VFLQV..---------------------------------------------EIGVAFLVLLLFT--------
A0A0E1X7Q6_STAAU/545-643-------HILFG..---------------------------------------------SKILLFIIMSIAI--------
Q926X5_LISIN/619-718-------FIITK..---------------------------------------------EPIALYFSVVILL--------
Q93MD9_CLOPE/619-718-------SLITK..---------------------------------------------DINIIYFTLILVV--------
Q9KG35_BACHD/612-712-------LYRHSG.---------------------------------------------TQYLAIVVLVLFL--------
A0A0Z8MBH7_STRSU/561-660-------MFMTK..---------------------------------------------SVIVSLGVVVALL--------
Q9CJI4_LACLA/565-662-------LSQRD..---------------------------------------------VNITLEGLGIYFV--------
Q8Y3Q8_LISMO/620-718-------FILSK..---------------------------------------------EPVALYFSVVILI--------
Q896P1_CLOTE/604-706-------FISKIAI---------------------------------------------SKVILITSIVGLI--------
Q892J9_CLOTE/609-706-------IILNKAS---------------------------------------------LNIILSVALAGLI--------
A8AXA7_STRGC/592-691-------FFLTQ..---------------------------------------------EWWIALVTLLLFA--------
Q9CE29_LACLA/560-659-------TIISN..---------------------------------------------EFLYSLFVVSALW--------
Q181M6_PEPD6/617-718-------STRVDL.---------------------------------------------SNNIILFGLLILV--------
A7GNK2_BACCN/616-716-------YVYLG..---------------------------------------------NILPFLTGLFVIL--------

PF02687

A0A0S8DDF8_9BACT/110-205---------------VGGAAALAVI-------------------------------A......GWIPALMA.TR-QD---
A1SH34_NOCSJ/795-890---------------AVAALAAVAA-------------------------------A......SAVASRLS.AS-TT---
A1SKN4_NOCSJ/326-416---------------VGLAVLALVL-------------------------------L......TGLAVARV.AR-EP---
A1TXE6_MARHV/209-306---------------TLTMVAVIVA-------------------------------A......CLAGVRDS.SG-SL---
A3I1M1_9BACT/315-407---------------AGFVAVIGVL-------------------------------A......GLYPSMIL.SG-ME---
A3I2Y5_9BACT/772-861---------------ILLGVIVGTV-------------------------------A........SQIWKL.IK-AN---
A3QAU8_SHELP/338-429---------------PTIAVGTALL-------------------------------A......GLYPAWVV.CR-TK---
A4VW57_STRSY/1024-1117---------------ILAISGILSV-------------------------------L......GWYVNHHL.RK-VD---
A4YKC0_BRASO/760-849---------------VLAALVVTVG-------------------------------L......GLAGTLLA.LN-QK---
A5N346_CLOK5/499-593---------------LLVVAITASA-------------------------------A......VYAPSKRI.RN-MA---
A5USK7_ROSS1/337-433---------------ATVLLALPAV-------------------------------V........IPALSA.AG-RT---
A6H1M7_FLAPJ/310-410---------------NLGTITVCLL-------------------------------V......LTIPTYII.TK-IS---
A6L8W9_PARD8/679-767---------------GLFCLMISFV-------------------------------S......VFFQSYRA.AT-SN---
A6LCJ9_PARD8/311-395---------------LFMALCAGLL-------------------------------A......GAYPAIYA.TS-IP---
A6LZM8_CLOB8/312-398---------------LLLTIILIML-------------------------------I.........SFNEI.NK-LT---
A6TSQ0_ALKMQ/290-387---------------FLLAIGVALI-------------------------------S......SWIPISKA.SK-IP---
A7H957_ANADF/310-394---------------FAAVMVICVL-------------------------------A......SGVAIRAA.LA-VD---
A7HK62_FERNB/280-383---------------IFIAAIVPMI-------------------------------I......LTCKSIEF.SN-IS---
A8ABZ3_IGNH4/274-373---------------FAMSALTTVL-------------------------------T......ILTSIIAI.SK-MN---
A8AR20_CITK8/257-351---------------LLLLLVCSMI-------------------------------.......GWVAAWLA.TV-QH---
A9KQT2_CLOPH/369-506---------------IAISILLASL-------------------------------A......GLASISKI.TK-YE---
B2HGJ6_MYCMM/200-292---------------SPALLALGVA-------------------------------M......AGATAYVT.LR-..---
B4EEB5_BURCJ/285-374---------------AACSVAVGLA-------------------------------A......ALVPAWQA.AR-V.---
B7VH43_VIBTL/299-399---------------VVLAIALSLI-------------------------------A......TVFPSYRA.SS-VK---
B8I8J6_CLOCE/322-424---------------FGIITLFTLL-------------------------------S......TVSPALKL.CY-QN---
D4K997_9FIRM/688-783---------------ILVLFGMELI-------------------------------L......SVWTIRRQ.KK-QS---
D4KYJ1_9FIRM/289-395---------------PVMLLCIFVS-------------------------------FLTVALALRKPMKIV.SR-IS---
D4KYJ2_9FIRM/288-378---------------FIMIFLVGLL-------------------------------Q......IVLSCVLS.SN-L.---
M1FFQ7_9ALTE/713-801---------------GAVSVLIGLS-------------------------------I........TLLMRS...-..---
O28455_ARCFU/301-396---------------LMAGTLTPTI-------------------------------S......GFLVAYQA.SR-VD---
O50782_BORBU/302-402---------------SIFMLILAIF-------------------------------S......SILPFSKA.SK-KS---
Y684_MYCPN/1015-1110---------------MLLIFVIFQF-------------------------------I......SWIAFKQL.FS-KP---
Q01VW7_SOLUE/1304-1396---------------ALLLAGAAAV-------------------------------A......MAGPARRS.SK-SD---
Q025M3_SOLUE/377-471---------------VALGMLTTLL-------------------------------F......GLLPAFRS.TK-VE---
Q034M7_LACC3/430-519---------------LALSFGVTIF-------------------------------A......SLWPIRLI.SR-KD---
Q0P8Y0_CAMJE/176-262---------------LTLIFLATLF-------------------------------I......CLLCVNTV...-..---
Q0RJL1_FRAAA/665-753---------------VAAGLLAALA-------------------------------V......LASTLPLL.RR-IT---
Q18EP9_HALWD/325-419---------------MTAVLIGILA-------------------------------L.......PYPVWLA.RR-TT---
Q1G8P7_LACDA/306-403---------------ILMLLITVLA-------------------------------I......ALVAAHFN.RK-T.---
Q2FUZ2_STAA8/85-179---------------FITLIIIAVL-------------------------------M......GMLLIFNL.FS-IN---
Q2RPK1_RHORT/306-403---------------GGILVLSIVP-------------------------------A........LGIGIHYAA-LE---
Q47EZ3_DECAR/269-372---------------FFFTVFPYTA-------------------------------A......VLVPIWRA.AI-TD---
Q481M7_COLP3/731-820---------------LAIILSTVTL-------------------------------L......GVYASRHS.LK-SS---
Q4A9N5_MYCHJ/1828-1923---------------LIIPFFVISV-------------------------------L......IYLVIFWN.LR-QK---
Q4A9N5_MYCHJ/2549-2644---------------FGIILVVFIF-------------------------------V......LSFLWYFLTSK-KS---
Q4DFN5_TRYCC/470-565---------------LGLGLVLPLL-------------------------------T......GWSLLSRV.LG-GS---
Q4QBC9_LEIMA/1003-1097---------------FGMALAAAVV-------------------------------G......SIAPLLSL.RK-KP---
Q54MT9_DICDI/571-666---------------ILLGFLIPMV-------------------------------S......LILPIRKA.LS-FS---
Q5JEM5_THEKO/229-318---------------ITMAIVLMVS-------------------------------L.........PYLYV.SR-IR---
Q5LCL1_BACFN/298-387---------------VIVLSFGISQ-------------------------------I.........PLYYF.RS-RT---
Q5LDA1_BACFN/308-392---------------LSVVTFLFVI-------------------------------G......GILPGKI....-..---
Q5LFF2_BACFN/320-426---------------FAFCLILNLL-------------------------------S......AWWPTWRS.LH-KD---
Q5V3A9_HALMA/900-995---------------FVGGVSLALF-------------------------------G......ALVATVPY.LT-AS---
Q6AA47_PROAC/625-722---------------SVLAIMVTAF-------------------------------A......TGVPRFQL.SA-VR---
Q6AMB4_DESPS/311-415---------------YYIGFIPGIA-------------------------------S..TLLGAALSGIGI.YK-RQ---
Q6F163_MESFL/1307-1400---------------TLSVMSVVLL-------------------------------F......GWYASNKQ.VK-RN---
Q6F1V8_MESFL/1717-1810---------------GIIIMFVLAF-------------------------------T........FSLRKP.IK-DE---
Q6F1W1_MESFL/1327-1420---------------VFLGIVGIYA-------------------------------I......AIFAGYKRITK-TN---
Q6MGV4_BDEBA/685-778---------------VAIMVLCYLM-------------------------------T......GLFLYSKV.KS-LN---
Q6MSQ5_MYCMS/397-490---------------LIFMWLIISA-------------------------------I......SFLIGYLI.MK-K.---
Q6MT15_MYCMS/588-682---------------ILIIPFIFLM-------------------------------G......SYWASIIY.IK-EP---
Q6MUJ8_MYCMS/1693-1786---------------ILLILVSFFT-------------------------------S......LWVSTKRV.RN-AE---
Q79Z83_STRAW/268-362---------------YMAFWTGLLV-------------------------------A...LCGAVAASWRA.GR-T.---
Q7UPA2_RHOBA/607-706---------------GILGWLVCMF-------------------------------T......AAWTLRFL.LR-LN---
Q7V1V4_PROMP/299-384---------------FILVLVMCMG-------------------------------S......AGIAMRKL.VD-..---
Q81HP3_BACCR/261-351---------------FLTMFVTVIP-------------------------------I...........KHI.IN-IY---
Q81QE5_BACAN/286-379---------------TTLLFLVVIL-------------------------------F......CRIILRNF.RR-IT---
Q830M8_ENTFA/609-698---------------IIVYLIFYIL-------------------------------T......SAIYARMI.RH-IH---
Q87SX2_VIBPA/317-410---------------LSFVQCAGIV-------------------------------I......GFIPAFRA.YR-QS---
Q899W1_CLOTE/276-369---------------APIIMSFLIS-------------------------------I........ISVKKF.FN-LD---
Q8A9F6_BACTN/292-381---------------LFLLLLPGIA-------------------------------V.......IYPFLRY.RH-IT---
Q8CYG6_STRR6/429-522---------------SLLALVLSWL-------------------------------A......SVLPAYLV.AW-RE---
Q8DQ76_STRR6/86-181---------------LVVFGLIFLG-------------------------------L......MFLNALRI.AR-MN---
Q8DQS2_STRR6/328-451---------------FVLALVLVVL-------------------------------V......MALASSNL.LR-KQ---
Q8EUA2_MYCPE/1386-1480---------------ASLGIIVIFF-------------------------------L......SYWTTWQKIRK-MD---
Q8EZY9_LEPIN/286-379---------------IGVLIPFFSS-------------------------------I........ESLIEI.RT-LK---
Q8G7P9_BIFLO/348-438---------------GSILILAILA-------------------------------A......LRLAFFSA...-..---
Q8KD33_CHLTE/294-389---------------VLLSFGAAVG-------------------------------G......ALAAARRA.VK-LP---
Q8NS27_CORGL/639-739---------------LVVAPLVCAV-------------------------------I......GAIASPSG.RH-QE---
Q8Y6E1_LISMO/85-180---------------MLVFFGIMLF-------------------------------T......SVYAVFLV.LR-YN---
Q97DB8_CLOAB/742-835---------------VILGVLITVI-------------------------------S......SIVPSLKS.SK-LN---
Q97LN0_CLOAB/763-854---------------VFGVLFIVFI-------------------------------T......MMYSISKI.KK-EN---
Q9A6K3_CAUCR/378-465---------------AGFLVAIAML-------------------------------S......GFLSLGVL.KN-SQ---
Q9FBP3_STRCO/683-772---------------TGIGAAVVLV-------------------------------V......TLCSLPPLLRL-MR---
Q9KF85_BACHD/565-650---------------VLTFLFSLIY-------------------------------VSMMRGVQKISFRRL...-..---
Q9PPU7_UREPA/189-284---------------PIALTLILGF-------------------------------I......CWVLIYYI.LK-HS---
Q9WZG5_THEMA/751-844---------------TVIALASAVM-------------------------------V........IPSLMM.SK-LS---
R5K905_9CLOT/831-926---------------DILKLTIVVV-------------------------------A......MFIICFIV.LR-TI---
R5KJ88_9CLOT/371-467---------------YGIVVPPVIS-------------------------------I.......IVNSLVIRKR-LS---
R5TSZ9_9FIRM/299-417---------------AVFLLCLLTF-------------------------------V.........SLILV.RR-ME---
R5UPZ8_9BACE/319-410---------------LLIATFVICF-------------------------------S......VAFYIRRV...-..---
R6WL88_9PORP/179-267---------------LFVCLVVLIC-------------------------------I.......VYRIWDV.AN-ED---
R6WLH2_9PORP/307-392---------------TGISWLILTI-------------------------------V......SLPLFLHF...-..---
R6WYF0_9PORP/312-402---------------CGLILILSVI-------------------------------P......ACYMSRKI.AN-L.---
R6X6U4_9PORP/300-397---------------FLFVLCALIV-------------------------------S........LVIFRI.KH-IT---
R7EAJ1_9BACE/317-408---------------WILMALMVIA-------------------------------G......IWYPASRA.MK-VQ---

PF03739

Q3ATU7_CHLCH/6-355K.KRGGIAAE.....IAITLFIGFL.YLGIQRTIAIAGYQ...GVL.PP...IV..A------AWLPNL.LFLV-VG...
Q118T4_TRIEI/24-389PQRKANRGTS.....FGISVIIIFA.YYLLSFITGAMGQK...EIL.TP...FL..A------GWLPNF.LGLG-VA...
A0LEN9_SYNFM/39-391F.RQRGRIAG.....ITIGLVVFLA.YYVILSAGKGLGEN...HLV.HP...FL..A------CWAPNL.LCIA-AS...
A7HYF9_PARL1/7-370F.NRRGYASRMA.TAAAMALTVRILGFALSNAVGNNLALA............PL..M------YILPIAVCGIC-LA...
Q8DIL4_THEEB/18-374PSQRRGRQG......FGISVAVVFG.QYVLTFFLGALGTT...GTL.SP...LA..A------AWLPHS.IGLV-VA...
Q82W93_NITEU/6-348A.PRKDKTDR....TFLVAALVFAV.YYNLSGLAKTWVEQ...GVV.AA...MP..G------VWWVYG.LLII-IV...
A0LB31_MAGMM/6-364L.HRMGGTFR....SMLMGFITGFF.MFVVVDLFTALGFG...ERL.PP...FL..A------AFAPVM.FFIC-IG...
Q6MKD0_BDEBA/11-364T.NRRAAKAG....GMILCIGIIIF.YWILYVAAEGAARS...GAL.PA...AL..A------IWTPNV.LFAA-LG...
Q6FFD6_ACIAD/9-354P....LRQQSMGFRLVI.ALFIGLG.FYYLQDFLGYASLV...YNP.SP...AW..F------VLGPIV.LMFV-AG...
Q0C1U6_HYPNA/7-346Y....GRRSNADIAVAA.GVAVGFF.YMVVDGILKTLAEN...GSI.SP...IL..A------VALPIL.ALFL-GS...
Q11U59_CYTH3/9-455I.KKGGLGIP.....VLICIIFFIF.YYVFSITGEKWTKE...GVY.PA...DF..A------MWFGNG.ILFC-VG...
A1AWC7_RUTMC/20-369S.PRSGKNLG.....VLVGVVMFIV.YNNVLLIAKSTLER...GES.SP...IV..G------LWWVHL.VMLL-L....
Q73NV9_TREDE/13-373G.KTYDQSTG.....FIVGLLISVA.YWAFLIGGQMLCLE...SGL.NIN.GAL..V------MWFPNV.LLVI-CT...
Q1GR36_SPHAL/14-363L.ARSGKLFV....RAIIGMALGFA.YFVADNFALAMGDL...GAY.SP...FL..A------AWGPFI.LFAL-IG...
A5EXI6_DICNV/8-348R.PRQGRYQR.....LLPAFILFGI.YINLLDIALKMFSR...GQI.PF...LI..G------GWGIHF.AAAF-IIAIY
Q7VQS8_BLOFL/9-358P.FYKKKISF....RLFFGGIIGFV.FYVLHQIFEILSIV...YNI.TP...IV..G------SIILIM.LFLM-IN...
Q310A0_DESAG/6-352T.WRDSIYIN.....VGTSLLLVFV.FYTLFTVGGSLGEN...GIV.PP...LF..A------AWTANA.FFSL-SA...
Q5SL96_THET8/6-344L.LGGSRSLG.....LVGVAVLTFF.YYATWSVGRIMGEQ...NAL.DP...FL..A------AFGPNL.LYGA-LG...
Q6MJL5_BDEBA/6-356R.ARSGGTML....NVGICLALVFA.YYVFYSSGITLGQH...GTL.PP...VA..A------AWAPNI.VMLG-VA...
A5WBH3_PSYWF/27-466K.PRQGRWLR.....LLPAILIFTSCVLVIISLKNAITKG...TLS......VL..S------YPLVLI.GFIV-LA...
E0TCF8_PARBH/6-360MNARGGGTAL....LMGMGILAGFL.LFILSELSAAIAEA...AIV.PV...GL..A------AWAPAL.LAVL-FA...
Q984S3_RHILO/7-356F.ARMGQSAT....MILGGVVAGFL.LYVVSVLVKAFGVA...GFV.PT...AI..A------AWVPVV.VAMF-FG...
Q2S3I0_SALRD/55-410R.RRGGQAVR.....FAIGLLIAFV.YLSVQKLAEPLGYA...GTL.SP...AW..T------AWLPHL.TFAV-VALLV
Q1IRI3_KORVE/435-789RQRRGGPLAG.....VATAIGIAIL.YWVSAGLFEAMGNA...NQL.PA...LL..A------AWAPNL.IFGF-AA...
A1WAC0_ACISJ/11-359S.KRGRRTPG.....VVFASLALLL.LNHTLQFGKSLAES...GRL.PA...AL..A------VWTPFL.LFAL-LS...
Q8D296_WIGBR/5-350K.LGSGQFFN.....LFLGIFFYLI.FFISQTFIYSNHSL...FKL.HS...IF..F------MWIINF.IYIF-FS...
Q6MDI9_PARUW/8-358F.SRQIPIFF.....IYIYSLFGLIAFYMLMDAAQVLAKR...QVL.PP...IW..A------IGLPFI.LVFS-FY...
Q9A939_CAUCR/5-350N.FRSGQGAV....LLTGGLAAGLM.FLVANGMLTALGES...GAL.TP...FL..A------VWAAPA.IFGA-LA...
Q1D894_MYXXD/7-356A.NRRGHLTA....AIIEGLLTAVA.MWGLMMVCRTLVLT...ERL.SP...GV..A------AWTPTV.LLGL-IA...
Q1QKW5_NITHX/6-356P.RTTRQSRN....FSMGAAIVTVFGLRMAGFALSVMAVK.......SP...TA..P------LLQYLL.LFAA-IG...
Q143Z1_BURXL/6-377H.TRAGVVGM....KVFGGIMLGMS.FQLFNTLFSHIGTL...NTW.PA...PL..T------AATPGL.VYLV-LG...
B5EBA8_GEOBB/11-361N.RRSGKAAG.....FSLSIGVILL.YYVTLSAFDTLGER...GTL.PP...LL..A------GWSPNL.IFLL-AG...
A3I2C6_9BACT/6-354K.SRGGSGFQ.....IAMGFLLAFI.YILLFILSRTFAEN...GAS.YP...IF..A------VWLPNI.VFGL-TG...
Q2RQ55_RHORT/8-372G.EFDRRGGNK...RVILAVALVVL.FQAGSLGAATVAKKSLDGLL......LLDLM------TLLPIL.VGWI-WL...
A1WUU9_HALHL/6-348A.VRSSGAGQ....RIVIGVLVGVA.FFLLNRALGQAGVV...YGV.PP...SL..S------ALLPVV.AFAA-LG...
A5G1T7_ACICJ/24-378S.PFRRQGGA....AALVAAVFIVMGLVALELGTENLAAR...QNGLIP...LIFAV------TLGPAL.VGLA-L....
Q3B4Y3_CHLL7/6-432A.RRGGFGIG.....AVLSLLFFVL.YWVLMITGENMAEW...GVL.PP...AV..A------IWMADV.VIAV-IG...
Q0BZX3_HYPNA/9-369L.QRLGGTSR....LLATGVLAAIG.LYFFTQFSSSLGST...GAA.PA...VV..A------AWSPPL.FVLF-VS...
A2U291_9FLAO/6-450I.RKGGFGLP.....MILAIAVYVL.YFFTNTFGKNLAEE...SSI.TS...IL..G------SWISAI.LMIP-LA...
A0LB30_MAGMM/6-357Q....NQRSGRG.FGFIVAISVLIL.QFILLTLGEAMAKR...GLI.SP...AM..G------AWSPNL.ALLL-FT...
E0TCF9_PARBH/51-404P.PISRRGYGQQVLMAIGCALLLRTGGFLLQGLAADLGAL...NGL..........Q------YIVPLA.VILL-GS...
A5EXI7_DICNV/7-348T.RRDGNGAR.....LVIGILLGAS.YYVVQGIVTKL