Sequence alignment for CL0406

PF05532

A2U1N1_9FLAO/4-56DTNEGTW-KQIKGEFKETYGEIANDESAEAEGKKDKLFGEIQEKYGKTKDEIAE--------------------------
Q03QQ0_LACBA/4-56TKGDAAK-DKLQGKAKEVTGKVTGDKQKETEGKADQLAGKAKDKFAQAKESLKG--------------------------
A1TPU9_ACIAC/4-56DQIKGSL-KEAAGKVQQKTGEVFNSPEHQAKGMAKQVEGNVQKNYGDAKENIKD--------------------------
Y1427_PROAC/5-57DKINSKS-DEAVGAAKEKIGGLTDDSDLKSAGADQKASGKVAQKVEDVKDKAND--------------------------
Y1180_ENTFA/6-58GRFDDAK-DKVEGTAKEAQGKVTDDKGKELEGKAQSTFADVKDKARDAGDDLKE--------------------------
Q091A6_STIAD/4-56DQVNGVW-EQFRGKAKQVWGELTDDDFMKAEGSTDRLYGIIQQRFGDTKEAIKA--------------------------
A8ZV30_DESOH/7-59EKAEGKI-HQVKGKFKEAAGIIAGNRDLEAVGKEEKKEGKIQEKLGQIKKLMDK--------------------------
A1RBI4_ARTAT/5-57DKIKNAA-EEAVGKVKEKTGETTGDRDLQAEGLGEQSRANLKQSGEKINDAAKG--------------------------
Y738_STRAW/5-57EKAQANG-EQAKGKVKKVVGGAAGNESLKGKGHAEESKGDLRAAKEKAKDAIKR--------------------------
Q3JEE2_NITOC/6-58DQIEGNW-KQFKGHARQKWGKLTDDEIDEAAGNKQILAGKIQERYGIEREEAEK--------------------------
Q1QNV4_NITHX/4-56NRIEENW-DQVKYKVRDQWGKFTFDDLWEISGKREQLEKKLQQRYGYGNDYAKK--------------------------
A5G466_GEOUR/7-59DKAEGTF-HEAKGKVKEIAGKITDNPKLEAKGKGEKLVGKVQEKIGQVKKVLGK--------------------------
Q0BTD3_GRABC/5-57EEFEGKA-EKLAGKVQEGIGRLTGDTETEIHGKARQRYGEAQSALAETCDTVKS--------------------------
Q0BVF3_GRABC/4-56HDIDAAV-TDLKGKVKDAAGGLTGDTGLQAEGKLDQGISKAKQFAHDATDAVQD--------------------------
Q28Q93_JANSC/4-56DQVEGKW-NEMTGNVKAKWGELTDDEIAEVNGNREALEGKIQAKYGKTKEAAKQ--------------------------
B9M9I1_GEODF/11-62DRAEGKY-HQMKGSLKESAGKALNKPGTTVAGKAEKTAGKVQEKVGRA.ERSSH--------------------------
Q5NPJ6_ZYMMO/6-58NKIKGTA-QKAVGAGKEELGKAIDDPELQSKGILEQAQGAASKAFGNAKEAISD--------------------------
A1R3R9_ARTAT/5-57DKISNKA-QEVTGKAKEALGDATNNQKLQAEGVADQAAAKTKQAGENVKDTAKD--------------------------
Q2Y5N9_NITMU/4-56DQVKGTA-KDIAGKIQEEAGRAAGSKEHEAKGLGKQVAGKAQKKYGDAKEAVKD--------------------------
Y2439_NITEU/5-57NTVERNW-KELKGKLKETWGDMTDDELDVIAGKREQLVGKIQTKYEIAREEAER--------------------------
Y2059_PSEPK/4-56EQIEGVA-EDLAGKAQSAVGRLVEDPALEAEGDARQAAGQVTKTYGDTLDTVSS--------------------------
Q0SB85_RHOSR/9-60QARKGLL-DSVKGKVKEVAGAVTGNDSLATEGQLQQAQAQQRREANSA.EAVAR--------------------------
B0SZI5_CAUSK/4-56NRVEGAV-DKGVGAVKEAAGKATGNERLEAEGAVQKAKGDVQNKVGQVQDKIGD--------------------------
A0K186_ARTS2/23-75DRIHNAA-ERLHGKGKKAAGEASGNRRMRAEGRGQAIKADLKQAGEKFRHAFKR--------------------------
A9B8E3_HERA2/6-58ERIKGKA-EEIYGDAKERLGDALDNEQMQAEGRATELKGEARQEAAKAAERLGG--------------------------
Y4474_RHOBA/5-57QELQGHW-NEVKGRLKEHWGQLTEDDLQQARGSAEQLVGVVQQKTGATQNEIEK--------------------------
Q2J6D8_FRASC/8-60DKVRNKM-QELRGRTKEQAGKATENRDLQAEGRGERGVADLKNAGEKAKEAFRH--------------------------
Q5WD64_BACSK/7-59DKMKSAA-NKAKGATKEAAGKAADNKKMQADGKKDKLKGKAQEVEGDVKERMKE--------------------------
Y1088_STRAW/5-57QKAKAKM-EQAKGKAKAAAGRAVGNERMAAEGQAEKSKGDARQAKEKTKDVFKH--------------------------
Y198_COREF/3-54D.LSNKA-EGVGGKIKEGIGEATGNESLADEGRADQTKADIKEAVSDAGDKIKD--------------------------
B0UMA2_METS4/4-56KRVTGET-NKVAGQVQGAVGDLTGDTKTQAEGALREARGTAENLVGQAKDAASR--------------------------
A1SQH9_NOCSJ/5-57DKAKHKL-EEAGGQVKESTGRATGDRDLEAEGKADQAEGKVKNAGEHVKDAAKD--------------------------
CSBD_BACSU/8-60DKMKGGF-NKAKGEVKDKVGDMADRTDMQAEGKKDKAKGEIQKDIGKAKDKFSD--------------------------
Q5FU16_GLUOX/7-59TKAEGLL-DEAKGKVKDGFGGLTGDAKLQAEGKFDQLSGMAQQDFADLYDEGET--------------------------
Q0SBD9_RHOSR/5-57KKLRHKA-ETAEGSAKKTVGKALGNERMEAEGRAQEAKGKAKQAGDQIKQAGQK--------------------------
Y4418_RHOPA/6-58DKIKGQA-NELAGKAKQGIGEATGSDKLKGEGAIQEAKGHGQQALGNAKDAVKD--------------------------
A8FAC4_BACP2/9-61DKAKGKT-NQAKGQLKEKLGEATDHQKLKSEGKKDQAKGKLQDKKGDLKNHLNE--------------------------
Y3924_XANCP/4-56DIISGKW-TQLKGQMQAKWGDLTDDDFKVAEGNAEYLQGKLQERYGWDRDRAQT--------------------------
Q0BZP9_HYPNA/19-71NTVKGVG-NQIAGNAKEAAGKATDNKKLEAEGRIQELKGDAQRAAGKVEDKVKK--------------------------
Q035N8_LACC3/3-54D.YDAAK-DKVSGKVKETAGKLTGDESTEAKGKAQQIAGDVKEKLGEAKDKVAE--------------------------
Y1136_STRA5/4-56EKFDAKV-DKVSGSVKESVGKLTGDKEVESEGKVDKLKGHAKEKLADIKDTIKG--------------------------
B1YJ57_EXIS2/9-61KKADGLV-DKVAGKAKEALGKATGDKSTEREGKKDQLKGDAKKTVGNVQQNLED--------------------------
A0K027_ARTS2/5-57DKIQNEA-EHLGGKAKEAAGNATDNDRLRAEGQKDQVVADAKKVGENVKDEFKR--------------------------
Y070_XANCP/4-56NRIEGAA-KQVKGSVKEAIGRVTGDKSTELEGAAEKNIGKVQRKAGELADDVRD--------------------------
Q8U506_AGRT5/4-56NRIEGIA-RQTKGTIKEAAGKITGNDKLQAEGKAEKLAGQAQEKLGQTKDTVKK--------------------------
Q161A5_ROSDO/4-56DVIKGNW-SKMTGEIKSQWGDLTDDEIQQAAGERERFVGLIQERYGMAKSDAET--------------------------
A7HB93_ANADF/4-56DQIKGKV-EEIKGDVKQRIGGATKDRSTQGEGWLEEKKGQVRQGIGDLKEEVKR--------------------------
B2JN16_BURP8/4-56DQVKGTA-EKMKGKVNETVGKATGNRSQELKGDLQQGAGEMQKSYGDGKEAAKD--------------------------
Y040_GLOVI/5-57KRAEATA-KDVQGKAQEAWGDLTDDPKLELEGKAKQVEASAEHKKEDLKDQAHR--------------------------
B2JR30_BURP8/4-56TKTEGAV-REAAGNVKETIGSIAGDVGMQLGGKADELRGKAQQVCADATDLARD--------------------------
Q1IQ08_KORVE/4-56DRIEGKM-DEVKGKVKEKVGEMTGNRKTQAEGMADQVKGKVQNTFGKMKDEVRA--------------------------
Y2685_OCEIH/7-58DKAKAIG-KKIKGEAKDQWGSATDDPQRKAEGKRDKAKGEAQDTIADAKNN.NK--------------------------
A4FL18_SACEN/5-57DKADHKA-EELKGRAKEKLGDVTDTEQLQAEGKAEQAKGSLKQAGEKLKDAVTG--------------------------
A5FT40_ACICJ/4-56DRVAGLA-KEIKGAVKEAVGKLVGDAKLQAEGRAGKTEGRVQNTVGGLKDSVRK--------------------------
A0K0M7_ARTS2/5-57DKIKNAA-EKAIGEAKEALGKLTNNSKLETEGKIDQGTADAKHAAEDVKDTIND--------------------------
Q2L349_BORA1/4-56DIIAGKW-KQLTGKARAAWGELTDDELTRTEGNAERLAGLIQERYGKTREQAQQ--------------------------
A3HS65_9BACT/6-58DKLKGNW-NVVKGKLKQEYAELNDDDLKFEEGQEDELIGRIQKKTGKAKEDVKS--------------------------
A2SM27_METPP/4-56DQLKGRI-EQAKGKVKEVAGKVVGSEKLETEGRVDQVTGKTQATYGDAKEKAKD--------------------------
Q03VV7_LEUMM/5-57EKFDNAK-DKIAGKAKELEGKITGDKAREVEGKTQNVKGEAKDDVQKVRDVAHD--------------------------
A6WFW3_KINRD/5-57DKIKNAA-QDVAGKAKEAAGGAKGDEALRREGQADQGAADLKQRGEHVKDAFKG--------------------------
Q5FN00_LACAC/3-55NMDSGLK-DKIIGKAKEVEGKITGDKSREAEGKAQKTKGKIKAKAKEVKDDIES--------------------------
Y8179_RHILO/8-60DQVAGLA-KQLKGSVKQAAGKATGNRRTQAEGMADKVAGKVQKAYGDVKDKVKK--------------------------
A1B833_PARDP/4-56DIIEGKW-NQLKGSVKEKWGDFTDDELTEVAGKKDKLAGKLQEKYGWTKEKADE--------------------------
Q5FU34_GLUOX/6-58DKIKGVA-NQVTGKVKEEVGHMTNDKELEGEGVAQNLKGKVQKTTGDAKNAVKS--------------------------
A7HP45_PARL1/4-56DQVEGNW-TQMKGRIKEAWGDITDSDLQKVEGKRDRLAGLLQERYGKQKEAAER--------------------------
Q744Z0_MYCPA/5-57AKIAHKF-EAAKGSAKKVFGRATGNTGMRAEGRAGQVKGNAKQAGDKLNDAFKH--------------------------
A5G0C4_ACICJ/4-56DEIEGGA-RAFAGKAEEALGEATGDEDLQREGMRHQAAGEAQKLFGAAKDAARS--------------------------
Q11J10_CHESB/16-68DELKGSA-KKMRGTVKDEVGKATGDDKMRAEGKADKAEGSIQKGVGKAKDTVRD--------------------------
Q03GM7_PEDPA/5-57ERLENTK-DRVTGKVREGAGKVTGDKKEETKGKAQNMTGKVKDKLKDVKESAEG--------------------------
A4YM73_BRASO/4-56DRLTGTA-KDVAGKVEGGIGEMTGDKSTQASGRAREASGVVQNLYGQAKDAARE--------------------------
A5VLZ6_LACRD/12-61...HGIK-DKVVGKLKEVEGKITNDKPRETEGKLQKAKGKAKDKVTDLKDTLED--------------------------
C5ARD0_METEA/5-57NRITGAA-RELGGKVQGAIGDLAGSHTDSGEGRLREAAGRVENIYGQAKDAARH--------------------------
C5AUZ8_METEA/5-57DRIVGTA-KDLGGRAQGVVGDALGSDRDSLEGRYREAEGRAQRIYGQAKDTVRD--------------------------
F0S4A3_PEDSD/6-54..LKGKW-NELKGKVKQAYADLTDDDLKYEEGKDDELLGKLQQKTGKTRDQV..--------------------------
F4B0Y2_KROS4/5-56.ELEGKW-NQVKGDFKQKYGKHFDDDETFADGKFDEVVGRIQEKTGKTKEAIKE--------------------------
G8RL32_MYCRN/10-61EGIKGAV-EDVKGKAKEAIGTVTGRDDMVREGEAQQDKADAQKNAAKKEAEAE.--------------------------
K5X5J2_AGABU/17-68.KVSGQL-NSAMGTAKETVGKMTGATSLQQSGKEDHAAGEAENKAAQTKGHAEG--------------------------
Q04FJ5_OENOB/5-57DKADSLK-DKTAGTAKEVEGKVTGDKTREGEGKMQKTVGKAKDILSDAKDAVKE--------------------------
Q327V2_SHIDS/4-56DEAGGNW-KQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEK--------------------------
Q3IHN4_PSEHT/4-56DRIKGNW-KELKGKAQRKWGDITDDDLDKIEGSRKELVGKIQQQYGKSKEEAER--------------------------
Q4WYU1_ASPFU/78-127.RTQGTW-DQTVGSAKESLGNLIGNENLRREGQEQNASGKAQEAKGQLQDWG..--------------------------
Q5M3N4_STRT2/2-52.GIEDKL-NQAKGALKEGAGKLTGDKKTEIEGAVEKVVAKAKDGIKYVKEGVD.--------------------------
Y987_BACAN/8-60EQITGKV-EKTKGQVKEGIGEVTEDRKLKNEGKWDKTKGTIKEKVGKVKQKISD--------------------------
Q81Y63_BACAN/10-61EKVEGAI-DKVKGEVKEVVGKVTDNKKLQAEGKWDKVKGTAKDTVGNVKEKVH.--------------------------
Y4561_PSEPK/6-58DKAKGLA-NEAIGNVKQGVGKVTDNEKLRAEGKAQELKGEAQQVKGNVKDAVKK--------------------------
Y1626_STRR6/3-53..VEEKL-NQAKGSIKEGVGKAIGDEKMEKEGAAEKVVSKVKEVAEDAKDAVEG--------------------------
Y4653_NOSS1/6-57.RIEATA-KNIEGKLQEVIGEVTGNPSDKAEGKAKQAESQVIHTTENIKDELKK--------------------------
Y2158_LISMO/9-60DKAKGLK-DKVVGDAKDKFGKATDDKGKQVEGKAQKAKGEVEDKTGDAKKKLS.--------------------------
Y2005_STRP1/4-56EKLKSKI-EQASGGLKEGAGKLTGDKELEAKGFVEKTIAKGKELADDAKEAVEG--------------------------
Y1261_STRP1/4-55EKYNAKL-DQAGGKLKEGFGKISGDKSLETEGKVDKVTGKVKEVIADAKDTVK.--------------------------
U9UUD4_RHIID/6-57.RVDANT-KYYQGAVKETIGKAIGNEQMEAEGTAKKLEGEGEYKAAQTKGQAEG--------------------------
V6F3L7_9PROT/4-55NRIIGSG-KQIKGSIKEAVGKAVGDAKLQVDGKAEKIEGKAQNLVGTIEDKIK.--------------------------

PF05957

A1WJ84_VEREI/57-150ATTQGDL.EKLVSDLRGLLANKNLDAVPEIRQLRQRLDDGMHSVRDSAVRAAQD....AARQAKEAALAADRY.......
Q98FN3_RHILO/16-108SDLEADI.RQLKADIDKLTKQLAKTGEHGYGTARRAATEGVEQLRAQGEAAFDS....LRGSAKDIEAQLLAN.......
Q0KFB2_CUPNH/42-137GEVKALI.AQLEHTIEVLAREGSAESMRAGQRLRERATDMAHRLRAQTTDGMMR....ARERMDGAVEHAQHR.......
A4SX80_POLSQ/25-118DQLIGEF.KSLMADAEALIKATEDHPGETLNSIRNKALETLTNAKASLSGVEGK....LADKAREVADGADDF.......
B2JFY8_BURP8/7-100ERLMSDI.KTVLADAEDLLKQAASATGERASELRETALSRLKQAKEKAADVQVV....VVEKGKKAARATDDY.......
A8GJY2_SERP5/8-101ENLRAEL.KSLADTLEEVLNSSTDKPKAELEKLRSKAEGALKDTRARLSDAGDK....IASQTKQIAGQADEY.......
B2JI17_BURP8/34-124EDIASEL.RTLMNELENTL...GDGTQADAAALRTQLRKRLDDARSRLNDTRDV....MRDRAQAAMHDADDF.......
Q6D9H6_PECAS/8-101EYLRAEL.KSLADTLEEVLSTSSDKSKAELDKLRNKAESALKETRSRLSDTGER....IASQTKEAVESADDY.......
Q1QXL0_CHRSD/16-109EQLKDDL.RHLSQTVEELVKATADDSRGHITQARERAQQRLTETRAKLEARGEK....VYDNARDQIDHCDRY.......
B2JEB7_BURP8/13-105QKIIQDL.NVLLTDSQEMLRLAAAVPGEGLEALRDRLRTHVDSVQHALADAQIS....AQRRYRSASVQTERY.......
Q0KA77_CUPNH/13-106EALARDA.NTLLADVQALLRDVADEAGVETAQARAQLSARLHALQGRLAEQRQA....ARMRVSQWADTTDRY.......
Q1GFM7_RUEST/4-97DQAAPSS.DEIIAQMDVLRSDIAELSKSVSHLAKDRVGKARDAARETARDQAQT....VADGAAQMSRQAEDA.......
Q2Y9T3_NITMU/10-103EKLIKDF.RSVIADTEELMKLVSNEGEGKAQMVRDKLNQNLNVAKEYLRNFEDV....VVDKSRVAARATDEY.......
Q21W93_ALBFT/10-103DKLMSDL.RMVIADAEEVLRMTADEVGEGAADLRGRVQARMNQAKDDLVHLQEA....AVAKAKAAGHVADDF.......
Q47JU8_DECAR/11-104EKLVSDL.KIVISDTEELLRATAGAAGDKVGELRERLGVRLRDAKERVIDLEVA....LVDKTKAAARATDDF.......
A1B1V1_PARDP/41-142REHGAELYETAREKGAEFVETAKKRGAEYADTVRERGHEYAERARDEARRLYRQ....GERQAHEVAAHAEEYYDEVSDM
Q0WDZ6_YERPE/9-102TSLEDDL.AMLTDTLEEVLRYSGTLADESYQEIKARAEKALKEVQSRLSDHGGC....HIKQIKAMACCTDDY.......
Q2YBA8_NITMU/44-137SVARDEF.AKLRADLDDLISRIPNLSDVDLEEAKEKLMAKIADTRAAAHDLAED....AQEQFDYALESSKEC.......
Q12F44_POLSJ/21-114DRLISDM.KVVLADVEDLLKSAAAATGETAVALREKAAGKLKLATEKLTGLQEA....ALLKGKEAAKLTDDY.......
A4XWN9_PSEMY/12-105DALLDEF.QALVSDTEKLLHHSASLAGEQAEALRDDIRSSLGRARETLHNAEAS....LREQGKIAVDATEEY.......
Q9CN33_PASMU/10-103DELLSEI.REILDNAEELFDEKSKASVDELKKLKSNLDSRVSKLQKQFGVLKDD....AVAGTKEVIKQTDEL.......
Q2KWA5_BORA1/12-105DKLIDSV.KSSLNDVESLLREAASSSGEKASELRELALGSLKRTREALYDAQDA....MVERGRRAARATDDY.......
Q47K12_DECAR/11-104QKIVADM.KAVVSDAEEIFRETAGVAGDKMLDVRQRISDRLGAAKVRVADAEAA....ILAKTKAAACATDTC.......
A1TPY9_ACIAC/14-107SNAQQEL.ERLVTDLRGLLSNKDLDSVPEIRQLRRRLDDGVNTVRDSAVRAAQE....AANQAKEAARVADRY.......
A1KBS7_AZOSB/9-102DKLMSDL.KVVVSDAEELLKLTAGQAGDKLGDVRVRLGERLAIAKERLIEAEAA....LVDKTRRAAHATDDY.......
Q7NSF9_CHRVO/11-104EQLLDDV.RQVLNSTEELINSTVDDGSQHAKELRKRLADKLGTAKAKLRDAEVA....VVGKAKEAAKATDQY.......
C1DFW5_AZOVD/14-107ERLEKEI.HDLLHALEHLKSSASRDTRNNYERLRDRAEGLLRHSRHHCHDTGHD....LARHCRKISECAYDC.......
Q6D2T0_PECAS/11-103IRVDDDL.KLLSETLDEVLRYTGDQADQTYLDLKKGAEKALLEVKARIG.VTDG....YYARAKQVADKADVY.......
A8GGZ4_SERP5/10-103TTLDDDL.RMLSDTLEEVLRYSGDRADQAYIDIKSHAEEALSEVKSRLADTTES....YYARAKDAVCRTDGY.......
B2U7J2_RALPJ/37-130EKLMTDV.KTVLSDAETLLKQAASTSGEKAAELRERGMGMLRQAKEKAQDLQDA....VVHKSKAAARATDDY.......
Q7N099_PHOLL/8-101EDLHVEL.KSLADTLEEVIKSSGDKSKVELEELRGKVEEVIKDTRSKLSNASDM....VVKKTKDMAGRADVY.......
A8GI74_SERP5/10-102RDIDQDV.TLLADTLDEVLRESGDKTKEELKELHSKAKGVLRDARARFNGSSN.....LTQHARDVVGQADSY.......
A4YM41_BRASO/45-132.DIAALT.DQITDVLNAFAGQAGKQARSGYRQARENVDQTFDDMSERGSAMLGA....AQDAASSLEERLEDV.......
B4EMP6_BURCJ/39-128.DVTDDL.RGLVDELEDLLKNDG...DGDIAALRKRVQSRLDEARSALDYASGS....AAARLRDSAERVSQA.......
D0IVQ5_COMT2/12-103..AQDDL.EKLVSDLRGLLSARELDKLPEISVLRQRIDDGMANVRESAVRAAQD....AARQAREAADVADRY.......
D5CC60_ENTCC/9-101.HLRAEL.KSLADTLEEVLNSSADKSKEEVSKLRSKAEQALKESRYRLGETGDA....LAKQTREAAARADEY.......
F2KI05_PSEBN/17-105.QAFSEL.TALIEESEKLLKSSASLVGEEAEDLRGQISQKLQQALDSVTS........TRERTRPMVDATEVY.......
M9X2I1_PASHA/10-103EELTNEI.RDILKNAEELFNETSDSSTEEYKKLKDKLAKQFDDVKDRFATLKDD....TVDSARTVVKQTDTL.......
YGAM_ECOLI/15-107QDIQNDV.NQLADSLESVLKSWGSDAKGEAEAARSKAQALLKETRARMHGRTR.....VQQAARDAVGCADSF.......
Q13TL8_BURXL/35-124.DIAGEL.RTLMSELESTL...ADGTQADAVALRSKLRKQLEVARARLNDTREA....VRERAEVAISDADDY.......
Q63J72_BURPS/39-126.DVKDNM.RSLVDELDALLKEDVD.....VDALRKRLHGRLEAARDTLDDASWH....ASRRLRQSAERVTQA.......
Q88B63_PSESM/13-106.SMEAEI.ESLLKSLEGLKDDATDESRKTLKNLKANAESALSHSRSLLSDVYED....VKEKTRENALATRDY.......
Q88L30_PSEPK/13-104..LMADF.QALVRDTEKLLADTANLAGDQADELREQIHERLAQARETLQLTQDS....VRERGQAALGSAEQY.......
Q88RP4_PSEPK/68-161.SMEAEI.ESLLKSLENLKHDASEESQKSVKAIRSNAESALRHSRSLLSDAYEE....VKQRTRQTGKATRDY.......
Q9HZG8_PSEAE/12-109DELLAEF.QALVADTEKLLQSTADVAGDQAEEIRGKIHDSLKRARDTLRDTKDSLKDNVRERSQAAVDATEVY.......
Q9I089_PSEAE/16-109DQAMAEL.QDLIAEVDQLMSGTGSLAGKEGANLREQINSVLHRGRDAIERTRRG....VVQRSQAAAEATEEY.......
Q9I421_PSEAE/18-109..SYSEL.QELLSEANSMLADSAAFAGDKADSARARIGALLEKANDALGKGGSA....VAERSRHAVDATESY.......
W8U6H2_YEREN/11-102.DLDQDV.TLLADTLDDVLRSSGEKTKEELTKVRQNAEGVLRDARARFSGS.TS....LQQHARDVASNTDNY.......
W8UH36_YEREN/10-102.SLDDDL.TMLTDTLEEVLRASGDVADESYQEIKARAEKALKEVQNRLSGRSEC....YIKRAQALACCTDDY.......

PF05532

A2U1N1_9FLAO/4-56-----------------------------
Q03QQ0_LACBA/4-56-----------------------------
A1TPU9_ACIAC/4-56-----------------------------
Y1427_PROAC/5-57-----------------------------
Y1180_ENTFA/6-58-----------------------------
Q091A6_STIAD/4-56-----------------------------
A8ZV30_DESOH/7-59-----------------------------
A1RBI4_ARTAT/5-57-----------------------------
Y738_STRAW/5-57-----------------------------
Q3JEE2_NITOC/6-58-----------------------------
Q1QNV4_NITHX/4-56-----------------------------
A5G466_GEOUR/7-59-----------------------------
Q0BTD3_GRABC/5-57-----------------------------
Q0BVF3_GRABC/4-56-----------------------------
Q28Q93_JANSC/4-56-----------------------------
B9M9I1_GEODF/11-62-----------------------------
Q5NPJ6_ZYMMO/6-58-----------------------------
A1R3R9_ARTAT/5-57-----------------------------
Q2Y5N9_NITMU/4-56-----------------------------
Y2439_NITEU/5-57-----------------------------
Y2059_PSEPK/4-56-----------------------------
Q0SB85_RHOSR/9-60-----------------------------
B0SZI5_CAUSK/4-56-----------------------------
A0K186_ARTS2/23-75-----------------------------
A9B8E3_HERA2/6-58-----------------------------
Y4474_RHOBA/5-57-----------------------------
Q2J6D8_FRASC/8-60-----------------------------
Q5WD64_BACSK/7-59-----------------------------
Y1088_STRAW/5-57-----------------------------
Y198_COREF/3-54-----------------------------
B0UMA2_METS4/4-56-----------------------------
A1SQH9_NOCSJ/5-57-----------------------------
CSBD_BACSU/8-60-----------------------------
Q5FU16_GLUOX/7-59-----------------------------
Q0SBD9_RHOSR/5-57-----------------------------
Y4418_RHOPA/6-58-----------------------------
A8FAC4_BACP2/9-61-----------------------------
Y3924_XANCP/4-56-----------------------------
Q0BZP9_HYPNA/19-71-----------------------------
Q035N8_LACC3/3-54-----------------------------
Y1136_STRA5/4-56-----------------------------
B1YJ57_EXIS2/9-61-----------------------------
A0K027_ARTS2/5-57-----------------------------
Y070_XANCP/4-56-----------------------------
Q8U506_AGRT5/4-56-----------------------------
Q161A5_ROSDO/4-56-----------------------------
A7HB93_ANADF/4-56-----------------------------
B2JN16_BURP8/4-56-----------------------------
Y040_GLOVI/5-57-----------------------------
B2JR30_BURP8/4-56-----------------------------
Q1IQ08_KORVE/4-56-----------------------------
Y2685_OCEIH/7-58-----------------------------
A4FL18_SACEN/5-57-----------------------------
A5FT40_ACICJ/4-56-----------------------------
A0K0M7_ARTS2/5-57-----------------------------
Q2L349_BORA1/4-56-----------------------------
A3HS65_9BACT/6-58-----------------------------
A2SM27_METPP/4-56-----------------------------
Q03VV7_LEUMM/5-57-----------------------------
A6WFW3_KINRD/5-57-----------------------------
Q5FN00_LACAC/3-55-----------------------------
Y8179_RHILO/8-60-----------------------------
A1B833_PARDP/4-56-----------------------------
Q5FU34_GLUOX/6-58-----------------------------
A7HP45_PARL1/4-56-----------------------------
Q744Z0_MYCPA/5-57-----------------------------
A5G0C4_ACICJ/4-56-----------------------------
Q11J10_CHESB/16-68-----------------------------
Q03GM7_PEDPA/5-57-----------------------------
A4YM73_BRASO/4-56-----------------------------
A5VLZ6_LACRD/12-61-----------------------------
C5ARD0_METEA/5-57-----------------------------
C5AUZ8_METEA/5-57-----------------------------
F0S4A3_PEDSD/6-54-----------------------------
F4B0Y2_KROS4/5-56-----------------------------
G8RL32_MYCRN/10-61-----------------------------
K5X5J2_AGABU/17-68-----------------------------
Q04FJ5_OENOB/5-57-----------------------------
Q327V2_SHIDS/4-56-----------------------------
Q3IHN4_PSEHT/4-56-----------------------------
Q4WYU1_ASPFU/78-127-----------------------------
Q5M3N4_STRT2/2-52-----------------------------
Y987_BACAN/8-60-----------------------------
Q81Y63_BACAN/10-61-----------------------------
Y4561_PSEPK/6-58-----------------------------
Y1626_STRR6/3-53-----------------------------
Y4653_NOSS1/6-57-----------------------------
Y2158_LISMO/9-60-----------------------------
Y2005_STRP1/4-56-----------------------------
Y1261_STRP1/4-55-----------------------------
U9UUD4_RHIID/6-57-----------------------------
V6F3L7_9PROT/4-55-----------------------------

PF05957

A1WJ84_VEREI/57-150AHDEPWRVASAALA.VGALIGFLLA..RR
Q98FN3_RHILO/16-108VREKPVTSLAIAAG.VGFLFALLA...RR
Q0KFB2_CUPNH/42-137VAESPLKAVAIAAA.VGALIGLLLANGRR
A4SX80_POLSQ/25-118VHRNPWEAVGVAAG.VGLLLGLFMR..RR
B2JFY8_BURP8/7-100VHEHPWASIGIAAG.VGVLVGLLIN..RK
A8GJY2_SERP5/8-101VRDNPWTGIGIGAA.VGVVLGVLLA..RR
B2JI17_BURP8/34-124VHENPWRTIAVVGG.LALIAGALIA..RG
Q6D9H6_PECAS/8-101VRQNPWTGVGIGAA.VGVVLGVLLS..RR
Q1QXL0_CHRSD/16-109VRDNPWTSIGIGTA.LGVVVGMLIG..RR
B2JEB7_BURP8/13-105VRQNPWQSLGIAAG.VGFVLGMLAA...R
Q0KA77_CUPNH/13-106VHAHPWESMGSVAA.VAAVAGALVA..LA
Q1GFM7_RUEST/4-97VRAQPLAATAIAAG.LGFALGYLSN..RR
Q2Y9T3_NITMU/10-103VHENAWQTVGLAIA.VGILVGYLIS..PR
Q21W93_ALBFT/10-103VHDNPWKSIGIATG.VGLVIGLLIS..RR
Q47JU8_DECAR/11-104VHEEPWKAVGVAAA.LGLALGVLIG..RR
A1B1V1_PARDP/41-142VRRHPAQALGIAAG.VGFLLGLIIA..RR
Q0WDZ6_YERPE/9-102VRQNPWCSVGIGAT.IGLIVGLLVA..RR
Q2YBA8_NITMU/44-137IREHPLQSVGYAAG.IGLIIGLLLA..RR
Q12F44_POLSJ/21-114VHANPWKAVGIAAA.AGFLIGLLVN..RK
A4XWN9_PSEMY/12-105VHKHPWQALGLSAA.IGLVLGLLIS..RR
Q9CN33_PASMU/10-103VQDNPYKAIGVAGV.IGLLLGVLIS..KK
Q2KWA5_BORA1/12-105VHDNPWQAISIAGV.TGLLLGLLIS..RR
Q47K12_DECAR/11-104VRDKPWQFVGIAAG.VGLLLGILMA..RR
A1TPY9_ACIAC/14-107AHDEPWRVATAALA.AGALVGFLLA..RR
A1KBS7_AZOSB/9-102VHEHPWQSVGVAAG.VGFLLGLLVS..RR
Q7NSF9_CHRVO/11-104VHDNPWKSIGIAAG.VGFLLGMLVS..RR
C1DFW5_AZOVD/14-107VRTHPWSSLAVGVG.AVALLGMLFA..RG
Q6D2T0_PECAS/11-103VHDKPWHGIGIGAT.VGLVLGLLLA..KR
A8GGZ4_SERP5/10-103VRENPWHSVGIGAT.VGLVLGLLLS..RK
B2U7J2_RALPJ/37-130VHDHPWQAVGVAAG.VGLLIGLLLN..RK
Q7N099_PHOLL/8-101VHDKPWVSIGIGTV.VGAVLGVVLA..KR
A8GI74_SERP5/10-102VRDKPWQGVGIGAA.VGIVLGVLLA..RR
A4YM41_BRASO/45-132ISQRPLATVGLALG.LGFLLGV.......
B4EMP6_BURCJ/39-128VHDNPWQTAGVVAG.LAFVAGLLLS..RR
D0IVQ5_COMT2/12-103AHDEPWRVAGAALA.VGALLGFMLG..RR
D5CC60_ENTCC/9-101VRDNPWTGVGIGAA.IGVVLGVLLT..RR
F2KI05_PSEBN/17-105IGGHPWQTVAISAG.FGLVVGLLLG..RR
M9X2I1_PASHA/10-103VQDNPYKAITVAGV.VGLLLGVLIS..RR
YGAM_ECOLI/15-107VRERPWCSVGTAAA.VGIFIGALLS..MR
Q13TL8_BURXL/35-124VHENPWQTIAIVGG.VALIAGALFA..SR
Q63J72_BURPS/39-126VHDNPWQTAGIVAG.LAFAAGILLA..RR
Q88B63_PSESM/13-106AQEHPWTTAGVAVGAIGLLAAYLLF..KR
Q88L30_PSEPK/13-104VQENPWRAIGIAAG.VGLLIGLLAN..RR
Q88RP4_PSEPK/68-161AQEHPYTTAGVAIGALGLLAAYLIC..KR
Q9HZG8_PSEAE/12-109VGEHPWQSIGIAAG.VGFLLGLLVS..RR
Q9I089_PSEAE/16-109VEDHPWQTIAVSAG.AGFLLGLLMG..RR
Q9I421_PSEAE/18-109IGANPWQTVAITTA.VGLLAGFLLG..RR
W8U6H2_YEREN/11-102VHDKPWQGVGIGAA.IGLVVGMLLA..RR
W8UH36_YEREN/10-102VHEKPWCSVGIGAA.VGLVAGLLLA..CR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window