Sequence alignment for CL0409

PF00620

RHG05_MOUSE/1274-1425----------PLF---------------------------V------EKCVEFIED.TG..LCTEGL---YRVS-----G
SYDE_DROME/968-1123----------PIV---------------------------L------RRCVEEVER.RG..LDIIGL---YRLC-----G
LRG1_YEAST/755-912----------PII---------------------------I------DELISSLRQ.MD..MSVEGI---FRKN-----G
P85B_MOUSE/125-265----------PPI---------------------------L------VKLVEAIEQ.AE..LDSECY---SKPE-----L
I5P2_MOUSE/830-972----------PKE---------------------------L------WMMVDYLYR.NA..VQQEDL---FQQP-----G
RHG07_HUMAN/1092-1238----------PQS---------------------------I------QQAMRYLRN.HC..LDQVGL---FRKS-----G
RHG28_HUMAN/399-552----------PLV---------------------------L------QKFFEKVEE.SG..LESEGI---FRLS-----G
ARAP2_HUMAN/1129-1281----------PII---------------------------V------NSCIAFVTQ.YG..LGCKYI---YQKN-----G
MYO9A_HUMAN/2076-2225----------PLV---------------------------V------EKLINYIEM.HG..LYTEGI---YRKS-----G
Q20442_CAEEL/896-1053----------PRP---------------------------I------LEVMKFLRN.IA..PETVGI---FRKN-----G
RHG18_HUMAN/343-492----------PLI---------------------------F------QKLISRIEE.RG..LETEGL---LRIP-----G
ARAP1_HUMAN/971-1120----------PVI---------------------------V------YRCVDYITQ.CG..LTSEGI---YRKC-----G
PAC1_CAEEL/963-1123----------PMI---------------------------V------QACVCVIET.YG..MDTVGI---YRIP-----G
Q9V4C2_DROME/875-1034----------PIF---------------------------V------NNCIDYLED.NG..LQQVGL---FRVS-----T
HMHA1_HUMAN/775-947----------PFI---------------------------V------KKCVCEIER.RA..LRTKGI---YRVN-----G
GMIP_HUMAN/565-728----------PFV---------------------------V------TKCTAEIEH.RA..LDVQGI---YRVS-----G
RHG32_HUMAN/386-538----------PQV---------------------------L------QSCTAFIER.YG...IVDGI---YRLS-----G
RG190_DROME/1364-1529----------PIF---------------------------L------NKCVEFIEK.EG..LDSEGI---YRVP-----G
RG92B_DROME/265-418----------SYI---------------------------V------ELCCCCLLE.HG..LEEEGL---LRVG-----C
RGAPX_ARATH/155-296----------PLI---------------------------L------VKCADYLIL.TG..LNSPNL---FKAE-----G
BCR_HUMAN/1068-1221----------PYI---------------------------V------RQCVEEIER.RG..MEEVGI---YRVS-----G
RHG21_HUMAN/1161-1314----------PLI---------------------------V------DICCKLVEE.RG..LEYTGI---YRVP-----G
RHG24_MOUSE/151-304----------PML---------------------------V------EQCVDFIRQ.RG..LKEEGL---FRLP-----G
RHG17_RAT/266-415----------ALP---------------------------I------EACVMLLLE.TG..MKEEGL---FRIG-----A
RHG20_HUMAN/377-527----------PKP---------------------------V------LDMLFFLNQ.KG..PLTKGI---FRQS-----A
RBP1_RAT/210-356----------PAV---------------------------F------RECVDYMEK.HG..MKCEGI---YRVS-----G
CHIN_MOUSE/282-436----------PMV---------------------------V------DMCIREIES.RG..LNSEGL---YRVS-----G
RHG09_HUMAN/556-726----------PSF---------------------------L------RLCIAAVDK.RG..LDVDGI---YRVS-----G
SRGP2_HUMAN/505-657----------PLV---------------------------V------ESCIRFISR.HG..LQHEGI---FRVS-----G
Q9VDE9_DROME/1154-1302----------PWI---------------------------Q------TTLSEHVLLLNG..KQTEGI---FRVS-----A
RRC1_CAEEL/294-443----------PVI---------------------------V------EKCCASIED.QG...IVTGI---YRQC-----G
RHG35_RAT/1262-1413----------PIF---------------------------I------ERCIEYIEA.TG..LSTEGI---YRVS-----G
RHG39_HUMAN/909-1055----------PWV---------------------------Q------TRLSEEVLALNG..DQTEGI---FRVP-----G
Q9W4A9_DROME/319-473----------PFV---------------------------V------RRCVEEVEA.RG..MLQEGI---YRVS-----G
RGA3_SCHPO/794-942----------PQV---------------------------I------AMCVSCVDA.HG..LEVEGI---YRIS-----G
RGA4_SCHPO/761-910----------PTL---------------------------I------VSCINFIES.YG..MDFEGL---YRKS-----G
MYO9B_RAT/1673-1822----------PIV---------------------------L------EKLLEHVEM.HG..LYTEGL---YRKS-----G
RGA1_YEAST/805-985----------PMI---------------------------L------SVCIDFIES.DEENMRSEGI---YRKS-----G
RGA2_YEAST/802-985----------PII---------------------------I------RCCIDRIEK.DDIGLNMEGL---YRKS-----G
TG325_CAEEL/624-775----------PKF---------------------------I------RVITEVIES.KG..LETDGI---YRVS-----G
Q9VWL9_DROME/292-441----------PRF---------------------------V------VDVCAYIEQPEC..IEQDGL---YRAS-----G
CDGAP_DROME/438-593----------PMV---------------------------L------RSCAEFIEN.YG...VIDGI---YRLS-----G
RGA7_SCHPO/520-671----------PNI---------------------------V------MQCTSQVEN.FG..LNLQGI---YRVP-----S
RGD1_YEAST/486-644----------PAI---------------------------V------RQCIYVIDK.FG..LDQEGI---YRKS-----A
BEM2_YEAST/1981-2141----------PTI---------------------------V------VKLLEEIEL.RG..LDEVGL---YRIP-----G
ARAP3_HUMAN/920-1071----------PII---------------------------V------DACISFVTQ.HG..LRLEGV---YRKG-----G
Q9XUS9_CAEEL/437-588----------PAA---------------------------V------IHCVVALEA.RG..LTQEGI---YRVP-----G
RHG01_HUMAN/260-408----------PIV---------------------------L------RETVAYLQA.HA..LTTEGI---FRRS-----A
RHG08_MOUSE/210-360----------PPV---------------------------L------RWTVTYLRE.KG..LRTEGL---FRRS-----A
RG68F_DROME/292-439----------PPI---------------------------V------RKCVDSLSITGV..IDTEGI---FRRS-----G
Q23130_CAEEL/263-421----------PPI---------------------------V------DQLIEYLEA.HA..LTMEGV---FRKS-----A
FA13B_MOUSE/39-190----------PFI---------------------------V------RHVVDYIEE.HG.GLEQQGL---FQVN-----G
Q19370_CAEEL/541-693----------PLL---------------------------V------QSAIAYLSR.YS..LRNQGL---FRVS-----G
O01443_CAEEL/529-695----------PKI---------------------------V------ENCTQYLMT.YG..LTQVGL---FRVA-----G
RHG06_HUMAN/411-572----------PRL---------------------------V------DSCCQHLEK.HG..LQTVGI---FRVG-----S
Q8T0G4_DROME/380-537----------PLF---------------------------L------EKLIGELLR.RG..SREEGL---LRIG-----G
RGA1_SCHPO/862-1019----------PAF---------------------------I------GNTLAAMKR.KD..MSVVGV---FRKN-----G
TAGAP_HUMAN/101-250----------PRP---------------------------I------QDILTILCL.KG..PSTEGI---FRRA-----A
Q9XW53_CAEEL/264-412----------PQP---------------------------I------MTIVDHLRM.DG..FDAEGI---FRKS-----P
BEM3_YEAST/927-1096----------PSV---------------------------V------YRCLEYLYKNRG..IQEEGI---FRLS-----G
RGA2_SCHPO/1083-1234----------PIV---------------------------V------YRCIEYLESCRA..EKEEGI---YRLS-----G
RGAP7_ARATH/176-325----------PSF---------------------------L------EKALQFIEK.YG..TKIEGI---LRQS-----A
YIL2_SCHPO/178-325----------PPD---------------------------A------LVEGMQVVS.KS..LQTEGL---FRKS-----C
RGA6_SCHPO/332-510----------PHI---------------------------F------AQCVHFLSL.NA..LHVPGI---FRIS-----G
RGA5_SCHPO/68-226----------PAV---------------------------V------AKCGFFLKQ.NA..TQVKGI---FRVN-----G
BAG7_YEAST/76-235----------PVV---------------------------I------AKSGKYLKE.NA..LDTTGI---FRIA-----G
OCRL_HUMAN/735-875----------PKE---------------------------I------WLLVDHLFK.YA..CHQEDL---FQTP-----G
Q8STW6_ENCCU/162-313----------SPV---------------------------V------FSVVKSLKK.RA..IRTKFI---FRYE-----P
Q8SRX9_ENCCU/91-256----------PRN---------------------------F------YILTETVLS.LD..CRVGGI---FRVR-----N
Q9VUR5_DROME/55-207----------PGP---------------------------L------LVLILKLNK.ES..PNRRDV---FRAP-----G
A1Z9I5_DROME/395-538----------PAL---------------------------I------VHCVNEIEA.RG..LTEVGL---YRLS-----S
B4IM29_DROSE/1223-1375----------PFI---------------------------I------GACIREVER.RG..MLEVGC---YRVS-----G
B4R2Z0_DROSI/903-1054----------PHL---------------------------V------EVCTNIVET.KG..LGVVGI---YRIP-----G
B9EHI3_MOUSE/380-524----------PAP---------------------------V------LDMLSIIDA.KG..PDTERI---FRTL-----A
C5DZH4_ZYGRC/1013-1185----------PMI---------------------------V------TVCVSHIES.NENYMKAEGI---YRKS-----G
E9PYS6_MOUSE/532-680----------PLV---------------------------V------ESCIRFINL.NG..LQHEGI---FRVS-----G
F6YU97_CALJA/140-288----------PKF---------------------------V------KLCIEHVEE.HG..LDVDGI---YRVS-----G
F6Z0J4_XENTR/128-275----------PPV---------------------------L------IKLIEAIEK.KG..LESATL---YR.S-----Q
F7C997_MACMU/242-408----------PLI---------------------------I------QKCVGQIEH.RG..LRVVGL---YRLC-----G
H0YIK5_HUMAN/99-243----------PSI---------------------------V------VHCVNEIEQ.RG..LTETGL---YRIS-----G
M2TU31_COCH5/545-687----------PII---------------------------V------YQCIQAVDL.YG..LEVEGI---YRIP-----G
Q0KHR5_DROME/1068-1216----------PVI---------------------------V------DKCINFVYI.HG..SMSEGI---YRKS-----G
Q54DW4_DICDI/28-177----------PKI---------------------------V------AQVIEWLDKFNA..VNEEGI---FRIP-----G
Q8IJX0_PLAF7/215-361----------PSI---------------------------L------IDFLTHLKK.PE.IINTKDL---FNLQ-----A
Q9VFK2_DROME/579-728----------PLA---------------------------V------RAAFRWLQL.NA..LDQVGI---FRKS-----G

PF08101

Q6C001_YARLI/166-664.VPRPLV---HDL---------------------------V......HVITGEIKA-RG..ILTPYLLLPFRPD-----S
R7YJ86_CONA1/46-524EVAPEEI---QEL---------------------------I......HVCTQEMKS-RA..LDMPFLLLPFRLH-----S
Q0CXG4_ASPTN/43-519EVAPEEV---HEL---------------------------L......RGCTQELKA-RA..LHTPFLLLPFRPS-----S
Q6FSL9_CANGA/51-451KFSRGNV---RGV---------------------------I......HLITAELKE-RG..TDVEYLMIPLRPE-----Q
A7TPE0_VANPO/51-441KFEFEEV---HDV---------------------------I......HFLSSELKS-RE..FDRTLLLEPLNSD-----.
B2AXU5_PODAN/42-515TVDPEEV---EEL---------------------------L......RFSTEELKA-RA..LDLPFLLLPFRPT-----S
Q75EK6_ASHGO/155-597..TGSNS---TDM---------------------------I......RAAMEIFKP-N..........LSHYSF-----S
G8B672_CANPC/35-437QFTRKNL---KSV---------------------------L......HLITQELKK-RG..TKTPHIFLPFRSR-----I
H2AY21_KAZAF/42-448DFERDKV---KGV---------------------------I......HLITASLKE-KA..IDVEYLMIPFRPE-----Q
G0SCJ0_CHATD/41-514TVEPEEV---HEL---------------------------I......RYCTEELKA-RG..LDLPFLLLPYRPA-----S
M7P709_PNEMU/52-510...EEEV---CDL---------------------------L......EACYIEVKS-RG..VMIPLVFLPFRPM-----S
C7YI83_NECH7/41-509SVEPEEV---HEL---------------------------I......RCCTQELKA-RA..LDHPFLLLPFRPT-----S
C5DWH8_ZYGRC/26-427EFNRDKV---KSV---------------------------I......HLITVELKE-RA..TDVEFLMIPFRPQ-----Q
Q59KB4_CANAL/48-454QFTRKNL---KSA---------------------------L......HIITQELKK-RG..TKTPHIFLPFRSK-----V
L8FN12_PSED2/45-518SVEAEEV---QEL---------------------------L......KGCTTELKS-RA..LDVPFFLLPFRPT-----S
G4U9K6_NEUT9/44-513SVEPEEV---VEL---------------------------I......ILSTEELKS-RA..LDIPFFLLPFRPT-----S
MSB1_YEAST/68-472QFSREKV---KGV---------------------------I......HVITAELKE-KG..PDVEFLMIPFRPE-----Q
G8JR31_ERECY/75-468...WVDC---KVV---------------------------V......RSITQRLKT-GG..MQEEYVLLPFRSG-----Q
A7TL24_VANPO/24-431EFSREKV---KII---------------------------V......HIITDELKT-NG..VNVEYLFLPFRPE-----Q
G0VGB1_NAUCC/47-451EFKRENV---KGI---------------------------I......HLITAEIKQ-KG..LDTEYLMIPFRPE-----Q
F9X960_MYCGM/45-521..VPAEV---QEL---------------------------V......HICTAEMKS-RAEALDAPFFLLPFRPD-----S
G8ZXX4_TORDC/64-466NFEREKV---KAV---------------------------I......HSITAELKD-RG..ADVEYLMIPFRPQ-----Q
W1QG29_OGAPD/54-458EFQRKDV---KDA---------------------------I......HIITSEIKR-KG..TKTPYLLLPFRPQ-----Q
S7ZE60_PENO1/43-511EVAPEEV---QDL---------------------------I......RGCTHEIKA-RA..LDTPFLLLPFRPS-----S
Q6CUF4_KLULA/46-446EFQREKV---RSL---------------------------I......HLITNELKL-NG..FETEYLFLPFRPE-----Q
A7ELT0_SCLS1/45-517TVEPEEI---QEL---------------------------V......RGCTVELKS-RA..LDMPFLLLPFRPT-----S
C4R4X2_PICPG/64-468.LQKHEL---KDL---------------------------I......HAITNEIKL-KG..TRAPYFFLPFRPQ-----L
C0NAR4_AJECG/43-520EVTPDEV---QEL---------------------------L......HGCTVELKS-RG..LEIPFLLLPFRPS-----S
T5A940_OPHSC/43-511TVEPEEI---HEL---------------------------L......HYCTAELKA-RG..LDIPFLLLPFRPT-----S
V5G8I7_BYSSN/42-517EVGPEEV---QEL---------------------------L......HGCTQELKF-RA..LDIPFLLLPFRPS-----S
Q2HFE8_CHAGB/41-504TIDPEEV---QQL---------------------------L......RFCTEELKA-RA..LDLPFLLLPFRPT-----S
E3RRN2_PYRTT/39-508DVAPEEI---QEL---------------------------I......HVCTQEMKS-RA..LDMPFLLLPFRPT-----S
K0KQP5_WICCF/58-453EFSRTDV---REL---------------------------I......HTVTQELKI-KG..NKTPLVLLAFRPK-----V
M3D790_SPHMS/42-520TIEPDEV---VDL---------------------------V......HACTAEMKK-RAEALEAPFMLLPFRPN-----T
G8ZN62_TORDC/123-556QYLTNHI---KEL---------------------------ILQKEDSKTLLQVFKP-N..........LHHFSH-----K
G8Y702_PICSO/33-436QFTRNNM---KGI---------------------------L......HLITRELKS-RG..SKVPHIFLPFRSR-----I
F2PPA7_TRIEC/40-517EVEPEEV---VDL---------------------------L......LGCTSELKD-RA..LDIPFLLLPFRPT-----S
G3AEL0_SPAPN/40-432QFTRNNL---KSI---------------------------I......HSLTQELKK-RG..TKTPYIFLPFRSK-----I
U1FZ21_ENDPU/42-520RVDPEEV---VEL---------------------------L......SGCTRELKS-RA..LDLPFILLPFRPT-----S
S3CDZ9_GLAL2/45-517TVEPEEV---QEL---------------------------I......SGCTVELKS-RG..LDMPFLLLPFRPT-----S
H1VJ74_COLHI/44-515TVEPEEI---QDL---------------------------I......RRCTGELKA-RA..LDHPFLLLPFRPT-----S
G0RMT4_HYPJQ/39-513TVEPEEV---REL---------------------------L......HGCTEELKS-RG..LDHPFFLLPFRPT-----S
J4WLM4_BEAB2/43-513SVEPDEI---DEL---------------------------I......RCCTQEIKS-RG..LDHPFLLLPFRPT-----S
K1WYN9_MARBU/44-531.VGPEEV---QEL---------------------------L......RGCTSELKS-RA..LDIPFLLLPFRPT-----S
C4Y8F5_CLAL4/25-422QLSRKRL---QAL---------------------------L......HAITGELKA-RG..TRTPHVFLPFRSR-----I
G2WT23_VERDV/45-514TIEPEEI---QDL---------------------------I......RRATEELKA-RA..LDLPFLLLPFRPT-----S
S8APA2_DACHA/42-517TVTPDEI---CEL---------------------------T......RACTTEIKS-RG..LTAPFFFLPFRPT-----S
A5DN67_PICGU/34-434EFSRRNL---KTI---------------------------L......HLITGELKS-RG..TKTPHVFLPFRSR-----I
U4LF75_PYROM/40-532EVSPDEV---QEL---------------------------L......RGCTNEMKA-RG..LLTPFILLPYRPN-----S
G4N725_MAGO7/47-516TVEPEEV---QEL---------------------------V......HRCTSELKA-RG..LDIPFLLLPFRPT-----S
H6BQM6_EXODN/41-520RVDPEEV---SEL---------------------------L......HMCTAELKS-RD..LNVPFLLLPFRPS-----S
A5DVE6_LODEL/33-436.YSRKDL---KTA---------------------------L......HIITQELKK-RG..TKTPHIFLPFRSR-----V
G8JPL3_ERECY/187-622.....NN---TDL---------------------------I......RSAMEIFKP-N..........LSHYSH-----S
J7SAQ4_KAZNA/50-456EFEREKV---KGV---------------------------I......HEITAHLKK-TA..LDVEYLMIPFRPE-----Q
J3K4J2_COCIM/39-514EVNPEEV---QEL---------------------------L......RGCTQELKA-RA..LDTPFLLLPFRPT-----S
D5GIW3_TUBMM/41-522EVTPEQV---QEL---------------------------L......RGCTQEIKS-RG..LSTPFLLLPFRPN-----S
I2GXB5_TETBL/101-506.VARTPI---...---------------------------.......HWLTIELKR-RA..KTTKNLLLPFRSP-----Q
K2SLP5_MACPH/42-514EVAPEEV---QEL---------------------------I......HVCTQELKS-RA..LDTPFLLLPFRPG-----S
K9GDF4_PEND2/42-525EVAPEEV---QDL---------------------------V......RGCAHELKA-RA..LDTPFLLLPFRPS-----S
G8BUH3_TETPH/39-448EFARENV---KVI---------------------------I......HLITDELKT-KG..MDIEYLFIPFRKE-----Q
S3CDY7_OPHP1/45-516TVEPEEI---HEL---------------------------V......NLCTEELKA-RA..LDIPFLLLPFRPT-----S
A3LX57_PICST/33-438QFSKRKL---KSI---------------------------L......HLITAELKA-RG..TNVPHILLPFRSK-----I
B5RTF9_DEBHA/33-436QFTRKKL---RGI---------------------------L......HLITGELKS-RG..TKTPHIFLPFRSR-----I
N1PN78_MYCP1/46-518..VPEEV---QEL---------------------------V......HVCTAEMKS-RAEALDAPFFLLPFRPD-----S
E9EC05_METAQ/43-511.VEPEEI---HEL---------------------------L......HICTAELKA-RG..LDIPFLLLPYRPT-----S
I2H455_TETBL/74-485TFEREKV---KGI---------------------------I......HLITSELKD-KG..LNVEYLLIPFRPE-----Q
B8MSL6_TALSN/42-515EVAPEEV---QEL---------------------------L......RGCTHELKS-RG..LDIPFLLLPFRPS-----S
C5E2R2_LACTC/41-444EFSRDKV---KGL---------------------------I......HLITQELKT-NA..IGIEFLFLPFRPE-----Q
M2N7H3_BAUCO/46-522.VELMEV---EEL---------------------------V......HLCTAEMKS-RGEALDAPFLLLPFRPD-----T
Q75ED0_ASHGO/36-425AFAAESV---KGV---------------------------V......HMITLQLKA-EG..VADSYVLLPFRPE-----H

PF00616

RASL1_MOUSE/321-510FLDYLTR...REV........................AR.T------NDPNTLF.RSNS--LASK.SMEQFMKL.....V
Q75DK0_ASHGO/576-771WFQALIE...KELAKFDKSI.........LTNNQNSAPS.T------HIYNSLF.RGNS--ILSK.SIEKYFNR.....I
RGAA_DICDI/239-445LYRLSIQ...KEM........................AN.I------ATVGDFL.KADT--VVPK.MIITYNKR....KQ
A5DN39_PICGU/903-1097FITELMK...VEV........................GA.C------RNLSDLTKPQCC--LWID.FLHNFNNH....TY
GAPD1_MOUSE/152-353VLRYLIE...FEL........................KE.S------DNPRRLLRRGTC--AFSI.LFKLFSEG...LFS
A5DR10_PICGU/619-844WFKALME...MELVNVDMATRK.....NYAKKSGSKSSS.N------NVFNTLF.RGSS--IFSK.SLENYNLR.....I
Q6BPM2_DEBHA/608-836SVDKMTR...KNYASNRRSRDN......RAQTNNNSSSS.N------NVFNTLF.RGLS--IFSK.SLEMYNLR.....I
Q0V6E4_PHANO/854-1062VLARSMK...EEI........................EG.C------GTLQEFL.RGNF--FWAK.LFGNYVRS....PR
Q6CFR5_YARLI/832-1039LISRSAA...AHI........................ST.L------DASKNMV.RDKH--MWQR.LFAALNRG....AA
IQGA2_MOUSE/938-1150LFKTALE...EEI........................KSKV------DQVQDIV.TGNP--TVIK.MVVSFNRG....AR
A5E5Z0_LODEL/955-1161FILTLMQ...NDI........................VQ.S------QTLSDITKVHFT--YWIE.YLAHFNSR....TS
IQG1_CANAL/977-1177LMIQLMQ...NDT........................AN.S------NNLGDITKLHLT--NWID.FFTNFNNH....TF
A3LY27_PICST/921-1130LISELMK...NDV........................ENNS------RSISDLTKTSTT--FWID.YFLLFNNH....TY
Q6CR01_KLULA/879-1073VIGDLLV...EEI........................DE.S------STLNDFLVNDDA--VWIQ.VLQNYLTS.....F
Q54F48_DICDI/1131-1337TIKSITE...IEF........................RISS------DKRNFGI..HEP--FSFT.LLSTYLNY....TY
Q6BG44_PARTE/169-435LLSELLK...LEL........................ID.L------KNPLELFQDKNN--LVCK.FLIGFSKG....PL
RASL2_HUMAN/323-512FLDLLFQ...LEL........................SR.T------SETNTLF.RSNS--LASK.SMESFLKV.....A
A2CE77_DANRE/319-508FLDVLFK...LEL........................DK.T------TEPNTLF.RSNS--LASK.SMESFLKV.....A
Q66JF5_XENTR/327-516FLDKLNQ...REV........................KR.T------VDPNTLF.RSNS--LASK.SMEQYMKI.....V
A3LZE1_PICST/612-848WFKALME...AELVNVDILTRKLYKKKNSDHKEAQTSAS.N------NAFNTLF.RGSS--IFSK.SLERYNLR.....I
BUD2_CANAL/642-872AVSNSKT...QQQ........................SSHN------NVFNTLF.RGSS--IFSK.SLEKYNLR.....I
A5E274_LODEL/753-994FFKTLME...MSLSSLGNK...........LATQSKSTSQN------NVFNTLF.RGSS--IFSK.ALERYNIR.....I
Q6FNM9_CANGA/542-738WCTILIN...KELEDFSKQSG........SRPGIDGQYM.P------SRVNSLF.RGNS--ILTK.TLELYFLR.....I
BUD2_YEAST/541-721TVSRINQ...KNL........................DS.K------HVFNSLF.RGNS--ILTK.SIEQYFFR.....V
Q6CW67_KLULA/546-743WFQALID...REFQGLDKSI.........TMSNSNHQSS.N------HIYNTLF.RGNS--ILTK.TMETYCYR.....V
Q4P4C4_USTMA/677-887RISHFIE...LESA.....................SWGE.K------MEPELLF.RANT--LLSR.SIDHFQRL.....L
NFAA_DICDI/68-259LIKDLIY...NEFN.....................TKVL.A------EGEGSIL.RGNS--IVNK.IEGAYVRL.....I
Q4DY44_TRYCC/96-330ILSVLLL...LELD.....................RATH.K------RNDVHTFMRGNG--VVPKVFEALLARVTSNAGG
A2R7H8_ASPNC/194-402MFQSVLT...YQF........................DN.T------PEYSSLL.RQNT--PVSR.MMTTYTRR....GP
Q54I64_DICDI/185-392MFQKVLQ...EEF........................KE.A------TSIGSLL.RANT--ALTR.MMTTYTRR....GP
A7S5U4_NEMVE/139-338MFELALK...YEF........................AE.S------ENFNSLL.RANT--AISR.MMTTYTRR....GP
GAP1_SCHPO/175-379LFQMVLT...TEF........................EA.T------SDVLSLL.RANT--PVSR.MLTTYTRR....GP
GAPA_DICDI/274-481LFRLAIG...QEM........................SR.I------KSAGDLL.AVES--VVPK.MIITYTRR....KQ
A7F2A6_SCLS1/1177-1385LIARSAR...EEI........................EH.F------ASLQDFL.RGNF--FWTK.LLANYTRS....PR
A2QP50_ASPNC/1125-1333LLARSAR...EEI........................ES.F------DSLHEYL.RCNS--FWNK.LFASYIKS....PR
A6R4D6_AJECN/1034-1242LLVRSAK...EEI........................NH.A------FSLQDYT.RCNA--FWNK.LFAAYTKS....PK
Q4P2J5_USTMA/1116-1323LFQRCVE...EEL........................GF.V------STVQEFI.RGNA--QFIK.LVAQYNRG....AR
Q5KM85_CRYNJ/1428-1635LLQLAVH...EEV........................LR.A------PSLQDLV.HSRF--PIMP.VTAQYIK.....PS
A7SXE3_NEMVE/113-325LFETALR...EEI........................YSKV------DQLQEII.TGNP--TVIR.MVVHFNRG....AR
RNG2_SCHPO/875-1077FISQVIK...LEA........................AL.V------NSSQDLL..SDD--CVWKLLFTGYRGD.....V
Q552W4_DICDI/717-964FLKALTVGIEYQI........................KY.S------ETLQDFL.QSES--VPMK.LLYQYFKK.....K
A0DYI4_PARTE/179-497LISEIIT...TEV........................NR.Q------EFPEFLWDREDT--LTQF.IMKEFTKR....PE
B4GY66_DROPE/162-365LLRELIE...IQL........................LG.S------EQPRRLLRTNSS--SFAR.LYQRLVES...LFS
D8Q477_SCHCM/172-379.FQSVLS...AQF........................ET.A------TEFGSLL.RANT--PVSR.MMTTYTRR....GP
E7QA29_YEASB/881-1068FVCEMLQ...NAI........................NE.A------PSIESFLDNRSQ--FWQT.ILQDFLRR.....E
F1RMJ4_PIG/208-420LFKTALQ...EEI........................KSKV------DQIQEIV.TGNP--TVIK.MVVSFNRG....AR
F2Z2E2_HUMAN/966-1177LFKTALQ...EEI........................KSKV------EQPQDVV.TGNP--TVVR.LVVRFYRN....GR
H3DDA1_TETNG/1025-1236LFRTALE...EEI........................NSKV------DQIQDIV.TGNP--TVIK.MVVSFNRG....AR
Q23D35_TETTS/322-667FISNIIK...FEV........................EQ.A------QDPSEIKFKSNQ--VLTK.ILNEFTKR....QD
Q4TE24_TETNG/96-307LFTEALR...LEI........................SLKV------EKPQDVI.TGNP--AVIK.MLVNFYRH....AG
Q7S5G6_NEUCR/194-402.FQSVLT...YQF........................DN.T------PEYSSLL.RANT--PVSR.MMTTYTRR....GP
V5IQZ3_NEUCR/1171-1379LISRSIR...EEV........................EA.C------AALQDYL.RGNY--FWTK.LLQNYTRS....PR

PF00620

RHG05_MOUSE/1274-1425NKTDQDNIQKQF-------------DQDHNINL...................ASME---VTVNAVAGALKAF--FADLPD
SYDE_DROME/968-1123SATKKRLLREAF-------------ERNSRAVEL.................TPEHV---PDINVITGVLKDY--LRELPE
LRG1_YEAST/755-912NIRRLRELTANI-------------DSNPTEAP...................DFSK---ENAIQLSALLKKF--IRELPQ
P85B_MOUSE/125-265PATRTDWSLS..-------------...........................DLEQ---WDRTALYDAVKGF--LLALPA
I5P2_MOUSE/830-972LRPEFDHIRDCL-------------DTGMI......................DQLC---ANNHSVAEALLLF--LESLPE
RHG07_HUMAN/1092-1238VKSRIQALRQ..-------------MNEGAIDC..................VNYEG---QSAYDVADMLKQY--FRDLPE
RHG28_HUMAN/399-552CTAKVKQYREEL-------------DAKFNADK..................FKWDK---MCHREAAVMLKAF--FRELPT
ARAP2_HUMAN/1129-1281DPLHISELLESF-------------KKDARSFK..................LRAGK---HQLEDVTAVLKSF--LSDIDD
MYO9A_HUMAN/2076-2225STNKIKELRQGL-------------DTDAESV....................NLDD---YNIHVIASVFKQW--LRDLPN
Q20442_CAEEL/896-1053VKSRIAELRSII-------------ESYSGNTDVFV.............GENLLDS---TQVHDVADLLKQY--FRDLPE
RHG18_HUMAN/343-492AAIRIKNLCQEL-------------EAKFYEGT..................FNWES---VKQHDAASLLKLF--IRELPQ
ARAP1_HUMAN/971-1120QTSKTQRLLESL-------------RQDARSVH..................LKEGE---QHVDDVSSALKRF--LRDLPD
PAC1_CAEEL/963-1123NTAAVNALKESL-------------SNRGFDSVDLSK...........VESLDPRW---RDVNVVSSLLKMF--LRKLPE
Q9V4C2_DROME/875-1034SKKRVKQLREEF-------------DKDIYFG....................ISVD---TCPHDVATLLKEF--LRDLPE
HMHA1_HUMAN/775-947VKTRVEKLCQAF-------------ENGKELV....................ELSQ---ASPHDISNVLKLY--LRQLPE
GMIP_HUMAN/565-728SRVRVERLCQAF-------------ENGRALV....................ELSG---NSPHDVSSVLKRF--LQELTE
RHG32_HUMAN/386-538VASNIQRLRHEF-------------DSEHVPDLT.................KEPYV---QDIHSVGSLCKLY--FRELPN
RG190_DROME/1364-1529SRAHVDMLFQRF-------------EEDTNTEI...................DALD---IPVNAVATALKDF--FSKRLP
RG92B_DROME/265-418ASTKLRRMKHAL-------------EAQHVKTP..................LPLDY---QDPHVIGSILKLY--LRELPE
RGAPX_ARATH/155-296DRKLIQQLVSAY-------------NQDPRAS....................IPEG---VNPVDVAALLKYY--LASLPT
BCR_HUMAN/1068-1221VATDIQALKAAF-------------DVNNKDVS..................VMMSE---MDVNAIAGTLKLY--FRELPE
RHG21_HUMAN/1161-1314NNAAISSMQEEL-------------NKGMADIDI.................QDDKW---RDLNVISSLLKSF--FRKLPE
RHG24_MOUSE/151-304QANLVKELQDAF-------------DCGEKPS....................FDSN---TDVHTVASLLKLY--LRELPE
RHG17_RAT/266-415GASKLKKLKAAL-------------DCSTSHL....................DEFY---SDPHAVAGALKSY--LRELPE
RHG20_HUMAN/377-527NVKSCRELKEKL-------------NSGVEV.....................HLDC---ESIFVIASVLKDF--LRNIPG
RBP1_RAT/210-356IKSKVDELKAAY-------------DREESP.....................NLEE---YEPNTVASLLKQY--LRDLPE
CHIN_MOUSE/282-436FSDLIEDVKMAF-------------DRDGEKADI.................SVNMY---EDINIITGALKLY--FRDLPI
RHG09_HUMAN/556-726NLAVVQKLRFLV-------------DRERAVTSDGRYVFPEQPGQEGRLDLDSTEW---DDIHVVTGALKLF--LRELPQ
SRGP2_HUMAN/505-657SQVEVNDIKNAF-------------ERGEDPLA..................GDQND---HDMDSIAGVLKLY--FRGLEH
Q9VDE9_DROME/1154-1302DVDEVGCMKNRL-------------DRWDVPDY...................KNTL---VDAHTPASLLKLW--YRELYD
RRC1_CAEEL/294-443IQSNIQRLRAKF-------------DSGAEPDL..................HEFGQ---RDIYSVSSLLKQY--FRQLPN
RHG35_RAT/1262-1413NKSEMESLQRQF-------------DQDHNLDL...................AEKD---FTVNTVAGAMKSF--FSELPD
RHG39_HUMAN/909-1055DIDEVNALKLQV-------------DQWKV......................PTGL---EDPHVPASLLKLW--YRELEE
Q9W4A9_DROME/319-473FADEIEALKLAL-------------DREGEKTDM.................SETAY---GNVNVIAGTLKLY--LRLLPV
RGA3_SCHPO/794-942SASQVRVLVDEF-------------ENGSIRM....................EHLT---SDLFACTSVLKTY--LHRLPE
RGA4_SCHPO/761-910ATSQMKKIVALL-------------RNEDTV.....................LDPS---EDISAVTSVFKQY--LRNLPN
MYO9B_RAT/1673-1822AANRTRELRQAL-------------QTDPATV....................KLED---FPIHAITGVLKQW--LRELPE
RGA1_YEAST/805-985SQLVIEEIEKQF-------------SAWKVQQNTE..............TPNILTE---QDLNVVTGVLKRY--LRKLPN
RGA2_YEAST/802-985SQTLVEEIENEF-------------AQNNSLHSDTLS...........PKLNALLN---QDIHAVASVLKRY--LRKLPD
TG325_CAEEL/624-775NLSAVQKIRCQA-------------DQDNYKA....................LVSE---EDIHVLTGALKLF--FRELTD
Q9VWL9_DROME/292-441NKVLVDELRKKL-------------THVYDPR....................WLKT---DDIHTLTSLHKQF--FRELTS
CDGAP_DROME/438-593ITSNIQRLRRAF-------------DEERVPDLG.................NPEMK---QDIHAVSSLLKMY--FRELPN
RGA7_SCHPO/520-671SSARVNMLRSQF-------------ENNPLLQLH................TPEDYE---NDVHAVADLLKIF--FRELRE
RGD1_YEAST/486-644NVLDVSKLKEEI-------------DKDPANISMIL.............PSKPHSD---SDIYLVGSLLKTF--FASLPD
BEM2_YEAST/1981-2141SIGSINALKNAF-------------DEEGATDNSF..............TLEDDRW---FEVNAIAGCFKMY--LRELPD
ARAP3_HUMAN/920-1071ARARSLRLLAEF-------------RRDARSVK..................LRPGE---HFVEDVTDTLKRF--FRELDD
Q9XUS9_CAEEL/437-588QVRTVNVLLDEL-------------RSKTVP.....................NVGL---HDVEVITDTLKRF--LRDLKD
RHG01_HUMAN/260-408NTQVVREVQQKY-------------NMGLPVD....................FDQY---NELHLPAVILKTF--LRELPE
RHG08_MOUSE/210-360SAQTVRQVQRLY-------------DQGKPVN....................FDDY---GDMHLPAVILKTF--LRELPQ
RG68F_DROME/292-439NHSEIMALKERV-------------NRGEDV.....................DLKS---VNVHVIAGLLKSF--LRDLAE
Q23130_CAEEL/263-421NIGSIKRLQDRI-------------NKGEKIDFEND............PEYKDNEY---VASLHASVLLKTF--FRSLGE
FA13B_MOUSE/39-190NAETVEWLRQRY-------------DSGEEVD....................LVKE---ADVPSAISLLRFF--LQELPE
Q19370_CAEEL/541-693SQSEINRFREAY-------------ERGEDLFQ..................YLDDG---SDANSAAGVLKLY--FRELRE
O01443_CAEEL/529-695NTKRCRQLRNAL-------------EKVGGGAVIN...............DNMVEN---TTSHDVATLLKEY--FRDLPQ
RHG06_HUMAN/411-572SKKRVRQLREEF-------------DRGIDVS....................LEEE---HSVHDVAALLKEF--LRDMPD
Q8T0G4_DROME/380-537HKQKTELLYNEL-------------ESTFYQNPDN..............LDNLFRT---ATVHELSSLLKRW--LRELPQ
RGA1_SCHPO/862-1019NIRRLKELSDML-------------DVSPDSI....................DYEQ---ETPIQLAALLKKF--LRELPD
TAGAP_HUMAN/101-250NEKARKELKEEL-------------NSGDAV.....................DLER---LPVHLLAVVFKDF--LRSIPR
Q9XW53_CAEEL/264-412KQSTFKELKCEL-------------DKGVVP.....................DFHK---YNTHVLASILKEY--LRSIPG
BEM3_YEAST/927-1096SSTVIKTLQERF-------------DKEYDVDLCRYNESI....EAKDDEASPSLY---IGVNTVSGLLKLY--LRKLPH
RGA2_SCHPO/1083-1234SASTIKHLKEQF-------------NEGVDYDLL.................SSDEE---FDVHVIAGLLKLY--LRNLPT
RGAP7_ARATH/176-325DVEEVERRVQEY-------------EQGKTE.....................FTFD---EDPHVVGDCIKHV--LRELPS
YIL2_SCHPO/178-325SRKHLDIVIELY-------------DNGCMV.....................DLEA---FGPIAACSLIKHL--FRSLPS
RGA6_SCHPO/332-510SGPVIKAITEYF-------------YSPPHFWLDETS...........EIFKRIGF---PSYIDIAAVLKRY--IMLLPG
RGA5_SCHPO/68-226SSKRIQILQKAF-------------STGPDYGRS.................FDWEG---YTVHDAANVFRRF--INLMPE
BAG7_YEAST/76-235SNKRVRELQAVF-------------SKPPDYGRK................FEGWCD---FNVHDIATLLKRY--LNSLSE
OCRL_HUMAN/735-875MQEELQQIIDCL-------------DTSIP......................ETIP---GSNHSVAEALLIF--LEALPE
Q8STW6_ENCCU/162-313DKLAAAKIANKI-------------HENTCV.....................DIEN---IDVLVLANALKNY--IREHLD
Q8SRX9_ENCCU/91-256SITTIKECVKAI-------------NSCVDRNLSYSE...........ARRLLIRD---FNVIDLTTAFKEI--LREYST
Q9VUR5_DROME/55-207HQGAMKKLIHFL-------------QAGRLV.....................NVDN---YSVFTIASVLKKF--LRKIPN
A1Z9I5_DROME/395-538SEREYKALKEQF-------------LRGKATP....................HLGN---TDIYVLCCCVKDF--LRSLTE
B4IM29_DROSE/1223-1375SASDLAKLKKAF-------------ESDAYEAE..................QLLRE---VDIHSVTGILKTF--LRELPE
B4R2Z0_DROSI/903-1054NKAAISELSELV-------------NTKDFQFESC...............ASDDRW---EDVNVVSSLLKLF--IRSLPD
B9EHI3_MOUSE/380-524NKPYLT.LREKL-------------DSAEEM.....................NLRE---ESVYIVASVLKEF--IRNIPG
C5DZH4_ZYGRC/1013-1185SQLLIEDIEKAF-------------ADCYAKPSPE...............VLKLMS---EDIHAVASVLKRY--LRKLPN
E9PYS6_MOUSE/532-680AQARISEIRDAF-------------ERGEDPLE..................KGCTV---HDLDSVAGVLKLY--FRSLEP
F6YU97_CALJA/140-288NLAVIQKLRFAV-------------NHDEKLDL..................NDSKW---EDIHVITGALKMF--FRELPE
F6Z0J4_XENTR/128-275SSSSLTELRQIL-------------ECDAASV....................DFEQ---FDISILSDALKRY--LLDLPN
F7C997_MACMU/242-408SAAVKKELRDAF-------------ERDSAAVCLSEDLYPD...INVITEASGALT---RGGPVFTGILKDY--LRELPT
H0YIK5_HUMAN/99-243CDRTVKELKEKF-------------LRVKTVPL...................LSKV---DDIHAICSLLKDF--LRNLKE
M2TU31_COCH5/545-687TSSHIQQMKALF-------------DSESFQ.........................---HDVNSVAGLLKQF--FRELPD
Q0KHR5_DROME/1068-1216SENSMHKLMSAF-------------RADAFNVE..................ITRNE---YNEHDVANVLKRF--MRDLPE
Q54DW4_DICDI/28-177NGVTIQEIKKSF-------------DEGKGDLS...................KFNS---SDIHSVAGVLKLY--LRELPE
Q8IJX0_PLAF7/215-361DAATLYGIVGDI-------------EYGEPT......................TDF---NNIPSLVCSFKLF--LNTQKH
Q9VFK2_DROME/579-728GKSRIMKLREQI-------------EVTDSTAEC................MDVFDL---QQAYDVADMLKQY--FRELPE

PF08101

Q6C001_YARLI/166-664DPDAVPALVNHIFPK..NFQP....LQGEELL.R------------------TVRN...ADIYTLCGVLKWC..WCRMPG
R7YJ86_CONA1/46-524DPSAARSFIRNFFK...SSCERTALCTGAGLR.H------------------ELRL...TEPMVLCSIMKWC..WSRMPQ
Q0CXG4_ASPTN/43-519DASAARTFVRNYFS...QSVERGSPLNGEALA.Q------------------ELRL...TDPLVLCGVLKWC..WSRLPG
Q6FSL9_CANGA/51-451TNEKLLSFLNQIFPL.GNGQP....VNEKKQI.R------------------VVNK...TDVWTLFQALKYI..WCRLPD
A7TPE0_VANPO/51-441NTDNLNDFLTGIFKL.......NLSLEGGELRWS------------------SLVK...ANSFTLFQALKYI..WCRLPN
B2AXU5_PODAN/42-515DPSAVRTFVRHFFG....NRDGAQTLYGEALA.Q------------------ELRM...TEPMVISGVVKWC..WSRLPG
Q75EK6_ASHGO/155-597ETQQIRQLLASFFPR......AGCTLAGTALR.E------------------AIEREFRNNWNRLILALRIL..WAELPE
G8B672_CANPC/35-437KDYKLNELLLQLAPQ...GEL....IQDVSKCKE------------------IFST...TDEFTLMCCLKYF..WARLPN
H2AY21_KAZAF/42-448TNEKLLRFLNEIFPQ.GNGVP....VNDSLQA.K------------------IISK...TNEWTLFQSLKYI..WARLPN
G0SCJ0_CHATD/41-514DPSAVRNFVRHFFD....KENGTVRLRGEALA.Q------------------ELRM...TEPMVISGVIKWC..WSRLQG
M7P709_PNEMU/52-510DVLSTKAYIRKFFSV......DNSQVHKNQLI.Q------------------ELPI...VDIYVIIGIIRWC..WLRLID
C7YI83_NECH7/41-509DPSAVRSFVRHFFE.......SHANLRGEQLL.Q------------------ELRM...TEPMVVSGVAKWC..WSRIQG
C5DWH8_ZYGRC/26-427TNENLLRMLNAMFPQ.GNGQP....VTDAKLQ.K------------------IVAH...TEVHTLFQGLKYI..WCRLED
Q59KB4_CANAL/48-454NDEKLESFLSSIAPS...GEL....RTDNTLLQQ------------------LCSE...TDEFTLISALKYF..WSRLPN
L8FN12_PSED2/45-518DPSAARTFIRNYFD.......GKQTLQGNDLL.Q------------------ELRL...TEPIVLCSVVKWC..WSRLAG
G4U9K6_NEUT9/44-513DPSAVRTFVRHFFD....KQNGGPAIRGEALQ.Q------------------ELRM...TEPMVISGVIKWC..WSRLEG
MSB1_YEAST/68-472TNDKLLTLLNQLFPL.GNGQP....VNEKKQL.R------------------IVSK...ADVWTLFQCLKYI..WCRLPN
G8JR31_ERECY/75-468VNQKLLRFLSAIFPDGGDGGP....VNEAKLA.R------------------IVNG...TGSWTLVQALKYI..WCRVPG
A7TL24_VANPO/24-431TNEKLLKLLNKLFPL.GNEKI....ITDTKSIKK------------------TISH...ADSFTLFQVLKYI..WCRLPN
G0VGB1_NAUCC/47-451TNEKLLKLLNQLFPQ.GNGKP....VHESHQK.K------------------IVSK...YDEFTLFQALKYI..WCRLPN
F9X960_MYCGM/45-521HPISARTFIRNYYK...ANAEGSTQYRGEALK.Q------------------ELRL...TDSVVLCSIMKWC..WSRMPA
G8ZXX4_TORDC/64-466TNEKLLKLLNSLFPM.GNGQP....VPEKQMW.K------------------IVKK...AEPLTLFQGLKYI..WCRLPE
W1QG29_OGAPD/54-458HEPALKSFLNEIFDN...GK.....VADPEIIRE------------------EVRQ...VSPYVLISALKFF..WCRLPG
S7ZE60_PENO1/43-511DPSAARTFVRNYFN...QSFDKGAPVSGNELM.Q------------------ELRL...TEPMVLCSVLKWC..WSRLAG
Q6CUF4_KLULA/46-446TNEKLLSFLNSIFPL.GNGQP....VADEKIQ.K------------------ILNR...TEVWTLFQALKYI..WCRLPN
A7ELT0_SCLS1/45-517DPSAARTFIRNFFD........KRQLSREMLA.Q------------------ELRL...TEPMVLCSVLKWC..WSRMVG
C4R4X2_PICPG/64-468NDYRLKVFLNRVFIE...GK.....PASLKVIEK------------------VVKK...TDEFTLTSALKFL..WSRLPN
C0NAR4_AJECG/43-520DPSSARTFIRHYFS...PPPERPAPLRGEHLI.Q------------------ELRL...TEPMVLCSIIKWC..WSRLPG
T5A940_OPHSC/43-511NPSAVRTFIRHFFD.......DTFPLKGEMLL.Q------------------ELRM...TEPMVISGVVKWC..WSRLQG
V5G8I7_BYSSN/42-517DPSAARTFIRNYFN.....LERSTPLRGEALM.Q------------------ELRL...TEPMVLCSVLKWC..WGRLPG
Q2HFE8_CHAGB/41-504DPSAVRTFVRHFFD....GKDGGQLLRGEALA.R------------------ELRM...TEPMV.....GYCDNFTRVVG
E3RRN2_PYRTT/39-508DTSASRNFVRNFFK...AAYENTLQFSGEGLA.Q------------------ELRL...TEPLTLCSIIKWC..WSRLPG
K0KQP5_WICCF/58-453DDSKLTTFLSLVFPN...GTT....PAPINQIER------------------AVRD...TDEYTLMAALKYL..WSRLPM
M3D790_SPHMS/42-520DPQGARTFIHNFYK...SNAERGTQYRGDSLK.Q------------------ELRL...TDALVLCSIIKWC..WSRMPN
G8ZN62_TORDC/123-556EVIETKNILKNFFPE......DGCSLKGDDLS.T------------------AMRLNFKNNIGSLTMALRIL..WNEFPR
G8Y702_PICSO/33-436DDRKLEAFLSSIFPD...GQIIPT.TPEEPVK.R------------------LLEE...FDAFTLICGLKYI..WSRFPN
F2PPA7_TRIEC/40-517DPSAAKSFIRNFFSPPPERMDRPGPLQGSQLA.Q------------------ELRL...SEPMVLCSVMKWC..WARLPG
G3AEL0_SPAPN/40-432NDSHLEKLLSFVFPN...GEIIDAAKAEAGLL..------------------...E...FDEFTLICGLKYL..WARLPN
U1FZ21_ENDPU/42-520DPSAARAFVRNYFF....PPADREVLKGESLT.R------------------ELRL...IEPMVLASVMKWC..WSRLPG
S3CDZ9_GLAL2/45-517DPSAARTFIRHFFD........RGNLYGEALA.Q------------------ELRL...TDPMVICSVIKWC..WSRIPG
H1VJ74_COLHI/44-515DPSAVRTFIRHFFD.......GAQPLRGEFLS.Q------------------ELRM...TEPMVIAGVVKWC..WSRLSG
G0RMT4_HYPJQ/39-513NPSAVRTFIRNFFS.......HDPPLSGELLL.Q------------------ELRL...TEPMVISGVVKWC..WSRLQG
J4WLM4_BEAB2/43-513NPSGVRTFIRNFFG....KDGLDAPIHGERLQ.Q------------------EVRI...AEPMVLASVLKWC..WSRLQG
K1WYN9_MARBU/44-531DPSAARSFIRNFFD.......RREPLRGEVLA.Q------------------ELRL...TEPMVLCSVVKWC..WSRIPG
C4Y8F5_CLAL4/25-422DDTKLEMFLRTVFPH...GQ.....YAGDAVL.G------------------AVKD...FDEFTLVCGLKYL..WCRLPN
G2WT23_VERDV/45-514DPSAVRTFVRHFFD.........GNQRGEALA.Q------------------ELRM...TEPMVIAGVMKWC..WSRLQG
S8APA2_DACHA/42-517EPSSARPFIKKYFS...TETDYNGPMRGERLA.Q------------------ELRL...TDITVLCSIIKWC..WARIPG
A5DN67_PICGU/34-434DDHQLELFLQASFPG...GTV....ASEEVLR.R------------------IVKE...YDEFTLMCAMKYL..WSRLPN
U4LF75_PYROM/40-532DPCAARTLIRNFFN......AENGPMTGAQLQ.Q------------------ELRL...TEPEVLCSALKWC..WSRLPG
G4N725_MAGO7/47-516NPSAVRTFIRHFFD.......HSSNLRGDVLG.Q------------------ELRM...LEPMVISGVIKWC..WARLQG
H6BQM6_EXODN/41-520DPSAARSFVRNFFL....PPHDRDPLRGDVLE.R------------------ELRM...TEAMVLISVMKWC..WARLPG
A5DVE6_LODEL/33-436DDRKLNHFLTKLAPK...GVV....SRDATMVSE------------------LCKE...TNEFTLICSLKYF..WSRLPN
G8JPL3_ERECY/187-622ETKETKRILASFFPW......DGCSLAGKWLQ.L------------------EIEKHFGSSWNKLILALRIM..WSELPQ
J7SAQ4_KAZNA/50-456TNERLLKFLNAMFPL.GNGQA....VGVEHQV.R------------------LIRK...TDPFVLFQALKYV..WCRLPN
J3K4J2_COCIM/39-514DPSAARTFVRNYFN...PPPERAALLRGDNLM.Q------------------ELRL...TEPMVLCSVMKWC..WSRLPG
D5GIW3_TUBMM/41-522DASAARTFIRNFFD......PVTGPLRGPHLQ.Q------------------ELRL...TEPVVLCSTLKWC..WSRLPG
I2GXB5_TETBL/101-506DNTNLVYLLTILFPN...ESIPDSQLTEKEII.G------------------HINK...NNVWTLIQCLKYI..WCRLPN
K2SLP5_MACPH/42-514DASSAKSFVRNFFK...DAYEGGGSYRGESLR.A------------------ELRL...TEPMVLCSIMKWC..WSRLPG
K9GDF4_PEND2/42-525DPSAARTFIRNYFN...QSFEKGSPVNGDVLS.Q------------------ELRL...TEPMVLCGVMKWC..WSRLPG
G8BUH3_TETPH/39-448TNEKLLKFLNKLFPM.AHGKK....IGETKSIKK------------------IVSN...TDCFTLFQALKYI..WCRLPN
S3CDY7_OPHP1/45-516DPSAVRTFVRHFFD.......QNARVTGELLL.Q------------------ELRM...TEPMVISGVVKWC..WSRLQG
A3LX57_PICST/33-438NDSKLEQFLEQLFPN...GELIDVDHDENHAL.I------------------IIQS...YDEFTLICALKYM..WSRLPN
B5RTF9_DEBHA/33-436DDTKLELFISKIFPR...GELIGM.YDEIEVV.E------------------ILRK...FDEFTLICGLKYL..WSRLPN
N1PN78_MYCP1/46-518DPAGGRTFIRSYYR...SNADRSSQYKGESLK.Q------------------ELRL...TDSVVLCSIMKWC..WSRMPG
E9EC05_METAQ/43-511DPSAVRTFIRRFFD.......ESYGLKGNILA.Q------------------ELRM...TEPMVISGVVKWC..WSRLSG
I2H455_TETBL/74-485NNEKLLKFLNILFPQ.GNGQP....ISESHQL.K------------------LLAK...TDVFTLFQALKYI..WCRLPN
B8MSL6_TALSN/42-515DPSAARTFIRNFFN....AEQKGTPLQGEALI.Q------------------ELRL...TEPMVLCSVVKWC..WSRLPG
C5E2R2_LACTC/41-444SNEKLLRFLNQVFPL.GNGVP....VNETKQS.R------------------IISK...TEPWTLFQALKYV..WCRLPE
M2N7H3_BAUCO/46-522DASGARTFIRNFFK...SNAEGSHQFRGSGLA.Q------------------ELRL...TEAVVLCSIIKWC..WSRMPG
Q75ED0_ASHGO/36-425ANRKLLAFLNAVFPL.GNGQA....VPRAKAR.H------------------VIGE...TDSWTLVQALKYI..WCRLPG

PF00616

RASL1_MOUSE/321-510GMRYLHEVLRPV-------------....ISRV.------------------F..E---EKKYMELDPCKMDLNRSR...
Q75DK0_ASHGO/576-771GQEYLDKSIGGI-------------....IRRI.------------------V..A---EEDMCELDPARIK........
RGAA_DICDI/239-445GTDYLKAVIGPI-------------....LSNV.------------------I..K---QELNLELKPNLVYAAIISEQE
A5DN39_PICGU/903-1097QRSHLKKLIGKH-------------....ICRI.------------------T.ED---DELNFESDPSQIYEDIVRKEV
GAPD1_MOUSE/152-353AKLFLTATLHEP-------------....IMQL.------------------L.VE---DEDHLETDPNKLIERFSPAQQ
A5DR10_PICGU/619-844GQEYLEKVFGDF-------------....FSKI.------------------S..T---DKKNCEVDPRYVRAAIVAARK
Q6BPM2_DEBHA/608-836GQEYLEKVFGEF-------------....MGKI.------------------S..Y---EEKDCETDPRYIRLQLKAERK
Q0V6E4_PHANO/854-1062DRKFLKEVLGPV-------------....IREN.------------------IIEN---EHLDLESDPMQIYRSAINNEE
Q6CFR5_YARLI/832-1039PKKLLKSLLGPH-------------....VSTV.------------------V.DQ---HMLDLESDPIAIYRSLINQEE
IQGA2_MOUSE/938-1150GQNTLRQLLAPV-------------....VKEI.------------------I.ED---KALVINTNPVEVYKAWVNQLE
A5E5Z0_LODEL/955-1161QRQHLKALFGAF-------------....VIQT.------------------.TED---DEFDFESDPTSILSTIIAKEI
IQG1_CANAL/977-1177QRQHLKALLGKF-------------....VIRI.------------------.VDN---EQVDFESDPIRIYNQIIDHEM
A3LY27_PICST/921-1130QRQHLKHLVGKF-------------....VYSV.------------------.IES---DMLDFESDPSEIYEAIVEREH
Q6CR01_KLULA/879-1073RSKEILTAFAQL-------------....YKYL.------------------..DS---NAIDFESDPSKIYAKLHPTAP
Q54F48_DICDI/1131-1337GKPYMISVLKDL-------------....VVSII------------------Q..D---HNLNLENDPQKKAML......
Q6BG44_PARTE/169-435CQSYIQQIC...-------------....GQALN------------------LLMN---VKEELQLNPKIIYESQLKLKE
RASL2_HUMAN/323-512GMQYLHGVLGPI-------------....INKV.------------------F..E---EKKYVELDPSKVEVKDVGC..
A2CE77_DANRE/319-508GMQYLHRLLGPI-------------....INRI.------------------F..E---EKKYVELDPSKVELKEAGC..
Q66JF5_XENTR/327-516GMPFLHEILRPI-------------....ISKI.------------------F..E---EKRYIELDPCKIDLNRSRR..
A3LZE1_PICST/612-848GQEYLEKALAGF-------------....FTKI.------------------S..M---EKKNCELDPRYVSLQEKKLRQ
BUD2_CANAL/642-872GQEYLEKVFGDF-------------....FAKI.------------------S..N---EKKNCEVDPRYVRIQERALRK
A5E274_LODEL/753-994GQEYLEKVFGDF-------------....FAKI.------------------N..K---ECKNCEVDPRYVKIQERAARK
Q6FNM9_CANGA/542-738GREYLEKAFGTL-------------....IRNL.------------------L..N---EEVSFEMDPMRISAK......
BUD2_YEAST/541-721GNEYLSKALSAI-------------....LKEI.------------------I..E---SNKSCELDPARVKEK......
Q6CW67_KLULA/546-743GQEYLDKCIGTV-------------....IRQL.------------------V..E---EDESYEIDPNRIKES......
Q4P4C4_USTMA/677-887TLSWLDDCLGPT-------------....VRKI.------------------C...---QDPHVPSRPDTAASISSAGSV
NFAA_DICDI/68-259GANYLRFVLSDL-------------....VTKV.------------------V.LD---SDLKLEIDPRKLNDYYED...
Q4DY44_TRYCC/96-330LEEQLLNCCNIL-------------REDDVAPT.------------------LAGG---ESRL.EEDGGESRGEASSPKF
A2R7H8_ASPNC/194-402GQSYLKQVLADQ-------------....INA..------------------LIEL---RDVDLEINPLKVYETMVKQIE
Q54I64_DICDI/185-392GQQYLKQRLTKP-------------....LAD..------------------ITSN---KDLILEVNPSTVYENYINEYE
A7S5U4_NEMVE/139-338GQEYLKCTLEEP-------------....LND..------------------LMSQ---EDLVLEINPIKVYIELYGHPM
GAP1_SCHPO/175-379GQAYLRSILYQC-------------....IND..------------------VAIH---PDLQLDIHPLSVYRYLVNTGQ
GAPA_DICDI/274-481GHEFLKQIIAPI-------------....LENN.------------------VVNA---PDLNLELNAVQVYQNMISEQE
A7F2A6_SCLS1/1177-1385DRKFLRDLLGPL-------------....IMEN.------------------IIED---PALDLESDPMQIYRSAINNEE
A2QP50_ASPNC/1125-1333DRKFMRDILGTV-------------....VREN.------------------VVEN---PELDLESDPIQIYRSAINNEE
A6R4D6_AJECN/1034-1242DRKFMRDILGEL-------------....VKEH.------------------IIEN---TELDLESDPMQIYRSAISNEE
Q4P2J5_USTMA/1116-1323ERKYLKDLLGPL-------------....VSD..------------------IMAQ---EGLDLETDPCAIYRATINQEE
Q5KM85_CRYNJ/1428-1635LTPYIHDVIAPH-------------....VMR..------------------IVDA---PELDLCTDPVRIYIGTINAEE
A7SXE3_NEMVE/113-325GQSSLRELLEPL-------------....VND..------------------VLNE---RNLNINTNPLDVYKGWVNQME
RNG2_SCHPO/875-1077REVKLWKTILGR-------------....IHKV.------------------LVAD---NHLDFEINPLTLFKSFNPEVA
Q552W4_DICDI/717-964GFKYLKEIITPL-------------....ILKV.------------------.LDQ---TDLNLNFDPYWIQKEIQIAKE
A0DYI4_PARTE/179-497NVKYTKVIFKNS-------------....LIQI.------------------T..K---VDKFLDLDKRKIADKLREIMK
B4GY66_DROPE/162-365ARIFLTAALHAP-------------....LMGV.------------------L.SE---HDIWLDLDPHKLMQSFSQKER
D8Q477_SCHCM/172-379GQSYLKSVLAER-------------....INSL.------------------I.EH---KDLNLEINPVKVYEQMINQIE
E7QA29_YEASB/881-1068SPEFFSIIV.PV-------------....LDYL.------------------S..D---PVVDFESDPYKIYQEIHGFSS
F1RMJ4_PIG/208-420GQNALRQILAPV-------------....VKEI.------------------M.DD---KSLNIKTDPVDIYKSWVNQME
F2Z2E2_HUMAN/966-1177GQSALQEILGKV-------------....IQDV.------------------L.ED---KVLSVHTDPVHLYKNWINQTE
H3DDA1_TETNG/1025-1236GQNTLRQLLAPV-------------....VKDI.------------------I.DD---KNLNINTNPVDIYKAWVNQVE
Q23D35_TETTS/322-667FQRYTKYIFKGP-------------....LQYI.------------------...T---KANKIVVNPQKIFELLKKKQT
Q4TE24_TETNG/96-307GQNALRDCLGPA-------------....LQDL.------------------L.LD---PGLSIRTDPLQVYRAWINLSE
Q7S5G6_NEUCR/194-402GQSFLKSVLADR-------------....INSL.------------------I.EL---KDLDLEINPLKVYERMIEEAE
V5IQZ3_NEUCR/1171-1379DRKYLRDLLGPL-------------....IRDN.------------------IIED---PALDLESDPMQIYRSAINNEE

PF00620

RHG05_MOUSE/1274-1425P-------------------------------------------------------------------------------
SYDE_DROME/968-1123P-------------------------------------------------------------------------------
LRG1_YEAST/755-912P-------------------------------------------------------------------------------
P85B_MOUSE/125-265A-------------------------------------------------------------------------------
I5P2_MOUSE/830-972P-------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238P-------------------------------------------------------------------------------
RHG28_HUMAN/399-552S-------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281A-------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225P-------------------------------------------------------------------------------
Q20442_CAEEL/896-1053P-------------------------------------------------------------------------------
RHG18_HUMAN/343-492P-------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120G-------------------------------------------------------------------------------
PAC1_CAEEL/963-1123P-------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034P-------------------------------------------------------------------------------
HMHA1_HUMAN/775-947P-------------------------------------------------------------------------------
GMIP_HUMAN/565-728P-------------------------------------------------------------------------------
RHG32_HUMAN/386-538P-------------------------------------------------------------------------------
RG190_DROME/1364-1529P-------------------------------------------------------------------------------
RG92B_DROME/265-418P-------------------------------------------------------------------------------
RGAPX_ARATH/155-296P-------------------------------------------------------------------------------
BCR_HUMAN/1068-1221P-------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314P-------------------------------------------------------------------------------
RHG24_MOUSE/151-304P-------------------------------------------------------------------------------
RHG17_RAT/266-415P-------------------------------------------------------------------------------
RHG20_HUMAN/377-527S-------------------------------------------------------------------------------
RBP1_RAT/210-356N-------------------------------------------------------------------------------
CHIN_MOUSE/282-436P-------------------------------------------------------------------------------
RHG09_HUMAN/556-726P-------------------------------------------------------------------------------
SRGP2_HUMAN/505-657P-------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302P-------------------------------------------------------------------------------
RRC1_CAEEL/294-443P-------------------------------------------------------------------------------
RHG35_RAT/1262-1413P-------------------------------------------------------------------------------
RHG39_HUMAN/909-1055P-------------------------------------------------------------------------------
Q9W4A9_DROME/319-473P-------------------------------------------------------------------------------
RGA3_SCHPO/794-942P-------------------------------------------------------------------------------
RGA4_SCHPO/761-910P-------------------------------------------------------------------------------
MYO9B_RAT/1673-1822P-------------------------------------------------------------------------------
RGA1_YEAST/805-985P-------------------------------------------------------------------------------
RGA2_YEAST/802-985P-------------------------------------------------------------------------------
TG325_CAEEL/624-775P-------------------------------------------------------------------------------
Q9VWL9_DROME/292-441P-------------------------------------------------------------------------------
CDGAP_DROME/438-593P-------------------------------------------------------------------------------
RGA7_SCHPO/520-671P-------------------------------------------------------------------------------
RGD1_YEAST/486-644S-------------------------------------------------------------------------------
BEM2_YEAST/1981-2141S-------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071P-------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588P-------------------------------------------------------------------------------
RHG01_HUMAN/260-408P-------------------------------------------------------------------------------
RHG08_MOUSE/210-360P-------------------------------------------------------------------------------
RG68F_DROME/292-439P-------------------------------------------------------------------------------
Q23130_CAEEL/263-421P-------------------------------------------------------------------------------
FA13B_MOUSE/39-190P-------------------------------------------------------------------------------
Q19370_CAEEL/541-693P-------------------------------------------------------------------------------
O01443_CAEEL/529-695S-------------------------------------------------------------------------------
RHG06_HUMAN/411-572P-------------------------------------------------------------------------------
Q8T0G4_DROME/380-537P-------------------------------------------------------------------------------
RGA1_SCHPO/862-1019P-------------------------------------------------------------------------------
TAGAP_HUMAN/101-250K-------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412K-------------------------------------------------------------------------------
BEM3_YEAST/927-1096L-------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234N-------------------------------------------------------------------------------
RGAP7_ARATH/176-325S-------------------------------------------------------------------------------
YIL2_SCHPO/178-325P-------------------------------------------------------------------------------
RGA6_SCHPO/332-510G-------------------------------------------------------------------------------
RGA5_SCHPO/68-226H-------------------------------------------------------------------------------
BAG7_YEAST/76-235P-------------------------------------------------------------------------------
OCRL_HUMAN/735-875P-------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313G-------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256T-------------------------------------------------------------------------------
Q9VUR5_DROME/55-207G-------------------------------------------------------------------------------
A1Z9I5_DROME/395-538P-------------------------------------------------------------------------------
B4IM29_DROSE/1223-1375A-------------------------------------------------------------------------------
B4R2Z0_DROSI/903-1054A-------------------------------------------------------------------------------
B9EHI3_MOUSE/380-524S-------------------------------------------------------------------------------
C5DZH4_ZYGRC/1013-1185P-------------------------------------------------------------------------------
E9PYS6_MOUSE/532-680P-------------------------------------------------------------------------------
F6YU97_CALJA/140-288P-------------------------------------------------------------------------------
F6Z0J4_XENTR/128-275P-------------------------------------------------------------------------------
F7C997_MACMU/242-408P-------------------------------------------------------------------------------
H0YIK5_HUMAN/99-243P-------------------------------------------------------------------------------
M2TU31_COCH5/545-687P-------------------------------------------------------------------------------
Q0KHR5_DROME/1068-1216R-------------------------------------------------------------------------------
Q54DW4_DICDI/28-177P-------------------------------------------------------------------------------
Q8IJX0_PLAF7/215-361G-------------------------------------------------------------------------------
Q9VFK2_DROME/579-728S-------------------------------------------------------------------------------

PF08101

Q6C001_YARLI/166-664G-------------------------------------------------------------------------------
R7YJ86_CONA1/46-524G-------------------------------------------------------------------------------
Q0CXG4_ASPTN/43-519G-------------------------------------------------------------------------------
Q6FSL9_CANGA/51-451S-------------------------------------------------------------------------------
A7TPE0_VANPO/51-441G-------------------------------------------------------------------------------
B2AXU5_PODAN/42-515G-------------------------------------------------------------------------------
Q75EK6_ASHGO/155-597S-------------------------------------------------------------------------------
G8B672_CANPC/35-437S-------------------------------------------------------------------------------
H2AY21_KAZAF/42-448S-------------------------------------------------------------------------------
G0SCJ0_CHATD/41-514G-------------------------------------------------------------------------------
M7P709_PNEMU/52-510G-------------------------------------------------------------------------------
C7YI83_NECH7/41-509G-------------------------------------------------------------------------------
C5DWH8_ZYGRC/26-427G-------------------------------------------------------------------------------
Q59KB4_CANAL/48-454N-------------------------------------------------------------------------------
L8FN12_PSED2/45-518G-------------------------------------------------------------------------------
G4U9K6_NEUT9/44-513G-------------------------------------------------------------------------------
MSB1_YEAST/68-472S-------------------------------------------------------------------------------
G8JR31_ERECY/75-468R-------------------------------------------------------------------------------
A7TL24_VANPO/24-431G-------------------------------------------------------------------------------
G0VGB1_NAUCC/47-451A-------------------------------------------------------------------------------
F9X960_MYCGM/45-521G-------------------------------------------------------------------------------
G8ZXX4_TORDC/64-466G-------------------------------------------------------------------------------
W1QG29_OGAPD/54-458N-------------------------------------------------------------------------------
S7ZE60_PENO1/43-511G-------------------------------------------------------------------------------
Q6CUF4_KLULA/46-446G-------------------------------------------------------------------------------
A7ELT0_SCLS1/45-517G-------------------------------------------------------------------------------
C4R4X2_PICPG/64-468G-------------------------------------------------------------------------------
C0NAR4_AJECG/43-520G-------------------------------------------------------------------------------
T5A940_OPHSC/43-511G-------------------------------------------------------------------------------
V5G8I7_BYSSN/42-517G-------------------------------------------------------------------------------
Q2HFE8_CHAGB/41-504G-------------------------------------------------------------------------------
E3RRN2_PYRTT/39-508G-------------------------------------------------------------------------------
K0KQP5_WICCF/58-453D-------------------------------------------------------------------------------
M3D790_SPHMS/42-520G-------------------------------------------------------------------------------
G8ZN62_TORDC/123-556G-------------------------------------------------------------------------------
G8Y702_PICSO/33-436N-------------------------------------------------------------------------------
F2PPA7_TRIEC/40-517G-------------------------------------------------------------------------------
G3AEL0_SPAPN/40-432N-------------------------------------------------------------------------------
U1FZ21_ENDPU/42-520G-------------------------------------------------------------------------------
S3CDZ9_GLAL2/45-517G-------------------------------------------------------------------------------
H1VJ74_COLHI/44-515G-------------------------------------------------------------------------------
G0RMT4_HYPJQ/39-513G-------------------------------------------------------------------------------
J4WLM4_BEAB2/43-513G-------------------------------------------------------------------------------
K1WYN9_MARBU/44-531G-------------------------------------------------------------------------------
C4Y8F5_CLAL4/25-422N-------------------------------------------------------------------------------
G2WT23_VERDV/45-514G-------------------------------------------------------------------------------
S8APA2_DACHA/42-517G-------------------------------------------------------------------------------
A5DN67_PICGU/34-434H-------------------------------------------------------------------------------
U4LF75_PYROM/40-532G-------------------------------------------------------------------------------
G4N725_MAGO7/47-516G-------------------------------------------------------------------------------
H6BQM6_EXODN/41-520G-------------------------------------------------------------------------------
A5DVE6_LODEL/33-436N-------------------------------------------------------------------------------
G8JPL3_ERECY/187-622G-------------------------------------------------------------------------------
J7SAQ4_KAZNA/50-456G-------------------------------------------------------------------------------
J3K4J2_COCIM/39-514G-------------------------------------------------------------------------------
D5GIW3_TUBMM/41-522G-------------------------------------------------------------------------------
I2GXB5_TETBL/101-506G-------------------------------------------------------------------------------
K2SLP5_MACPH/42-514G-------------------------------------------------------------------------------
K9GDF4_PEND2/42-525G-------------------------------------------------------------------------------
G8BUH3_TETPH/39-448G-------------------------------------------------------------------------------
S3CDY7_OPHP1/45-516G-------------------------------------------------------------------------------
A3LX57_PICST/33-438N-------------------------------------------------------------------------------
B5RTF9_DEBHA/33-436N-------------------------------------------------------------------------------
N1PN78_MYCP1/46-518G-------------------------------------------------------------------------------
E9EC05_METAQ/43-511G-------------------------------------------------------------------------------
I2H455_TETBL/74-485N-------------------------------------------------------------------------------
B8MSL6_TALSN/42-515G-------------------------------------------------------------------------------
C5E2R2_LACTC/41-444G-------------------------------------------------------------------------------
M2N7H3_BAUCO/46-522G-------------------------------------------------------------------------------
Q75ED0_ASHGO/36-425E-------------------------------------------------------------------------------

PF00616

RASL1_MOUSE/321-510................................................................................
Q75DK0_ASHGO/576-771................................................................................
RGAA_DICDI/239-445IRTGEK..........................................................................
A5DN39_PICGU/903-1097KVHGF...........................................................................
GAPD1_MOUSE/152-353EK..............................................................................
A5DR10_PICGU/619-844GDAGSD..........................................................................
Q6BPM2_DEBHA/608-836GRTIDDSD........................................................................
Q0V6E4_PHANO/854-1062LRTGQR..........................................................................
Q6CFR5_YARLI/832-1039LASGRT..........................................................................
IQGA2_MOUSE/938-1150TQTGEA..........................................................................
A5E5Z0_LODEL/955-1161RVTGT...........................................................................
IQG1_CANAL/977-1177KVYGR...........................................................................
A3LY27_PICST/921-1130RVNGF...........................................................................
Q6CR01_KLULA/879-1073P...............................................................................
Q54F48_DICDI/1131-1337................................................................................
Q6BG44_PARTE/169-435SKESAKLLKLKQENKARKIMFNIIPMLMQGT.................................................
RASL2_HUMAN/323-512................................................................................
A2CE77_DANRE/319-508................................................................................
Q66JF5_XENTR/327-516................................................................................
A3LZE1_PICST/612-848GKEIDDSDS.......................................................................
BUD2_CANAL/642-872GKSIHEATGLENGQNEDV..............................................................
A5E274_LODEL/753-994GLLNKDNDLTDLDDLCG...............................................................
Q6FNM9_CANGA/542-738................................................................................
BUD2_YEAST/541-721................................................................................
Q6CW67_KLULA/546-743................................................................................
Q4P4C4_USTMA/677-887GGDD............................................................................
NFAA_DICDI/68-259................................................................................
Q4DY44_TRYCC/96-330P...............................................................................
A2R7H8_ASPNC/194-402EEQGSL..........................................................................
Q54I64_DICDI/185-392TKTGKP..........................................................................
A7S5U4_NEMVE/139-338DE..............................................................................
GAP1_SCHPO/175-379LSPS............................................................................
GAPA_DICDI/274-481IQTGAK..........................................................................
A7F2A6_SCLS1/1177-1385LRTGRP..........................................................................
A2QP50_ASPNC/1125-1333LRTGKR..........................................................................
A6R4D6_AJECN/1034-1242LRTGRK..........................................................................
Q4P2J5_USTMA/1116-1323METGQP..........................................................................
Q5KM85_CRYNJ/1428-1635TQTGTP..........................................................................
A7SXE3_NEMVE/113-325SETGQT..........................................................................
RNG2_SCHPO/875-1077SQT.............................................................................
Q552W4_DICDI/717-964LK..............................................................................
A0DYI4_PARTE/179-497EKDKKQKEEKQSLNSSAFIVKQVPLMLNSSQKLPQRQIPIITPIRNIEMPQQNMTLYYANL...................
B4GY66_DROPE/162-365ER..............................................................................
D8Q477_SCHCM/172-379EETGSL..........................................................................
E7QA29_YEASB/881-1068................................................................................
F1RMJ4_PIG/208-420SQTGEA..........................................................................
F2Z2E2_HUMAN/966-1177AQTGQR..........................................................................
H3DDA1_TETNG/1025-1236TTTGEA..........................................................................
Q23D35_TETTS/322-667SQGTSIQQQIQRKTMGNNQKDMYVSYNSNQSMRTEPSISDNSNKNYAQKYEQILRQYDSVNSNKNNIVSHNVMKIVGLGE
Q4TE24_TETNG/96-307TQSGCR..........................................................................
Q7S5G6_NEUCR/194-402AKDPESP.........................................................................
V5IQZ3_NEUCR/1171-1379LRTGRP..........................................................................

PF00620

RHG05_MOUSE/1274-1425------------------------------------------------------------LIPYSLHPELL.E.------
SYDE_DROME/968-1123------------------------------------------------------------LFTRCLFQMTV.D.------
LRG1_YEAST/755-912------------------------------------------------------------ILSTDLYELWI.K.------
P85B_MOUSE/125-265------------------------------------------------------------VVTPEAAAEAY...------
I5P2_MOUSE/830-972------------------------------------------------------------VICYSAYHSCL.E.------
RHG07_HUMAN/1092-1238------------------------------------------------------------LMTNKLSETFL.Q.------
RHG28_HUMAN/399-552------------------------------------------------------------LFPVEYIPAFISL.------
ARAP2_HUMAN/1129-1281------------------------------------------------------------LLTKELYPYWI.S.------
MYO9A_HUMAN/2076-2225------------------------------------------------------------LMTFELYEEFL.R.------
Q20442_CAEEL/896-1053------------------------------------------------------------LMTVKMSEVFA.N.------
RHG18_HUMAN/343-492------------------------------------------------------------LLSVEYLKAFQ.A.------
ARAP1_HUMAN/971-1120------------------------------------------------------------LFTRAQRLTWL.E.------
PAC1_CAEEL/963-1123------------------------------------------------------------LLTDKLYPFFI.D.------
Q9V4C2_DROME/875-1034------------------------------------------------------------LLCNTLYLTFL.K.------
HMHA1_HUMAN/775-947------------------------------------------------------------LISFRLYHELVGL.------
GMIP_HUMAN/565-728------------------------------------------------------------VIPFHLYDAFI.S.------
RHG32_HUMAN/386-538------------------------------------------------------------LLTYQLYEKFS.D.------
RG190_DROME/1364-1529------------------------------------------------------------LFSKDIIKELE.E.------
RG92B_DROME/265-418------------------------------------------------------------LLTYNLYKDFI.R.------
RGAPX_ARATH/155-296------------------------------------------------------------LTTFELYNEIK...------
BCR_HUMAN/1068-1221------------------------------------------------------------LFTDEFYPNFA.E.------
RHG21_HUMAN/1161-1314------------------------------------------------------------LFTNDKYADFI.E.------
RHG24_MOUSE/151-304------------------------------------------------------------VVPYAKYEDFL.SC------
RHG17_RAT/266-415------------------------------------------------------------LMTFSLYEEWT.Q.------
RHG20_HUMAN/377-527------------------------------------------------------------IFSSDLYDHWV.S.------
RBP1_RAT/210-356------------------------------------------------------------LLTKELMPRFE.E.------
CHIN_MOUSE/282-436------------------------------------------------------------LITYDAYPKFI.E.------
RHG09_HUMAN/556-726------------------------------------------------------------LVPPLLLPHFR...------
SRGP2_HUMAN/505-657------------------------------------------------------------LFPKDIFHDLM.A.------
Q9VDE9_DROME/1154-1302------------------------------------------------------------LIPDAYYEDCV.N.------
RRC1_CAEEL/294-443------------------------------------------------------------LFTYQAYPKLI.E.------
RHG35_RAT/1262-1413------------------------------------------------------------LVPYSMQIDLV.E.------
RHG39_HUMAN/909-1055------------------------------------------------------------LIPHEFYEQCI.A.------
Q9W4A9_DROME/319-473------------------------------------------------------------LITFQAYPSFM.A.------
RGA3_SCHPO/794-942------------------------------------------------------------VIPGTQYEELL.E.------
RGA4_SCHPO/761-910------------------------------------------------------------IITYDQYFPFI.T.------
MYO9B_RAT/1673-1822------------------------------------------------------------LMTFAQYGDFL.R.------
RGA1_YEAST/805-985------------------------------------------------------------IFTFQIYEPLM.R.------
RGA2_YEAST/802-985------------------------------------------------------------VLSFSIYDALI.D.------
TG325_CAEEL/624-775------------------------------------------------------------LFPISLHKEYT.S.------
Q9VWL9_DROME/292-441------------------------------------------------------------LITQEAYERLGRS.------
CDGAP_DROME/438-593------------------------------------------------------------LCTYQLYDNFV.EA------
RGA7_SCHPO/520-671------------------------------------------------------------LIPDNHQRDFI.D.------
RGD1_YEAST/486-644------------------------------------------------------------VLPKALSSEIKVCL------
BEM2_YEAST/1981-2141------------------------------------------------------------LFSHAMVNDFTDLA------
ARAP3_HUMAN/920-1071------------------------------------------------------------VTSARLLPRWR.E.------
Q9XUS9_CAEEL/437-588------------------------------------------------------------LIPRTSRQELIVAA------
RHG01_HUMAN/260-408------------------------------------------------------------LLTFDLYPHVV...------
RHG08_MOUSE/210-360------------------------------------------------------------LLTFQAYEQIL...------
RG68F_DROME/292-439------------------------------------------------------------LLTFELYEDVT...------
Q23130_CAEEL/263-421------------------------------------------------------------LTTNRLYPKLA...------
FA13B_MOUSE/39-190------------------------------------------------------------VIPGSLHIHLLQL.------
Q19370_CAEEL/541-693------------------------------------------------------------IFPIFMFEQFC.D.------
O01443_CAEEL/529-695------------------------------------------------------------LLPGEHYSAYI...------
RHG06_HUMAN/411-572------------------------------------------------------------LLTRELYTAFI...------
Q8T0G4_DROME/380-537------------------------------------------------------------LLTNELIQLFY...------
RGA1_SCHPO/862-1019------------------------------------------------------------LLTFKLFGLFI.T.------
TAGAP_HUMAN/101-250------------------------------------------------------------LLSSDLFEEWM.G.------
Q9XW53_CAEEL/264-412------------------------------------------------------------ILLSGNYELWMRE.------
BEM3_YEAST/927-1096------------------------------------------------------------LFGDEQFLSFK.RV------
RGA2_SCHPO/1083-1234------------------------------------------------------------LLDTSMHKLFE.L.------
RGAP7_ARATH/176-325------------------------------------------------------------PVSASCCTALL.E.------
YIL2_SCHPO/178-325------------------------------------------------------------LFSAEFLNGLTDH.------
RGA6_SCHPO/332-510------------------------------------------------------------LFTHKDILNLLVPL------
RGA5_SCHPO/68-226------------------------------------------------------------VIPLEYYERFR.EP------
BAG7_YEAST/76-235------------------------------------------------------------LVPLALYDIFRNPI------
OCRL_HUMAN/735-875------------------------------------------------------------VICYELYQRCL...------
Q8STW6_ENCCU/162-313------------------------------------------------------------LVPIEAFEKIKTCI------
Q8SRX9_ENCCU/91-256------------------------------------------------------------IIPESLIDTMFKIA------
Q9VUR5_DROME/55-207------------------------------------------------------------IFGRSGEMELFAIN------
A1Z9I5_DROME/395-538------------------------------------------------------------LIPTSQWKDFA.N.------
B4IM29_DROSE/1223-1375------------------------------------------------------------LFTDQLYPRFF.DT------
B4R2Z0_DROSI/903-1054------------------------------------------------------------LMPASYYINFI...------
B9EHI3_MOUSE/380-524------------------------------------------------------------LLCSNLYGKWL.A.------
C5DZH4_ZYGRC/1013-1185------------------------------------------------------------VLTFQIYEPLI.K.------
E9PYS6_MOUSE/532-680------------------------------------------------------------LFPLDMFNELL.A.------
F6YU97_CALJA/140-288------------------------------------------------------------LFTFNHFNDFV...------
F6Z0J4_XENTR/128-275------------------------------------------------------------VIPALMYSEMLSA.------
F7C997_MACMU/242-408------------------------------------------------------------LITQPLYQVVL.E.------
H0YIK5_HUMAN/99-243------------------------------------------------------------LLTFRLNRAFM.E.------
M2TU31_COCH5/545-687------------------------------------------------------------LLTREFYGKYI.E.------
Q0KHR5_DROME/1068-1216------------------------------------------------------------LLGK.LTDSFV.F.------
Q54DW4_DICDI/28-177------------------------------------------------------------LFIWRYYSTFI.K.------
Q8IJX0_PLAF7/215-361------------------------------------------------------------LLGKDAFSRLH...------
Q9VFK2_DROME/579-728------------------------------------------------------------LLTTKMSETFV.A.------

PF08101

Q6C001_YARLI/166-664-----------------------------------------------------------.VVSWPVYNTFVQAE..K...
R7YJ86_CONA1/46-524-----------------------------------------------------------.VVTWDAYEMFKMGE..K...
Q0CXG4_ASPTN/43-519-----------------------------------------------------------.VVTWEAYELFKVGE..Q...
Q6FSL9_CANGA/51-451-----------------------------------------------------------EVVGWKAYKEFKIRE..K...
A7TPE0_VANPO/51-441-----------------------------------------------------------GVIGWDSYKLFKVKE..K...
B2AXU5_PODAN/42-515-----------------------------------------------------------.VVGWDSYELFSLGE..Q...
Q75EK6_ASHGO/155-597-----------------------------------------------------------.IVPWDCFITFKRLE..E...
G8B672_CANPC/35-437-----------------------------------------------------------EIIGQDVYREFKRKE..A...
H2AY21_KAZAF/42-448-----------------------------------------------------------EVIGWQAYLEFKLRE..A...
G0SCJ0_CHATD/41-514-----------------------------------------------------------.VVGWDSYELFQMGE..K...
M7P709_PNEMU/52-510-----------------------------------------------------------.VVGWNVYEAFRKLE..K...
C7YI83_NECH7/41-509-----------------------------------------------------------.IVGWDAYELFKVGE..I...
C5DWH8_ZYGRC/26-427-----------------------------------------------------------EVVGWRSYLQFKLRE..K...
Q59KB4_CANAL/48-454-----------------------------------------------------------EIIGWDVYLEFKRRE..A...
L8FN12_PSED2/45-518-----------------------------------------------------------.VVTWDSYEMFRIGE..L...
G4U9K6_NEUT9/44-513-----------------------------------------------------------.VVGWDAYELFKVGE..Q...
MSB1_YEAST/68-472-----------------------------------------------------------EIIGWKSYLEFKFRE..E...
G8JR31_ERECY/75-468-----------------------------------------------------------EVIGWKAYREFEREE..R...
A7TL24_VANPO/24-431-----------------------------------------------------------EIIGWKSYLEFKARE..K...
G0VGB1_NAUCC/47-451-----------------------------------------------------------EIVGWKSYLEFKYRE..E...
F9X960_MYCGM/45-521-----------------------------------------------------------.VVTWPVYEGFRIGE..K...
G8ZXX4_TORDC/64-466-----------------------------------------------------------QVVSWKAYLEFKRRE..K...
W1QG29_OGAPD/54-458-----------------------------------------------------------CVIGWKTYTKFVTLD..E...
S7ZE60_PENO1/43-511-----------------------------------------------------------.VVTWDAYELFKVGE..Q...
Q6CUF4_KLULA/46-446-----------------------------------------------------------EIIGWAAYNEFKTKE..A...
A7ELT0_SCLS1/45-517-----------------------------------------------------------.VVSWDAYELFKVGE..H...
C4R4X2_PICPG/64-468-----------------------------------------------------------YIVGWKSYAQFAKLE..Q...
C0NAR4_AJECG/43-520-----------------------------------------------------------.VVTWEAYELFKVGE..Q...
T5A940_OPHSC/43-511-----------------------------------------------------------.VVGWDAYELFKVGE..Y...
V5G8I7_BYSSN/42-517-----------------------------------------------------------.VVTWEAYELFKVGE..Q...
Q2HFE8_CHAGB/41-504-----------------------------------------------------------.RV..................
E3RRN2_PYRTT/39-508-----------------------------------------------------------.VVTWDAYELFRIGE..S...
K0KQP5_WICCF/58-453-----------------------------------------------------------SIVGWDAYETFKKLE..A...
M3D790_SPHMS/42-520-----------------------------------------------------------.VVSWPVYEGFRIGE..K...
G8ZN62_TORDC/123-556-----------------------------------------------------------.IVPWEAYYKFIKWE..S...
G8Y702_PICSO/33-436-----------------------------------------------------------EIIGWDVYLEFKRRE..K...
F2PPA7_TRIEC/40-517-----------------------------------------------------------.VVTWEAYELFKVGE..N...
G3AEL0_SPAPN/40-432-----------------------------------------------------------EIIGWDVYLEFKRKE..K...
U1FZ21_ENDPU/42-520-----------------------------------------------------------.VVTWETYELFRIGE..K...
S3CDZ9_GLAL2/45-517-----------------------------------------------------------.VVGEAAYDTFRAAE..I...
H1VJ74_COLHI/44-515-----------------------------------------------------------.VVGWDAYELFKVGE..Q...
G0RMT4_HYPJQ/39-513-----------------------------------------------------------.LVGWTAYDLFRVGE..R...
J4WLM4_BEAB2/43-513-----------------------------------------------------------.VVSWDAYELFKIGE......
K1WYN9_MARBU/44-531-----------------------------------------------------------.VVGWDAYKLFQVGE..KGMK
C4Y8F5_CLAL4/25-422-----------------------------------------------------------EVIGWKVYLEFRRRE..H...
G2WT23_VERDV/45-514-----------------------------------------------------------.VTEHREMERPSPNADPA...
S8APA2_DACHA/42-517-----------------------------------------------------------.VVSWDTYELFRTGE..V...
A5DN67_PICGU/34-434-----------------------------------------------------------EIIGWDVYLEFKRKE..E...
U4LF75_PYROM/40-532-----------------------------------------------------------.VVTWDVYELFR.........
G4N725_MAGO7/47-516-----------------------------------------------------------.VVGWDAYELFKVGE..H...
H6BQM6_EXODN/41-520-----------------------------------------------------------.VVSWEVYEGFRVGE..K...
A5DVE6_LODEL/33-436-----------------------------------------------------------EIIGMDVYKEFKRKE..E...
G8JPL3_ERECY/187-622-----------------------------------------------------------.IVPWESFSSFKRLE..Q...
J7SAQ4_KAZNA/50-456-----------------------------------------------------------EIVGWNAYSQFKFRE..I...
J3K4J2_COCIM/39-514-----------------------------------------------------------.IVTWEAYELFKVGE..Q...
D5GIW3_TUBMM/41-522-----------------------------------------------------------.VVTWDLYELFRQGE..I...
I2GXB5_TETBL/101-506-----------------------------------------------------------GILHYKQYLKFKKDE..L...
K2SLP5_MACPH/42-514-----------------------------------------------------------.VVTWDAYELFRVGE..Q...
K9GDF4_PEND2/42-525-----------------------------------------------------------.VVTWEAYETFKMGE..H...
G8BUH3_TETPH/39-448-----------------------------------------------------------EIIGWNSYLEFKARE..K...
S3CDY7_OPHP1/45-516-----------------------------------------------------------.IVGWDAYELFKIGE..Q...
A3LX57_PICST/33-438-----------------------------------------------------------EIIGWDVYLEYRRRE..R...
B5RTF9_DEBHA/33-436-----------------------------------------------------------EIIGWDVYLEYKRKE..K...
N1PN78_MYCP1/46-518-----------------------------------------------------------.VVSWPVYEGFRLGE..K...
E9EC05_METAQ/43-511-----------------------------------------------------------.VVGWDAYELFKIGE..G...
I2H455_TETBL/74-485-----------------------------------------------------------QIIGWKSYYKFKYKE..K...
B8MSL6_TALSN/42-515-----------------------------------------------------------.VVTWEAYELFKVGE..Q...
C5E2R2_LACTC/41-444-----------------------------------------------------------QVITWKAYEAFRVRE..Q...
M2N7H3_BAUCO/46-522-----------------------------------------------------------.VVTWPVYEGFQIGE..K...
Q75ED0_ASHGO/36-425-----------------------------------------------------------QVIGWETYWRFRAEE..R...

PF00616

RASL1_MOUSE/321-510...................................................................RISFKG-------
Q75DK0_ASHGO/576-771......................................................................EPD-------
RGAA_DICDI/239-445..........................................................STLDRN.VSHEKALE-------
A5DN39_PICGU/903-1097...........................................................SDRPSVLPAPSAIK-------
GAPD1_MOUSE/152-353...............................................................LFGEKGSDRF-------
A5DR10_PICGU/619-844..........................................................YDDSDDYDSDEEKET-------
Q6BPM2_DEBHA/608-836........................................................LESDDSDDYDSDIEKEN-------
Q0V6E4_PHANO/854-1062...........................................................SRRDPNVSRDVALK-------
Q6CFR5_YARLI/832-1039...........................................................SARDPNLPVDEAIQ-------
IQGA2_MOUSE/938-1150...........................................................SKLPYDVTTEQALT-------
A5E5Z0_LODEL/955-1161...........................................................STKKPTSDPQEAIR-------
IQG1_CANAL/977-1177...........................................................SEKSRDISPQAAIQ-------
A3LY27_PICST/921-1130...........................................................SERPRGISPQHAIK-------
Q6CR01_KLULA/879-1073.................................................................QLAHEAIE-------
Q54F48_DICDI/1131-1337........................................................................A-------
Q6BG44_PARTE/169-435.................................EENKDINVYENVRRTNIPEYILNAIMEQISPAIQSYCQTP-------
RASL2_HUMAN/323-512....................................................................SGLHR-------
A2CE77_DANRE/319-508....................................................................AGLHR-------
Q66JF5_XENTR/327-516....................................................................ISFKG-------
A3LZE1_PICST/612-848........................................................DSEFTSDSEDEVVDEEE-------
BUD2_CANAL/642-872...............................................SDDDDDDDDNSSDDDADYNAEKERER-------
A5E274_LODEL/753-994................................................SSDDDDDDDGDGNGNGYDSELEREK-------
Q6FNM9_CANGA/542-738........................................................................D-------
BUD2_YEAST/541-721........................................................................D-------
Q6CW67_KLULA/546-743........................................................................E-------
Q4P4C4_USTMA/677-887.............................................................APFDFSTSIRSP-------
NFAA_DICDI/68-259....................................................................KIEFE-------
Q4DY44_TRYCC/96-330................................................................FEGLNYFES-------
A2R7H8_ASPNC/194-402..........................................................PESLQRSVTAEDAAA-------
Q54I64_DICDI/185-392...........................................................SPLKRKVSPEECAD-------
A7S5U4_NEMVE/139-338...............................................................SSLTLERAMD-------
GAP1_SCHPO/175-379............................................................EDDNLLTNEEVSE-------
GAPA_DICDI/274-481...........................................................STLNRGLAEDQIIQ-------
A7F2A6_SCLS1/1177-1385...........................................................SQRALEIPRDQAIK-------
A2QP50_ASPNC/1125-1333...........................................................SRRRLDILREEAIR-------
A6R4D6_AJECN/1034-1242...........................................................SRRRIDVPREEAIR-------
Q4P2J5_USTMA/1116-1323...........................................................SRRPLEVAFNEALA-------
Q5KM85_CRYNJ/1428-1635...........................................................SALPRDRNADQILQ-------
A7SXE3_NEMVE/113-325...........................................................SKLPYDVDPEQALS-------
RNG2_SCHPO/875-1077.............................................................DSPKLTLSLAMQ-------
Q552W4_DICDI/717-964..............................................................DGKKSEKKTLD-------
A0DYI4_PARTE/179-497...IKQYDQSKKSNIKNSRRNQNQLAEFSLKVLQFGEEQRQAKFLTMERRSVAPIQESQSESPIRKLSKVYSH-------
B4GY66_DROPE/162-365...............................................................RFGQAGEGEH-------
D8Q477_SCHCM/172-379..........................................................PPNLPRGVPPEVAQE-------
E7QA29_YEASB/881-1068.................................................................PQHCSPVD-------
F1RMJ4_PIG/208-420...........................................................SKLPYDVTPEQALA-------
F2Z2E2_HUMAN/966-1177...........................................................SHLPYDVTPEQALS-------
H3DDA1_TETNG/1025-1236...........................................................SKLPYEVTPEQAMS-------
Q23D35_TETTS/322-667ESKSARFQARQTIFSKPANLQISTTNVKESSNLTVSKADSIQMPLSARNYSSNQGKDAIQDFSGVIKRGPESG-------
Q4TE24_TETNG/96-307...........................................................SSLPYEVSPAEALR-------
Q7S5G6_NEUCR/194-402..........................................................EAMLPKGITQEEAAE-------
V5IQZ3_NEUCR/1171-1379...........................................................SQRPLDVPREVAIK-------

PF00620

RHG05_MOUSE/1274-1425---------------------------------------------------..AAKI.............PDKTER....
SYDE_DROME/968-1123---------------------------------------------------..ALAVC..........LPDDPEGN....
LRG1_YEAST/755-912---------------------------------------------------..AAKI.............DLEDEK....
P85B_MOUSE/125-265---------------------------------------------------...................RALREV....
I5P2_MOUSE/830-972---------------------------------------------------..C...................SGN....
RHG07_HUMAN/1092-1238---------------------------------------------------..IYQY.............VPKDQR....
RHG28_HUMAN/399-552---------------------------------------------------..MERG.............PHVKVQ....
ARAP2_HUMAN/1129-1281---------------------------------------------------..ALDT.............QDDKER....
MYO9A_HUMAN/2076-2225---------------------------------------------------..AMGL.............QERKET....
Q20442_CAEEL/896-1053---------------------------------------------------..ICSV.............VPDVER....
RHG18_HUMAN/343-492---------------------------------------------------..VQNL.............PTKKQQ....
ARAP1_HUMAN/971-1120---------------------------------------------------..ASEI.............EDEEEK....
PAC1_CAEEL/963-1123---------------------------------------------------..ANRI.............STHHNR....
Q9V4C2_DROME/875-1034---------------------------------------------------..TQRI.............RNRRLQ....
HMHA1_HUMAN/775-947---------------------------------------------------..AKDS.............LKAEAEAKAA
GMIP_HUMAN/565-728---------------------------------------------------..LAKT.............LHADPGDDPG
RHG32_HUMAN/386-538---------------------------------------------------..AVSA.............ATDEER....
RG190_DROME/1364-1529---------------------------------------------------..IAGSRGVGNSKLNVEVKTDRSCR....
RG92B_DROME/265-418---------------------------------------------------..IAER.............HSEAER....
RGAPX_ARATH/155-296---------------------------------------------------....................DARSS....
BCR_HUMAN/1068-1221---------------------------------------------------..GIAL.............SDPVAK....
RHG21_HUMAN/1161-1314---------------------------------------------------..ANRK.............EDPLDR....
RHG24_MOUSE/151-304---------------------------------------------------.ATLLS.............KEEEAG....
RHG17_RAT/266-415---------------------------------------------------..VASV.............QDQDKK....
RHG20_HUMAN/377-527---------------------------------------------------..VMDQ.............GNDEEK....
RBP1_RAT/210-356---------------------------------------------------..ACGR.............TTEVEK....
CHIN_MOUSE/282-436---------------------------------------------------..SAKI.............MDPDEQ....
RHG09_HUMAN/556-726---------------------------------------------------..AALA.............LSESEQ....
SRGP2_HUMAN/505-657---------------------------------------------------..CVTM.............DNLQER....
Q9VDE9_DROME/1154-1302---------------------------------------------------..T................EDPDKA....
RRC1_CAEEL/294-443---------------------------------------------------..AFEK............EDSLSEK....
RHG35_RAT/1262-1413---------------------------------------------------..AHKI.............NDREQK....
RHG39_HUMAN/909-1055---------------------------------------------------..HYDS.......................
Q9W4A9_DROME/319-473---------------------------------------------------..AGRT.............GKQAEQ....
RGA3_SCHPO/794-942---------------------------------------------------..AEKI.............EKEEEK....
RGA4_SCHPO/761-910---------------------------------------------------..AANC.............ASFQDK....
MYO9B_RAT/1673-1822---------------------------------------------------..AVEL.............PEKQEQ....
RGA1_YEAST/805-985---------------------------------------------------..LVKS.............KKMMENLPFV
RGA2_YEAST/802-985---------------------------------------------------..LVRN.............NQLIERLPLN
TG325_CAEEL/624-775---------------------------------------------------..AMQM.............PNATTR....
Q9VWL9_DROME/292-441---------------------------------------------------...................LNDDAA....
CDGAP_DROME/438-593---------------------------------------------------.IQVKA.............DEADER....
RGA7_SCHPO/520-671---------------------------------------------------..AGNV.............EDESRR....
RGD1_YEAST/486-644---------------------------------------------------.QI................EDPTTR....
BEM2_YEAST/1981-2141---------------------------------------------------.IKYKAH...........AMVNEEY....
ARAP3_HUMAN/920-1071---------------------------------------------------..AAEL.............PQKNQR....
Q9XUS9_CAEEL/437-588---------------------------------------------------.NLYST.............DPDNGR....
RHG01_HUMAN/260-408---------------------------------------------------..GFLN.............IDESQR....
RHG08_MOUSE/210-360---------------------------------------------------..GITS.............VESSLR....
RG68F_DROME/292-439---------------------------------------------------..GFLD.............WPKEER....
Q23130_CAEEL/263-421---------------------------------------------------..ALSE.............VSKTEK....
FA13B_MOUSE/39-190---------------------------------------------------..SQDY.............NNEDEF....
Q19370_CAEEL/541-693---------------------------------------------------..CAKS.............ESPTEF....
O01443_CAEEL/529-695---------------------------------------------------..GAAK.............LNVDER....
RHG06_HUMAN/411-572---------------------------------------------------..NTLL.............LEPEEQ....
Q8T0G4_DROME/380-537---------------------------------------------------..QCHT.............LPSIDQ....
RGA1_SCHPO/862-1019---------------------------------------------------..SSKL.............ESEEER....
TAGAP_HUMAN/101-250---------------------------------------------------..ALEM.............QDEEDR....
Q9XW53_CAEEL/264-412---------------------------------------------------..IADE.............PNTEKK....
BEM3_YEAST/927-1096---------------------------------------------------.VDENH.............NNPVQI....
RGA2_SCHPO/1083-1234---------------------------------------------------..LPNV.............PNDSAA....
RGAP7_ARATH/176-325---------------------------------------------------..AYRI.............ESKEAR....
YIL2_SCHPO/178-325---------------------------------------------------.M.................DSGIDY....
RGA6_SCHPO/332-510---------------------------------------------------.YVDSSR...........VKVPIDI....
RGA5_SCHPO/68-226---------------------------------------------------.MTIPN.............LTDNER....
BAG7_YEAST/76-235---------------------------------------------------.LENPKI...........NEHKEQI....
OCRL_HUMAN/735-875---------------------------------------------------...................DSAYDP....
Q8STW6_ENCCU/162-313---------------------------------------------------.IS................NDRYTR....
Q8SRX9_ENCCU/91-256---------------------------------------------------.KV................ENEEDQ....
Q9VUR5_DROME/55-207---------------------------------------------------.DL................QNEAEQ....
A1Z9I5_DROME/395-538---------------------------------------------------..AVQN.............PDTKTA....
B4IM29_DROSE/1223-1375---------------------------------------------------FSAFSN.............NNESTR....
B4R2Z0_DROSI/903-1054---------------------------------------------------..EADK.............KFGLER....
B9EHI3_MOUSE/380-524---------------------------------------------------..VLDQ.............EFHDQK....
C5DZH4_ZYGRC/1013-1185---------------------------------------------------..LVRE.............HRLLNTLPLK
E9PYS6_MOUSE/532-680---------------------------------------------------..SAEL.............EVVGER....
F6YU97_CALJA/140-288---------------------------------------------------..NAIK.............QEPRQR....
F6Z0J4_XENTR/128-275---------------------------------------------------..ARES.............ISSDEY....
F7C997_MACMU/242-408---------------------------------------------------...AMA.............RDPPNRAP..
H0YIK5_HUMAN/99-243---------------------------------------------------..AAEI.............TDEDNS....
M2TU31_COCH5/545-687---------------------------------------------------..AARI.............DDDTMR....
Q0KHR5_DROME/1068-1216---------------------------------------------------..VTEL.............AVASEK....
Q54DW4_DICDI/28-177---------------------------------------------------..VIKN.............PDHLQR....
Q8IJX0_PLAF7/215-361---------------------------------------------------..YLKS.............TSASDKV...
Q9VFK2_DROME/579-728---------------------------------------------------..IFQH.............LPAEVR....

PF08101

Q6C001_YARLI/166-664................DGEMDHDAFLTLI...............PRCIST.EAHASILYDFMDLLAAIATHGKKNGMGGR
R7YJ86_CONA1/46-524................DSNMARHAFNAFI...............PISVDS.DARKEIIFDFFDLLAAVAARGKTNGLGGR
Q0CXG4_ASPTN/43-519................DSQFAPDAFSTFI...............PISVDS.DARSQIIFDFFDLLTAIAAHGKSNGLGGR
Q6FSL9_CANGA/51-451................EKDYPRKSFLEIM...............PQCLAS.PNHASIVYDFFDLIVTISSNSKKNKMSAR
A7TPE0_VANPO/51-441................KKNYPTRAFLEIV...............PESLTS.YAHNSVVYDFFELILTFTS...KTGLHTT
B2AXU5_PODAN/42-515................DSNLARDSFKTFI...............PLSFENRKAQAQIVFHFFDLLSAVAAHGKTNGFGGR
Q75EK6_ASHGO/155-597................RDGYPTSAFFMLL...............KQVLPS.HDYMCTTYAFLEILVTIVG...RTDLLVE
G8B672_CANPC/35-437................EQHFPKNAFLTIM...............PKCLSS.PAHASIVYDFLDLILNITSNAPYNNLSGR
H2AY21_KAZAF/42-448................EKNFPQKAFLEIM...............PQCLDS.PHHASIVYDFFDLIVTIASNAKVNKLSAR
G0SCJ0_CHATD/41-514................DSNMARDSFKTFI...............PLSVDN.ELRSKIIFDFFDLLSAIAAHSKNNGHGGR
M7P709_PNEMU/52-510................EAKYPYNAFSDYI...............PTIVKS.KIREKIILGFFDILSAIAAYSKINGLCGD
C7YI83_NECH7/41-509................DSNLARDSFKTFI...............PISVEN.GARQRIIFDFFDLMAAIAAHGKSNGLGGR
C5DWH8_ZYGRC/26-427................IKNYPKKAFLELM...............PQCLDS.PSHASIVYDFFDLIVTISANSRVNKMSAR
Q59KB4_CANAL/48-454................EKGYPKNAFLSIM...............PKCLSS.PAHASIVYDFLDLILSITSNSQFNYLSGR
L8FN12_PSED2/45-518................DSEMARDSFTAFI...............PVGADS.DARSKIIFDFFDLLAAVAAHGKKNGLGGR
G4U9K6_NEUT9/44-513................DSNMARDSFKTFI...............PLSVDN.RARTEIIFQFFDLLSAVAAHGKMNGFGGR
MSB1_YEAST/68-472................DKKFPRKSFLEIM...............PQCLAS.PNHASIVYDFFDLIISISSNSRVNKMSAR
G8JR31_ERECY/75-468................VKGYPAGAFLEIL...............PQFLAS.PEQASVVYDFFDLLVSVAANSKSNKMSAR
A7TL24_VANPO/24-431................YANYPQKAFLEIM...............PKCLSS.SNHASIVYDFLDLIVTIASNSKINKLSAR
G0VGB1_NAUCC/47-451................DLKFPQKAFLELM...............PQCLAS.PNHASIVYDFFDLIVTLASNSRVNKMSAR
F9X960_MYCGM/45-521................EADLARNAFNTFI...............PMGVDS.EARRSIIFDFFDLLASVAAHGKLNGLGGR
G8ZXX4_TORDC/64-466................SKDYPRRAFLEIM...............PQCLES.PSHASIVYDYFDLIITLASNSRINKMSAR
W1QG29_OGAPD/54-458................EAGFPKRAFLEFM...............PSCLSS.GAHASIVYDFFDLIVALILNSKHNMLSAK
S7ZE60_PENO1/43-511................DSDFARDAFATFI...............PISVDS.DARTKIILDFFDLLAAIAAHGKSNGLGGR
Q6CUF4_KLULA/46-446................EQNYSQKSFLEIM...............PKCLDS.PNHASIVYDFFDLIVTMASNSKKNKMSAR
A7ELT0_SCLS1/45-517................DSNYARDAFVTFI...............PLSVES.DARRDIIFDFFDLLSAIAAHGKLNGLAGR
C4R4X2_PICPG/64-468................EQNYPQRAFLDII...............PQCLLS.PSHASIVYDFFDLIVAIAADTKQNKMSAR
C0NAR4_AJECG/43-520................DSQFARDAFSTFI...............PLSVES.DSRTKIIFDFFDLMSAVAAHGKTNGFGGR
T5A940_OPHSC/43-511................DSNKARDSFKTFI...............PISVEN.GAKQRIIFDFFDLIAAIAAHGKSNGFGGR
V5G8I7_BYSSN/42-517................DSHFARDAFSTFI...............PISVES.DARTKIIFDFFDLLAAIAAHGKSNGLGGR
Q2HFE8_CHAGB/41-504.................ANIGDRSFRAWLSGAGADSRAALLGGTPTSFS..RSESMIIFDFFDLLAAIAAHSKSNGFGGR
E3RRN2_PYRTT/39-508................DSKFARHAFDTFI...............PISVES.EARKRIIFDFFDLLSAVAARGKSNGMGGR
K0KQP5_WICCF/58-453................RSNYPKKAFLEFM...............PQCLTS.PAHASIVYDFLDLLVSLSANAKENQLSGR
M3D790_SPHMS/42-520................ESHMARNAFDTFV...............PIGADS.EARRSIIVDFYDLLAAVAAHGKVNGLGGR
G8ZN62_TORDC/123-556................ENDFPLESFHFRL...............SKFLPD.KDYTFCTFAFLEFLLCILL..QKNKLLVD
G8Y702_PICSO/33-436................EAGYPKNAFLSIM...............PKCLSS.SAHASIVYDFLDLLVSVSSNSQYNYLNGR
F2PPA7_TRIEC/40-517................DAQFARDAFSTFI...............PLSVDS.DARTKIIFAFFDLMAAIAAHGKSNGLGGR
G3AEL0_SPAPN/40-432................EKGYPKNAFLAIM...............PKCLSS.PAHASIVYDFLDLIVNITSNSHDNFLSGR
U1FZ21_ENDPU/42-520................DSALARDAFATFI...............PMSVDC.EARRQIVFDFFDLMAALAAHGKSNGLGGR
S3CDZ9_GLAL2/45-517................DSNMARESFATFI...............PISVES.DARTRIIFDYFDLLSAIAAHAKTNGFGGR
H1VJ74_COLHI/44-515................DSNMARDSFKTFI...............PLSVEN.GARSCIIFDFFDLLSAIAAHGKMNGLGGR
G0RMT4_HYPJQ/39-513................DSNMARDSFKTFI...............PLSVDN.AARQQIIFDFFSLIAAVAAHGKNNGFGGR
J4WLM4_BEAB2/43-513...................LGKDSFKTFI...............PISVES.DSRQNIIFSFFELVAAIAAHGKKNGLSGV
K1WYN9_MARBU/44-531EHSTWQEGDTNKGKTPDSSLARDSFATFI...............PLSVDS.EARSKIIFDFFDLLSAIAAHAKTNGLGGR
C4Y8F5_CLAL4/25-422................EAGYPKDAFLTIM...............PKCLSS.SAHASIVYDFLDLLISIASNSQYNHLSGR
G2WT23_VERDV/45-514................DSNMARDSFKTFI...............PLSVDN.GARSCIIFDFFDLISAIAAHGKMNGLGGR
S8APA2_DACHA/42-517................DSEMSRNAFTSFI...............PISVDS.PARSAIIFDFFDLLSAIAANGKHNGLTGL
A5DN67_PICGU/34-434................EQGFPRTAFLTIM...............PKCLSS.PSHASIVYDFLDLLVSIASNSQYNYLSGR
U4LF75_PYROM/40-532................HSSMARDSFATFI...............PISAES.EARSKIIFDYFDLLSAIAAHGKHNGLGGL
G4N725_MAGO7/47-516................DSDMARDSFRTFI...............PLSVEN.EARTSIIFDFFDLLAAVAAHGKMNGFGGR
H6BQM6_EXODN/41-520................DSGFARDAFSTFV...............PLGVDS.PARLQIIQDFFDLLAAVAAHGKANGLGGH
A5DVE6_LODEL/33-436................KQGYPKNAFLTIM...............PKCLSS.PAHASIVYDFLDLLLSVIANSQYNYLSGR
G8JPL3_ERECY/187-622................KYYFPVTAFYNFI...............PQVLPS.RDFTCIAYSFLEILVTIIG...KTDLVVE
J7SAQ4_KAZNA/50-456................DREFPQKAFLEIM...............PQCLDS.PNHASIVYDFLDLIVTISSNSKVNKMSAR
J3K4J2_COCIM/39-514................DSQLARDAFSTFI...............PISVDS.DARTKIIFDFFDLLAAIAAHGKKNGLGGR
D5GIW3_TUBMM/41-522................GSGMARDSFATFI...............PISAES.EARSKIIFDFFDLISAIAAHGKHNGLGGM
I2GXB5_TETBL/101-506................SNELPNDSFFNIL...............PKYLDG.KDQASIVYDFFDLIKIITSNGFITNINSI
K2SLP5_MACPH/42-514................DSGMAKHAFDTFI...............PISVDS.EARKQIIIDFFDLLAAISARGKTNGLGGR
K9GDF4_PEND2/42-525................DSDMARDAFSTFI...............PIGGDS.DARTRIILDFFDLLAAIAAHGKSNGLGGR
G8BUH3_TETPH/39-448................YLGYPQKAFLEIM...............PKCLTS.SNHASIVYDFLDLIVTISSNSIVNKLSAR
S3CDY7_OPHP1/45-516................DSNGARDSFTTFI...............PLSVDN.DARSTIVFSFFDLLSAIAAHGKVNGFGGR
A3LX57_PICST/33-438................EAGYPKNAFLSIM...............PKCLSS.PAHASIVYDFLDLLISITSNSQYNYLSGR
B5RTF9_DEBHA/33-436................EAGYPKGAFLSIM...............PKCLSS.PAHASIVYDFLDLLISIASNSQYNYLSGR
N1PN78_MYCP1/46-518................EAKLARNAFDTFI...............PIGVDS.EARRSIIFDFYDLLSAIAAHGKSNGLTGR
E9EC05_METAQ/43-511................DSRMARDSFKTFI...............PLSVES.GARQRIIFDFFELTAAIAAHGKTNGFGGR
I2H455_TETBL/74-485................SLNYPQKSFLEIM...............PKCLSS.ANHASIVYDFFDLIVTLASNSQKNKMSAR
B8MSL6_TALSN/42-515................DSDLARDAFNTFI...............PISVDS.DARTKIIFDFFDLLTAIAAHGKSNGLGGR
C5E2R2_LACTC/41-444................SDGYRSRSFLELM...............PKCLSS.PDHASIVYDFFDLIVTASSNSKHNKMSAR
M2N7H3_BAUCO/46-522................ESKMARNAFDTFI...............PIGAGS.EARKNIIFDFFDLLAAVAAHGKTNGLGGR
Q75ED0_ASHGO/36-425................KLGYPSDAFMQVL...............PGCLSS.SSHASIVYDFFDLLVAVAANVSENRMSGR

PF00616

RASL1_MOUSE/321-510-----------------------------------------------------TPT.EEQVRE........TSLGLL...
Q75DK0_ASHGO/576-771-----------------------------------------------------EIK.KRVILE........TNQAKL...
RGAA_DICDI/239-445-----------------------------------------------------VPE.VTKTIK........ARVDQL...
A5DN39_PICGU/903-1097-----------------------------------------------------EPD.VSSQFV........ENLMSL...
GAPD1_MOUSE/152-353-----------------------------------------------------RQK.VQEMVD........SNEAKL...
A5DR10_PICGU/619-844-----------------------------------------------------DDA.VRKQVD........SNFQNL...
Q6BPM2_DEBHA/608-836-----------------------------------------------------EEL.IKERVN........TNFGNL...
Q0V6E4_PHANO/854-1062-----------------------------------------------------DPE.TRGTFI........HNLQDL...
Q6CFR5_YARLI/832-1039-----------------------------------------------------DPE.TRQTFI........ANLQRL...
IQGA2_MOUSE/938-1150-----------------------------------------------------YPE.VKNKLE........ASIENL...
A5E5Z0_LODEL/955-1161-----------------------------------------------------CPE.VSTQFV........RNLTSL...
IQG1_CANAL/977-1177-----------------------------------------------------LPE.VSNKFV........GNLMSL...
A3LY27_PICST/921-1130-----------------------------------------------------EED.VSAKFV........NNLMNL...
Q6CR01_KLULA/879-1073-----------------------------------------------------DSS.TSKRFI........KNMTSLWGA
Q54F48_DICDI/1131-1337-----------------------------------------------------SIG.IVDDDDDDSGLPVIDQQILL...
Q6BG44_PARTE/169-435-----------------------------------------------------LQRIMDPQLLEETAKILYDRHKVT...
RASL2_HUMAN/323-512-----------------------------------------------------PQT.EAEVLE........QSAQTL...
A2CE77_DANRE/319-508-----------------------------------------------------QQT.ESDVIQ........QSSSLL...
Q66JF5_XENTR/327-516-----------------------------------------------------SMS.EHHILE........SSLETL...
A3LZE1_PICST/612-848-----------------------------------------------------REKNVNKMLE........DNFENL...
BUD2_CANAL/642-872-----------------------------------------------------NER.IKQMVE........ENFQNL...
A5E274_LODEL/753-994-----------------------------------------------------DER.IKKMVE........DNYQNL...
Q6FNM9_CANGA/542-738-----------------------------------------------------DIE.RRQIIQ........HNSEDL...
BUD2_YEAST/541-721-----------------------------------------------------EVK.KRKIIA........DNYKRL...
Q6CW67_KLULA/546-743-----------------------------------------------------LTE.KEKIIE........TNFQKL...
Q4P4C4_USTMA/677-887-----------------------------------------------------PSF.PDNIIETIP..DGPITINAL...
NFAA_DICDI/68-259-----------------------------------------------------KKV.AEVELR........DNQKSL...
Q4DY44_TRYCC/96-330-----------------------------------------------------MTA.VPSEDDGGISHNEDTYTQAI...
A2R7H8_ASPNC/194-402-----------------------------------------------------NAQ.VQAIIE........PRLKML...
Q54I64_DICDI/185-392-----------------------------------------------------NQN.VKDIIK........PRIDKL...
A7S5U4_NEMVE/139-338-----------------------------------------------------DPE.VMFRTK........LRIKKL...
GAP1_SCHPO/175-379-----------------------------------------------------FPA.VKNAIQ........ERSAQL...
GAPA_DICDI/274-481-----------------------------------------------------LKE.VQSILE........PRVEKC...
A7F2A6_SCLS1/1177-1385-----------------------------------------------------DPE.TRDMFI........DHLRDL...
A2QP50_ASPNC/1125-1333-----------------------------------------------------DPE.TRATFI........QHLQDL...
A6R4D6_AJECN/1034-1242-----------------------------------------------------DPE.TRETFI........RHLQDL...
Q4P2J5_USTMA/1116-1323-----------------------------------------------------DPM.ARTIFI........RHLQSL...
Q5KM85_CRYNJ/1428-1635-----------------------------------------------------EHAITRALFI........RNLQEL...
A7SXE3_NEMVE/113-325-----------------------------------------------------HPE.VREKIA........MSMRNL...
RNG2_SCHPO/875-1077-----------------------------------------------------HPP.TRNLYV........SRLREL...
Q552W4_DICDI/717-964-----------------------------------------------------QTF.EQLMANNDVVSIFNSRCLQL...
A0DYI4_PARTE/179-497-----------------------------------------------------SNK.SDQYMNNEINSVLIACIDKF...
B4GY66_DROPE/162-365-----------------------------------------------------GEE.YQR..NVAR..FHAETLGKL...
D8Q477_SCHCM/172-379-----------------------------------------------------NPD.VQAIIA........PRLTML...
E7QA29_YEASB/881-1068-----------------------------------------------------DAS.TKNKFI........DNLRCL...
F1RMJ4_PIG/208-420-----------------------------------------------------HEE.VRTRLD........NSIRNM...
F2Z2E2_HUMAN/966-1177-----------------------------------------------------HPE.VQRRLD........IALRNL...
H3DDA1_TETNG/1025-1236-----------------------------------------------------HEE.VRSRLE........ASSLAL...
Q23D35_TETTS/322-667-----------------------------------------------------LDK.ESQMMQDNVNRLLKKNIDIL...
Q4TE24_TETNG/96-307-----------------------------------------------------HPE.VRRRVE........VAAVNL...
Q7S5G6_NEUCR/194-402-----------------------------------------------------NPK.VQEIIN........PRLTML...
V5IQZ3_NEUCR/1171-1379-----------------------------------------------------DPE.TRELFI........DHLRDL...

PF00620

RHG05_MOUSE/1274-1425................----------------------------------------------------------------
SYDE_DROME/968-1123................----------------------------------------------------------------
LRG1_YEAST/755-912................----------------------------------------------------------------
P85B_MOUSE/125-265................----------------------------------------------------------------
I5P2_MOUSE/830-972................----------------------------------------------------------------
RHG07_HUMAN/1092-1238................----------------------------------------------------------------
RHG28_HUMAN/399-552................----------------------------------------------------------------
ARAP2_HUMAN/1129-1281................----------------------------------------------------------------
MYO9A_HUMAN/2076-2225................----------------------------------------------------------------
Q20442_CAEEL/896-1053................----------------------------------------------------------------
RHG18_HUMAN/343-492................----------------------------------------------------------------
ARAP1_HUMAN/971-1120................----------------------------------------------------------------
PAC1_CAEEL/963-1123................----------------------------------------------------------------
Q9V4C2_DROME/875-1034................----------------------------------------------------------------
HMHA1_HUMAN/775-947SRGRQDGSESEAVAVA----------------------------------------------------------------
GMIP_HUMAN/565-728TP.........SPSPE----------------------------------------------------------------
RHG32_HUMAN/386-538................----------------------------------------------------------------
RG190_DROME/1364-1529................----------------------------------------------------------------
RG92B_DROME/265-418................----------------------------------------------------------------
RGAPX_ARATH/155-296................----------------------------------------------------------------
BCR_HUMAN/1068-1221................----------------------------------------------------------------
RHG21_HUMAN/1161-1314................----------------------------------------------------------------
RHG24_MOUSE/151-304................----------------------------------------------------------------
RHG17_RAT/266-415................----------------------------------------------------------------
RHG20_HUMAN/377-527................----------------------------------------------------------------
RBP1_RAT/210-356................----------------------------------------------------------------
CHIN_MOUSE/282-436................----------------------------------------------------------------
RHG09_HUMAN/556-726................----------------------------------------------------------------
SRGP2_HUMAN/505-657................----------------------------------------------------------------
Q9VDE9_DROME/1154-1302................----------------------------------------------------------------
RRC1_CAEEL/294-443................----------------------------------------------------------------
RHG35_RAT/1262-1413................----------------------------------------------------------------
RHG39_HUMAN/909-1055................----------------------------------------------------------------
Q9W4A9_DROME/319-473................----------------------------------------------------------------
RGA3_SCHPO/794-942................----------------------------------------------------------------
RGA4_SCHPO/761-910................----------------------------------------------------------------
MYO9B_RAT/1673-1822................----------------------------------------------------------------
RGA1_YEAST/805-985GGKLSLEAKNSDTYMS----------------------------------------------------------------
RGA2_YEAST/802-985NDKFLDSPQKVTIYEM----------------------------------------------------------------
TG325_CAEEL/624-775................----------------------------------------------------------------
Q9VWL9_DROME/292-441................----------------------------------------------------------------
CDGAP_DROME/438-593................----------------------------------------------------------------
RGA7_SCHPO/520-671................----------------------------------------------------------------
RGD1_YEAST/486-644................----------------------------------------------------------------
BEM2_YEAST/1981-2141................----------------------------------------------------------------
ARAP3_HUMAN/920-1071................----------------------------------------------------------------
Q9XUS9_CAEEL/437-588................----------------------------------------------------------------
RHG01_HUMAN/260-408................----------------------------------------------------------------
RHG08_MOUSE/210-360................----------------------------------------------------------------
RG68F_DROME/292-439................----------------------------------------------------------------
Q23130_CAEEL/263-421................----------------------------------------------------------------
FA13B_MOUSE/39-190................----------------------------------------------------------------
Q19370_CAEEL/541-693................----------------------------------------------------------------
O01443_CAEEL/529-695................----------------------------------------------------------------
RHG06_HUMAN/411-572................----------------------------------------------------------------
Q8T0G4_DROME/380-537................----------------------------------------------------------------
RGA1_SCHPO/862-1019................----------------------------------------------------------------
TAGAP_HUMAN/101-250................----------------------------------------------------------------
Q9XW53_CAEEL/264-412................----------------------------------------------------------------
BEM3_YEAST/927-1096................----------------------------------------------------------------
RGA2_SCHPO/1083-1234................----------------------------------------------------------------
RGAP7_ARATH/176-325................----------------------------------------------------------------
YIL2_SCHPO/178-325................----------------------------------------------------------------
RGA6_SCHPO/332-510................----------------------------------------------------------------
RGA5_SCHPO/68-226................----------------------------------------------------------------
BAG7_YEAST/76-235................----------------------------------------------------------------
OCRL_HUMAN/735-875................----------------------------------------------------------------
Q8STW6_ENCCU/162-313................----------------------------------------------------------------
Q8SRX9_ENCCU/91-256................----------------------------------------------------------------
Q9VUR5_DROME/55-207................----------------------------------------------------------------
A1Z9I5_DROME/395-538................----------------------------------------------------------------
B4IM29_DROSE/1223-1375................----------------------------------------------------------------
B4R2Z0_DROSI/903-1054................----------------------------------------------------------------
B9EHI3_MOUSE/380-524................----------------------------------------------------------------
C5DZH4_ZYGRC/1013-1185SGGNT...DKNPLYLN----------------------------------------------------------------
E9PYS6_MOUSE/532-680................----------------------------------------------------------------
F6YU97_CALJA/140-288................----------------------------------------------------------------
F6Z0J4_XENTR/128-275................----------------------------------------------------------------
F7C997_MACMU/242-408...............P----------------------------------------------------------------
H0YIK5_HUMAN/99-243................----------------------------------------------------------------
M2TU31_COCH5/545-687................----------------------------------------------------------------
Q0KHR5_DROME/1068-1216................----------------------------------------------------------------
Q54DW4_DICDI/28-177................----------------------------------------------------------------
Q8IJX0_PLAF7/215-361................----------------------------------------------------------------
Q9VFK2_DROME/579-728................----------------------------------------------------------------

PF08101

Q6C001_YARLI/166-664KLARL.....AGSWAF...............DV..NTGADG........................PVSFQDGLDAWSRAA
R7YJ86_CONA1/46-524KLSRM.....AGWWAF...............EH..SDG...........................GKGFDGGYRSWASAA
Q0CXG4_ASPTN/43-519KLSRY.....AGWWAF...............EH..TDT...........................GNGFEAAYKNWSTAA
Q6FSL9_CANGA/51-451KISKM.....CAIWAF...............N.......DNKSS.STDYDFDSSSPQT..V....NNSIQNGFDQWIPGS
A7TPE0_VANPO/51-441QIAYI.....FSLWAF...............EY..PSQYKDGFQKQIL.................TNSISSGFESWIPGA
B2AXU5_PODAN/42-515KLSRM.....AAWWAF...............EQTEADR...........................ANGFEGAYKAWLKAA
Q75EK6_ASHGO/155-597KTTQMDLIFTAGQVCFPSCKAVEEYKDANDEG.................................NDDELILNKIYRNRG
G8B672_CANPC/35-437KISKM.....AGIWAF...............NP..EKPLSTSIFSDDSIE.T.............EHDFVEGINNWKKTT
H2AY21_KAZAF/42-448KISKM.....CAIWAF...............DK..PVHVNKGN....DLDFDSKTPIN..PEKKSNNSLQDGLDQWIPGS
G0SCJ0_CHATD/41-514KLSRM.....AAWWAF...............EH..RDT...........................GNGFEGGYKAWLTAA
M7P709_PNEMU/52-510KLSRT.....AGWWAF...............NF..KNK...........................DQGFHRGYSNWKRSA
C7YI83_NECH7/41-509KLSRM.....AAWWAF...............EH..KDT...........................TKGFEGGYEAWLRAA
C5DWH8_ZYGRC/26-427KISKM.....FAIWAF...............G....KAVPNPSL.A.DYDFDDKRTL...P....NNSFQDGLDQWIPAT
Q59KB4_CANAL/48-454KISKM.....ASFWAF...............SC..RQQFLQSPFYDATQEEA.............EHNFIEGIDTWKKST
L8FN12_PSED2/45-518KLSRL.....AGWWAF...............DH..GNK...........................GEGFDGGYKGWSAAA
G4U9K6_NEUT9/44-513KLSRM.....AAWWAF...............EH..DDG...........................GQGFEGGYKSWLKAA
MSB1_YEAST/68-472KISKM.....CAIWAF...............S.....KQIPNSD.IQDYDFESAAMKSFAP....NNSIQDGLDQWIPAS
G8JR31_ERECY/75-468KVSRM.....CAIWAF...............GK..EEEREATG.................SQVCQNNSFREGLDMWIPGS
A7TL24_VANPO/24-431KISKM.....SAIWAF...............NN..KEFPRNLS..DENINLPEFN..........DNSIQDGFQQWIPAS
G0VGB1_NAUCC/47-451KISKM.....CAIWAF...............NG..PPATASTTD.SQIPDFGSTKNR...P....NNSLQDGLDEWIPGS
F9X960_MYCGM/45-521KLSRL.....AGWWAF...............EH..SDD...........................GKGFEGGYKCWQSAA
G8ZXX4_TORDC/64-466KISKM.....CAIWAF...............G....VAIEQGGK.SLDYDFTNTSTL...P....SNSFQDGLDEWIPGT
W1QG29_OGAPD/54-458KVARL.....CGLWAF...............HP..VKNKQNE.......................TPSFERGMYEWIPAG
S7ZE60_PENO1/43-511KLSRY.....AGWWAF...............EH..TDT...........................GKGFEASYRNWAAAA
Q6CUF4_KLULA/46-446KISKM.....CAVWAF...............Q................MDQDTATNMIFDARRADTNDYKQGLSQWIPAA
A7ELT0_SCLS1/45-517KLSRY.....AGWWAF...............DH..VDT...........................GNGFEGGYKGWSTAA
C4R4X2_PICPG/64-468KISKM.....CGIWAF...............GP..IKVSPKG.......................DTSYHRGIANWLPAS
C0NAR4_AJECG/43-520KLSRY.....AGWWAF...............EH..VDT...........................GNGFESSYKNWASAA
T5A940_OPHSC/43-511KISRM.....VAWWAF...............EQ..RET...........................GSGFDGGYQAWLGAA
V5G8I7_BYSSN/42-517KLSRY.....AGWWAF...............EH..TDA...........................GNGFDAAYKNWAAAA
Q2HFE8_CHAGB/41-504KLSRM.....AAWWAF...............EP..NDN...........................GNGFEGG......AA
E3RRN2_PYRTT/39-508KLSRL.....AGWWAF...............EF..VED...........................GKGFDGGYKTWEKAA
K0KQP5_WICCF/58-453KISKM.....AGLWAF...................HGPPNSANLTKSRLDPT.............ENSFREGLRDWLPAA
M3D790_SPHMS/42-520KLSRM.....AGWWAF...............DH..SDD...........................GIGFEGGYKSWEKAA
G8ZN62_TORDC/123-556KSVQLDLIFTAGATCFVREPFEDL.........................................NDDTPAVIKSYHTRG
G8Y702_PICSO/33-436KITKM.....ASLWAF...............NY..RVKPGASPFFDATLN.E.............ENTFVDGMESWKHCA
F2PPA7_TRIEC/40-517KLSRY.....AGWWAF...............EH..ADT...........................GKGFEASYKTWNSAA
G3AEL0_SPAPN/40-432KISKM.....ASFWAF...............NPMHSKKPQ.........................EFDFIEGIEMWTKST
U1FZ21_ENDPU/42-520KLSRY.....AGWWAF...............EH..YDT...........................GKGFNAGYRGWASAA
S3CDZ9_GLAL2/45-517KLSRL.....AGWWAF...............EH..IDD...........................GNGFEGGYKNWTKSA
H1VJ74_COLHI/44-515KLSRM.....AAWWAF...............EH..KDT...........................GSGFEGGYKSWATAA
G0RMT4_HYPJQ/39-513KLSRM.....ASWWAF...............DH..NDT...........................GNGFDGGYGAWLRAA
J4WLM4_BEAB2/43-513KLSRM.....AAWWAF...............EQ..RDT...........................GDGFDGGYKAWKKAA
K1WYN9_MARBU/44-531KLSRM.....AGLWCF...............EI..HDE...........................GNGFEGGYKRWIAAA
C4Y8F5_CLAL4/25-422KVAKM.....ASLWAF...............NV..APH.SDSAFYDATAI.R.............ENTFLDGLDAWKLHC
G2WT23_VERDV/45-514KLSRM.....AAWWAF...............EQ..KDT...........................GSGFEGGYKSWSSAA
S8APA2_DACHA/42-517KISRM.....AGWWAF...............EH..SDN...........................GFGFEGGYGSYSKAA
A5DN67_PICGU/34-434KIAKM.....SSLWAF...............NP..ARERMKSAFYDATID.R.............DHSFIDGLDRWKQSS
U4LF75_PYROM/40-532KLSRL.....AGWWAF...............EH..VDT...........................GYGFEGGYATWTSAA
G4N725_MAGO7/47-516KLSRM.....ASWWAF...............EH..KDT...........................SNGFEGGYKLWLRAA
H6BQM6_EXODN/41-520KLSRY.....AGWWAF...............EH..YDT...........................GKGFESGYESWANAA
A5DVE6_LODEL/33-436KVSRM.....ASFWAF...............NS..NLNVRNKLVFADFDNEQ.............EHDFPEGLDNWKVTT
G8JPL3_ERECY/187-622KTTQMDLVFTAGQVCFTKSNAIDEYMDSDSGE.................................SFDVLTLNKIYYARG
J7SAQ4_KAZNA/50-456KISKL.....CAVWAF...............NK..PTPPEEEGQ.PSSWDFDNSP.....KYKKINNSFQDGLDQWIPAS
J3K4J2_COCIM/39-514KLSRY.....AGWWAF...............EH..TDA...........................GKGFEASYKTWTNAA
D5GIW3_TUBMM/41-522KLSRL.....AGWWAF...............EH..SDM...........................GWGFEGGYTSWSRAA
I2GXB5_TETBL/101-506DTCKI.....YGIWCFGGLNDCIFYSGEDTAEH..TSKSVNSS......................NSPLEIGIEGYFKIA
K2SLP5_MACPH/42-514KLSRM.....AGWWAF...............EH..PDN...........................GKGFDDGYKTWTSAA
K9GDF4_PEND2/42-525KLSRY.....AGWWAF...............EH..VDT...........................GKGFEAAYKNWAVAA
G8BUH3_TETPH/39-448KIAKM.....SAIWGF...............NN..KHFPENIEQVNEDFKFPVYN..........DNSIQDGIKQWLPAA
S3CDY7_OPHP1/45-516KLSRM.....ASWWAF...............ET..TDT...........................GSGFEGGYKEWLKAA
A3LX57_PICST/33-438KVTKM.....ASIWAF...............NP..TSKLSKSAFYDATIN.Q.............EFNFIQGVEAWKSSG
B5RTF9_DEBHA/33-436KIAKM.....SSLWAF...............NG..STKPHQSPFYDATLS.K.............ENTFIDGLEYWKPSS
N1PN78_MYCP1/46-518KVSRL.....AGWWAF...............EH..TDN...........................GQGFEGGYKSWSAAA
E9EC05_METAQ/43-511QLPRM.....AAWWAF...............EQ..KDT...........................GSGFDGGYKAWQKAA
I2H455_TETBL/74-485KISKM.....CAIWAF...............SN..EEKDDNDTI.A.APDFDSNNPYSHLP....SNSIQEGIEKWLPAS
B8MSL6_TALSN/42-515KLSRY.....AGWWAF...............EH..TDM...........................GNGFEASYKNWAQAA
C5E2R2_LACTC/41-444KISKM.....FGIWAF...............RS..KVE.......NSPYDFGEPT.....PEIEKKNSFSEGIEQWIPAS
M2N7H3_BAUCO/46-522KLSRL.....AGWWAF...............EH..SDD...........................GKGFEGGYKSWTTAA
Q75ED0_ASHGO/36-425KVAKM.....SAIWAF...............GD..YRHPDGGG......................NNSFQEGLAQWRRGA

PF00616

RASL1_MOUSE/321-510TGYL----------------------------------------------------------------------------
Q75DK0_ASHGO/576-771ISWA----------------------------------------------------------------------------
RGAA_DICDI/239-445ISIC----------------------------------------------------------------------------
A5DN39_PICGU/903-1097RECV----------------------------------------------------------------------------
GAPD1_MOUSE/152-353VALV----------------------------------------------------------------------------
A5DR10_PICGU/619-844LGYC----------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836YHYA----------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062RDVA----------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039RELT----------------------------------------------------------------------------
IQGA2_MOUSE/938-1150RKVT----------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161REHC----------------------------------------------------------------------------
IQG1_CANAL/977-1177RETC----------------------------------------------------------------------------
A3LY27_PICST/921-1130REVA----------------------------------------------------------------------------
Q6CR01_KLULA/879-1073VELV----------------------------------------------------------------------------
Q54F48_DICDI/1131-1337QQFS----------------------------------------------------------------------------
Q6BG44_PARTE/169-435EMII----------------------------------------------------------------------------
RASL2_HUMAN/323-512RAHL----------------------------------------------------------------------------
A2CE77_DANRE/319-508QSYL----------------------------------------------------------------------------
Q66JF5_XENTR/327-516RGYL----------------------------------------------------------------------------
A3LZE1_PICST/612-848YDYV----------------------------------------------------------------------------
BUD2_CANAL/642-872YGYV----------------------------------------------------------------------------
A5E274_LODEL/753-994YGYA----------------------------------------------------------------------------
Q6FNM9_CANGA/542-738KQWV----------------------------------------------------------------------------
BUD2_YEAST/541-721YSWV----------------------------------------------------------------------------
Q6CW67_KLULA/546-743LSLA----------------------------------------------------------------------------
Q4P4C4_USTMA/677-887RKLS----------------------------------------------------------------------------
NFAA_DICDI/68-259HNIA----------------------------------------------------------------------------
Q4DY44_TRYCC/96-330VEMA----------------------------------------------------------------------------
A2R7H8_ASPNC/194-402TDYA----------------------------------------------------------------------------
Q54I64_DICDI/185-392IEIG----------------------------------------------------------------------------
A7S5U4_NEMVE/139-338QDIS----------------------------------------------------------------------------
GAP1_SCHPO/175-379LLLT----------------------------------------------------------------------------
GAPA_DICDI/274-481IQIC----------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385REIS----------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333RDIA----------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242RDIA----------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323RATT----------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635RNLT----------------------------------------------------------------------------
A7SXE3_NEMVE/113-325IQAT----------------------------------------------------------------------------
RNG2_SCHPO/875-1077RKLC----------------------------------------------------------------------------
Q552W4_DICDI/717-964VELG----------------------------------------------------------------------------
A0DYI4_PARTE/179-497KQLV----------------------------------------------------------------------------
B4GY66_DROPE/162-365HTHA----------------------------------------------------------------------------
D8Q477_SCHCM/172-379MEIA----------------------------------------------------------------------------
E7QA29_YEASB/881-1068WHAI----------------------------------------------------------------------------
F1RMJ4_PIG/208-420RAVT----------------------------------------------------------------------------
F2Z2E2_HUMAN/966-1177LAMT----------------------------------------------------------------------------
H3DDA1_TETNG/1025-1236RAAT----------------------------------------------------------------------------
Q23D35_TETTS/322-667KNLT----------------------------------------------------------------------------
Q4TE24_TETNG/96-307RSLT----------------------------------------------------------------------------
Q7S5G6_NEUCR/194-402TEIA----------------------------------------------------------------------------
V5IQZ3_NEUCR/1171-1379REIC----------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425----------------------------.FHALKEIVK..K-------F-HP----------------------------
SYDE_DROME/968-1123----------------------------.AKLMLSILD..C-------L-PR----------------------------
LRG1_YEAST/755-912----------------------------.QRVILLIYS..L-------L-PT----------------------------
P85B_MOUSE/125-265----------------------------.AGPVGLVLEPPT-------L-PL----------------------------
I5P2_MOUSE/830-972----------------------------.YAASKQIIL..T-------L-PS----------------------------
RHG07_HUMAN/1092-1238----------------------------.LQAIKAAIM..L-------L-PD----------------------------
RHG28_HUMAN/399-552----------------------------.FQALHLMVM..A-------L-PD----------------------------
ARAP2_HUMAN/1129-1281----------------------------.IKKYGAFIR..S-------L-PG----------------------------
MYO9A_HUMAN/2076-2225----------------------------.IRGVYSVID..Q-------L-SR----------------------------
Q20442_CAEEL/896-1053----------------------------.ITALQYAIL..L-------L-PD----------------------------
RHG18_HUMAN/343-492----------------------------.LQALNLLVI..L-------L-PD----------------------------
ARAP1_HUMAN/971-1120----------------------------.VSRYRELLV..R-------L-PP----------------------------
PAC1_CAEEL/963-1123----------------------------.LHKLRNLLR..K-------L-PR----------------------------
Q9V4C2_DROME/875-1034----------------------------.LEAISHLIR..L-------L-PI----------------------------
HMHA1_HUMAN/775-947----------------------------LAGRLRELLR..D-------L-PP----------------------------
GMIP_HUMAN/565-728----------------------------VIRSLKTLLV..Q-------L-PD----------------------------
RHG32_HUMAN/386-538----------------------------.LIKIHDVIQ..Q-------L-PP----------------------------
RG190_DROME/1364-1529----------------------------.LIALKSLLQ..K-------L-PP----------------------------
RG92B_DROME/265-418----------------------------.KTEIKAILT..K-------L-PK----------------------------
RGAPX_ARATH/155-296----------------------------.IHRMRQSLQ..K-------L-SN----------------------------
BCR_HUMAN/1068-1221----------------------------.ESCMLNLLL..S-------L-PE----------------------------
RHG21_HUMAN/1161-1314----------------------------.LKTLKRLIH..D-------L-PE----------------------------
RHG24_MOUSE/151-304----------------------------.VKELMKQVK..S-------L-PV----------------------------
RHG17_RAT/266-415----------------------------.LQYLWTTCQ..K-------L-PP----------------------------
RHG20_HUMAN/377-527----------------------------.INTVQRLLD..Q-------L-PR----------------------------
RBP1_RAT/210-356----------------------------.VQEFQRLLR..E-------L-PE----------------------------
CHIN_MOUSE/282-436----------------------------.LETLHEALR..S-------L-PP----------------------------
RHG09_HUMAN/556-726----------------------------CLSQIQELIG..S-------M-PK----------------------------
SRGP2_HUMAN/505-657----------------------------.ALHIRKVLL..V-------L-PK----------------------------
Q9VDE9_DROME/1154-1302----------------------------.....KEIVN..K-------L-PE----------------------------
RRC1_CAEEL/294-443----------------------------.VESLRFSLE..T-------M-PE----------------------------
RHG35_RAT/1262-1413----------------------------.LHALKEVLK..K-------F-PK----------------------------
RHG39_HUMAN/909-1055----------------------------.PEAAVAVVH..A-------L-PR----------------------------
Q9W4A9_DROME/319-473----------------------------.RQLMAEAVR..R-------L-PP----------------------------
RGA3_SCHPO/794-942----------------------------.IERVVEVMK..T-------L-HP----------------------------
RGA4_SCHPO/761-910----------------------------.LDGFIMVIK..S-------L-PP----------------------------
MYO9B_RAT/1673-1822----------------------------.LAAIYAVLD..H-------L-PE----------------------------
RGA1_YEAST/805-985----------------------------SKSALKNILE..D-------L-PR----------------------------
RGA2_YEAST/802-985----------------------------VLKSLLEIFK..I-------L-PV----------------------------
TG325_CAEEL/624-775----------------------------.FKKFEELLS..R-------L-PN----------------------------
Q9VWL9_DROME/292-441----------------------------.IERMSLAFD..D-------M-PE----------------------------
CDGAP_DROME/438-593----------------------------.LRLMKETVL..K-------L-PP----------------------------
RGA7_SCHPO/520-671----------------------------.RDAVHRAIN..D-------L-PD----------------------------
RGD1_YEAST/486-644----------------------------.KNFMHGLIY..N-------L-PD----------------------------
BEM2_YEAST/1981-2141----------------------------.KRMMNELLQ..K-------L-PT----------------------------
ARAP3_HUMAN/920-1071----------------------------.LEKYKDVIG..C-------L-PR----------------------------
Q9XUS9_CAEEL/437-588----------------------------..LALNRVIC..E-------L-PQ----------------------------
RHG01_HUMAN/260-408----------------------------.VPATLQVLQ..T-------L-PE----------------------------
RHG08_MOUSE/210-360----------------------------.VTHCRLILR..S-------L-PE----------------------------
RG68F_DROME/292-439----------------------------.SRNVTQLIR.EK-------L-PE----------------------------
Q23130_CAEEL/263-421----------------------------.SAAVKEFVK..L-------L-PR----------------------------
FA13B_MOUSE/39-190----------------------------.GRKLRFLLQ..Q-------L-PP----------------------------
Q19370_CAEEL/541-693----------------------------.VRRARELVS..K-------L-PV----------------------------
O01443_CAEEL/529-695----------------------------.IEAIRLLFA..L-------L-VS----------------------------
RHG06_HUMAN/411-572----------------------------.LGTLQLLIY..L-------L-PP----------------------------
Q8T0G4_DROME/380-537----------------------------.MNALSILCH..L-------L-PP----------------------------
RGA1_SCHPO/862-1019----------------------------.MRVLHLTIC..L-------L-PK----------------------------
TAGAP_HUMAN/101-250----------------------------.IEALKQVAD..K-------L-PR----------------------------
Q9XW53_CAEEL/264-412----------------------------.VSCCRALLS..H-------L-PT----------------------------
BEM3_YEAST/927-1096----------------------------.SLGFKELIESGL-------V-PH----------------------------
RGA2_SCHPO/1083-1234----------------------------.LGELCDVIS..K-------L-PP----------------------------
RGAP7_ARATH/176-325----------------------------.ISSLRSAIA.ET-------F-PE----------------------------
YIL2_SCHPO/178-325----------------------------.AVSLQKLID.AS-------M-DK----------------------------
RGA6_SCHPO/332-510----------------------------.RNEMAALCFSQI-------D-SY----------------------------
RGA5_SCHPO/68-226----------------------------.VEMYRRRID..E-------L-PI----------------------------
BAG7_YEAST/76-235----------------------------.IKDYEDIYM..L-------L-PQ----------------------------
OCRL_HUMAN/735-875----------------------------..RICRQVIS..Q-------L-PR----------------------------
Q8STW6_ENCCU/162-313----------------------------.EALFSYMPF..I-------F-TD----------------------------
Q8SRX9_ENCCU/91-256----------------------------.VILCQMLFI..S-------M-PK----------------------------
Q9VUR5_DROME/55-207----------------------------.TERLHRLFG..S-------L-PK----------------------------
A1Z9I5_DROME/395-538----------------------------.QDMLVKSVK..Q-------L-PQ----------------------------
B4IM29_DROSE/1223-1375----------------------------.INELLKVFE..E-------L-PQ----------------------------
B4R2Z0_DROSI/903-1054----------------------------.IVLLREIVE..S-------L-PR----------------------------
B9EHI3_MOUSE/380-524----------------------------.ISAIQSLLI..Q-------M-PL----------------------------
C5DZH4_ZYGRC/1013-1185----------------------------ALESVTKILK..N-------L-PR----------------------------
E9PYS6_MOUSE/532-680----------------------------.VEPVSHLLF..K-------L-PR----------------------------
F6YU97_CALJA/140-288----------------------------.VTAVKDLIR..Q-------L-PK----------------------------
F6Z0J4_XENTR/128-275----------------------------.VQLLRKTIRCAN-------V-PQ----------------------------
F7C997_MACMU/242-408----------------------------TTEGTRGLLS..C-------L-PD----------------------------
H0YIK5_HUMAN/99-243----------------------------.IAAMYQAVG..E-------L-PQ----------------------------
M2TU31_COCH5/545-687----------------------------.RDSMHALIN..A-------L-PD----------------------------
Q0KHR5_DROME/1068-1216----------------------------.IPIYRELLA..R-------L-SA----------------------------
Q54DW4_DICDI/28-177----------------------------.ALHLRMLCY..G-------L-PK----------------------------
Q8IJX0_PLAF7/215-361----------------------------IKLNLSKLYE..K-------L-SQ----------------------------
Q9VFK2_DROME/579-728----------------------------.LDAVQCAVL..L-------L-PD----------------------------

PF08101

Q6C001_YARLI/166-664EATNHLFFSFLRTMLPTKESRIEA.NR.IPRSLEALLVSSV-------Y-PPLPLHKSR........LVPVPLVTLTVGK
R7YJ86_CONA1/46-524DATSHLFFAYLRSLSPDSVTGVSGIST.LPRSLQALLSQTE-------Y-PPE...TPMLMQTST......TKVVMIVDQ
Q0CXG4_ASPTN/43-519DATSHLFFAYLRSLSPET.RGMGGIST.LPIALQTLVQATE-------Y-PPE...TPTLLQVST......TKVVMIVDT
Q6FSL9_CANGA/51-451DAMFHLLLAFLRSFVPKDVEN....AK.LPRTLKNLLFTNE-------Y-PPQ...DSTAFNSET..ILTIPLVTLHTDE
A7TPE0_VANPO/51-441DATLHMLLSFLKIYVSQNLQK....SK.ISGTEIQFLLNSE-------Y-PPLEIKETIKKSHRT.....IPLVTLKALN
B2AXU5_PODAN/42-515DATSHLFFAYLRSLAPE..PVVGGISL.LPMSLQKLLQETE-------Y-PPQ...RPHLLQTST......YRVAMIVDT
Q75EK6_ASHGO/155-597SALYHLFVAYLRSLADK........GKIKDFYLLDNFDVHE-------Y-PP....GPYRPMTQRALTLTVPRF.IPESD
G8B672_CANPC/35-437DAMFHLVLAFLRAMLPENNAET...LK.LPKTLQSLLVTSQ-------Y-PPSSEKESS.....K..SITIPCVCVTTTK
H2AY21_KAZAF/42-448DAMFHLLLAFLKSFITNDLET....SK.LPRSLKSVLFNND-------Y-PPE...GSTAYSSET..ILTIPLVTLYTDD
G0SCJ0_CHATD/41-514DATSHLFFAYLRSLSPE..PVPGAISL.LPMSLQKLLQETE-------Y-PPQ...RPALLQTST......YRVAMIVEN
M7P709_PNEMU/52-510DANEHLFFAYLRSIKEQHTNTELYVPNPLPLSLVKLLEQTP-------Y-PLSVASPITLHHKDT......LCIDVFSNI
C7YI83_NECH7/41-509DATSHMFFAFLRSLSPE..QNVTGITM.LPMSLQKLLQETE-------Y-PPQ...RPALMSSTT......NKVVMIVDT
C5DWH8_ZYGRC/26-427DAMFHLLLAFLKSFVPEDLET....AQ.LPRTLKSLLFNNE-------Y-PPE...KSNAYSSET..ILTIPLVTLETDH
Q59KB4_CANAL/48-454NALFHLVLAFLRSMLPETNSET...LK.IPKTLQSLLVTTQ-------Y-PPSSDNESDQSMLRG..AITIPCVCVSTTQ
L8FN12_PSED2/45-518DATSHLFFAYLRSMSPESVKGVNGIST.LPISLQKLVHETE-------Y-PPM...TPTLMLYST......PKVAMIVES
G4U9K6_NEUT9/44-513DATSHLFFAYLRCLAPL..PTLGAIST.LPLSLQKLLQETE-------Y-PPQ...RPALLQSST......HKVAMIVET
MSB1_YEAST/68-472DAMFHLLLAFLRSFVPQDLES....AK.LPRTLKSLLFNNQ-------Y-PPR...KSTAYTSET..ILTIPLVTLKTDV
G8JR31_ERECY/75-468DAMFHLFLSFMRSFVHGDLGS....AD.IPKSLKSVLFTNE-------Y-PPA...KYYASVHDS..VLTVPVVTLKTDR
A7TL24_VANPO/24-431DAMFHLLLAFLKSFLPDDANETDTYNK.LPRNLKSLLINNE-------Y-PPVL..KSTAYTSET..ILTIPLVTLFTNQ
G0VGB1_NAUCC/47-451DAMFHLLLAFLKSFVPEDLES....SK.LPKSLKSLLFNNE-------Y-PPA...ESTAYSSET..ILTIPLVTLKTDK
F9X960_MYCGM/45-521DACSHLFFAYLRSLSPDTNPSMNVIER.IPRSLQALVASTE-------Y-PPE...TPSMLQRST......ARVVMVVDN
G8ZXX4_TORDC/64-466DAMFHLLLAFLKSFVPQELES....AK.LPLSLKSLLFNND-------Y-PPK...GSTAYSSET..VLTIPLVTLQTDK
W1QG29_OGAPD/54-458DATFHLLLSFLNSMPPKGQIE.....K.LPKSLQHILKNTP-------Y-PPP...ATTTSSSSSRFLQEVPMVTIKVNN
S7ZE60_PENO1/43-511DATSHLFFAYLRSLSPDTTRGVTGISS.LPLSLQTLVEATE-------Y-PPE...TPTLLQVTT......TKVVMIVDT
Q6CUF4_KLULA/46-446EAMFHLLLAFIRSFVPTDSTK....VK.LPKSLRNILFDNA-------Y-PPK...NSDTFTSET..ILTVPIVTLMTTK
A7ELT0_SCLS1/45-517DAASHLFFAYLRSLSPESVRGMSGISK.LPMSLQKLVQETE-------Y-PPE...HPSLLQQST......MKVVMIVNS
C4R4X2_PICPG/64-468DAIFHLLLSFVRSMLPESPNDE...YK.LPRTLQNLVLSNS-------Y-PPA...ETVLTSRSN..LVDVPLITLKVNN
C0NAR4_AJECG/43-520DATSHLFFAYLRSLSPDSLRGSNGISA.LPISLQSLVQATE-------Y-PPE...TPALLQMES......TKVVMIVEN
T5A940_OPHSC/43-511DATSHLFFAYLRSLSPE..QSLTGISM.LPRSLEKLLKETD-------Y-PPP...TSRQMMSST......NKLAMVVDA
V5G8I7_BYSSN/42-517DASSHLFFAYLRSLSPEPGRAIKGIST.LPIALQSLVQATE-------Y-PPE...APVLLQITT......TKVVMIVDT
Q2HFE8_CHAGB/41-504DATSHLFFAYMRSLAPE..PVQGGISL.LPMSLQKLLQETE-------Y-PPQ...RPALMQTST......NRVAMIVDT
E3RRN2_PYRTT/39-508DAASHLFFAYLRSLAPDA.NTVGGISA.LPRSLQSLLSQTE-------Y-PPQ...TPTLMQTRT......TKVVMIVNS
K0KQP5_WICCF/58-453DALFHLFLSFLRSMLPDDQNTK...LQ.LPRTLQALLASNS-------Y-PP....PDLTFQSST..LVSVPLVTIRSNT
M3D790_SPHMS/42-520DASSHLFFAYLRSLSPDTDPSLTVIER.IPRSLQALLASTE-------Y-PPE...KPSLLQRST......PRVVMLVDS
G8ZN62_TORDC/123-556NALYRLFVGYLRSLNHE........GKVKDFYLSDIFHIDQ-------Y-PP....TAYRARSSKALTLTIP....FEFS
G8Y702_PICSO/33-436DAMFHLLISFLRAMLPENDMDT...LK.LPKTLQSLLISTS-------Y-PPV...KNT.DSLKS..VITIPCVVIRSTK
F2PPA7_TRIEC/40-517DATSHLFFAYLRSQSPDSLRGTNGIST.LPLSLQNLVRATE-------Y-PPE...TPSLLQTST......TKVVMLVDV
G3AEL0_SPAPN/40-432NALFHLVLSFLRSMLPETDMET...LK.LPKSLQSLLVTNQ-------Y-PPV...EERGEALKN..MITIPCVHIKSTR
U1FZ21_ENDPU/42-520DAASHLFFAYLRSLYPDPAKGPKGIIG.LPTSLQQLVQATE-------Y-PPE...APTLMFNEA......TKVVMVVNS
S3CDZ9_GLAL2/45-517DQASHLFFAYLRSLSPESVQGLNGISN.LPMSLQKLVQETE-------Y-PPE...RPYLLQSST......SKVVMIVDS
H1VJ74_COLHI/44-515DATSHLFFAYLRSLAPQK.QTQGAISM.LPMSLQKLLQETE-------Y-PPQ...KPSLMQSST......YRVVMIVDA
G0RMT4_HYPJQ/39-513DATSHLFFAYLRSLAPE..QDPTGISM.LPRSLQKLLQETE-------Y-PPQ...RPELLIVKT......KKVAMIVET
J4WLM4_BEAB2/43-513DATTHLFFAYLRSLSPE..QELTGITM.LPRSLQKLLNETE-------Y-PPK...AADMLVSRT......NKLVMIVDS
K1WYN9_MARBU/44-531DAASHLFFAYLRSLTPSTLKGMGGISI.LPMSLQKLVQETE-------Y-PPE...RPALLQTRT......TKVVMIVDA
C4Y8F5_CLAL4/25-422NGLFHLCLSFLRAMLPDTESDT...LN.LPKTLQSLLVTSS-------Y-PPP...DNA.PSTKS..VIVIPCVQVRTTV
G2WT23_VERDV/45-514DATSHLFFAYLRSVAPQ..LSKGGISM.LPMSLQKLLQETE-------Y-PPQ...RPSLMQTST......NKVVMIVDT
S8APA2_DACHA/42-517LATCHMFFAYLRSLAPS...GKGSVSV.LPLSLQQLLYDIE-------Y-PPT...ATSFLKEPT......SRIIMTVDT
A5DN67_PICGU/34-434GALFHLLLSFLRAMLPENDMDT...LK.LPKTLQSLLISNS-------Y-PPL...ANN.DSVKS..MIKIPCVLLKSTK
U4LF75_PYROM/40-532DACCHLFFAYLRSLSPA..DPTRSVSL.LPTSLRALLASVD-------Y-PPV...TPPQFQTRT......VRVVMTVDK
G4N725_MAGO7/47-516DATSHLFFAYLRSVAPQ..QTQAGISM.LPMSLQKLLQETE-------Y-PPE...RPSLMMSTT......YKVVMIVET
H6BQM6_EXODN/41-520DATSHLFFAYLRSLSPDS.GKTSGILG.LPRSLQQLLNSTE-------Y-PPK....HALLSNEV......TKVVMIVDI
A5DVE6_LODEL/33-436MALFHLVLSFLRSMLPENDSET...LK.LPKALQNLLVTTQ-------Y-PP....EEK.ENLRK..VVAVPCICVSTTR
G8JPL3_ERECY/187-622SALYHLFVSYLRSLVDK........GKIKDFYLIDNFNVEQ-------Y-PP....APYTPMTQRALTLTVPKF.LVDDE
J7SAQ4_KAZNA/50-456DAMFHLLLAFLKSFVPEDLES....SK.LPRSLKSILFNNE-------Y-PPK...GSTAYSSQT..ILTIPLVTLTTDQ
J3K4J2_COCIM/39-514DATSHLFFAYLRSLSPDSIRGTNGIAT.LPLSLQTLVQGTE-------Y-PPE...SPSLLQTQT......TKVVMIVDT
D5GIW3_TUBMM/41-522DATMHLFFAYLRSLSPA..DGTRGVSV.LPISLKALVASVD-------Y-PPT...TPVQLQSQT......VRVVMTVET
I2GXB5_TETBL/101-506NALFHLYLSFLRHFTKNGIKKT...SS.INNELKKLLIDYD-------Y-PPI.....DFKINSN..LITIPLVQLHTPV
K2SLP5_MACPH/42-514DATSHLYFAYLRSLSPED.KNLTGINT.LPRSLQALVNQTE-------Y-PPE...PPTLMQTTT......TKVVMIVDT
K9GDF4_PEND2/42-525DATSHLFFAYLRSLSPDVPRGVSGISS.LPISLQSLVEATE-------Y-PPE...IPTLLQVTT......TKVVMIVEN
G8BUH3_TETPH/39-448NAMFHLLLSFLRSFLPSDDNTGKSNSN.LPKNLKNLLLNNH-------Y-PPNI..EKSTYSSST..ILTIPVVTLNTNQ
S3CDY7_OPHP1/45-516DATSHLFFAYLRSLSPQ..PGLGSFAT.LPMSLQKLLQETE-------Y-PPQ...RPSLLQSST......NKVIMIVDA
A3LX57_PICST/33-438NALFHLLLSFLRAMLPENDAET...LK.LPKALQSLLITTA-------Y-PPS...EDTGRTLKS..MITIPCVVVKSTR
B5RTF9_DEBHA/33-436EALFHLLLSFLRAMLPDNESDT...LK.LPKTLQSLLITNS-------Y-PPL...ENT.DSIKS..IITIPCVVIKSTK
N1PN78_MYCP1/46-518DASGHLFFAYLRSLSPDTEPSLNVIER.IPRSLQALVASTE-------Y-PPE...TPTLLQRST......PRVVMLVDT
E9EC05_METAQ/43-511DATTHLFFSYLRSLTPE..EGLTGITL.LPRSLEKLLNETE-------Y-PPI...TPPTLVSKT......NKLVMLVDT
I2H455_TETBL/74-485DAMFHLLLAFLRSFVPKDLES....SK.LPRNLKSLLFNNE-------Y-PPI...NSNAYDSKT..ILTIPLVTLNTST
B8MSL6_TALSN/42-515DATSHLFFAYLRSISPDSVRGINGISA.LPIALQSLVQATE-------Y-PPQ...APSLLQFST......TKVVMIVET
C5E2R2_LACTC/41-444DAMFHLLLAFIRSFISNDLKD....AN.IPTSLKTILFNST-------Y-PPK...GSTAYDSET..ILTVPIVSLKTTE
M2N7H3_BAUCO/46-522DATSHLFFAYLRSLSPEADPSLSVIER.IPRSLQALLASTE-------Y-PPE...TPTLLQRLT......PRVVMLVDS
Q75ED0_ASHGO/36-425NAMFHLFLAFLRAFAVDEQKS....GK.FTRELEAILFQNA-------Y-PPP...EDLQEDPAK..LISVPVLTLKTDR

PF00616

RASL1_MOUSE/321-510-----------------------------GSVVDAIVS.ST.GR....C.PL----------------------------
Q75DK0_ASHGO/576-771-----------------------------KEIWHIIYK.TS.ND....L.PD----------------------------
RGAA_DICDI/239-445-----------------------------EQFLDGIIS.SL.NR....L.PY----------------------------
A5DN39_PICGU/903-1097-----------------------------SEILSTLEA.VV.ES....V.PL----------------------------
GAPD1_MOUSE/152-353-----------------------------NKFIGYLKQ.NT.YC....F.PH----------------------------
A5DR10_PICGU/619-844-----------------------------EEIWDKICK.TS.KD....L.PE----------------------------
Q6BPM2_DEBHA/608-836-----------------------------EEVWNKIYI.TS.ND....L.PQ----------------------------
Q0V6E4_PHANO/854-1062-----------------------------DQYFSMFEE.IL.HR....M.PY----------------------------
Q6CFR5_YARLI/832-1039-----------------------------SEFLHTIES.SV.LQ....L.PY----------------------------
IQGA2_MOUSE/938-1150-----------------------------DKVLGSIIS.SL.DL....L.PY----------------------------
A5E5Z0_LODEL/955-1161-----------------------------HEFFGKVQK.CV.DK....I.PH----------------------------
IQG1_CANAL/977-1177-----------------------------SDLLSMLQKNASGNKALLQI.PD----------------------------
A3LY27_PICST/921-1130-----------------------------TEFLNTLEL.SA.DR....V.PL----------------------------
Q6CR01_KLULA/879-1073-----------------------------CAVLDHIVS.ST.........RN----------------------------
Q54F48_DICDI/1131-1337-----------------------------GEFLRRVCALSS..S....I.PY----------------------------
Q6BG44_PARTE/169-435-----------------------------NSICDNILN.SL.HN....L.PF----------------------------
RASL2_HUMAN/323-512-----------------------------GALLSALSR.SV.RA....C.PA----------------------------
A2CE77_DANRE/319-508-----------------------------SELLTSILQ.SA.SY....C.PL----------------------------
Q66JF5_XENTR/327-516-----------------------------SDIIDAILR.SV.EQ....C.PS----------------------------
A3LZE1_PICST/612-848-----------------------------EEVWHKIYI.TS.ND....L.PA----------------------------
BUD2_CANAL/642-872-----------------------------EEIWYKIYI.TS.ND....L.PD----------------------------
A5E274_LODEL/753-994-----------------------------EEIWHKIYI.TS.ND....I.PE----------------------------
Q6FNM9_CANGA/542-738-----------------------------CTIWNRIIE.TS.ND....L.PK----------------------------
BUD2_YEAST/541-721-----------------------------TKIWKRLYA.TS.ND....L.PI----------------------------
Q6CW67_KLULA/546-743-----------------------------ERTWKLIFE.TS.ND....L.PQ----------------------------
Q4P4C4_USTMA/677-887-----------------------------ESMWQNIYR.QR.HS....C.PP----------------------------
NFAA_DICDI/68-259-----------------------------QQFLDRITDPSVVVE....M.PR----------------------------
Q4DY44_TRYCC/96-330-----------------------------YRISNVVYA.SV.CQ....W.PW----------------------------
A2R7H8_ASPNC/194-402-----------------------------NRFLNIIIE.SV.EE....T.PY----------------------------
Q54I64_DICDI/185-392-----------------------------DQFLDSILS.SV.DA....V.PY----------------------------
A7S5U4_NEMVE/139-338-----------------------------SLFLGIIIS.SL.SQ....V.PY----------------------------
GAP1_SCHPO/175-379-----------------------------KRFLDAVLN.SI.DE....I.PY----------------------------
GAPA_DICDI/274-481-----------------------------ERFFTGIIQ.SL.NR....L.PY----------------------------
A7F2A6_SCLS1/1177-1385-----------------------------DLFMLALES.LL.HR....M.PY----------------------------
A2QP50_ASPNC/1125-1333-----------------------------DQFFSAFEE.LL.YR....M.PF----------------------------
A6R4D6_AJECN/1034-1242-----------------------------DQFFTSLEE.YL.PR....M.PF----------------------------
Q4P2J5_USTMA/1116-1323-----------------------------EAFLSAILS.ST.RK....M.PY----------------------------
Q5KM85_CRYNJ/1428-1635-----------------------------DFLLTDLLQ.SH.DK....L.PY----------------------------
A7SXE3_NEMVE/113-325-----------------------------DKFLNSIVQ.SV.EK....I.PY----------------------------
RNG2_SCHPO/875-1077-----------------------------QSFLVALSK.NI.EN....I.PY----------------------------
Q552W4_DICDI/717-964-----------------------------NAFLERITK.SI.EQ....L.PV----------------------------
A0DYI4_PARTE/179-497-----------------------------NNIMENIFK.NI..Y....LIPQ----------------------------
B4GY66_DROPE/162-365-----------------------------QVFVKSLQQ.SW.AL....F.PS----------------------------
D8Q477_SCHCM/172-379-----------------------------NSFLLTIIE.SM.ES....V.PY----------------------------
E7QA29_YEASB/881-1068-----------------------------EMVAEIYTR.KV.HT....I.PV----------------------------
F1RMJ4_PIG/208-420-----------------------------DKFLAAIIS.SV.DK....I.PY----------------------------
F2Z2E2_HUMAN/966-1177-----------------------------DKFLLAITS.SV.DQ....I.PY----------------------------
H3DDA1_TETNG/1025-1236-----------------------------DKVLNSIVS.SL.DN....L.PY----------------------------
Q23D35_TETTS/322-667-----------------------------NIVFDSIFK.NL.YN....I.PV----------------------------
Q4TE24_TETNG/96-307-----------------------------DRVLNAVTS.SL.GK....L.PY----------------------------
Q7S5G6_NEUCR/194-402-----------------------------NGFLETIID.GL.EE....T.PY----------------------------
V5IQZ3_NEUCR/1171-1379-----------------------------DQFLLALED.LL.PR....M.PY----------------------------

PF00620

RHG05_MOUSE/1274-1425------------------------------------------------VNYDVFRYVITHLNRVS---------------
SYDE_DROME/968-1123------------------------------------------------ANRATLVFLLDHLSLVV---------------
LRG1_YEAST/755-912------------------------------------------------YNRNLLEALLSFLHWTS---------------
P85B_MOUSE/125-265------------------------------------------------HQALTLRFLLQHLGRVA---------------
I5P2_MOUSE/830-972------------------------------------------------FHKNVFNYLMAFLQELL---------------
RHG07_HUMAN/1092-1238------------------------------------------------ENREVLQTLLYFLSDVT---------------
RHG28_HUMAN/399-552------------------------------------------------ANRDAAQALMTFFNKVI---------------
ARAP2_HUMAN/1129-1281------------------------------------------------VNRATLAAIIEHLYRVQ---------------
MYO9A_HUMAN/2076-2225------------------------------------------------THLNTLERLIFHLVRIA---------------
Q20442_CAEEL/896-1053------------------------------------------------ENREALKTLLLFLKEVS---------------
RHG18_HUMAN/343-492------------------------------------------------ANRDTLKALLEFLQRVI---------------
ARAP1_HUMAN/971-1120------------------------------------------------VNRATVKALISHLYCVQ---------------
PAC1_CAEEL/963-1123------------------------------------------------PHYDTLRFLIVHLSEIT---------------
Q9V4C2_DROME/875-1034------------------------------------------------PHRDTLYVLLVFLAKVA---------------
HMHA1_HUMAN/775-947------------------------------------------------ENRASLQYLLRHLRRIV---------------
GMIP_HUMAN/565-728------------------------------------------------SNYNTLRHLVAHLFRVA---------------
RHG32_HUMAN/386-538------------------------------------------------PHYRTLEFLMRHLSLLA---------------
RG190_DROME/1364-1529------------------------------------------------INFAILKYIFQHFVHVS---------------
RG92B_DROME/265-418------------------------------------------------ENYANLRYLTRFLSIVQ---------------
RGAPX_ARATH/155-296------------------------------------------------VNYNTLEFITALLLRVS---------------
BCR_HUMAN/1068-1221------------------------------------------------ANLLTFLFLLDHLKRVA---------------
RHG21_HUMAN/1161-1314------------------------------------------------HHYETLKFLSAHLKTVA---------------
RHG24_MOUSE/151-304------------------------------------------------VNYNLLKYICRFLDEVQ---------------
RHG17_RAT/266-415------------------------------------------------QNFVNFRYLIKFLAKLA---------------
RHG20_HUMAN/377-527------------------------------------------------ANVVLLRYLFGVLHNIE---------------
RBP1_RAT/210-356------------------------------------------------YNHLLLSWLIVHMDHVI---------------
CHIN_MOUSE/282-436------------------------------------------------AHCETLRYLMAHLKRVT---------------
RHG09_HUMAN/556-726------------------------------------------------PNHDTLRYLLEHLCRVI---------------
SRGP2_HUMAN/505-657------------------------------------------------TTLIIMRYLFAFLNHLS---------------
Q9VDE9_DROME/1154-1302------------------------------------------------INQLVLTYLIHFLQQFA---------------
RRC1_CAEEL/294-443------------------------------------------------AHYRTAKFLMEHLTRLC---------------
RHG35_RAT/1262-1413------------------------------------------------ENHEVFKYVISHLNRVS---------------
RHG39_HUMAN/909-1055------------------------------------------------INRMVLCYLIRFLQVFV---------------
Q9W4A9_DROME/319-473------------------------------------------------AHHSCLQYMLEHLKRVA---------------
RGA3_SCHPO/794-942------------------------------------------------AHLSVFRFLIAHLGRVC---------------
RGA4_SCHPO/761-910------------------------------------------------AHAEILQLIIRHLARVA---------------
MYO9B_RAT/1673-1822------------------------------------------------ANHTSLERLIFHLVKVA---------------
RGA1_YEAST/805-985------------------------------------------------EHYRVLRVLSEHIEKVT---------------
RGA2_YEAST/802-985------------------------------------------------EHQEVLKVLAAHIGKVR---------------
TG325_CAEEL/624-775------------------------------------------------ENRETLKMLLRHLNRVA---------------
Q9VWL9_DROME/292-441------------------------------------------------PNRSTLRFLIRHLTRVA---------------
CDGAP_DROME/438-593------------------------------------------------PHYRTLKYLAEHLYKVS---------------
RGA7_SCHPO/520-671------------------------------------------------ANYSTIRHLTIHLAKIK---------------
RGD1_YEAST/486-644------------------------------------------------AQYWTLRALVFHLKRVL---------------
BEM2_YEAST/1981-2141------------------------------------------------CYYQTLKRIVFHLNKVH---------------
ARAP3_HUMAN/920-1071------------------------------------------------VNRRTLATLIGHLYRVQ---------------
Q9XUS9_CAEEL/437-588------------------------------------------------ANRDTLAYLFIHWRKVI---------------
RHG01_HUMAN/260-408------------------------------------------------ENYQVLRFLTAFLVQIS---------------
RHG08_MOUSE/210-360------------------------------------------------HNYAVLRYLMGFLHEVS---------------
RG68F_DROME/292-439------------------------------------------------ENYELFKYIVEFLVRVM---------------
Q23130_CAEEL/263-421------------------------------------------------ENYILLKTVIKFLTRVA---------------
FA13B_MOUSE/39-190------------------------------------------------VNYSLLKFLCRFLANVA---------------
Q19370_CAEEL/541-693------------------------------------------------SHVLLLRFLFAFLSHLC---------------
O01443_CAEEL/529-695------------------------------------------------PILDTLFVLLKFLHEVS---------------
RHG06_HUMAN/411-572------------------------------------------------CNCDTLHRLLQFLSIVA---------------
Q8T0G4_DROME/380-537------------------------------------------------ENRNTLRSLLSFFNIII---------------
RGA1_SCHPO/862-1019------------------------------------------------GHRDTMEVIFGFLYWVA---------------
TAGAP_HUMAN/101-250------------------------------------------------PNLLLLKHLVYVLHLIS---------------
Q9XW53_CAEEL/264-412------------------------------------------------SHSILLANVLKLLNKIS---------------
BEM3_YEAST/927-1096------------------------------------------------ANLSLMYALFELLVRIN---------------
RGA2_SCHPO/1083-1234------------------------------------------------ENFALLDSLLHHLRRII---------------
RGAP7_ARATH/176-325------------------------------------------------PNRRLLQRILKMMHTIS---------------
YIL2_SCHPO/178-325------------------------------------------------NSQKLARLIFSLLYQIT---------------
RGA6_SCHPO/332-510------------------------------------------------VRFSILCSLLALLHQIA---------------
RGA5_SCHPO/68-226------------------------------------------------PNRQLLLYLLDLLSVFA---------------
BAG7_YEAST/76-235------------------------------------------------QNRHLILYLAALLNLFA---------------
OCRL_HUMAN/735-875------------------------------------------------CHRNVFRYLMAFLRELL---------------
Q8STW6_ENCCU/162-313------------------------------------------------AERRLLTSLFELLKMID---------------
Q8SRX9_ENCCU/91-256------------------------------------------------TNRHVLEATIYFLYVIH---------------
Q9VUR5_DROME/55-207------------------------------------------------YTQHLLVLLFGTFRVIA---------------
A1Z9I5_DROME/395-538------------------------------------------------ANRDTLAFLILHFQRIA---------------
B4IM29_DROSE/1223-1375------------------------------------------------ANKASITSILDHLIRVH---------------
B4R2Z0_DROSI/903-1054------------------------------------------------HPYETMKHLIRHLCRVS---------------
B9EHI3_MOUSE/380-524------------------------------------------------PNVLLLRHLLSVLHKIK---------------
C5DZH4_ZYGRC/1013-1185------------------------------------------------EHYDLLRYLSRHISKIT---------------
E9PYS6_MOUSE/532-680------------------------------------------------PVLVVLRYLFTFLNHLA---------------
F6YU97_CALJA/140-288------------------------------------------------PNQDTMQILFRHLRRVI---------------
F6Z0J4_XENTR/128-275------------------------------------------------QYWLTLQYLLKHFLQLC---------------
F7C997_MACMU/242-408------------------------------------------------VERATLTLLLDHLRLVS---------------
H0YIK5_HUMAN/99-243------------------------------------------------ANRDTLAFLMIHLQRVA---------------
M2TU31_COCH5/545-687------------------------------------------------PNYATLRALALHLHRVQ---------------
Q0KHR5_DROME/1068-1216------------------------------------------------IERETLRRIVGHLVFIS---------------
Q54DW4_DICDI/28-177------------------------------------------------VNRDLVLSLMVFLNKIS---------------
Q8IJX0_PLAF7/215-361------------------------------------------------GIKQCVLCLLHFFKTIS---------------
Q9VFK2_DROME/579-728------------------------------------------------ENREILYVLLEFLTIVA---------------

PF08101

Q6C001_YARLI/166-664LSSSPLVLLKRAAK..TVRFDNPAVFATEDDFNTLFFLFK........DPKIVDQKLSPESKRVLHDIVQENPLNNEVYY
R7YJ86_CONA1/46-524VSPTPFALLRRAKN...........FAYRDDDQVLQQFS.........AYDDPIRALSDECRRVL...............
Q0CXG4_ASPTN/43-519VSPTPFALLRRAKN...........FEYRDSDHHLQEFA.........SFEDPLRALTDECVRVL...............
Q6FSL9_CANGA/51-451FSRKPWQLLERCNE..MLDFSDHEAFEAREDYALLKSLFKKKN.....NVEGISRKMSQESRRLM...............
A7TPE0_VANPO/51-441.CKTAISLLRRCAK..LLDFSNNDNFEAYEDYVILKSIFKSSSN....KHFDIRKMLTHESLLTY...............
B2AXU5_PODAN/42-515VSPTPFALLRRANH...........FQYRDDDRALKQWS.........EYEDPIKALTEECVRVL...............
Q75EK6_ASHGO/155-597MRNDFNQLIKFVAKAGSRIYSSQHAFSKLEN.SFLDKFEEN.......PLKVVEGLFSKSSKRYL...............
G8B672_CANPC/35-437PSSTAYDLISKVRQ..SLTFDKRDMF.SKENYTILKNVFEKK......STSEIVDVLTGESRRII...............
H2AY21_KAZAF/42-448FSRKPWQLLERCND..LLDFSNHDAFEAREDYALLKSLFKKKN.....NVEGISRKMSQESRRIM...............
G0SCJ0_CHATD/41-514VSPTPFALLRRAKH...........FQYRDSDQALKDWS.........EYEDPVQALTEECRRVL...............
M7P709_PNEMU/52-510PSPNIFTILQRVAI.........QGLDTDDEISL..ALWK........HRDHIENALTDESKRIL...............
C7YI83_NECH7/41-509VSPTPFALLRRANH...........FQYRDEDRALQEFS.........EYEDPVKALTDECRRVL...............
C5DWH8_ZYGRC/26-427FSRKPWQLLERCNE..LLDFSDYDAFEAREDYALLKSLFKKKN.....NVEGISRKMSQESRRIM...............
Q59KB4_CANAL/48-454PSKDAYELISKVRH..NLKFDKKDDFLSIENYTILKNLFSKK......GTFEIVNSLTDESKRIL...............
L8FN12_PSED2/45-518VSPTPFALLRRANN...........FVYRDEDHALQEFS.........NYDDPVKALSDECRRVL...............
G4U9K6_NEUT9/44-513VSPTPFALLRRANH...........FQYREEDKALREWS.........EYDDPVQALTEECRRVL...............
MSB1_YEAST/68-472FSRKPWQLLERCND..LLDFSDHDAFEAREDYALLKSLFRKKN.....TVEGISRKMSQESRRLM...............
G8JR31_ERECY/75-468FSNKPWELLQRCSD..LFVNSNPGDFAAREDYVMMKSLFKNRD.....SIHAFSKMMSGESRRLM...............
A7TL24_VANPO/24-431FSRKPWELLERCNN..LLDFNDHNSFEAREDYALLKSLFNKKH.....NIEGISRKMSQESRRIM...............
G0VGB1_NAUCC/47-451FSRKPWQLLERCNE..LLDFQDHDAFEAREDYALLKSLFRKKN.....NVEGISRKMSQESRRLM...............
F9X960_MYCGM/45-521VSPTPFALLRRAKN...........FEYRDRDRVLREFA.........EFEDPIDALTEECKRVL...............
G8ZXX4_TORDC/64-466FSRKPWQLLERCNE..LLDFTDHDAFQAREDFALLKSLFKKKN.....NVEGISRKMSQESRRLM...............
W1QG29_OGAPD/54-458PSKNPAELLVRVSK..TLKFNDPTVFYTREDYLLLKRLFK........DVDGLISKLSSEGSRLL...............
S7ZE60_PENO1/43-511VSPTPFALLRRAKN...........FEYRDEHWHLQEFA.........NYEDPVKALTDECLRVL...............
Q6CUF4_KLULA/46-446FTRKPWQLIERCNE..LMDFDEPEKFETREDFALLKSLFKKKK.....NIEGISSKMSKESKRLM...............
A7ELT0_SCLS1/45-517VSPTPFALLRRANH...........FQYRDDDRALQQFS.........EYEDPVRALTDECRRVL...............
C4R4X2_PICPG/64-468PSRSPIEMLHRVGK..TLKFDDTNLFYTREEYILLKSLFK........DYQSLPQKLSSEGKRVM...............
C0NAR4_AJECG/43-520VSPTPFALLRRAKN...........FEYRDSDHALQKFS.........NFEDPVKALTDECRRVL...............
T5A940_OPHSC/43-511VSPTPFALLRRAGH...........FQYRDSDVGLQEFA.........SYDDPVQALTEECLRVL...............
V5G8I7_BYSSN/42-517VSPTPFALLRRAKN...........FEYRDSDQELQEFA.........AYEDPVRALTDECLRVL...............
Q2HFE8_CHAGB/41-504VSPTPFTLLRRANH...........FQYRDEDRALQEWS.........EYEDPIQALTEECRRVL...............
E3RRN2_PYRTT/39-508VSPTPFALLRRAKH...........FEYRDDDKALQQFS.........AYEDTVKALTDECRRVL...............
K0KQP5_WICCF/58-453LSKNPTELLNKLPK..VLSFDNQKRFEAKEDYALLKSLCR........NDSNIMNKLSGESRRII...............
M3D790_SPHMS/42-520VSPTPFALLRRAKN...........FEYRDRDRVLREFA.........EFEDPVDALTDECKRVL...............
G8ZN62_TORDC/123-556NGNDFTSLIYQAATAKQRFYSSKTSFSKVEN.VFLDQLEEE.......TLKVITTLFSESSNRYI...............
G8Y702_PICSO/33-436WSSDTYELLSKIRH..TISFDKKDAFLSMENYTILKNIFKKP......STSDIVSMFTEESKRIF...............
F2PPA7_TRIEC/40-517VSPTPFALLRRAKN...........FEYRASDHALQQFA.........SYEDPQDALTEECKRVL...............
G3AEL0_SPAPN/40-432PSKNAYDLISKVRY..SLSFDKRDSFLSVENYTILKKLFNKK......GTSEIVETLTEESRRIL...............
U1FZ21_ENDPU/42-520VSPTPFALLRRAKN...........FEYRDDDSALQQFS.........NYDDPVQALTEECRRVL...............
S3CDZ9_GLAL2/45-517VSPTPFALLRRANH...........FEYRDDDRALQEFS.........EYEDPVKALTDECRRVL...............
H1VJ74_COLHI/44-515VSPTPFALLRRANH...........FQYREEDRALREFS.........EYEDPVKALTEECRRVL...............
G0RMT4_HYPJQ/39-513VSPTPFALLRRANH...........FQYRDSDSELQEFS.........SYEDPVQALTDECQRVL...............
J4WLM4_BEAB2/43-513VSPTPFALLRRASK...........FEYRDSDIALRKLS.........DFDDATEALSEECRRVL...............
K1WYN9_MARBU/44-531VSPTPFALLRRANH...........FQYRDDDRALQEYA.........EYEDPVKALTEECRRVL...............
C4Y8F5_CLAL4/25-422PCSDPYELISKVRH..TLRFDRKDDFLSIENYTILKSIFQKG......STNEIVDTLTEESRRVL...............
G2WT23_VERDV/45-514VSPTPFALLRRASH...........FHFRDEDRALQEFS.........DFEDPIRALTEECRRVL...............
S8APA2_DACHA/42-517VSPTPFALLRRARN...........FDFSDESRALQEFS.........DYEDPVQALTDESKRIL...............
A5DN67_PICGU/34-434PSENVYELLSKVRR..TIKFDKKDDFMSVENYTILKNIFKKD......STADIVASLSEESRRIM...............
U4LF75_PYROM/40-532VSPSPFSLLRRAKN...........IEYDNGDRALKVFT.........EFEDPVKALTDECRRVL...............
G4N725_MAGO7/47-516VSPTPFALLRRGNH...........FQYRDSDRPLFEFS.........DYEDPVQALTEECRRVL...............
H6BQM6_EXODN/41-520VSPTPYALLRRAKN...........FEYRDDDRALQRFA.........SYEDPVEALTDECRRVL...............
A5DVE6_LODEL/33-436PSLSAYDLISKVRQ..SLPLDKKDEF.SKENYTILKNVFLKK......STSEVVDTFTQESTRVL...............
G8JPL3_ERECY/187-622MRNDFNHLIKLVSKASSRIYSSHHAFSKLEN.SFLDKFEEN.......PLKVIESLFSKSSKRYL...............
J7SAQ4_KAZNA/50-456FSRKPWQLLERCNE..LLNFENYDGFQAREDYVLLKSLFKKRK.....NVEGISRKMSQESRRLM...............
J3K4J2_COCIM/39-514VSPTPFALLRRAKN...........FEYRDSDTVLKSFA.........GFEDPAHALSDECRRVL...............
D5GIW3_TUBMM/41-522VSPTPFSLLRRARN...........FQFRESNLALRALV.........GYDDPIQALTEECKRVL...............
I2GXB5_TETBL/101-506PSDDLWQLLNRCKMNLNLNFDNPDLFKSRENFALLKILFKNLK.....DIKDLNNSFTEDTENNV...............
K2SLP5_MACPH/42-514VSPTPFALLRRAKN...........FEYRDDDRALQRFT.........QYEDPVQALTEECRRVL...............
K9GDF4_PEND2/42-525VSPTPFSLLRRAKN...........FEYRDDDWHLQEFA.........NYEDPVSALTDECLRVL...............
G8BUH3_TETPH/39-448FSRKAWELIERCND..ILDFTNPDDFQVREDYALLKSLFRKKN.....NMEGISRKMSQESRRIM...............
S3CDY7_OPHP1/45-516VSPTPFTLLRRSNH...........FEYRDDDRALREFS.........DYEDPVQALTDECRRVL...............
A3LX57_PICST/33-438PSSNVYELLSKVRH..TLSFDKKDAFLSIENYTILKNIFKKD......STDDIVRGLTEESRRVL...............
B5RTF9_DEBHA/33-436VSSNVYELLSKVRN..TISFSKKDSFLSMENYTILKNIFQKS......STNEIVSSLTEESRRIL...............
N1PN78_MYCP1/46-518VSPTPFALLRRAKN...........FEYRDRDRVLREFA.........EFEDPIDALTEENKRVL...............
E9EC05_METAQ/43-511VSPTPFALLRRAGH...........FQYRDSDPALQQFS.........DYDDPVQALTEECLRVL...............
I2H455_TETBL/74-485FSKKPWHLLERCGD..HLDFKDYDAFQAREDYALLKSLFRKNKSKNGSNIKSISKKMSQESRRLL...............
B8MSL6_TALSN/42-515VSPTPFALLRRARN...........FEYRDSDKHLQEFS.........EYEDPVDALTDECARVL...............
C5E2R2_LACTC/41-444FSKKPWQLIERCNE..LFDFSNYDAFEAREDYALLKSLFKRKK.....NIDGISHKMSKESRRIM...............
M2N7H3_BAUCO/46-522VSPTPFALLRRAKH...........FEYRDNDRVLRAYS.........EFDDPLDALTDECKRVL...............
Q75ED0_ASHGO/36-425FSRKPWELFERCNS..LFQTAGHYG.GPLEDYTLLQSLFMRKN.....QANALSKKMTGETRRLL...............

PF00616

RASL1_MOUSE/321-510------------------------------------------------ALRLAFKQLQRCVEKRF---------------
Q75DK0_ASHGO/576-771------------------------------------------------AIKVQLTHIRKKLEIVC---------------
RGAA_DICDI/239-445------------------------------------------------GIRWICKQIYQIAEKNF---------------
A5DN39_PICGU/903-1097------------------------------------------------HIRIACKYAFDLVKINF---------------
GAPD1_MOUSE/152-353------------------------------------------------SLRWIVSQMYKTLSCVD---------------
A5DR10_PICGU/619-844------------------------------------------------QIKKQLKNFRTKVELAC---------------
Q6BPM2_DEBHA/608-836------------------------------------------------QIKSQLKNFRTKVELSC---------------
Q0V6E4_PHANO/854-1062------------------------------------------------GVRYLAQQMFEELRLQF---------------
Q6CFR5_YARLI/832-1039------------------------------------------------HVRYVARECYRSVQKTF---------------
IQGA2_MOUSE/938-1150------------------------------------------------GLRYIAKVLKNSIREKF---------------
A5E5Z0_LODEL/955-1161------------------------------------------------HIRVLCREAYVLSKSRY---------------
IQG1_CANAL/977-1177------------------------------------------------HVKLICRQGYLCAQRKF---------------
A3LY27_PICST/921-1130------------------------------------------------HVKVICKQAYELSQLQF---------------
Q6CR01_KLULA/879-1073------------------------------------------------DLKYLASRAYRSSANKD---------------
Q54F48_DICDI/1131-1337------------------------------------------------ALRWISKVVIELWRQHV---------------
Q6BG44_PARTE/169-435------------------------------------------------MIRALCRLQYQIFKVLY---------------
RASL2_HUMAN/323-512------------------------------------------------VVRATFRQLFRRVRERF---------------
A2CE77_DANRE/319-508------------------------------------------------LICQVFHQLYLRVQERF---------------
Q66JF5_XENTR/327-516------------------------------------------------GMRLCFKQLHKRVEEQF---------------
A3LZE1_PICST/612-848------------------------------------------------QIKIQLKNFRTKVELAC---------------
BUD2_CANAL/642-872------------------------------------------------QIKLQLKNFRTKVELVC---------------
A5E274_LODEL/753-994------------------------------------------------QIKLQLKNFRTKVELVC---------------
Q6FNM9_CANGA/542-738------------------------------------------------KIKKQLHELRKGFEIIC---------------
BUD2_YEAST/541-721------------------------------------------------EIRNVLKIFRQKLEIIC---------------
Q6CW67_KLULA/546-743------------------------------------------------GIKTQLKCFRKKLEIIE---------------
Q4P4C4_USTMA/677-887------------------------------------------------DLRTVLHKVRTKVNERY---------------
NFAA_DICDI/68-259------------------------------------------------EIRAIADYTAESALRYA---------------
Q4DY44_TRYCC/96-330------------------------------------------------SLRQSLRCLLETVGASF---------------
A2R7H8_ASPNC/194-402------------------------------------------------GIRWICKQIRSLSRRKY---------------
Q54I64_DICDI/185-392------------------------------------------------GIRWICKQIRELVKQKF---------------
A7S5U4_NEMVE/139-338------------------------------------------------GIQWLCRAIKELAMEKF---------------
GAP1_SCHPO/175-379------------------------------------------------GIRWVCKLIRNLTNRLF---------------
GAPA_DICDI/274-481------------------------------------------------GIRWICKQIQSIAQKNF---------------
A7F2A6_SCLS1/1177-1385------------------------------------------------GVRFICQQIFDGLCQQF---------------
A2QP50_ASPNC/1125-1333------------------------------------------------GIRYIAKQMYESLLARF---------------
A6R4D6_AJECN/1034-1242------------------------------------------------GVRFVAQQIYEHLLSKF---------------
Q4P2J5_USTMA/1116-1323------------------------------------------------GVRYIAREVFRALQSKF---------------
Q5KM85_CRYNJ/1428-1635------------------------------------------------TIRLMAREALLALQRKF---------------
A7SXE3_NEMVE/113-325------------------------------------------------GMRYVAMTLRLALTEKF---------------
RNG2_SCHPO/875-1077------------------------------------------------ALCYTAAQLKNSLQRYF---------------
Q552W4_DICDI/717-964------------------------------------------------QLRYLCRIIAEKSKYAF---------------
A0DYI4_PARTE/179-497------------------------------------------------GIRIICKMIQITILKKF---------------
B4GY66_DROPE/162-365------------------------------------------------SLRWLLQTLSQQLRQTH---------------
D8Q477_SCHCM/172-379------------------------------------------------GIRWICKQIRSLTRRKY---------------
E7QA29_YEASB/881-1068------------------------------------------------EIRYLCTKIFCYAADKN---------------
F1RMJ4_PIG/208-420------------------------------------------------GMRFIAKVLKDSLHEKF---------------
F2Z2E2_HUMAN/966-1177------------------------------------------------GMRYVAKVLKATLAEKF---------------
H3DDA1_TETNG/1025-1236------------------------------------------------GMRYIAKVLKNSLHEKF---------------
Q23D35_TETTS/322-667------------------------------------------------PIRITCKIIEIVTKEKF---------------
Q4TE24_TETNG/96-307------------------------------------------------GLRYSAKVLRDALQAKF---------------
Q7S5G6_NEUCR/194-402------------------------------------------------GIRWICKQIRSLTKRKY---------------
V5IQZ3_NEUCR/1171-1379------------------------------------------------GLRFVCRQTYEALCQHF---------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAPX_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
SRGP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
RGAP7_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------
A1Z9I5_DROME/395-538--------------------------------------------------------------------------------
B4IM29_DROSE/1223-1375--------------------------------------------------------------------------------
B4R2Z0_DROSI/903-1054--------------------------------------------------------------------------------
B9EHI3_MOUSE/380-524--------------------------------------------------------------------------------
C5DZH4_ZYGRC/1013-1185--------------------------------------------------------------------------------
E9PYS6_MOUSE/532-680--------------------------------------------------------------------------------
F6YU97_CALJA/140-288--------------------------------------------------------------------------------
F6Z0J4_XENTR/128-275--------------------------------------------------------------------------------
F7C997_MACMU/242-408--------------------------------------------------------------------------------
H0YIK5_HUMAN/99-243--------------------------------------------------------------------------------
M2TU31_COCH5/545-687--------------------------------------------------------------------------------
Q0KHR5_DROME/1068-1216--------------------------------------------------------------------------------
Q54DW4_DICDI/28-177--------------------------------------------------------------------------------
Q8IJX0_PLAF7/215-361--------------------------------------------------------------------------------
Q9VFK2_DROME/579-728--------------------------------------------------------------------------------

PF08101

Q6C001_YARLI/166-664DTRAAEWKVRSSKLPAGQHGDYRAKTWSKHYNSTFTDPATGARSSNPHNYVYDADEGYSYKMRSNQNVS...........
R7YJ86_CONA1/46-524.................................................................NCISNTNQSV.NVNN
Q0CXG4_ASPTN/43-519.................................................................KCISSTNQSS.VTDP
Q6FSL9_CANGA/51-451.................................................................KVLS...........
A7TPE0_VANPO/51-441.................................................................NFLT...........
B2AXU5_PODAN/42-515.................................................................RAISAANQSHAVSSS
Q75EK6_ASHGO/155-597.................................................................YKFDKHFSTNYFKTL
G8B672_CANPC/35-437.................................................................ERIT...........
H2AY21_KAZAF/42-448.................................................................KLMS...........
G0SCJ0_CHATD/41-514.................................................................KAISAANQSHGASSV
M7P709_PNEMU/52-510.................................................................MCISNTLINT.....
C7YI83_NECH7/41-509.................................................................KAVAGANQSQ.VSSS
C5DWH8_ZYGRC/26-427.................................................................KEMS...........
Q59KB4_CANAL/48-454.................................................................SRIS...........
L8FN12_PSED2/45-518.................................................................RSISSSNQTQ.VSNS
G4U9K6_NEUT9/44-513.................................................................KAVSAANQSQAVSST
MSB1_YEAST/68-472.................................................................KAMS...........
G8JR31_ERECY/75-468.................................................................REWT...........
A7TL24_VANPO/24-431.................................................................KLIQ...........
G0VGB1_NAUCC/47-451.................................................................KLMS...........
F9X960_MYCGM/45-521.................................................................WAISSTNQSQTKAVT
G8ZXX4_TORDC/64-466.................................................................KLMS...........
W1QG29_OGAPD/54-458.................................................................DNMCIYD........
S7ZE60_PENO1/43-511.................................................................KCISSTNESS.VSSI
Q6CUF4_KLULA/46-446.................................................................KCMS...........
A7ELT0_SCLS1/45-517.................................................................RSISSTNQSQ.ISNS
C4R4X2_PICPG/64-468.................................................................DNFCMFD........
C0NAR4_AJECG/43-520.................................................................RCISSTNQSK.ITAL
T5A940_OPHSC/43-511.................................................................KSISAANQSQ.VSSV
V5G8I7_BYSSN/42-517.................................................................RCISSTNQSH.VSST
Q2HFE8_CHAGB/41-504.................................................................RAIAAANQSQAVSSS
E3RRN2_PYRTT/39-508.................................................................DCIATANQSIVAVDP
K0KQP5_WICCF/58-453.................................................................GLLC...........
M3D790_SPHMS/42-520.................................................................FAVSSANASTHIARS
G8ZN62_TORDC/123-556.................................................................TTFDNGFNAGMLENG
G8Y702_PICSO/33-436.................................................................DRLN...........
F2PPA7_TRIEC/40-517.................................................................CCIATTNQSE.VSTV
G3AEL0_SPAPN/40-432.................................................................ARIT...........
U1FZ21_ENDPU/42-520.................................................................KYISSTNHST.ISTS
S3CDZ9_GLAL2/45-517.................................................................KSISSANQSQGSSNA
H1VJ74_COLHI/44-515.................................................................KAISSANQSQ.VSSA
G0RMT4_HYPJQ/39-513.................................................................KAISSANQSQ.ASSA
J4WLM4_BEAB2/43-513.................................................................KAISAANQSQ.ASSA
K1WYN9_MARBU/44-531.................................................................RSISSANQSQ.VSNS
C4Y8F5_CLAL4/25-422.................................................................TRLC...........
G2WT23_VERDV/45-514.................................................................KSISSANQSQ.VSNS
S8APA2_DACHA/42-517.................................................................KCISAANQSAKPGV.
A5DN67_PICGU/34-434.................................................................GRLT...........
U4LF75_PYROM/40-532.................................................................KCISSTGQST.SGVF
G4N725_MAGO7/47-516.................................................................KAIAAANQTQAVSSA
H6BQM6_EXODN/41-520.................................................................KAISSTNQSH.VSNA
A5DVE6_LODEL/33-436.................................................................DRIS...........
G8JPL3_ERECY/187-622.................................................................YKLDKQFSTNYFKTL
J7SAQ4_KAZNA/50-456.................................................................KLMS...........
J3K4J2_COCIM/39-514.................................................................RCISTTNQSE.VSTT
D5GIW3_TUBMM/41-522.................................................................KCISSTNQSS..SGF
I2GXB5_TETBL/101-506.................................................................KSLTTRHSTL.....
K2SLP5_MACPH/42-514.................................................................DAISSANQSSTATEG
K9GDF4_PEND2/42-525.................................................................TCISSANQSS.VSST
G8BUH3_TETPH/39-448.................................................................KAIQ...........
S3CDY7_OPHP1/45-516.................................................................KAISAANQTQAVSSS
A3LX57_PICST/33-438.................................................................GRLT...........
B5RTF9_DEBHA/33-436.................................................................TRLN...........
N1PN78_MYCP1/46-518.................................................................NAVAIANQQT.VARS
E9EC05_METAQ/43-511.................................................................RAISAANESQ.VSSV
I2H455_TETBL/74-485.................................................................KLMT...........
B8MSL6_TALSN/42-515.................................................................KAISTTNQSA.VSTS
C5E2R2_LACTC/41-444.................................................................KEIS...........
M2N7H3_BAUCO/46-522.................................................................YAVSSTNS...AAAH
Q75ED0_ASHGO/36-425.................................................................KEMS...........

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
IQG1_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
BUD2_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
B4GY66_DROPE/162-365--------------------------------------------------------------------------------
D8Q477_SCHCM/172-379--------------------------------------------------------------------------------
E7QA29_YEASB/881-1068--------------------------------------------------------------------------------
F1RMJ4_PIG/208-420--------------------------------------------------------------------------------
F2Z2E2_HUMAN/966-1177--------------------------------------------------------------------------------
H3DDA1_TETNG/1025-1236--------------------------------------------------------------------------------
Q23D35_TETTS/322-667--------------------------------------------------------------------------------
Q4TE24_TETNG/96-307--------------------------------------------------------------------------------
Q7S5G6_NEUCR/194-402--------------------------------------------------------------------------------
V5IQZ3_NEUCR/1171-1379--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAPX_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
SRGP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
RGAP7_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------
A1Z9I5_DROME/395-538--------------------------------------------------------------------------------
B4IM29_DROSE/1223-1375--------------------------------------------------------------------------------
B4R2Z0_DROSI/903-1054--------------------------------------------------------------------------------
B9EHI3_MOUSE/380-524--------------------------------------------------------------------------------
C5DZH4_ZYGRC/1013-1185--------------------------------------------------------------------------------
E9PYS6_MOUSE/532-680--------------------------------------------------------------------------------
F6YU97_CALJA/140-288--------------------------------------------------------------------------------
F6Z0J4_XENTR/128-275--------------------------------------------------------------------------------
F7C997_MACMU/242-408--------------------------------------------------------------------------------
H0YIK5_HUMAN/99-243--------------------------------------------------------------------------------
M2TU31_COCH5/545-687--------------------------------------------------------------------------------
Q0KHR5_DROME/1068-1216--------------------------------------------------------------------------------
Q54DW4_DICDI/28-177--------------------------------------------------------------------------------
Q8IJX0_PLAF7/215-361--------------------------------------------------------------------------------
Q9VFK2_DROME/579-728--------------------------------------------------------------------------------

PF08101

Q6C001_YARLI/166-664.............TWEEFKQSGFEANDVIRRPSTALSGRS........................................
R7YJ86_CONA1/46-524DS....ASGVPDASWSRFEDMGFSAVDDVSSIGSNGS..................GFGSKQNGMQGL.....RS.TP...
Q0CXG4_ASPTN/43-519......TSSAQDASWSRFEDMGFGSTLDTDLEEDRKS..................ASLARREFGGGL.....KS.AP...
Q6FSL9_CANGA/51-451.............T....KHSTFQAG......................................................
A7TPE0_VANPO/51-441.................DNPNNFLSG......................................................
B2AXU5_PODAN/42-515KH....STSLRDASWSRFEDIGFASALEEEDELDDS.....................LAVQRRQQGM.....RN.TP...
Q75EK6_ASHGO/155-597NDRQGWNRALHELDPTN...............................................................
G8B672_CANPC/35-437.............EDEIDNKFNLKPG......................................................
H2AY21_KAZAF/42-448.............T....KHSTLQAG......................................................
G0SCJ0_CHATD/41-514KQ....STSVPDASWSRFEDLGFASTLEEDSSEENSI....................INVPKIRPSL.....RS.TP...
M7P709_PNEMU/52-510......SSPKECEKWEEFMNFGFDYIENKSSSPKTDSLYKIDKQNAYLIDNLNQHSTDLEPKTNPTL.............
C7YI83_NECH7/41-509KH....STSLRDASWSRFEDIGFSSTLEEEDDDDESA...............LAQK.....QPPPGL.....RR.TP...
C5DWH8_ZYGRC/26-427.............T....RHSTFQSG......................................................
Q59KB4_CANAL/48-454.............SEPISSKFNISPG......................................................
L8FN12_PSED2/45-518KN....SAGLKDASWSRFEDIGFSGAFDEAEEDQEDQ..................FSAKRRENAQSL.....RS.AP...
G4U9K6_NEUT9/44-513KH....STSLRDASWSRFEDMGFSGSIEEDSTDDETT...............LAAKREKAIKAQ................
MSB1_YEAST/68-472.............T....KHSTFQPG......................................................
G8JR31_ERECY/75-468.............T....KHSTFQAG......................................................
A7TL24_VANPO/24-431.............T....KHSTFQAG......................................................
G0VGB1_NAUCC/47-451.............T....KHSTFQAG......................................................
F9X960_MYCGM/45-521SSHGLPGLPKPDESWSAFQNMGFGDIDERALS.KGPE................GMNK.PSSMIGSSL.....RS.GP...
G8ZXX4_TORDC/64-466.............T....KHSTFQAG......................................................
W1QG29_OGAPD/54-458......EDMISDGTSGNKLAYKLVPG......................................................
S7ZE60_PENO1/43-511KQ....STSLRDASWSRFEDIGFGGSIESDEDEVPAR..................PSISKADVFGGI.....RT.AP...
Q6CUF4_KLULA/46-446.............T....KHSTFQAG......................................................
A7ELT0_SCLS1/45-517QD....STGLPDASWSRFEDVGFSATFDDRAGDDNGF..................LAPGKPKPVQGL.....RN.TP...
C4R4X2_PICPG/64-468......EDLISDGAGSNHIRFKLCSG......................................................
C0NAR4_AJECG/43-520EE.....GPIRDASWSRFEDLGFTASIEEGDGEGDGD..................RTMSKHTGPPGL.....RS.AP...
T5A940_OPHSC/43-511KH....STSLRDASWSRFEDIGFASALDEDDTVEDGA...............APP......RPLQAL.....RS.TP...
V5G8I7_BYSSN/42-517KD....STSLRDASWSRFEDIGFGGVESDTDEPADGT....................TSPGSGTPGL.....SS.VP...
Q2HFE8_CHAGB/41-504KH....STSLRDASWSRFEDIGFASALEEDDMDDD.A...............LAKR.....RMQQGL.....RN.TP...
E3RRN2_PYRTT/39-508TK........PDPSWSRFEDFGFSGILDTPNTPNGTS.........................INGGT.....QNFGP...
K0KQP5_WICCF/58-453...............KKPSEGTLMAG......................................................
M3D790_SPHMS/42-520RQ....GLPKADESWSAFSNMGFSDIDEKALEQKPST................GVNGSSTKTVGQGL.....RQ.EP...
G8ZN62_TORDC/123-556QEGEQPKVGDD.....................................................................
G8Y702_PICSO/33-436.............QEPIDSKFGLFPG......................................................
F2PPA7_TRIEC/40-517KA....STSLQDASWSRFEDIGFGGAIEDDLDENSKK......................TSSTPMGL.....RS.AP...
G3AEL0_SPAPN/40-432.............AEPAESQYNLEPG......................................................
U1FZ21_ENDPU/42-520KA....STSLRDASWSRFEDVGFGAAVDESDGDDDGD.................GSMLGPKGEPDSL.....RR.RA...
S3CDZ9_GLAL2/45-517KQ....STGLRDASWSRFEDMGFSGGMDEVEEDDDES..................NFLRKPRTMGGL.....RS.TP...
H1VJ74_COLHI/44-515KH....STSLRDASWSRFEDIGFTSALEDDDDDDDAA..................AAAAAARKPQGL.....RS.TP...
G0RMT4_HYPJQ/39-513KH....STSLRDASWSRFEDLGFTTSLEEDDDTEGSI...............LPSRRVQELKPFQGL.....RN.SP...
J4WLM4_BEAB2/43-513KH....STSLRDASWSRFEDIGFASALTEEDDYEESA..............VPVKRPPQTFGPSKSM.....LN.MP...
K1WYN9_MARBU/44-531KE....STGLTDASWSRFEDIGFSGGFDEEDEDEESN....................FAKKRPQPGL.....RT.KA...
C4Y8F5_CLAL4/25-422.............APPIDSEFNLYPG......................................................
G2WT23_VERDV/45-514KH....STGLRDASWSRFEDIGFASTLEDDEEDEDSA...............LAR......RPRQGL.....RT.TP...
S8APA2_DACHA/42-517......GAGLGDQSWSRFQDLGFS.VLEDSESSGDDD.....................SIFSGGQAY.....RKRKPNNS
A5DN67_PICGU/34-434.............DISDSSDYDLYPG......................................................
U4LF75_PYROM/40-532KL....AANAPEASWSRFQDIGFSGLVESESDEDDVLQSEAFARRRISSQQANVPTPTGTPLSRDTM.....SRDSP..M
G4N725_MAGO7/47-516KH....STGLRDASWSRFEDIGFGATLMEEDDDSEQK.....................QGRRQITGL.....RT.TP...
H6BQM6_EXODN/41-520KT....STSLADPSWSRFEDIGFGSSLEDEDEDEEDD............................GVLVRRPRATRPIHP
A5DVE6_LODEL/33-436.............DDGVENEFGLRPG......................................................
G8JPL3_ERECY/187-622NEKQHLNRALQELDPNN...............................................................
J7SAQ4_KAZNA/50-456.............T....KHSTFQAG......................................................
J3K4J2_COCIM/39-514KA....STSLRDASWSRFEDIGFGGSIEESEDEELPS.....................FGKPPQVGL.....RS.AP...
D5GIW3_TUBMM/41-522KS....GSGLQDQSWSRFQDLGFSGLLEESEGSADED.....................GLSMTGSETFPRRRASTQPIPS
I2GXB5_TETBL/101-506................................................................................
K2SLP5_MACPH/42-514SS.........DPSWSRFEDLGFGFLDTSLSSPGSTS..................SGPTPTSTSNGL.....RA.TP...
K9GDF4_PEND2/42-525KQ....STSLRDASWSRFEDIGFGGLNDSDPEDEGKE............IGPPATGKTTNSGSAGGL.....QS.VS...
G8BUH3_TETPH/39-448.............T....KHSTFQAG......................................................
S3CDY7_OPHP1/45-516KH....STSLRDASWSRFEDIGFGTVLEEDDDDDENA...............NQAN.....RRNRGL.....RT.TP...
A3LX57_PICST/33-438.............DDSIESKYELYPG......................................................
B5RTF9_DEBHA/33-436.............SDPIDSNYDLYPG......................................................
N1PN78_MYCP1/46-518RQ....GLAAPEESWSAFQNLGFADLDEQALSQKSPT................SMNG.STNTVGQGL.....RE.QP...
E9EC05_METAQ/43-511KH....STSLRDASWSRFEDIGFAGTVEEEPHIEDSH...............VPTQN....RQLQGL.....RS.TP...
I2H455_TETBL/74-485.............T....KHSTFQPG......................................................
B8MSL6_TALSN/42-515KT....STSLRDASWSRFEDMGFGASIDSDHDDDIIE......................ERTGPLEL.....RS.AP...
C5E2R2_LACTC/41-444.............T....KHSTFQAG......................................................
M2N7H3_BAUCO/46-522SRHGVSRTTSGQETWSNFQNLGFSDLD...FAPKAPN................GMNG.SVRPPGEAL.....KA.QP...
Q75ED0_ASHGO/36-425.............T....KHSTFQAG......................................................

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
IQG1_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
BUD2_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
B4GY66_DROPE/162-365--------------------------------------------------------------------------------
D8Q477_SCHCM/172-379--------------------------------------------------------------------------------
E7QA29_YEASB/881-1068--------------------------------------------------------------------------------
F1RMJ4_PIG/208-420--------------------------------------------------------------------------------
F2Z2E2_HUMAN/966-1177--------------------------------------------------------------------------------
H3DDA1_TETNG/1025-1236--------------------------------------------------------------------------------
Q23D35_TETTS/322-667--------------------------------------------------------------------------------
Q4TE24_TETNG/96-307--------------------------------------------------------------------------------
Q7S5G6_NEUCR/194-402--------------------------------------------------------------------------------
V5IQZ3_NEUCR/1171-1379--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425--------------------------------------------------------------------------------
SYDE_DROME/968-1123--------------------------------------------------------------------------------
LRG1_YEAST/755-912--------------------------------------------------------------------------------
P85B_MOUSE/125-265--------------------------------------------------------------------------------
I5P2_MOUSE/830-972--------------------------------------------------------------------------------
RHG07_HUMAN/1092-1238--------------------------------------------------------------------------------
RHG28_HUMAN/399-552--------------------------------------------------------------------------------
ARAP2_HUMAN/1129-1281--------------------------------------------------------------------------------
MYO9A_HUMAN/2076-2225--------------------------------------------------------------------------------
Q20442_CAEEL/896-1053--------------------------------------------------------------------------------
RHG18_HUMAN/343-492--------------------------------------------------------------------------------
ARAP1_HUMAN/971-1120--------------------------------------------------------------------------------
PAC1_CAEEL/963-1123--------------------------------------------------------------------------------
Q9V4C2_DROME/875-1034--------------------------------------------------------------------------------
HMHA1_HUMAN/775-947--------------------------------------------------------------------------------
GMIP_HUMAN/565-728--------------------------------------------------------------------------------
RHG32_HUMAN/386-538--------------------------------------------------------------------------------
RG190_DROME/1364-1529--------------------------------------------------------------------------------
RG92B_DROME/265-418--------------------------------------------------------------------------------
RGAPX_ARATH/155-296--------------------------------------------------------------------------------
BCR_HUMAN/1068-1221--------------------------------------------------------------------------------
RHG21_HUMAN/1161-1314--------------------------------------------------------------------------------
RHG24_MOUSE/151-304--------------------------------------------------------------------------------
RHG17_RAT/266-415--------------------------------------------------------------------------------
RHG20_HUMAN/377-527--------------------------------------------------------------------------------
RBP1_RAT/210-356--------------------------------------------------------------------------------
CHIN_MOUSE/282-436--------------------------------------------------------------------------------
RHG09_HUMAN/556-726--------------------------------------------------------------------------------
SRGP2_HUMAN/505-657--------------------------------------------------------------------------------
Q9VDE9_DROME/1154-1302--------------------------------------------------------------------------------
RRC1_CAEEL/294-443--------------------------------------------------------------------------------
RHG35_RAT/1262-1413--------------------------------------------------------------------------------
RHG39_HUMAN/909-1055--------------------------------------------------------------------------------
Q9W4A9_DROME/319-473--------------------------------------------------------------------------------
RGA3_SCHPO/794-942--------------------------------------------------------------------------------
RGA4_SCHPO/761-910--------------------------------------------------------------------------------
MYO9B_RAT/1673-1822--------------------------------------------------------------------------------
RGA1_YEAST/805-985--------------------------------------------------------------------------------
RGA2_YEAST/802-985--------------------------------------------------------------------------------
TG325_CAEEL/624-775--------------------------------------------------------------------------------
Q9VWL9_DROME/292-441--------------------------------------------------------------------------------
CDGAP_DROME/438-593--------------------------------------------------------------------------------
RGA7_SCHPO/520-671--------------------------------------------------------------------------------
RGD1_YEAST/486-644--------------------------------------------------------------------------------
BEM2_YEAST/1981-2141--------------------------------------------------------------------------------
ARAP3_HUMAN/920-1071--------------------------------------------------------------------------------
Q9XUS9_CAEEL/437-588--------------------------------------------------------------------------------
RHG01_HUMAN/260-408--------------------------------------------------------------------------------
RHG08_MOUSE/210-360--------------------------------------------------------------------------------
RG68F_DROME/292-439--------------------------------------------------------------------------------
Q23130_CAEEL/263-421--------------------------------------------------------------------------------
FA13B_MOUSE/39-190--------------------------------------------------------------------------------
Q19370_CAEEL/541-693--------------------------------------------------------------------------------
O01443_CAEEL/529-695--------------------------------------------------------------------------------
RHG06_HUMAN/411-572--------------------------------------------------------------------------------
Q8T0G4_DROME/380-537--------------------------------------------------------------------------------
RGA1_SCHPO/862-1019--------------------------------------------------------------------------------
TAGAP_HUMAN/101-250--------------------------------------------------------------------------------
Q9XW53_CAEEL/264-412--------------------------------------------------------------------------------
BEM3_YEAST/927-1096--------------------------------------------------------------------------------
RGA2_SCHPO/1083-1234--------------------------------------------------------------------------------
RGAP7_ARATH/176-325--------------------------------------------------------------------------------
YIL2_SCHPO/178-325--------------------------------------------------------------------------------
RGA6_SCHPO/332-510--------------------------------------------------------------------------------
RGA5_SCHPO/68-226--------------------------------------------------------------------------------
BAG7_YEAST/76-235--------------------------------------------------------------------------------
OCRL_HUMAN/735-875--------------------------------------------------------------------------------
Q8STW6_ENCCU/162-313--------------------------------------------------------------------------------
Q8SRX9_ENCCU/91-256--------------------------------------------------------------------------------
Q9VUR5_DROME/55-207--------------------------------------------------------------------------------
A1Z9I5_DROME/395-538--------------------------------------------------------------------------------
B4IM29_DROSE/1223-1375--------------------------------------------------------------------------------
B4R2Z0_DROSI/903-1054--------------------------------------------------------------------------------
B9EHI3_MOUSE/380-524--------------------------------------------------------------------------------
C5DZH4_ZYGRC/1013-1185--------------------------------------------------------------------------------
E9PYS6_MOUSE/532-680--------------------------------------------------------------------------------
F6YU97_CALJA/140-288--------------------------------------------------------------------------------
F6Z0J4_XENTR/128-275--------------------------------------------------------------------------------
F7C997_MACMU/242-408--------------------------------------------------------------------------------
H0YIK5_HUMAN/99-243--------------------------------------------------------------------------------
M2TU31_COCH5/545-687--------------------------------------------------------------------------------
Q0KHR5_DROME/1068-1216--------------------------------------------------------------------------------
Q54DW4_DICDI/28-177--------------------------------------------------------------------------------
Q8IJX0_PLAF7/215-361--------------------------------------------------------------------------------
Q9VFK2_DROME/579-728--------------------------------------------------------------------------------

PF08101

Q6C001_YARLI/166-664............IPMNIPWAST.............................L............................
R7YJ86_CONA1/46-524...GSRPAELG.RPTTPSWADFLS.........................SGFVEENGKPS...PAPLLLPPGKVLPPLSV
Q0CXG4_ASPTN/43-519...QSGAGDLG.RPTTPSWADFMS.........................SGFSDENPFKAP..VTPVLLPPDKVLPPIAM
Q6FSL9_CANGA/51-451..................WAPRKA...........................L............................
A7TPE0_VANPO/51-441..................WV............................................................
B2AXU5_PODAN/42-515...ASG.NDLG.RPTTPSWADFLS.........................SGFVDEKNNT......SHLLPPDKVLPPIET
Q75EK6_ASHGO/155-597............QYAVSTWIESCK.QHGFSEFLSMLEDNMGGEGTLALGHPL............................
G8B672_CANPC/35-437..................WAEPNI........................................................
H2AY21_KAZAF/42-448..................WARRRP...........................L............................
G0SCJ0_CHATD/41-514...ASGANDLG.RPTTPSWADFLS.........................SGFQVDDRLS.....PNHLLPPDKILPPIDT
M7P709_PNEMU/52-510..........................................................SLEKSPLHRIFPFNNAFPLING
C7YI83_NECH7/41-509...ASGNN.LG.RPTTPSWADFLS.........................SGFVDENQAA....RSNLLLPPDKVLPPLET
C5DWH8_ZYGRC/26-427..................WAPRKC...........................V............................
Q59KB4_CANAL/48-454..................WNK...........................................................
L8FN12_PSED2/45-518...HSKTMDKG.RPTTPSWADFLS.........................SGFVDEKMNN....PTPLLLPPDKILPPIET
G4U9K6_NEUT9/44-513...IAANADMG.RPTTPSWADFLS.........................SGF.DDKSHG....SHNILLPPDKILPPIET
MSB1_YEAST/68-472..................WAPREC...........................I............................
G8JR31_ERECY/75-468..................WPKNKC...........................V............................
A7TL24_VANPO/24-431..................WGKRSC...........................S............................
G0VGB1_NAUCC/47-451..................WATRKC...........................L............................
F9X960_MYCGM/45-521...HSRGDDFG.RPTTPSWGDFLS.........................SGFADDG..K....PSTLLYPPTETLPPLVQ
G8ZXX4_TORDC/64-466..................WATRKC...........................L............................
W1QG29_OGAPD/54-458..................WSEDMT.........................SPK............................
S7ZE60_PENO1/43-511...HSQGGDLG.RPTTPSWADFMS.........................SGFADENLK.............DRVLPPIVT
Q6CUF4_KLULA/46-446..................WSKGRN...........................L............................
A7ELT0_SCLS1/45-517...ANAVVKSGDRPTTPSWADFLS.........................SGFTDDGTTS....PPPLLLPPDKILPPINT
C4R4X2_PICPG/64-468..................WSSEML...........................Q............................
C0NAR4_AJECG/43-520...QSRTADLG.RPTTPSWADFLS.........................SGFADENEPRS...RPPFLLPPDKVLPPIQT
T5A940_OPHSC/43-511...AS.GNDMG.RPTTPSWADFLS.........................SGFHDDHPHG.....PNMLLPPDKAIPPLES
V5G8I7_BYSSN/42-517...RSAGPDLG.RPTTPSWADFLS.........................TGFNDENGSMKA..PHSLLLPPDKVLPPIGS
Q2HFE8_CHAGB/41-504...ASGNGDLG.RPTTPSWADFLS.........................SGFVDERGA......PNMLLPPDKVLPPIDT
E3RRN2_PYRTT/39-508.SARSKDTDFG.RPTTPSWADFLS.........................SGFADENNQS....PPTTLLMPTQKLPPLGE
K0KQP5_WICCF/58-453..................WPEYHP........................................................
M3D790_SPHMS/42-520...RSRTADAG.RPTTPSWADFLS.........................VGFSDDGTAK....SPTLLYPPAQVLPPLGS
G8ZN62_TORDC/123-556............QYAVATWLHFAKEQNSFDELLKMLEGGNCAEGGTLALGGG............................
G8Y702_PICSO/33-436..................WAK...........................................................
F2PPA7_TRIEC/40-517...ESRTADFG.RPTTPSWADFLS.........................SGFSEENGVKS...PTTLLLPPDKILPPLQA
G3AEL0_SPAPN/40-432..................WAK...........................................................
U1FZ21_ENDPU/42-520...LSQNWDMG.RPTTPSWADFLS.........................TGF.DENGDKT...ASSILLPPDKVLPPIHT
S3CDZ9_GLAL2/45-517...HQRNVGLA.RPTTPSWADFLN.........................VGFVDEAKNG....PAPLLLPPDKILPPINT
H1VJ74_COLHI/44-515...AAGNAGLG.RPTTPSWADFLS.........................SGFVDDNPSS.....PNMLLPPDKVLPPIET
G0RMT4_HYPJQ/39-513...LSGGNGVA.RPTTPSWADFLS.........................AGFVDDSHSK.....PTYLLPPDKILPPLSP
J4WLM4_BEAB2/43-513....SSSAHNA.RPTTPSWADFLS.........................TGFVDDSA......KTNTLVPPDKVLPPIDV
K1WYN9_MARBU/44-531...ASKNVGGG.RPTTPSWAEFLS.........................SGFVDEATSG....PAPLLLPPDKVLPPIDT
C4Y8F5_CLAL4/25-422..................WVK...........................................................
G2WT23_VERDV/45-514...ASGAVDMG.RPTTPSWADFLS.........................SGFVDDGQNT....RTNHLLPPDKVLPPIET
S8APA2_DACHA/42-517APKRQQVVDLA.RPTTPSWADFMA.........................SGFSEAASEARS..PPPLLLSPDKLLPQIET
A5DN67_PICGU/34-434..................WAP...........................................................
U4LF75_PYROM/40-532SRDRDDFMEIA.RPTTPSWADFMD.........................AGFGERDNMAHHGSAAPTLLPPDKVLPPIET
G4N725_MAGO7/47-516...ASG.VNLA.RPTTPSWADFLS.........................SGFAQDGPNS....PSNLLLPPDKVLPPIDT
H6BQM6_EXODN/41-520SVRPRGYADLA.RPTTPSWADFLS.........................SGFADENGSKA...PAPILLPPDKILPPIQS
A5DVE6_LODEL/33-436..................WAKPTM...........................L............................
G8JPL3_ERECY/187-622............QYAVATWIESCK.QHGFSEFLSMLEDNMGGDGTLVLGHPF............................
J7SAQ4_KAZNA/50-456..................WAQRKC...........................L............................
J3K4J2_COCIM/39-514...ASRTADLG.RPTTPSWADFLS.........................TGFTDEQQNRS...RAPLLLPPDKVLPPIQT
D5GIW3_TUBMM/41-522TPHQELAMDIA.RPTTPSWADFMA.........................AGFGDRDQGPNQ..PAPLLLPPDKILPPIDS
I2GXB5_TETBL/101-506................................................................................
K2SLP5_MACPH/42-514...RARPDQMG.RPTTPSWADFLS.........................SGFTDEQGHTA...PSPMLLPPDKVLPPIGE
K9GDF4_PEND2/42-525...ESGTGDLG.RPTTPSWADFMS.........................SGFADENSLKNH..VGPLLLPPDKILPPI..
G8BUH3_TETPH/39-448..................WAKRTC...........................L............................
S3CDY7_OPHP1/45-516...ASGGDGLA.RPTTPSWADFLS.........................SGFVDDGPNS....PTNMLLPPDKVLPPIDA
A3LX57_PICST/33-438..................WPK...........................................................
B5RTF9_DEBHA/33-436..................WSK...........................................................
N1PN78_MYCP1/46-518...LSRNGRAG.RPTTPSWADFLS.........................SGFADDGSAK....SPTLLYPPAQVLPPLGS
E9EC05_METAQ/43-511...AS.GTDFG.RPTTPSWADFLS.........................SGFIDENQAP.....SSVLLPPDKVLPPIET
I2H455_TETBL/74-485..................WNKRSC...........................L............................
B8MSL6_TALSN/42-515...QSRTNDFA.RPTTPSWADFMS.........................SGFADDHVPRG...PASLLLPPDKVLPPIGT
C5E2R2_LACTC/41-444..................WASQKC...........................V............................
M2N7H3_BAUCO/46-522...RSRNAEHG.RPTTPSWADFLS.........................AGFSDDDIAKS...PTSLSLPSDRVLPPIGS
Q75ED0_ASHGO/36-425..................WGNRNP...........................L............................

PF00616

RASL1_MOUSE/321-510--------------------------------------------------------------------------------
Q75DK0_ASHGO/576-771--------------------------------------------------------------------------------
RGAA_DICDI/239-445--------------------------------------------------------------------------------
A5DN39_PICGU/903-1097--------------------------------------------------------------------------------
GAPD1_MOUSE/152-353--------------------------------------------------------------------------------
A5DR10_PICGU/619-844--------------------------------------------------------------------------------
Q6BPM2_DEBHA/608-836--------------------------------------------------------------------------------
Q0V6E4_PHANO/854-1062--------------------------------------------------------------------------------
Q6CFR5_YARLI/832-1039--------------------------------------------------------------------------------
IQGA2_MOUSE/938-1150--------------------------------------------------------------------------------
A5E5Z0_LODEL/955-1161--------------------------------------------------------------------------------
IQG1_CANAL/977-1177--------------------------------------------------------------------------------
A3LY27_PICST/921-1130--------------------------------------------------------------------------------
Q6CR01_KLULA/879-1073--------------------------------------------------------------------------------
Q54F48_DICDI/1131-1337--------------------------------------------------------------------------------
Q6BG44_PARTE/169-435--------------------------------------------------------------------------------
RASL2_HUMAN/323-512--------------------------------------------------------------------------------
A2CE77_DANRE/319-508--------------------------------------------------------------------------------
Q66JF5_XENTR/327-516--------------------------------------------------------------------------------
A3LZE1_PICST/612-848--------------------------------------------------------------------------------
BUD2_CANAL/642-872--------------------------------------------------------------------------------
A5E274_LODEL/753-994--------------------------------------------------------------------------------
Q6FNM9_CANGA/542-738--------------------------------------------------------------------------------
BUD2_YEAST/541-721--------------------------------------------------------------------------------
Q6CW67_KLULA/546-743--------------------------------------------------------------------------------
Q4P4C4_USTMA/677-887--------------------------------------------------------------------------------
NFAA_DICDI/68-259--------------------------------------------------------------------------------
Q4DY44_TRYCC/96-330--------------------------------------------------------------------------------
A2R7H8_ASPNC/194-402--------------------------------------------------------------------------------
Q54I64_DICDI/185-392--------------------------------------------------------------------------------
A7S5U4_NEMVE/139-338--------------------------------------------------------------------------------
GAP1_SCHPO/175-379--------------------------------------------------------------------------------
GAPA_DICDI/274-481--------------------------------------------------------------------------------
A7F2A6_SCLS1/1177-1385--------------------------------------------------------------------------------
A2QP50_ASPNC/1125-1333--------------------------------------------------------------------------------
A6R4D6_AJECN/1034-1242--------------------------------------------------------------------------------
Q4P2J5_USTMA/1116-1323--------------------------------------------------------------------------------
Q5KM85_CRYNJ/1428-1635--------------------------------------------------------------------------------
A7SXE3_NEMVE/113-325--------------------------------------------------------------------------------
RNG2_SCHPO/875-1077--------------------------------------------------------------------------------
Q552W4_DICDI/717-964--------------------------------------------------------------------------------
A0DYI4_PARTE/179-497--------------------------------------------------------------------------------
B4GY66_DROPE/162-365--------------------------------------------------------------------------------
D8Q477_SCHCM/172-379--------------------------------------------------------------------------------
E7QA29_YEASB/881-1068--------------------------------------------------------------------------------
F1RMJ4_PIG/208-420--------------------------------------------------------------------------------
F2Z2E2_HUMAN/966-1177--------------------------------------------------------------------------------
H3DDA1_TETNG/1025-1236--------------------------------------------------------------------------------
Q23D35_TETTS/322-667--------------------------------------------------------------------------------
Q4TE24_TETNG/96-307--------------------------------------------------------------------------------
Q7S5G6_NEUCR/194-402--------------------------------------------------------------------------------
V5IQZ3_NEUCR/1171-1379--------------------------------------------------------------------------------

PF00620

RHG05_MOUSE/1274-1425------Q..Q--------------------------------NKI............NL-MTADNL------SI------
SYDE_DROME/968-1123------S..N--------------------------------SER............NK-MSAQAL------AT------
LRG1_YEAST/755-912------S..F--------------------------------SYIEN.......EMGSK-MDIHNL------ST------
P85B_MOUSE/125-265------R..R--------------------------------APS............PD-TAVHAL------AS------
I5P2_MOUSE/830-972------K..N--------------------------------SAN............NH-LDENIL------AS------
RHG07_HUMAN/1092-1238------A..A--------------------------------VKE............NQ-MTPTNL------AV------
RHG28_HUMAN/399-552------A..N--------------------------------ESK............NR-MSLWNI------ST------
ARAP2_HUMAN/1129-1281------K..C--------------------------------SEI............NH-MNAHNL------AL------
MYO9A_HUMAN/2076-2225------L..Q--------------------------------EDT............NR-MSANAL------AI------
Q20442_CAEEL/896-1053------R..N--------------------------------SQV............NN-MTAQNL------SV------
RHG18_HUMAN/343-492------D..N--------------------------------KEK............NK-MTVMNV------AM------
ARAP1_HUMAN/971-1120------C..F--------------------------------SDT............NQ-MNVHNL------AI------
PAC1_CAEEL/963-1123------K..H--------------------------------SDV............NK-MECRNL------AL------
Q9V4C2_DROME/875-1034------A..H--------------------------------SDDIWSTEGCCLTLGNK-MDSYNL------AT------
HMHA1_HUMAN/775-947------E..V--------------------------------EQD............NK-MTPGNL------GI------
GMIP_HUMAN/565-728------A..R--------------------------------FME............NK-MSANNL------GI------
RHG32_HUMAN/386-538------D..Y--------------------------------CSI............TN-MHAKNL------AI------
RG190_DROME/1364-1529------D..N--------------------------------SKL............NS-MDSKNL------AI------
RG92B_DROME/265-418------Q..R--------------------------------SAL............NK-MSSQNL------AI------
RGAPX_ARATH/155-296------Q..K--------------------------------SLL............NK-MDSHSL------AM------
BCR_HUMAN/1068-1221------E..K--------------------------------EAV............NK-MSLHNL------AT------
RHG21_HUMAN/1161-1314------E..N--------------------------------SEK............NK-MEPRNL------AI------
RHG24_MOUSE/151-304------S..Y--------------------------------SGV............NK-MSAQNL------AT------
RHG17_RAT/266-415------Q..T--------------------------------SDV............NK-MTPSNI------AI------
RHG20_HUMAN/377-527------Q..H--------------------------------SSS............NQ-MTAFNL------AV------
RBP1_RAT/210-356------A..K--------------------------------ELE............TK-MNIQNI------SI------
CHIN_MOUSE/282-436------L..H--------------------------------EKE............NL-MSAENL------GI------
RHG09_HUMAN/556-726------A..H--------------------------------SDK............NR-MTPHNL------GI------
SRGP2_HUMAN/505-657------Q..F--------------------------------SEE............NM-MDPYNL------AI------
Q9VDE9_DROME/1154-1302------I..P--------------------------------EVVS..........CTK-MDSSNL------AM------
RRC1_CAEEL/294-443------K..S--------------------------------KSL............TD-MTSKNL------AI------
RHG35_RAT/1262-1413------H..N--------------------------------NKV............NL-MTSENL------SI------
RHG39_HUMAN/909-1055------QPAN--------------------------------VAV............TK-MDVSNL------AM------
Q9W4A9_DROME/319-473------S..H--------------------------------YAV............NK-MNEHNL------AT------
RGA3_SCHPO/794-942------K..H--------------------------------AEK............NL-MNSKNV------ST------
RGA4_SCHPO/761-910------A..Y--------------------------------SHA............NR-MTSKNL------AV------
MYO9B_RAT/1673-1822------L..L--------------------------------EDV............NR-MSPGAL------AI------
RGA1_YEAST/805-985------R..Y--------------------------------SHW............NR-MTLYNL------AL------
RGA2_YEAST/802-985------R..C--------------------------------SER............NL-MNLHNL------SL------
TG325_CAEEL/624-775------S..H--------------------------------SSQ............NR-MQQHNL------AI------
Q9VWL9_DROME/292-441------A..A--------------------------------SAS............NR-MPSTNL------AI------
CDGAP_DROME/438-593------Q..H--------------------------------HGR............TG-MTDKNL------AI------
RGA7_SCHPO/520-671------E..N--------------------------------SDV............NK-MSTNNL------AI------
RGD1_YEAST/486-644------A..H--------------------------------EAQ............NR-MNLRAL------CI------
BEM2_YEAST/1981-2141------Q..H--------------------------------VVN............NK-MDASNL------AI------
ARAP3_HUMAN/920-1071------K..C--------------------------------AAL............NQ-MCTRNL------AL------
Q9XUS9_CAEEL/437-588------A..Q--------------------------------SSR............NK-MNCEAM------AR------
RHG01_HUMAN/260-408------A..H--------------------------------SDQ............NK-MTNTNL------AV------
RHG08_MOUSE/210-360------L..E--------------------------------SIS............NK-MNSSNL------AC------
RG68F_DROME/292-439------D..C--------------------------------EDL............NK-MTSSNL------AI------
Q23130_CAEEL/263-421------E..N--------------------------------SKV............NL-MTANNL------SV------
FA13B_MOUSE/39-190------S..H--------------------------------HE.............EI-WSANSL------AA------
Q19370_CAEEL/541-693------E..F--------------------------------ADE............NM-MEPHNL------AI------
O01443_CAEEL/529-695------C..H--------------------------------SQDRHDED.GELLSGNK-MDARNL------AT------
RHG06_HUMAN/411-572------R..H--------------------------------ADDNISKD.GQEVTGNK-MTSLNL------AT------
Q8T0G4_DROME/380-537------N..L--------------------------------KDI............NK-MNVHNV------AT------
RGA1_SCHPO/862-1019------S..F--------------------------------SHIDD.......EVGSK-MDIHNL------AT------
TAGAP_HUMAN/101-250------K..N--------------------------------SEV............NR-MDSSNL------AI------
Q9XW53_CAEEL/264-412------N..S--------------------------------PS.............SK-MNASSL------SV------
BEM3_YEAST/927-1096------E..N--------------------------------SKF............NK-MNLRNL------CI------
RGA2_SCHPO/1083-1234------A..F--------------------------------EKV............NK-MNIRNV------CI------
RGAP7_ARATH/176-325------S..H--------------------------------SHE............NR-MNPNAV------AA------
YIL2_SCHPO/178-325------Q..H--------------------------------EQE............NM-MNAQNL------AL------
RGA6_SCHPO/332-510------T..R--------------------------------TQELENGM.ENTKDSTL-MKPEAL------GI------
RGA5_SCHPO/68-226------M..N--------------------------------SSK............NL-MTADNL------AA------
BAG7_YEAST/76-235------R..N--------------------------------EKK............NL-MSASNL------AA------
OCRL_HUMAN/735-875------K..F--------------------------------SEY............NS-VNANMI------AT------
Q8STW6_ENCCU/162-313------K..N--------------------------------SDA............TE-MNIDSL------LG------
Q8SRX9_ENCCU/91-256------DIAT--------------------------------DKGKN........HKDN-MNMEGI------ST------
Q9VUR5_DROME/55-207------SNAA--------------------------------HAS............TG-MTSEAL------GV------
A1Z9I5_DROME/395-538------Q..C--------------------------------PV.............VL-MPIDNI------SL------
B4IM29_DROSE/1223-1375------E..K--------------------------------ETD............NK-MSLHNL------AM------
B4R2Z0_DROSI/903-1054------G..N--------------------------------CDV............NR-MEPKNL------AI------
B9EHI3_MOUSE/380-524------G..R--------------------------------SSI............TH-MTAYAL------SV------
C5DZH4_ZYGRC/1013-1185------S..Y--------------------------------SEW............NL-MNLYNL------SL------
E9PYS6_MOUSE/532-680------Q..Y--------------------------------SDE............NM-MDSYNL------AV------
F6YU97_CALJA/140-288------E..N--------------------------------GEK............NR-MTYQSI------AI------
F6Z0J4_XENTR/128-275------Q..S--------------------------------SSK............NL-LSAKSL------AE------
F7C997_MACMU/242-408------S..F--------------------------------HAY............NR-MTPQNL------AV------
H0YIK5_HUMAN/99-243------Q..S--------------------------------PH.............TK-MDVANL------AK------
M2TU31_COCH5/545-687------Q..S--------------------------------SEI............NR-MSTANL------AI------
Q0KHR5_DROME/1068-1216------S..Q--------------------------------QAK............NK-MSVQNL------TM------
Q54DW4_DICDI/28-177------L..N--------------------------------NRV............NK-MTSQNL------AT------
Q8IJX0_PLAF7/215-361------E..H--------------------------------ASE............NN-MTILAL------SK------
Q9VFK2_DROME/579-728------A..N--------------------------------SQQ............NQ-MTSNNL------GV------

PF08101

Q6C001_YARLI/166-664......PGQN--------------------------------GDT.APAVKSGYEQKVT-AAVSQV------AIDDFFVW
R7YJ86_CONA1/46-524..SRV.QSSQ--------------------------------SVLSNVTQDSSLEPGEL-ASITQF------ELDETFWW
Q0CXG4_ASPTN/43-519..DRG.QSSQ--------------------------------SHKRNLDSEPSIDPGEL-ASITTL------DLDDSFWW
Q6FSL9_CANGA/51-451......A...--------------------------------..N.DLGLKS......K-ISVNRL------DIDDYFIW
A7TPE0_VANPO/51-441......SQDQ--------------------------------KDNIEFVKDE.......-VIVERI------DIADYFPL
B2AXU5_PODAN/42-515.NLRQ.RSSQ--------------------------------SHRPRLENENHLEPGEL-ASITRF------DLDDAFWW
Q75EK6_ASHGO/155-597......LASL--------------------------------TEELSFNAKEEEEELAA-VRLSKM------GVSEWFIS
G8B672_CANPC/35-437......SAKL--------------------------------SKK.DVPSIT......R-IAVKDV------SIQDYYIW
H2AY21_KAZAF/42-448......E...--------------------------------..N.IHELDE......F-IQVKRV------DIDDYFIW
G0SCJ0_CHATD/41-514.SIRQ.RSSQ--------------------------------SHKPRLESDRDLEPGEL-ASITKF------DLDDAFWW
M7P709_PNEMU/52-510IH....PHPE--------------------------------LDSATKINTEWLNESTI-SNKIRI------SLDESFWG
C7YI83_NECH7/41-509..VRQ.RSSQ--------------------------------SHRPRLEHDRSLEPGEL-ASITTF------SLDDAFWW
C5DWH8_ZYGRC/26-427......P...--------------------------------..N.YENFSE......N-ISVKRV------DIDDYFIW
Q59KB4_CANAL/48-454......SKVE--------------------------------TDP.DIPLFS......E-ISIKDV------SIHDYYIW
L8FN12_PSED2/45-518..SRG.RSSQ--------------------------------SHRPRLESDRTLEPGEL-ASITKF------DLDDSFWW
G4U9K6_NEUT9/44-513.TVRQ.KSSE--------------------------------SHKPRFE..DALQPGEL-ASITRF------DLDDAFWW
MSB1_YEAST/68-472......E...--------------------------------..N.ISHLKE......C-IEVKRL------DIDDYFIW
G8JR31_ERECY/75-468......A...--------------------------------..N.EQCLAE......H-LVWGRA------EIDDYFIW
A7TL24_VANPO/24-431......P...--------------------------------.DS.SKSLKE......N-IEVSRV------DIDDYFIW
G0VGB1_NAUCC/47-451......E...--------------------------------..N.VYDLKE......S-IEVKRV------DIDDYFIW
F9X960_MYCGM/45-521......RSAS--------------------------------FGR.LEGINEALAPGEL-AAITNV------ELDDAFWW
G8ZXX4_TORDC/64-466......P...--------------------------------..N.ESNLKE......N-IEVSRV------EIDDYFIW
W1QG29_OGAPD/54-458......PVEL--------------------------------RD....ADYF......T-ATVSRA------TIDDYFIW
S7ZE60_PENO1/43-511..PRG.QSSQ--------------------------------SHRRTMSADDPLEPAEL-ASITSL------DLDDSFWW
Q6CUF4_KLULA/46-446......PS..--------------------------------.SN.PDLIEE......S-ISISRV------DIDDYFIW
A7ELT0_SCLS1/45-517...RA.GSSQ--------------------------------SHQPRLESNKDLEPGEL-ASITRF------DLDDSFWW
C4R4X2_PICPG/64-468......PYEN--------------------------------WDE.SKGDYF......T-ANISKT------LIDDYFVW
C0NAR4_AJECG/43-520..VRG.QSSQ--------------------------------SHKRLFDEESSFEPGSL-ASITTM------DLDASFWW
T5A940_OPHSC/43-511.QFRQHQSSQ--------------------------------SHRPRLEREQDLEPGEL-ASITVF------ELDDAFWW
V5G8I7_BYSSN/42-517..VRG.QSSQ--------------------------------SHKRTFDAESSLDPGEL-ANVTRI------DLDDSFWW
Q2HFE8_CHAGB/41-504GTARQ.RSSQ--------------------------------SHKPRLETDNQFEPGEL-ASIVRF------DLDDAFWW
E3RRN2_PYRTT/39-508..NRV.HSSQ--------------------------------SHVRNGLTDDDLEPGEL-ASITQF------DLDETFWW
K0KQP5_WICCF/58-453......PETV--------------------------------VEN...........KIQ-VSVSRV------SIDDYFIW
M3D790_SPHMS/42-520......RSSS--------------------------------AGH.LEGIDENLAPGEL-AAIANV------ELDDAFWW
G8ZN62_TORDC/123-556......AGGL--------------------------------TLQQPLKLNREPSQDSK-VRVAKT------DISEWLIS
G8Y702_PICSO/33-436......PEHE--------------------------------TDP.NIPLYS......Q-LSISNI------AIQDYYIW
F2PPA7_TRIEC/40-517..VRG.QSSQ--------------------------------SHKRGFDDGSMLDPGEL-ASISTL------DLDDSFWW
G3AEL0_SPAPN/40-432......SPVP--------------------------------FDE.DIPQYS......K-IEIKNV------SIQDYYIW
U1FZ21_ENDPU/42-520.TPRG.QSSQ--------------------------------SHRRNMNPEADLEPGEL-ARIDKI------ALDDSFWW
S3CDZ9_GLAL2/45-517...RA.NSSQ--------------------------------SHAPRLEANAHLEPGEL-ASITRF------DLDDSFWW
H1VJ74_COLHI/44-515.AARQ.RSSQ--------------------------------SHNPRLESDR.LEPGEL-ASIARF------DLDESFWW
G0RMT4_HYPJQ/39-513.DARQ.LSSQ--------------------------------SHQPRLESERDVEPGEL-ASIKVI------DLDDAFWW
J4WLM4_BEAB2/43-513..QRQ.HSSQ--------------------------------SHQPRLESDKDLEPGEL-ASITPF------DLDDAFWW
K1WYN9_MARBU/44-531...RG.RSSQ--------------------------------SHKPRLEQNR.LEPGEL-ASIARF------DLDDSFWW
C4Y8F5_CLAL4/25-422......PD.K--------------------------------IDT.DIPMYS......E-VSISNV------TLQDYYIW
G2WT23_VERDV/45-514.NVRQ.RSSQ--------------------------------SHHPRLETERQLEPGEL-ASITRF------DLDEAFWW
S8APA2_DACHA/42-517..SRA.RSVQ--------------------------------SNRR..PDDSHLEPGEL-ASITTI------MIDDAFWL
A5DN67_PICGU/34-434......FGGK--------------------------------VDE.NIPLFT......E-LTIQDV------TIQDYYIW
U4LF75_PYROM/40-532.ADRL.KSSA--------------------------------SNRKL....QVLEPGEL-ESVTPM------DVDDVFWW
G4N725_MAGO7/47-516.TVRQ.RSAQ--------------------------------SHRPRLESEQNLEPGEL-ASISRL------ELDDSFWW
H6BQM6_EXODN/41-520TMIRG.QSSQ--------------------------------SHRRNLDAHPSLDPGEL-ASITRI------NVDDSFWW
A5DVE6_LODEL/33-436......QASS--------------------------------SDK.GLPLFS......H-IVVKDV------MIQDYYIW
G8JPL3_ERECY/187-622......LNSL--------------------------------TEGLQ...KEEEEEVYP-VKLSKM------GVSEWFIS
J7SAQ4_KAZNA/50-456......P...--------------------------------..N.PEHLKE......F-IQVGRV------DIDDYFIW
J3K4J2_COCIM/39-514..VRG.QSSQ--------------------------------SHKRSFDQESTLDPGEL-ASISIL------DLDDSFWW
D5GIW3_TUBMM/41-522.GSRV.RSSQ--------------------------------SNRKI..AEDNLDPGEL-ASVSPL------TVDDAFWW
I2GXB5_TETBL/101-506......NTNW--------------------------------PHSKYVSEKNTIQFDDY-LQIKNV------EIDKTFYW
K2SLP5_MACPH/42-514.VARV.QSSQ--------------------------------SHLRTI..DDDLEPGEL-ASIQKF------DLDDTFWW
K9GDF4_PEND2/42-525..ARG.MSSQ--------------------------------SHKRSLDIEPALEPAEL-ASISTL------DMDDSFWW
G8BUH3_TETPH/39-448......S...--------------------------------.DP.ANVLKE......E-IEITRI------DIDDYFIW
S3CDY7_OPHP1/45-516.NIRQ.RSSQ--------------------------------SHRPRLETERSFEPGEL-ASISRF------DLDDSFWW
A3LX57_PICST/33-438......SQPE--------------------------------IDD.NIPLFS......Q-VSVYDV------TLQDFYIW
B5RTF9_DEBHA/33-436......PDLV--------------------------------TDP.NIPLFS......Q-INIEDV------SLQDYYIW
N1PN78_MYCP1/46-518......RSSS--------------------------------PG...LGNEESLAPGEL-AAITNI------ELDDAFWW
E9EC05_METAQ/43-511.QIRQ.QSSQ--------------------------------SHRPRLENTTTLQPGEL-ASITLI------DLDNAFWW
I2H455_TETBL/74-485......K...--------------------------------..N.VNKLED......N-IKVDRI------DIDDYFIW
B8MSL6_TALSN/42-515..VRG.QSSQ--------------------------------SHKRTLDTEPNLEPGEL-ASITVL------DIDDSFWW
C5E2R2_LACTC/41-444......PS..--------------------------------.DDGMKRLET......H-LEMGRV------DIDDYFIW
M2N7H3_BAUCO/46-522......RTHT--------------------------------PSHAVNGAGDDLAPGEM-AAITDV------ELDDAFWW
Q75ED0_ASHGO/36-425......P...--------------------------------..N.RLNLTE......S-ISWTRT------EISDYFIW

PF00616

RASL1_MOUSE/321-510------SGIE................................HQDV.KYLAISGFLFLR.FFAPAI......LT.PKLFD
Q75DK0_ASHGO/576-771------GDSN................................LKTV..LNCISGFLFLR.FFCPVL......LN.PKLFH
RGAA_DICDI/239-445------TKST................................QDEI..LKVIGYFIYYR.FIQVAM......VS.PEEYD
A5DN39_PICGU/903-1097------PEKT.................................NLQ..HLAVAGVIFYK.HYVGSI......IQNPENFG
GAPD1_MOUSE/152-353------RLEV.................................GEV..RAMCTDLLLAC.FICPAV......VN.PEQYG
A5DR10_PICGU/619-844------DPED................................KVTA..LNCLSAFIFLR.FFCPAI......LN.PKLFY
Q6BPM2_DEBHA/608-836------DPDD................................KVTA..LNCLSSFIFLR.FFCPAI......LN.PKLFY
Q0V6E4_PHANO/854-1062------PYEA................................QEQL..LVIVGHWVWKA.YIQPAL......IQ.PQHWG
Q6CFR5_YARLI/832-1039------PHES................................EDRH..LAVIGVVLVSL.FVIPPI......VA.PDDYG
IQGA2_MOUSE/938-1150------PDAT................................EEEL..LKIVGNLLYYR.YMNPAI......VA.PDGFD
A5E5Z0_LODEL/955-1161------PEKS.................................SKQ..HMAVAGVVFFK.HYIGSI......FNTPENYG
IQG1_CANAL/977-1177------PDKS.................................DQQ..HLAVAGVIFVK.HYLGSI......LQVPENYG
A3LY27_PICST/921-1130------PEKS.................................DQQ..HLAVAGVVFIK.HYIAPI......LQFPENFG
Q6CR01_KLULA/879-1073------T....................................EESSALSAISKIVVDN.FIFVAL......MKRSDFSS
Q54F48_DICDI/1131-1337------KQQRKPDFVP....................SEISKVRDKQEEREFIIRLIFEN.FFIPAI......IR.PDHYG
Q6BG44_PARTE/169-435------QSYK................................QEEI..FNLLIQFFINK.WILPEF......TA.MFLNQ
RASL2_HUMAN/323-512------..PGA.............................QHENVP..FIAVTSFLCLR.FFSPAI......MS.PKLFH
A2CE77_DANRE/319-508------..PDP.............................EYRKVK..FIAVTSFLCLR.FISPAI......MS.PKLFH
Q66JF5_XENTR/327-516------..PGA.............................VYQDVK..YAAISGFLFLR.FFAPAI......LT.PKLFH
A3LZE1_PICST/612-848------DPDD................................KTTP..LNCLSAFIFLR.FFCPAI......LN.PKLF.
BUD2_CANAL/642-872------DPED................................KVTS..LNCLSAFIFLR.FFCPAI......LN.PKLF.
A5E274_LODEL/753-994------EPND................................KVTS..LNCISAFIFLR.FFCPAI......LN.PKLF.
Q6FNM9_CANGA/542-738------LEKG................................QQSI..LNCISAFLFLR.FFCPLI......LN.PKLF.
BUD2_YEAST/541-721------IDDT................................LQII..LNGISGLLFLR.FFCPVI......LN.PKLFK
Q6CW67_KLULA/546-743------PDEKI..............................SSKSL..LNCISGFLFLR.FFCPVI......LN.PKIF.
Q4P4C4_USTMA/677-887------RGTK.................................STRPGIQGVGAFVFLR.LFCAAL......NS.PQLYG
NFAA_DICDI/68-259------....................................PESL..APLVGGFIMLR.FFSPAI......VT.PEYSK
Q4DY44_TRYCC/96-330------RDDVHLGPT......................GSDMEMLTVLQQNMMATIVVLR.AVVPALLNTVPRLL.PGVSC
A2R7H8_ASPNC/194-402------PDAQ................................DQTI..CTLIGGFFFLR.FINPAI......VT.PRSYM
Q54I64_DICDI/185-392------PQAT................................RAQT..CGLIGGFFLLR.YINPAV......VT.PQAFM
A7S5U4_NEMVE/139-338------PEAT................................PEQI..NAMIGGFFLLR.FINPAI......VT.PTAYM
GAP1_SCHPO/175-379------PSIS................................DSTI..CSLIGGFFFLR.FVNPAI......IS.PQTSM
GAPA_DICDI/274-481------.DSK................................PDEI..AKVIGYFVYYR.FINLAI......VT.PDAFE
A7F2A6_SCLS1/1177-1385------PRES................................QRNL..LQLVGNWLFRF.YLYPAL......TT.PESMG
A2QP50_ASPNC/1125-1333------PQEN................................PGFI..LQTAGHWVWRN.YFHPAM......VE.PEKYG
A6R4D6_AJECN/1034-1242------ENED................................HGYV..LQVTGQWVWKN.YLYPAV......LE.PERCS
Q4P2J5_USTMA/1116-1323------PDEP................................QDAL..IKVVGHLVYYR.YLNPAI......VA.PEGFD
Q5KM85_CRYNJ/1428-1635------PEAM................................DDDL..VPVVARTVILP.FLLPAI......IA.PEQFG
A7SXE3_NEMVE/113-325------PNLS................................EEEI..IKVVGNLVYYR.YMNPAI......VA.PDAFD
RNG2_SCHPO/875-1077------PAAH................................KEEI..FGVIGKFVYWA.YVAPVL......VS.PDNFK
Q552W4_DICDI/717-964------PTNNTNNHHNGGGISSDESGSTTANITLNNNRSKQLPENR..EKYISYFLIIYRFIIPII......SS.PDLLN
A0DYI4_PARTE/179-497------PDAT................................EQQI..QENIFSFLFNV.WLIPQL......VF.PKQYS
B4GY66_DROPE/162-365------RHK.................................EQEI..RQLLTDLVFTH.FISPAI......VS.ADLVG
D8Q477_SCHCM/172-379------PEAT................................DYAI..CSLIGGFFFLR.FINPAI......VT.PQAYM
E7QA29_YEASB/881-1068------..IE................................EIDS..LRAISSILVNV.FVSEYL......VN.REYYG
F1RMJ4_PIG/208-420------PDAG................................EDEL..LKIIGNLLYYR.YMNPAI......VA.PDAFD
F2Z2E2_HUMAN/966-1177------PDAT................................DSEV..YKVVGNLLYYR.FLNPAV......VA.PDAFD
H3DDA1_TETNG/1025-1236------PDSS................................EDEL..MKIVGNLLYYR.YMNPAI......VA.PDGFD
Q23D35_TETTS/322-667------QNIS................................DEDL..FTIIGYFLFDC.YLIPQF......MF.SHHLR
Q4TE24_TETNG/96-307------PGAS................................EDEL..YKVVGNLVYYR.YMNPAI......VA.PDGFD
Q7S5G6_NEUCR/194-402------PDAN................................DQII..CTLIGSFFFLR.FINPAI......VT.PKSYM
V5IQZ3_NEUCR/1171-1379------QRDH................................PQNV..LQFVSNWLWRF.YLQPAL......LG.PESYG

PF00620

RHG05_MOUSE/1274-1425----------------CFWP---TLMRP---------DFE.-..NRE
SYDE_DROME/968-1123----------------VMGP---PLMLH---------SA..-..SAQ
LRG1_YEAST/755-912----------------VITP---NILYL---------RHK.-.EISN
P85B_MOUSE/125-265----------------AFGP---LLLRI---------PPSG-.GEGD
I5P2_MOUSE/830-972----------------IFGS---LLLRN---------PAR.-..HQK
RHG07_HUMAN/1092-1238----------------CLAP---SLFH.---------....-..LNT
RHG28_HUMAN/399-552----------------VMAP---NLFFS---------RSK.-..HSD
ARAP2_HUMAN/1129-1281----------------VFSS---CLFQT---------KGQ.-..TSE
MYO9A_HUMAN/2076-2225----------------VFAP---CILRC---------PD..-..TTD
Q20442_CAEEL/896-1053----------------CFTP---SLFQL---------GAS.-..RLD
RHG18_HUMAN/343-492----------------VMAP---NLFMC---------....-..HAL
ARAP1_HUMAN/971-1120----------------VFGP---TLFQT---------....-..DGQ
PAC1_CAEEL/963-1123----------------MFGP---SIVRP---------SDD.-.NMAT
Q9V4C2_DROME/875-1034----------------VFAP---NILRS---------....-..THL
HMHA1_HUMAN/775-947----------------VFGP---TLLRP---------RPT.-..EAT
GMIP_HUMAN/565-728----------------VFGP---TLLRP---------PDG.-.PRAA
RHG32_HUMAN/386-538----------------VWAP---NLLRS---------KQI.-..ESA
RG190_DROME/1364-1529----------------CWWP---TLIPI---------DFT.-.DMGH
RG92B_DROME/265-418----------------VMSP---NMLWP---------RID.-.KSSN
RGAPX_ARATH/155-296----------------EMAP---VIMWR---------....-..EDN
BCR_HUMAN/1068-1221----------------VFGP---TLLRP---------SEK.-.ESKL
RHG21_HUMAN/1161-1314----------------VFGP---TLVRT---------SED.-..NMT
RHG24_MOUSE/151-304----------------VFGP---NILRP---------KVE.-.DPLT
RHG17_RAT/266-415----------------VLGP---NLLWA---------KQ..-..EGT
RHG20_HUMAN/377-527----------------CVAP---SILWP---------PAS.-.SSPE
RBP1_RAT/210-356----------------VLSP---TVQIS---------....-..NRV
CHIN_MOUSE/282-436----------------VFGP---TLMRS---------PEL.-.DPMA
RHG09_HUMAN/556-726----------------VFGP---TLFRP---------EQE.-..TSD
SRGP2_HUMAN/505-657----------------CFGP---SLMSV---------PEG.-..HDQ
Q9VDE9_DROME/1154-1302----------------VFAP---NCLRC---------TSE.-.DPKV
RRC1_CAEEL/294-443----------------VWSP---NLFRP---------....-..PPT
RHG35_RAT/1262-1413----------------CFWP---TLMRP---------DFS.-..SMD
RHG39_HUMAN/909-1055----------------VMAP---NCLRC---------QSD.-.DPRV
Q9W4A9_DROME/319-473----------------VFAP---TLIAT---------PQH.-.MTNL
RGA3_SCHPO/794-942----------------VFAP---TLMRD---------K...-..VNR
RGA4_SCHPO/761-910----------------VFSP---TLIRD---------PDN.-..SRD
MYO9B_RAT/1673-1822----------------IFAP---CLLRC---------PD..-..NSD
RGA1_YEAST/805-985----------------VFAP---GLIRD---------FSG.-.EKDI
RGA2_YEAST/802-985----------------VFAP---SLIHD---------FDG.-.EKDI
TG325_CAEEL/624-775----------------VFGP---TLFHN---------GDG.-.AVNL
Q9VWL9_DROME/292-441----------------VWGP---CLLSA---------NQI.-.QLDI
CDGAP_DROME/438-593----------------VWAP---NLLRS---------PAL.-.ESGG
RGA7_SCHPO/520-671----------------IWGP---TIIKQ---------....-..ATI
RGD1_YEAST/486-644----------------IWGP---TIAPA---------NPD.-.DAND
BEM2_YEAST/1981-2141----------------VFSM---SFINQ---------ED..-..LAN
ARAP3_HUMAN/920-1071----------------LFAP---SVFQT---------DG..-..RGE
Q9XUS9_CAEEL/437-588----------------MVAP---AVMGH---------PVK.-..QSQ
RHG01_HUMAN/260-408----------------VFGP---NLLWA---------KD..-..AAI
RHG08_MOUSE/210-360----------------VFGL---NLIWP---------SQG.-.VASL
RG68F_DROME/292-439----------------VFGP---NFLWS---------....-..RST
Q23130_CAEEL/263-421----------------VFGP---NLTWP---------TDQ.-.EVPI
FA13B_MOUSE/39-190----------------VFGP---DVFHI---------YTD.-..VED
Q19370_CAEEL/541-693----------------CFGP---TLLPI---------PEG.-..KDQ
O01443_CAEEL/529-695----------------IFAP---SILRV---------DHD.-.KLHE
RHG06_HUMAN/411-572----------------IFGP---NLLHK---------QKS.-.SDKE
Q8T0G4_DROME/380-537----------------IMAP---SMFPP---------RYIH-.PSDN
RGA1_SCHPO/862-1019----------------VITP---NILYS---------KSND-.PVDE
TAGAP_HUMAN/101-250----------------CIGP---NMLTL---------END.-..QSL
Q9XW53_CAEEL/264-412----------------CLAP---SFLES---------PD..-..PME
BEM3_YEAST/927-1096----------------VFSP---TLNIP---------I...-..SML
RGA2_SCHPO/1083-1234----------------VFSP---TLNIP---------....-..SDI
RGAP7_ARATH/176-325----------------CMAP---LLLRP---------LL..-..AGE
YIL2_SCHPO/178-325----------------CIGP---SFSKA---------DN..-..IAE
RGA6_SCHPO/332-510----------------IFGP---LLLGN---------SST.-.DLSK
RGA5_SCHPO/68-226----------------IFQP---GILSH---------PDHE-VYSKD
BAG7_YEAST/76-235----------------IVQP---SLLSH---------PKD.-..EMC
OCRL_HUMAN/735-875----------------LFTS---LLLRP---------P...-..PNL
Q8STW6_ENCCU/162-313----------------LFSL---VLHPQ---------AAFT-.TLDD
Q8SRX9_ENCCU/91-256----------------IMMP---NLVIK---------PHS.-..ELD
Q9VUR5_DROME/55-207----------------SVAP---SFFQS---------CVS.-.DGKT
A1Z9I5_DROME/395-538----------------IFGP---TIVGY---------....-.....
B4IM29_DROSE/1223-1375----------------VFGP---TLLRP---------GQT.-.....
B4R2Z0_DROSI/903-1054----------------IFGP---SIIRT---------PND.-.....
B9EHI3_MOUSE/380-524----------------RIAP---SMLWN---------PS..-.....
C5DZH4_ZYGRC/1013-1185----------------VFAP---GLIRD---------YNG.-.....
E9PYS6_MOUSE/532-680----------------CFGP---TLLPV---------PA..-.....
F6YU97_CALJA/140-288----------------VFGP---TLLKP---------EKE.-.....
F6Z0J4_XENTR/128-275----------------IFSP---LLFRI---------Q...-.....
F7C997_MACMU/242-408----------------CFGP---VLLPA---------RQ..-.....
H0YIK5_HUMAN/99-243----------------VFGP---TIVAH---------....-.....
M2TU31_COCH5/545-687----------------CWAP---SIMGP---------HKG.-.....
Q0KHR5_DROME/1068-1216----------------IWGP---TLLAK---------KSD.-.....
Q54DW4_DICDI/28-177----------------VFAP---NILRP---------QKE.-.....
Q8IJX0_PLAF7/215-361----------------IFAP---TFFRS---------KT..-.....
Q9VFK2_DROME/579-728----------------CLAQ---SIFHS---------S...-.....

PF08101

Q6C001_YARLI/166-664VWMSSLSIEQPEMNKALFGR...SLVVEVEIAPGPGGRRWV-VVEEI
R7YJ86_CONA1/46-524VWMTSLANEESTERKAVFGR...CALIETRI.GG...GKWL-VMEEQ
Q0CXG4_ASPTN/43-519VWISSLAGEEPVSRKAVFGR...CALLETVI.KN...TKWL-VLEEQ
Q6FSL9_CANGA/51-451TWLSTLSYEETSDKRKIFGR...SLILEFEF.DGF..KKWV-VFQES
A7TPE0_VANPO/51-441VWESSLSYEQTIEKRSLFGK...ILLLEFKF.DQF..TKWV-AFQAV
B2AXU5_PODAN/42-515VWLTSLAPEETSERKSTFGR...CAVIETII.RD...GRWL-VMEEI
Q75EK6_ASHGO/155-597SWKYEM..........FLGKIYNTLVIKLTKRVGD..CDWI-VISTD
G8B672_CANPC/35-437AWLSSLASEQPPSIKKIFGR...SIVVEVEV.LGF..QKWI-VVTEK
H2AY21_KAZAF/42-448TWLSSLSYEQTSQKKKIFGR...SLILEFEF.DGF..KKWV-VFQEC
G0SCJ0_CHATD/41-514VWMSSLAPEETPERKSAFGR...CAVVETDI.KS...GRWL-VFEEI
M7P709_PNEMU/52-510VWIDSCSEETPIFKKTLFGK...SFLFEIEL.DE...KKWL-VIEEQ
C7YI83_NECH7/41-509VWMTSLAPEETAERKSAFGR...CAIVETKI.TG...GRWL-VMEEM
C5DWH8_ZYGRC/26-427TWLSSLSSEQTSERKKTFGR...SLILEFEF.DGF..KKWV-LFQES
Q59KB4_CANAL/48-454TWLASISSDQPSVTKQIFGR...SIVVEAEV.LGF..QKWI-VVTEK
L8FN12_PSED2/45-518VWISSLAGEETAERKAAFGR...CALVETVI.PH...GKWL-VIEEQ
G4U9K6_NEUT9/44-513VWMSSLAPEETLERKAAFGR...CAVIETLI.RA...GRWL-VMEEI
MSB1_YEAST/68-472TWLSSLSFEQTSEKKKIFGR...SIILEFEF.DGF..KKWV-VFQEC
G8JR31_ERECY/75-468TWMSTLSHEQSTEKRKIFGR...SLIVEFEF.DGI..KKWV-IVEES
A7TL24_VANPO/24-431TWLSSLSNEQTSEKKRLFGR...SLIIEFEF.DGL..KKWV-VFQEC
G0VGB1_NAUCC/47-451AWLSTLSYEQTSQKKKIFGR...PLILEFEF.DGF..KKWV-VFQEI
F9X960_MYCGM/45-521VWMTSLAGEEPTGRKAVFGR...CALIETTI.MN...GKWL-IMEEQ
G8ZXX4_TORDC/64-466AWLSTLSYEQTSQKEKLFGR...SLILEFEF.DGF..KKWV-MFQEC
W1QG29_OGAPD/54-458TWLASLGSEETSAKKKMFGK...TYILEVELAEGF..KKWV-IVEEQ
S7ZE60_PENO1/43-511VWISSLSADEPSARKAVFGR...CALIETRI.RD...TKWL-VLEEQ
Q6CUF4_KLULA/46-446AWLSTLSYEQTSQKRKMFGR...SLILEFEF.DGF..KKWL-ILEEC
A7ELT0_SCLS1/45-517VWISSLAG