Sequence alignment for CL0410

PF04941

RPOB_NPVSL/4-783-VVSDFDHVYNIIRNN.YNLNY-----------------------YLNCAD.RSNNVCTIK-------------------
Q9J825_9ABAC/4-779-VIADFNRLYDKLREK.YNLRY-----------------------YLNCNN.KSVNTCTVK-------------------
Q9YMS3_NPVLD/4-744-VVRDFDALYDTMLEK.FGLSF-----------------------FLSCAD.RALDRVSLH-------------------
RPOB_NPVOP/4-757-VVRDFDALYAKLEAPPHNLRL-----------------------VLECCA.PESGPLDLA-------------------
Q99H09_9ABAC/4-774-VIADFNKLYDNIRNQ.HNLDF-----------------------YLNCND.RSVNECTLK-------------------
Q9DVS4_9BBAC/3-715-IIEDFNKLYRYLES..FDLKF-----------------------LLSCQS.SVVI.TSLK-------------------
O55596_NPVBM/4-749-VVQDFNELYDKIENK.YKLKY-----------------------TFDCATNNSNERILFG-------------------

PF00562

B7WY91_COMTE/723-1292VVTAKRGGIVDYVDAT----RI.......................VIRV.N-DDEAVAGEV...................
RPOB_DESOH/723-1286AVVARRPGEVVYVDSG----RI.......................VVRH.D-TDDKDPEAK...................
RPOB_GEOLS/851-1417SVIARHNGVVDAVDAG----RI.......................VIKI.D-EEEYDETGT...................
D1NBR7_9BACT/651-1192VVAAKADGIVAEVCSE----HI.......................IVTP..-.DGNLPAPDAD.................
Q9AIH1_CARRU/596-1191SVGASLIPFLSHNDAN----RC.......................LMGS.N-MQRQAVPLIDSENPIVGTGNELEIGLNS
Q8SQY8_ENCCU/673-1023GYVAGLVPFPHHNQSP----RN.......................TYQC.A-MGKQAIG.....................
RPOB_NEOSM/711-1263VIVAKRAGVVQYIDAR----NI.......................VVAS..-.ESKD..DF...................
RPOB_SALRD/694-1211CVVAEGEGVVEYVDAE----RL.......................VVRY..-.DEEQDKTDLTF................
RPOB_LACDA/679-1067ALLAEADGEVEYVDAN----EI.......................RVRR..-.EDQT..L....................
Q74MN2_NANEQ/131-507GILSAAVPYARFNQSA----RL.......................NRGE.R-TQRQALG.....................
RPB2_IIV3/687-1053GIVAGIIPFPDRTQSA----RN.......................CFYS.S-MVKQAIG.....................
Q22C62_TETTS/682-1065SILPSQIPFLNYNQSP----RN.......................MYQC.Q-MAKQTMG.....................
A2EN74_TRIVA/632-991SLIASLTPFSDYNQSP----RN.......................MYQC.Q-MAKQTMG.....................
Q90022_ORFV/654-1041RVPRRVRGLLARGHQP----QLRA...................GAILGC.A-QAKQAIS.....................
RPOB_BORAP/667-1059VVKAKRSGEVILATSN----KI.......................VVKP..-FESEN..VK...................
RPOB_SYNAS/717-1284VVVAKRSGIVESVDAS----RI.......................VIKC..-.ESAE..KTDR.................
RPOB_DEHSC/650-1123VIFAKHAGVASSVTSE----KI.......................IIRT..-.AE....GG...................
RPOB_PARDP/739-1300AIMARRGGIIDQVDAQ----RI.......................VIRA..-.TEDLGAGDA..................
RPOB_AQUAE/796-1374VVVAKRGGVVEEVDSS----KI.......................IIRV..-.NPEEINFDDPL................
A5Z8Z3_9FIRM/700-1129CVVAKRAGVIERSTSK----EI.......................TIRY..-.DDN...GE...................
Q4GZE8_TRYB2/673-1036GVVAGIIPFPHHNQSA----RN.......................TFQS.A-MGKQALG.....................
RPOB_UREPA/837-1300AVVAKNDGVVEFVDSQ----KI.......................IIRN..-.DNDK..L....................
A7YUZ1_FRATU/718-1276CIIARNVGEVAEVDSN----RI.......................VIKV..-.DTEK..SQTS.................
RPA2_DICDI/662-1031SLLANLTPFSDYNQSP----RN.......................MYQC.Q-MAKQTMG.....................
RPOB_CORGB/629-1051LVITPVAGVVENVSAD----FI.......................TIMA..-.DD....GK...................
Q1NPU6_9DELT/719-1284CLLAGGDGVIEEVDAN----RI.......................VVRY..-.DEPG..TDGF.................
Q0EVW7_9PROT/695-1254SQVARRGGFIERVDGE----RI.......................VVRV..-.GEDE..QVEG.................
A0CUT2_PARTE/739-1109GVCASVIPFANHNQGP----RN.......................TLQS.A-MGKQAMG.....................
A7UZT8_BACUN/679-1194QITAEGDGVVEFVDAT----TI.......................RILY..-.DRTEEEEFVSF................
Q5AFK6_CANAL/673-1039SILANLTPFSDFNQSP----RN.......................MYQC.Q-MGKQTMG.....................
RPOB_KORVE/828-1399VVLARRSGIIDSVDSE----RV.......................IVRV..-.EGEHHPMQLSR................
RPOB_EIMTE/562-966ILKAYQEGIVVYVSSY----KI.......................IIRD.L-YNRKI.......................
Q4A245_EHV8U/683-1058GICVSQIPFCDHNQSP----RI.......................AYQA.A-QCKQAIG.....................
Q1L6W4_9TRAC/184-547AIGAFVIPFVNHNQSS----RV.......................MQQSRK-HCRQAIG.....................
A2E3T5_TRIVA/686-1052GVCAGVVPCPHHNQSP----RN.......................TYQC.A-MGKQAIG.....................
Q4N2L4_THEPA/737-1128SLSASLTPFSNHNQSP----RN.......................MYQC.Q-MLKQSVG.....................
RPOB_MYCGE/814-1279TMSSPCSGVVSYVDNS----KI.......................IITS..-.DSSK..K....................
O21237_RECAM/676-1397SLSASMIPFLEHNDGN----RA.......................LMGSNM-QKQAVPLLNLEKSLIGTGIEGIIGRDFF
RPOB_PLAF7/525-929LIISYQEGIVIYVSCI----KI.......................IIRD.L-FNRQI.......................
A4E9H0_9ACTN/589-1012VTLAKNAGEVIFADAA----KI.......................IVKH..-.......AG...................
Q8TXI7_METKA/159-536GTCCSCIPWPESNSAP----RN.......................TMGT.N-MTRQALG.....................
A4WN98_PYRAR/656-1029GAIASIIPFLEHNQSP----RN.......................QYEA.A-MAKQSLG.....................
RPOBC_HELPY/729-1296AIKANRAGVVEKIDSK----NI.......................YILG..-.ESKE..EA...................
Q6Q8Z4_9GAMM/699-1253CIVARNSGVVESVDAS----RI.......................VVRV..-.TDKK..SKT..................
Q9FKF1_ARATH/698-1075GVVAGLIPYPHHNQSP----RN.......................TYQC.A-MGKQAMG.....................
Q5RB08_PONAB/668-1031SVIANFIPFSDHNQSP----RN.......................MYQC.Q-MGKQTMG.....................
A7XDR4_PEWBP/753-1146VVIAEDSGFVVYVDAK----KI.......................IIQN..-.NHGE..K....................
RPOB_PELUB/725-1287TIVASRDGTVDKIDGK----RI.......................VIKA..-.TEETDFTKS..................
Q5CSG7_CRYPI/757-1165SVTASLIPYAHHNQSP----RN.......................MYQC.Q-MLKQTMG.....................
Q1L6W0_9TRAC/133-496GLGASVIPFPNHNQSS----RV.......................MQQAQK-HGKXAIG.....................
A0D7M6_PARTE/653-1033SCVTGLVPFPHHNQSA----RN.......................TFQC.Q-MGKQSLG.....................
Q4UB41_THEAN/764-1155GVVAGLIPFPNHNQSP----RN.......................TYQC.A-MGKQSIG.....................
RPOB2_SCEOB/49-472THISPFDSFSCLFASQ----SI.......................ESLQ..-.......NQ...................
A7AXE5_BABBO/518-899CIISSTSGIIVLSTNY----KI.......................TILD.D-NNRYV.......................
RPOB_PSEAK/1488-2086YAINDKKRRVEIINSS----SLFY...................NNLIPQ..-............................
RPOB_MAGSM/722-1281TITARRTGVVDEVDAA----RI.......................VVKA..-.DEEPGSTEP..................
A6DPM7_9BACT/669-1185VLTAKADGIVASSVSD----KI.......................IITKDG-VLKDEEDLK...................
Q583H5_TRYB2/722-1094GICASIIPYPNHNQSP----RN.......................TYQS.A-MGKQAMG.....................
RPOB_OSTTA/585-1008TIVAKQNSYISYVDAQ----RIDYFTPVIGDTNLIDYQNLTAEDVFASN..-.......QF...................
RPOB_THEPA/517-924CITSLCEGIIVSVNNY----KI.......................IVMD.D-KNRYL.......................
RPOB_FUSNN/673-1063VVTTKVSGKVTYVDGK----KI.......................IIED..-.KDKKEH.....................
RPOB_DEIGD/617-1059SVISDVTGRVTYVDAR----AI.......................QVTL..-.TEDAPQIGLV.................
A8B2N4_GIAIC/761-1143GYVVGLIPYPHHNQSP----RN.......................CYQC.S-MGKQASG.....................
Q3LVX3_BIGNA/673-1033SFTASLIPFWNHNQSP----RN.......................IYQC.Q-MSKQAIG.....................
A2SSM5_METLZ/135-540GIGAAHVPFPEHNASP----RV.......................TMGA.G-MIKQALG.....................
Q5GAH6_9VIRU/620-1017DVMSAVIPFYDHTQSP----RN.......................AYQS.N-MGKQAIG.....................
RPOB_DESDG/714-1278CIIAEADGVVRYADAD----RI.......................VVSY..-.EGDLYPRTG..................
Q27493_CAEEL/647-1005SFAGNLIPFPDHNQSP----RN.......................VYQC.Q-MGKQTMG.....................
Q5MIL2_CHLP6/660-1172IVVAEEDGVVEYVDGY----KV.......................VIAA..-.KHNPTLK....................
Q9YVT7_MSEPV/705-1077GKMAGV..........----RG.......................TFGA.A-QYKHIIT.....................
Q1L120_MYCAA/199-587NFRARNEGKVEYVDGA----KI.......................KIRN..-.NKGT..L....................
Q5YF54_ISKNV/603-966DAMSAVIPFYNHTQSP----RN.......................AYQS.N-MGKQAVG.....................
RPOB_PHATC/874-1274TLNSYSNGVVSSVTAN----KI.......................VVND..-.KTGK..R....................
RPB2_ASFB7/780-1141GLAALVSPYANCTQPA----RV.......................TYET.N-QGRQTGG.....................
A8B827_GIAIC/681-1140SILGLLVPFSDHNQSP----RN.......................MYEC.Q-MLKQTMG.....................
Q4ZJA8_FLDV/552-932DVMASVIPFYNHAPSP----RI.......................AYQS.N-MGKQAVG.....................
Q07DU9_MAIZE/693-1067GLSCGIIPFANHNFAR----RV.......................LYQSEK-HSQQAIG.....................
Q8SSB7_ENCCU/630-975GIIAGLIPYSDHNQSP----RN.......................MYQC.Q-MAKQAIG.....................
RPOB_PHOPR/715-1263TAVAKRGGQVQSVDAS----RI.......................VVKV..-.NEDE..LVPG.................
Q1L6V8_9TRAC/152-501GLSASVIPFLDHNHSS----RV.......................THQAQK-HGKQAIG.....................
RPOB_EHRRW/738-1291VVLAKRSGIVHRVDGL----YI.......................VIRAFD-KEKNE..YL...................
Q06VE3_TNAVC/706-1065GLLAGEIPYANYTPSP----RA.......................CYKT.N-MARQSMG.....................
Q98S72_GUITH/656-1015SIVPGCTPFFDMNQSP----RN.......................MYQC.Q-MAKQSIG.....................
Q5CPZ8_CRYPI/817-1197GVVSGLIPYPNHNQSP----RN.......................TYQC.A-MGKQVMG.....................
A0RXX0_CENSY/642-1018GAGASIIPYPEHNQSP----RN.......................TYES.A-MAKQSLG.....................
RPOB_GNEPA/588-1017LAISTQEGRIQYSDAA----TI.......................VSVL..-.......KG...................
A4I1A3_LEIIN/1105-1506SLTSATIPFFEHNCSP----RN.......................LFQC.G-LSKQSSG.....................
A5ULN7_METS3/133-507GICAGIIPFSDHNSSP----RN.......................TMEA.G-MTKQALG.....................
Q98RY5_GUITH/732-1110GVCASLIPFCDHNQSP----RN.......................TYQA.A-MGKQAIG.....................
RPOB_PORYE/620-1023VVISRTSGHVNYVSAN----KI.......................GIQD..-.NSGR..T....................
Q98S96_GUITH/637-966GISASLIPFSDHNQSP----RN.......................TYQC.S-MGKQSAS.....................
Q1L6W1_9MARC/306-677GLSASVIPFPHRNQSS----RN.......................LFQAHK-HSKQAIG.....................
Q980R1_SULSO/174-547GITASIIPYPEHNQSP----RN.......................TYQS.A-MAKQALG.....................
Q8KTP8_TREPR/703-1210AIRARYAGRVAYVDPL----HI.......................AIVPIC-ENQGHAC.....................
A7BQQ8_9GAMM/365-1039TVVAERGGIIDSVDAA----RI.......................VVRI..-.NDDE..VLKEGEDNSIT..........
Q0N5M4_VARV/670-1047GYVASSLVGINHNSGP----RA.......................ILGC.A-QAKQAIS.....................
A4RSZ5_OSTLU/678-1042SCVASLTPWSDFNQSP----RN.......................MYQC.Q-MAKQTMG.....................
Q1Q128_9BACT/647-1145TVQSEKNGTVTKVSSN----EI.......................VIDN..-.NE.........................
RPOB_RUTMC/721-1282CVTAKHSGVVEAVDAS----RI.......................VIRV..-.DSKK..TKAS.................
A6DE89_9PROT/728-1294IVKAKRDGKVIKVDAK----NI.......................YILG..-.EDEN..GA...................
A0SEA6_9MOLU/200-587AIVATEGGVVKYVDSK----RI.......................VVEQ..-.......KN...................
RPOB_RHOBA/664-1160VVRARRAGKVTYADAT----RI.............................-.......EI...................
RPO2_MIMIV/724-1093GLISSNIPFPDHNQSP----RG.......................IFQY.N-QARQAMG.....................
Q8II17_PLAF7/942-1400SFLASLTPFSDHNQSP----RN.......................IYQC.Q-MLKQTMG.....................
RPC2_MOUSE/666-1041GVCAGLIPYPHHNQSP----RN.......................TYQC.A-MGKQAMG.....................
E2RU19_GIAIC/790-1189SAITSLIPFPDHNQSP----RN.......................LYQA.S-MGKQAVG.....................
Q236N3_TETTS/662-1046GVVSGLVPYPHHNQAS----RN.......................TFQC.A-MGKQALG.....................
Q9EMY3_AMEPV/709-1081GKMTGV..........----RG.......................TFGT.A-QSKHIIT.....................
RPOB_ASTLO/574-991TIIAKESGTVIYSSSK----KI.......................IIQKKS-KKSKFKNINLFKKYFKKKL.........
RPOB_TOXGO/547-957TIKALQEGIVLNASSL----KI.......................HIKD.L-FNREI.......................
RPOB_SACHY/586-984SVIAEREGKIISSDSH----KI.......................LLSS..-.......SG...................
RPB2_IIV6/722-1098GVMAAQIPFAEHTQSP----RL.......................CYQS.S-MAKQAIG.....................
Q2WGI3_SELUN/574-977TITAAQGGKTDYTDGE----RT.......................TSVN..-.GEET.......................
A2E7H8_TRIVA/710-1082GVCGTIIPFPDHNQSP----RN.......................TYQC.A-MGKQAIG.....................
RPOB_THEP1/758-1175VTLAEHDGIVKEVDAA----RI.......................VVHR..-.TDENGNLMYDDK...............
RPOB_RICAH/733-1293SVLALHDGIVEQVDSN----RI.......................VIR...-.TLEQ..KIDG.................
Q3LW27_BIGNA/705-1066GVSASQVPFSQHNQSP----RN.......................TYQS.S-MGKQAIG.....................

PF04941

RPOB_NPVSL/4-783----------------------------------------------YLQERKSYFCCAVDESTGRCVLHRCV-LIVFGTW
Q9J825_9ABAC/4-779----------------------------------------------YLQERRSYFCCAVD.SFERCVLHKCV-LVIFGTW
Q9YMS3_NPVLD/4-744----------------------------------------------GLRERQSYFCCAVD.AANRCVLHKCV-LVVFGTR
RPOB_NPVOP/4-757----------------------------------------------AIQERKSYTCCALN.NRRNCVLHKCV-VVVFGTA
Q99H09_9ABAC/4-774----------------------------------------------YLQERKSYFCCAAD.TVGRCVLHKCV-LVVFGTW
Q9DVS4_9BBAC/3-715----------------------------------------------QLQDRKTYFCCAVRES..KCILHNCV-VVVIGTY
O55596_NPVBM/4-749----------------------------------------------AIQERKSYLCCALN.EQLNCVMHKCV-PVIFGTR

PF00562

B7WY91_COMTE/723-1292...........................................GVDIYNLI.KYQRSNQN.T...NIHQRP..IVSRGDK
RPOB_DESOH/723-1286...........................................PVTVYNLS.KFIRSNQN.T...CFNHRP..IVKKGQR
RPOB_GEOLS/851-1417...........................................GVDIYNLV.KFSRSNQN.T...CINQKP..VVKVGDK
D1NBR7_9BACT/651-1192.........................................KKSYQYYRLY.KYLRSNAG.T...SVNQRP..IVEHGQA
Q9AIH1_CARRU/596-1191NYNI.................LSDLNGYVLYSDNYKIIIKNNNFIKTYFLE.KYTRTNQN.T...ILNQYT..KVLKGDF
Q8SQY8_ENCCU/673-1023..............................................HISLN.VKKRFDSV.ILQLTYTHRP..MVSTK.I
RPOB_NEOSM/711-1263...........................................WIDSYTLC.KFRKSNHN.T...CIHQRC..VVHQGQR
RPOB_SALRD/694-1211.........................................GEPVQEYELT.KFRRTNQG.T...CMNQKP..IVQAGDR
RPOB_LACDA/679-1067.............................................DTYTLE.KYRRSNAT.K...NYNQTP..NVKRGDK
Q74MN2_NANEQ/131-507..............................................LYSVA.YPLRFESD.VHVAQTLQKP..LVRTI.V
RPB2_IIV3/687-1053..............................................FVPC..HNLKTETV.SHTLNYPQKP..LVTTS.F
Q22C62_TETTS/682-1065..............................................TSMHN.FPYRFDNR.IYRLLNGQIP..MVKGM.D
A2EN74_TRIVA/632-991..............................................YPSHR.EAASTEVK.TYHVHYPQRP..IVRTM.E
Q90022_ORFV/654-1041..............................................CLTAD.LRNKVDNG.I.HLMFAERP..IVVSK.A
RPOB_BORAP/667-1059...........................................DLDEYHIV.KYERTNQD.T...CFNQSV..LVKEGQK
RPOB_SYNAS/717-1284.........................................DTGVDIYTLI.KYQRSNQD.T...CFNQKA..IVNKGQR
RPOB_DEHSC/650-1123............................................HDEYLLK.KFVRTNQG.T...CINQHA..IINKGQK
RPOB_PARDP/739-1300...........................................GVDIYRLR.KFKRSNQS.S...TINQRP..LVKVGDK
RPOB_AQUAE/796-1374.........................................DIGIDIYELR.KFQRTNQK.T...CVNQRP..IVRKGEK
A5Z8Z3_9FIRM/700-1129............................................KETYKLL.KFQRSNQS.N...CYNQRS..IVFKGDH
Q4GZE8_TRYB2/673-1036..............................................TIAYN.QYIRMDTV.LMLGAYPQRP..LCRTK.A
RPOB_UREPA/837-1300.............................................DDYKLI.KYRKSNQD.T...CNNQIP..IVKVGQR
A7YUZ1_FRATU/718-1276..........................................NLVDIYSLT.KFKRSNKN.T...CINQRP..IVNVGDK
RPA2_DICDI/662-1031..............................................TPLHS.YPFRTDNK.LYKVQNVQKP..IVHTK.N
RPOB_CORGB/629-1051............................................RETYLLR.KFQRTNQG.T...SYNQKP..LVNLGER
Q1NPU6_9DELT/719-1284.........................................TTGIGIYRLE.KYKKSNQN.T...CFTQRP..LVDPGVR
Q0EVW7_9PROT/695-1254.........................................EPGVDIYRLF.KYRRSNQN.T...CFNQRP..LVKMGDK
A0CUT2_PARTE/739-1109..............................................LNSTN.FNIRFDTL.VHILHYPQKP..LASSR.A
A7UZT8_BACUN/679-1194.........................................EPALKEYNIP.KWRRTNQN.M...TIDLRP..ICEKGQR
Q5AFK6_CANAL/673-1039..............................................TPGTA.LVHRSDNK.LYRLQTGQTP..IVKAN.L
RPOB_KORVE/828-1399.........................................EVGSDIYQLT.KFKRSNQN.T...CINQKP..IVKQGDH
RPOB_EIMTE/562-966..............................................TYFLD.KYKRSNHF.T...ILHSKP..NVWQGER
Q4A245_EHV8U/683-1058..............................................LYTTN.FAERLDTV.GHVLATPQKP..LVTTR.L
Q1L6W4_9TRAC/184-547..............................................FNCSN.LRVRCDTT.SHELLYPQRP..LVRTQ.A
A2E3T5_TRIVA/686-1052..............................................PTALN.IMHRVDKS.TYFNCYPQQP..MVQTR.T
Q4N2L4_THEPA/737-1128..............................................IPFHS.QFYRSEVK.TYVLTSLQRP..LVATK.E
RPOB_MYCGE/814-1279.............................................ETVNLV.KFERSNQN.T...CYNHKP..IVEIGQR
O21237_RECAM/676-1397NISKNLLLEKMTNENVFGISILKILKKENKNIIFSQFVDLFIKNHFLYSTI.KHKNSNQK.T...DIDFKY..VNKKNIN
RPOB_PLAF7/525-929..............................................IYYLN.NYKKINQN.I...LLIYKP..IVWVGEK
A4E9H0_9ACTN/589-1012...........................................GMDEYHLA.KYQRSNQS.T...CINHRP..LVRVGDT
Q8TXI7_METKA/159-536..............................................FYAAN.HPIRMESR.GHLLYYPHRP..LVKTR.G
A4WN98_PYRAR/656-1029..............................................LPQSN.FLYKLDSR.GHMLYYPERP..IVTTR.G
RPOBC_HELPY/729-1296...........................................YIDAYSLQ.KNLRTNQN.T...SFNQVP..IVKVGDK
Q6Q8Z4_9GAMM/699-1253...........................................ASDVYNLI.KYTRSNQN.T...CINQRP..IVKVGDT
Q9FKF1_ARATH/698-1075..............................................NIAYN.QLNRMDTL.LYLLVYPQRP..LLTTR.T
Q5RB08_PONAB/668-1031..............................................FPLLT.YQDRSDNK.LYRLQTPQSP..LVRPS.M
A7XDR4_PEWBP/753-1146.............................................KVYILS.TFDKSNQD.T...LILQKP..IVKFNEY
RPOB_PELUB/725-1287...........................................GVDIYNLQ.KFKRSNQN.T...CINQKP..LVRVGDK
Q5CSG7_CRYPI/757-1165..............................................TPCLN.HPYRTDNK.MYRLLTPQEP..TIITK.G
Q1L6W0_9TRAC/133-496..............................................FYCSN.FKSRSDTS.SHLLYYPQKQ..LVRTR.A
A0D7M6_PARTE/653-1033..............................................IIGMN.TQIRCDTQ.LYQLIYPQTP..LVRTV.S
Q4UB41_THEAN/764-1155..............................................SIGYN.QLQRCDTV.VHLMNYTQQP..LVTTK.T
RPOB2_SCEOB/49-472...........................................KFSKYSLQ.KYQRSNQD.T...LIVQRP..MVREGDW
A7AXE5_BABBO/518-899..............................................SYYLS.PYNIHDYN.Y...YTRYRP..VVWEGEK
RPOB_PSEAK/1488-2086..............................................NYILN.NYHRSNQD.T...YMIHRP..LVQEGQW
RPOB_MAGSM/722-1281...........................................GVDIYNLT.KFSRSNQN.T...CINQVP..LVKNGER
A6DPM7_9BACT/669-1185...........................................PENIYNLY.KFMRSNSS.T...CMNQKP..LVKAGDV
Q583H5_TRYB2/722-1094..............................................IYASN.FNMRMDTT.AHVLFYPQKP..LVRTK.A
RPOB_OSTTA/585-1008...........................................KHNTIWLT.SYQRSNQD.T...CLNHKP..LVEANTW
RPOB_THEPA/517-924..............................................HYYLY.PFNVLDYN.S...FVSYKP..IVWVGEK
RPOB_FUSNN/673-1063..............................................IYRLL.NYERSNQS.M...CLHQTP..LVDLGDK
RPOB_DEIGD/617-1059.........................................KGNVRTFELV.RFTRSNQG.T...NLDQHP..IVSVGDE
A8B2N4_GIAIC/761-1143..............................................AIAFN.QLERFETA.MFLLDYPQQP..LTSTK.I
Q3LVX3_BIGNA/673-1033..............................................AGLEN.SMFCQDTK.VMFLYYPQKY..LFKKF.N
A2SSM5_METLZ/135-540..............................................FAQAN.MKLRPDTR.GHMLHYAQVP..MVHTQ.A
Q5GAH6_9VIRU/620-1017..............................................FPAIN.CEDRYDAT.LHRLDYPQSA..LTESR.A
RPOB_DESDG/714-1278...........................................GVRSYDLQ.KYHKSNQS.S...CFGQKP..LVSRGQV
Q27493_CAEEL/647-1005..............................................TAVHA.WHSRADNK.MYRLQFPQQP..MLKLE.A
Q5MIL2_CHLP6/660-1172.............................................RTYDLK.KFLRSNSG.T...CINQRP..LCSVGDV
Q9YVT7_MSEPV/705-1077..............................................GPQDN.ILNKFESC.TYLSFPLQKS..CVTNI.P
Q1L120_MYCAA/199-587.............................................DTYSLK.NFQRSNQD.T...VIHQKP..IIKVGQD
Q5YF54_ISKNV/603-966..............................................LPCLN.YMSRWDVT.LDVLMYPQVP..LSRSK.A
RPOB_PHATC/874-1274.............................................LTYKLQ.KYLRSNQQ.T...CINHRP..IVWKGEQ
RPB2_ASFB7/780-1141..............................................WYCFS.WPYRVDMN.RFFQFYNEMP..LVKTI.A
A8B827_GIAIC/681-1140..............................................IPCRN.LAYKYDTK.SYLLTTPQKP..LVRNAII
Q4ZJA8_FLDV/552-932..............................................ITTLTGGRDRYDPT.FYSLDYPQKA..LARTI.C
Q07DU9_MAIZE/693-1067..............................................YSTTN.PHIRVDTL.SHQLYYPQRP..LFKTV.I
Q8SSB7_ENCCU/630-975..............................................HPAHN.IRTRTDPT.MYTVNYLQSP..IVRTE.G
RPOB_PHOPR/715-1263.........................................EAGIDIYNLT.KYTRSNQN.T...CINQRP..TVMPGEP
Q1L6V8_9TRAC/152-501..............................................VYACD.NLSRMEPT.AH.LYYPQKP..LVHSW.L
RPOB_EHRRW/738-1291...........................................GVDIYNLR.KFQRSNHN.T...CINQKP..LVKPGDY
Q06VE3_TNAVC/706-1065..............................................ILPSI.SKFNNHSN.SIHLNYAQAP..IITTR.C
Q98S72_GUITH/656-1015..............................................IPFHN.IWRKMDSK.IYFLFSVQIP..ICRNKIN
Q5CPZ8_CRYPI/817-1197..............................................SVGFN.QFLRCDSV.LYLLVYPQKP..LCKTR.T
A0RXX0_CENSY/642-1018..............................................FSTPM.MNTSTYVR.QHFMLYPQTP..IVNTR.A
RPOB_GNEPA/588-1017...........................................NTTQTELQ.IYQRSNSN.T...LMHQKT..HASQAKY
A4I1A3_LEIIN/1105-1506..............................................TQLQA.LAWRKEAK.LFRTYCPQRY..ISRTL.P
A5ULN7_METS3/133-507..............................................LYVSN.YALRTDTR.AHLLHHPQTP..IVKTR.I
Q98RY5_GUITH/732-1110..............................................INVSN.YDFRMDTM.CHILYYPQKP..LVCTK.S
RPOB_PORYE/620-1023.............................................VHYRLK.KYYRSNQD.T...CINQRP..IVWVGEK
Q98S96_GUITH/637-966..............................................FLGFN.QNSRIDIT.LSLLIYPQKP..ILKTK.I
Q1L6W1_9MARC/306-677..............................................VYVTN.LACRADTS.GQHLFYPQVQ..LVKTN.I
Q980R1_SULSO/174-547..............................................LYAAN.YQLRTDTR.AHLLHYPQRP..LVQTR.A
Q8KTP8_TREPR/703-1210..............................................TYRLA.RNVRTNQG.T...QADHRP..TVIPGSY
A7BQQ8_9GAMM/365-1039..................................PKFGTLLSSGVDIYNLT.KYVRSNQN.T...CINQKP..LVKPDDL
Q0N5M4_VARV/670-1047..............................................CLSSD.IRNKIDNG.I.HLMYPERP..IVISK.A
A4RSZ5_OSTLU/678-1042..............................................TPMHT.ICYRSDTK.LYRLHTPQRP..LALTC.T
Q1Q128_9BACT/647-1145..............................................IYKLR.KFVGLNEG.T...CLNQKP..IVTEGQK
RPOB_RUTMC/721-1282.........................................ELGVDIYNLT.KYSRSNQN.T...CINQKP..LVKTGDK
A6DE89_9PROT/728-1294...........................................YIDHYGLE.KYLRTNQN.T...CFDQRP..IVKVGDV
A0SEA6_9MOLU/200-587...........................................GIKNYDLN.DFNRSNNG.T...AITHIP..IVKVGDK
RPOB_RHOBA/664-1160...........................................GSDHYPLK.KYQGLNER.T...CQNQKP..LITVGDK
RPO2_MIMIV/724-1093..............................................LYISD.YRERTDIS..YILYHPQIP..LVTSR.A
Q8II17_PLAF7/942-1400..............................................IQSLN.NVYTFTNK.IYRMITPQFP..LVVTR.D
RPC2_MOUSE/666-1041..............................................TIGYN.QRNRIDTL.MYLLAYPQKP..MVKTK.T
E2RU19_GIAIC/790-1189..............................................IYALN.YLKRFDTSGINVMHYPQLP..LVTTR.S
Q236N3_TETTS/662-1046..............................................IIGST.SMNRVDTI.LYQLIYPQTP..LLKTK.V
Q9EMY3_AMEPV/709-1081..............................................GPPDN.VMNKYDTC.NYLAYPIERP..SITNI.P
RPOB_ASTLO/574-991..................................KKNKKIKKHKHTIYLLN.IDEKNNSN.I...YQTRTS..IVKKNDW
RPOB_TOXGO/547-957..............................................VYYLS.KYKKSNQN.T...IIHQKP..LVWNGER
RPOB_SACHY/586-984...........................................KTISIPLV.AHRRSNKN.T...CMHQKP..RVPRGKS
RPB2_IIV6/722-1098..............................................NIPS..HHVKSDNT.TRVMDYVQRP..LVTTQ.I
Q2WGI3_SELUN/574-977..............................................IDTESVMYRSPNNS.T...RVHQRPNGRFGKGGF
A2E7H8_TRIVA/710-1082..............................................LYTTN.YMIRMDSS.SHVLWYPQKP..LVATR.N
RPOB_THEP1/758-1175........................................GNPVVDEYRLL.KFVRSNQD.T...MINQKP..IVNEGDF
RPOB_RICAH/733-1293.........................................SPSVYIYNLL.KFQKSNHN.T...CINQKP..LVQVGHY
Q3LW27_BIGNA/705-1066..............................................INYSN.FQLRYDTQ.INILESNQRP..LVFTI.Q

PF04941

RPOB_NPVSL/4-783LDKKFRKKEFSGGDATCGGGGGDGDQDQDAIDERSNIKGTFMID-----GRFLSFPNVMMNNNILMHNFYDKLYS..KNC
Q9J825_9ABAC/4-779LDLEFRCDD.....................ENKSAQFNGTFMID-----GRYLSFPNIMMNNNILIHNFYDKLYS..KDC
Q9YMS3_NPVLD/4-744LDLRFRGV..................AAADEDAARGVYGTFMID-----GRHLSFPNIMMNNNVLVHNFYDKLYS..KSC
RPOB_NPVOP/4-757LDARLRAPS...................AEFDAQNNLRGTFMLD-----GRFLSFPNIMMNNNVLMHNFYDKLYA..KHC
Q99H09_9ABAC/4-774LDKQLRCND......................APRPDLNGTFMLD-----GRHLSFPNVMMNNNILIHNFYDKLYS..KSC
Q9DVS4_9BBAC/3-715LDKVFRNNE.......................PDHGFTGTFIID-----GRHFSFPNILMNNNILLHNFFDKQYARNKNL
O55596_NPVBM/4-749LDKQFRETD....................DIDANNNINGTFMLD-----GRFLSFPNIMMNNNVLVHNFYDKLYA..KHC

PF00562

B7WY91_COMTE/723-1292LAK-----------------------------------GDVLAD.....GASTDLGEIAIGQNMLIA-------------
RPOB_DESOH/723-1286VAP-----------------------------------GDVLAD.....GPATEKGELALGKNVTVA-------------
RPOB_GEOLS/851-1417VKR-----------------------------------GDVIAD.....GPSTDMGELALGQNIIVA-------------
D1NBR7_9BACT/651-1192VKK-----------------------------------GDILAD.....GAATQDGELALGRNVLVA-------------
Q9AIH1_CARRU/596-1191VKV-----------------------------------GNIIAD.....SNSTKNGEISLGKNLRVA-------------
Q8SQY8_ENCCU/673-1023LDL-----------------------------------IN..............YNEIPAGQNAMVA-------------
RPOB_NEOSM/711-1263VKK-----------------------------------GDILAD.....GPAIQKGELALGRNLVVA-------------
RPOB_SALRD/694-1211VEE-----------------------------------GEVLTD.....GFAMEKGELALGKNVLCA-------------
RPOB_LACDA/679-1067VVD-----------------------------------GQVIAN.....GPSMADGELALGQNPVIA-------------
Q74MN2_NANEQ/131-507HDL-----------------------------------IR..............FDERPAGYNMVVA-------------
RPB2_IIV3/687-1053AEY-----------------------------------NQ..............LNEYPNGINAIVA-------------
Q22C62_TETTS/682-1065PES-----------------------------------YG..............LSDYPSGTNAIVA-------------
A2EN74_TRIVA/632-991QDS-----------------------------------HA..............LEDFLLGTNACVA-------------
Q90022_ORFV/654-1041LET-----------------------------------SK..............IADNCFGHHVTIA-------------
RPOB_BORAP/667-1059VER-----------------------------------GEIIAD.....GPATRYGELALGNNLLLG-------------
RPOB_SYNAS/717-1284VRK-----------------------------------GDIIAD.....GPATDNGELALGHNVMVA-------------
RPOB_DEHSC/650-1123IAA-----------------------------------GQVLAD.....SSATENGELALGQNCVVA-------------
RPOB_PARDP/739-1300VVK-----------------------------------GQVVAD.....GPSTDQGELAIGRNVVVA-------------
RPOB_AQUAE/796-1374VEK-----------------------------------GQIIAD.....GHSTDRGELALGKDVLVA-------------
A5Z8Z3_9FIRM/700-1129VEA-----------------------------------GEVIAD.....GASTSNGEIALGKNPLIG-------------
Q4GZE8_TRYB2/673-1036MNL-----------------------------------TN..............YEILGAGINAMVC-------------
RPOB_UREPA/837-1300VHK-----------------------------------SETIGD.....GPAMQNGELALGRNILVG-------------
A7YUZ1_FRATU/718-1276VEA-----------------------------------GDILAD.....GFATDFGELSLGHNLMVA-------------
RPA2_DICDI/662-1031QFK-----------------------------------FR..............CNDYPHGCNAVIA-------------
RPOB_CORGB/629-1051VEA-----------------------------------GQVIAD.....GPGTFNGEMSLGRNLLVA-------------
Q1NPU6_9DELT/719-1284VKK-----------------------------------GEILAD.....GPACEQGELALAKNVTVA-------------
Q0EVW7_9PROT/695-1254VVK-----------------------------------GDIIAD.....GPSTDMGELALGRNVLVA-------------
A0CUT2_PARTE/739-1109VDF-----------------------------------IT..............VNEVPIGINCVTS-------------
A7UZT8_BACUN/679-1194VTA-----------------------------------GQILTE.....GYSTEDGELALGKNLLVA-------------
Q5AFK6_CANAL/673-1039YDD-----------------------------------YG..............MDNFPNGMNAIVA-------------
RPOB_KORVE/828-1399VKK-----------------------------------GQVIAD.....GPCTDHGELGLGRNVLVS-------------
RPOB_EIMTE/562-966IFC-----------------------------------GQILTS.....TQDILFSEYIGGNNLLVS-------------
Q4A245_EHV8U/683-1058EEL-----------------------------------LG..............TSVVRSGAVPIVA-------------
Q1L6W4_9TRAC/184-547MTL-----------------------------------IG..............RPELHNGQNPIVA-------------
A2E3T5_TRIVA/686-1052IRL-----------------------------------SR..............YHEMPCGQNAMVA-------------
Q4N2L4_THEPA/737-1128YEK-----------------------------------MG..............FQDYPTGVNCVVA-------------
RPOB_MYCGE/814-1279VNK-----------------------------------DEIIVD.....GPAVNKSELALGQNVLVA-------------
O21237_RECAM/676-1397IFE-----------------------------------NNIDNI.....GYSIKNNELSLGNNVLVG-------------
RPOB_PLAF7/525-929VNI-----------------------------------GQILAI.....NSNLLNSEYSLGNNLLVG-------------
A4E9H0_9ACTN/589-1012VEQ-----------------------------------GEPLAD.....GPSTDHGELALGQNLTVA-------------
Q8TXI7_METKA/159-536TEA-----------------------------------FD..............YDERPAGQNMIVA-------------
A4WN98_PYRAR/656-1029LEL-----------------------------------VG..............YSKRPAGQNAVVA-------------
RPOBC_HELPY/729-1296VGA-----------------------------------GQIIAD.....GPSMDRGELALGKNVRVA-------------
Q6Q8Z4_9GAMM/699-1253VKA-----------------------------------GDILAD.....GPSVDNGELALGQNIRIA-------------
Q9FKF1_ARATH/698-1075IEL-----------------------------------VG..............YDKLGAGQNATVA-------------
Q5RB08_PONAB/668-1031YDY-----------------------------------YD..............MDNYPIGTNAIVA-------------
A7XDR4_PEWBP/753-1146VNK-----------------------------------GDIIAD.....GSSTHQGELALGKNVTVA-------------
RPOB_PELUB/725-1287VKS-----------------------------------GDIIAD.....GPSTKLGELALGKNVTVA-------------
Q5CSG7_CRYPI/757-1165YSS-----------------------------------FG..............FSEYPTGTNAIVA-------------
Q1L6W0_9TRAC/133-496SAL-----------------------------------LE..............RPEFTNGQNAIVA-------------
A0D7M6_PARTE/653-1033MEA-----------------------------------VN..............QHRLPAGHNAQVA-------------
Q4UB41_THEAN/764-1155IQL-----------------------------------VN..............FDKLPAGQNAIVA-------------
RPOB2_SCEOB/49-472VQS-----------------------------------GDLLAD.....CASSLGGELCLGKNIFIA-------------
A7AXE5_BABBO/518-899SNI-----------------------------------GTILAI.....PSDAANCEFTLGFNNFVN-------------
RPOB_PSEAK/1488-2086VEK-----------------------------------GDILAD.....SSVSVQGELSIGQNILVG-------------
RPOB_MAGSM/722-1281VTA-----------------------------------GDIIAD.....GPSTQIGELALGRNVLVA-------------
A6DPM7_9BACT/669-1185VKA-----------------------------------GDVIAD.....GFGTDNGELALGQNVLVA-------------
Q583H5_TRYB2/722-1094MSY-----------------------------------MR..............SNDLPAGHNAIVA-------------
RPOB_OSTTA/585-1008VEA-----------------------------------GDCLAD.....NAATAKGELALGRNILIG-------------
RPOB_THEPA/517-924INI-----------------------------------GKILAL.....PSDLKHSEFTLGVNNLLN-------------
RPOB_FUSNN/673-1063VKA-----------------------------------GDIIAD.....GPATKLGDLSLGRNILMG-------------
RPOB_DEIGD/617-1059VVP-----------------------------------GQVIAD.....GPASDQGRLALGQNITIA-------------
A8B2N4_GIAIC/761-1143LKL-----------------------------------TG..............YERLPAGQNATVC-------------
Q3LVX3_BIGNA/673-1033RII-----------------------------------TR..............RGLLPYGNNIIIS-------------
A2SSM5_METLZ/135-540AEL-----------------------------------IG..............SDNRPQGQNFCVA-------------
Q5GAH6_9VIRU/620-1017IER-----------------------------------VN..............FDTMAHGALPVVA-------------
RPOB_DESDG/714-1278IRK-----------------------------------GDVLAD.....GPGIEDGELALGKNLVVA-------------
Q27493_CAEEL/647-1005YEK-----------------------------------YE..............MDEYPLGTNACVA-------------
Q5MIL2_CHLP6/660-1172VVK-----------------------------------GDVIAD.....GPATDKGELALGKNILVA-------------
Q9YVT7_MSEPV/705-1077KDI-----------------------------------SG..............ISKNGMGQHILVG-------------
Q1L120_MYCAA/199-587VAK-----------------------------------GDLLVD.....GSSFKDGELALGKNLLVA-------------
Q5YF54_ISKNV/603-966MDA-----------------------------------LS..............FDTMPHGACPIVA-------------
RPOB_PHATC/874-1274VKS-----------------------------------GQILTD.....GPAITSSELSLGQNVLIG-------------
RPB2_ASFB7/780-1141HNY-----------------------------------VI..................PNGLNTIVA-------------
A8B827_GIAIC/681-1140HDI-----------------------------------GG..............FDTHPTGTNLVVA-------------
Q4ZJA8_FLDV/552-932YDR-----------------------------------YK..............FDIMCHGAVPIVA-------------
Q07DU9_MAIZE/693-1067ADC-----------------------------------LGRSDYASFGRKNDFARPEYFNGQNAIVA-------------
Q8SSB7_ENCCU/630-975YEM-----------------------------------VK................DYPVGINCMVA-------------
RPOB_PHOPR/715-1263VAR-----------------------------------GDVLAD.....GPSTDLGELALGQNIRIA-------------
Q1L6V8_9TRAC/152-501AQH-----------------------------------LT..............CPXLTNGTNCVVA-------------
RPOB_EHRRW/738-1291VRE-----------------------------------NDVIAD.....GSAIDQGELALGKNVLVA-------------
Q06VE3_TNAVC/706-1065AKA-----------------------------------TK..............VNEYPNGINAIVA-------------
Q98S72_GUITH/656-1015QDG-----------------------------------LG..............LDNFINGFNAVVG-------------
Q5CPZ8_CRYPI/817-1197IEM-----------------------------------IN..............FEQLPAGQNSSVA-------------
A0RXX0_CENSY/642-1018MGL-----------------------------------LG..............LEDRPAGQNCVVA-------------
RPOB_GNEPA/588-1017VRK-----------------------------------GQILAD.....GAAMLGGEICLGKNILVA-------------
A4I1A3_LEIIN/1105-1506MDY-----------------------------------YG..............LDDVNLGVNAVIA-------------
A5ULN7_METS3/133-507IDS-----------------------------------TN..............YDKRPSGQNFVVA-------------
Q98RY5_GUITH/732-1110MNF-----------------------------------IK..............FKDFPNGINAIVA-------------
RPOB_PORYE/620-1023IVV-----------------------------------GQTLAD.....GASTDGGEIALGRNILVA-------------
Q98S96_GUITH/637-966LNL-----------------------------------IG..............AGKCPTGINTCIS-------------
Q1L6W1_9MARC/306-677VNC-----------------------------------LQ..............KDEIFSGQNAIVA-------------
Q980R1_SULSO/174-547LDI-----------------------------------IG..............YTNRPAGNNAILA-------------
Q8KTP8_TREPR/703-1210VQA-----------------------------------GDVIAD.....GPASEGGVLALGRDVLVA-------------
A7BQQ8_9GAMM/365-1039IKR-----------------------------------GDVLAD.....GPSTDLGELALGQNLFVA-------------
Q0N5M4_VARV/670-1047LET-----------------------------------SK..............IAANCFGQHVTIA-------------
A4RSZ5_OSTLU/678-1042YDK-----------------------------------YS..............LDDYALGTNAVVA-------------
Q1Q128_9BACT/647-1145IKK-----------------------------------GEVIAD.....GAATHNGELSLGKNVLVA-------------
RPOB_RUTMC/721-1282ISA-----------------------------------ADVLAD.....GPSTDMGELALGQNMKIA-------------
A6DE89_9PROT/728-1294VKA-----------------------------------GDVIAD.....GPNMDNGEIALGKNVLVA-------------
A0SEA6_9MOLU/200-587VKK-----------------------------------RDILAD.....GPSMEKGELALGQNVVVA-------------
RPOB_RHOBA/664-1160VEK-----------------------------------GQIIAD.....GAATQKGELALGRNVLVG-------------
RPO2_MIMIV/724-1093SKY-----------------------------------TG..............THIFPAGENSIVA-------------
Q8II17_PLAF7/942-1400YEF-----------------------------------YG..............VDNFPSGTNAVVA-------------
RPC2_MOUSE/666-1041IEL-----------------------------------ID..............FEKLPAGQNATVA-------------
E2RU19_GIAIC/790-1189MPH-----------------------------------VK..............FRYLPAGQNVIIA-------------
Q236N3_TETTS/662-1046IEY-----------------------------------AG..............YDKFPAGHNASIA-------------
Q9EMY3_AMEPV/709-1081MEI-----------------------------------SG..............IARNSIGTHVLVG-------------
RPOB_ASTLO/574-991IKK-----------------------------------GQIIAE.....GIGSLNGNLCLGKNILVG-------------
RPOB_TOXGO/547-957VFT-----------------------------------NQLLTQ.....HQDIIDSEFAIGNNLLFY-------------
RPOB_SACHY/586-984IKK-----------------------------------GQILAE.....GAATVGGELALGKNVLVA-------------
RPB2_IIV6/722-1098AEM-----------------------------------NR..............FNDFPNGLNAMVA-------------
Q2WGI3_SELUN/574-977PRK-----------------------------------GQIAAD.....SGAAEGGESASGINISTA-------------
A2E7H8_TRIVA/710-1082MRY-----------------------------------LN..............FNKLPAGINVTVA-------------
RPOB_THEP1/758-1175VKK-----------------------------------GDPIAD.....GPATDMGELALGRNILVA-------------
RPOB_RICAH/733-1293VKK-----------------------------------NDIIAD.....GPSTDNGEIALGRNVLVA-------------
Q3LW27_BIGNA/705-1066KLC-----------------------------------LR..............GQEMPSGINTIMA-------------

PF04941

RPOB_NPVSL/4-783KRMFLYGN-VDEEKRINRAIQLVYDDHEDVLFARDVYAKDYVVSENLNETLETYLRS--SGKWEPLNFLFDFDKNQTDKM
Q9J825_9ABAC/4-779KRMFLYGN-FDEEKNINRAIQLVYDNQRDVLFARDVYASEYVVTEDLNAILEIYLKN--SGKWAPLNFIFNFSKEQSLQL
Q9YMS3_NPVLD/4-744KRMFLYGN-VDEEKQVNRAIQLVYSNVEDALFARDVYARDYVVTGELNKILHVYLKQ--SGKWEPLNFLFNYTPAQSASL
RPOB_NPVOP/4-757KRMFLYGN-VDAEKHINRAIQLVYDKATRRLFARDVYASDYVVTDDLNAVLETYLAS--SGKWRPLDHLFRYSKAHKQQL
Q99H09_9ABAC/4-774KRMFLYGN-LDEEKKINRAIQLVYDHQNDVLFARDVYAKDYIVTEDLNQILEIYLSR--SGKWEPLNFLFEYTAKQVVQL
Q9DVS4_9BBAC/3-715RRMFLYGN-YDDDKIINRAIQLVYDRGEDILYVRDVYAKDYVVDSGINSVLRQYLRC--SGKWKNMDFVFDFDDYND..I
O55596_NPVBM/4-749KRMFLYGN-VDQEKHINRAIQLVYDKQNDVLFARDVYASDYVVTEDLNSVLETYLAN--SGKWKPLDFLFEYNTLHKQQL

PF00562

B7WY91_COMTE/723-1292--FMPWNG.YNYEDSVMINERIVADDRYTSIHIEEL...VVMA..........RDTK..LGA.EEITRDIPNL.......
RPOB_DESOH/723-1286--FMPWGG.YNFEDSILVGETLVRDGVFTSIHIEEF...EVVA..........RDTK..LGK.EEITCDIPNV.......
RPOB_GEOLS/851-1417--FMPWGG.YNFEDSILVSERLTKDDRYTSIHIEEF...ECVA..........RDTK..LGK.EEITADIPNL.......
D1NBR7_9BACT/651-1192--YMPWCG.YNFEDAIIVSERLVKEDVYTSIHVDEF...EITS..........RETK..LGP.EEITRDIPNV.......
Q9AIH1_CARRU/596-1191--FMSWYG.YNFEDSILLSSSILNKNNFNSIHIYEF...ITVL..........KYNE..NGF.EIVSNECFGS.......
Q8SQY8_ENCCU/673-1023--VMSYSG.YDIEDALVLNKTSVERGLFRVEVYKT.....TTTL........LKKHS..NGMSDVLWPNP..........
RPOB_NEOSM/711-1263--FLSWRG.YNFEDSVVISSNVVRDDLFTSVHLEGF...ECVV..........RDTR..LGP.EEITRDVSGV.......
RPOB_SALRD/694-1211--FMPWHG.YNYEDAIVISERLVADDVYTSVHIEEF...EHEV..........RDTK..RGE.EELTREIPNV.......
RPOB_LACDA/679-1067--FTTWNM.YNFEDAIMLSERLVKEDVYTSIHIEDY...DSEA..........RDTK..LGP.EEITREIPNV.......
Q74MN2_NANEQ/131-507--VMAYEG.YNTQDALVINRNAIDFGFTRTMYFRP.....YEAV........ERKYA..LGLSDE.ITVP..SPDV....
RPB2_IIV3/687-1053--IACYTG.YNQEDSIILNKSSIDRGLFGTITYNT.....FTA..........QEKK..NGIIEERIEIPSNAI......
Q22C62_TETTS/682-1065--VISYTG.YDMEDAMILNKSSYERGFGHGCVYKN.....YSYD.......VAELNKEKNSKFKMLNEVKNID.......
A2EN74_TRIVA/632-991--VLSYTG.YDMEDALLINKCSVERGFGHGCIYKTHRYTAEEIESN...SYFCNTKD.......................
Q90022_ORFV/654-1041--LMSFRG.MNQEDGIILKRQFAERGGLDILTCKK.....YQV.................EIPLENFNKPERV.......
RPOB_BORAP/667-1059--VIPWNG.FNYEDAILISDRIVKEDLYTSIHIKEF...SIEV..........RETK..LGP.EKVTGDIPNV.......
RPOB_SYNAS/717-1284--FMSWGG.YNYEDSILVSERIVKEDIYTSIHIEEF...ETMA..........RDTK..LGK.EDITRDIPNV.......
RPOB_DEHSC/650-1123--FMSWQG.FNYEDAIILSERLVREDAFTSIHITKH...ELEA..........RDTK..LGV.EEITRDIPNV.......
RPOB_PARDP/739-1300--FMPWNG.YNYEDSILISERIHRDDVFTSIHIDEY...EVAA..........RDTK..LGP.EEITRDIPNV.......
RPOB_AQUAE/796-1374--FMPWRG.YNFEDAIVISERLVKEDVYTSIHIEEL...EVEA..........RETK..VGE.EEITRQIPGV.......
A5Z8Z3_9FIRM/700-1129--FMTWEG.YNYEDAVLLSERLVQDDVYTSIHIEEY...ETEA..........RDTK..LGP.EEITNDVPGV.......
Q4GZE8_TRYB2/673-1036--VMSYSG.YDIEDAQVYNRSSLDRGYGRCVVLRK.....HEVE........LERLP..NGEYDIILPADSNV.......
RPOB_UREPA/837-1300--YTTWRG.YNFEDAIIISERLVDQDVFTSIHIDEH...TIQC..........MKTK..NGD.EEITRDMPNV.......
A7YUZ1_FRATU/718-1276--FMPWNG.YNFEDSILLSERIVKDDKYTSIHIEEF...TCVA..........RDTK..LGP.EEITADIPNV.......
RPA2_DICDI/662-1031--VISNTG.YDMEDAMIINKSAYERGFGHGSVYKN.....EYIDLDQGLSRFEQKKT........FFGRPNTV.......
RPOB_CORGB/629-1051--FMPWEG.HNYEDAIILNQNIVEQDILTSIHIEEH...EIDA..........RDTK..LGA.EEITRDIPNV.......
Q1NPU6_9DELT/719-1284--FMPWRG.YNYEDSILVNERLLKQDTYTSLHIEVF...ETVA..........RDTK..LGK.EEVTRDIPNV.......
Q0EVW7_9PROT/695-1254--LMPWRG.YNFEDAIVISEKLVREDVYTSIHIEEF...ECVS..........RDTK..LGS.EEITRDIPNV.......
A0CUT2_PARTE/739-1109--IACFTG.YNQEDSIIINQYAIDRGFFRSVFYRT.....YKES........EDKDP..DNFTETKITKPIGDN......
A7UZT8_BACUN/679-1194--YMPWKG.YNYEDAIVLNERVVREDLLTSVHVEEY...SLEV..........RETK..RGM.EELTSDIPNV.......
Q5AFK6_CANAL/673-1039--VISYTG.YDMDDAMIINKSADERGFGYGTVYKT.....EKVDL......SQSRRR..GDPITQHFGFGSDE.......
RPOB_KORVE/828-1399--FMPWRG.YNFEDAILVSEKLVKEDYYTSVHIEEF...EIEA..........RDTK..LGP.EEITRDIPNV.......
RPOB_EIMTE/562-966--YGNFFG.YNFEDAIVLNKKIIYSQLFTSLHFKVY...EIIF..........NSLN..KFSFEISTINLPKK.......
Q4A245_EHV8U/683-1058--IMCYSG.FNQDDSVLLNQSSIDRGLFTSFAYHT.....IRD..........EEKG..TGADIERFENPKNIPGC....
Q1L6W4_9TRAC/184-547--VLSDTG.YNQEDSIILNQSSLDRGMFRSMHFHT.....HKDA........L......KPTLDQRFGEPSESDVG....
A2E3T5_TRIVA/686-1052--IMSYSG.HDIEDALLMNKASLDRGFGRRYYLSK.....LDLM........LKNYQ..GGVIGDRIAPLDRERP.....
Q4N2L4_THEPA/737-1128--IIAHSG.FDMEDAMILNKASVDRGLFNSFIYKS.....KVIDLN...SQASSTKE..RGGTVEYFNNMDKD.......
RPOB_MYCGE/814-1279--FTTWNG.YNYEDAIVISERLVKEDILTSLTINEY...VAQC..........LSTK..NGD.EQITRDIPNV.......
O21237_RECAM/676-1397--FTSMNG.HTFEDSIVISERIVRDNYFQSIHLEV....Y.............KTMEMYEKDSQEIIRNFLST.......
RPOB_PLAF7/525-929--YGSYLG.YEYEDAIIISRKILYNNLYTSLHLNIY...EISL..........NIIN..NIP.EICSINLSKM.......
A4E9H0_9ACTN/589-1012--YMPWEG.FNYEDGIVVSERLVAEDLLTTINITRH...EIDA..........RDTK..LGP.EEITREIPNL.......
Q8TXI7_METKA/159-536--VLTYEG.YNMEDAIIMNESAIERGLARSFFFKT.....FEDE........ARTYP..GGMKDK.FCIP..EKEV....
A4WN98_PYRAR/656-1029--LLTYTG.YNIEDAVILNKASVERGMFRSVFYRT.....YETE........EQRYP..GGEEDK.IEIP..DSSV....
RPOBC_HELPY/729-1296--FMPWNG.YNFEDAIVVSECITKDDIFTSTHIYEK...EVDA..........RELK..HGV.EEFTADIPDV.......
Q6Q8Z4_9GAMM/699-1253--FMPWNG.YNFEDSILISEKVAREDRFTSIHIQEI...VCIA..........RDTK..LGS.EEITADIPNV.......
Q9FKF1_ARATH/698-1075--VMSFSG.YDIEDAIVMNKSSLDRGFGRCIVMKK........IV.....AMSQKYD..NCTADRILIPQRTG.......
Q5RB08_PONAB/668-1031--VISYTG.YDMEDAMIVNKASWERGFAHGSAYKS.....EFID.......LSEKIK..QGDSSLVFGMKPGD.......
A7XDR4_PEWBP/753-1146--FMTWDG.YNYEDAVILSERLVQEDIFTSVHISKY...EIQV..........RELKKGAGR.EEITREIPNV.......
RPOB_PELUB/725-1287--FMPWQG.YNFEDSILISERCVTDDVFTSVHIVEY...EVMA..........RDTK..LGE.EEITRDIPNV.......
Q5CSG7_CRYPI/757-1165--VMSYSG.YDMEDAMILNKSSYDRGMFHACVYKT.....KIISAA....PPSATKK..SDAESYFFHNIGPD.......
Q1L6W0_9TRAC/133-496--IACYSG.YNQEDSIIMNQSSIERGLYRTMHYHT.....FHFD........I......PANVDEEFRKPSASDVG....
A0D7M6_PARTE/653-1033--VMSYSC.YDIEDALIMNKSSLDRGFGRTAVYKK.....SVTEC.....EINQRNK..ESRFNERIDEPPTKTHN....
Q4UB41_THEAN/764-1155--VMSYQG.YEIEDAIILNKASIDRGFARCYTLRR.....LTC..........EITP..GNATSINGYNPNKS.......
RPOB2_SCEOB/49-472--YMPWEG.YNYEDAILISQRLVTEDVYTSVHIESY...EVET..........KNTK..LGK.EQITNKIPDI.......
A7AXE5_BABBO/518-899--YSFYYG.YEHEDAIVLNKNVAYNDMLTSLEFDID...DIDL..........SFKK.......................
RPOB_PSEAK/1488-2086--YIPWEG.YNFEDAVLISERLIFDDLYTSLHIERY...EVEI..........RDTQ..FGL.EQITNQIPN........
RPOB_MAGSM/722-1281--FMPWNG.YNFEDSILISERLVAEDVFTSIHIDEF...EVMA..........RDTK..LGA.EEITRDMPNV.......
A6DPM7_9BACT/669-1185--FMPWCG.YNFEDAIIISERLVQDDVFTSIHIAEA...SIQA..........RDTK..LGP.EEITRDTPNV.......
Q583H5_TRYB2/722-1094--IACYSG.YNQEDSIIMSRSAVERGFFRSVFWRS.....YKAS........EEKKR..EGR.EM.FEIP..DRKV....
RPOB_OSTTA/585-1008--YMPWEG.YNFEDAVLVSERLVYDDVFTSIHISRY...EVST..........ARLR..EGQ.EYFTNQVDRN.......
RPOB_THEPA/517-924--YSFYNG.YEHEDAIVINKNLIIEDILTSISFDVY...EEYL..........SINK..LDYVELTLRHLLEY.......
RPOB_FUSNN/673-1063--FMPWEG.YNYEDAILISDRLRKDDVFTSIHIEEY...EIDA..........RTTK..LGD.EEITREIPNV.......
RPOB_DEIGD/617-1059--IMPFDG.FNFEDAICISEGLVRKDFYTSVHIEKD...EIEA..........RDTK..LGP.EKITRDIPGL.......
A8B2N4_GIAIC/761-1143--VMSYSS.FDIEDALILNRNAIDRGFGRCSIYRS.....VSTEL.....NSIGSKS..VDGIKDILLGPPKDH......
Q3LVX3_BIGNA/673-1033--IGSNSQ.NDMEDACVLNKFSSQNGLFHTIILKK.............................................
A2SSM5_METLZ/135-540--IISYEG.YNIEDALIFNKASVERGVGRSHFFRT.....YEGE........ERRYP..GGQVDR.IELP..EEDV....
Q5GAH6_9VIRU/620-1017--IMTAEG.FNQEDSIVLNASSLDRGLFSCVTYRT.....FAA.........NDKRR..SKYDSEQICLPEYGN......
RPOB_DESDG/714-1278--FMPWCG.YNFEDSILISERCVKEDVFTSVHIEEF...EVVA..........RDTK..LGP.EEITRDIPNV.......
Q27493_CAEEL/647-1005--VISYTG.YDMEDAMTINKASYQRGFAHGTVIKV.....ERIN.......LVTERE..RKTIFYRN.............
Q5MIL2_CHLP6/660-1172--FMPWYG.YNFEDAIIISEKLIKQDAYTSIYIEEF...ELTA..........RDTK..LGK.EEITRDIPNV.......
Q9YVT7_MSEPV/705-1077--FFSYN..KNIEDGVIVNKRSVENGMLSVITLNA..................IVAE..VSDIQINNNNPSPD.......
Q1L120_MYCAA/199-587--FSTYKG.YNYEDAIVLNERLAKKDVLTSIHIEEQ...TIQF..........RTSK..AGA.DELTRDIPNV.......
Q5YF54_ISKNV/603-966--VLTFDG.YNQEDSIILNRSSVQRGMFVSTTYKT.....LCE..........CEKHVKRCEFERIMCVPVDKR......
RPOB_PHATC/874-1274--YMPWQG.YNFEDAILINERLVYDDVFTSIHIERY...KIEI..........DRNS..DTL.ERTTKNIPNL.......
RPB2_ASFB7/780-1141--YMIYGG.YNQEDSVIVSQSFIDRGGFAGTFYRE..................EKVE..LESDIESFGKPDPLITK....
A8B827_GIAIC/681-1140--VSAYTS.YDMEDAALINKASLERGLFHGTVYSV.....HDIDCYDDKLMRYMRTV..ATAVPYLKRSPDYIVT.....
Q4ZJA8_FLDV/552-932--VSTMDG.YNQEDSVVLNKSSIDRGLFNITCYKT.....FVE.........IEKYK..SKHDSELIAHPDFSI......
Q07DU9_MAIZE/693-1067--VNVHQG.FNQEDSLVMNRASLERGMFRTEHLRS.....YKADV.....ENKDGTKRLKLKEKIDFGKTESK.......
Q8SSB7_ENCCU/630-975--VLSYTA.YDMEDALVINKNSIDRGLFTGYVYKT..................EKVP.......................
RPOB_PHOPR/715-1263--FMPWNG.YNFEDSILVSERVVQQDRLTTIHIQEL...SCVA..........RDTK..LGS.EEITADIPNV.......
Q1L6V8_9TRAC/152-501--VASYGG.FNQEDSLIVNQASVDRGLFRSTHFFV.....KKAS........L......DSKSSQHFGKSSDS.......
RPOB_EHRRW/738-1291--FMSWQG.YNFEDSIVISSEVVKKDVFTSIHIEEF...ECVV..........RDTA..LGP.EKIMRSIPDV.......
Q06VE3_TNAVC/706-1065--VMAHTG.FNQEDSIIINKSALDRGMFNATQRRE..................ITVDLRIGTIVDDMCKPPEDL......
Q98S72_GUITH/656-1015--VLSYSS.FDMEDAVVFNKSSIERGLGMSYIYNT.....SNFDVNLSMIKNLNKNY.......................
Q5CPZ8_CRYPI/817-1197--VMSFAG.YDIEDAIVMNKASVDRGFARCFVMKR.....QTIE........LQKLP..NGLSERVVRPISVGSGNT..G
A0RXX0_CENSY/642-1018--VLPFDG.YNIEDAIVLSKSSVDRGLARTFFYRI.....YDAE........AKQYP..GGMRDN.FEIPGAEDNI....
RPOB_GNEPA/588-1017--YMPWQG.YNFEDAILISECLIYKDIFTSFHITRY...ET.............TIC..TAECEKMTREIPRL.......
A4I1A3_LEIIN/1105-1506--ILAYTG.YDMDDAVIINSTAAQRGMLTAGVTVA.....KIVT.......AS.GKG..SDKDDVFV......FHN....
A5ULN7_METS3/133-507--LMSYEG.YNMEDAMVINKGSLERGLARSSFFRA.....YDTA........EKRYP..GGQEDK.FEVP..DKNI....
Q98RY5_GUITH/732-1110--IACYGG.YNQEDSIIMSQDSIDRGLFRSFFFRN.....YKDV........EKIKF..GGKKET.FEIP..NWKS....
RPOB_PORYE/620-1023--YMPWEG.YNYEDAFLISERLVYDDLYTSIHIEKY...EVEC..........RQTK..LGP.EEITREIPNV.......
Q98S96_GUITH/637-966--IMSFTG.YDVEDAIILNKSSVERGFFKTAFLRK.....TKI..........EISS..FRHLTQLFSKVNHN.......
Q1L6W1_9MARC/306-677--IACYTG.YNQEDSIIMDQSALDRGMFRTQHYRT.....FKSE........E......RSD.HETFGKPSAADDS....
Q980R1_SULSO/174-547--VMSFTG.YNMEDSIIMNRSSVERGMYRSTFFRL.....YSTE........EVKYP..GGQEDK.IVMP..EAGV....
Q8KTP8_TREPR/703-1210--FMPWEG.YNYEDSVAVSEALLRNGAYTSVHLDEV...SVDM...........DGD..DGCGTVLSRCVPGI.......
A7BQQ8_9GAMM/365-1039--FMPWNG.YNFEDSILISERVVEEERFTSIHIVEL...SCLA..........RDTK..LGA.EEITADIPNV.......
Q0N5M4_VARV/670-1047--LMSYKG.INQEDGIIIKKQFIQRGGLDIVTAKK.....HQV.................EIPLENFNNKERD.......
A4RSZ5_OSTLU/678-1042--VIAYTG.YDMEDAMIVNKGSLHRGFAHATLYKT.....LVEGISANETLSRRDNT.......................
Q1Q128_9BACT/647-1145--FMTWDG.YNFEDAMVISEALLKDDRFTSIHRDEF...EVEI..........RETK..LGR.EEFTRDIPNV.......
RPOB_RUTMC/721-1282--FMPWNG.YNFEDSILISEKVIQEDRYTTIHIEEL...TAYS..........RDTK..LGP.EEITADIPNV.......
A6DE89_9PROT/728-1294--FMPWNG.YNFEDAIVLSERIIRDDVYTSVHIYEE...VCEV..........RELK..HGL.EELTADIPGV.......
A0SEA6_9MOLU/200-587--FTTWNG.YNYEDAVIVSERVVIDDRFTSIHIDEY...TIER..........RQTK..QGQ.EEITRDIPNV.......
RPOB_RHOBA/664-1160--FMSFDG.FNYEDAIIISEELVRNDTYTSIHIEDF...DVEI..........RETK..LGR.EEFTRDIPNV.......
RPO2_MIMIV/724-1093--IASYTGLMNQEDSLVINDSAIQKGYMRAQALKK.....YMEI........IKKNP..ASSQTSIFMKPDRNKV.....
Q8II17_PLAF7/942-1400--ILAYTG.YDMEDALIINKASADRGIFRTHIYKT.....EFIDLQ...KVGESSNFVFGNNIRYLNNNKNNNKN.....
RPC2_MOUSE/666-1041--VMSYSG.YDIEDALVLNKASLDRGFGRCLVYKN........AK.....CTLKRYT..NQTFDKVMGPMLDAAT.....
E2RU19_GIAIC/790-1189--IAVYSG.FNQEDSLIMSQSAVDRGFMRATYYHT.....YEEMIS...SAASSINA..PDRIEK.FCRP.IGPNI....
Q236N3_TETTS/662-1046--VLSYSG.YDIEDATVLNKSSLDRGFGRTMVFKK.....YETE........IQKLK..MSGLTELLRGPPKEAEGSYKK
Q9EMY3_AMEPV/709-1081--FFSFN..YNVEDGVIVNKESINRGLLSVISLMS..................VKNE..LSDTQINNNNPSAE.......
RPOB_ASTLO/574-991--YLSWEG.YNFEDAIIISERLRNEDILTSIHVKKCKSFLINH..........KEKK......EEITKNIPDI.......
RPOB_TOXGO/547-957--YGNFCG.YDFEDAVIVSKRVLYQQLFSSLHMDIY...EFNF..........CYNN..ENDIEFSTLEIPKQ.......
RPOB_SACHY/586-984--YMPWEG.YNFEDAVLISERLVYEDIYTSFHIRKY...EIQT..........DTTS..QGSAEKITKQIPHL.......
RPB2_IIV6/722-1098--VAIYTG.FNQEDSIILNKASIDRGMFHVVTYKT.....IIV..........EERK..IGVNEKICMPVASV.......
Q2WGI3_SELUN/574-977--YTPREG.HNSEDSVPTSERPAFGDTYTSIHTEKY...EMEA..........RVTP..QGTAEIITGEIPHS.......
A2E7H8_TRIVA/710-1082--ICCYTG.YNQEDSLMLNASAIDRGLFRSYFFRT.....YKET.......AEGDGT..EGASEV.FTFP..DPQT....
RPOB_THEP1/758-1175--FMPWEG.YNYEDAILVSQELLEEDVFTSIHIEVY...ETQA..........RETR..LGP.EEITADIPNV.......
RPOB_RICAH/733-1293--FLPWNG.YNFEDSILISERIVKEDIFTSIHIEEF...EVIA..........RDTR..LGP.EEITRDIPNV.......
Q3LW27_BIGNA/705-1066--ILSYSG.FNQEDSLIINHSSVERGLFRTIIYKT.....FAER........ENTNV..NGIIEK.IELESKSSN.....

PF04941

RPOB_NPVSL/4-783FDRIKMIMRAEINYSID----SLS--------------------------------------------------NKI---
Q9J825_9ABAC/4-779VNQIKKIMATDINYSID----SLA--------------------------------------------------NKI---
Q9YMS3_NPVLD/4-744VEQIKKIMRAPINYSID----SLA--------------------------------------------------NKI---
RPOB_NPVOP/4-757VDHIKMIMHHDICYSID----NLA--------------------------------------------------NKI---
Q99H09_9ABAC/4-774VDIIKQTMRTQINYQID----SLS--------------------------------------------------NKI---
Q9DVS4_9BBAC/3-715FDKLKRIMSIDINYQID----SLS--------------------------------------------------NKI---
O55596_NPVBM/4-749VEHIKIIMNHDINYSID----SLA--------------------------------------------------NKI---

PF00562

B7WY91_COMTE/723-1292....SEQQLNRL..DES....GII.............................YV...................GAE...
RPOB_DESOH/723-1286....GEESLVDL..DES....GIV.............................RL...................GAE...
RPOB_GEOLS/851-1417....GEEALKDL..DES....GII.............................RI...................GAE...
D1NBR7_9BACT/651-1192....SEDALRNL..DSR....GVV.............................FE...................GAE...
Q9AIH1_CARRU/596-1191....NEK.IKNK..VKN....GII.............................KI...................GEF...
Q8SQY8_ENCCU/673-1023.......KESVL..DED....GLG.............................KP...................GKM...
RPOB_NEOSM/711-1263....AEEFLHCL..DEF....GIA.............................CV...................GAN...
RPOB_SALRD/694-1211....SEEATKDL..DER....GIV.............................RV...................GAE...
RPOB_LACDA/679-1067....GEDALKDL..DEN....GII.............................RI...................GAE...
Q74MN2_NANEQ/131-507RGYKGEKHYRHL..ESD....GIV.............................YP...................EAE...
RPB2_IIV3/687-1053..KIRDCNYGLV..GPD....GIV.............................RL...................RQR...
Q22C62_TETTS/682-1065....KSQIAEGL..EGD....GIP.............................AI...................GSV...
A2EN74_TRIVA/632-991....GVIVDPDL..DAD....GLP.............................FV...................GQR...
Q90022_ORFV/654-1041....ASAAYSKI..DVN....AWV.............................RL...................NAF...
RPOB_BORAP/667-1059....SEKILNKL..DEN....GII.............................RI...................GTY...
RPOB_SYNAS/717-1284....GEEALRNL..DDS....GIV.............................RM...................GVS...
RPOB_DEHSC/650-1123....GEESLREL..DED....GII.............................RI...................GAE...
RPOB_PARDP/739-1300....GEEALRNL..DEA....GIV.............................YI...................GAE...
RPOB_AQUAE/796-1374....PERALAHL..DEH....GIV.............................RV...................GTY...
A5Z8Z3_9FIRM/700-1129....GDEARKDL..DER....GII.............................RI...................GAE...
Q4GZE8_TRYB2/673-1036......GRHSAL..NSD....GIA.............................SK...................GAV...
RPOB_UREPA/837-1300....SDTAKRFL..DNQ....GIV.............................LV...................GAE...
A7YUZ1_FRATU/718-1276....SESSLAKL..DES....GIV.............................HI...................GAN...
RPA2_DICDI/662-1031....VDELDKFI..DTD....GLP.............................FV...................GRL...
RPOB_CORGB/629-1051....SEEVLKDL..DDR....GIV.............................RI...................GAD...
Q1NPU6_9DELT/719-1284....SEDALRNL..DES....GII.............................RS...................GAE...
Q0EVW7_9PROT/695-1254....GEDALRHL..DDC....GIA.............................YV...................GAE...
A0CUT2_PARTE/739-1109...FAGKLFIKL..DSD....GIV.............................PP...................GTK...
A7UZT8_BACUN/679-1194....SEEATKDL..DEN....GIV.............................RV...................GAR...
Q5AFK6_CANAL/673-1039...WPEAWKEKL..DAD....GLP.............................LI...................GVK...
RPOB_KORVE/828-1399....SESALRDL..DES....GVI.............................RI...................GAP...
RPOB_EIMTE/562-966....SFYSKRNL..DFF....GII.............................KE...................GSK...
Q4A245_EHV8U/683-1058.SGMKEADYSKI..DDK....GMP.............................II...................GKT...
Q1L6W4_9TRAC/184-547.GYKKQSHYEKL..DSD....GLP.............................HV...................GAA...
A2E3T5_TRIVA/686-1052.ENIASPQYSLL..DAD....GII.............................RP...................GER...
Q4N2L4_THEPA/737-1128....SKLIVKKL..DFD....GLP.............................RL...................GEK...
RPOB_MYCGE/814-1279....SDANKRYL..DEN....GII.............................MV...................GAE...
O21237_RECAM/676-1397.........DFL..DVD....GVI.............................HL...................GTN...
RPOB_PLAF7/525-929....YYKNIKHL..DKY....GII.............................KE...................GTY...
A4E9H0_9ACTN/589-1012....SEDMLANL..DED....GII.............................RI...................GAE...
Q8TXI7_METKA/159-536RGYRSEDAYKHL..GED....GLA.............................EV...................GER...
A4WN98_PYRAR/656-1029KGYRGPEAYSHL..DED....GIA.............................PP...................EVY...
RPOBC_HELPY/729-1296....KEEALAHL..DES....GIV.............................KV...................GTY...
Q6Q8Z4_9GAMM/699-1253....GEGSLNKL..DEC....GIV.............................YV...................GAE...
Q9FKF1_ARATH/698-1075...PDAEKMQIL..DDD....GLA.............................TP...................GEI...
Q5RB08_PONAB/668-1031.....PRILQKL..DDD....GLP.............................FI...................GAK...
A7XDR4_PEWBP/753-1146....SAEAIKNL..DSR....GII.............................IP...................GSE...
RPOB_PELUB/725-1287....NEEALKNL..DES....GIV.............................YI...................GAE...
Q5CSG7_CRYPI/757-1165....GELVVKEL..SAD....GLP.............................NI...................GQR...
Q1L6W0_9TRAC/133-496.GTRYQGSNDKL..DNE....GFP.............................YI...................GAA...
A0D7M6_PARTE/653-1033TKKKFIKKYHAL..DND....GIT.............................KV...................GAQ...
Q4UB41_THEAN/764-1155.........QNK..DSDSTNEYVI.............................GV...................GEP...
RPOB2_SCEOB/49-472....PEKEKNHL..DER....GIV.............................KL...................GTF...
A7AXE5_BABBO/518-899....KKYIETILIDNKK....KIF........................................................
RPOB_PSEAK/1488-2086....EKGEYDYI..DSN....GIA.............................KI...................GTW...
RPOB_MAGSM/722-1281....GEDALRNL..DES....GII.............................YV...................GAE...
A6DPM7_9BACT/669-1185....GEEALRNL..GPE....GVI.............................RL...................GSE...
Q583H5_TRYB2/722-1094.CHVKRADYTKL..DTD....GLI.............................KP...................GMP...
RPOB_OSTTA/585-1008.........QYL..DEF....GVV.............................KI...................GTW...
RPOB_THEPA/517-924....NRYNRYLI..NEV....GVS.............................SN...................QDY...
RPOB_FUSNN/673-1063....SESALRNL..DEN....GVI.............................MI...................GSE...
RPOB_DEIGD/617-1059....SEAALRDL..DED....GIV.............................RV...................GAE...
A8B2N4_GIAIC/761-1143..LKQYEGYHAI..EDD....GLC.............................AV...................GAH...
Q3LVX3_BIGNA/673-1033....VKQNNYLI..EKDKEKIALT.............................K....................NIR...
A2SSM5_METLZ/135-540QGSHGIGSYANL..DVD....GII.............................NP...................ETV...
Q5GAH6_9VIRU/620-1017..RNKDWDYTLL..DEN....GVISPALAS................PPHVRKHYVAKNKQESRRTGGALACACDTLW...
RPOB_DESDG/714-1278....GEDMLRNL..DGS....GII.............................RI...................GAN...
Q27493_CAEEL/647-1005....PREEIKTV..GPD....GLP.............................IP...................GRR...
Q5MIL2_CHLP6/660-1172....SEEVLANL..GED....GII.............................RI...................GAE...
Q9YVT7_MSEPV/705-1077...NANNNYSKI..NVM....GLP.............................DV...................GTV...
Q1L120_MYCAA/199-587....SKYAIRHL..DEH....GIV.............................LV...................GSE...
Q5YF54_ISKNV/603-966...RPGLVYDYL..GDD....GIF.............................DPAL...............ARGMF...
RPOB_PHATC/874-1274....NPREIRHL..NDD....GIV.............................TV...................GTF...
RPB2_ASFB7/780-1141.NLKPGANYEKL...VD....GFV.............................PV...................GTV...
A8B827_GIAIC/681-1140..HMDENYDTEL..DED....GLP.............................PV...................GAY...
Q4ZJA8_FLDV/552-932..RNRDLDYSLL..GKT....GVL.............................DPKLGKKNK....KYRCPLCDALW...
Q07DU9_MAIZE/693-1067.....RGRXDNL..DDD....GLP.............................YV...................GAS...
Q8SSB7_ENCCU/630-975...........L..DKGYFFTYLP.............................SV...................GQR...
RPOB_PHOPR/715-1263....GEAALSKL..DES....GIV.............................YI...................GAE...
Q1L6V8_9TRAC/152-501.........ASL..DSD....GLP.............................YI...................GAK...
RPOB_EHRRW/738-1291....NEDSLSHL..DDV....GIV.............................NV...................GAE...
Q06VE3_TNAVC/706-1065...RIRANYDNI..GED....GLP.............................IM...................GSI...
Q98S72_GUITH/656-1015....STLHYNCL....D....GIC.............................NV...................GNA...
Q5CPZ8_CRYPI/817-1197NRRFSFKNDSIL..DND....GVC.............................NV...................GVQ...
A0RXX0_CENSY/642-1018RGYKGEKSYRLL..EDD....GVI.............................AS...................EST...
RPOB_GNEPA/588-1017....ATYSLRHL..DKN....GLV.............................RV...................GSW...
A4I1A3_LEIIN/1105-1506LLSTGERFTAEL..EAN....GLPPKRANASLDAFSFDRDHKYPGLRDNNDVYCC...................AKR...
A5ULN7_METS3/133-507KGYRSEDAYRHL..DDD....GVV.............................NP...................ESY...
Q98RY5_GUITH/732-1110CNGIKIHSYEKL..DLD....GLI.............................GE...................GKK...
RPOB_PORYE/620-1023....SDNSLKDL..DRN....GIV.............................VG...................GSW...
Q98S96_GUITH/637-966....NKEVFEFL..NKS...............................................................
Q1L6W1_9MARC/306-677GGPRAMRSDQIL..EDD....GLP.............................YI...................GCN...
Q980R1_SULSO/174-547RGYKGKEYYRLL..EDN....GVV.............................SP...................EVE...
Q8KTP8_TREPR/703-1210....TQSQRDRL..DER....GIV.............................RV...................GSM...
A7BQQ8_9GAMM/365-1039....SESALKNL..DEA....GII.............................SI...................GAQ...
Q0N5M4_VARV/670-1047....RSNAYSKL..ESN....GLV.............................RL...................NAF...
A4RSZ5_OSTLU/678-1042....YTSENKQL..DGT....GSV.............................QL...................GSI...
Q1Q128_9BACT/647-1145....SEKALRNL..DEN....GII.............................RV...................GTK...
RPOB_RUTMC/721-1282....SELALAKL..DEV....GVV.............................YV...................GAR...
A6DE89_9PROT/728-1294....KPEYLSHL..DES....GIV.............................KV...................GTY...
A0SEA6_9MOLU/200-587....SEAIKKNL..DED....GIV.............................AI...................GSE...
RPOB_RHOBA/664-1160....SEKALRNL..DDT....GIV.............................QT...................GTY...
RPO2_MIMIV/724-1093.DNLRDANYDKL..SEE....GYA.............................KV...................ETV...
Q8II17_PLAF7/942-1400..LAYENKGKFL..NKD....GLP.............................CV...................QQK...
RPC2_MOUSE/666-1041..RKPIWRHEIL..DAD....GIC.............................SP...................GEK...
E2RU19_GIAIC/790-1189KGIKDPGCASYL..EAD....GLP.............................RV...................GNA...
Q236N3_TETTS/662-1046KQNRVLKKFGAL..DDD....GTP.............................IV...................GAS...
Q9EMY3_AMEPV/709-1081...NSNNNYSKI..SAT....GLP.............................SI...................GTV...
RPOB_ASTLO/574-991....KLKNVKNL..NNN....GII.............................KI...................GSK...
RPOB_TOXGO/547-957....SYYIKKNL..DSL....GII.............................KE...................GEK...
RPOB_SACHY/586-984....EEHLLRNL..DRN....GVV.............................RL...................GSW...
RPB2_IIV6/722-1098...RRMNNYSLLEDNPESPYFGVV.............................KV...................KSF...
Q2WGI3_SELUN/574-977....DDYFLRHS..DES....GLV.............................SP...................GSR...
A2E7H8_TRIVA/710-1082VKGIKLHDSSKI..DAD....GLA.............................IP...................GAV...
RPOB_THEP1/758-1175....SKELLKNL..DEN....GII.............................RV...................GAYVVS
RPOB_RICAH/733-1293....SEEALRHL..DEV....GII.............................YV...................GAE...
Q3LW27_BIGNA/705-1066.LFG.......L..DID....GTR.............................KI...................ETL...

PF04941

RPOB_NPVSL/4-783---IYKHAYLTHLLY.RPVLKMYQASKIDSAAAVS...........ESNGSLRKLGGNQSGAMYPKDCKKIVDTIVNGKL
Q9J825_9ABAC/4-779---IYKHDYLLWLIY.KPILKNYSAVVECGGGGGDDDDDNDDGRIKKATTTQCRKKKV.QSILFPKECKKVIDTIVNGKL
Q9YMS3_NPVLD/4-744---IYKHDYLLGLLY.KPLLDAFAASAAAS....................DGGKRKKT.QTVMFARECKKIVETVVNGRL
RPOB_NPVOP/4-757---IYKHAYLMELLLTSTVLQHYQKRAGENEALKRRL.......ECEGEPPASKRRKA.QSVLYGKESKKIVDSVVNGRL
Q99H09_9ABAC/4-774---IYKHVYLLSLIY.KPVLKCYEVMLKTAVDENEN.........SNCNGGANKRKKI.QSILYFKESKKIVDTIVNGKL
Q9DVS4_9BBAC/3-715---IYKHSYLLKITY.DNLLNIID..............................EDNNKKTIAFPAESKKIHDSIIAGKL
O55596_NPVBM/4-749---VYKHAYLIELLLTSTILQNYQRVLDKTADDD.............AYTVANKRRKI.QSVLYNKESKKIVDCIVNGRL

PF00562

B7WY91_COMTE/723-1292...VQPGDVLVGKVT--------------------------------------------P..KGETTLT..PEEKLLRAI
RPOB_DESOH/723-1286...VKPGDVLVGKIT--------------------------------------------P..KGETQLS..PEEKLLRAI
RPOB_GEOLS/851-1417...VKPGDILVGKIT--------------------------------------------P..KGETQLS..PEEKLLRAI
D1NBR7_9BACT/651-1192...VKPGDILVGKIT--------------------------------------------P..KSETELA..PEERLLRAI
Q9AIH1_CARRU/596-1191...VFSKDVIVGKMI--------------------------------------------P..KKKRKFS..PEEKLFKIV
Q8SQY8_ENCCU/673-1023...VRDGTVYVNKM.--------------------------------------------....SP...............
RPOB_NEOSM/711-1263...VEAGDVLVGKVT--------------------------------------------P..KSSSPVT..PEEKLLRAI
RPOB_SALRD/694-1211...ITPGDIIVGKIT--------------------------------------------P..KGETDPT..PEEKLLRAI
RPOB_LACDA/679-1067...VHDGDILVGKVT--------------------------------------------P..KGITELS..AEERLLHAI
Q74MN2_NANEQ/131-507...VKGKDVLIGRI.--------------------------------------------....SPPRFLEGG...ELALL
RPB2_IIV3/687-1053...VKKGDVLICKV.--------------------------------------------...................TI
Q22C62_TETTS/682-1065...IKKGTAVFQI..--------------------------------------------....................Y
A2EN74_TRIVA/632-991...VSKGCKLLRV..--------------------------------------------....................Y
Q90022_ORFV/654-1041...LEQGDAIARNVS--------------------------------------------...S............RTLDD
RPOB_BORAP/667-1059...VKPGDILVGKVT--------------------------------------------P..KSEGDIT..PEFRLLTSI
RPOB_SYNAS/717-1284...VKSGDILVGKIT--------------------------------------------P..KGETQLS..SEEKLLRAI
RPOB_DEHSC/650-1123...VGPDDILVGKIT--------------------------------------------P..KGETELS..AEEKLLRAI
RPOB_PARDP/739-1300...VGPGDILVGKIT--------------------------------------------P..KGESPMT..PEEKLLRAI
RPOB_AQUAE/796-1374...VKPGDILVGKVT--------------------------------------------P..KGETRLT..PEEKLLQAI
A5Z8Z3_9FIRM/700-1129...VRAGDILVGKVT--------------------------------------------P..KGETELT..PEERLLRAI
Q4GZE8_TRYB2/673-1036...VRQFDILVNKY.--------------------------------------------....TP...............
RPOB_UREPA/837-1300...VHEGDVLVGKTT--------------------------------------------P..RGNVETA..PEDRLLQTI
A7YUZ1_FRATU/718-1276...VEAGDILVAKIT--------------------------------------------P..KAEQQLT..PEERLLRAI
RPA2_DICDI/662-1031...IKPGEPYYTY..--------------------------------------------....................I
RPOB_CORGB/629-1051...VRDGDILVGKVT--------------------------------------------P..KGETELT..PEERLLRAI
Q1NPU6_9DELT/719-1284...IKSGDILVGKIT--------------------------------------------P..KGETQLS..PEEKLLRAI
Q0EVW7_9PROT/695-1254...VKQGDILVGKIT--------------------------------------------P..KGESQLS..PEEKLLRAI
A0CUT2_PARTE/739-1109...VDEEEPIIGK..--------------------------------------------............ELIIDNIML
A7UZT8_BACUN/679-1194...IEPGDILIGKIT--------------------------------------------P..KGESDPS..PEEKLLRAI
Q5AFK6_CANAL/673-1039...VEEGDPIVAY..--------------------------------------------....................Y
RPOB_KORVE/828-1399...VKAGDILVGKVT--------------------------------------------P..KGETQLT..PEEKLLRAI
RPOB_EIMTE/562-966...VLNNDILVSKIF--------------------------------------------...ITNINISLLPLYNLIYIL
Q4A245_EHV8U/683-1058...FYNGDVLIGKV.--------------------------------------------....VSMSLL......QADPK
Q1L6W4_9TRAC/184-547...LSSSDVIIGKL.--------------------------------------------....FT...............
A2E3T5_TRIVA/686-1052...IEKGMIYANKY.--------------------------------------------..................VPL
Q4N2L4_THEPA/737-1128...LTKNSPFYRI..--------------------------------------------.....................
RPOB_MYCGE/814-1279...VKEGDVLVGKVS--------------------------------------------P..KGQVEVS..PEEKLFKAI
O21237_RECAM/676-1397...VCTNDILIGKEK--------------------------------------------.................RQLL
RPOB_PLAF7/525-929...ILANNILISKLM--------------------------------------------...FMPFIFNNKSLINIINFL
A4E9H0_9ACTN/589-1012...VGPGDILVGKVT--------------------------------------------P..KGESALT..AEERLLRAI
Q8TXI7_METKA/159-536...VEGRDVIIGKT.--------------------------------------------....SPPRFL.E....EFRPE
A4WN98_PYRAR/656-1029...VSSSEVLIGKT.--------------------------------------------....SPPRFY.T....TLETE
RPOBC_HELPY/729-1296...VSAGMILVGKTS--------------------------------------------P..KGEIKST..PEERLLRAI
Q6Q8Z4_9GAMM/699-1253...VEPGDILVGKIT--------------------------------------------P..KGETQLS..PEEKLLRAI
Q9FKF1_ARATH/698-1075...IRPNDIYINKQ.--------------------------------------------....VPVDTV........TKF
Q5RB08_PONAB/668-1031...LQYGDPYYSY..--------------------------------------------....................L
A7XDR4_PEWBP/753-1146...VNEGDYLVGKIV--------------------------------------------IIPQSSLENN..PYEKLIQTI
RPOB_PELUB/725-1287...VKAGDILVGKVT--------------------------------------------P..KGDSASG..PEEKLLRSI
Q5CSG7_CRYPI/757-1165...LTKGSPICRV..--------------------------------------------....................E
Q1L6W0_9TRAC/133-496...LSSPDIVAGKV.--------------------------------------------....TS...............
A0D7M6_PARTE/653-1033...LHHGDIYVNKK.--------------------------------------------....TP...........QVPD
Q4UB41_THEAN/764-1155...VKPGQVLISTK.--------------------------------------------....APPTDFTTNGSMNGKNG
RPOB2_SCEOB/49-472...VHEGQILVGKVT--------------------------------------------P..IQKKYRS..GYEKLLYTI
A7AXE5_BABBO/518-899.......KIIIRIIS--------------------------------------------.......NLKKQKREALKRAV
RPOB_PSEAK/1488-2086...VKEGDILVGKIA--------------------------------------------P..IGQKKLT..AYENLLYDI
RPOB_MAGSM/722-1281...VKPGDILVGKVT--------------------------------------------P..KGETQLT..PEEKLLRAI
A6DPM7_9BACT/669-1185...VGPGDILVGKIT--------------------------------------------P..KSETELA..PEERLLRAI
Q583H5_TRYB2/722-1094...VIGGDIIVGKT.--------------------------------------------....IPVPKTLSE...E...S
RPOB_OSTTA/585-1008...VEAGDVLVGKIS--------------------------------------------P..QPDSDND..PESRLLRAI
RPOB_THEPA/517-924...MLFGDILSTKIR--------------------------------------------...YELSLSKNKKFFKVFKLI
RPOB_FUSNN/673-1063...VGPGDILVGKTA--------------------------------------------P..KGETEPP..AEEKLLRAI
RPOB_DEIGD/617-1059...VKPGDILVGKTS--------------------------------------------F..KGESEPT..PEERLLRSI
A8B2N4_GIAIC/761-1143...LKTGDIVINKGR--------------------------------------------HITNIP............GLS
Q3LVX3_BIGNA/673-1033...SLLNSLIINKSV--------------------------------------------...R............NLCHN
A2SSM5_METLZ/135-540...VNEKDVLIGKT.--------------------------------------------....SPPRFL.E....EPTGE
Q5GAH6_9VIRU/620-1017...IPAGTVIIGKV.--------------------------------------------..................AYR
RPOB_DESDG/714-1278...VKPDDILVGKIT--------------------------------------------P..KGETQLT..PEEKLLRAI
Q27493_CAEEL/647-1005...YFLDEVYYVT..--------------------------------------------....................F
Q5MIL2_CHLP6/660-1172...VKPGDILVGKIT--------------------------------------------P..KSETELA..PEERLLRAI
Q9YVT7_MSEPV/705-1077...MVKNDALYRC..--------------------------------------------................LKPKY
Q1L120_MYCAA/199-587...VIPGDVLVGRVS--------------------------------------------P..KGDDNPS..REEKLLAAI
Q5YF54_ISKNV/603-966...VTAGVVVVGK..--------------------------------------------....................M
RPOB_PHATC/874-1274...VRPGDILVGKVI--------------------------------------------S..NNTSEQL..PESKLLRAI
RPB2_ASFB7/780-1141...VKKGDIIIGK..--------------------------------------------................VAKIR
A8B827_GIAIC/681-1140...LSHGSVFY....--------------------------------------------.....................
Q4ZJA8_FLDV/552-932...FPAGTVLVGKV.--------------------------------------------...................AK
Q07DU9_MAIZE/693-1067...LQTNDIVIGKV.--------------------------------------------.....................
Q8SSB7_ENCCU/630-975...IQKDDTLYRY..--------------------------------------------....................V
RPOB_PHOPR/715-1263...VKGGDILVGKVT--------------------------------------------P..KGETQLT..PEEKLLRAI
Q1L6V8_9TRAC/152-501...MTAGDVVIGRM.--------------------------------------------....AL...............
RPOB_EHRRW/738-1291...VSAGDILVGKVT--------------------------------------------P..RPPVSLP..PETKLLVTI
Q06VE3_TNAVC/706-1065...IKKGDALLGK..--------------------------------------------....................V
Q98S72_GUITH/656-1015...LKKKDIILLN..--------------------------------------------.....................
Q5CPZ8_CRYPI/817-1197...VSEDDIIVNKM.--------------------------------------------....SPINTR......EYVGD
A0RXX0_CENSY/642-1018...VLGGDILIGKT.--------------------------------------------....SPPRFM.E....EYKEF
RPOB_GNEPA/588-1017...VQPGDVLVGKLR--------------------------------------------P..RSSEDFSRFPELRLLQDL
A4I1A3_LEIIN/1105-1506...VERVDPFTNK..--------------------------------------------..................SVY
A5ULN7_METS3/133-507...VESGDVLIGKT.--------------------------------------------....SPPRFL.E....EIDEF
Q98RY5_GUITH/732-1110...VNSNDIIIGKT.--------------------------------------------....CPTNLFDNN...NEDLR
RPOB_PORYE/620-1023...VEAGDILVGKIT--------------------------------------------P..KGEADQL..PEGKLLRAI
Q98S96_GUITH/637-966...NNNNQKITSNL.--------------------------------------------.....................
Q1L6W1_9MARC/306-677...LGMNDVIVGKI.--------------------------------------------....VT..........HSQKN
Q980R1_SULSO/174-547...VKGGDVLIGKV.--------------------------------------------....SPPRFL.Q....EFKEL
Q8KTP8_TREPR/703-1210...VYPGDIIVGRIS--------------------------------------------P..RHAGIAP..KGNSLLRTA
A7BQQ8_9GAMM/365-1039...VMPGDILVGKVT--------------------------------------------P..KGETQLT..PEEKLLRAI
Q0N5M4_VARV/670-1047...LESGDAMARNIS--------------------------------------------...S............RTLED
A4RSZ5_OSTLU/678-1042...VRPGDTLL....--------------------------------------------.....................
Q1Q128_9BACT/647-1145...VKPGDILVGKIA--------------------------------------------P..KSRSELS..PEEKLLHAI
RPOB_RUTMC/721-1282...VKGGDILVGKVT--------------------------------------------P..KSETVLS..PEEKLLRAI
A6DE89_9PROT/728-1294...VKPGMILVGKIS--------------------------------------------P..KGDVKPT..PEERLLKSI
A0SEA6_9MOLU/200-587...VKVGDILVGKVT--------------------------------------------P..KSQTQLS..PEDKLLHAI
RPOB_RHOBA/664-1160...VKPGDILVGKVS--------------------------------------------P..KSKTELT..PEEKLLHAI
RPO2_MIMIV/724-1093...IRDGDVVIGVV.--------------------------------------------....NP.............KP
Q8II17_PLAF7/942-1400...ITEGSPLYSY..--------------------------------------------.....................
RPC2_MOUSE/666-1041...VENKQVLVNKS.--------------------------------------------....MPTVTQ......IPLEG
E2RU19_GIAIC/790-1189...VNSQRLIIGKI.--------------------------------------------....RPNKR.......SMNSR
Q236N3_TETTS/662-1046...INNGDVLFNKY.--------------------------------------------....TPLLTLEQQ...RGRDI
Q9EMY3_AMEPV/709-1081...LVQGDALYRC..--------------------------------------------................LKPKF
RPOB_ASTLO/574-991...INGKEILIGIIK--------------------------------------------.....KRLIN..YEVELIYEI
RPOB_TOXGO/547-957...ILTGSILLTKIK--------------------------------------------...VAKPTYTYKSIFKLIYSI
RPOB_SACHY/586-984...VETGDILVGKLT--------------------------------------------P..QIASESSYIAEAGLLRAI
RPB2_IIV6/722-1098...VKRNDVLVGK..--------------------------------------------................VI.TK
Q2WGI3_SELUN/574-977...VETGDVSVGKPT--------------------------------------------P..RNPEESPKAPESNLPQAV
A2E7H8_TRIVA/710-1082...VSAQDVIIGKI.--------------------------------------------....SPDSP...T...ELDHR
RPOB_THEP1/758-1175DYGVGSQAILVGKVT--------------------------------------------P..KGEGDTT..PEEKIIRSV
RPOB_RICAH/733-1293...VKAGDILVGKVT--------------------------------------------P..KSESPIT..PEEKLLRAI
Q3LW27_BIGNA/705-1066...VNGDDVLISK..--------------------------------------------................TIKLT

PF04941

RPOB_NPVSL/4-783IHVISKTFSKQKKNFLNHQ--DN-SSNNNIEMCPPMIKYRVGNEVVRIINDNMRQDMLKQEYDFVKFVDSFFHGEMTVAG
Q9J825_9ABAC/4-779IYSVSKTFSKQKKNFINYQ--DN-SSNNNIEINLPSLKYRIGNEVVRITNDTMRQDMLKQKFDFIKFIDNFFHGEMTVAG
Q9YMS3_NPVLD/4-744IYVVSKTFSKQKKNFINYQ--DN-SSNNNIEIVPPVLKYRIGNEVVRITNETMRQDMLMQKSDFVKFVDSFFHGEMTVAG
RPOB_NPVOP/4-757IYCVSKTFSKQRRSFPNQH--DN-CSNNNIEISLPVLKYRVGSEVTRITNDSVRQKMLKQKKDFVKFIGSFFHGEMTVAG
Q99H09_9ABAC/4-774IYGVSKTFSKQKKNFVNYQ--DN-SSNNNIEINPPTLKYRIGNEVVRITNDTMRQDMLMQQYDFVKFVDSFFHGEMTVAG
Q9DVS4_9BBAC/3-715IQSVSKTLCKQKKY..DQD--FN-SNNNNLEVFP..LDHRIGNEVLRIVNENLQQDMLKHTSDYVKFIDSFFHGEMTVAG
O55596_NPVBM/4-749IYCVSKTFSKQRKVFPNQQ--DN-SSNNNIEISLPVLKYRVGNEVRRITNDSMRQKMLKQKKDFVKFIGSFFHGEMTVAG

PF00562

B7WY91_COMTE/723-1292FGEKASD.VKDTSLRVDQG..SQ.GTVIDVQVFTREGIQRDKRAQQIIDDELKRFRLDLNDQLRIVEADAFDRIEKLLTG
RPOB_DESOH/723-1286FGEKGGN.VKDTSLRVPPG..VS.GTVIDAKVFTRRGVEKDTRTRMIEEEEIRVLEKNRDDEIAVIEEVTRERLKALLTG
RPOB_GEOLS/851-1417FGEKAGD.VRDTSLTIPPG..VE.GTVIGAKVFSRKGNDKDARTELIEKIEEEKLRKDEQDEVRIIRDSARGKLKRLLVG
D1NBR7_9BACT/651-1192FGEKAAD.VKDSSLTVPSG..KG.GIVMDIRIEYAKDPSRSSLSKSEEKRQQKMMKNDYRDIYNGLIDDLTSRLSDVMLG
Q9AIH1_CARRU/596-1191FSESNFN.YYEQPLTVPKN..IK.GTIIAVNDFKIFYFKNKIFKLLKFEQLNYTCKNINNFFYETFNYYLTKIKKLLFNN
Q8SQY8_ENCCU/673-1023....VDGTYKFTGKVHRG...DP.AYIDKILI................................................
RPOB_NEOSM/711-1263FGEKAID.VKDSSLYLPPG..VS.GCVVDVKVLQRRGIEKVGRALLIEKQAIDAEKTRRDHELAVLTNYIYSLLKEMLVG
RPOB_SALRD/694-1211FGDKAGD.VKDASLKAKPG..MEGGVVIDTRLFSRRELDPASKKMEEKRLENIESDHERKLADLNERFWEKFFALVEDAT
RPOB_LACDA/679-1067FGEKARE.VRDTSLRVPHG..GG.GVVQDVQVFTR.............................................
Q74MN2_NANEQ/131-507GAATLQ..KRDSSITVRSE..EE.GIVDSVLV................................................
RPB2_IIV3/687-1053KNKNQDEKLVDSSVIVQHG..EE.GYVDRIVD................................................
Q22C62_TETTS/682-1065DTQKN....AMKTFYHKDS..EL.GRLDGIAL................................................
A2EN74_TRIVA/632-991NPKEN....KERIMSYKDG..ED.GFVDKVITT...............................................
Q90022_ORFV/654-1041DFVADNQISFDIAEA.TRT..ST.PRAWRLQADL..............................................
RPOB_BORAP/667-1059FGEKAKD.VKNNSLKVPHG..TE.GTVIDVQRITK.............................................
RPOB_SYNAS/717-1284FGEKASD.VRDTSLRVPPG..VE.GTVIDAKVFTRKGAEKDHRSQYIEDEAIAMLQKDREDEIRIITEAVKKEVGTLLQG
RPOB_DEHSC/650-1123FGEKARE.VKDTSLRMPHG..EW.GKVINVRIFSR.............................................
RPOB_PARDP/739-1300FGEKASD.VRDTSLRLPPG..AY.GTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAILERNIYARLKSLIMG
RPOB_AQUAE/796-1374FGEKTRD.VKDASLRCPPG..VE.GIVIDVQVFTRKGTGKKDMLAEKVEREELEALEQELEKKKNLIITGRDKVLKGLVL
A5Z8Z3_9FIRM/700-1129FGEKARE.VRDTSLKVPHG..EQ.GIIVDAKVFKR.............................................
Q4GZE8_TRYB2/673-1036...VPSMEPRPNPLVYKYP..QP.AVVDHVVI................................................
RPOB_UREPA/837-1300FGDKSKT.VKDSSLKVKHG..QE.GIVAAVKRIKSS............................................
A7YUZ1_FRATU/718-1276FNEKASN.VADSSLRMPSG..TS.GTVINVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVIESVVKSSIEQEVVG
RPA2_DICDI/662-1031RPSDG....RQVTKDYKGK..EE.AYIEDVRIIFG.............................................
RPOB_CORGB/629-1051FGEKARE.VRDTSMKVPHG..ET.GKVIGVRHFSR.............................................
Q1NPU6_9DELT/719-1284FGEKAGD.VKDTSLRVPPG..VE.GVVVDAKVFSRKGVEKDERTLAIEEAEIKALERDLEDELQLLAGSVRNGVAELLVG
Q0EVW7_9PROT/695-1254FGEKASD.VRDTSMRVKPG..EE.GVVVDVQIFTRRGDEKDERAKAIEESGIEQLYADKEEERRILEGNAASRLCSLVVG
A0CUT2_PARTE/739-1109NTANGQKNTKECSLLTRRA..ER.GVVDSVLI................................................
A7UZT8_BACUN/679-1194FGDKAGD.VKDASLKASPS..LK.GVVIGKRLFSRVVKTRSSKLADKALLPKIDDEFDAKIGDLKKVLINKLLKLTENYT
Q5AFK6_CANAL/673-1039DDTLG....KTKVKTYHSS..EP.AYIEEVKLL...............................................
RPOB_KORVE/828-1399FGEKAGD.VRDASLTCPPG..IE.GVVVDVKIFSRKGQEKDERAKQIEGTQIAKLEKNLADEIRILTDERLKRLEGLLGA
RPOB_EIMTE/562-966FGKEIKN.IKDKSILVSFG..NS.GRIVKTELFSYSSKI.........................................
Q4A245_EHV8U/683-1058EGEVRRDTKRDRSHVLRTD..EP.VVVDAVFL................................................
Q1L6W4_9TRAC/184-547..AGADVREVDASQKLKHT..ER.GRVDQVVI................................................
A2E3T5_TRIVA/686-1052NFEESPVKFMAQPARYNY...YP.VMIQNVSV................................................
Q4N2L4_THEPA/737-1128EERGKNNIVNDKVVKYTE...EP.AIVDQITLVGKSEI..........................................
RPOB_MYCGE/814-1279FPESVQN.VRDSSLKVSHG..GD.GIVSAVKRFSI.............................................
O21237_RECAM/676-1397LSEKNKLIVYDKSIRYKNK..KK.GVVIQIAKFFDSLVDLNKHYITTSNLQKSTESLLSYIYKEEKIRLMFLSYLFFIFK
RPOB_PLAF7/525-929FGSKLRI.FKNKPIISTIH..DI.GRVIKIEILPNHLY..........................................
A4E9H0_9ACTN/589-1012FGAKAHD.VRDTSLKMPHG..AY.GRVIDVVRFSR.............................................
Q8TXI7_METKA/159-536ELPAEE..RRESSTAIRHT..DS.GIVDSVII................................................
A4WN98_PYRAR/656-1029RILKE...RRDASVAVRRG..EK.GIVDRVIV................................................
RPOBC_HELPY/729-1296FGDKAGH.VVNKSLYCPPS..LE.GTVIDVKVFTKKGYEKDARVLSAYEEEKAKLDMEHFDRLTMLNREELLRVSSLLSQ
Q6Q8Z4_9GAMM/699-1253FGEKASD.VKDTSQR..SS..SK.GTVIGVEVFTRDGMEKDERTLAIEQDHLDQSKKDADDEAAVVERATKRRLSELLKS
Q9FKF1_ARATH/698-1075TSALSDSQYRPAREYFKGPEGET.QVVDRVAL................................................
Q5RB08_PONAB/668-1031NLNTG....ESFVMYYKSK..EN.CVVDNIKAC...............................................
A7XDR4_PEWBP/753-1146IGEKSRD.YKDASLKVPCG..ES.GIVQSVQYFSVK............................................
RPOB_PELUB/725-1287FGEKAID.VTDTSLKMSRG..SS.GTVVDVRVFNRHGIEKDERSITIERAEIDTVQQDKIVEEEILERSIKQRANQILSG
Q5CSG7_CRYPI/757-1165RIGSGGGPSNATIQTYHDD..EV.AFVEKINRIASGISIELQQ.....................................
Q1L6W0_9TRAC/133-496..VPNSSRLSDRSVRLKHT..EM.GRVDRVVL................................................
A0D7M6_PARTE/653-1033NPQTENIQIADTPSVFKEK..WP.YTVDRVLI................................................
Q4UB41_THEAN/764-1155ESNQSSGTNEDKYIVNKYDLNTG.GYIDRLIL................................................
RPOB2_SCEOB/49-472LEKELIP.MRDSSLRTPKG..LK.AKVVEIKILNFSWNFAPTEKTLPS................................
A7AXE5_BABBO/518-899RRRKRRRKIKKIVIKSKKCLYSDQTDIKKLVKYECTQ...........................................
RPOB_PSEAK/1488-2086LNKEIPK.TRDTSLRVPRG..VT.GRVIHVEIVETTKKKGNDSSIFAKSLKFPKKQKLKRVTSPEYWYPVNTKKDQKVQS
RPOB_MAGSM/722-1281FGEKASD.VRDTSLRLPPG..VA.GTVVDVRVFSRRGLEKDDRAKLIDQDEIALLRKDMAAERRIIERDADERIRNLMNG
A6DPM7_9BACT/669-1185FGDKAAD.VKDSSLYVASS..TS.GIVMDIRVDRKIDPTKAAVTKSDLKRKRKEIDAEYKVQYNEFLEDLAEKLGAILLG
Q583H5_TRYB2/722-1094PVSDTRILKRDCSISSRAA..EK.GVVDRVML................................................
RPOB_OSTTA/585-1008FGGVARN.TKTTSYCLSSG..VS.GRILDVRCEFKRQTKN........................................
RPOB_THEPA/517-924FKENKKLIVYTKPLTIKRG..GE.GRLIKYEILGYSKF..........................................
RPOB_FUSNN/673-1063FGEKARD.VRDTSLTMPHG..SK.GVVVDILELSR.............................................
RPOB_DEIGD/617-1059FGEKARE.VKDTSLRVQSG..QG.GIVVKTVRFRRG............................................
A8B2N4_GIAIC/761-1143DGTEATASLIKAPESLKSPLETI.TYVDKVLV................................................
Q3LVX3_BIGNA/673-1033RFILSSIFNYTKKNKVKVQ..EY.NNFDQFTYFGK.............................................
A2SSM5_METLZ/135-540LIAVEK..RRDTSITMRSN..ET.GIVDTVII................................................
Q5GAH6_9VIRU/620-1017QGPTGTTVCKDISLTVKAS..EE.GYLDKIVQ................................................
RPOB_DESDG/714-1278FGEKARD.VKNTSLKVPPG..IE.GTVIDVKLFNRRSGEKDERTRNIEDYELARLDQKEKDHIRALTETTREKLAPVVVG
Q27493_CAEEL/647-1005NMETG....DFRTHKFHYA..EP.AYCGLVRIV...............................................
Q5MIL2_CHLP6/660-1172FGEKAAD.VKDASLTVPPG..TE.GVVMDVKVFSRKDRLSKSDDELVEEAVHLKDLQKGYKNQISVLKTEYREKLGALLL
Q9YVT7_MSEPV/705-1077KETDDNTRLFDKSEPYVSN..YP.AVVERTRK................................................
Q1L120_MYCAA/199-587LGQRQLN.VKDTSLKVKNG..HN.GTVIGVEILSR.............................................
Q5YF54_ISKNV/603-966SFDQSRPEGVCCSLAVKPH..EE.GYFDDKLV................................................
RPOB_PHATC/874-1274FGAKAKG.VKDNSYRMSDG..EY.GRVIETVTFNR.............................................
RPB2_ASFB7/780-1141GEKDELNKYIDRSVMYGFD..EP.AVVDAVMR................................................
A8B827_GIAIC/681-1140..QTYDPTKQCYSTKLYHH..EP.GFVEKVIVIHKSAAKGEYWTDNDIATKKKRDSSFPAGDSNSSNLDNDASDD.....
Q4ZJA8_FLDV/552-932KLIDGVIVYRDVSLAVKAD..EE.GYLDELLD................................................
Q07DU9_MAIZE/693-1067.....SESGEDHSIKLKHT..EK.GMVQKVLL................................................
Q8SSB7_ENCCU/630-975DQDG.....REYEKRYLGT..EP.GIVDIVRV................................................
RPOB_PHOPR/715-1263FGEKASD.VKDSSLRVPNS..VS.GTIIDVQVFTRDGVEKDKRALEIEEMQLKEAKKDITEEFQILEGGLLARVRTLLLS
Q1L6V8_9TRAC/152-501..TKPXNKFVD...KMSNL..EQ.AWVDQVVC................................................
RPOB_EHRRW/738-1291FGEKVFD.CVDSSLYLPID..VE.GTVVDVHVFVRRGVEENDRSLLIKQNEINGFIKERDYEIDVVSEYFYDELKRVLVN
Q06VE3_TNAVC/706-1065STDRNTSRREDTSIIARMQ..DE.GVVKSVKI................................................
Q98S72_GUITH/656-1015NKLVNNKLVRETTINYNND..EI.ASVDCVKIL...............................................
Q5CPZ8_CRYPI/817-1197PSQFDLSEYKPSPVKYKGP..TS.SYIDRVIL................................................
A0RXX0_CENSY/642-1018EPSGPY..RRDTSIGVRPS..ET.GVVDTVVM................................................
RPOB_GNEPA/588-1017FC..TSP.IKETCLR..AN..GK.GRVIDVNWSKLQAFCKDDLEKGHQDDD.............................
A4I1A3_LEIIN/1105-1506EYTRHH...ATKWRHFDKG..ED.AWVQQVIP................................................
A5ULN7_METS3/133-507GTVAEK..RRETSVTVRHG..EK.GIVDAVLL................................................
Q98RY5_GUITH/732-1110LLGKNLKIKTDCSSSIKNF..ET.GVVDKVIL................................................
RPOB_PORYE/620-1023FGEKARD.VRDTSLRLPNA..AK.GRVVKVRVFTR.............................................
Q98S96_GUITH/637-966........................KYSDNLVV................................................
Q1L6W1_9MARC/306-677TQSADSARLVDTSTRLKAH..EK.GRVEQVIL................................................
Q980R1_SULSO/174-547SPEQA...KRDTSIVTRHG..EM.GIVDLVLI................................................
Q8KTP8_TREPR/703-1210LATSEQA.NRDSSIRATQG..MT.GTVVYSRIEPCNQPDVHDDLPGQCAGEQSLLRRIQHGARATY..............
A7BQQ8_9GAMM/365-1039FGEKASD.VKDTSLRVPSG..TM.GTVIDVQVFTRDGVDKGARAGRIEQAELNRVKKDLQDTLRILEHDVYLRVEKLLVG
Q0N5M4_VARV/670-1047DFARDNQISFDVSEKYTDM..YK.SRVERVQVEL..............................................
A4RSZ5_OSTLU/678-1042NLHSSDGVTKGRSIRLRGT..DA.AVVDKVVLTQ..............................................
Q1Q128_9BACT/647-1145FGRAGED.VKNESLEVPSG..ME.GIIINTQVFSRKSYISEEKRQKILGEVSEIESKYNETIAKEFAKMLKAINAEIEEA
RPOB_RUTMC/721-1282FGEKANN.VKDSSLRVGAS..KS.GVVIDVQIFTRDRVEKDDRALSIDAERLERIKKDIDDEFGIIDGDIFRRVRLKLSG
A6DE89_9PROT/728-1294FGDKSGH.VVNSSLYAPAS..ME.GVVIDVKVYTKKGYELDERAKKAYEEEKQKIEDVYKNKLAIIDEEEMIALTTLLSS
A0SEA6_9MOLU/200-587FGEKSRN.VKDNSLRVPNG..GE.GIVKSIKRFSK.............................................
RPOB_RHOBA/664-1160FGRAGED.VKNDSLEVPSG..IE.GIVIDTQKFSRRMSLGEDERKAFERELKQHETEGNEEIASTFESLIRDMEEASGVK
RPO2_MIMIV/724-1093TAREDEKQYKDASSIYKSL..IP.GAVDKVIT................................................
Q8II17_PLAF7/942-1400.INKGNELTTYESFRNHGE.....YFVDFVSI................................................
RPC2_MOUSE/666-1041SNVPQQPQYKDVPITYKGA..TD.SYIEKVMI................................................
E2RU19_GIAIC/790-1189AVSTYD..FQDVSLKVKME..ET.GRVDSVIIAPDLREQS........................................
Q236N3_TETTS/662-1046LNNNSVSEYIHNPTTFKGK..KL.ARIDRVIR................................................
Q9EMY3_AMEPV/709-1081KNDDDNRYIFDQSETLSNT..YP.AVVERTRK................................................
RPOB_ASTLO/574-991LSEYER...KNISVLSPKN..LV.GIVTNTKIHKI.............................................
RPOB_TOXGO/547-957FGKTIRN.IKDNSLYIQTG..KS.GRVSKIELFLVNISSRH.......................................
RPOB_SACHY/586-984FGLEVST.SKETSLKLPIG..GR.GRVIDVKWIQR.............................................
RPB2_IIV6/722-1098ISKDGTRQETDHSTIVSIS..EE.GKVDRIIR................................................
Q2WGI3_SELUN/574-977PGIDITA.ARETCPRVPTG..GR.GRIIDVKWIYPE............................................
A2E7H8_TRIVA/710-1082Q.......YKDTSCVVRPM..ET.GVVDLVLR................................................
RPOB_THEP1/758-1175FGERGRD.VKDTSLRLPHG..VE.GRVIRVDVYDQ.............................................
RPOB_RICAH/733-1293FGEKAFD.VKDSSLHVPSG..VS.GTVVEVRVFSRRGVEKDQRAIAIEKQQIEKLAKDRDDELEIIEHFVFSLLEKLLVG
Q3LW27_BIGNA/705-1066GKGDTKVNTIHSDLKLPLN..SQ.GVVDSIMY................................................

PF04941

RPOB_NPVSL/4-783KKFFLCRDVRL---------------------------------------------------------------------
Q9J825_9ABAC/4-779KKFFLCRDVRL---------------------------------------------------------------------
Q9YMS3_NPVLD/4-744KKFFLCRNVRL---------------------------------------------------------------------
RPOB_NPVOP/4-757KKFFLCRNARL---------------------------------------------------------------------
Q99H09_9ABAC/4-774KKFFLCRDVRL---------------------------------------------------------------------
Q9DVS4_9BBAC/3-715KKFFVCHNVVL---------------------------------------------------------------------
O55596_NPVBM/4-749KKFFLCRNACL---------------------------------------------------------------------

PF00562

B7WY91_COMTE/723-1292RVANGGPQKLS.....................................................................
RPOB_DESOH/723-1286QKCDTPVKKGKKTI..................................................................
RPOB_GEOLS/851-1417KTAGAKIEDRHGVTV.................................................................
D1NBR7_9BACT/651-1192IKLPYPIFDMSPAREN................................................................
Q9AIH1_CARRU/596-1191KITIKKK.........................................................................
Q8SQY8_ENCCU/673-1023................................................................................
RPOB_NEOSM/711-1263KVALSTLAPI......................................................................
RPOB_SALRD/694-1211SAGLEDREGEVLLT..................................................................
RPOB_LACDA/679-1067................................................................................
Q74MN2_NANEQ/131-507................................................................................
RPB2_IIV3/687-1053................................................................................
Q22C62_TETTS/682-1065................................................................................
A2EN74_TRIVA/632-991................................................................................
Q90022_ORFV/654-1041................................................................................
RPOB_BORAP/667-1059................................................................................
RPOB_SYNAS/717-1284KQSGAKIVDPKRKKIY................................................................
RPOB_DEHSC/650-1123................................................................................
RPOB_PARDP/739-1300KEVVKGPKGIRA....................................................................
RPOB_AQUAE/796-1374GRKVEKDAKVGRKTV.................................................................
A5Z8Z3_9FIRM/700-1129................................................................................
Q4GZE8_TRYB2/673-1036................................................................................
RPOB_UREPA/837-1300................................................................................
A7YUZ1_FRATU/718-1276AKIQKAKGLKK.....................................................................
RPA2_DICDI/662-1031................................................................................
RPOB_CORGB/629-1051................................................................................
Q1NPU6_9DELT/719-1284KVAKSVVKNRKGEEI.................................................................
Q0EVW7_9PROT/695-1254QKAATFKGLNR.....................................................................
A0CUT2_PARTE/739-1109................................................................................
A7UZT8_BACUN/679-1194SEGVKDYMGADIIS..................................................................
Q5AFK6_CANAL/673-1039................................................................................
RPOB_KORVE/828-1399KVVQADLHDERTNKRL................................................................
RPOB_EIMTE/562-966................................................................................
Q4A245_EHV8U/683-1058................................................................................
Q1L6W4_9TRAC/184-547................................................................................
A2E3T5_TRIVA/686-1052................................................................................
Q4N2L4_THEPA/737-1128................................................................................
RPOB_MYCGE/814-1279................................................................................
O21237_RECAM/676-1397NKYKYDLGIKKKIILDDLNIHLNQKMNWSFSSFYTKTILYRNNLNIKLNFDLIYKMYLLICYKYLFSIEIFLKKNKKDLL
RPOB_PLAF7/525-929................................................................................
A4E9H0_9ACTN/589-1012................................................................................
Q8TXI7_METKA/159-536................................................................................
A4WN98_PYRAR/656-1029................................................................................
RPOBC_HELPY/729-1296AILEEPFSHNGKDY..................................................................
Q6Q8Z4_9GAMM/699-1253NKVVKGNGVKK.....................................................................
Q9FKF1_ARATH/698-1075................................................................................
Q5RB08_PONAB/668-1031................................................................................
A7XDR4_PEWBP/753-1146................................................................................
RPOB_PELUB/725-1287ASLTKKIKDLDE....................................................................
Q5CSG7_CRYPI/757-1165................................................................................
Q1L6W0_9TRAC/133-496................................................................................
A0D7M6_PARTE/653-1033................................................................................
Q4UB41_THEAN/764-1155................................................................................
RPOB2_SCEOB/49-472................................................................................
A7AXE5_BABBO/518-899................................................................................
RPOB_PSEAK/1488-2086FSFKNKSEKLFLTPVQSYFNKEAKTKNPKLNSPFFYLNKRNPDFNLKRNKRIAK..........................
RPOB_MAGSM/722-1281KPVRSAPGLQP.....................................................................
A6DPM7_9BACT/669-1185SKLSNDIVSKDGKET.................................................................
Q583H5_TRYB2/722-1094................................................................................
RPOB_OSTTA/585-1008................................................................................
RPOB_THEPA/517-924................................................................................
RPOB_FUSNN/673-1063................................................................................
RPOB_DEIGD/617-1059................................................................................
A8B2N4_GIAIC/761-1143................................................................................
Q3LVX3_BIGNA/673-1033................................................................................
A2SSM5_METLZ/135-540................................................................................
Q5GAH6_9VIRU/620-1017................................................................................
RPOB_DESDG/714-1278KQLAYGLAGQKKGEV.................................................................
Q27493_CAEEL/647-1005................................................................................
Q5MIL2_CHLP6/660-1172NEKAPASIIHRRTADI................................................................
Q9YVT7_MSEPV/705-1077................................................................................
Q1L120_MYCAA/199-587................................................................................
Q5YF54_ISKNV/603-966................................................................................
RPOB_PHATC/874-1274................................................................................
RPB2_ASFB7/780-1141................................................................................
A8B827_GIAIC/681-1140................................................................................
Q4ZJA8_FLDV/552-932................................................................................
Q07DU9_MAIZE/693-1067................................................................................
Q8SSB7_ENCCU/630-975................................................................................
RPOB_PHOPR/715-1263IGYSE...........................................................................
Q1L6V8_9TRAC/152-501................................................................................
RPOB_EHRRW/738-1291TNTEYNNQ........................................................................
Q06VE3_TNAVC/706-1065................................................................................
Q98S72_GUITH/656-1015................................................................................
Q5CPZ8_CRYPI/817-1197................................................................................
A0RXX0_CENSY/642-1018................................................................................
RPOB_GNEPA/588-1017................................................................................
A4I1A3_LEIIN/1105-1506................................................................................
A5ULN7_METS3/133-507................................................................................
Q98RY5_GUITH/732-1110................................................................................
RPOB_PORYE/620-1023................................................................................
Q98S96_GUITH/637-966................................................................................
Q1L6W1_9MARC/306-677................................................................................
Q980R1_SULSO/174-547................................................................................
Q8KTP8_TREPR/703-1210................................................................................
A7BQQ8_9GAMM/365-1039NKVTNSSNGWEGWEGVKKLLVGNKVTNSSKDEDGIETNTIITSRSDDIETNTIITSEIL.....................
Q0N5M4_VARV/670-1047................................................................................
A4RSZ5_OSTLU/678-1042................................................................................
Q1Q128_9BACT/647-1145LVDIQTGQVYKT....................................................................
RPOB_RUTMC/721-1282NMLSKVAGDIKA....................................................................
A6DE89_9PROT/728-1294KPLIKEVALNSKIF..................................................................
A0SEA6_9MOLU/200-587................................................................................
RPOB_RHOBA/664-1160LKDSTGTPLADG....................................................................
RPO2_MIMIV/724-1093................................................................................
Q8II17_PLAF7/942-1400................................................................................
RPC2_MOUSE/666-1041................................................................................
E2RU19_GIAIC/790-1189................................................................................
Q236N3_TETTS/662-1046................................................................................
Q9EMY3_AMEPV/709-1081................................................................................
RPOB_ASTLO/574-991................................................................................
RPOB_TOXGO/547-957................................................................................
RPOB_SACHY/586-984................................................................................
RPB2_IIV6/722-1098................................................................................
Q2WGI3_SELUN/574-977................................................................................
A2E7H8_TRIVA/710-1082................................................................................
RPOB_THEP1/758-1175................................................................................
RPOB_RICAH/733-1293QVIINGLKQVKA....................................................................
Q3LW27_BIGNA/705-1066................................................................................

PF04941

RPOB_NPVSL/4-783-------------------------------------------------PNVDYESIAKKFKDLIESNLIVRRD......
Q9J825_9ABAC/4-779-------------------------------------------------PSVDYNSVAAKFKSLLALNLIKIAQYK....
Q9YMS3_NPVLD/4-744-------------------------------------------------PAVDYQAVADRFAHLETSGLLRRHG......
RPOB_NPVOP/4-757-------------------------------------------------PNVDYAMVADKFAELQQFGLVAPVH......
Q99H09_9ABAC/4-774-------------------------------------------------PSVDYIMVAERFRMLIDKKFILHCSWLGSND
Q9DVS4_9BBAC/3-715-------------------------------------------------IDVDYTLVSDLFKKAIESNLFFKTC......
O55596_NPVBM/4-749-------------------------------------------------PNVNFEMVAQKFQYLLKHNLVEFVN......

PF00562

B7WY91_COMTE/723-1292.................................................KGAKIDKAYLDGVEKFHWFDIRPAEDDVAAQ
RPOB_DESOH/723-1286...............................................LAKGDKITAALFDEVPTSQFEKLAVTSDSVTEQ
RPOB_GEOLS/851-1417..............................................LAKGKKITDELLESLTMDRWATISVSDGTDVEEK
D1NBR7_9BACT/651-1192............................................AVLISSNRKVTKSSIQKLAAHYDCWSMEDCDLKKTL
Q9AIH1_CARRU/596-1191.....................................................RINSYNININNIFKIKCFNKKINFKLN
Q8SQY8_ENCCU/673-1023................................................................................
RPOB_NEOSM/711-1263..................................................SKGDLITEEALEKIDRENWWKISVDGISSI
RPOB_SALRD/694-1211..............................................EGADFEEDAFDEVDPSDLSTRAEFTEDEELNDQI
RPOB_LACDA/679-1067................................................................................
Q74MN2_NANEQ/131-507................................................................................
RPB2_IIV3/687-1053................................................................................
Q22C62_TETTS/682-1065................................................................................
A2EN74_TRIVA/632-991................................................................................
Q90022_ORFV/654-1041................................................................................
RPOB_BORAP/667-1059................................................................................
RPOB_SYNAS/717-1284.............................................LKKGDIITPEILSEIPLHLWKEITVADDEETERAV
RPOB_DEHSC/650-1123................................................................................
RPOB_PARDP/739-1300.................................................GAVVDEDLLGQLSRGQWWQLAVADEDTAKEV
RPOB_AQUAE/796-1374.............................................KKGTVIDEKVFEEFVNYILGRPENFFEDEDLIRKI
A5Z8Z3_9FIRM/700-1129................................................................................
Q4GZE8_TRYB2/673-1036................................................................................
RPOB_UREPA/837-1300................................................................................
A7YUZ1_FRATU/718-1276.................................................GAILTKEFLATLPFSKWLEISFEDEKLEEKV
RPA2_DICDI/662-1031................................................................................
RPOB_CORGB/629-1051................................................................................
Q1NPU6_9DELT/719-1284.............................................LAKGKKLNREVLNKLSPSEIKKLDYAGRESLEGEV
Q0EVW7_9PROT/695-1254.................................................GVTITAADVESMSLRDLSGVSVDDDAVNEKI
A0CUT2_PARTE/739-1109................................................................................
A7UZT8_BACUN/679-1194...............................................KGARFSASDFSDLDFTAVQLSNWTKDEHTNGLI
Q5AFK6_CANAL/673-1039................................................................................
RPOB_KORVE/828-1399............................................LTKDAVLDRETIERISTRNLKRIKYADKDPRVNEQI
RPOB_EIMTE/562-966................................................................................
Q4A245_EHV8U/683-1058................................................................................
Q1L6W4_9TRAC/184-547................................................................................
A2E3T5_TRIVA/686-1052................................................................................
Q4N2L4_THEPA/737-1128................................................................................
RPOB_MYCGE/814-1279................................................................................
O21237_RECAM/676-1397KECIKQDNFKYVDIRFKNMYREIYKRNKKNDFVLLNIKMSLSKVFFIDLKKKIPYSMEFLLKNFILQEMYILLFLYYIKE
RPOB_PLAF7/525-929................................................................................
A4E9H0_9ACTN/589-1012................................................................................
Q8TXI7_METKA/159-536................................................................................
A4WN98_PYRAR/656-1029................................................................................
RPOBC_HELPY/729-1296..............................................KEGDQIPKEEIASINRFTLASLVKKYSKEVQNHY
Q6Q8Z4_9GAMM/699-1253.................................................GEILTSEKLDSLKISDIFSIRIAKEATNNII
Q9FKF1_ARATH/698-1075................................................................................
Q5RB08_PONAB/668-1031................................................................................
A7XDR4_PEWBP/753-1146................................................................................
RPOB_PELUB/725-1287.................................................GTKLDLEIINKININDVFKITVGNVNDEASI
Q5CSG7_CRYPI/757-1165................................................................................
Q1L6W0_9TRAC/133-496................................................................................
A0D7M6_PARTE/653-1033................................................................................
Q4UB41_THEAN/764-1155................................................................................
RPOB2_SCEOB/49-472................................................................................
A7AXE5_BABBO/518-899................................................................................
RPOB_PSEAK/1488-2086......EMYFFNKNEKIKLSTLQIKIKGLEKKEFSFPKILKARFSLLQKAQTANLKIEKFLDDKFWNNVNYSNKNFSRNG
RPOB_MAGSM/722-1281.................................................GDHISQSWLDKSPSSHLRDVVLDDDAITQQI
A6DPM7_9BACT/669-1185.............................................IIVPANRKITKVLLRKLSAQHDNYTMVDSPAKAQI
Q583H5_TRYB2/722-1094................................................................................
RPOB_OSTTA/585-1008................................................................................
RPOB_THEPA/517-924................................................................................
RPOB_FUSNN/673-1063................................................................................
RPOB_DEIGD/617-1059................................................................................
A8B2N4_GIAIC/761-1143................................................................................
Q3LVX3_BIGNA/673-1033................................................................................
A2SSM5_METLZ/135-540................................................................................
Q5GAH6_9VIRU/620-1017................................................................................
RPOB_DESDG/714-1278..............................................IAEAGQTLTAEMLEGLPVKKLSGLFKSKDTNEAV
Q27493_CAEEL/647-1005................................................................................
Q5MIL2_CHLP6/660-1172............................................LVQEGTVFDQETIELLEQESLVDLLMPPCDMYDVLK
Q9YVT7_MSEPV/705-1077................................................................................
Q1L120_MYCAA/199-587................................................................................
Q5YF54_ISKNV/603-966................................................................................
RPOB_PHATC/874-1274................................................................................
RPB2_ASFB7/780-1141................................................................................
A8B827_GIAIC/681-1140..................................................................EISNQPGSGSESNE
Q4ZJA8_FLDV/552-932................................................................................
Q07DU9_MAIZE/693-1067................................................................................
Q8SSB7_ENCCU/630-975................................................................................
RPOB_PHOPR/715-1263.......................................................EKIASMDRERLFALTLDDESLQNQL
Q1L6V8_9TRAC/152-501................................................................................
RPOB_EHRRW/738-1291....................................................NIEDYLKSIPQKSWWDIKLSDESVLSQI
Q06VE3_TNAVC/706-1065................................................................................
Q98S72_GUITH/656-1015................................................................................
Q5CPZ8_CRYPI/817-1197................................................................................
A0RXX0_CENSY/642-1018................................................................................
RPOB_GNEPA/588-1017................................................................................
A4I1A3_LEIIN/1105-1506................................................................................
A5ULN7_METS3/133-507................................................................................
Q98RY5_GUITH/732-1110................................................................................
RPOB_PORYE/620-1023................................................................................
Q98S96_GUITH/637-966................................................................................
Q1L6W1_9MARC/306-677................................................................................
Q980R1_SULSO/174-547................................................................................
Q8KTP8_TREPR/703-1210...........................................................................CWASA
A7BQQ8_9GAMM/365-1039..GEPSDKWFKFSLEDKKSQAQLESFAALKALHDLHQVEEDEKSQAQLESFKPALKALHDLPRTKLFELRVEDEKIQAQI
Q0N5M4_VARV/670-1047................................................................................
A4RSZ5_OSTLU/678-1042................................................................................
Q1Q128_9BACT/647-1145................................................ERAMSEKTILAMEDHFNIENIAFSSKKKKELA
RPOB_RUTMC/721-1282.................................................GEKLSAKLMKKLDNKDISKLKVEDAAVNKEV
A6DE89_9PROT/728-1294..............................................KEGEKIPKEELQNINKFLLLSLVEYYDEETKREF
A0SEA6_9MOLU/200-587................................................................................
RPOB_RHOBA/664-1160.................................................QDPKFVAERATSFRLELVLEQIEDEEKRKAA
RPO2_MIMIV/724-1093................................................................................
Q8II17_PLAF7/942-1400................................................................................
RPC2_MOUSE/666-1041................................................................................
E2RU19_GIAIC/790-1189................................................................................
Q236N3_TETTS/662-1046................................................................................
Q9EMY3_AMEPV/709-1081................................................................................
RPOB_ASTLO/574-991................................................................................
RPOB_TOXGO/547-957................................................................................
RPOB_SACHY/586-984................................................................................
RPB2_IIV6/722-1098................................................................................
Q2WGI3_SELUN/574-977................................................................................
A2E7H8_TRIVA/710-1082................................................................................
RPOB_THEP1/758-1175................................................................................
RPOB_RICAH/733-1293.................................................GQTITTEMLKGLSKGQFWQLTVEDANVMNEI
Q3LW27_BIGNA/705-1066................................................................................

PF04941

RPOB_NPVSL/4-783.....ED....ENGSGGDDDDDEWLMIAFNNRPT-TFSCKRKHLVRIVYEFKRKRFPVEIKLSKSILFVNHHEGMICI--
Q9J825_9ABAC/4-779...NINDDDDDNDDVDSDDNERNNVLIAFNNRPT-IFQCDRNKLVYIVYELKRNKFPIEIKFHNDIIFLNHHEGMICI--
Q9YMS3_NPVLD/4-744.....DD.........DDEAAPDELRVAFNDRPT-VYACRRADLDKIFYAFKRNMSPIELKLNDGILFVNHHEGMICI--
RPOB_NPVOP/4-757.....DL..........AHCADGALLIAFNDRPT-NLQCARADVPKIVYRLKRDRCPIELKASSNILYVNHHEGMVCI--
Q99H09_9ABAC/4-774LDYRDRSDNRNNVGSANGDNNDDLLLIAFNDRPT-VFNCRRTDLQTIFYYFKRNMCPVELKLANNILFVNHHEGMVCI--
Q9DVS4_9BBAC/3-715.....KH..............DNVYLISFNNRPT-NLYCDKDDVCKIYYLMKRNFSPVEIKLTKDILFINHHEGMITL--
O55596_NPVBM/4-749.....DL..........NDVQDDSLLIAFNDRPT-NLKCLKLNTSFIVYTMKRNMAPIELKITDRILYVNHHEGMVCI--

PF00562

B7WY91_COMTE/723-1292LESIKNSIEQQRHTFDLAFEEKRKKLTQGDELPAGV.....LKMVKVYLAVKRR-----LQPGDKMAGRHGNKGVVSKIT
RPOB_DESOH/723-1286AHRVFEWYRTQVDACREEFEARISRYGAGEELPPGV.....IKMVKVYVAMKRV-----LSTGDKMAGRHGNKGVVSRIL
RPOB_GEOLS/851-1417VAEVLSKLNEQVELIRGVFDDKVQKLRRGDDLPPGV.....IKMVKVYVAIKRK-----LQVGDKMAGRHGNKGVVSRIL
D1NBR7_9BACT/651-1192TEIIDSFIPQFEENEEKRRRMADNMDSGDNADLG.V.....IKRVKVYVGCKRK-----LQVGDKMAGRHGNKGIVSRIV
Q9AIH1_CARRU/596-1191IFKNIISNELLKKKNIFVYKKINFIKHDDFENS..I.....IRIIKIKIAVKKQ-----IAIGDKMSGGHGNKGVVSNII
Q8SQY8_ENCCU/673-1023.............................TKSQD.......QVLIKTMLRQTRV-----PEIGDKFSSRHGQKGVVGLLV
RPOB_NEOSM/711-1263KLLRQRFVDRFDEINKTYEENFEKIRGDDDLAQG.V.....LMVVKVFVAVKHT-----LQPGDKMSGRHGNKGVISRIV
RPOB_SALRD/694-1211STLLRNYKSRRRDIEGTTKRQKHQVEMGDELPSG.V.....VQMAKVYVARKKK-----IEVGDKMAGRHGNKGVIAKIA
RPOB_LACDA/679-1067.........................EAGDELAPG.V.....NTLVRVYIVQKRK-----IQVGDKMSGRHGNKGTVALIA
Q74MN2_NANEQ/131-507.............................TEGED.S.....NLKVRVRIRMERP-----TEIGDKFSSRHGQKGVIGLIV
RPB2_IIV3/687-1053..............................NVID.G.....CRIVKVVIGQMRT-----PEIGDKFCSGMAQKGTCGMIF
Q22C62_TETTS/682-1065............................VHDEKT.K.....EPRVEYRIRIPRN-----PIIGDKFSSRHGQKGVLSVLW
A2EN74_TRIVA/632-991............................TSDDGK.R.....VLSVVLKFRMVRT-----PTIGDKFSSRHGQKGVFSFPW
Q90022_ORFV/654-1041..........................TDK.............VKVRALTVPERR-----AILGDKFTTRTSQKGTVAYVA
RPOB_BORAP/667-1059.........................EDVGNLSPG.V.....EEILKVYVAKKRK-----LKEGDKMAGRHGNKGVVAKIL
RPOB_SYNAS/717-1284GQMMANLYDKIEVVEAYFNEKTEKLKASDELPPG.V.....IKMVKVYIAIKRK-----LQAGDKMAGRHGNKGVLSRIL
RPOB_DEHSC/650-1123.........................DSGDDLPAR.V.....NKWVQVWVAQKRK-----VSVGDKLAGRHGNKGVISIIA
RPOB_PARDP/739-1300EALNQQFDAQKRALDNRFDDKVEKVRQGDDLPPG.V.....MKMVKVFVAVKRK-----LQAGDKMAGRHGNKGVVSKVV
RPOB_AQUAE/796-1374REIAERTRTQIEMLNKVYEEKKETLLKRRDLPPG.V.....ITLVKVFIANKRK-----IKVGDKMAGRHGNKGVISVVL
A5Z8Z3_9FIRM/700-1129.........................ENGDELAPG.V.....NESVRIYIAQKRK-----ISVGDKMAGRHGNKGVVSRVL
Q4GZE8_TRYB2/673-1036.............................SPPGDSDRSMDVEQKIKVVTREVRG-----PEPGDKFSSRHGQKGVVGLIT
RPOB_UREPA/837-1300........................DENGSELPDD.V.....IEIIKVYIVQKRK-----IQVGDKMAGRHGNKGIVSKVV
A7YUZ1_FRATU/718-1276QNAREYYEEAKIAIDAKFEAKKKSITQSNELSPG.V.....LKTVKVFVAIKKR-----IQPGDKMAGRHGNKGVVSRVL
RPA2_DICDI/662-1031.........................PNGATRDPS.K.....INNICVKLRFNRN-----PVIGDKFSSRHGQKGVLSQLW
RPOB_CORGB/629-1051.........................EDDDDLAPG.V.....NEMIRIYVAQKRK-----IQDGDKLAGRHGNKGVVGKIL
Q1NPU6_9DELT/719-1284KLLFDRHESQIKAVRSRYEARISRLQKGDDLPPG.V.....IRMVKVYVAIKRK-----LAVGDKMAGRHGNKGVVSRIL
Q0EVW7_9PROT/695-1254AEILESMDKERSRLESRFEQKVAKVREGSELKPG.V.....IKVVKVFVAVKRK-----LQPGDKMAGRHGNKGVISIIV
A0CUT2_PARTE/739-1109.............................SENQK.G.....YKLVKVKVRSLRI-----PQIGDKFCSRHGQKGTCGMTY
A7UZT8_BACUN/679-1194RALVMNFIKKYKELDAELKRKKFAITIGDELPAG.I.....IQMAKVYIAKKRK-----IGVGDKMAGRHGNKGIVSRVV
Q5AFK6_CANAL/673-1039...........................GDDSNEQ.E.....GQQITIKYRITRQ-----PLIGDKFSSRHGQKGVCSRKW
RPOB_KORVE/828-1399DEIEEMTSRQIDVLRKIVREKIEKLQKGDELPPG.V.....IKLVKVYIAMKRK-----LSVGDKMAGRHGNKGVIARIL
RPOB_EIMTE/562-966......................KSYLGYY.............LKCRVYICKQRL-----LSVGDKLCGRYGNKGIIAYIL
Q4A245_EHV8U/683-1058.............................SKTPE.G.....HGYVKVRTRAIRI-----PMVGDKFSARHGQKGVCGVTM
Q1L6W4_9TRAC/184-547.............................AAKND.A.....ETDVKVRLRECRT-----PQVGDKFSSMHGQKGVVGMCF
A2E3T5_TRIVA/686-1052.............................YTTET.......TQVIKIKTADFRR-----PELGDKFSSRHGQKGVIGLIV
Q4N2L4_THEPA/737-1128.......................TVGDKISCPGL.K.....HDRAIIKLRVLRS-----PIVGDKFASRHGQKGILSAVW
RPOB_MYCGE/814-1279.........................ANGDELNDG.V.....IEMIKVYVVQKRK-----IQIGDKLAGRHGNKGVISKVV
O21237_RECAM/676-1397YNKQNFNVFENDQIFVQKKTKSINKKKDCLKNNY.S.....LRMVKVVVACKHN-----IQVGDKLTGRYGNKGVISRIL
RPOB_PLAF7/525-929......................NKTEKNN......I.....YLKFRIYIGIQKY-----LQLGDKICNRHGHKGIISYIS
A4E9H0_9ACTN/589-1012.........................ENGDDLAPG.V.....NEQVRVYVAQRRK-----IQQGDKIAGRHGNKGVICNVL
Q8TXI7_METKA/159-536.............................TETSD.G.....HKLVKVRIRDERV-----PELGDKFSSRHGQKGVIGMIV
A4WN98_PYRAR/656-1029.............................TESPE.G.....NKLVKVRLRELRI-----PELGDKFASRHGQKGVVGMLL
RPOBC_HELPY/729-1296EITKNNFLEQKKVLGEEHEEKLSILEKDDILPNG.V.....IKKVKLYIATKRK-----LKVGDKMAGRHGNKGIVSNIV
Q6Q8Z4_9GAMM/699-1253EETETSYKQFIKDIKSRFEEKKSKIIRGHDLAPG.V.....IKIVKVYLAIKRR-----IQPGDKMAGRHGNKGVISEIM
Q9FKF1_ARATH/698-1075.............................CSDKK.G.....QLCIKYIIRHTRR-----PELGDKFSSRHGQKGVCGIII
Q5RB08_PONAB/668-1031...........................SNDTGSG.K.....FKCVCITMRVPRN-----PTIGDKFASRHGQKGILSRLW
A7XDR4_PEWBP/753-1146.........................KGDFISTPG.V.....NEIIKVYIAKKRK-----IREGDKIAGRHGNKGVISCIA
RPOB_PELUB/725-1287AQLKDQYNQAKQDIQERFEDKVLKIRSGDDLLPS.V.....MKMVKVFVAIKRR-----LRPGDKMSGRHGNKGVVSKIV
Q5CSG7_CRYPI/757-1165..................DSLSGGGGDGASSSSG.Y.....GEKVSIKLRIVRN-----PMVGDKFASRHGQKGILSMLW
Q1L6W0_9TRAC/133-496.............................SMDED.G.....KKHARVRLRESRM-----PQVGDKFSSMHGQKGILGMVF
A0D7M6_PARTE/653-1033.............................INNTNDGT..EKIKTIKTIFRQIRR-----PEFGDKFSSRHGQKGVVGLIV
Q4UB41_THEAN/764-1155.............................TENFN.G.....NTMYKIMVRQSRP-----PEIGDKFSSRHGQKGVVGLIA
RPOB2_SCEOB/49-472............PIQQKKKNSKILLKKQR......K.....PERVQVYLAEKRK-----IQVGDKMAGRHGNKGIVSKIL
A7AXE5_BABBO/518-899.......................YSNFVRIGSNL.N.....YANFKLFLVSINN-----INVGDKLCGRHGNKGTISKII
RPOB_PSEAK/1488-2086SQKENSNADGLQFYNPLKKTKTKVLQPMEKTSFS.G.....PQKVHIYLAEKRK-----LQIGDKIAGRHGNKGIISNIL
RPOB_MAGSM/722-1281EGIRHHVEKAADRLKKRFESKVEKLERGDDLPPG.V.....LKMVKVYIAVKRK-----LQPGDKMAGRHGNKGVISKIN
A6DPM7_9BACT/669-1185DEVMGNFKPRLNDIRLRNSEKIDQLADENSQERG.V.....IKSVKVYIASKRK-----ISVGDKMAGRHGNKGIISNIV
Q583H5_TRYB2/722-1094.............................TENK..G.....NRFTKVRIRTIKI-----PNIGDKFCSRHGQKGTNGIQF
RPOB_OSTTA/585-1008.....................IEDESIES............TGSVYVYLVEKRR-----LQVGDKVAGRHGNKGIVSNIL
RPOB_THEPA/517-924......................RQLDAMYPEINV.S.....YLTLRFFIFKIDR-----INIGDKLCGRHGNKGVVSKIV
RPOB_FUSNN/673-1063.........................ENGDELKAG.V.....NKSIRVLVAEKRK-----ITVGDKMSGRHGNKGVVSRVL
RPOB_DEIGD/617-1059.........................DEGVDLKPG.V.....REMVRVYVAQKRQ-----LQVGDKVANRHGNKGVVSKIL
A8B2N4_GIAIC/761-1143.............................TTNGD.G.....NMLIKVLTREPRR-----PEVGDKFSSRHGQKGVCGLIV
Q3LVX3_BIGNA/673-1033..........................EKVKSKTR.F.....KFSLEITKNITRN-----ILVGDKLASLHGQKSVVSTLI
A2SSM5_METLZ/135-540.............................TESEN.S.....SRLVKVRTRDLRI-----PEIGDKFASRHGQKGVCGLIT
Q5GAH6_9VIRU/620-1017.............................DVDPD.G.....RKIVKVRLRTPRI-----PEMGDKFASFTAQKGTCGAVK
RPOB_DESDG/714-1278QQALESYDRQIEFINAMYESKREKVTEGDDLPPG.V.....IKMAKVHIAVKRK-----LNVGDKMAGRHGNKGVVSCIL
Q27493_CAEEL/647-1005...........................EQGEGDS.G.....AKHALIQWRIERN-----PIIGDKFASRHGQKGINSFLW
Q5MIL2_CHLP6/660-1172SLLSDYETSLQRLEVNYKTEVEHIREGDADLDHG.V.....IRQVKVYVASKRK-----LQVGDKMAGRHGNKGVVSKIV
Q9YVT7_MSEPV/705-1077...............................QGT.D.....IIKVEILLSSYRR-----LAIGDKLA.KSVQKVTVADIL
Q1L120_MYCAA/199-587.........................ENKDLLEDG.I.....DMIVKVSIAVKRK-----IRVGDKMSGRHGNKGVVSVIL
Q5YF54_ISKNV/603-966.............................FNMAD.G.....CKCVKIKLRKIRI-----PEMGDKFASFTAQKGTCGMMY
RPOB_PHATC/874-1274.........................RTKLTY....K.....FEKIYVFIAQIRK-----IQVGDKIAGRHGNKGIISRIL
RPB2_ASFB7/780-1141.............................PHGPN.D.....EIFGLMRLRYERN-----LNIGDKMSSRSGNKGIAALAL
A8B827_GIAIC/681-1140DNQTATPRSHASKAERKSSRQLQTRARTESSSLH.F.....IQRVRIVIRHDRT-----PVVGDKVASRHGQKGIMGIRW
Q4ZJA8_FLDV/552-932.............................HYTIE.T.....GRIIKVKLRSSKI-----PEIGDKFASFTAQKGTCGMIY
Q07DU9_MAIZE/693-1067.............................SANDE.G.....KNFAVVTLRQVRT-----PCLGDKFSSMHGQKGVVGFLE
Q8SSB7_ENCCU/630-975.............................FENDM.G.....ERCATFTIRIVRS-----PMIGDKFSSRHGQKGVCSMHW
RPOB_PHOPR/715-1263EQLAEQYDELKAEFDKKFETKRRKITQGDDLAPG.V.....LKIVKVYLAVKRR-----IQPGDKMAGRHGNKGVISKIC
Q1L6V8_9TRAC/152-501.............................SMGEEQD.....QRHVNVRLRESRC-----PQVGDKFSSMHGQKGVVGMML
RPOB_EHRRW/738-1291SDLKEKFDSMIENAHSKFDQKIDKLNYGYDLPQG.V.....LCIVKVFVAVKHN-----LQPGDKMAGRHGNKGVISRIV
Q06VE3_TNAVC/706-1065...................................D.....GSSVRIRLEVVLD-----VMIGDKFCSAMAQKGTCGMIL
Q98S72_GUITH/656-1015...........................KNYSKIQ.S.....KHNVMIRLKSKRK-----PIEGDKFASRHGQKGILSFKY
Q5CPZ8_CRYPI/817-1197.............................TENAD.G.....NQIYKVITRQTRR-----PELGDKFSSRHGQKGVVGLII
A0RXX0_CENSY/642-1018.............................TQSNE.G.....GKMYKIRVRDMRV-----PEIGDKFAARHGQKGVLGILA
RPOB_GNEPA/588-1017.........TEDIYDEAEDALEKVYQLNNYNLSS.D.....SEKVHVYLLEKRK-----IQVGDKVAGRHGNKGIVSIVL
A4I1A3_LEIIN/1105-1506............................LVYSGP.D.....PTSVLMIFRIPRP-----PTVGDKFSSRHGQKGTLPLHI
A5ULN7_METS3/133-507.............................TETVE.G.....SRLAKIRVRDTRQ-----PEFGDKFASRHGQKGVLGLIL
Q98RY5_GUITH/732-1110.............................AKSDE.G.....FRLVKIRIRSVRL-----PQIGDKFASRHGQKGIIGMIY
RPOB_PORYE/620-1023.........................QKGDELPPG.T.....NAMIRVYVAQKRK-----IQVGDKMAGRHGNKGIISRIL
Q98S96_GUITH/637-966.............................VKYGL.D.....LTLAKFLIRECRN-----PEIGDKFSSRHGQKGICGFIK
Q1L6W1_9MARC/306-677.............................VQDEE.G.....KKIAKVKLRETRI-----PQVGDKFSRMHGQKGIVGMVF
Q980R1_SULSO/174-547.............................TETAE.G.....NKLVKVRVRDLRI-----PTIGDKFASRHGQKGVIGMLI
Q8KTP8_TREPR/703-1210RDPYFWMPRNGLAAAPYAMEQHASPKAGLHPYDK.A.....TRTLKVAIASRID-----LQPGDKVSGRHGNKGVVSKVV
A7BQQ8_9GAMM/365-1039ESFAQQLKDQRQRADALYEEKRQKLISGDELAPG.V.....LKMVKVYLAIKRT-----IQPGDKMAGRHGNKGVVSMIV
Q0N5M4_VARV/670-1047..........................TDK.............VKVRVLTMKERR-----PILGDKFTTRTSQKGTVAYIA
A4RSZ5_OSTLU/678-1042..........................SVKQAATK.N.....DKRAAITLRYDRN-----PVIGDKFSSRHGQKGVLSFLW
Q1Q128_9BACT/647-1145LEISQEYKRKMEELKEERDGKINQLKRGDELPTG.V.....LELAKVSIATKRK-----LSVGDKMAGRHGNKGVISKIL
RPOB_RUTMC/721-1282AALIKQAKAKQIEFKKFFEEEKAKINEGAELPPG.V.....MKMVKVYVATSKT-----LQVGDKMAGRHGNKGVISRVS
A6DE89_9PROT/728-1294EEIKSKYQKEKENIRKEYDEKIEVLERDDILPNG.V.....AKMVKVYIANKRK-----IKVGDKMAGRHGNKGIVSIIV
A0SEA6_9MOLU/200-587.........................ANGHDLPAD.I.....LEVIKVYVVQKRK-----IQEGDKMAGRHGNKGVISKIL
RPOB_RHOBA/664-1160EKVHQTQWQNVEQAIDERDRKLNSMKRGDELRSG.V.....LQMVKIYIATKRT-----ISVGDKMAGRHGNKGVIAKIL
RPO2_MIMIV/724-1093.............................EVNND.G.....YPIIKMRIRSERI-----PNVGDKFSSRAGQKGTIGYKA
Q8II17_PLAF7/942-1400..............................GKNN.S.....NQVAVVKLRSTRQ-----PQVGDKFASRHGQKGVVSRLF
RPC2_MOUSE/666-1041.............................SSNAE.D.....AFLIKMLLRQTRR-----PEIGDKFSSRHGQKGVCGLIV
E2RU19_GIAIC/790-1189....................FLSEGVDSNTTGAE.G.....SLLAKVRVRSSRV-----PQLGDKFSSRHGQKGTVGMLL
Q236N3_TETTS/662-1046.............................SQQDG.......NVIIKTIVRETRR-----PEYGDKFSSRHGQKGIIGLIV
Q9EMY3_AMEPV/709-1081...............................QGT.D.....LIKIDMLLSSYRR-----LSVGDKIA.KSVQKVTVSKIM
RPOB_ASTLO/574-991.........................KNCY..............QIEIYITEKKK-----IQIGDKLSGRHGNKGVISKII
RPOB_TOXGO/547-957....................KYKTYNNSY.............LKCRIFICKQRF-----LTVGDKLCGRYGNKGILSYIA
RPOB_SACHY/586-984.........................DPFD.............IMVRVYILQKRE-----IKVGDKVAGRHGNKGIISKIL
RPB2_IIV6/722-1098..............................TSKK.G.....ILMFKIVIAQQKR-----PEIGDKFCSAMAQKGTVGMIL
Q2WGI3_SELUN/574-977........................DTSGH............TRVVHAYAPQARE-----TQVGDKAAGRHGNKGITPKIA
A2E7H8_TRIVA/710-1082.............................TITKK.N.....LQLARVRTRQMRR-----PEIGDKFCSRHGQKGVCGMTY
RPOB_THEP1/758-1175.........................NDIAELGAG.V.....LKLVRVYVASRKT-----LDIGDKLAGRHGNKGVVSNIL
RPOB_RICAH/733-1293EQIKIHYDEKKDALNKRFATKVEKLQSGDDLPQG.A.....LKVVKVFIATKHK-----LQPGDKMAGRHGNKGVVSRIV
Q3LW27_BIGNA/705-1066.............................SLDEG.G.....YKIIKVRIRSIRE-----PVIGDKFSSLHGQKGIIGYSY

PF04941

RPOB_NPVSL/4-783-RKQVRINE-...KVNISALLTPYEYHNVESI------IGQIG...ARIVDVDHVSALMSKTLQYYYRSHLHIFATIPVP
Q9J825_9ABAC/4-779-KKKVKYPQ-RGGVVKIMALLTPYEYHNELSY------LRTVDGI..DVEEERHCSQLMSKLLHYYYKDILSMFATTPVP
Q9YMS3_NPVLD/4-744-KRAVKLRD-....VSIACLLTPHEYHNSASL------LNAAPDV.GRVEESDDVTSLMSKLVQYYYKNHTSIFSTLPVP
RPOB_NPVOP/4-757-AKRVRIGA-P.VNASINALLTPYEYHYKNSL------FHAPTVSACEIEESDDVRCLMSKLEQYYFAEYTHLFYTIPVP
Q99H09_9ABAC/4-774-KRKLKIRD-....VHITALLTAYEYHNSNSI------LRTHNDV.ATIIEKDTVVCLMSKLVQYYYKGYTQMFCTVPVP
Q9DVS4_9BBAC/3-715-KKTVKICD-...KIMINTLQTPFEYHNSESI------VRNFKML.NFVDEHDDTTSLMSTMIRTYYNGYLQIFNTVPVA
O55596_NPVBM/4-749-KKKLRVNN-...EADINVLLTPYEYHYKHSI------YYNSIIQ.CTIVENDDVKSLMSKLEQYYYCNFIHLFHTTPVP

PF00562

B7WY91_COMTE/723-1292PVEDMPFLA.DGS..TADIVLNPLGVPSRMNI...................GQVLEVHLGWAGKGLGQRIGDMLQKEARA
RPOB_DESOH/723-1286PQEDLPYFE.DGT..TVDMVLNPLGVPSRMNV...................GQILEIHLGRAARVLGDQISTMLEEKKYK
RPOB_GEOLS/851-1417PEEDMPYMD.DGR..PVEIVLNPLGVPSRMNV...................GQILETHLGWAAKGLGWKIQKMLEEHTSE
D1NBR7_9BACT/651-1192PVEDMPFLE.DGT..PVDIILNPLGVPSRMNI...................GQVLETHLGWAAKM...............
Q9AIH1_CARRU/596-1191DYENMPYDK.FGN..KIDLILNPLGVPSRMNV...................GQLLEVFLAGSLNL.IKSFFLKIKNLNKI
Q8SQY8_ENCCU/673-1023RQEDMPFND.QGI..VPDIIMNPHGFPSRMTV...................GKIVELISGKAGVL...............
RPOB_NEOSM/711-1263PAEDMPYLA.DGT..PVDIILNPLGVPSRMNV...................GQILETHLGWAAYN.LGKKISKLLDEGNY
RPOB_SALRD/694-1211PVEDMPFLD.DGT..PVDLVLNPLGVPSRMNL...................GQIYETLLGWAGDR...............
RPOB_LACDA/679-1067PVEDMPYLP.DGT..PVDICLNPMGVPSRMNI...................GQLLEIHLGRAARA...............
Q74MN2_NANEQ/131-507PPSDMPFTA.SGI..VPDLIFNPHGLPSRMTI...................GQIIELVAGKVASL...............
RPB2_IIV3/687-1053PQEDMPFTA.SGM..TPDIIINPNCIPSRMTI...................NQIISTVMGKLYTVNP.............
Q22C62_TETTS/682-1065PHIDMPFTE.SGI..TPDVIINPHAFPSRMTIGKFTLYSRRLTNQLNFNKKGMLIESMAGKSGAL...............
A2EN74_TRIVA/632-991PQENMPFCE.NGI..TPDVIINPHAFPSRMTI...................GMLIESMCGKLRAS...............
Q90022_ORFV/654-1041DETELPYDE.NGMHPIPDVIINSTSIFSRKTL...................SMLMEVILTTAYGT.QSL...........
RPOB_BORAP/667-1059PVEDMPYLA.DGT..PLDICLNPLGVPSRMNI...................GQLMESQLGLAGKY...............
RPOB_SYNAS/717-1284PEEDMPYFK.DGR..PVDIVLNPLGVPSRMNV...................GQILETHLGWAAKG.LGEKLNDMLDSYQK
RPOB_DEHSC/650-1123PVEDMPYLP.DGT..PVDVVLNPIGVPSRMNL...................GQILETHLGWAGHL...............
RPOB_PARDP/739-1300PIEDMPFLS.DGT..PVDLVFNPLGVPSRMNV...................GQILETHMGWASRG.LGIKIDEALQDYRR
RPOB_AQUAE/796-1374PVEDMPFLP.DGT..PVDIVLNPLGVPSRMNV...................GQILETHLGWAAKE.LGKKIGEMIEKGRD
A5Z8Z3_9FIRM/700-1129PVEDMPFLP.NGR..PLDIVLNPLGVPSRMNI...................GQVLEIHLSLAAKV...............
Q4GZE8_TRYB2/673-1036DGVNMPFNE.QGI..CPDMIMNPHGFPSRMTV...................GKLLELVSSKVSAL...............
RPOB_UREPA/837-1300PIQDMPFLK.DGT..PLDIMLNPLGVPSRMNI...................GQILELHLGYAAAE.IGKKQLIQIAIDQL
A7YUZ1_FRATU/718-1276PVEDMPYME.DGT..PVDVCLNPLGIPSRMNI...................GQILEAHLGLASYG.LGKKIEKTLEKTRK
RPA2_DICDI/662-1031PEINMPFTE.SGM..KPDVIINPNAFPSRMTI...................GMLVEILAGKAGAI...............
RPOB_CORGB/629-1051PQEDMPFLP.DGT..PVDIILNTHGVPRRMNI...................GQVLETHLGWLASA.GWSVDPEDPENAE.
Q1NPU6_9DELT/719-1284PEEDMPYFA.DGT..SVDVVLNPLGVPSRMNV...................GQLLEIHLGLAAKE.LGKQVQQMAEARDL
Q0EVW7_9PROT/695-1254PEEDMPYTA.DGT..PVEICLNPLGVPSRMNI...................GQIFEIHMGWAGSE.LGKRIEEKMRAKVG
A0CUT2_PARTE/739-1109RQEDLPYTL.VGI..SPDLTINPHCIPSRMTI...................GHLIECLSSKLASI...............
A7UZT8_BACUN/679-1194RQEDMPFLA.DGT..PVDIVLNPLGVPSRMNI...................GQIFEAVLGRAGKN...............
Q5AFK6_CANAL/673-1039PQIDMPFTE.SGM..QPDVIINPHAFPSRMTI...................GMFVESLAGKAGAL...............
RPOB_KORVE/828-1399PEEDMPYLE.DGT..PVEIVLNPLGVPSRMNV...................GQILETHLGWAGHE.LGKKIAEFMVENSE
RPOB_EIMTE/562-966PSNDLPYTN.TGI..IPDIISDSLGIPSRMNI...................GQLFENLFGLSCYF.LNKRLCI.......
Q4A245_EHV8U/683-1058PAADFPCTA.DGV..APDIIINPHAIPSRMTI...................GMLMEMVLSKVACY...............
Q1L6W4_9TRAC/184-547HQEDLPFTR.DGI..VPDLIINPHAFPTRQTL...................GQLMECLAGKAAAV...............
A2E3T5_TRIVA/686-1052PQEDMPYTE.DGI..CPDMIMNPHGFPSRMTV...................GKMIELVSGKVGIL...............
Q4N2L4_THEPA/737-1128PTEDMPFLE.NGI..VPDVIFNPHGLPSRMTI...................GKLIEGMAGKVASI...............
RPOB_MYCGE/814-1279PIEDMPHLE.DGT..PVDILLNPLGVPSRMNI...................GQIFETHLGYAAHK.LAVRSLISSCFDQN
O21237_RECAM/676-1397SLEDMPYLR.DGT..PLDIVLSPLGVSSRMNI...................GQLLECHLGLAGVE.LSKKLQQIIQTYDI
RPOB_PLAF7/525-929EINDIPYLN.NKI..QPDIFISAISIPSRINI...................GQIFEGIYGLNSLY.LNTRYII.......
A4E9H0_9ACTN/589-1012PVEDMPYMA.DGT..PIDVILNPLGVPSRMNV...................GQLLECHLGWAAAC.GWDTEQA.......
Q8TXI7_METKA/159-536PEEDMPFTE.DGI..TPDLILNPHALPSRETM...................AHILETLAGKAAAL...............
A4WN98_PYRAR/656-1029RQEDMPFTE.EGI..VPDIIVNPHALPSRMTV...................AQLLESMAGKVGAA...............
RPOBC_HELPY/729-1296PVADMPYTA.DGE..PVDIVLNPLGVPSRMNI...................GQILEMHLGLVGKE.FGKQIARMLEDKTK
Q6Q8Z4_9GAMM/699-1253PVEDMPYDE.SGN..PIDIVLNPLGVPSRMNV...................GQILETHMGSAAKG.IGDKIDLMLKENAK
Q9FKF1_ARATH/698-1075QQEDFPFSE.LGI..CPDLIMNPHGFPSRMTV...................GKMIELLGSKAGVS...............
Q5RB08_PONAB/668-1031PAEDMPFTE.SGM..VPDILFNPHGFPSRMTI...................GMLIESMAGKSAAL...............
A7XDR4_PEWBP/753-1146AKVDMPYMS.DGT..PIDVILNPLGVPSRMNI...................GQILEMHLGMAAHK...............
RPOB_PELUB/725-1287PVEDMPYRE.DGR..PVDIVLNPLGVPSRMNV...................GQILETHLGWACKE.FGEEVKRLVNENNK
Q5CSG7_CRYPI/757-1165PQENMPFSE.SGM..VPDILFNPHGFPSRMTI...................GMLLESMGGKAACI...............
Q1L6W0_9TRAC/133-496NQEDLPFTQ.EGI..VPDIIINPHAFPSRQTL...................GQMLESVLGKAVAN...............
A0D7M6_PARTE/653-1033NQEDMPFNE.RGW..CPDLIMNPHGYPSRMTI...................AKLMELLCGKLGAL...............
Q4UB41_THEAN/764-1155EHEDMPFTE.SGI..VPDLIMNPHGFPSRMTV...................GKLLELVASKSSVF...............
RPOB2_SCEOB/49-472PIQDMPFLP.DGT..PLDMVLNPLGVPSRMNV...................GQIYECLLGLASKY...............
A7AXE5_BABBO/518-899EIPESPYTS.EDK..LPNIITSPIGAASRMNV...................GQFIEGYIGNTCDI.DNVRIK........
RPOB_PSEAK/1488-2086PRQDMPYLS.DGT..PLDIVLNPLGVPSRMNV...................GQILECLLGMAGYY...............
RPOB_MAGSM/722-1281PLEDMPYMA.NGT..PVDIVLNPLGVPSRMNV...................GQILETHLGWAARG.MGFKIEEALKQHRK
A6DPM7_9BACT/669-1185PKSDLPFMK.DGT..VVDIILNPLGVPSRMNV...................GQILETHLGMAANR...............
Q583H5_TRYB2/722-1094RQEDMPFNH.DGI..SPDLIINPHAIPSRMTV...................AHLIETLAGKVACY...............
RPOB_OSTTA/585-1008PRVDMPYLQ.SGK..ALDMVLNPLGVPSRMNV...................GQIFECLLGLAANT...............
RPOB_THEPA/517-924DNIDLPYTF.RGL..CPYSITSPIGALARINL...................GQFLEGSCGYFGLN.FNCRIK........
RPOB_FUSNN/673-1063PAEDMPFLE.DGT..HLDVVLNPLGVPSRMNI...................GQVLEVHLGMAMR..TL............
RPOB_DEIGD/617-1059PPEDMPYLE.DGT..PVDLVFNPLGVPSRMNL...................GQILETHLGEVARL...............
A8B2N4_GIAIC/761-1143PQSDLPFTS.QGI..VPDLIMNPHGYPSRMTV...................AKLLELLSNKSGCF...............
Q3LVX3_BIGNA/673-1033SREDLPFSFFDGI..IPEVSLNPHSFPSRMTI...................GMLKEMALLKNSIF...............
A2SSM5_METLZ/135-540PQENMPFTA.AGI..APDLVINPHAVPSRMTI...................GHMLEMIGGKAGAL...............
Q5GAH6_9VIRU/620-1017SQEDMPFDK.DGV..VPDLIINPHAFPSRMTV...................NYLLQMCFGLAGCK...............
RPOB_DESDG/714-1278PQEDMPFFA.DGR..PVDIVLNPLGVPSRMNI...................GQIMETHLGWAAKE.MGRKLALMLEHGQD
Q27493_CAEEL/647-1005PVESLPFSE.TGM..VPDIIFNPHGFPSRMTI...................GMMIESMAGKAAAT...............
Q5MIL2_CHLP6/660-1172PEADMPYLA.NGE..TVQMILNPLGVPSRMNL...................GQVLETHLGYAAKT...............
Q9YVT7_MSEPV/705-1077DESELPYTK.DGL..RPDLIFNSTSITSRKTF...................PMYFDAMLTNMFSLIPYDENNN.......
Q1L120_MYCAA/199-587PEEDMPHLE.DGT..PIDVMLNPQGVPSRMNI...................GQVLEVHLGMAARS...............
Q5YF54_ISKNV/603-966DQWDMPFTA.DGV..VPDLVINPHAFPSRMTV...................HYLLQMCFELGAVA...............
RPOB_PHATC/874-1274SRQDMPFLP.DGT..PLDILLNPLGVPSRMNV...................GQLYECLLGLAGDK...............
RPB2_ASFB7/780-1141PTSDMPFTE.DGL..QPDLIVNPHSHPSRMTN...................GQMIETTVGLANAL...............
A8B827_GIAIC/681-1140RQTDMPFTS.SGI..VPDLIINPHAFPSRMTV...................GMLIESLASKIGVH...............
Q4ZJA8_FLDV/552-932RQEDMPFTA.EGV..VPDLIINPHAFPSRMTI...................NYILQMCYGLAACY...............
Q07DU9_MAIZE/693-1067SQENFPFTH.EGI..VPDIVINPHAFPTRQTP...................GQLLEAALGKGIAC...............
Q8SSB7_ENCCU/630-975PGIDMPFTE.SGC..VPDIIINPHAFPSRMTI...................GMLIESIAGKVGCL...............
RPOB_PHOPR/715-1263PVEDMPYDE.KGQ..TVEIVLNPLGVPSRMNI...................GQILETHMGLAAKG.IGDKLNEMLKQQQE
Q1L6V8_9TRAC/152-501SQEDLLFTQ.QGI..VPDVIINPHAFPSRQTL...................AQMLESLVGKTAAM...............
RPOB_EHRRW/738-1291PVEDMPYLE.DGT..PVDIILNSLGVPSRMNV...................GQILETHLGWASVN.LGKKIGNILDNIDE
Q06VE3_TNAVC/706-1065PDIDMPFVADSGM..IPDILVNVHSMPSRMTV...................NQIMASMAGKLACI...............
Q98S72_GUITH/656-1015EVENLPFSE.TGI..IPDILFNPHGFPSRMTI...................GMVIESLSGKSGAL...............
Q5CPZ8_CRYPI/817-1197SQEDLPFSE.TGW..CPDLIMNPHGFPSRMTV...................GKLLELISSKASVL...............
A0RXX0_CENSY/642-1018KNEDLPYTA.EGV..TPDVLINPHAFPSRMTV...................GMFMESITGKAAAL...............
RPOB_GNEPA/588-1017SRQDMPFLQ.SGI..SLDMVLNPLSVPSRMNV...................GQIFECLLGLAGTM...............
A4I1A3_LEIIN/1105-1506RSHNLPFATASGI..TPDVIINPHAFPSRMTV...................GMVLEIMTAKVGAI...............
A5ULN7_METS3/133-507SPEDVPFTE.SGV..VPDLIVNPHAIPSRMSV...................GQVLEMVAGKAGCL...............
Q98RY5_GUITH/732-1110RQVNMPFSE.QGI..SPDIIMNPHAIPSRMTI...................GHLLECLLSKAVSM...............
RPOB_PORYE/620-1023PKQDMPYLS.DGT..PVDIVLNPLGVPSRMNV...................GQVFECLLGLAGGY...............
Q98S96_GUITH/637-966PQQDMPFSE.KGI..CPDIIMNPHGFPSRMTI...................GKTIEIILSKSGCI...............
Q1L6W1_9MARC/306-677TQEDLPFTN.EGI..VPDIIINPHAFPSRQTL...................GQMCESALGKAIAK...............
Q980R1_SULSO/174-547PQVDMPYTV.KGV..VPDIILNPHALPSRMTL...................GQIMEGIAGKYAAL...............
Q8KTP8_TREPR/703-1210PIEDMPYMK.NGR..SVDVIVNPLGVPSRMNV...................GQLLETHIGLASIA.LEARSNTAEHLLCS
A7BQQ8_9GAMM/365-1039PVEDMPYTK.DGR..PVDLVLNPLGVPSRMNI...................GQVLETHLGWAAKA.LGEQIEQKLKIINK
Q0N5M4_VARV/670-1047DETELPYDE.NGI..TPDVIINSTSIFSRKTI...................SMLIEVILTAAYSA.KPY...........
A4RSZ5_OSTLU/678-1042PEEDMPFSDRTGL..RPDVIINPHAFPSRMTI...................GMLVESLAAKAGAS...............
Q1Q128_9BACT/647-1145PEEDMPFLA.DGT..RVEMLLNPLGVPSRMNV...................GQILETHLGWAAKK...............
RPOB_RUTMC/721-1282PVEDMPYLV.DGS..TIDVVLNPLGVPSRMNV...................GQVLEVHLGYAAKG.LGYKITAMLDEKRT
A6DE89_9PROT/728-1294PEEDMPYME.DGR..TVDVVLNPLGVPSRMNI...................GQILEVHLGLVGKK.LGEQIEEILKEKQD
A0SEA6_9MOLU/200-587PIEDMPHME.DGT..PVDIMLNPQGVPSRMNI...................GQVLEIHLGMAAQK...............
RPOB_RHOBA/664-1160PIEDMPFLP.DGT..PIQIMLNPLGVPSRMNV...................GQILETHLGWAGAK...............
RPO2_MIMIV/724-1093HRADMLFSK.SGL..IPDIIINPNCMPKRMTI...................GQLIECLLGKLCAV...............
Q8II17_PLAF7/942-1400PQEDMPFAE.SGI..VPDIIFNPHGIPSRMTI...................GMLIESICGKAASL...............
RPC2_MOUSE/666-1041PQEDMPFCD.SGI..CPDIIMNPHGFPSRMTV...................GKLIELLAGKAGVL...............
E2RU19_GIAIC/790-1189RHEDLPFTL.DGI..TPDIIMNPHAIPSRMTI...................GQLMESVASKLGAL...............
Q236N3_TETTS/662-1046NQEDMPFSE.KGW..VPDLIMNPHGYPSRMTV...................GKLLELLGSKAAVL...............
Q9EMY3_AMEPV/709-1081EEEDMPYNE.NGE..RPDIIFNSPSIISRKTL...................PLYDEVSLCNMFSKIPYNDKCD.......
RPOB_ASTLO/574-991PIVDMPYLP.DGT..PIDIILNPLGIPSRMNV...................GQIYECLLNLSAIN...............
RPOB_TOXGO/547-957ENADLPFLQ.NSF..YPDIIVGALGIPSRMNL...................GQLFEALVGKISFS.YNIRILPS......
RPOB_SACHY/586-984PRQDMPYLQ.DGT..PVDMVFNPLGVPSRMNV...................GQIFESSLGLAGDL...............
RPB2_IIV6/722-1098EEVDMPFME.DGS..IPDMIINPHCLPSRMTI...................NQIMASIMGKTCCA.K.............
Q2WGI3_SELUN/574-977PRQDMPHLQ.DGT..SIDMILSPSGVPPRMNV...................GQISERVPGPAGYH.PERHHRI.......
A2E7H8_TRIVA/710-1082RQEDMPFTR.DGM..VPDIIMNPHALPSRMTI...................GHLIECLLGKCTAIDP.............
RPOB_THEP1/758-1175PKEDMPFLP.DGT..PVQMVLNPLGIPSRMNV...................GQILETHLGWLAKL...............
RPOB_RICAH/733-1293PEEDMPFLE.DGT..VVDIVLNPLGLPSRMNI...................GQILETHLGWASIN.LAQKISTLVKEYKN
Q3LW27_BIGNA/705-1066RQSLLPTTA.TSV..TPDLIMNPHAIPSRMTI...................GHMIEMLMSKVSSH...............

PF04941

RPOB_NPVSL/4-783KLIVSVTNLKNAMPVIEYDDVEWNENRDMFIRNLPVGNSVVASPGSVHNNKMINLWTLVRDSRLMTAEDPYIPNVTLPVK
Q9J825_9ABAC/4-779KSIVSLTNLKNAMPVVTYDA...SSDANVFLDNLPVGNSVVVAPEIMRNDKMFRLWTLVRDHKLMTAEDPYIPDNKLPIR
Q9YMS3_NPVLD/4-744KLIVSLTNLKNAMPVQSYTG......EGVDADALPVGNSVVVAPRVMLNNKMFTLWTLVRDHRLMTAEDPYIPHLSLPVR
RPOB_NPVOP/4-757KMIVALTNLKNAMPVLRYST..........LGTAPVGLSVAVGDHVLMNNKMVKLWTLVRDSKLMTAEDPYIPHMALPIR
Q99H09_9ABAC/4-774KLIVSLTNLKNAMPVLSYQD..LCDDNERFLNMLPNGNSVVVAPHILHNNKMFKLWTLVRDDRLQTAEDPYIPDIKLPIK
Q9DVS4_9BBAC/3-715KLIVSLTNLKNGMVVQCPTK.......IDNYDYLPLGNSVSVDPKLMFNNRMFYLWTLVRDSNLKTAEDPYIPHSNLPIR
O55596_NPVBM/4-749KLIVSLTNLKNAMPVFEYKE.......NSCVSGLPNGYSVAVNKSILLNNKMFKLWTLVRDNKLMTAEDPYIPHIALPIC

PF00562

B7WY91_COMTE/723-1292AEVRAFLEEIY........................NRSGRKEELSQLDDGEVMSMAKELTTG.VPFATPVFD........
RPOB_DESOH/723-1286DLKKKLSAVFN.........................KEIPAAEIEAMSSARLCEFASEYKDG.VHMETPVFD........
RPOB_GEOLS/851-1417ENLKKFIRETY........................DNADFNKILDTMDREELLLVARRLSRG.VPMASPVFE........
D1NBR7_9BACT/651-1192............................................................LG.FKAATPVFDG.......
Q9AIH1_CARRU/596-1191SYFKMKLFIKIIF.....................KCIYDKNINLNIFNNSLVLKIFKNIKNQ.LNVCVHNFYN.......
Q8SQY8_ENCCU/673-1023............................................................EG.QILDSTAFK........
RPOB_NEOSM/711-1263SEVKSLVLEIYK.......................NDRKMMARLNEMTDAEIVEYSRSLRGG.VPVAASVFEG.......
RPOB_SALRD/694-1211............................................................LG.VKYATPIFDG.......
RPOB_LACDA/679-1067............................................................LG.IHVATPVFDG.......
Q74MN2_NANEQ/131-507............................................................RG.KAVDGTPWE........
RPB2_IIV3/687-1053............................................................NP.RFRNGNSFQE.......
Q22C62_TETTS/682-1065............................................................NG.NILETQPFQN.......
A2EN74_TRIVA/632-991............................................................QDCAFFDATPFTH.......
Q90022_ORFV/654-1041.........................................................RRGTAPTARSASPAP........
RPOB_BORAP/667-1059............................................................LS.ESYNVPVFES.......
RPOB_SYNAS/717-1284GNQLRDELKGIY.......................QSREFEKFVDGATEEETYQFVRKLRRG.IAVSSPVFDG.......
RPOB_DEHSC/650-1123............................................................LG.FRVATPVFDG.......
RPOB_PARDP/739-1300NGDMTPVREAMQN....................GYGDDFYAETFEGMEDETLLEHADAVRGG.VPISTPVFDG.......
RPOB_AQUAE/796-1374RKAITEYLKEIFAIGD..............KDGENAKFIEEFLNSLSEEEFWSVVRDYAERG.IPMATPAFEG.......
A5Z8Z3_9FIRM/700-1129............................................................LG.FNIATPVFDG.......
Q4GZE8_TRYB2/673-1036............................................................TG.KFGDGTAFG........
RPOB_UREPA/837-1300GYEKYISLFGINEIIAKKLYE....NISNLIKHKQAKQAKDIDLIDVTIILKELGLSYDDIG.IKISTPVFDG.......
A7YUZ1_FRATU/718-1276AAELRKTLEEVY......................NSVGDKKVNLEALNDEEILTLCDNLKGG.VPIATPVFDG.......
RPA2_DICDI/662-1031............................................................HG.KFQDATAFQF.......
RPOB_CORGB/629-1051...............................................LVKTLPADLLEVPAG.SLTATPVFDG.......
Q1NPU6_9DELT/719-1284AAVKKKLAAVY........................SPQEYEQLVGDLSDDELLELASRMGNG.LHMATPVFDG.......
Q0EVW7_9PROT/695-1254NEEMRSFLLDIY......................AEDKTACRQIGEMNDAELVELSTNLKGG.VPIATPVFDG.......
A0CUT2_PARTE/739-1109............................................................KG.QFNDATPFA........
A7UZT8_BACUN/679-1194............................................................LG.VKFATPIFDG.......
Q5AFK6_CANAL/673-1039............................................................HG.IAQDSTPWKF.......
RPOB_KORVE/828-1399AGQVRKHLKQLF.......................KDTAFVDHVTELDDEMLLKVAKGMQDG.VFFGSAVFDG.......
RPOB_EIMTE/562-966.....................................................SNTFNLPK..VYIKTILYNYIN.....
Q4A245_EHV8U/683-1058............................................................EG.ETQDGTPFT........
Q1L6W4_9TRAC/184-547............................................................SA.REQDATPFV........
A2E3T5_TRIVA/686-1052............................................................TG.RIGNGTAFS........
Q4N2L4_THEPA/737-1128............................................................YG.KPQDSTCFQAYY.....
RPOB_MYCGE/814-1279KAKEFAIEINQPQARVERLIKGLKNQINDRNIKSEKEALEKLDNSDISLVLKEIGMSFDDLI.YKIATPIFQG.......
O21237_RECAM/676-1397VGKSRKYLSMLY.......................RNKKELLLLNSLNDSQIICLFKNISHG.IPISTPIFNS.......
RPOB_PLAF7/525-929.....................................................SNNLNKNY..YNNYNHIFNYYKY....
A4E9H0_9ACTN/589-1012.....................................................DSDKYVPGP.FFTATPVFDG.......
Q8TXI7_METKA/159-536............................................................SG.KRIDGSAFT........
A4WN98_PYRAR/656-1029............................................................TG.NLVDATPFE........
RPOBC_HELPY/729-1296DFAKELRAKMLEIAN................AINEKDPLTIHALENCSDEELLEYAKDWSKG.VKMAIPVFEG.......
Q6Q8Z4_9GAMM/699-1253PAELKDYLDKLY......................NKNAANKEDIQSFNNTEINELANNLRKG.LPIATPVFDG.......
Q9FKF1_ARATH/698-1075............................................................CG.RFHYGSAFG........
Q5RB08_PONAB/668-1031............................................................HG.LCHGATPFIF.......
A7XDR4_PEWBP/753-1146............................................................LN.IKVATPVLDG.......
RPOB_PELUB/725-1287KFEKTEKISSFLKS...................VYGKEVFDGGIEKLNKTEFSDLCENLQNG.IAISTPVFDG.......
Q5CSG7_CRYPI/757-1165............................................................HGARSLDATPFNINI.....
Q1L6W0_9TRAC/133-496............................................................GC.CQNDATPSS........
A0D7M6_PARTE/653-1033............................................................EG.KFKYGTAFG........
Q4UB41_THEAN/764-1155............................................................SG.NFVDSTPFS........
RPOB2_SCEOB/49-472............................................................LN.HYYRIQAFDEIYG....
A7AXE5_BABBO/518-899......................................................SPINLHS..SDMYSSLYV........
RPOB_PSEAK/1488-2086............................................................LK.QNFKIQPFDEIYG....
RPOB_MAGSM/722-1281GVADVLRRQFEEI.....................YDNTRESAEIAALSDDQLVDMAKNLQYG.VPTATPVFDG.......
A6DPM7_9BACT/669-1185............................................................MG.IKIATPVFDG.......
Q583H5_TRYB2/722-1094............................................................KG.GEVYATPFC........
RPOB_OSTTA/585-1008............................................................LK.QNFKVLPFDEMHG....
RPOB_THEPA/517-924......................................................APINLYN..YHLYSNMYL........
RPOB_FUSNN/673-1063...........................................................NGG.TCIATPVFDG.......
RPOB_DEIGD/617-1059............................................................TG.QKFVTPVFDS.......
A8B2N4_GIAIC/761-1143............................................................RG.EQTDGTCFR........
Q3LVX3_BIGNA/673-1033............................................................TG.KLLNLSDFTK.......
A2SSM5_METLZ/135-540............................................................EG.SRVNATSFR........
Q5GAH6_9VIRU/620-1017............................................................LG.KRYDATAFE........
RPOB_DESDG/714-1278LASVREQVKTVF.......................ASDAISSEVDNMDDETFVRSVRRLRDG.IVTKTPVFDG.......
Q27493_CAEEL/647-1005............................................................HG.ENYDASPFVF.......
Q5MIL2_CHLP6/660-1172............................................................AG.IHVKTPVFEG.......
Q9YVT7_MSEPV/705-1077......................................................TRYINYP..TYTDMTSTDIIEYIRNK
Q1L120_MYCAA/199-587............................................................LG.CKFVTPVFDG.......
Q5YF54_ISKNV/603-966............................................................GGGKGYDATAFN........
RPOB_PHATC/874-1274............................................................LN.ARFKILPFDEMYG....
RPB2_ASFB7/780-1141............................................................QG.VVTDGTAFL........
A8B827_GIAIC/681-1140............................................................YA.DFVDSSPFQW.......
Q4ZJA8_FLDV/552-932............................................................TG.KIYDATPFK........
Q07DU9_MAIZE/693-1067............................................................KG.TMRYATPFT........
Q8SSB7_ENCCU/630-975............................................................SG.NEQDGTVFKKSF.....
RPOB_PHOPR/715-1263LHKFRNFLQKVYD.....................LGDTRQDVDIAALSDDQVHTLVQNLRDG.LPIATPVFDG.......
Q1L6V8_9TRAC/152-501............................................................GL.CLGD.TPFT........
RPOB_EHRRW/738-1291LTIAHLRNFLDQV.....................YDGQDLKYSIRSMSDDDLLAFAERLRDG.VPMAAPVFEG.......
Q06VE3_TNAVC/706-1065............................................................TA.RNIDGSPFQL.......
Q98S72_GUITH/656-1015............................................................NG.NFNDSSPFTS.......
Q5CPZ8_CRYPI/817-1197............................................................DG.NYRYGTAFG........
A0RXX0_CENSY/642-1018............................................................RG.TQFDGSAFV........
RPOB_GNEPA/588-1017.............................................................N.KHYRIPPFDERYE....
A4I1A3_LEIIN/1105-1506............................................................EG.RFIDHSAWS........
A5ULN7_METS3/133-507............................................................EG.ERVDGTPFN........
Q98RY5_GUITH/732-1110............................................................KG.IEGDGTPFE........
RPOB_PORYE/620-1023............................................................LG.KRFKIIPFDEMYG....
Q98S96_GUITH/637-966............................................................SG.KFKDGSIFK........
Q1L6W1_9MARC/306-677............................................................RG.EQLFATPFN........
Q980R1_SULSO/174-547............................................................SG.NIVDATPFY........
Q8KTP8_TREPR/703-1210SAYHDAMCH............................GLMACDGRCYPACSAAGGSPGHRVT.LCTLCPAFDG.......
A7BQQ8_9GAMM/365-1039SKIIAQSIEELRSYL................TKIYNVSGKPEDLTVLNNAEILELAKNLSDG.VPMATQVFDG.......
Q0N5M4_VARV/670-1047..........................................................NNKGENRPVCFPSS........
A4RSZ5_OSTLU/678-1042............................................................TG.IFADATPFK........
Q1Q128_9BACT/647-1145............................................................LG.FRAITPIFEG.......
RPOB_RUTMC/721-1282DMVKQIRDFLDEV.....................YNSYGKQENLASFSDEEIIELASNLREG.VPMATPVFDG.......
A6DE89_9PROT/728-1294DMMNKLRAKMKEIVK.................VAHFGEHFEKFLDSLTNEELLKYARDWAKG.VKFSTPVFEG.......
A0SEA6_9MOLU/200-587............................................................LG.IKISTPVFEG.......
RPOB_RHOBA/664-1160............................................................LG.FQALTPIFDG.......
RPO2_MIMIV/724-1093............................................................KG.VYGDATPFT........
Q8II17_PLAF7/942-1400............................................................YG.KRIDATPFRKYTQQKSF
RPC2_MOUSE/666-1041............................................................DG.RFHYGTAFG........
E2RU19_GIAIC/790-1189............................................................SG.HEVDGTAFN........
Q236N3_TETTS/662-1046............................................................SG.QFKYGTAFG........
Q9EMY3_AMEPV/709-1081......................................................VEYINYP..IYTDKSPLDKYNFIKKE
RPOB_ASTLO/574-991............................................................LK.ERYKIQPFDEYQY....
RPOB_TOXGO/547-957....................................................FTTSSNLYF..NYLKILIYNFLMF....
RPOB_SACHY/586-984............................................................LK.KHYRIAPFDERYE....
RPB2_IIV6/722-1098............................................................NE.TFGDASPFQESS.....
Q2WGI3_SELUN/574-977.....................................................IPSDERYER.EAPRKPVFPETY.....
A2E7H8_TRIVA/710-1082...........................................................QNA.DEGDATPFC........
RPOB_THEP1/758-1175............................................................TG.KWFATPVFEG.......
RPOB_RICAH/733-1293KNIGIEKIKKFLL.....................ELYGENINYILERSEEEIISFCNKVGKG.VYFATPVFDG.......
Q3LW27_BIGNA/705-1066............................................................SG.KLGDATAFS........

PF04941

RPOB_NPVSL/4-783LFNNKVNRLKGKMVYASKS-------------------------------------------------------------
Q9J825_9ABAC/4-779LYNNKINKLKGKLNYSKN.-------------------------------------------------------------
Q9YMS3_NPVLD/4-744LYNNKVNKLKGKIVCAKT.-------------------------------------------------------------
RPOB_NPVOP/4-757LYNHKVNKLKGKLALAGK.-------------------------------------------------------------
Q99H09_9ABAC/4-774LYNNKINKLKGKLLYAKN.-------------------------------------------------------------
Q9DVS4_9BBAC/3-715IYHNKLHKLKGKLETDHN.-------------------------------------------------------------
O55596_NPVBM/4-749LYNNKVNKLKGKLVVGPK.-------------------------------------------------------------

PF00562

B7WY91_COMTE/723-1292..............................................GA................................
RPOB_DESOH/723-1286..............................................GA................................
RPOB_GEOLS/851-1417..............................................GA................................
D1NBR7_9BACT/651-1192............................................IG..................................
Q9AIH1_CARRU/596-1191............................................FN..................................
Q8SQY8_ENCCU/673-1023................................................................................
RPOB_NEOSM/711-1263............................................PK..................................
RPOB_SALRD/694-1211............................................AS..................................
RPOB_LACDA/679-1067............................................AS..................................
Q74MN2_NANEQ/131-507................................................................................
RPB2_IIV3/687-1053............................................NS..................................
Q22C62_TETTS/682-1065............................................YQ..................................
A2EN74_TRIVA/632-991............................................DE..................................
Q90022_ORFV/654-1041................................................................................
RPOB_BORAP/667-1059............................................AT..................................
RPOB_SYNAS/717-1284............................................AT..................................
RPOB_DEHSC/650-1123............................................AD..................................
RPOB_PARDP/739-1300............................................AK..................................
RPOB_AQUAE/796-1374............................................AE..................................
A5Z8Z3_9FIRM/700-1129............................................AD..................................
Q4GZE8_TRYB2/673-1036................................................................................
RPOB_UREPA/837-1300............................................AN..................................
A7YUZ1_FRATU/718-1276............................................AK..................................
RPA2_DICDI/662-1031............................................DE..................................
RPOB_CORGB/629-1051............................................AS..................................
Q1NPU6_9DELT/719-1284............................................AR..................................
Q0EVW7_9PROT/695-1254............................................AN..................................
A0CUT2_PARTE/739-1109................................................................................
A7UZT8_BACUN/679-1194............................................AS..................................
Q5AFK6_CANAL/673-1039............................................NE..................................
RPOB_KORVE/828-1399............................................ST..................................
RPOB_EIMTE/562-966...........................................NIK..................................
Q4A245_EHV8U/683-1058................................................................................
Q1L6W4_9TRAC/184-547................................................................................
A2E3T5_TRIVA/686-1052................................................................................
Q4N2L4_THEPA/737-1128...........................................SEN.PENG...........................DE
RPOB_MYCGE/814-1279............................................VN..................................
O21237_RECAM/676-1397............................................AN..................................
RPOB_PLAF7/525-929..........................................NYNN..................................
A4E9H0_9ACTN/589-1012............................................AK..................................
Q8TXI7_METKA/159-536................................................................................
A4WN98_PYRAR/656-1029................................................................................
RPOBC_HELPY/729-1296............................................IS..................................
Q6Q8Z4_9GAMM/699-1253............................................AK..................................
Q9FKF1_ARATH/698-1075................................................................................
Q5RB08_PONAB/668-1031............................................SE..................................
A7XDR4_PEWBP/753-1146............................................AN..................................
RPOB_PELUB/725-1287............................................AK..................................
Q5CSG7_CRYPI/757-1165...........................................SDD.LSRSEEN......................CEDD
Q1L6W0_9TRAC/133-496................................................................................
A0D7M6_PARTE/653-1033................................................................................
Q4UB41_THEAN/764-1155................................................................................
RPOB2_SCEOB/49-472..........................................PHAS..................................
A7AXE5_BABBO/518-899................................................................................
RPOB_PSEAK/1488-2086..........................................CEAS..................................
RPOB_MAGSM/722-1281............................................AI..................................
A6DPM7_9BACT/669-1185............................................CP..................................
Q583H5_TRYB2/722-1094................................................................................
RPOB_OSTTA/585-1008..........................................AEVS..................................
RPOB_THEPA/517-924................................................................................
RPOB_FUSNN/673-1063............................................AT..................................
RPOB_DEIGD/617-1059............................................AT..................................
A8B2N4_GIAIC/761-1143................................................................................
Q3LVX3_BIGNA/673-1033............................................HR..................................
A2SSM5_METLZ/135-540................................................................................
Q5GAH6_9VIRU/620-1017................................................................................
RPOB_DESDG/714-1278............................................AT..................................
Q27493_CAEEL/647-1005............................................NE..................................
Q5MIL2_CHLP6/660-1172............................................FP..................................
Q9YVT7_MSEPV/705-1077.....................................IKPLYPNIS..................................
Q1L120_MYCAA/199-587............................................VK..................................
Q5YF54_ISKNV/603-966................................................................................
RPOB_PHATC/874-1274..........................................LEIS..................................
RPB2_ASFB7/780-1141................................................................................
A8B827_GIAIC/681-1140............................................SD..................................
Q4ZJA8_FLDV/552-932................................................................................
Q07DU9_MAIZE/693-1067................................................................................
Q8SSB7_ENCCU/630-975...........................................LLE.QEE.............................G
RPOB_PHOPR/715-1263............................................AP..................................
Q1L6V8_9TRAC/152-501................................................................................
RPOB_EHRRW/738-1291............................................PK..................................
Q06VE3_TNAVC/706-1065............................................DV..................................
Q98S72_GUITH/656-1015............................................FL..................................
Q5CPZ8_CRYPI/817-1197................................................................................
A0RXX0_CENSY/642-1018................................................................................
RPOB_GNEPA/588-1017..........................................QEAS..................................
A4I1A3_LEIIN/1105-1506...............................................TV...............................
A5ULN7_METS3/133-507................................................................................
Q98RY5_GUITH/732-1110................................................................................
RPOB_PORYE/620-1023..........................................AEAS..................................
Q98S96_GUITH/637-966................................................................................
Q1L6W1_9MARC/306-677................................................................................
Q980R1_SULSO/174-547................................................................................
Q8KTP8_TREPR/703-1210............................................PS..................................
A7BQQ8_9GAMM/365-1039............................................AS..................................
Q0N5M4_VARV/670-1047................................................................................
A4RSZ5_OSTLU/678-1042...............................................HS...............................
Q1Q128_9BACT/647-1145............................................AL..................................
RPOB_RUTMC/721-1282............................................IK..................................
A6DE89_9PROT/728-1294............................................VT..................................
A0SEA6_9MOLU/200-587............................................VK..................................
RPOB_RHOBA/664-1160............................................AS..................................
RPO2_MIMIV/724-1093................................................................................
Q8II17_PLAF7/942-1400NNPWIDNCGIKGFLEKNDTIKSDLDTCQKEKDKNKNINNNNNNKIKENKYNNSNDSNASIDSDDNTNNCNDKRDEEEKKA
RPC2_MOUSE/666-1041................................................................................
E2RU19_GIAIC/790-1189................................................................................
Q236N3_TETTS/662-1046................................................................................
Q9EMY3_AMEPV/709-1081.....................................LKKIYNNVT..................................
RPOB_ASTLO/574-991..........................................KNNS..................................
RPOB_TOXGO/547-957..........................................NNFK..................................
RPOB_SACHY/586-984..........................................QEAS..................................
RPB2_IIV6/722-1098...........................................LEK..................................
Q2WGI3_SELUN/574-977...........................................EAS..................................
A2E7H8_TRIVA/710-1082................................................................................
RPOB_THEP1/758-1175............................................AK..................................
RPOB_RICAH/733-1293............................................AK..................................
Q3LW27_BIGNA/705-1066................................................................................

PF04941

RPOB_NPVSL/4-783---KTPLVKFF.KS.ESNNFVDTNE-------------------------------GHVLA-------------------
Q9J825_9ABAC/4-779---EVPKIKYY.KS.AQNNCVQVQG-------------------------------GHVLH-------------------
Q9YMS3_NPVLD/4-744---ERPRVKFV.AAPARDNCAAVDG-------------------------------GHLLH-------------------
RPOB_NPVOP/4-757---AVPTLKFVASS.GPHNCVVLPD-------------------------------NMVQY-------------------
Q99H09_9ABAC/4-774---ETPVVKFN.NS.NDNNYVTVEG-------------------------------GNVLL-------------------
Q9DVS4_9BBAC/3-715---ASSVI.YK.IS.YRNNIIDVEG-------------------------------DNRLC-------------------
O55596_NPVBM/4-749---QSCLVKFT.NS.SDKNYVALDD-------------------------------GLVLY-------------------

PF00562

B7WY91_COMTE/723-1292..SE..................AEI...............................KDMLK...................
RPOB_DESOH/723-1286..KE..................AEI...............................KALLK...................
RPOB_GEOLS/851-1417..GE..................AKI...............................KELLT...................
D1NBR7_9BACT/651-1192...E..................QEI...............................IDLMRKGNDAFTAKEGHDYHWGFK
Q9AIH1_CARRU/596-1191...V..................NKV...............................NNIIK...................
Q8SQY8_ENCCU/673-1023...EN...............SVEQT...............................CELLI...................
RPOB_NEOSM/711-1263...T..................DEI...............................ERLLV...................
RPOB_SALRD/694-1211...L..................EDV...............................GDELE...................
RPOB_LACDA/679-1067...E..................DDV...............................WDFVR...................
Q74MN2_NANEQ/131-507...EE...............PVEDL...............................RKQLL...................
RPB2_IIV3/687-1053....NT..............ILKEL...............................CHHLK...................
Q22C62_TETTS/682-1065...DDD..............IVNYF...............................GKQLQ...................
A2EN74_TRIVA/632-991...KNR..............ITDEV...............................GQMLA...................
Q90022_ORFV/654-1041...TRP..............TSQTY...............................IAVAP...................
RPOB_BORAP/667-1059...N..................EQI...............................QEKLK...................
RPOB_SYNAS/717-1284...E..................SDI...............................RNMLK...................
RPOB_DEHSC/650-1123...D..................TVI...............................EDALA...................
RPOB_PARDP/739-1300...E..................ADI...............................NDALR...................
RPOB_AQUAE/796-1374...E..................DAI...............................KELLK...................
A5Z8Z3_9FIRM/700-1129...E..................YDI...............................MDTLE...................
Q4GZE8_TRYB2/673-1036...GD...............KAEDL...............................GEELI...................
RPOB_UREPA/837-1300...H..................DDI...............................VSIMN...................
A7YUZ1_FRATU/718-1276...E..................EDI...............................KSLLK...................
RPA2_DICDI/662-1031...NNT..............AIDFF...............................GEQLA...................
RPOB_CORGB/629-1051...N..................EEL...............................SGLLA...................
Q1NPU6_9DELT/719-1284...E..................DEI...............................RQLLV...................
Q0EVW7_9PROT/695-1254...E..................AHI...............................RRMLK...................
A0CUT2_PARTE/739-1109...QI...............LVNDI...............................ANELH...................
A7UZT8_BACUN/679-1194...L..................DDL...............................NEWTD...................
Q5AFK6_CANAL/673-1039...QDT..............PADYF...............................GEQLL...................
RPOB_KORVE/828-1399...E..................AEI...............................KSLLD...................
RPOB_EIMTE/562-966...E..................KSG...............................NLWIY...................
Q4A245_EHV8U/683-1058...GN...............NIELI...............................ADRLE...................
Q1L6W4_9TRAC/184-547...ER...............SLPRF...............................SEELH...................
A2E3T5_TRIVA/686-1052...SD...............RVKDI...............................ADDLI...................
Q4N2L4_THEPA/737-1128EMEEVD..............VVDYF...............................GKSLI...................
RPOB_MYCGE/814-1279...F..................LDL...............................QDVMQ...................
O21237_RECAM/676-1397...N..................FDI...............................DNLLR...................
RPOB_PLAF7/525-929...N..................FNI...............................NSKMS...................
A4E9H0_9ACTN/589-1012...E..................DEI...............................AEVIR...................
Q8TXI7_METKA/159-536...SNPK............EAYEEI...............................KKMLR...................
A4WN98_PYRAR/656-1029...GV...............KEEDL...............................RKLLL...................
RPOBC_HELPY/729-1296...Q..................EKF...............................YKLFE...................
Q6Q8Z4_9GAMM/699-1253...E..................SEI...............................KELLK...................
Q9FKF1_ARATH/698-1075...ERSGH..........ADKVETI...............................SATLV...................
Q5RB08_PONAB/668-1031...ENS..............ALEYF...............................GEMLK...................
A7XDR4_PEWBP/753-1146...N..................EDL...............................KNIMQ...................
RPOB_PELUB/725-1287...E..................KDV...............................SEMLE...................
Q5CSG7_CRYPI/757-1165KAGEKT..............TVDYF...............................GKALE...................
Q1L6W0_9TRAC/133-496...SI...............SVESL...............................TDLLH...................
A0D7M6_PARTE/653-1033...GE...............NVLQV...............................GEELL...................
Q4UB41_THEAN/764-1155...NSYSDNLCNDLNNTKTDNMSDI...............................CNILI...................
RPOB2_SCEOB/49-472...R..................SFT...............................FAKLY...................
A7AXE5_BABBO/518-899......................KSV...............................SNKI....................
RPOB_PSEAK/1488-2086...R..................SLV...............................YSKLY...................
RPOB_MAGSM/722-1281...E..................SDI...............................SSWLN...................
A6DPM7_9BACT/669-1185...E..................SII...............................NDMLE...................
Q583H5_TRYB2/722-1094...SV...............VVEDF...............................GKALT...................
RPOB_OSTTA/585-1008...R..................GFV...............................YHYLY...................
RPOB_THEPA/517-924......................KNI...............................FNSLN...................
RPOB_FUSNN/673-1063...E..................EQV...............................KDYLE...................
RPOB_DEIGD/617-1059...E..................EAI...............................KEMLEVAAAERLQRRKDEGFELDK
A8B2N4_GIAIC/761-1143...TKTD...........ETFLAEL...............................YDSLR...................
Q3LVX3_BIGNA/673-1033....KRE...........YDWYNDI...............................SVFFK...................
A2SSM5_METLZ/135-540...KT...............QVEKIFDSSFAQNRLLNDKEIGKDVKSSTLTREQVLRHQLA...................
Q5GAH6_9VIRU/620-1017...RAD..............IVKDI...............................ADAAK...................
RPOB_DESDG/714-1278...E..................EQI...............................WSWME...................
Q27493_CAEEL/647-1005...DNT..............AINHF...............................GELLT...................
Q5MIL2_CHLP6/660-1172...E..................SRI...............................WDMMI...................
Q9YVT7_MSEPV/705-1077...D..................EEL...............................NDIVY...................
Q1L120_MYCAA/199-587...K..................EAI...............................QDVIS...................
Q5YF54_ISKNV/603-966...SD................GTDL...............................LKTLE...................
RPOB_PHATC/874-1274...R..................ILI...............................NKKLR...................
RPB2_ASFB7/780-1141....PI..............NVQLL...............................SERLA...................
A8B827_GIAIC/681-1140...ERR..............AIDVF...............................GEQLL...................
Q4ZJA8_FLDV/552-932...RYN..............LTEEL...............................KELAL...................
Q07DU9_MAIZE/693-1067...TA...............SVDVI...............................AEQLH...................
Q8SSB7_ENCCU/630-975DDEKVR..............RKEYL...............................CSELR...................
RPOB_PHOPR/715-1263...E..................SSI...............................KELLK...................
Q1L6V8_9TRAC/152-501...HL...............RAEQL...............................AQKLA...................
RPOB_EHRRW/738-1291...D..................NQI...............................SNLLK...................
Q06VE3_TNAVC/706-1065....ND..............VLFDL...............................CEQLA...................
Q98S72_GUITH/656-1015...NCN..............KSYIF...............................GEFLR...................
Q5CPZ8_CRYPI/817-1197...GT...............PLEES...............................AKCLV...................
A0RXX0_CENSY/642-1018...GE...............KMEEV...............................REVMD...................
RPOB_GNEPA/588-1017...R..................KLV...............................FYELY...................
A4I1A3_LEIIN/1105-1506.DEQPR..............VAELI...............................GEALV...................
A5ULN7_METS3/133-507...TE...............LEKEI...............................KQQLK...................
Q98RY5_GUITH/732-1110...RQ...............NMEDI...............................MNFLE...................
RPOB_PORYE/620-1023...R..................ALV...............................NRKLK...................
Q98S96_GUITH/637-966...KI...............NINTI...............................VKSLR...................
Q1L6W1_9MARC/306-677...PAS..............TVESI...............................TEALH...................
Q980R1_SULSO/174-547...KT...............PIEQL...............................QNEIL...................
Q8KTP8_TREPR/703-1210...E..................AEI...............................RSMAR...................
A7BQQ8_9GAMM/365-1039...E..................SEI...............................KMMLE...................
Q0N5M4_VARV/670-1047...NET..............SIDTY...............................MQFA....................
A4RSZ5_OSTLU/678-1042.DKEIS..............PTEEY...............................GKLLR...................
Q1Q128_9BACT/647-1145...E..................EEI...............................RETLK...................
RPOB_RUTMC/721-1282...E..................KDI...............................KSLLK...................
A6DE89_9PROT/728-1294...E..................EEF...............................KKLFE...................
A0SEA6_9MOLU/200-587...E..................EDL...............................KDIMA...................
RPOB_RHOBA/664-1160...E..................SEI...............................NDCLA...................
RPO2_MIMIV/724-1093...SV...............DLNAI...............................NDELV...................
Q8II17_PLAF7/942-1400NITYDE..............KIDYF...............................AKLLL...................
RPC2_MOUSE/666-1041...GS...............KVKDV...............................CEDLV...................
E2RU19_GIAIC/790-1189...APPG............STDKQI...............................AADLH...................
Q236N3_TETTS/662-1046...GD...............KMADL...............................SSILV...................
Q9EMY3_AMEPV/709-1081...D..................EEL...............................ENIIY...................
RPOB_ASTLO/574-991...E..................ILI...............................YKKLN...................
RPOB_TOXGO/547-957...K....................G...............................FNWLY...................
RPOB_SACHY/586-984...R..................KLV...............................FSELY...................
RPB2_IIV6/722-1098...PQD..............KIHAL...............................CKELE...................
Q2WGI3_SELUN/574-977...E..................QTA...............................NPRSL...................
A2E7H8_TRIVA/710-1082...GV...............TVDAI...............................AKRLQ...................
RPOB_THEP1/758-1175...E..................DEI...............................LRPLY...................
RPOB_RICAH/733-1293...V..................QDV...............................KDMLK...................
Q3LW27_BIGNA/705-1066...EG...............NIGKI...............................IGHLS...................

PF04941

RPOB_NPVSL/4-783--MAGVIVSNV---------------------------------------------------------------------
Q9J825_9ABAC/4-779--AAGVIVSNV---------------------------------------------------------------------
Q9YMS3_NPVLD/4-744--AVGMVVSNV---------------------------------------------------------------------
RPOB_NPVOP/4-757--FAGTVLSGA---------------------------------------------------------------------
Q99H09_9ABAC/4-774--IVGVVVSNV---------------------------------------------------------------------
Q9DVS4_9BBAC/3-715--LFGVLLSSN---------------------------------------------------------------------
O55596_NPVBM/4-749--MAGVLVSNA---------------------------------------------------------------------

PF00562

B7WY91_COMTE/723-1292..LAY.PDDIAAAK..................................................................
RPOB_DESOH/723-1286..EGG.ADE.......................................................................
RPOB_GEOLS/851-1417..RAG.FAT.......................................................................
D1NBR7_9BACT/651-1192QNE.....AGE.....................................................................
Q9AIH1_CARRU/596-1191..T.....IGI.....................................................................
Q8SQY8_ENCCU/673-1023..KHG.FSY.......................................................................
RPOB_NEOSM/711-1263..L.....AGK.....................................................................
RPOB_SALRD/694-1211..K.....AGL.....................................................................
RPOB_LACDA/679-1067..E.....AGV.....................................................................
Q74MN2_NANEQ/131-507..RLG.FRE.......................................................................
RPB2_IIV3/687-1053..LNG.FDP.......................................................................
Q22C62_TETTS/682-1065..SHG.YNY.......................................................................
A2EN74_TRIVA/632-991..KEG.FEY.......................................................................
Q90022_ORFV/654-1041..RRC.YALS......................................................................
RPOB_BORAP/667-1059..K.....AGF.....................................................................
RPOB_SYNAS/717-1284..L.....ANL.....................................................................
RPOB_DEHSC/650-1123..RSWLSAKAGAIDMSPENKRPSADAHKAIEWIKQQGFDGKKIFDEKHPGLAKEVSLKLWLKDMGVDASALSGAELEKKA
RPOB_PARDP/739-1300..R.....AGF.....................................................................
RPOB_AQUAE/796-1374..K.....AGL.....................................................................
A5Z8Z3_9FIRM/700-1129..M.....ANDYANTEWEDFQAKYQDKLNPE........................................VMEYLGEHL
Q4GZE8_TRYB2/673-1036..RHG.YNY.......................................................................
RPOB_UREPA/837-1300..E.....ANID....................................................................
A7YUZ1_FRATU/718-1276..I.....GGF.....................................................................
RPA2_DICDI/662-1031..KAG.FNR.......................................................................
RPOB_CORGB/629-1051..N.....SRPNRDG.................................................................
Q1NPU6_9DELT/719-1284..E.....AGL.....................................................................
Q0EVW7_9PROT/695-1254..L.....AGL.....................................................................
A0CUT2_PARTE/739-1109..KVG.WQK.......................................................................
A7UZT8_BACUN/679-1194..K.....AGL.....................................................................
Q5AFK6_CANAL/673-1039..KAG.YNY.......................................................................
RPOB_KORVE/828-1399..Q.....AGL.....................................................................
RPOB_EIMTE/562-966..NSYSP.........................................................................
Q4A245_EHV8U/683-1058..THG.MQR.......................................................................
Q1L6W4_9TRAC/184-547..KAG.FQR.......................................................................
A2E3T5_TRIVA/686-1052..AAG.YSY.......................................................................
Q4N2L4_THEPA/737-1128..KSG.YEY.......................................................................
RPOB_MYCGE/814-1279..E.....AGLD....................................................................
O21237_RECAM/676-1397..I.....SGL.....................................................................
RPOB_PLAF7/525-929..YNY...........................................................................
A4E9H0_9ACTN/589-1012..R.....ANKNMLNKATAAFG..........................................................
Q8TXI7_METKA/159-536..ELG.FEP.......................................................................
A4WN98_PYRAR/656-1029..KLG.YKW.......................................................................
RPOBC_HELPY/729-1296..L.....AKI.....................................................................
Q6Q8Z4_9GAMM/699-1253..L.....ADL.....................................................................
Q9FKF1_ARATH/698-1075..EKG.FSY.......................................................................
Q5RB08_PONAB/668-1031..AAG.YNF.......................................................................
A7XDR4_PEWBP/753-1146..E.....ANL.....................................................................
RPOB_PELUB/725-1287..L.....AKL.....................................................................
Q5CSG7_CRYPI/757-1165..RAG.FQY.......................................................................
Q1L6W0_9TRAC/133-496..RSG.YER.......................................................................
A0D7M6_PARTE/653-1033..KRG.FHY.......................................................................
Q4UB41_THEAN/764-1155..KNG.FHP.......................................................................
RPOB2_SCEOB/49-472..E.....ARLKTNQK................................................................
A7AXE5_BABBO/518-899................................................................................
RPOB_PSEAK/1488-2086..E.....ARIKTGQD................................................................
RPOB_MAGSM/722-1281..K.....AGL.....................................................................
A6DPM7_9BACT/669-1185..E.....VGY.....................................................................
Q583H5_TRYB2/722-1094..QLK.LNR.......................................................................
RPOB_OSTTA/585-1008..K.....SRLLTQQK................................................................
RPOB_THEPA/517-924................................................................................
RPOB_FUSNN/673-1063..K.....QGY.....................................................................
RPOB_DEIGD/617-1059REQEVLDRAGKLGVISPPNG............................................................
A8B2N4_GIAIC/761-1143..VAG.FSY.......................................................................
Q3LVX3_BIGNA/673-1033..EYGHTN........................................................................
A2SSM5_METLZ/135-540..EAG.FAH.......................................................................
Q5GAH6_9VIRU/620-1017..EAG.IEH.......................................................................
RPOB_DESDG/714-1278..Q.....AGL.....................................................................
Q27493_CAEEL/647-1005..KAG.YNY.......................................................................
Q5MIL2_CHLP6/660-1172..E.....QGL.....................................................................
Q9YVT7_MSEPV/705-1077................................................................................
Q1L120_MYCAA/199-587..E.....AGL.....................................................................
Q5YF54_ISKNV/603-966..ELG.YA........................................................................
RPOB_PHATC/874-1274..Q.....ASIAKNES................................................................
RPB2_ASFB7/780-1141..QEG.LRF.......................................................................
A8B827_GIAIC/681-1140..KTGQFNR.......................................................................
Q4ZJA8_FLDV/552-932..ELK.LET.......................................................................
Q07DU9_MAIZE/693-1067..RAG.YSR.......................................................................
Q8SSB7_ENCCU/630-975..RHG.FNY.......................................................................
RPOB_PHOPR/715-1263..L.....GDL.....................................................................
Q1L6V8_9TRAC/152-501..KRG.FQK.......................................................................
RPOB_EHRRW/738-1291..L.....ADL.....................................................................
Q06VE3_TNAVC/706-1065..EVK.YDK.......................................................................
Q98S72_GUITH/656-1015..ENG.FEF.......................................................................
Q5CPZ8_CRYPI/817-1197..EHG.FHY.......................................................................
A0RXX0_CENSY/642-1018..TAG.FKY.......................................................................
RPOB_GNEPA/588-1017..K.....ASEQTANP................................................................
A4I1A3_LEIIN/1105-1506..KAG.YNR.......................................................................
A5ULN7_METS3/133-507..NHG.FES.......................................................................
Q98RY5_GUITH/732-1110..KNN.FDK.......................................................................
RPOB_PORYE/620-1023..E.....ASLITSNK................................................................
Q98S96_GUITH/637-966..SFG.FVS.......................................................................
Q1L6W1_9MARC/306-677..ESG.YNG.......................................................................
Q980R1_SULSO/174-547..RYG.YLP.......................................................................
Q8KTP8_TREPR/703-1210..A.....AATQGVR.................................................................
A7BQQ8_9GAMM/365-1039..L.....AGL.....................................................................
Q0N5M4_VARV/670-1047..KQC.YEHS......................................................................
A4RSZ5_OSTLU/678-1042..ESG.YNF.......................................................................
Q1Q128_9BACT/647-1145..E.....AKL.....................................................................
RPOB_RUTMC/721-1282..L.....ADL.....................................................................
A6DE89_9PROT/728-1294..M.....AGI.....................................................................
A0SEA6_9MOLU/200-587..E.....AGM.....................................................................
RPOB_RHOBA/664-1160..E.....AGL.....................................................................
RPO2_MIMIV/724-1093..AAG.YEE.......................................................................
Q8II17_PLAF7/942-1400..NKG.YDY.......................................................................
RPC2_MOUSE/666-1041..RHG.YNY.......................................................................
E2RU19_GIAIC/790-1189..ARG.YQK.......................................................................
Q236N3_TETTS/662-1046..QNG.FSY.......................................................................
Q9EMY3_AMEPV/709-1081................................................................................
RPOB_ASTLO/574-991..Q.....SRKKTKKE................................................................
RPOB_TOXGO/547-957..NFNLP.........................................................................
RPOB_SACHY/586-984..E.....ASKQTKNP................................................................
RPB2_IIV6/722-1098..ECG.YNY.......................................................................
Q2WGI3_SELUN/574-977..E.....LG......................................................................
A2E7H8_TRIVA/710-1082..DAG.FEK.......................................................................
RPOB_THEP1/758-1175..E.....ERKKRGLH................................................................
RPOB_RICAH/733-1293..L.....AGQ.....................................................................
Q3LW27_BIGNA/705-1066..KFG.IHH.......................................................................

PF04941

RPOB_NPVSL/4-783-------KINWTHDGKR--------------YKIETCKNKSF---------YIFKIYTFLRKIRSQRI--ELIDAKLSTL
Q9J825_9ABAC/4-779-------KIGWIYDGKR--------------YKIETCRNKNF---------YVYKIYVYYRQIEKQKV--ERLDSSLTVS
Q9YMS3_NPVLD/4-744-------KIAWIYDGKR--------------YKIETCKNKNH---------FVFKIYLYLRRLRGQRI--ERLQSLFYCA
RPOB_NPVOP/4-757-------KIVWAHDGKR--------------CMVEACTNGAH---------NVYKVYVFFRRTRNQAV--ESLAASMTLA
Q99H09_9ABAC/4-774-------KIGWVYDGKR--------------YKIETCRNKNF---------YVYKIFVYFRQINNQRV--EKIDATLTCF
Q9DVS4_9BBAC/3-715-------KINWNHDGKK--------------YKIEYCMSKGH---------HVYKIYLYFRKLFGQLV--ERVHSECQIE
O55596_NPVBM/4-749-------KINWVYDGRR--------------YKIETCTNGNF---------NVYKVYVYFRQIKNQKI--EKLDASMVVN

PF00562

B7WY91_COMTE/723-1292........GLTETRTQA..............YLYDGRTGERF.......ERPTTVGYMHYLKLHHLVD..DKMHAR.STG
RPOB_DESOH/723-1286.............TGQA..............ILYDGRTGQPF.......DERITVGTMYMLKLHHLVD..DKLHAR.SIG
RPOB_GEOLS/851-1417.............NGQV..............TLFDGRTGEPF.......KHKVTVGIMYVLKLHHLVD..DKIHAR.SIG
D1NBR7_9BACT/651-1192..........WVYDGKA..............DVYDGRTGNKF.......DQRVMVGQVYMLKLDHLVA..NKIHAR.AVG
Q9AIH1_CARRU/596-1191...........NKNCEL..............LLFDGITGKRY.......LQLVNVGYIYFMKLNHLVI..DKIYSR.SIG
Q8SQY8_ENCCU/673-1023.............SGKD..............CFTSGTTGAPL.......AAYIFFGPVFYQRLKHMVA..DKIHMR.ARG
RPOB_NEOSM/711-1263...........DPSGQE..............VLYDGVTGEKF.......DRKVTVGCKYMLKLHHLVN..DKIHAR.SIG
RPOB_SALRD/694-1211...........PRDGKV..............QLYDGRTGEPF.......DEKTTVGQIYMMKLEHLVE..DKMHAR.SIG
RPOB_LACDA/679-1067...........DSDGKT..............VLYDGRTGEPF.......HNRVSVGVMYYLKLTHMVD..DKIHAR.SIG
Q74MN2_NANEQ/131-507.............DGTE..............TMYDPITGEEY.......KVKIFVGVMWYHKLKFLAA..NKLHAR.ARG
RPB2_IIV3/687-1053.............SGSE..............VMYSGFTGERI.......QSTIFMGPTYYHRLKHMVK..DKMHAR.SHG
Q22C62_TETTS/682-1065.............YGNE..............VMYSGTYGCMM.......KVDIYMGIVYYQRLRHMVS..DKAQAR.STG
A2EN74_TRIVA/632-991.............YGNE..............AMYSGITGEQF.......KADIFMGVVYYQRLRHMVG..DKYQVR.ATG
Q90022_ORFV/654-1041...........HPRGRSGPTPSSEHRVFCERVLFDPRPTEPF.......AARVFFGPLYYLRLRHLTL..DKATVR.CRG
RPOB_BORAP/667-1059...........NPTSKE..............ILYDGYTGEPF.......ENEVMVGVIYMLKLHHLVD..DKMHAR.STG
RPOB_SYNAS/717-1284...........PSTGQA..............ILYDGRTGEPF.......DQEITVGMIYMLKLHHLVD..NKIHAR.SIG
RPOB_DEHSC/650-1123YDVSSQSRLPSPIVGKS..............VLRDGRTGETF.......DQPVTVGNMYILKLIHLVE..DKVHAR.ATG
RPOB_PARDP/739-1300...........DTSGQS..............IVFDGRTGEQF.......ARPVTVGMKYVLKLHHLVD..DKMHAR.STG
RPOB_AQUAE/796-1374...........PENGKT..............TLYDGRTGEPF.......DFEVTVGYMHMLKLIHMVD..DKIHAR.ATG
A5Z8Z3_9FIRM/700-1129DHREEWKGVPIARDGKV..............RLRDGRTGDYF.......DNPVTIGFMHYLKLHHLVD..DKIHAR.STG
Q4GZE8_TRYB2/673-1036.............HGKD..............IFYSGVTGEML.......RAYVFFGPIYYQRLKHMVT..DKMHAR.ATG
RPOB_UREPA/837-1300.........IENNKGKQ..............VLYDGRTGEPF.......DGLISVGLTYMLKLDHMVD..DKIHSR.SVG
A7YUZ1_FRATU/718-1276...........ATNGQM..............KLFDGRTGKPF.......DRHVTVGYMYMLKLDHLVD..DKMHAR.STG
RPA2_DICDI/662-1031.............FGNE..............QMYSGTTGKEF.......ECEIFFGVCYYQRLRHMVK..DKYQVR.ALG
RPOB_CORGB/629-1051.......DVMVNADGKA..............TLIDGRSGEPY.......PYPVSIGYMYMLKLHHLVD..EKIHAR.STG
Q1NPU6_9DELT/719-1284...........DEIGQI..............ELYDGLSGEKF.......DNKVTVGSMYVLKLHHLVD..DKIHAR.STG
Q0EVW7_9PROT/695-1254...........PETGQT..............ILYDGRTGEAF.......DRPVTIGQMYILKLHHLVD..EKIHAR.STG
A0CUT2_PARTE/739-1109.............WGNE..............VMTNPYTGNMF.......SIPIFVGPTYYQRLRHLVD..DKMYAR.SRG
A7UZT8_BACUN/679-1194...........PRYGKT..............TLYDGGTGEAF.......EQQATVGVTYMLKLGHMVE..DKMHAR.SIG
Q5AFK6_CANAL/673-1039.............HGNE..............PMYSGATGEEL.......RCDIYIGCVYYQRLRHMVN..DKFQVR.STG
RPOB_KORVE/828-1399...........PTSGKT..............FLYDGMTGDRF.......EQPVTVGYIYMLKLSHLVD..DKIHAR.SIG
RPOB_EIMTE/562-966..............GKI..............LLRDGRQGYKL.......SEPSFLGISKYSKLIHMIK..DKIHYR.TIG
Q4A245_EHV8U/683-1058.............YGNE..............MLYNGMSGEML.......ESMIFIAPCYYQRLKHMVV..DKSHAR.NRG
Q1L6W4_9TRAC/184-547.............TGME..............CMYSGRVGTRM.......KVRVNIGVTFYQRLTHMAE..DKMKYR.RTG
A2E3T5_TRIVA/686-1052.............SGKD..............MLMSGITGEPL.......YAYIFFGPVFYQSLKHMVK..DKMQAR.ATG
Q4N2L4_THEPA/737-1128.............YGTE..............SMYCGTLGTEI.......QTHIFVGLIYYQRLRHMVS..DKAQVR.STG
RPOB_MYCGE/814-1279.........PQKNQGKF..............KLIDGRSGMPF.......ERPISLGIMYMMKLNHMVD..DKIHAR.AVG
O21237_RECAM/676-1397...........NIQSKV..............TIIDGITGVVL.......DNKVTVGYMYMMKLNHLID..HKIHGR.STG
RPOB_PLAF7/525-929..............NKY..............YLKNPFTGNMI.......NNSICLNNIYYYKLIHMIK..DKFRYR.FIG
A4E9H0_9ACTN/589-1012DHMRPEFVTQLDERGKT..............RLFDGRTGEEF.......REPITVGTSYILKLGHMVD..DKIHAR.STG
Q8TXI7_METKA/159-536.............TGKE..............VMYDGRTGQKL.......EAEVFIGVCLYRKLYHMVK..DKYHAR.SRG
A4WN98_PYRAR/656-1029.............DGKE..............VMYSGITGEKL.......VADIFIGIVYYQKLHHMVA..DKIHAR.ARG
RPOBC_HELPY/729-1296...........AMDGKM..............DLYDGRTGEKM.......RERVNVGYMYMIKLHHLVD..EKVHAR.STG
Q6Q8Z4_9GAMM/699-1253...........PESGQI..............TLFDGRTGNKF.......DSPVTVGYMYMIKLNHLVD..DKMHAR.STG
Q9FKF1_ARATH/698-1075.............SGKD..............LLYSGISGEPV.......EAYIFMGPIYYQKLKHMVL..DKMHAR.GSG
Q5RB08_PONAB/668-1031.............YGTE..............RLYSGISGLEL.......EADIFIGVVYYQRLRHMVS..DKFQVR.TTG
A7XDR4_PEWBP/753-1146...........PFDGKM..............TLYDGRTGEPY.......DNSISVGILYMLKLSHMVE..DKIHAR.NVG