Sequence alignment for CL0410

PF04941

Q8B9K0_NPVR1/5-748VQDFNELYDRIENKYK--------------------LKYIFDC.ATNNNEPMLFCA---------IQERKSYLCCALNEQ
Q6JP89_NPVNC/3-721VKDFNFLYQKLCNRNE--------------------I.YVLNCKHKRKNVPNIDQL---------INQKKSYVCCLYNEV
Q91ES4_GVCPM/4-750ITDFNNLYTHLAHTYN--------------------LDYQLSC.HHHNNTPL...A---------MANIKTYFCCAVSVP

PF00562

Q74MN2_NANEQ/133-507LSAAVPYARFNQSARL.......................NRGE..RTQRQALG............LYSVAYPLRFESD.V
Q8TXI7_METKA/161-536CCSCIPWPESNSAPRN.......................TMGT..NMTRQALG............FYAANHPIRMESR.G
A2SSM5_METLZ/137-540GAAHVPFPEHNASPRV.......................TMGA..GMIKQALG............FAQANMKLRPDTR.G
A5ULN7_METS3/135-507CAGIIPFSDHNSSPRN.......................TMEA..GMTKQALG............LYVSNYALRTDTR.A
A0RXX0_CENSY/644-1018GASIIPYPEHNQSPRN.......................TYES..AMAKQSLG............FSTPMMNTSTYVR.Q
Q980R1_SULSO/176-547TASIIPYPEHNQSPRN.......................TYQS..AMAKQALG............LYAANYQLRTDTR.A
Q8ZYQ9_PYRAE/658-1029IASIIPYIEHNQSPRN.......................QYEA..AMAKQSLG............LPQSNFLYKLDSR.G
RPB2_IIV3/689-1053VAGIIPFPDRTQSARN.......................CFYS..SMVKQAIG............FVPC.HNLKTETV.S
RPB2_IIV6/724-1098MAAQIPFAEHTQSPRL.......................CYQS..SMAKQAIG............NIPS.HHVKSDNT.T
A0CUT2_PARTE/741-1109CASVIPFANHNQGPRN.......................TLQS..AMGKQAMG............LNSTNFNIRFDTL.V
Q583H5_TRYB2/724-1094CASIIPYPNHNQSPRN.......................TYQS..AMGKQAMG............IYASNFNMRMDTT.A
A2E7H8_TRIVA/712-1082CGTIIPFPDHNQSPRN.......................TYQC..AMGKQAIG............LYTTNYMIRMDSS.S
RPO2_MIMIV/726-1093ISSNIPFPDHNQSPRG.......................IFQY..NQARQAMG............LYISDYRERTDIS..
E2RU19_GIAIC/792-1189ITSLIPFPDHNQSPRN.......................LYQA..SMGKQAVG............IYALNYLKRFDTSGI
Q4A245_EHV8U/685-1058CVSQIPFCDHNQSPRI.......................AYQA..AQCKQAIG............LYTTNFAERLDTV.G
C5WRS0_SORBI/754-1125.CGIIPFANHNFARRV.......................LYQS.EKHSQQAIG............YSTTNPHIRVDTL.S
Q8QUS6_ISKNN/596-957MSAVIPFYNHTQSPRN.......................AYQS..NMGKQAVG............LPCLNYMSRWDVT.L
Q4GZE8_TRYB2/675-1036VAGIIPFPHHNQSARN.......................TFQS..AMGKQALG............TIAYNQYIRMDTV.L
Q5CPZ8_CRYPI/819-1197VSGLIPYPNHNQSPRN.......................TYQC..AMGKQVMG............SVGFNQFLRCDSV.L
RPC2_MOUSE/668-1041CAGLIPYPHHNQSPRN.......................TYQC..AMGKQAMG............TIGYNQRNRIDTL.M
F4KD38_ARATH/690-1065VAGLIPYPHHNQSPRN.......................TYQC..AMGKQAMG............NIAYNQLNRMDTL.L
A0D7M6_PARTE/655-1033VTGLVPFPHHNQSARN.......................TFQC..QMGKQSLG............IIGMNTQIRCDTQ.L
Q236N3_TETTS/664-1046VSGLVPYPHHNQASRN.......................TFQC..AMGKQALG............IIGSTSMNRVDTI.L
A8B2N4_GIAIC/763-1143VVGLIPYPHHNQSPRN.......................CYQC..SMGKQASG............AIAFNQLERFETA.M
Q4UB41_THEAN/766-1155VAGLIPFPNHNQSPRN.......................TYQC..AMGKQSIG............SIGYNQLQRCDTV.V
A2E3T5_TRIVA/688-1052CAGVVPCPHHNQSPRN.......................TYQC..AMGKQAIG............PTALNIMHRVDKS.T
RPA2_DICDI/664-1031LANLTPFSDYNQSPRN.......................MYQC..QMAKQTMG............TPLHSYPFRTDNK.L
Q5AFK6_CANAL/675-1039LANLTPFSDFNQSPRN.......................MYQC..QMGKQTMG............TPGTALVHRSDNK.L
Q27493_CAEEL/649-1005AGNLIPFPDHNQSPRN.......................VYQC..QMGKQTMG............TAVHAWHSRADNK.M
Q5CSG7_CRYPI/759-1165TASLIPYAHHNQSPRN.......................MYQC..QMLKQTMG............TPCLNHPYRTDNK.M
F7A8L9_MACMU/29-389IANFIPFSDHNQSPRN.......................MYQC..QMGKQTMG............FPLLTYQDRSDNK.L
A8B827_GIAIC/683-1140LGLLVPFSDHNQSPRN.......................MYEC..QMLKQTMG............IPCRNLAYKYDTK.S
Q22C62_TETTS/684-1046LPSQIPFLNYNQSPRN.......................MYQC..QMAKQTMG............TSMHNFPYRFDNR.I
Q8II17_PLAF7/944-1400LASLTPFSDHNQSPRN.......................IYQC..QMLKQTMG............IQSLNNVYTFTNK.I
Q4N2L4_THEPA/739-1128SASLTPFSNHNQSPRN.......................MYQC..QMLKQSVG............IPFHSQFYRSEVK.T
RPB2_ASFB7/782-1141AALVSPYANCTQPARV.......................TYET..NQGRQTGG............WYCFSWPYRVDMN.R
RPOB_SALRD/696-1211VAEGEGVVEYVDAERL.......................VVRY....DEEQDKTDLTF..GEPVQEYELTKFRRTNQG.T
R7EM77_9BACE/681-1194TAEGDGVVEFVDATTI.......................RILY..DRTEEE.EFVSF...EPALKEYNIPKWRRTNQN.M
RPOB_UREPA/839-1300VAKNDGVVEFVDSQKI.......................IIRN....DNDK..L..........DDYKLIKYRKSNQD.T
A5IZ53_MYCAP/720-1106RARNEGKVEYVDGAKI.......................KIRN....NKGTLD............TYSLKNFQRSNQD.T
S5LVD1_9MOLU/753-1138VATADGIVKYVDSKKI.......................IIEQ.....KDGIK............TYDLNDFSRSNNG.T
RPOB_DESOH/725-1286VARRPGEVVYVDSGRI.......................VVRH..DTDDKDPEAK.......PVTVYNLSKFIRSNQN.T
RPOB_GEOLS/853-1417IARHNGVVDAVDAGRI.......................VIKI..DEEEYDETGT.......GVDIYNLVKFSRSNQN.T
RPOB_LACDA/681-1067LAEADGEVEYVDANEI.......................RVRR....EDQT..L..........DTYTLEKYRRSNAT.K
RPOB_DESAG/716-1278IAEADGVVRYADADRI.......................VVSY....EGDLYPRTG......GVRSYDLQKYHKSNQS.S
RPOB_SYNAS/719-1284VAKRSGIVESVDASRI.......................VIKC....ESAE..KTDR...DTGVDIYTLIKYQRSNQD.T
R5KT32_9FIRM/702-1129VAKRAGVVERSTSKEI.......................TLRY..DDNGEK.E............TYKLLKFQRSNQS.N
D6Z3M9_DESAT/721-1284LAGGDGVVEEVDANRI.......................VVRY..DEP....GTDGF...TTGIGIYRLEKYKKSNQN.T
RPOB_NEOSM/713-1263VAKRAGVVQYIDARNI.......................VVAS....ESKD..DF.......WIDSYTLCKFRKSNHN.T
RPOB_EHRCR/741-1291LAKRGGIVHRVDGLYI.......................VIRA.FDQEKNEYLG.........VDIYNLRKFQRSNHN.T
C4YYN1_9RICK/735-1292LALHDGIVEQVDSNRI.......................VIRT....LEQKVDGSP......SVDIYNLLKFQKSNHN.T
RPOB_PARDP/741-1300MARRGGIIDQVDAQRI.......................VIRA....TEDLGAGDA......GVDIYRLRKFKRSNQS.S
RPOB_PELUB/727-1287VASRDGTVDKIDGKRI.......................VIKA....TEETDFTKS......GVDIYNLQKFKRSNQN.T
RPOB_FUSNN/675-1063TTKVSGKVTYVDGKKI.......................IIED....KDKKEH............IYRLLNYERSNQS.M
RPOB_MAGSM/724-1281TARRTGVVDEVDAARI.......................VVKA....DEEPGSTEP......GVDIYNLTKFSRSNQN.T
RPOB_PHOPR/717-1263VAKRGGQVQSVDASRI.......................VVKV....NEDE..LVPG...EAGIDIYNLTKYTRSNQN.T
RPOB_FRATT/720-1276IARNAGEVAEVDSNRI.......................VIKV..DTEKSQTSNL........VDIYSLTKFKRSNKN.T
RPOB_RUTMC/723-1282TAKHSGVVEAVDASRI.......................VIRV....DSKK..TKAS...ELGVDIYNLTKYSRSNQN.T
D0IXK9_COMT2/725-1292TAKRGGIVDYVDATRI.......................VIRV..NDDEAVAGEV.......GVDIYNLIKYQRSNQN.T
R6A1S7_9ACTN/612-1033LAKNAGEVIFADAAKI.......................IVKH.....AGGMD............EYHLAKYQRSNQS.T
RPOB_KORVE/830-1399LARRSGIIDSVDSERV.......................IVRV....EGEHHPMQLSR..EVGSDIYQLTKFKRSNQN.T
RPOB_THEMA/760-1174LAEHDGIVKEVDAARV.......................VVHR..TDENG..NLMYDDKGNPVVDEYRLLKFVRSNQD.T
RPOB_DEIGD/619-1059ISDVTGRVTYVDARAI.......................QVTL....TEDAPQIGLV...KGNVRTFELVRFTRSNQG.T
W8JR39_9CHLA/672-1182VAEENGTVDYVDGYKI.......................VIAA..QHNPTIKR............TYHLKKFLRSNSG.T
RPOB_CORGL/631-1051ITPVAGVVENVSADFI.......................TIMA..DDGKRE..............TYLLRKFQRTNQG.T
RPOB_AQUAE/798-1374VAKRGGVVEEVDSSKI.......................IIRV....NPEEINFDDPL..DIGIDIYELRKFQRTNQK.T
RPOB_DEHM1/652-1123FAKRAGVAASVTSEKI.......................IIRT..AEGQDD..............EYLLKKFVRTNQG.T
RPOB_RHOBA/666-1160RARRAGKVTYADATRI.....................................EI.......GSDHYPLKKYQGLNER.T
RPOB_BORBU/669-1059KAKRSGEVILATSSKI.......................VVKPFEAENAKDLD............EYHIVKYERTNQD.T
RPOBC_HELPY/731-1296KANRAGVVEKIDSKNI.......................YILG....ESKE..EA.......YIDAYSLQKNLRTNQN.T
RPOB_OSTTA/587-1008VAKQNSYISYVDAQRIDYFTPVIGDTNLIDYQNLTAEDVFASN..........QF.......KHNTIWLTSYQRSNQD.T
W5A749_WHEAT/37-433IAEREGKIISTDSHKI.......................LLSS....SGKTI.............SIPLVNHRRSNKN.T
RPOB_PHATC/876-1274NSYSNGVVSSVTANKI.......................VVND....KTGK..R..........LTYKLQKYLRSNQQ.T
RPOB_PLAF7/527-929ISYQEGIVIYVSCIKI.......................IIRD..LFNRQI..............IYYLNNYKKINQN.I

PF04941

Q8B9K0_NPVR1/5-748L.SCVMHKCVPVIFGTRLDKQFRKPDNVDANNNING.TFMLDGRFLSFPNIMMNNNVLVHNFYDKLYAKH..CKRMFLYG
Q6JP89_NPVNC/3-721LQQCILHQCVVVALQSWLDRKFRDITTIDEDEQVLGCCFVMNGHYYTIPNIMMNNNIQLHNFRSAQFSSD..AKRLYLYG
Q91ES4_GVCPM/4-750LKKCVLHNCVVVIVGTWLDKRFRGD...ECNYGFEG.TFILDGRHFSFPNIMMNNNVLIHNFFDKQYARDKKMKRMFLYG

PF00562

Q74MN2_NANEQ/133-507HVAQTLQKPLV-----------RTI.VHDLIR...............FDERPAGYNMVV---------------AVMAYE
Q8TXI7_METKA/161-536HLLYYPHRPLV-----------KTR.GTEAFD...............YDERPAGQNMIV---------------AVLTYE
A2SSM5_METLZ/137-540HMLHYAQVPMV-----------HTQ.AAELIG...............SDNRPQGQNFCV---------------AIISYE
A5ULN7_METS3/135-507HLLHHPQTPIV-----------KTR.IIDSTN...............YDKRPSGQNFVV---------------ALMSYE
A0RXX0_CENSY/644-1018HFMLYPQTPIV-----------NTR.AMGLLG...............LEDRPAGQNCVV---------------AVLPFD
Q980R1_SULSO/176-547HLLHYPQRPLV-----------QTR.ALDIIG...............YTNRPAGNNAIL---------------AVMSFT
Q8ZYQ9_PYRAE/658-1029HMLYYPERPIV-----------TTR.GLELIG...............YSKRPAGQNAVV---------------ALLTYT
RPB2_IIV3/689-1053HTLNYPQKPLV-----------TTS.FAEYNQ...............LNEYPNGINAIV---------------AIACYT
RPB2_IIV6/724-1098RVMDYVQRPLV-----------TTQ.IAEMNR...............FNDFPNGLNAMV---------------AVAIYT
A0CUT2_PARTE/741-1109HILHYPQKPLA-----------SSR.AVDFIT...............VNEVPIGINCVT---------------SIACFT
Q583H5_TRYB2/724-1094HVLFYPQKPLV-----------RTK.AMSYMR...............SNDLPAGHNAIV---------------AIACYS
A2E7H8_TRIVA/712-1082HVLWYPQKPLV-----------ATR.NMRYLN...............FNKLPAGINVTV---------------AICCYT
RPO2_MIMIV/726-1093YILYHPQIPLV-----------TSR.ASKYTG...............THIFPAGENSIV---------------AIASYT
E2RU19_GIAIC/792-1189NVMHYPQLPLV-----------TTR.SMPHVK...............FRYLPAGQNVII---------------AIAVYS
Q4A245_EHV8U/685-1058HVLATPQKPLV-----------TTR.LEELLG...............TSVVRSGAVPIV---------------AIMCYS
C5WRS0_SORBI/754-1125HQLYYPQRPLF-----------KTV.IADCLGRS.DYTTFGRKDDFMRPEYFNGQNAIV---------------AVNVHQ
Q8QUS6_ISKNN/596-957DVLMYPQVPLS-----------RSK.AMDALS...............FDTMPHGACPIV---------------AVLTFD
Q4GZE8_TRYB2/675-1036MLGAYPQRPLC-----------RTK.AMNLTN...............YEILGAGINAMV---------------CVMSYS
Q5CPZ8_CRYPI/819-1197YLLVYPQKPLC-----------KTR.TIEMIN...............FEQLPAGQNSSV---------------AVMSFA
RPC2_MOUSE/668-1041YLLAYPQKPMV-----------KTK.TIELID...............FEKLPAGQNATV---------------AVMSYS
F4KD38_ARATH/690-1065YLLVYPQRPLL-----------TTR.TIELVG...............YDKLGAGQNATV---------------AVMSFS
A0D7M6_PARTE/655-1033YQLIYPQTPLV-----------RTV.SMEAVN...............QHRLPAGHNAQV---------------AVMSYS
Q236N3_TETTS/664-1046YQLIYPQTPLL-----------KTK.VIEYAG...............YDKFPAGHNASI---------------AVLSYS
A8B2N4_GIAIC/763-1143FLLDYPQQPLT-----------STK.ILKLTG...............YERLPAGQNATV---------------CVMSYS
Q4UB41_THEAN/766-1155HLMNYTQQPLV-----------TTK.TIQLVN...............FDKLPAGQNAIV---------------AVMSYQ
A2E3T5_TRIVA/688-1052YFNCYPQQPMV-----------QTR.TIRLSR...............YHEMPCGQNAMV---------------AIMSYS
RPA2_DICDI/664-1031YKVQNVQKPIV-----------HTK.NQFKFR...............CNDYPHGCNAVI---------------AVISNT
Q5AFK6_CANAL/675-1039YRLQTGQTPIV-----------KAN.LYDDYG...............MDNFPNGMNAIV---------------AVISYT
Q27493_CAEEL/649-1005YRLQFPQQPML-----------KLE.AYEKYE...............MDEYPLGTNACV---------------AVISYT
Q5CSG7_CRYPI/759-1165YRLLTPQEPTI-----------ITK.GYSSFG...............FSEYPTGTNAIV---------------AVMSYS
F7A8L9_MACMU/29-389YRLQTPQSPLV-----------RPS.MYDYYD...............MDNYPIGTNAIV---------------AVISYT
A8B827_GIAIC/683-1140YLLTTPQKPLV-----------RNAIIHDIGG...............FDTHPTGTNLVV---------------AVSAYT
Q22C62_TETTS/684-1046YRLLNGQIPMV-----------KGM.DPESYG...............LSDYPSGTNAIV---------------AVISYT
Q8II17_PLAF7/944-1400YRMITPQFPLV-----------VTR.DYEFYG...............VDNFPSGTNAVV---------------AILAYT
Q4N2L4_THEPA/739-1128YVLTSLQRPLV-----------ATK.EYEKMG...............FQDYPTGVNCVV---------------AIIAHS
RPB2_ASFB7/782-1141FFQFYNEMPLV-----------KTI.AHNYVI...................PNGLNTIV---------------AYMIYG
RPOB_SALRD/696-1211...CMNQKPIV-----------QAGDRVEEGEVLTD......GFAMEKGELALGKNVLC---------------AFMPWH
R7EM77_9BACE/681-1194...TIDLRPIC-----------EKGQRVTAGQILTE......GYSTEDGELALGKNLLV---------------AYMPWK
RPOB_UREPA/839-1300...CNNQIPIV-----------KVGQRVHKSETIGD......GPAMQNGELALGRNILV---------------GYTTWR
A5IZ53_MYCAP/720-1106...VIHQKPII-----------KVGQDVAKGDLLVD......GSSFKDGELALGKNLLV---------------AFSTYK
S5LVD1_9MOLU/753-1138...AITHLPIV-----------KLGDKVKARDILAD......GPSMEKGELALGQNVVV---------------AFTTWN
RPOB_DESOH/725-1286...CFNHRPIV-----------KKGQRVAPGDVLAD......GPATEKGELALGKNVTV---------------AFMPWG
RPOB_GEOLS/853-1417...CINQKPVV-----------KVGDKVKRGDVIAD......GPSTDMGELALGQNIIV---------------AFMPWG
RPOB_LACDA/681-1067...NYNQTPNV-----------KRGDKVVDGQVIAN......GPSMADGELALGQNPVI---------------AFTTWN
RPOB_DESAG/716-1278...CFGQKPLV-----------SRGQVIRKGDVLAD......GPGIEDGELALGKNLVV---------------AFMPWC
RPOB_SYNAS/719-1284...CFNQKAIV-----------NKGQRVRKGDIIAD......GPATDNGELALGHNVMV---------------AFMSWG
R5KT32_9FIRM/702-1129...CYNQRAIV-----------FKGDHVEAGEVIAD......GASTSNGEIALGKNPLI---------------GFMTWE
D6Z3M9_DESAT/721-1284...CFTQRPLV-----------EPGVRVKKGDILAD......GPACDHGELALAKNVTV---------------AFMPWR
RPOB_NEOSM/713-1263...CIHQRCVV-----------HQGQRVKKGDILAD......GPAIQKGELALGRNLVV---------------AFLSWR
RPOB_EHRCR/741-1291...CINQRPLV-----------KPGDYVKANDVIAD......GSAIDQGELALGKNVLV---------------AFMSWQ
C4YYN1_9RICK/735-1292...CINQKPLV-----------KVGHYVKKNDIIAD......GPSTDNGEIALGRNVLV---------------AFLPWN
RPOB_PARDP/741-1300...TINQRPLV-----------KVGDKVVKGQVVAD......GPSTDQGELAIGRNVVV---------------AFMPWN
RPOB_PELUB/727-1287...CINQKPLV-----------RVGDKVKSGDIIAD......GPSTKLGELALGKNVTV---------------AFMPWQ
RPOB_FUSNN/675-1063...CLHQTPLV-----------DLGDKVKAGDIIAD......GPATKLGDLSLGRNILM---------------GFMPWE
RPOB_MAGSM/724-1281...CINQVPLV-----------KNGERVTAGDIIAD......GPSTQIGELALGRNVLV---------------AFMPWN
RPOB_PHOPR/717-1263...CINQRPTV-----------MPGEPVARGDVLAD......GPSTDLGELALGQNIRI---------------AFMPWN
RPOB_FRATT/720-1276...CINQRPIV-----------NVGDKVEAGDILAD......GFATDFGELSLGHNLMV---------------AFMPWN
RPOB_RUTMC/723-1282...CINQKPLV-----------KTGDKISAADVLAD......GPSTDMGELALGQNMKI---------------AFMPWN
D0IXK9_COMT2/725-1292...NIHQRPIV-----------SRGDKLAKGDVLAD......GASTDLGEIAIGQNMLI---------------AFMPWN
R6A1S7_9ACTN/612-1033...CINHRPLV-----------RVGDTVEQGEPLAD......GPSTDHGELALGQNLTV---------------AYMPWE
RPOB_KORVE/830-1399...CINQKPIV-----------KQGDHVKKGQVIAD......GPCTDHGELGLGRNVLV---------------SFMPWR
RPOB_THEMA/760-1174...MINQKPIV-----------NEGDFVKKGDPIAD......GPATDMGELALGRNILV---------------AFMPWE
RPOB_DEIGD/619-1059...NLDQHPIV-----------SVGDEVVPGQVIAD......GPASDQGRLALGQNITI---------------AIMPFD
W8JR39_9CHLA/672-1182...CINQRPLC-----------SVGDTVVKGDVIAD......GPATDRGELALGKNILV---------------AFMPWY
RPOB_CORGL/631-1051...SYNQKPLV-----------NLGERVEAGQVIAD......GPGTFNGEMSLGRNLLV---------------AFMPWE
RPOB_AQUAE/798-1374...CVNQRPIV-----------RKGEKVEKGQIIAD......GHSTDRGELALGKDVLV---------------AFMPWR
RPOB_DEHM1/652-1123...CINQHAVI-----------NKGQKIEAGQVLAD......SSATENGELALGQNCVV---------------AFMSWQ
RPOB_RHOBA/666-1160...CQNQKPLI-----------TVGDKVEKGQIIAD......GAATQKGELALGRNVLV---------------GFMSFD
RPOB_BORBU/669-1059...CFNQSVLV-----------KEGQKVERGEIIAD......GPATRYGELALGNNLLL---------------GVIPWN
RPOBC_HELPY/731-1296...SFNQVPIV-----------KVGDKVGAGQIIAD......GPSMDRGELALGKNVRV---------------AFMPWN
RPOB_OSTTA/587-1008...CLNHKPLV-----------EANTWVEAGDCLAD......NAATAKGELALGRNILI---------------GYMPWE
W5A749_WHEAT/37-433...CMHQKPRV-----------PRGKSIKKGQILAE......GAATVGGELALGKNVLV---------------AYMPWE
RPOB_PHATC/876-1274...CINHRPIV-----------WKGEQVKSGQILTD......GPAITSSELSLGQNVLI---------------GYMPWQ
RPOB_PLAF7/527-929...LLIYKPIV-----------WVGEKVNIGQILAI......NSNLLNSEYSLGNNLLV---------------GYGSYL

PF04941

Q8B9K0_NPVR1/5-748N-VDQEKHINR...AIQLVYDKQDDVLFARDVYASDYVVTEDLNSILETYLANSG--KWKPLDFLFEYNTLHKQQLVEHI
Q6JP89_NPVNC/3-721N-FCPDGDVKRYGQSIQLVYESSTDELHVRDVYGQDYFVDDKIIEKIVPYFQNNY--KWPELGFLFDNIDS......DLI
Q91ES4_GVCPM/4-750N-YDDDKTVNR...AIQLVYDKVDDVLYVRDVYAKDYIVDSGINQILREYLKCSG--KWPDMDFVFSFDDY..TELFDTL

PF00562

Q74MN2_NANEQ/133-507G.YNTQDAL--------VINRNAIDFGFTRTMYFRP..YEAV........ERKYA..LGLSDE.ITVP..S------PDV
Q8TXI7_METKA/161-536G.YNMEDAI--------IMNESAIERGLARSFFFKT..FEDE........ARTYP..GGMKDK.FCIP..E------KEV
A2SSM5_METLZ/137-540G.YNIEDAL--------IFNKASVERGVGRSHFFRT..YEGE........ERRYP..GGQVDR.IELP..E------EDV
A5ULN7_METS3/135-507G.YNMEDAM--------VINKGSLERGLARSSFFRA..YDTA........EKRYP..GGQEDK.FEVP..D------KNI
A0RXX0_CENSY/644-1018G.YNIEDAI--------VLSKSSVDRGLARTFFYRI..YDAE........AKQYP..GGMRDN.FEIPGAE------DNI
Q980R1_SULSO/176-547G.YNMEDSI--------IMNRSSVERGMYRSTFFRL..YSTE........EVKYP..GGQEDK.IVMP..E------AGV
Q8ZYQ9_PYRAE/658-1029G.YNIEDAV--------ILNKASVERGMFRSVFYRTYETEE..........QKYP..GGE.EDRIEIPDSS------VK.
RPB2_IIV3/689-1053G.YNQEDSI--------ILNKSSIDRGLFGTITYNT..FTA..........QEKK..NGIIEERIEIPSNA------I..
RPB2_IIV6/724-1098G.FNQEDSI--------ILNKASIDRGMFHVVTYKT..IIV..........EERK..IGVNEKICMPVASV------...
A0CUT2_PARTE/741-1109G.YNQEDSI--------IINQYAIDRGFFRSVFYRT..YKES........EDKDP..DNFTETKITKPIGD------N..
Q583H5_TRYB2/724-1094G.YNQEDSI--------IMSRSAVERGFFRSVFWRS..YKAS........EEKKR..EGR.EM.FEIP..D------RKV
A2E7H8_TRIVA/712-1082G.YNQEDSL--------MLNASAIDRGLFRSYFFRT..YKET.......AEGDGT..EGASEV.FTFP..D------PQT
RPO2_MIMIV/726-1093GLMNQEDSL--------VINDSAIQKGYMRAQALKK..YMEI........IKKNP..ASSQTSIFMKPDRN------KV.
E2RU19_GIAIC/792-1189G.FNQEDSL--------IMSQSAVDRGFMRATYYHT..YEEMIS...SAASSINA..PDRIEK.FCRP.IG------PNI
Q4A245_EHV8U/685-1058G.FNQDDSV--------LLNQSSIDRGLFTSFAYHT..IRD..........EEKG..TGADIERFENPKNI------PGC
C5WRS0_SORBI/754-1125G.FNQEDSL--------VMNRASLERGMFRTEHLRS..YKADVE....NKDG.TK.RLKLKEKIDFGKTES------...
Q8QUS6_ISKNN/596-957G.YNQEDSI--------ILNRSSVQRGMFVSTTYKT.LCEC.........EKHVK..RCEFERIMRVPVDK------R..
Q4GZE8_TRYB2/675-1036G.YDIEDAQ--------VYNRSSLDRGYGRCVVLRK..HEVE........LERLP..NGEYDIILPADSNV------...
Q5CPZ8_CRYPI/819-1197G.YDIEDAI--------VMNKASVDRGFARCFVMKR..QTIE........LQKLP..NGLSERVVRPISVG------SGN
RPC2_MOUSE/668-1041G.YDIEDAL--------VLNKASLDRGFGRCLVYKN.....AK.....CTLKRYT..NQTFDKVMGPMLDA------AT.
F4KD38_ARATH/690-1065G.YDIEDAI--------VMNKSSLDRGFGRCIVMKK..IVAM........SQKYD..NCTADRIL..IPQR------T..
A0D7M6_PARTE/655-1033C.YDIEDAL--------IMNKSSLDRGFGRTAVYKK..SVTEC.....EINQRNK..ESRFNERIDEPPTK------THN
Q236N3_TETTS/664-1046G.YDIEDAT--------VLNKSSLDRGFGRTMVFKK..YETE........IQKLK..MSGLTELLRGPPKE------AEG
A8B2N4_GIAIC/763-1143S.FDIEDAL--------ILNRNAIDRGFGRCSIYRS..VSTEL.....NSIGSKS..VDGIKDILLGPPKD------H..
Q4UB41_THEAN/766-1155G.YEIEDAI--------ILNKASIDRGFARCYTLRR..LTC..........EITP..GNATSINGYNPNKS------...
A2E3T5_TRIVA/688-1052G.HDIEDAL--------LMNKASLDRGFGRRYYLSK..LDLM........LKNYQ..GGVIGDRIAPLDRE------RP.
RPA2_DICDI/664-1031G.YDMEDAM--------IINKSAYERGFGHGSVYKN..EYIDLDQGLSRFEQKKT........FFGRPNTV------...
Q5AFK6_CANAL/675-1039G.YDMDDAM--------IINKSADERGFGYGTVYKT..EKVDL......SQSRRR..GDPITQHFGFGSDE------...
Q27493_CAEEL/649-1005G.YDMEDAM--------TINKASYQRGFAHGTVIKV..ERIN.......LVTERE..RKTIFYRN......------...
Q5CSG7_CRYPI/759-1165G.YDMEDAM--------ILNKSSYDRGMFHACVYKT..KIISAA....PPSATKK..SDAESYFFHNIGPD------...
F7A8L9_MACMU/29-389G.YDMEDAM--------IVNKASWERGFAHGSVYKSEFIDL.........SEKIK..QGDSSLVF.GIKPG------...
A8B827_GIAIC/683-1140S.YDMEDAA--------LINKASLERGLFHGTVYSV..HDIDCYDDKLMRYMRTV..ATAVPYLKRSPDYI------VT.
Q22C62_TETTS/684-1046G.YDMEDAM--------ILNKSSYERGFGHGCVYKNYSYDVA.......ELNKEK..NSKFKMLNEVKNID------...
Q8II17_PLAF7/944-1400G.YDMEDAL--------IINKASADRGIFRTHIYKT..EFIDLQ...KVGESSNFVFGNNIRYLNNNKNNN------KN.
Q4N2L4_THEPA/739-1128G.FDMEDAM--------ILNKASVDRGLFNSFIYKS..KVIDLN...SQASSTKE..RGGTVEYFNNMDKD------...
RPB2_ASFB7/782-1141G.YNQEDSV--------IVSQSFIDRGGFAGTFYRE...............EKVE..LESDIESFGKPDPL------ITK
RPOB_SALRD/696-1211G.YNYEDAI--------VISERLVADDVYTSVHIEEFEHEV..........RDTK..RGE.EELTREIPNV------...
R7EM77_9BACE/681-1194G.YNYEDAI--------VLNERVVREDLLTSVHVEEYSLEV..........RETK..RGM.EELTSDIPNV------...
RPOB_UREPA/839-1300G.YNFEDAI--------IISERLVDQDVFTSIHIDEHTIQC..........MKTK..NGD.EEITRDMPNV------...
A5IZ53_MYCAP/720-1106G.YNYEDAI--------VLNERLAKKDVLTSIHIEEQTIQF..........RTSK..AGA.DELTRDIPNV------...
S5LVD1_9MOLU/753-1138G.YNYEDAV--------IVSERIVIDDRFTSIHIDEYTIER..........RQTK..QGP.EEVTRDIPNI------...
RPOB_DESOH/725-1286G.YNFEDSI--------LVGETLVRDGVFTSIHIEEFEVVA..........RDTK..LGK.EEITCDIPNV------...
RPOB_GEOLS/853-1417G.YNFEDSI--------LVSERLTKDDRYTSIHIEEFECVA..........RDTK..LGK.EEITADIPNL------...
RPOB_LACDA/681-1067M.YNFEDAI--------MLSERLVKEDVYTSIHIEDYDSEA..........RDTK..LGP.EEITREIPNV------...
RPOB_DESAG/716-1278G.YNFEDSI--------LISERCVKEDVFTSVHIEEFEVVA..........RDTK..LGP.EEITRDIPNV------...
RPOB_SYNAS/719-1284G.YNYEDSI--------LVSERIVKEDIYTSIHIEEFETMA..........RDTK..LGK.EDITRDIPNV------...
R5KT32_9FIRM/702-1129G.YNYEDAV--------LLSERLVQDDVYTSIHIEEYETEA..........RDTK..LGP.EEITNDVPGV------...
D6Z3M9_DESAT/721-1284G.YNYEDSI--------LVNERLLKNDTYTSFHIEVFETVA..........RDTK..LGK.EEVTRDIPNV------...
RPOB_NEOSM/713-1263G.YNFEDSV--------VISSNVVRDDLFTSVHLEGFECVV..........RDTR..LGP.EEITRDVSGV------...
RPOB_EHRCR/741-1291G.YNFEDSI--------VISSEVVKKDVFTSIHIEEFECVV..........RDTT..LGP.EKIMRSVPDI------...
C4YYN1_9RICK/735-1292G.YNFEDSI--------LISERIVKEDVFTSIHIEEFEVIA..........RDTR..LGP.EEITRDIPNV------...
RPOB_PARDP/741-1300G.YNYEDSI--------LISERIHRDDVFTSIHIDEYEVAA..........RDTK..LGP.EEITRDIPNV------...
RPOB_PELUB/727-1287G.YNFEDSI--------LISERCVTDDVFTSVHIVEYEVMA..........RDTK..LGE.EEITRDIPNV------...
RPOB_FUSNN/675-1063G.YNYEDAI--------LISDRLRKDDVFTSIHIEEYEIDA..........RTTK..LGD.EEITREIPNV------...
RPOB_MAGSM/724-1281G.YNFEDSI--------LISERLVAEDVFTSIHIDEFEVMA..........RDTK..LGA.EEITRDMPNV------...
RPOB_PHOPR/717-1263G.YNFEDSI--------LVSERVVQQDRLTTIHIQELSCVA..........RDTK..LGS.EEITADIPNV------...
RPOB_FRATT/720-1276G.YNFEDSI--------LLSERIVKDDKYTSIHIEEFTCVA..........RDTK..LGP.EEITADIPNV------...
RPOB_RUTMC/723-1282G.YNFEDSI--------LISEKVIQEDRYTTIHIEELTAYS..........RDTK..LGP.EEITADIPNV------...
D0IXK9_COMT2/725-1292G.YNYEDSV--------MINERIVADDRYTSIHIEELVVMA..........RDTK..LGA.EEITRDIPNL------...
R6A1S7_9ACTN/612-1033G.FNYEDGI--------VVSERLVAEDLLTTINITRHEIDA..........RDTK..LGP.EEITREIPNL------...
RPOB_KORVE/830-1399G.YNFEDAI--------LVSEKLVKEDYYTSVHIEEFEIEA..........RDTK..LGP.EEITRDIPNV------...
RPOB_THEMA/760-1174G.YNYEDAI--------LVSQELLEEDVFTSIHIEVYETQA..........RETR..LGP.EEITADIPNV------...
RPOB_DEIGD/619-1059G.FNFEDAI--------CISEGLVRKDFYTSVHIEKDEIEA..........RDTK..LGP.EKITRDIPGL------...
W8JR39_9CHLA/672-1182G.YNFEDAI--------IISEKLIKQDAYTSIYIEEFELTA..........RDTK..LGK.EEITRDIPNV------...
RPOB_CORGL/631-1051G.HNYEDAI--------ILNQNIVEQDILTSIHIEEHEIDA..........RDTK..LGA.EEITRDIPNV------...
RPOB_AQUAE/798-1374G.YNFEDAI--------VISERLVKEDVYTSIHIEELEVEA..........RETK..VGE.EEITRQIPGV------...
RPOB_DEHM1/652-1123G.FNYEDAI--------ILSERLVREDAFTSIHITKHELEA..........HDTK..LGG.EEITRDIPNV------...
RPOB_RHOBA/666-1160G.FNYEDAI--------IISEELVRNDTYTSIHIEDFDVEI..........RETK..LGR.EEFTRDIPNV------...
RPOB_BORBU/669-1059G.FNYEDAI--------LISDRIVKEDLYTSIHIKEFSIEV..........RETK..LGP.EKVTGDIPNV------...
RPOBC_HELPY/731-1296G.YNFEDAI--------VVSECITKDDIFTSTHIYEKEVDA..........RELK..HGV.EEFTADIPDV------...
RPOB_OSTTA/587-1008G.YNFEDAV--------LVSERLVYDDVFTSIHISRYEVST..........ARLR..EGQ.EYFTNQVDRN------...
W5A749_WHEAT/37-433G.YNFEDAV--------LISERLVYEDIYTSFHIRKYEIQT..........DTTS..QGSAEKITKEIPHL------...
RPOB_PHATC/876-1274G.YNFEDAI--------LINERLVYDDVFTSIHIERYKIEI..........DRNS..DTL.ERTTKNIPNL------...
RPOB_PLAF7/527-929G.YEYEDAI--------IISRKILYNNLYTSLHLNIYEISL..........NIIN..NIP.EICSINLSKM------...

PF04941

Q8B9K0_NPVR1/5-748KIIMNH.DINYSIDSL--ANK----IVYKH----AYL------IELLLTSTILQNYQRVLDKTADDDAYTVVNKRRKIQS
Q6JP89_NPVNC/3-721KSTMRHICTDYHIDTL--SNK----LILSP----SQL------LE............TFLLQTKKFILYLIDKQIPV..T
Q91ES4_GVCPM/4-750KSIMSV.DIPYQIDSL--SNK----IIYKH----SYL------IHL........TYSTVLNKLRNLTVTDADNTKKK..C

PF00562

Q74MN2_NANEQ/133-507....RGYKGEKHYRHL..ESD....GIVYP....EAE......VK------------------GKDVLIGRI.....SPP
Q8TXI7_METKA/161-536....RGYRSEDAYKHL..GED....GLAEV....GER......VE------------------GRDVIIGKT.....SPP
A2SSM5_METLZ/137-540....QGSHGIGSYANL..DVD....GIINP....ETV......VN------------------EKDVLIGKT.....SPP
A5ULN7_METS3/135-507....KGYRSEDAYRHL..DDD....GVVNP....ESY......VE------------------SGDVLIGKT.....SPP
A0RXX0_CENSY/644-1018....RGYKGEKSYRLL..EDD....GVIAS....EST......VL------------------GGDILIGKT.....SPP
Q980R1_SULSO/176-547....RGYKGKEYYRLL..EDN....GVVSP....EVE......VK------------------GGDVLIGKV.....SPP
Q8ZYQ9_PYRAE/658-1029.....GYRGPEAYSHL..DED....GIAPP....EVY......VS------------------SNEVLIGKTS.....PP
RPB2_IIV3/689-1053......KIRDCNYGLV..GPD....GIVRL....RQR......VK------------------KGDVLICKV........
RPB2_IIV6/724-1098.......RRMNNYSLLEDNPESPYFGVVKV....KSF......VK------------------RNDVLVGK.........
A0CUT2_PARTE/741-1109.......FAGKLFIKL..DSD....GIVPP....GTK......VD------------------EEEPIIGK.........
Q583H5_TRYB2/724-1094.....CHVKRADYTKL..DTD....GLIKP....GMP......VI------------------GGDIIVGKT.....IPV
A2E7H8_TRIVA/712-1082....VKGIKLHDSSKI..DAD....GLAIP....GAV......VS------------------AQDVIIGKI.....SPD
RPO2_MIMIV/726-1093.....DNLRDANYDKL..SEE....GYAKV....ETV......IR------------------DGDVVIGVV.....NP.
E2RU19_GIAIC/792-1189....KGIKDPGCASYL..EAD....GLPRV....GNA......VN------------------SQRLIIGKI.....RPN
Q4A245_EHV8U/685-1058.....SGMKEADYSKI..DDK....GMPII....GKT......FY------------------NGDVLIGKV.....VSM
C5WRS0_SORBI/754-1125........KRGRVDNL..DDD....GLPYI....GAS......LQ------------------TNDIVIGKV........
Q8QUS6_ISKNN/596-957.......RPGLVYDYL..GDD....GIFDPALARGMF......VA------------------AGVVVVGKM........
Q4GZE8_TRYB2/675-1036..........GRHSAL..NSD....GIASK....GAV......VR------------------QFDILVNKY.....TP.
Q5CPZ8_CRYPI/819-1197T..GNRRFSFKNDSIL..DND....GVCNV....GVQ......VS------------------EDDIIVNKM.....SPI
RPC2_MOUSE/668-1041......RKPIWRHEIL..DAD....GICSP....GEK......VE------------------NKQVLVNKS.....MPT
F4KD38_ARATH/690-1065......GPDAEKMQIL..DDD....GLATP....GEI......IR------------------PNDIYINKQV....PVD
A0D7M6_PARTE/655-1033....TKKKFIKKYHAL..DND....GITKV....GAQ......LH------------------HGDIYVNKK.....TP.
Q236N3_TETTS/664-1046SYKKKQNRVLKKFGAL..DDD....GTPIV....GAS......IN------------------NGDVLFNKY.....TPL
A8B2N4_GIAIC/763-1143......LKQYEGYHAI..EDD....GLCAV....GAH......LK------------------TGDIVINKGRHITNIP.
Q4UB41_THEAN/766-1155.............QNK..DSDSTNEYVIGV....GEP......VK------------------PGQVLISTK.....APP
A2E3T5_TRIVA/688-1052.....ENIASPQYSLL..DAD....GIIRP....GER......IE------------------KGMIYANKY........
RPA2_DICDI/664-1031........VDELDKFI..DTD....GLPFV....GRL......IK------------------PGEPYYTY.........
Q5AFK6_CANAL/675-1039.......WPEAWKEKL..DAD....GLPLI....GVK......VE------------------EGDPIVAY.........
Q27493_CAEEL/649-1005........PREEIKTV..GPD....GLPIP....GRR......YF------------------LDEVYYVT.........
Q5CSG7_CRYPI/759-1165........GELVVKEL..SAD....GLPNI....GQR......LT------------------KGSPICRV.........
F7A8L9_MACMU/29-389........DPRILQKL..DDD....GLPFI....GAK......LQ------------------YGDPYYSYL........
A8B827_GIAIC/683-1140......HMDENYDTEL..DED....GLPPV....GAY......LS------------------HGSVFY...........
Q22C62_TETTS/684-1046........KSQIAEGL..EGD....GIPAI....GSV......IK------------------KGTAVFQIY........
Q8II17_PLAF7/944-1400......LAYENKGKFL..NKD....GLPCV....QQK......IT------------------EGSPLYSY.........
Q4N2L4_THEPA/739-1128........SKLIVKKL..DFD....GLPRL....GEK......LT------------------KNSPFYRI.........
RPB2_ASFB7/782-1141.....NLKPGANYEKL...VD....GFVPV....GTV......VK------------------KGDIIIGK.........
RPOB_SALRD/696-1211........SEEATKDL..DER....GIVRV....GAE......IT------------------PGDIIVGKITP..KGET
R7EM77_9BACE/681-1194........SEEATKDL..DEN....GIVRV....GAR......IE------------------PGDILIGKITP..KGES
RPOB_UREPA/839-1300........SDTAKRFL..DNQ....GIVLV....GAE......VH------------------EGDVLVGKTTP..RGNV
A5IZ53_MYCAP/720-1106........SKYAIRHL..DEH....GIVLV....GSE......VI------------------PGDVLVGRVSP..KGDD
S5LVD1_9MOLU/753-1138........SEASKKYL..DED....GIVAI....GAE......VK------------------VGDILVGKVTP..KSQT
RPOB_DESOH/725-1286........GEESLVDL..DES....GIVRL....GAE......VK------------------PGDVLVGKITP..KGET
RPOB_GEOLS/853-1417........GEEALKDL..DES....GIIRI....GAE......VK------------------PGDILVGKITP..KGET
RPOB_LACDA/681-1067........GEDALKDL..DEN....GIIRI....GAE......VH------------------DGDILVGKVTP..KGIT
RPOB_DESAG/716-1278........GEDMLRNL..DGS....GIIRI....GAN......VK------------------PDDILVGKITP..KGET
RPOB_SYNAS/719-1284........GEEALRNL..DDS....GIVRM....GVS......VK------------------SGDILVGKITP..KGET
R5KT32_9FIRM/702-1129........GDDARKDL..DER....GIIRI....GAE......VR------------------AGDILVGKVTP..KGET
D6Z3M9_DESAT/721-1284........SEEALRNL..DES....GIVRV....GAE......IK------------------AGDILVGKITP..KGET
RPOB_NEOSM/713-1263........AEEFLHCL..DEF....GIACV....GAN......VE------------------AGDVLVGKVTP..KSSS
RPOB_EHRCR/741-1291........NEDSLSHL..DDV....GIVNV....GAE......VS------------------AGDILVGKVTP..RP..
C4YYN1_9RICK/735-1292........SEEALRHL..DEV....GIIYV....GAE......VK------------------AGDILVGKVTP..KSES
RPOB_PARDP/741-1300........GEEALRNL..DEA....GIVYI....GAE......VG------------------PGDILVGKITP..KGES
RPOB_PELUB/727-1287........NEEALKNL..DES....GIVYI....GAE......VK------------------AGDILVGKVTP..KGDS
RPOB_FUSNN/675-1063........SESALRNL..DEN....GVIMI....GSE......VG------------------PGDILVGKTAP..KGET
RPOB_MAGSM/724-1281........GEDALRNL..DES....GIIYV....GAE......VK------------------PGDILVGKVTP..KGET
RPOB_PHOPR/717-1263........GEAALSKL..DES....GIVYI....GAE......VK------------------GGDILVGKVTP..KGET
RPOB_FRATT/720-1276........SESSLAKL..DES....GIVHI....GAN......VE------------------AGDILVAKITP..KAEQ
RPOB_RUTMC/723-1282........SELALAKL..DEV....GVVYV....GAR......VK------------------GGDILVGKVTP..KSET
D0IXK9_COMT2/725-1292........SEQQLNRL..DES....GIIYV....GAE......VQ------------------PGDVLVGKVTP..KGET
R6A1S7_9ACTN/612-1033........SEDMLANL..DED....GIIRI....GAE......VG------------------PGDILVGKVTP..KGES
RPOB_KORVE/830-1399........SESALRDL..DES....GVIRI....GAP......VK------------------AGDILVGKVTP..KGET
RPOB_THEMA/760-1174........SKELLKNL..DEN....GIIRV....GAYVVSDYGVG------------------SQAILVGKVTP..KGEG
RPOB_DEIGD/619-1059........SEAALRDL..DED....GIVRV....GAE......VK------------------PGDILVGKTSF..KGES
W8JR39_9CHLA/672-1182........SEEVLANL..GED....GIIRI....GAE......VK------------------PGDILVGKITP..KSET
RPOB_CORGL/631-1051........SEEVLKDL..DDR....GIVRI....GAD......VR------------------DGDILVGKVTP..KGET
RPOB_AQUAE/798-1374........PERALAHL..DEH....GIVRV....GTY......VK------------------PGDILVGKVTP..KGET
RPOB_DEHM1/652-1123........GEESLREL..DED....GIIRI....GAE......VG------------------PDDILVGKITP..KGET
RPOB_RHOBA/666-1160........SEKALRNL..DDT....GIVQT....GTY......VK------------------PGDILVGKVSP..KSKT
RPOB_BORBU/669-1059........SEKILNKL..DEN....GIIRI....GTY......VK------------------PGDILVGKVTP..KSEG
RPOBC_HELPY/731-1296........KEEALAHL..DES....GIVKV....GTY......VS------------------AGMILVGKTSP..KGEI
RPOB_OSTTA/587-1008.............QYL..DEF....GVVKI....GTW......VE------------------AGDVLVGKISP..QPDS
W5A749_WHEAT/37-433........EEHLLRNL..DRN....GVVRL....GSW......VE------------------TGDILVGKLTP..QIAS
RPOB_PHATC/876-1274........NPREIRHL..NDD....GIVTV....GTF......VR------------------PGDILVGKVIS..NNTS
RPOB_PLAF7/527-929........YYKNIKHL..DKY....GIIKE....GTY......IL------------------ANNILISKLM...FMPF

PF04941

Q8B9K0_NPVR1/5-748VLYNKESKKIVDCIVNGRLIYCVSKTFSKQR..--KVFPNQQDNSSNNNIEISLPVLKYRVGNEVARITNDSMRQKMLKQ
Q6JP89_NPVNC/3-721KLVNDSSRGVMQSIVDGQIFKGISKTLSTQKIF--KMNPRLQEHTSRTNRDVNVFDLNFKNIDEILKIVSKDVSYKANMQ
Q91ES4_GVCPM/4-750VLFATESKKINDTIVMGKLIQSVSKTLSKQKKY--D.....QEYNSNNN.NLEIFPLRHRIGNEVLRVINENLQQDMLKH

PF00562

Q74MN2_NANEQ/133-507RFLE...GGELALLGAATLQ..KRDSSITVRSE..EE.GIVDSVLV..................................
Q8TXI7_METKA/161-536RFL.....EEFRPEELPAEE..RRESSTAIRHT..DS.GIVDSVII..................................
A2SSM5_METLZ/137-540RFL.....EEPTGELIAVEK..RRDTSITMRSN..ET.GIVDTVII..................................
A5ULN7_METS3/135-507RFL.....EEIDEFGTVAEK..RRETSVTVRHG..EK.GIVDAVLL..................................
A0RXX0_CENSY/644-1018RFM.....EEYKEFEPSGPY..RRDTSIGVRPS..ET.GVVDTVVM..................................
Q980R1_SULSO/176-547RFL.....QEFKELSPEQA...KRDTSIVTRHG..EM.GIVDLVLI..................................
Q8ZYQ9_PYRAE/658-1029RFY.....TTLEAERILKER...RDASVAVRRG..EK.GIVDKVII..................................
RPB2_IIV3/689-1053............TIKNKNQDEKLVDSSVIVQHG..EE.GYVDRIVD..................................
RPB2_IIV6/724-1098.........VI.TKISKDGTRQETDHSTIVSIS..EE.GKVDRIIR..................................
A0CUT2_PARTE/741-1109...EL..IIDNIMLNTANGQKNTKECSLLTRRA..ER.GVVDSVLI..................................
Q583H5_TRYB2/724-1094PKTL...SEE...SPVSDTRILKRDCSISSRAA..EK.GVVDRVML..................................
A2E7H8_TRIVA/712-1082SP......TELDHRQ.......YKDTSCVVRPM..ET.GVVDLVLR..................................
RPO2_MIMIV/726-1093............KPTAREDEKQYKDASSIYKSL..IP.GAVDKVIT..................................
E2RU19_GIAIC/792-1189KR.......SMNSRAVSTYD..FQDVSLKVKME..ET.GRVDSVIIAPDLREQS..........................
Q4A245_EHV8U/685-1058SLL......QADPKEGEVRRDTKRDRSHVLRTD..EP.VVVDAVFL..................................
C5WRS0_SORBI/754-1125...............SES....GEDHSIKLKHT..EK.GMVQKVLL..................................
Q8QUS6_ISKNN/596-957.............SFDQSRPE.GACCSLAVKPH..EE.GYFDDKLVF.................................
Q4GZE8_TRYB2/675-1036.................VPSMEPRPNPLVYKYP..QP.AVVDHVVI..................................
Q5CPZ8_CRYPI/819-1197NTR......EYVGDPSQFDLSEYKPSPVKYKGP..TS.SYIDRVIL..................................
RPC2_MOUSE/668-1041VTQ......IPLEGSNVPQQPQYKDVPITYKGA..TD.SYIEKVMI..................................
F4KD38_ARATH/690-1065TVT......KFTSALSDSQYR.PAREYFKGPEG..ET.QVVDRVAL..................................
A0D7M6_PARTE/655-1033..........QVPDNPQTENIQIADTPSVFKEK..WP.YTVDRVLI..................................
Q236N3_TETTS/664-1046LTLE...QQRGRDILNNNSVSEYIHNPTTFKGK..KL.ARIDRVIR..................................
A8B2N4_GIAIC/763-1143...........GLSDGTEATASLIKAPESLKSPLETI.TYVDKVLV..................................
Q4UB41_THEAN/766-1155TDFTTNGSMNGKNGESNQSSGTNEDKYIVNKYDLNTG.GYIDRLIL..................................
A2E3T5_TRIVA/688-1052...........VPLNFEESPVKFMAQPARYNY...YP.VMIQNVSV..................................
RPA2_DICDI/664-1031.............IRPSDG....RQVTKDYKGK..EE.AYIEDVRIIFG...............................
Q5AFK6_CANAL/675-1039.............YDDTLG....KTKVKTYHSS..EP.AYIEEVKLL.................................
Q27493_CAEEL/649-1005.............FNMETG....DFRTHKFHYA..EP.AYCGLVRIV.................................
Q5CSG7_CRYPI/759-1165.............ERIGSGGGPSNATIQTYHDD..EV.AFVEKINRIASGISIELQ........................
F7A8L9_MACMU/29-389..............NLNTG....ESFVMYYKSK..EN.CVVDNIKVCS................................
A8B827_GIAIC/683-1140................QTYDPTKQCYSTKLYHH..EP.GFVEKVIVIHKSAAKGEYWTDNDIATKKKRDSSFPAGDSNSS
Q22C62_TETTS/684-1046..............DTQKN....AMKTFYHKDS..EL.GRLDGIAL..................................
Q8II17_PLAF7/944-1400...............INKGNELTTYESFRNHGE.....YFVDFVSI..................................
Q4N2L4_THEPA/739-1128..............EERGKNNIVNDKVVKYTE...EP.AIVDQITLVGKSE.............................
RPB2_ASFB7/782-1141.........VAKIRGEKDELNKYIDRSVMYGFD..EP.AVVDAVMR..................................
RPOB_SALRD/696-1211DPTPE..EKLLRAIFGDKAGD.VKDASLKAKPG..MEGGVVIDTRLFSRRELDPASKKMEEKRLENIESDHERKLADLNE
R7EM77_9BACE/681-1194DPSPE..EKLLRAIFGDKAGD.VKDASLKASPS..LK.GVVIGKRLFSRVVKTRSSKLADKALLPKIDDEFDAKIGDLKK
RPOB_UREPA/839-1300ETAPE..DRLLQTIFGDKSKT.VKDSSLKVKHG..QE.GIVAAVKRIKSS..............................
A5IZ53_MYCAP/720-1106NPSRE..EKLLAAILGQRQLN.VKDTSLKVKNG..HN.GTVIGVEILSR...............................
S5LVD1_9MOLU/753-1138QLSPE..DKLLHAIFGEKSRN.VKDNSLRVPNG..GE.GIIKSIKRFSR...............................
RPOB_DESOH/725-1286QLSPE..EKLLRAIFGEKGGN.VKDTSLRVPPG..VS.GTVIDAKVFTRRGVEKDTRTRMIEEEEIRVLEKNRDDEIAVI
RPOB_GEOLS/853-1417QLSPE..EKLLRAIFGEKAGD.VRDTSLTIPPG..VE.GTVIGAKVFSRKGNDKDARTELIEKIEEEKLRKDEQDEVRII
RPOB_LACDA/681-1067ELSAE..ERLLHAIFGEKARE.VRDTSLRVPHG..GG.GVVQDVQVFTR...............................
RPOB_DESAG/716-1278QLTPE..EKLLRAIFGEKARD.VKNTSLKVPPG..IE.GTVIDVKLFNRRSGEKDERTRNIEDYELARLDQKEKDHIRAL
RPOB_SYNAS/719-1284QLSSE..EKLLRAIFGEKASD.VRDTSLRVPPG..VE.GTVIDAKVFTRKGAEKDHRSQYIEDEAIAMLQKDREDEIRII
R5KT32_9FIRM/702-1129ELTPE..ERLLRAIFGEKARE.VRDTSLKVPHG..ES.GIIVDAKVFKR...............................
D6Z3M9_DESAT/721-1284QLSPE..EKLLRAIFGEKAGD.VKDTSLRVPPG..VE.GVVVDAKVFSRKGVEKDERSLAIEEAEIKALERDLEDELNLL
RPOB_NEOSM/713-1263PVTPE..EKLLRAIFGEKAID.VKDSSLYLPPG..VS.GCVVDVKVLQRRGIEKVGRALLIEKQAIDAEKTRRDHELAVL
RPOB_EHRCR/741-1291PVSLPPETKLLVTIFGEKVFD.CVDSSLYLPLD..VE.GTVVDVHVFVRRGVEENDRSLLIKQNEINGFIKERDYEIDVV
C4YYN1_9RICK/735-1292PITPE..EKLLRAIFGEKAFD.IKDSSLYVPSG..VS.GTVVEVRVFSRRGVEKDQRAIAIEKQQIEKLAKDRDDELEII
RPOB_PARDP/741-1300PMTPE..EKLLRAIFGEKASD.VRDTSLRLPPG..AY.GTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAIL
RPOB_PELUB/727-1287ASGPE..EKLLRSIFGEKAID.VTDTSLKMSRG..SS.GTVVDVRVFNRHGIEKDERSITIERAEIDTVQQDKIVEEEIL
RPOB_FUSNN/675-1063EPPAE..EKLLRAIFGEKARD.VRDTSLTMPHG..SK.GVVVDILELSR...............................
RPOB_MAGSM/724-1281QLTPE..EKLLRAIFGEKASD.VRDTSLRLPPG..VA.GTVVDVRVFSRRGLEKDDRAKLIDQDEIALLRKDMAAERRII
RPOB_PHOPR/717-1263QLTPE..EKLLRAIFGEKASD.VKDSSLRVPNS..VS.GTIIDVQVFTRDGVEKDKRALEIEEMQLKEAKKDITEEFQIL
RPOB_FRATT/720-1276QLTPE..ERLLRAIFNEKASN.VADSSLRMPSG..TS.GTVINVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVI
RPOB_RUTMC/723-1282VLSPE..EKLLRAIFGEKANN.VKDSSLRVGAS..KS.GVVIDVQIFTRDRVEKDDRALSIDAERLERIKKDIDDEFGII
D0IXK9_COMT2/725-1292TLTPE..EKLLRAIFGEKASD.VKDTSLRVDQG..SQ.GTVIDVQVFTREGIQRDKRAQQIIDDELKRFRLDLNDQLRIV
R6A1S7_9ACTN/612-1033ALTAE..ERLLRAIFGAKAHD.VRDTSLKMPHG..AY.GRVIDVVRFSR...............................
RPOB_KORVE/830-1399QLTPE..EKLLRAIFGEKAGD.VRDASLTCPPG..IE.GVVVDVKIFSRKGQEKDERAKQIEGTQIAKLEKNLADEIRIL
RPOB_THEMA/760-1174DTTPE..EKIIRSVFGERGRD.VKDTSLRLPHG..VE.GRVIRVDVYDQ...............................
RPOB_DEIGD/619-1059EPTPE..ERLLRSIFGEKARE.VKDTSLRVQSG..QG.GIVVKTVRFRR...............................
W8JR39_9CHLA/672-1182ELAPE..ERLLRAIFGEKAAD.VKDASLTVPPG..TE.GVVMDVKVFSRKDRLSKSDDELVEEAVHLKDLQKGYKNQVAI
RPOB_CORGL/631-1051ELTPE..ERLLRAIFGEKARE.VRDTSMKVPHG..ET.GKVIGVRHFSR...............................
RPOB_AQUAE/798-1374RLTPE..EKLLQAIFGEKTRD.VKDASLRCPPG..VE.GIVIDVQVFTRKGTGKKDMLAEKVEREELEALEQELEKKKNL
RPOB_DEHM1/652-1123ELSAE..EKLLRAIFGEKARE.VKDTSLRMPHG..EW.GKVINVRVFSR...............................
RPOB_RHOBA/666-1160ELTPE..EKLLHAIFGRAGED.VKNDSLEVPSG..IE.GIVIDTQKFSRRMSLGEDERKAFERELKQHETEGNEEIASTF
RPOB_BORBU/669-1059DITPE..FRLLTSIFGEKAKD.VKNNSLKVPHG..TE.GTVIDVQRITK...............................
RPOBC_HELPY/731-1296KSTPE..ERLLRAIFGDKAGH.VVNKSLYCPPS..LE.GTVIDVKVFTKKGYEKDARVLSAYEEEKAKLDMEHFDRLTML
RPOB_OSTTA/587-1008DNDPE..SRLLRAIFGGVARN.TKTTSYCLSSG..VS.GRILDVRCEFKRQTK...........................
W5A749_WHEAT/37-433ESSYIAEAGLLRAIFGLEVST.SKETSLKLPIG..GR.GRVIDVKW..................................
RPOB_PHATC/876-1274EQLPE..SKLLRAIFGAKAKG.VKDNSYRMSDG..EY.GRVIETVTFNR...............................
RPOB_PLAF7/527-929IFNNKSLINIINFLFGSKLRI.FKNKPIISTIH..DI.GRVIKIEILPNHLY............................

PF04941

Q8B9K0_NPVR1/5-748KKDFVKFIGSFFHGEMTVAGKKFFLCRNACLPNVDYEMVAQKFKYLLKHNLV...............AFVDDLN......
Q6JP89_NPVNC/3-721YSDYRYFIDHCDHGELHAAGKTFTKTHDVILPNIDYSTIFRIFTTLINDQLI............................
Q91ES4_GVCPM/4-750TADYIKFVDSFFHGEMTVAGKKFFLCHNVVLPDVDYKRVSLLFRELIHKNVLYTKKVGGEDESELTGEKVKILNFSKKSP

PF00562

Q74MN2_NANEQ/133-507................................................................................
Q8TXI7_METKA/161-536................................................................................
A2SSM5_METLZ/137-540................................................................................
A5ULN7_METS3/135-507................................................................................
A0RXX0_CENSY/644-1018................................................................................
Q980R1_SULSO/176-547................................................................................
Q8ZYQ9_PYRAE/658-1029................................................................................
RPB2_IIV3/689-1053................................................................................
RPB2_IIV6/724-1098................................................................................
A0CUT2_PARTE/741-1109................................................................................
Q583H5_TRYB2/724-1094................................................................................
A2E7H8_TRIVA/712-1082................................................................................
RPO2_MIMIV/726-1093................................................................................
E2RU19_GIAIC/792-1189................................................................................
Q4A245_EHV8U/685-1058................................................................................
C5WRS0_SORBI/754-1125................................................................................
Q8QUS6_ISKNN/596-957................................................................................
Q4GZE8_TRYB2/675-1036................................................................................
Q5CPZ8_CRYPI/819-1197................................................................................
RPC2_MOUSE/668-1041................................................................................
F4KD38_ARATH/690-1065................................................................................
A0D7M6_PARTE/655-1033................................................................................
Q236N3_TETTS/664-1046................................................................................
A8B2N4_GIAIC/763-1143................................................................................
Q4UB41_THEAN/766-1155................................................................................
A2E3T5_TRIVA/688-1052................................................................................
RPA2_DICDI/664-1031................................................................................
Q5AFK6_CANAL/675-1039................................................................................
Q27493_CAEEL/649-1005................................................................................
Q5CSG7_CRYPI/759-1165................................................................................
F7A8L9_MACMU/29-389................................................................................
A8B827_GIAIC/683-1140NLDNDASD...........................................DEISNQPGSGSESNEDNQTATPRSHASKA
Q22C62_TETTS/684-1046................................................................................
Q8II17_PLAF7/944-1400................................................................................
Q4N2L4_THEPA/739-1128................................................................................
RPB2_ASFB7/782-1141................................................................................
RPOB_SALRD/696-1211RFWEKFFALVEDATSAGLEDREGEVLLT....EGADFEEDAFDEVDPSDLSTRAEFTEDEELNDQISTLLRNYKSRRRDI
R7EM77_9BACE/681-1194VLINKLLKLTENYTSEGVKDYMGADII.....SKGARFSASDFSDLDFTAVQLSNWTKDEHTNGLIRALVMNFIKKYKEL
RPOB_UREPA/839-1300................................................................................
A5IZ53_MYCAP/720-1106................................................................................
S5LVD1_9MOLU/753-1138................................................................................
RPOB_DESOH/725-1286EEVTRERLKALLTGQKCDTPVKKGKKT.....ILAKGDKITAALFDEVPTSQFEKLAVTSDSVTEQAHRVFEWYRTQVDA
RPOB_GEOLS/853-1417RDSARGKLKRLLVGKTAGAKIEDRHGVT...VLAKGKKITDELLESLTMDRWATISVSDGTDVEEKVAEVLSKLNEQVEL
RPOB_LACDA/681-1067................................................................................
RPOB_DESAG/716-1278TETTREKLAPVVVGKQLAYGLAGQKKGE...VIAEAGQTLTAEMLEGLPVKKLSGLFKSKDTNEAVQQALESYDRQIEFI
RPOB_SYNAS/719-1284TEAVKKEVGTLLQGKQSGAKIVDPKRKKI.YLKKGDIITPEILSEIPLHLWKEITVADDEETERAVGQMMANLYDKIEVV
R5KT32_9FIRM/702-1129................................................................................
D6Z3M9_DESAT/721-1284ARSVRNGLADLLVGKKVKNAVKNRKGEEL..LAKDKKITREVLEKLSPSEIKKLDYAGRDSLEGEINLLFDRHDSQVKMV
RPOB_NEOSM/713-1263TNYIYSLLKEMLVGKVALSTLAPI............SKGDLITEEALEKIDRENWWKISVDGISSIKLLRQRFVDRFDEI
RPOB_EHRCR/741-1291SEYFYDELKRVLVSSGVQYNNQ................NIDDYLASIPKKEWWDINLSDEAMLLQVKDLKEKFDSMIQNA
C4YYN1_9RICK/735-1292EHFVFSWLEKLLVGQVIINGPKQVK.........AGQTITSEMLKSLSKGQFWQLTVEDANVMNEIEQIKTHYDEKKDAL
RPOB_PARDP/741-1300ERNIYARLKSLIMGKEVVKGPKGIR.........AGAVVDEDLLGQLSRGQWWQLAVADEDTAKEVEALNQQFDAQKRAL
RPOB_PELUB/727-1287ERSIKQRANQILSGASLTKKIKDLD.........EGTKLDLEIINKININDVFKITVGNVNDEASIAQLKDQYNQAKQDI
RPOB_FUSNN/675-1063................................................................................
RPOB_MAGSM/724-1281ERDADERIRNLMNGKPVRSAPGLQP..........GDHISQSWLDKSPSSHLRDVVLDDDAITQQIEGIRHHVEKAADRL
RPOB_PHOPR/717-1263EGGLLARVRTLLLSIGYSE......................EKIASMDRERLFALTLDDESLQNQLEQLAEQYDELKAEF
RPOB_FRATT/720-1276ESVVKSSIEQEVVGAKIQKAKGLKK..........GAILTKEFLATLPFSKWLEISFEDEKLEEKVQNAREYYEEAKIAI
RPOB_RUTMC/723-1282DGDIFRRVRLKLSGNMLSKVAGDIK.........AGEKLSAKLMKKLDNKDISKLKVEDAAVNKEVAALIKQAKAKQIEF
D0IXK9_COMT2/725-1292EADAFDRIEKLLTGRVANGGPQKLS.........KGAKIDKAYLDGVEKFHWFDIRPAEDDVAAQLESIKNSIEQQRHTF
R6A1S7_9ACTN/612-1033................................................................................
RPOB_KORVE/830-1399TDERLKRLEGLLGAKVVQADLHDERTNKRLLTKDAVLDRETIERISTRNLKRIKYADKDPRVNEQIDEIEEMTSRQIDVL
RPOB_THEMA/760-1174................................................................................
RPOB_DEIGD/619-1059................................................................................
W8JR39_9CHLA/672-1182LKTEYREKLGALLLNEKAPAAIIHRRTADILVPEGAIFDQETIELLEKESLVDLLMPSCEIYDVLKSLLSEYETSLQRLE
RPOB_CORGL/631-1051................................................................................
RPOB_AQUAE/798-1374IITGRDKVLKGLVLGRKVEKDAKVGRKTV..KKGTVIDEKVFEEFVNYILGRPENFFEDEDLIRKIREIAERTRTQIEML
RPOB_DEHM1/652-1123................................................................................
RPOB_RHOBA/666-1160ESLIRDMEEASGVKLKDSTGTPLAD.........GQDPKFVAERATSFRLELVLEQIEDEEKRKAAEKVHQTQWQNVEQA
RPOB_BORBU/669-1059................................................................................
RPOBC_HELPY/731-1296NREELLRVSSLLSQAILEEPFSHNGKDY....KEGDQIPKEEIASINRFTLASLVKKYSKEVQNHYEITKNNFLEQKKVL
RPOB_OSTTA/587-1008................................................................................
W5A749_WHEAT/37-433................................................................................
RPOB_PHATC/876-1274................................................................................
RPOB_PLAF7/527-929................................................................................

PF04941

Q8B9K0_NPVR1/5-748....DVQDDSLLIAFNDRPT-NLKCLKSNTSFIVYTMKRNLAPIELKITDRILYVNHHEGMICI----KKKLRVNNEANI
Q6JP89_NPVNC/3-721....STSNSKYRIVFNSCPT-QYFV..HNVEKFVKIIKA..LPIEIRMFKSLICLNYHVGLIMK----KARLFVDDG.YI
Q91ES4_GVCPM/4-750NKVGLVSNSELVVAFNNRPT-KYYCNRDSLYQIYYTMKRGYAPVEIKLTNNILFVNHHEGMVML----KRVVYIDNEIHI

PF00562

Q74MN2_NANEQ/133-507...............TEGED.S.....NLKVRVRIRMER-----PTEIGDKFSSRHGQKGVIGLIVPPSDMPFTASGIVP
Q8TXI7_METKA/161-536...............TETSD.G.....HKLVKVRIRDER-----VPELGDKFSSRHGQKGVIGMIVPEEDMPFTEDGITP
A2SSM5_METLZ/137-540...............TESEN.S.....SRLVKVRTRDLR-----IPEIGDKFASRHGQKGVCGLITPQENMPFTAAGIAP
A5ULN7_METS3/135-507...............TETVE.G.....SRLAKIRVRDTR-----QPEFGDKFASRHGQKGVLGLILSPEDVPFTESGVVP
A0RXX0_CENSY/644-1018...............TQSNE.G.....GKMYKIRVRDMR-----VPEIGDKFAARHGQKGVLGILAKNEDLPYTAEGVTP
Q980R1_SULSO/176-547...............TETAE.G.....NKLVKVRVRDLR-----IPTIGDKFASRHGQKGVIGMLIPQVDMPYTVKGVVP
Q8ZYQ9_PYRAE/658-1029...............TESPE.G.....NKLVKVRLRELR-----VPELGDKFASRHGQKGVVGMLLRQEDMPFTEDGIVP
RPB2_IIV3/689-1053................NVID.G.....CRIVKVVIGQMR-----TPEIGDKFCSGMAQKGTCGMIFPQEDMPFTASGMTP
RPB2_IIV6/724-1098................TSKK.G.....ILMFKIVIAQQK-----RPEIGDKFCSAMAQKGTVGMILEEVDMPFMEDGSIP
A0CUT2_PARTE/741-1109...............SENQK.G.....YKLVKVKVRSLR-----IPQIGDKFCSRHGQKGTCGMTYRQEDLPYTLVGISP
Q583H5_TRYB2/724-1094...............TENK..G.....NRFTKVRIRTIK-----IPNIGDKFCSRHGQKGTNGIQFRQEDMPFNHDGISP
A2E7H8_TRIVA/712-1082...............TITKK.N.....LQLARVRTRQMR-----RPEIGDKFCSRHGQKGVCGMTYRQEDMPFTRDGMVP
RPO2_MIMIV/726-1093...............EVNND.G.....YPIIKMRIRSER-----IPNVGDKFSSRAGQKGTIGYKAHRADMLFSKSGLIP
E2RU19_GIAIC/792-1189......FLSEGVDSNTTGAE.G.....SLLAKVRVRSSR-----VPQLGDKFSSRHGQKGTVGMLLRHEDLPFTLDGITP
Q4A245_EHV8U/685-1058...............SKTPE.G.....HGYVKVRTRAIR-----IPMVGDKFSARHGQKGVCGVTMPAADFPCTADGVAP
C5WRS0_SORBI/754-1125...............SANDE.G.....KNFAVVTLRQVR-----TPCLGDKFSSMHGQKGVVGFLESQENFPFTHKGIVP
Q8QUS6_ISKNN/596-957................NMAD.G.....CKCVKIKLRKIR-----IPEMGDKFASFTAQKGTCGMMYDQWDMPFTADGVVP
Q4GZE8_TRYB2/675-1036...............SPPGDSDRSMDVEQKIKVVTREVR-----GPEPGDKFSSRHGQKGVVGLITDGVNMPFNEQGICP
Q5CPZ8_CRYPI/819-1197...............TENAD.G.....NQIYKVITRQTR-----RPELGDKFSSRHGQKGVVGLIISQEDLPFSETGWCP
RPC2_MOUSE/668-1041...............SSNAE.D.....AFLIKMLLRQTR-----RPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICP
F4KD38_ARATH/690-1065...............CSDKK.G.....QLCIKYIIRHTR-----RPELGDKFSSRHGQKGVCGIIIQQEDFPFSELGICP
A0D7M6_PARTE/655-1033...............INNTNDGT..EKIKTIKTIFRQIR-----RPEFGDKFSSRHGQKGVVGLIVNQEDMPFNERGWCP
Q236N3_TETTS/664-1046...............SQQDG.......NVIIKTIVRETR-----RPEYGDKFSSRHGQKGIIGLIVNQEDMPFSEKGWVP
A8B2N4_GIAIC/763-1143...............TTNGD.G.....NMLIKVLTREPR-----RPEVGDKFSSRHGQKGVCGLIVPQSDLPFTSQGIVP
Q4UB41_THEAN/766-1155...............TENFN.G.....NTMYKIMVRQSR-----PPEIGDKFSSRHGQKGVVGLIAEHEDMPFTESGIVP
A2E3T5_TRIVA/688-1052...............YTTET.......TQVIKIKTADFR-----RPELGDKFSSRHGQKGVIGLIVPQEDMPYTEDGICP
RPA2_DICDI/664-1031...........PNGATRDPS.K.....INNICVKLRFNR-----NPVIGDKFSSRHGQKGVLSQLWPEINMPFTESGMKP
Q5AFK6_CANAL/675-1039.............GDDSNEQ.E.....GQQITIKYRITR-----QPLIGDKFSSRHGQKGVCSRKWPQIDMPFTESGMQP
Q27493_CAEEL/649-1005.............EQGEGDS.G.....AKHALIQWRIER-----NPIIGDKFASRHGQKGINSFLWPVESLPFSETGMVP
Q5CSG7_CRYPI/759-1165...QDSLSGGGGDGASSSSG.Y.....GEKVSIKLRIVR-----NPMVGDKFASRHGQKGILSMLWPQENMPFSESGMVP
F7A8L9_MACMU/29-389..............NDTGSG.K.....FKCVCITMRVPR-----NPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMVP
A8B827_GIAIC/683-1140ERKSSRQLQTRARTESSSLH.F.....IQRVRIVIRHDR-----TPVVGDKVASRHGQKGIMGIRWRQTDMPFTSSGIVP
Q22C62_TETTS/684-1046..............VHDEKT.K.....EPRVEYRIRIPR-----NPIIGDKFSSRHGQKGVLSVLWPHIDMPFTESGITP
Q8II17_PLAF7/944-1400................GKNN.S.....NQVAVVKLRSTR-----QPQVGDKFASRHGQKGVVSRLFPQEDMPFAESGIVP
Q4N2L4_THEPA/739-1128........ITVGDKISCPGL.K.....HDRAIIKLRVLR-----SPIVGDKFASRHGQKGILSAVWPTEDMPFLENGIVP
RPB2_ASFB7/782-1141...............PHGPN.D.....EIFGLMRLRYER-----NLNIGDKMSSRSGNKGIAALALPTSDMPFTEDGLQP
RPOB_SALRD/696-1211EGTTKRQKHQVEMGDELPSG.V.....VQMAKVYVARKK-----KIEVGDKMAGRHGNKGVIAKIAPVEDMPFLDDGTPV
R7EM77_9BACE/681-1194DAELKRKKFAITIGDELPAG.I.....IQMAKVYIAKKR-----KIGVGDKMAGRHGNKGIVSRVVRQEDMPFLADGTPV
RPOB_UREPA/839-1300..........DENGSELPDD.V.....IEIIKVYIVQKR-----KIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPL
A5IZ53_MYCAP/720-1106...........ENKDLLEDG.I.....DMIVKVSIAVKR-----KIRVGDKMSGRHGNKGVVSVILPEEDMPHLEDGTPI
S5LVD1_9MOLU/753-1138...........ADGHDLPAD.I.....LEIIKVYIVQKR-----KIQEGDKMAGRHGNKGVISKILPVEDMPHMEDGTPV
RPOB_DESOH/725-1286CREEFEARISRYGAGEELPPGV.....IKMVKVYVAMKR-----VLSTGDKMAGRHGNKGVVSRILPQEDLPYFEDGTTV
RPOB_GEOLS/853-1417IRGVFDDKVQKLRRGDDLPPGV.....IKMVKVYVAIKR-----KLQVGDKMAGRHGNKGVVSRILPEEDMPYMDDGRPV
RPOB_LACDA/681-1067...........EAGDELAPG.V.....NTLVRVYIVQKR-----KIQVGDKMSGRHGNKGTVALIAPVEDMPYLPDGTPV
RPOB_DESAG/716-1278NAMYESKREKVTEGDDLPPG.V.....IKMAKVHIAVKR-----KLNVGDKMAGRHGNKGVVSCILPQEDMPFFADGRPV
RPOB_SYNAS/719-1284EAYFNEKTEKLKASDELPPG.V.....IKMVKVYIAIKR-----KLQAGDKMAGRHGNKGVLSRILPEEDMPYFKDGRPV
R5KT32_9FIRM/702-1129...........ENGDELAPG.V.....NESVRIYIAQKR-----KISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPL
D6Z3M9_DESAT/721-1284RSRYEARIARLQKGDDLPPG.V.....IRMVKVYLAIKR-----KLAVGDKMAGRHGNKGVVSRILPEEDMPYFADGTAV
RPOB_NEOSM/713-1263NKTYEENFEKIRGDDDLAQG.V.....LMVVKVFVAVKH-----TLQPGDKMSGRHGNKGVISRIVPAEDMPYLADGTPV
RPOB_EHRCR/741-1291HSKFDQKIDKLNYGYDLPQG.V.....LCIVKVFVAVKH-----NLQPGDKMAGRHGNKGVISRIVPVEDMPYLEDGTPV
C4YYN1_9RICK/735-1292DKRLATKVEKLQSGDDLPQG.A.....LKVVKVFIATKH-----KLQPGDKMAGRHGNKGVISRIVPEEDMPFLENGTVI
RPOB_PARDP/741-1300DNRFDDKVEKVRQGDDLPPG.V.....MKMVKVFVAVKR-----KLQAGDKMAGRHGNKGVVSKVVPIEDMPFLSDGTPV
RPOB_PELUB/727-1287QERFEDKVLKIRSGDDLLPS.V.....MKMVKVFVAIKR-----RLRPGDKMSGRHGNKGVVSKIVPVEDMPYREDGRPV
RPOB_FUSNN/675-1063...........ENGDELKAG.V.....NKSIRVLVAEKR-----KITVGDKMSGRHGNKGVVSRVLPAEDMPFLEDGTHL
RPOB_MAGSM/724-1281KKRFESKVEKLERGDDLPPG.V.....LKMVKVYIAVKR-----KLQPGDKMAGRHGNKGVISKINPLEDMPYMANGTPV
RPOB_PHOPR/717-1263DKKFETKRRKITQGDDLAPG.V.....LKIVKVYLAVKR-----RIQPGDKMAGRHGNKGVISKICPVEDMPYDEKGQTV
RPOB_FRATT/720-1276DAKFEAKKKSITQSNELSPG.V.....LKTVKVFVAIKK-----RIQPGDKMAGRHGNKGVVSRVLPVEDMPYMEDGTPV
RPOB_RUTMC/723-1282KKFFEEEKAKINEGAELPPG.V.....MKMVKVYVATSK-----TLQVGDKMAGRHGNKGVISRVSPVEDMPYLVDGSTI
D0IXK9_COMT2/725-1292DLAFEEKRKKLTQGDELPAG.V.....LKMVKVYLAVKR-----RLQPGDKMAGRHGNKGVVSKITPVEDMPFLADGTTA
R6A1S7_9ACTN/612-1033...........ENGDDLAPG.V.....NEQVRVYVAQRR-----KIQQGDKIAGRHGNKGVICNVLPVEDMPYMADGTPI
RPOB_KORVE/830-1399RKIVREKIEKLQKGDELPPG.V.....IKLVKVYIAMKR-----KLSVGDKMAGRHGNKGVIARILPEEDMPYLEDGTPV
RPOB_THEMA/760-1174...........NDIAELGAG.V.....LKLVRVYVASRK-----TLDIGDKLAGRHGNKGVVSNILPKEDMPFLPDGTPV
RPOB_DEIGD/619-1059..........GDEGVDLKPG.V.....REMVRVYVAQKR-----QLQVGDKVANRHGNKGVVSKILPPEDMPYLEDGTPV
W8JR39_9CHLA/672-1182VNYKTEVEHIREGDADLDHG.V.....IRQVKVYVASKR-----KLQVGDKMAGRHGNKGVVSKIVPEADMPYLSNGETV
RPOB_CORGL/631-1051...........EDDDDLAPG.V.....NEMIRIYVAQKR-----KIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPV
RPOB_AQUAE/798-1374NKVYEEKKETLLKRRDLPPG.V.....ITLVKVFIANKR-----KIKVGDKMAGRHGNKGVISVVLPVEDMPFLPDGTPV
RPOB_DEHM1/652-1123...........ENGDDLPAR.V.....NKWVQVWVAQKR-----KVSVGDKLAGRHGNKGVISIIAPVEDMPYLPDGTPV
RPOB_RHOBA/666-1160IDERDRKLNSMKRGDELRSG.V.....LQMVKIYIATKR-----TISVGDKMAGRHGNKGVIAKILPIEDMPFLPDGTPI
RPOB_BORBU/669-1059...........EDVGNLSPG.V.....EEILKVYVAKKR-----KLKEGDKMAGRHGNKGVVAKILPVEDMPYLADGTPL
RPOBC_HELPY/731-1296GEEHEEKLSILEKDDILPNG.V.....IKKVKLYIATKR-----KLKVGDKMAGRHGNKGIVSNIVPVADMPYTADGEPV
RPOB_OSTTA/587-1008......NIEDESIES............TGSVYVYLVEKR-----RLQVGDKVAGRHGNKGIVSNILPRVDMPYLQSGKAL
W5A749_WHEAT/37-433...............IQRDP.L.....DIMVRVYILQKR-----EIKVGDKVAGRHGNKGIISKILPRQDMPYLQDGTPV
RPOB_PHATC/876-1274...........RTKLTY....K.....FEKIYVFIAQIR-----KIQVGDKIAGRHGNKGIISRILSRQDMPFLPDGTPL
RPOB_PLAF7/527-929........NKTEKNN......I.....YLKFRIYIGIQK-----YLQLGDKICNRHGHKGIISYISEINDIPYLNNKIQP

PF04941

Q8B9K0_NPVR1/5-748NVLLTPYEYHYKHSIYYNPIIQCAIVENDDV.............KSLMSKLEQYYYRNFIHLFHTTPVPKLIVSLTNLKN
Q6JP89_NPVNC/3-721DTYVTPFELHHESSCFKDKI....FLNESCV.............RSLLSRTTLFYCNKHTDVFINIPPAKIMVFMRNLKN
Q91ES4_GVCPM/4-750KTLQTAYEYHNEHS..........LLNSEDVLLRCDETGPMNTTASLMSTMVLEYYKNYLHIFNTIPVAKLIVSLTNLKN

PF00562

Q74MN2_NANEQ/133-507DLIFNPHGLPSRMTI-----------------------------GQIIELVAGKVASL......................
Q8TXI7_METKA/161-536DLILNPHALPSRETM-----------------------------AHILETLAGKAAAL......................
A2SSM5_METLZ/137-540DLVINPHAVPSRMTI-----------------------------GHMLEMIGGKAGAL......................
A5ULN7_METS3/135-507DLIVNPHAIPSRMSV-----------------------------GQVLEMVAGKAGCL......................
A0RXX0_CENSY/644-1018DVLINPHAFPSRMTV-----------------------------GMFMESITGKAAAL......................
Q980R1_SULSO/176-547DIILNPHALPSRMTL-----------------------------GQIMEGIAGKYAAL......................
Q8ZYQ9_PYRAE/658-1029DIIVNPHALPSRMTV-----------------------------AQLLESIAGKLGAS......................
RPB2_IIV3/689-1053DIIINPNCIPSRMTI-----------------------------NQIISTVMGKLYTVN.....................
RPB2_IIV6/724-1098DMIINPHCLPSRMTI-----------------------------NQIMASIMGKTCCA......................
A0CUT2_PARTE/741-1109DLTINPHCIPSRMTI-----------------------------GHLIECLSSKLASI......................
Q583H5_TRYB2/724-1094DLIINPHAIPSRMTV-----------------------------AHLIETLAGKVACY......................
A2E7H8_TRIVA/712-1082DIIMNPHALPSRMTI-----------------------------GHLIECLLGKCTAID.....................
RPO2_MIMIV/726-1093DIIINPNCMPKRMTI-----------------------------GQLIECLLGKLCAV......................
E2RU19_GIAIC/792-1189DIIMNPHAIPSRMTI-----------------------------GQLMESVASKLGAL......................
Q4A245_EHV8U/685-1058DIIINPHAIPSRMTI-----------------------------GMLMEMVLSKVACY......................
C5WRS0_SORBI/754-1125DIVINPHAFPTRQTP-----------------------------GQLLEAALGKGIAC......................
Q8QUS6_ISKNN/596-957DLVINPHAFPSRMTV-----------------------------HYLLQMCFELGAVA......................
Q4GZE8_TRYB2/675-1036DMIMNPHGFPSRMTV-----------------------------GKLLELVSSKVSAL......................
Q5CPZ8_CRYPI/819-1197DLIMNPHGFPSRMTV-----------------------------GKLLELISSKASVL......................
RPC2_MOUSE/668-1041DIIMNPHGFPSRMTV-----------------------------GKLIELLAGKAGVL......................
F4KD38_ARATH/690-1065DLIMNPHGFPSRMTV-----------------------------GKMIELLGSKAGVS......................
A0D7M6_PARTE/655-1033DLIMNPHGYPSRMTI-----------------------------AKLMELLCGKLGAL......................
Q236N3_TETTS/664-1046DLIMNPHGYPSRMTV-----------------------------GKLLELLGSKAAVL......................
A8B2N4_GIAIC/763-1143DLIMNPHGYPSRMTV-----------------------------AKLLELLSNKSGCF......................
Q4UB41_THEAN/766-1155DLIMNPHGFPSRMTV-----------------------------GKLLELVASKSSVF......................
A2E3T5_TRIVA/688-1052DMIMNPHGFPSRMTV-----------------------------GKMIELVSGKVGIL......................
RPA2_DICDI/664-1031DVIINPNAFPSRMTI-----------------------------GMLVEILAGKAGAI......................
Q5AFK6_CANAL/675-1039DVIINPHAFPSRMTI-----------------------------GMFVESLAGKAGAL......................
Q27493_CAEEL/649-1005DIIFNPHGFPSRMTI-----------------------------GMMIESMAGKAAAT......................
Q5CSG7_CRYPI/759-1165DILFNPHGFPSRMTI-----------------------------GMLLESMGGKAACI......................
F7A8L9_MACMU/29-389DILFNPHGFPSRMTI-----------------------------GMLIESMAGKSAAL......................
A8B827_GIAIC/683-1140DLIINPHAFPSRMTV-----------------------------GMLIESLASKIGVH......................
Q22C62_TETTS/684-1046DVIINPHAFPSRMTI-----------------------------GMLIESMAGKSGAL......................
Q8II17_PLAF7/944-1400DIIFNPHGIPSRMTI-----------------------------GMLIESICGKAASL......................
Q4N2L4_THEPA/739-1128DVIFNPHGLPSRMTI-----------------------------GKLIEGMAGKVASI......................
RPB2_ASFB7/782-1141DLIVNPHSHPSRMTN-----------------------------GQMIETTVGLANAL......................
RPOB_SALRD/696-1211DLVLNPLGVPSRMNL-----------------------------GQIYETLLGWAGDR......................
R7EM77_9BACE/681-1194DIVLNPLGVPSRMNI-----------------------------GQIFEAVLGRAGKN......................
RPOB_UREPA/839-1300DIMLNPLGVPSRMNI-----------------------------GQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISL
A5IZ53_MYCAP/720-1106DVMLNPQGVPSRMNI-----------------------------GQVLEVHLGMAARS......................
S5LVD1_9MOLU/753-1138DIMLNPQGVPSRMNI-----------------------------GQVLEIHLGMAAKK......................
RPOB_DESOH/725-1286DMVLNPLGVPSRMNV-----------------------------GQILEIHLGRAARVLGDQISTMLEEKKYKDLKKKLS
RPOB_GEOLS/853-1417EIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKGLGWKIQKMLEEHTSEENLKKFI
RPOB_LACDA/681-1067DICLNPMGVPSRMNI-----------------------------GQLLEIHLGRAARA......................
RPOB_DESAG/716-1278DIVLNPLGVPSRMNI-----------------------------GQIMETHLGWAAKEMGRKLALMLEHGQDLASVREQV
RPOB_SYNAS/719-1284DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKGLGEKLNDMLDSYQKGNQLRDEL
R5KT32_9FIRM/702-1129DIVLNPLGVPSRMNI-----------------------------GQVLEIHLSLAAKV......................
D6Z3M9_DESAT/721-1284DIVLNPLGVPSRMNV-----------------------------GQLLEIHLGLAAKKLGEQVQRLAQTRDLAAVKKKLA
RPOB_NEOSM/713-1263DIILNPLGVPSRMNV-----------------------------GQILETHLGWAAYNLGKKISKLLDEGNYSEVKSLVL
RPOB_EHRCR/741-1291DIILNSLGVPSRMNV-----------------------------GQILETHLGWASVNLGKKIGHILDNLDELTVSHLRN
C4YYN1_9RICK/735-1292DIVLNPLGLPSRMNI-----------------------------GQILETHLGWASINLAKKISELVKEYKNKHIGIEQI
RPOB_PARDP/741-1300DLVFNPLGVPSRMNV-----------------------------GQILETHMGWASRGLGIKIDEALQDYRRNGDMTPVR
RPOB_PELUB/727-1287DIVLNPLGVPSRMNV-----------------------------GQILETHLGWACKEFGEEVKRLVNENNKKFEKTEKI
RPOB_FUSNN/675-1063DVVLNPLGVPSRMNI-----------------------------GQVLEVHLGMAMR.T.....................
RPOB_MAGSM/724-1281DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAARGMGFKIEEALKQHRKGVADVLRR
RPOB_PHOPR/717-1263EIVLNPLGVPSRMNI-----------------------------GQILETHMGLAAKGIGDKLNEMLKQQQELHKFRNFL
RPOB_FRATT/720-1276DVCLNPLGIPSRMNI-----------------------------GQILEAHLGLASYGLGKKIEKTLEKTRKAAELRKTL
RPOB_RUTMC/723-1282DVVLNPLGVPSRMNV-----------------------------GQVLEVHLGYAAKGLGYKITAMLDEKRTDMVKQIRD
D0IXK9_COMT2/725-1292DIVLNPLGVPSRMNI-----------------------------GQVLEVHLGWAGKGLGQRIGDMLQKEARAAEVRAFL
R6A1S7_9ACTN/612-1033DVILNPLGVPSRMNV-----------------------------GQLLECHLGWAAACGWDTEQA...............
RPOB_KORVE/830-1399EIVLNPLGVPSRMNV-----------------------------GQILETHLGWAGHELGKKIAEFMVENSEAGQVRKHL
RPOB_THEMA/760-1174QMVLNPLGIPSRMNV-----------------------------GQILETHLGWLAKL......................
RPOB_DEIGD/619-1059DLVFNPLGVPSRMNL-----------------------------GQILETHLGEVARL......................
W8JR39_9CHLA/672-1182QMILNPLGVPSRMNL-----------------------------GQVLETHLGYAAKT......................
RPOB_CORGL/631-1051DIILNTHGVPRRMNI-----------------------------GQVLETHLGWLASAGWSVDPEDPENAE.........
RPOB_AQUAE/798-1374DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKELGKKIGEMIEKGRDRKAITEYL
RPOB_DEHM1/652-1123DVVLNPIGVPSRMNL-----------------------------GQILETHLGWAGHL......................
RPOB_RHOBA/666-1160QIMLNPLGVPSRMNV-----------------------------GQILETHLGWAGAK......................
RPOB_BORBU/669-1059DICLNPLGVPSRMNI-----------------------------GQLMESQLGLAGKY......................
RPOBC_HELPY/731-1296DIVLNPLGVPSRMNI-----------------------------GQILEMHLGLVGKEFGKQIARMLEDKTKDFAKELRA
RPOB_OSTTA/587-1008DMVLNPLGVPSRMNV-----------------------------GQIFECLLGLAANT......................
W5A749_WHEAT/37-433DMVFNPLGVPSRMNV-----------------------------GQIFESSLGLAGDL......................
RPOB_PHATC/876-1274DILLNPLGVPSRMNV-----------------------------GQLYECLLGLAGDK......................
RPOB_PLAF7/527-929DIFISAISIPSRINI-----------------------------GQIFEGIYGLNSLYLNTRYII...............

PF04941

Q8B9K0_NPVR1/5-748AMPVF...EYKKENCVTGL..PNGYSVAVNKSVLLNNKMFKLWTLVRDNK-LMTAEDPYIP-------------------
Q6JP89_NPVNC/3-721ASPVFIPSSFVPEKYMKFMKNENKNCIVVDSKHYCNDKMIYLWTMIGDDR-LKTSEDPYVP-------------------
Q91ES4_GVCPM/4-750GMVV.......QKKGFKSL..PVGNSVVVEDSVYCNDRMFCLWTVVMDSR-LKTAEDPYVP-------------------

PF00562

Q74MN2_NANEQ/133-507................................................RG.KAVDGTPWE....................
Q8TXI7_METKA/161-536................................................SG.KRIDGSAFT....................
A2SSM5_METLZ/137-540................................................EG.SRVNATSFR....................
A5ULN7_METS3/135-507................................................EG.ERVDGTPFN....................
A0RXX0_CENSY/644-1018................................................RG.TQFDGSAFV....................
Q980R1_SULSO/176-547................................................SG.NIVDATPFY....................
Q8ZYQ9_PYRAE/658-1029................................................TG.QLIDATPFEG...................
RPB2_IIV3/689-1053...............................................PNP.RFRNGNSFQE...................
RPB2_IIV6/724-1098...............................................KNE.TFGDASPFQES..................
A0CUT2_PARTE/741-1109................................................KG.QFNDATPFA....................
Q583H5_TRYB2/724-1094................................................KG.GEVYATPFC....................
A2E7H8_TRIVA/712-1082..............................................PQNA.DEGDATPFC....................
RPO2_MIMIV/726-1093................................................KG.VYGDATPFT....................
E2RU19_GIAIC/792-1189................................................SG.HEVDGTAFN....................
Q4A245_EHV8U/685-1058................................................EG.ETQDGTPFT....................
C5WRS0_SORBI/754-1125................................................KG.TMRYATPFTT...................
Q8QUS6_ISKNN/596-957................................................GGGKGYDATAFN....................
Q4GZE8_TRYB2/675-1036................................................TG.KFGDGTAFG....................
Q5CPZ8_CRYPI/819-1197................................................DG.NYRYGTAFG....................
RPC2_MOUSE/668-1041................................................DG.RFHYGTAFG....................
F4KD38_ARATH/690-1065................................................CG.RFHYGSAFGE...................
A0D7M6_PARTE/655-1033................................................EG.KFKYGTAFG....................
Q236N3_TETTS/664-1046................................................SG.QFKYGTAFG....................
A8B2N4_GIAIC/763-1143................................................RG.EQTDGTCFR....................
Q4UB41_THEAN/766-1155................................................SG.NFVDSTPFS....................
A2E3T5_TRIVA/688-1052................................................TG.RIGNGTAFS....................
RPA2_DICDI/664-1031................................................HG.KFQDATAFQF...................
Q5AFK6_CANAL/675-1039................................................HG.IAQDSTPWKF...................
Q27493_CAEEL/649-1005................................................HG.ENYDASPFVF...................
Q5CSG7_CRYPI/759-1165................................................HGARSLDATPFNIN..................
F7A8L9_MACMU/29-389................................................HG.LCHDATPFIF...................
A8B827_GIAIC/683-1140................................................YA.DFVDSSPFQW...................
Q22C62_TETTS/684-1046................................................NG.NILETQPFQN...................
Q8II17_PLAF7/944-1400................................................YG.KRIDATPFRKYTQQKSFNNPWIDNCGIKG
Q4N2L4_THEPA/739-1128................................................YG.KPQDSTCFQAY..................
RPB2_ASFB7/782-1141................................................QG.VVTDGTAFL....................
RPOB_SALRD/696-1211................................................LG.VKYATPIFDG...................
R7EM77_9BACE/681-1194................................................LG.VKFATPIFDG...................
RPOB_UREPA/839-1300FGINEIIAKKLYENISNLIKHKQAKQAKDIDLIDVTIILKELGLSYDDIG.IKISTPVFDG...................
A5IZ53_MYCAP/720-1106................................................LG.CKFVTPVFDG...................
S5LVD1_9MOLU/753-1138................................................LG.IKVNTPVFEG...................
RPOB_DESOH/725-1286AVF....................NKEIPAAEIEAMSSARLCEFASEYKDG.VHMETPVFD....................
RPOB_GEOLS/853-1417RET...................YDNADFNKILDTMDREELLLVARRLSRG.VPMASPVFE....................
RPOB_LACDA/681-1067................................................LG.IHVATPVFDG...................
RPOB_DESAG/716-1278KTV...................FASDAISSEVDNMDDETFVRSVRRLRDG.IVTKTPVFDG...................
RPOB_SYNAS/719-1284KGI...................YQSREFEKFVDGATEEETYQFVRKLRRG.IAVSSPVFDG...................
R5KT32_9FIRM/702-1129................................................LG.FNIATPVFDG...................
D6Z3M9_DESAT/721-1284AVY....................SKEEYEQLLADLTDDDLLELASRMGKG.LHMATPVFDG...................
RPOB_NEOSM/713-1263EIY...................KNDRKMMARLNEMTDAEIVEYSRSLRGG.VPVAASVFEG...................
RPOB_EHRCR/741-1291FLYQ.................VYDGQDLKDNIQSMSDEDLLVFAERLRDG.VPMAAPVFEG...................
C4YYN1_9RICK/735-1292KKFL.................LELYGENINYVLERSEEEIISFCNKVSKG.VHFATPVFDG...................
RPOB_PARDP/741-1300EAMQN................GYGDDFYAETFEGMEDETLLEHADAVRGG.VPISTPVFDG...................
RPOB_PELUB/727-1287SSFLK...............SVYGKEVFDGGIEKLNKTEFSDLCENLQNG.IAISTPVFDG...................
RPOB_FUSNN/675-1063..............................................LNGG.TCIATPVFDG...................
RPOB_MAGSM/724-1281QFEE.................IYDNTRESAEIAALSDDQLVDMAKNLQYG.VPTATPVFDG...................
RPOB_PHOPR/717-1263QKVY.................DLGDTRQDVDIAALSDDQVHTLVQNLRDG.LPIATPVFDG...................
RPOB_FRATT/720-1276EEVY..................NSVGDKKVNLEALNDEEILTLCDNLKGG.VPIATPVFDG...................
RPOB_RUTMC/723-1282FLDE.................VYNSYGKQENLASFSDEEIIELASNLREG.VPMATPVFDG...................
D0IXK9_COMT2/725-1292EEI...................YNRSGRKEELSQLDDGEVMSMAKELTTG.VPFATPVFDG...................
R6A1S7_9ACTN/612-1033.........................................DSDKYVPGP.FFTATPVFDG...................
RPOB_KORVE/830-1399KQL...................FKDTAFVDHVTELDDEMLLKVAKGMQDG.VFFGSAVFDG...................
RPOB_THEMA/760-1174................................................TG.KWFATPVFEG...................
RPOB_DEIGD/619-1059................................................TG.QKFVTPVFDS...................
W8JR39_9CHLA/672-1182................................................AG.IYVKTPVFEG...................
RPOB_CORGL/631-1051...................................LVKTLPADLLEVPAG.SLTATPVFDG...................
RPOB_AQUAE/798-1374KEIFAIGD..........KDGENAKFIEEFLNSLSEEEFWSVVRDYAERG.IPMATPAFEG...................
RPOB_DEHM1/652-1123................................................LG.FRVATPVFDG...................
RPOB_RHOBA/666-1160................................................LG.FQALTPIFDG...................
RPOB_BORBU/669-1059................................................LG.ESYNVPVFES...................
RPOBC_HELPY/731-1296KMLEIAN............AINEKDPLTIHALENCSDEELLEYAKDWSKG.VKMAIPVFEG...................
RPOB_OSTTA/587-1008................................................LK.QNFKVLPFDEMH.................
W5A749_WHEAT/37-433................................................LK.KHYRIAPFDERY.................
RPOB_PHATC/876-1274................................................LN.ARFKILPFDEMY.................
RPOB_PLAF7/527-929.........................................SNNLNKNY..YNNYNHIFNYYK.................

PF04941

Q8B9K0_NPVR1/5-748--------------------------------HIALPICLYNNKVNKLKGKLVVGTKQSCLVKFTNSSDKNYVALDDGLV
Q6JP89_NPVNC/3-721--------------------------------NXNQPFVVYNLRSIILRG..ISTLNENEYFRITSNVENNVLNTLYGYK
Q91ES4_GVCPM/4-750--------------------------------HARLPIKIYHNKINRIKGK.VSGDNNE..FVYEKSGANNIIEVEGGNC

PF00562

Q74MN2_NANEQ/133-507........................................................................EEP.....
Q8TXI7_METKA/161-536..................................S....................................NPKE....A
A2SSM5_METLZ/137-540........................................................................KTQ.....
A5ULN7_METS3/135-507........................................................................TEL.....
A0RXX0_CENSY/644-1018........................................................................GEK.....
Q980R1_SULSO/176-547........................................................................KTP.....
Q8ZYQ9_PYRAE/658-1029................................VK.......................................E......
RPB2_IIV3/689-1053................................NS......................................NTI.....
RPB2_IIV6/724-1098..............................SLEKP.....................................QDK.....
A0CUT2_PARTE/741-1109........................................................................QIL.....
Q583H5_TRYB2/724-1094........................................................................SVV.....
A2E7H8_TRIVA/712-1082........................................................................GVT.....
RPO2_MIMIV/726-1093........................................................................SVD.....
E2RU19_GIAIC/792-1189..................................A....................................PPGS....T
Q4A245_EHV8U/685-1058........................................................................GNN.....
C5WRS0_SORBI/754-1125................................AS.......................................V......
Q8QUS6_ISKNN/596-957.................................S.......................................D......
Q4GZE8_TRYB2/675-1036........................................................................GDK.....
Q5CPZ8_CRYPI/819-1197........................................................................GTP.....
RPC2_MOUSE/668-1041........................................................................GSK.....
F4KD38_ARATH/690-1065................................RSGH...................................ADK......
A0D7M6_PARTE/655-1033........................................................................GEN.....
Q236N3_TETTS/664-1046........................................................................GDK.....
A8B2N4_GIAIC/763-1143..................................T....................................KTDET...F
Q4UB41_THEAN/766-1155..................................NSYSD............................NLCNDLNNTKTDN
A2E3T5_TRIVA/688-1052........................................................................SDR.....
RPA2_DICDI/664-1031................................DEN.....................................NTA.....
Q5AFK6_CANAL/675-1039................................NEQ.....................................DTP.....
Q27493_CAEEL/649-1005................................NED.....................................NTA.....
Q5CSG7_CRYPI/759-1165..............................ISDDLSRSEENC.......................EDDKAGEKTT.....
F7A8L9_MACMU/29-389................................SE.......................................ENS...A
A8B827_GIAIC/683-1140................................SDE.....................................RRA.....
Q22C62_TETTS/684-1046................................YQ.......................................DDD...I
Q8II17_PLAF7/944-1400FLEKNDTIKSDLDTCQKEKDKNKNINNNNNNKIKENKYNNSNDSNASIDSDDNTNNCNDKRDEEEKKANITYDEK.....
Q4N2L4_THEPA/739-1128..............................YSENPENGD............................EEMEEVDV.....
RPB2_ASFB7/782-1141........................................................................PIN.....
RPOB_SALRD/696-1211................................AS.......................................L......
R7EM77_9BACE/681-1194................................AS.......................................L......
RPOB_UREPA/839-1300................................AN.......................................H......
A5IZ53_MYCAP/720-1106................................VK.......................................K......
S5LVD1_9MOLU/753-1138................................VK.......................................E......
RPOB_DESOH/725-1286..................................G....................................AKE......
RPOB_GEOLS/853-1417..................................G....................................AGE......
RPOB_LACDA/681-1067................................AS.......................................E......
RPOB_DESAG/716-1278................................AT.......................................E......
RPOB_SYNAS/719-1284................................AT.......................................E......
R5KT32_9FIRM/702-1129................................AD.......................................E......
D6Z3M9_DESAT/721-1284................................AQ.......................................E......
RPOB_NEOSM/713-1263................................PK.......................................T......
RPOB_EHRCR/741-1291................................PK.......................................D......
C4YYN1_9RICK/735-1292................................AK.......................................V......
RPOB_PARDP/741-1300................................AK.......................................E......
RPOB_PELUB/727-1287................................AK.......................................E......
RPOB_FUSNN/675-1063................................AT.......................................E......
RPOB_MAGSM/724-1281................................AI.......................................E......
RPOB_PHOPR/717-1263................................AP.......................................E......
RPOB_FRATT/720-1276................................AK.......................................E......
RPOB_RUTMC/723-1282................................IK.......................................E......
D0IXK9_COMT2/725-1292................................AS.......................................E......
R6A1S7_9ACTN/612-1033................................AK.......................................E......
RPOB_KORVE/830-1399................................ST.......................................E......
RPOB_THEMA/760-1174................................AK.......................................E......
RPOB_DEIGD/619-1059................................AT.......................................E......
W8JR39_9CHLA/672-1182................................FP.......................................E......
RPOB_CORGL/631-1051................................AS.......................................N......
RPOB_AQUAE/798-1374................................AE.......................................E......
RPOB_DEHM1/652-1123................................AD.......................................D......
RPOB_RHOBA/666-1160................................AS.......................................E......
RPOB_BORBU/669-1059................................AT.......................................N......
RPOBC_HELPY/731-1296................................IS.......................................Q......
RPOB_OSTTA/587-1008.............................GAEVS.......................................R......
W5A749_WHEAT/37-433.............................EQEAS.......................................R......
RPOB_PHATC/876-1274.............................GLEIS.......................................R......
RPOB_PLAF7/527-929.............................YNYNN.......................................N......

PF04941

Q8B9K0_NPVR1/5-748LYMA-------------------------------GVLVT---------------------NAK-INW------------
Q6JP89_NPVNC/3-721LIGV-------------------------------CQITS---------------------QNA-INW------------
Q91ES4_GVCPM/4-750LCMF-------------------------------GTLLC---------------------NNK-INW------------

PF00562

Q74MN2_NANEQ/133-507VEDL...............................RKQLL.....................RLG.FRE............
Q8TXI7_METKA/161-536YEEI...............................KKMLR.....................ELG.FEP............
A2SSM5_METLZ/137-540VEKIFDSSFAQNRLLNDKEIGKDVKSSTLTREQVLRHQLA.....................EAG.FAH............
A5ULN7_METS3/135-507EKEI...............................KQQLK.....................NHG.FES............
A0RXX0_CENSY/644-1018MEEV...............................REVMD.....................TAG.FKY............
Q980R1_SULSO/176-547IEQL...............................QNEIL.....................RYG.YLP............
Q8ZYQ9_PYRAE/658-1029.EDL...............................RKLLL.....................KLG.YKW............
RPB2_IIV3/689-1053LKEL...............................CHHLK.....................LNG.FDP............
RPB2_IIV6/724-1098IHAL...............................CKELE.....................ECG.YNY............
A0CUT2_PARTE/741-1109VNDI...............................ANELH.....................KVG.WQK............
Q583H5_TRYB2/724-1094VEDF...............................GKALT.....................QLK.LNR............
A2E7H8_TRIVA/712-1082VDAI...............................AKRLQ.....................DAG.FEK............
RPO2_MIMIV/726-1093LNAI...............................NDELV.....................AAG.YEE............
E2RU19_GIAIC/792-1189DKQI...............................AADLH.....................ARG.YQK............
Q4A245_EHV8U/685-1058IELI...............................ADRLE.....................THG.MQR............
C5WRS0_SORBI/754-1125.DVI...............................AEQLH.....................RAG.YSR............
Q8QUS6_ISKNN/596-957GADL...............................LKTLE.....................ELG.Y..............
Q4GZE8_TRYB2/675-1036AEDL...............................GEELI.....................RHG.YNY............
Q5CPZ8_CRYPI/819-1197LEES...............................AKCLV.....................EHG.FHY............
RPC2_MOUSE/668-1041VKDV...............................CEDLV.....................RHG.YNY............
F4KD38_ARATH/690-1065VETI...............................SATLV.....................EKG.FSY............
A0D7M6_PARTE/655-1033VLQV...............................GEELL.....................KRG.FHY............
Q236N3_TETTS/664-1046MADL...............................SSILV.....................QNG.FSY............
A8B2N4_GIAIC/763-1143LAEL...............................YDSLR.....................VAG.FSY............
Q4UB41_THEAN/766-1155MSDI...............................CNILI.....................KNG.FHP............
A2E3T5_TRIVA/688-1052VKDI...............................ADDLI.....................AAG.YSY............
RPA2_DICDI/664-1031IDFF...............................GEQLA.....................KAG.FNR............
Q5AFK6_CANAL/675-1039ADYF...............................GEQLL.....................KAG.YNY............
Q27493_CAEEL/649-1005INHF...............................GELLT.....................KAG.YNY............
Q5CSG7_CRYPI/759-1165VDYF...............................GKALE.....................RAG.FQY............
F7A8L9_MACMU/29-389LEYF...............................GEMLK.....................AAG.YNF............
A8B827_GIAIC/683-1140IDVF...............................GEQLL.....................KTGQFNR............
Q22C62_TETTS/684-1046VNYF...............................GKQLQ.....................SHG.YNY............
Q8II17_PLAF7/944-1400IDYF...............................AKLLL.....................NKG.YDY............
Q4N2L4_THEPA/739-1128VDYF...............................GKSLI.....................KSG.YEY............
RPB2_ASFB7/782-1141VQLL...............................SERLA.....................QEG.LRF............
RPOB_SALRD/696-1211.EDV...............................GDELE.....................K.....AGL..........
R7EM77_9BACE/681-1194.DDL...............................NEWTD.....................KAG.LPR............
RPOB_UREPA/839-1300.DDI...............................VSIMN.....................E.....ANID.........
A5IZ53_MYCAP/720-1106.EAI...............................QDVIS.....................EAG.LPL............
S5LVD1_9MOLU/753-1138.QEL...............................QDIMV.....................EAG.MDN............
RPOB_DESOH/725-1286.AEI...............................KALLK.....................EGG.ADE............
RPOB_GEOLS/853-1417.AKI...............................KELLT.....................RAG.FAT............
RPOB_LACDA/681-1067.DDV...............................WDFVR.....................E.....AGV..........
RPOB_DESAG/716-1278.EQI...............................WSWME.....................Q.....AGL..........
RPOB_SYNAS/719-1284.SDI...............................RNMLK.....................L.....ANL..........
R5KT32_9FIRM/702-1129.YDI...............................MDTLE.....................LANDY.ANTEWEDFQAKYK
D6Z3M9_DESAT/721-1284.EEI...............................RRLLV.....................EAG.LDE............
RPOB_NEOSM/713-1263.DEI...............................ERLLV.....................L.....AGK..........
RPOB_EHRCR/741-1291.SQI...............................SNLLR.....................LAD.LDV............
C4YYN1_9RICK/735-1292.QDV...............................KDMLK.....................LAG.QDP............
RPOB_PARDP/741-1300.ADI...............................NDALR.....................R.....AGF..........
RPOB_PELUB/727-1287.KDV...............................SEMLE.....................L.....AKL..........
RPOB_FUSNN/675-1063.EQV...............................KDYLE.....................K.....QGY..........
RPOB_MAGSM/724-1281.SDI...............................SSWLN.....................K.....AGL..........
RPOB_PHOPR/717-1263.SSI...............................KELLK.....................L.....GDL..........
RPOB_FRATT/720-1276.EDI...............................KSLLK.....................IGG.FAT............
RPOB_RUTMC/723-1282.KDI...............................KSLLK.....................L.....ADL..........
D0IXK9_COMT2/725-1292.AEI...............................KDMLK.....................LAY.PDDIAAAK.......
R6A1S7_9ACTN/612-1033.DEI...............................AEVIR.....................RAN.KNMLNKATAAFGDH.
RPOB_KORVE/830-1399.AEI...............................KSLLD.....................Q.....AGL..........
RPOB_THEMA/760-1174.DEI...............................LRPLY.....................EER.KKRGLHLG.......
RPOB_DEIGD/619-1059.EAI...............................KEMLEVAAAERLQRRKDEGFELDKREQEVLDRAGKLGVISPPNG.
W8JR39_9CHLA/672-1182.SRI...............................WDMMI.....................EQG.LPA............
RPOB_CORGL/631-1051.EEL...............................AGLLA.....................NSR.PNRDGDV........
RPOB_AQUAE/798-1374.DAI...............................KELLK.....................K.....AGL..........
RPOB_DEHM1/652-1123.TAI...............................EDALA.....................RSW.LSAKAGATDMSPENK
RPOB_RHOBA/666-1160.SEI...............................NDCLA.....................E.....AGL..........
RPOB_BORBU/669-1059.EQI...............................QEKLK.....................TAG.FNP............
RPOBC_HELPY/731-1296.EKF...............................YKLFE.....................L.....AKI..........
RPOB_OSTTA/587-1008.GFV...............................YHYLY.....................K.....SRLLTQQK.....
W5A749_WHEAT/37-433.KLV...............................FSELY..........................EASKETKNP.....
RPOB_PHATC/876-1274.ILI...............................NKKLR.....................Q.....ASIAKNES.....
RPOB_PLAF7/527-929.FNI...............................NSKMS.....................YNY................

PF04941

Q8B9K0_NPVR1/5-748-----------------------------------------------------------------------VYDGRRYKI
Q6JP89_NPVNC/3-721-----------------------------------------------------------------------NTLGKKIKI
Q91ES4_GVCPM/4-750-----------------------------------------------------------------------NHDGKKYKI

PF00562

Q74MN2_NANEQ/133-507.........................................................................DGTETMY
Q8TXI7_METKA/161-536.........................................................................TGKEVMY
A2SSM5_METLZ/137-540.........................................................................TGREVMY
A5ULN7_METS3/135-507.........................................................................AGCESLY
A0RXX0_CENSY/644-1018.........................................................................SGKEIMY
Q980R1_SULSO/176-547.........................................................................DATEVVY
Q8ZYQ9_PYRAE/658-1029.........................................................................DGKEVMY
RPB2_IIV3/689-1053.........................................................................SGSEVMY
RPB2_IIV6/724-1098.........................................................................NGTETMM
A0CUT2_PARTE/741-1109.........................................................................WGNEVMT
Q583H5_TRYB2/724-1094.........................................................................YGNERLY
A2E7H8_TRIVA/712-1082.........................................................................YGNETLY
RPO2_MIMIV/726-1093.........................................................................WGNETMY
E2RU19_GIAIC/792-1189.........................................................................HNYEAMM
Q4A245_EHV8U/685-1058.........................................................................YGNEMLY
C5WRS0_SORBI/754-1125.........................................................................WGTENVL
Q8QUS6_ISKNN/596-957..........................................................................AKQVMY
Q4GZE8_TRYB2/675-1036.........................................................................HGKDIFY
Q5CPZ8_CRYPI/819-1197.........................................................................SGKEYLT
RPC2_MOUSE/668-1041.........................................................................LGKDYVT
F4KD38_ARATH/690-1065.........................................................................SGKDLLY
A0D7M6_PARTE/655-1033.........................................................................QGKDCLI
Q236N3_TETTS/664-1046.........................................................................TGKDVII
A8B2N4_GIAIC/763-1143.........................................................................SGKDVLY
Q4UB41_THEAN/766-1155.........................................................................KGKEILY
A2E3T5_TRIVA/688-1052.........................................................................SGKDMLM
RPA2_DICDI/664-1031.........................................................................FGNEQMY
Q5AFK6_CANAL/675-1039.........................................................................HGNEPMY
Q27493_CAEEL/649-1005.........................................................................YGNETFY
Q5CSG7_CRYPI/759-1165.........................................................................YGCEPLY
F7A8L9_MACMU/29-389.........................................................................YGTERLY
A8B827_GIAIC/683-1140.........................................................................YGSEVMY
Q22C62_TETTS/684-1046.........................................................................YGNEVMY
Q8II17_PLAF7/944-1400.........................................................................YGTELLY
Q4N2L4_THEPA/739-1128.........................................................................YGTESMY
RPB2_ASFB7/782-1141.........................................................................NGCQKMF
RPOB_SALRD/696-1211.......................................................................PRDGKVQLY
R7EM77_9BACE/681-1194.........................................................................YGKTTLY
RPOB_UREPA/839-1300.....................................................................IENNKGKQVLY
A5IZ53_MYCAP/720-1106.........................................................................SGKQTLI
S5LVD1_9MOLU/753-1138.........................................................................YGKVTLI
RPOB_DESOH/725-1286.........................................................................TGQAILY
RPOB_GEOLS/853-1417.........................................................................NGQVTLF
RPOB_LACDA/681-1067.......................................................................DSDGKTVLY
RPOB_DESAG/716-1278.......................................................................ANDGKTELY
RPOB_SYNAS/719-1284.......................................................................PSTGQAILY
R5KT32_9FIRM/702-1129DTLRPEVM.............................................EYLGEHLDHRDEWRGVPINRDGKVRLR
D6Z3M9_DESAT/721-1284.........................................................................IGQLDLY
RPOB_NEOSM/713-1263.......................................................................DPSGQEVLY
RPOB_EHRCR/741-1291.........................................................................SGQVDLY
C4YYN1_9RICK/735-1292.........................................................................SGQVKLI
RPOB_PARDP/741-1300.......................................................................DTSGQSIVF
RPOB_PELUB/727-1287.......................................................................PTSGQTNLW
RPOB_FUSNN/675-1063.......................................................................PRTGKVTLY
RPOB_MAGSM/724-1281.......................................................................PTSGQIQLI
RPOB_PHOPR/717-1263.......................................................................PESGQLKMF
RPOB_FRATT/720-1276.........................................................................NGQMKLF
RPOB_RUTMC/723-1282.......................................................................PESGQEQLY
D0IXK9_COMT2/725-1292....................................................................GLTETRTQAYLY
R6A1S7_9ACTN/612-1033..............................................................MRPEFVTQLDERGKTRLF
RPOB_KORVE/830-1399.......................................................................PTSGKTFLY
RPOB_THEMA/760-1174...................................................................DDENNPNGKVVLR
RPOB_DEIGD/619-1059..............................................................DYAAAQMQLARTGKSVLY
W8JR39_9CHLA/672-1182.........................................................................DGKSYLY
RPOB_CORGL/631-1051.....................................................................MVNADGKATLI
RPOB_AQUAE/798-1374.......................................................................PENGKTTLY
RPOB_DEHM1/652-1123RPSTDTAKAVEWIKQQGFDGKKVFDERHPGLAKEVSLKLWLKDMGVDASSLSGAELEKKAYEVSSQSRLPSPIVGKSVLR
RPOB_RHOBA/666-1160.......................................................................PAHGKIRLT
RPOB_BORBU/669-1059.........................................................................TSKEILY
RPOBC_HELPY/731-1296.......................................................................AMDGKMDLY
RPOB_OSTTA/587-1008..................................................................WLFKPNSPGKSIVF
W5A749_WHEAT/37-433..................................................................WVFEPEYPGKSRIF
RPOB_PHATC/876-1274..................................................................WLFNPYAPGKMVLI
RPOB_PLAF7/527-929..........................................................................NKYYLK

PF04941

Q8B9K0_NPVR1/5-748ETCTNGNF--NVYKVYVYFRQ...IKNQKI....EKLDASMVVN.GDNVMLKIVIVT-STNDLE--GIKICGIHGQKGVF
Q6JP89_NPVNC/3-721TSLRSKNM--YIYKIMMYFHNNFDIRSLKVKCEFEKINKEYI........VKIRHVF-EYKDCV--GIKICSVHGQKGVL
Q91ES4_GVCPM/4-750EFCTSKQW--CVYKFYMYFRK...VGGQVV....ERVDSEMTTDESGSVFVKLEMVY-SVSDLE--GLKICGVHGQKGVL

PF00562

Q74MN2_NANEQ/133-507DPITGEEYKVKIFVGVMWYHK---LKFLAA----NKL-----------------HAR.ARGPMA..ILTRQPTEGKSR--
Q8TXI7_METKA/161-536DGRTGQKLEAEVFIGVCLYRK---LYHMVK----DKY-----------------HAR.SRGPVQ..VLTRQPTEGRAR--
A2SSM5_METLZ/137-540DGITGRRFQADIYIGVIYYQK---LYHMVS----TKM-----------------HAR.SRGPVQ..VLTRQPTEGRAR--
A5ULN7_METS3/135-507NGVTGERIEAEIFVGVAYYQK---LHHMTT----DKV-----------------YAR.SRGPVQ..VLTRQPTEGRAR--
A0RXX0_CENSY/644-1018DGRTGKAFPVEVFIGVVYYQK---LHHMVA----DKI-----------------HAR.ARGQVQ..MLTKQPTEGRAR--
Q980R1_SULSO/176-547DGRTGQKIKSRIYFGVVYYQK---LHHMVA----DKL-----------------HAR.ARGPVQ..ILTRQPTEGRAR--
Q8ZYQ9_PYRAE/658-1029SGITGERLVADIFIGIVYYQK---LHHMVA----DKI-----------------HAR.ARGPVQ..ILTRQPTEGRSR--
RPB2_IIV3/689-1053SGFTGERIQSTIFMGPTYYHR---LKHMVK----DKM-----------------HAR.SHGQVT..TLHRQPNCGRSQ--
RPB2_IIV6/724-1098CGWNGKKLRAEIFFGPVYYHR---LTHMVS----DKI-----------------FSR.ASTNQKRHAITRQPLNGRAN--
A0CUT2_PARTE/741-1109NPYTGNMFSIPIFVGPTYYQR---LRHLVD----DKM-----------------YAR.SRGPVT..GITRQPTHGRSR--
Q583H5_TRYB2/724-1094NGHTGLPLDHLIFFGPTYYQR---LKHLSS----DKI-----------------HAR.PRGPLQ..PLVRQPTEGRAH--
A2E7H8_TRIVA/712-1082NGRSGKRLKAKIYFGPTYYQR---LKHMVG----DKA-----------------HAR.ALGRKS..LILRQPVDGRAR--
RPO2_MIMIV/726-1093NGMNGKKLPVKIFIGPTYYQR---LKQMVG----DKA-----------------HSR.ARGPTQ..LLTRQAPEGRSR--
E2RU19_GIAIC/792-1189NGMTGEMMTYRIFIGPTFYQR---LKHMVL----DKI-----------------SSR.NTGPIV..TLTRQPNEGRSN--
Q4A245_EHV8U/685-1058NGMSGEMLESMIFIAPCYYQR---LKHMVV----DKS-----------------HAR.NRGAQQ..LLTRAPTEGRSR--
C5WRS0_SORBI/754-1125NGRTGERMQSLIFMGPTFYQR---LIHMSE----DKV-----------------KFR.NTGPVH..PLTRQPVADRKR--
Q8QUS6_ISKNN/596-957CGRTGRRFESLVFMAPCPYQK---LKHLVA----NKV-----------------HAR.TTGPVD..PLTRQPVAGRSR--
Q4GZE8_TRYB2/675-1036SGVTGEMLRAYVFFGPIYYQR---LKHMVT----DKM-----------------HAR.ATGPRS..MLTRQPTEGRSR--
Q5CPZ8_CRYPI/819-1197SGTTGEAIEAYIFVGPIYYQK---LKHMVL----DKM-----------------HAR.GRGPRQ..ILTRQPTEGRSK--
RPC2_MOUSE/668-1041SGITGEPLEAYIYFGPVYYQK---LKHMVL----DKM-----------------HAR.ARGPRA..VLTRQPTEGRSR--
F4KD38_ARATH/690-1065SGISGEPVEAYIFMGPIYYQK---LKHMVL----DKM-----------------HAR.GSGPRV..MMTRQPTEGKSK--
A0D7M6_PARTE/655-1033SGITGEYMECYVYQGPIFYQR---LKHMVI----DKI-----------------HAR.AKGPME..KLTRQPVEGRAK--
Q236N3_TETTS/664-1046SGITGEYMQCYVFCGPVFYQR---LKHMVA----DKV-----------------HAR.AKGRVT..TLTRQPTEGRAK--
A8B2N4_GIAIC/763-1143SGLTGDVIPVYIFNGPIYYQK---LKHMVK----DKI-----------------HSR.GTGPIT..MLTRQPTEGRRV--
Q4UB41_THEAN/766-1155SGISGNPINTLIFIGPIYYQR---LKHMVT----DKI-----------------HAR.GRGPRQ..PITRQPTEGRSR--
A2E3T5_TRIVA/688-1052SGITGEPLYAYIFFGPVFYQS---LKHMVK----DKM-----------------QAR.ATGQVQ..YLTRQPTQGRSR--
RPA2_DICDI/664-1031SGTTGKEFECEIFFGVCYYQR---LRHMVK----DKY-----------------QVR.ALGKVN..ALTRQPIKGRKV--
Q5AFK6_CANAL/675-1039SGATGEELRCDIYIGCVYYQR---LRHMVN----DKF-----------------QVR.STGPVN..SLTMQPVKGRKR--
Q27493_CAEEL/649-1005SGVDGRQMEMQIFFGIVYYQR---LRHMIA----DKF-----------------QVR.ATGPID..PITHQPVKGRKK--
Q5CSG7_CRYPI/759-1165NGMTGVELPCHIFMGVIYYQR---LRHMVA----DKA-----------------QVR.ATGPID..ALTRQPVKGRKR--
F7A8L9_MACMU/29-389SGISGLELEADIFIGVVYYQR---LRHMVS----DKF-----------------QVR.TTGARD..RVTNQPIGGRN.--
A8B827_GIAIC/683-1140SAITGDPMPADIFIGVVYYQR---LRHMVS----DKY-----------------QVR.AEGPSD..KITKQPIKGRKR--
Q22C62_TETTS/684-1046SGTYGCMMKVDIYMGIVYYQR---LRHMVS----DKA-----------------QAR.STGPVD..MLTQQPIKGRKR--
Q8II17_PLAF7/944-1400SGIYGVPLQAHIFIGVIYYQR---LRHMAY----DKA-----------------QVR.RTGPVC..NLTHQPLKGKRK--
Q4N2L4_THEPA/739-1128CGTLGTEIQTHIFVGLIYYQR---LRHMVS----DKA-----------------QVR.STGPVD..TITKQPVKGRKN--
RPB2_ASFB7/782-1141NGQTGEYFDAAIFIGPTYHQR---LQKFVL----DDR-----------------YAVASYGPTD..ALTGQPLDGKRS--
RPOB_SALRD/696-1211DGRTGEPFDEKTTVGQIYMMK---LEHLVE----DKM-----------------HAR.SIGPYS..LITQQPLGGKAQ--
R7EM77_9BACE/681-1194DGGTGEAFEQQATVGVTYMLK---LGHMVE----DKM-----------------HAR.SIGPYS..LITQQPLGGKAQ--
RPOB_UREPA/839-1300DGRTGEPFDGLISVGLTYMLK---LDHMVD----DKI-----------------HSR.SVGPYS..KITQQPLGGKSQ--
A5IZ53_MYCAP/720-1106DPITGEKFDNPVSVGVMYMFK---LNHMVD----DKM-----------------YAR.SVGPYS..LITQQPLGGKSQ--
S5LVD1_9MOLU/753-1138DGKTGEAFDKPISVGVMYMLK---LSHMVD----DKL-----------------HTR.NIGPYS..LITQQPLGGKAQ--
RPOB_DESOH/725-1286DGRTGQPFDERITVGTMYMLK---LHHLVD----DKL-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
RPOB_GEOLS/853-1417DGRTGEPFKHKVTVGIMYVLK---LHHLVD----DKI-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
RPOB_LACDA/681-1067DGRTGEPFHNRVSVGVMYYLK---LTHMVD----DKI-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
RPOB_DESAG/716-1278DGRTGVRFHNRVTTGVMYILK---LHHLVD----EKI-----------------HAR.STGPYS..LVTQQPLGGKAQ--
RPOB_SYNAS/719-1284DGRTGEPFDQEITVGMIYMLK---LHHLVD----NKI-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
R5KT32_9FIRM/702-1129DGRTGEYFDSPVTIGFMHYLK---LHHLVD----DKI-----------------HAR.STGPYS..LVTQQPLGGKAQ--
D6Z3M9_DESAT/721-1284DGLTGEKFDNQVTVGSMYMLK---LHHLVD----DKI-----------------HAR.STGPYS..LVTQQPLGGKAQ--
RPOB_NEOSM/713-1263DGVTGEKFDRKVTVGCKYMLK---LHHLVN----DKI-----------------HAR.SIGSYS..LITQQPLGGKSH--
RPOB_EHRCR/741-1291DGRIGEKFDRKVTVGYIYMLK---LHHLVD----DKI-----------------HAR.SVGPYG..LVTQQPLGGKS.--
C4YYN1_9RICK/735-1292DGRTGEYFDRLVTVGQKYLLK---LHHLVD----NKI-----------------HSR.SIGPYS..LVTQQPLGGKS.--
RPOB_PARDP/741-1300DGRTGEQFARPVTVGMKYVLK---LHHLVD----DKM-----------------HAR.STGPYS..LVTQQPLGGKAQ--
RPOB_PELUB/727-1287DGRTGEMFDRPVTVGIIYMLK---LHHLVE----DKI-----------------HAR.STGPYS..LVTQQPLGGKAQ--
RPOB_FUSNN/675-1063DGRTGEKFDNKVTVGIMYMLK---LHHLVE----DKM-----------------HAR.AIGPYS..LVTQQPLGGKAQ--
RPOB_MAGSM/724-1281DGRTGEPFDRHVTVGYIYMLK---LHHLVD----DKI-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
RPOB_PHOPR/717-1263DGRTGDMFERPVTVGYMYMLK---LNHLVD----DKM-----------------HAR.STGSYS..LVTQQPLGGKAQ--
RPOB_FRATT/720-1276DGRTGKPFDRHVTVGYMYMLK---LDHLVD----DKM-----------------HAR.STGSYS..LVTQQPLGGKAQ--
RPOB_RUTMC/723-1282DGRTGEPFDRHVTVGYMHMLK---LNHLVN----DKM-----------------HAR.STGPYS..LVTQQPLSGKAQ--
D0IXK9_COMT2/725-1292DGRTGERFERPTTVGYMHYLK---LHHLVD----DKM-----------------HAR.STGPYS..LVTQQPLGGKAQ--
R6A1S7_9ACTN/612-1033DGRTGEEFREPITVGTSYILK---LGHMVD----DKI-----------------HAR.STGPYS..LVTQQPLGGKAQ--
RPOB_KORVE/830-1399DGMTGDRFEQPVTVGYIYMLK---LSHLVD----DKI-----------------HAR.SIGPYS..LITQQPLGGKAQ--
RPOB_THEMA/760-1174DGRTGEPFDNPVVVGYMYMLK---LIHIAK----EKI-----------------HAR.STGPYS..LIHQQPLGGKS.--
RPOB_DEIGD/619-1059DGRTGEPISGPVVVGTMYVMK---LYHMVE----DKL-----------------HAR.STGPYS..LITQQPLGGKAQ--
W8JR39_9CHLA/672-1182DGKTGERFDNTVVIGYIYMLK---LSHLIA----DKI-----------------HAR.SIGPYS..LVTQQPLGGKAQ--
RPOB_CORGL/631-1051DGRSGEPYPYPVSIGYMYMLK---LHHLVD----EKI-----------------HAR.STGPYS..MITQQPLGGKAQ--
RPOB_AQUAE/798-1374DGRTGEPFDFEVTVGYMHMLK---LIHMVD----DKI-----------------HAR.ATGPYS..LVTQQPLGGRAQ--
RPOB_DEHM1/652-1123DGRTGETFDQPVTVGNMYILK---LIHLVE----DKV-----------------HAR.ATGPYS..LISQQPLGGKAQ--
RPOB_RHOBA/666-1160DGRTGEPMEQETTVGYIYMLK---LHHLVD----DKV-----------------HAR.STGPYS..LITQQPLGGKAR--
RPOB_BORBU/669-1059DGYTGEPFENEVMVGVIYMLK---LHHLVD----DKM-----------------HAR.STGPYS..LVSQQPLGGKAQ--
RPOBC_HELPY/731-1296DGRTGEKMRERVNVGYMYMIK---LHHLVD----EKV-----------------HAR.STGPYS..LVTHQPVGGKAL--
RPOB_OSTTA/587-1008DGRTGLNFDQPVTVGYPYILK---LVHLVD----DKI-----------------HAR.STGPYS..LVTQQPLGGRSK--
W5A749_WHEAT/37-433DGRTGDPFEQPVLIGKSYILK---LIHQVD----EKI-----------------HGR.STGPYS..LVTQQPVRGRAK--
RPOB_PHATC/876-1274DGRTGKEFENPVTVGNAYMLK---LIHLVD----DKM-----------------HAR.ATGPYS..LITQQPLRGKAQ--
RPOB_PLAF7/527-929NPFTGNMINNSICLNNIYYYK---LIHMIK----DKF-----------------RYR.FIGLYS..ELTQQPIKGNTK--

PF04941

Q8B9K0_NPVR1/5-748NRSEDLTEWMAEDG
Q6JP89_NPVNC/3-721NIASDLNCWISEDG
Q91ES4_GVCPM/4-750HQAEDLSRFVAEDD

PF00562

Q74MN2_NANEQ/133-507--------------
Q8TXI7_METKA/161-536--------------
A2SSM5_METLZ/137-540--------------
A5ULN7_METS3/135-507--------------
A0RXX0_CENSY/644-1018--------------
Q980R1_SULSO/176-547--------------
Q8ZYQ9_PYRAE/658-1029--------------
RPB2_IIV3/689-1053--------------
RPB2_IIV6/724-1098--------------
A0CUT2_PARTE/741-1109--------------
Q583H5_TRYB2/724-1094--------------
A2E7H8_TRIVA/712-1082--------------
RPO2_MIMIV/726-1093--------------
E2RU19_GIAIC/792-1189--------------
Q4A245_EHV8U/685-1058--------------
C5WRS0_SORBI/754-1125--------------
Q8QUS6_ISKNN/596-957--------------
Q4GZE8_TRYB2/675-1036--------------
Q5CPZ8_CRYPI/819-1197--------------
RPC2_MOUSE/668-1041--------------
F4KD38_ARATH/690-1065--------------
A0D7M6_PARTE/655-1033--------------
Q236N3_TETTS/664-1046--------------
A8B2N4_GIAIC/763-1143--------------
Q4UB41_THEAN/766-1155--------------
A2E3T5_TRIVA/688-1052--------------
RPA2_DICDI/664-1031--------------
Q5AFK6_CANAL/675-1039--------------
Q27493_CAEEL/649-1005--------------
Q5CSG7_CRYPI/759-1165--------------
F7A8L9_MACMU/29-389--------------
A8B827_GIAIC/683-1140--------------
Q22C62_TETTS/684-1046--------------
Q8II17_PLAF7/944-1400--------------
Q4N2L4_THEPA/739-1128--------------
RPB2_ASFB7/782-1141--------------
RPOB_SALRD/696-1211--------------
R7EM77_9BACE/681-1194--------------
RPOB_UREPA/839-1300--------------
A5IZ53_MYCAP/720-1106--------------
S5LVD1_9MOLU/753-1138--------------
RPOB_DESOH/725-1286--------------
RPOB_GEOLS/853-1417--------------
RPOB_LACDA/681-1067--------------
RPOB_DESAG/716-1278--------------
RPOB_SYNAS/719-1284--------------
R5KT32_9FIRM/702-1129--------------
D6Z3M9_DESAT/721-1284--------------
RPOB_NEOSM/713-1263--------------
RPOB_EHRCR/741-1291--------------
C4YYN1_9RICK/735-1292--------------
RPOB_PARDP/741-1300--------------
RPOB_PELUB/727-1287--------------
RPOB_FUSNN/675-1063--------------
RPOB_MAGSM/724-1281--------------
RPOB_PHOPR/717-1263--------------
RPOB_FRATT/720-1276--------------
RPOB_RUTMC/723-1282--------------
D0IXK9_COMT2/725-1292--------------
R6A1S7_9ACTN/612-1033--------------
RPOB_KORVE/830-1399--------------
RPOB_THEMA/760-1174--------------
RPOB_DEIGD/619-1059--------------
W8JR39_9CHLA/672-1182--------------
RPOB_CORGL/631-1051--------------
RPOB_AQUAE/798-1374--------------
RPOB_DEHM1/652-1123--------------
RPOB_RHOBA/666-1160--------------
RPOB_BORBU/669-1059--------------
RPOBC_HELPY/731-1296--------------
RPOB_OSTTA/587-1008--------------
W5A749_WHEAT/37-433--------------
RPOB_PHATC/876-1274--------------
RPOB_PLAF7/527-929--------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window