Sequence alignment for CL0410

PF04941

Q8B9K0_NPVR1/5-748VQDFNELYDRIENKYK--------------------LKYIFDC-ATNNNEPMLFCA---------IQERKSYLCCALNEQ
Q6JP89_NPVNC/3-721VKDFNFLYQKLCNRNE--------------------I-YVLNCKHKRKNVPNIDQL---------INQKKSYVCCLYNEV
Q91ES4_GVCPM/4-750ITDFNNLYTHLAHTYN--------------------LDYQLSC-HHHNNTPL---A---------MANIKTYFCCAVSVP

PF00562

F7A8L9_MACMU/487-847IANFIPFSDHNQSPRN-----------------------MYQC--QMGKQTMG------------FPLLTYQDRSDNK-L
Q74MN2_NANEQ/133-507LSAAVPYARFNQSARL-----------------------NRGE--RTQRQALG------------LYSVAYPLRFESD-V
Q8TXI7_METKA/161-536CCSCIPWPESNSAPRN-----------------------TMGT--NMTRQALG------------FYAANHPIRMESR-G
A2SSM5_METLZ/137-540GAAHVPFPEHNASPRV-----------------------TMGA--GMIKQALG------------FAQANMKLRPDTR-G
A0RXX0_CENSY/644-1018GASIIPYPEHNQSPRN-----------------------TYES--AMAKQSLG------------FSTPMMNTSTYVR-Q
Q980R1_SACS2/176-547TASIIPYPEHNQSPRN-----------------------TYQS--AMAKQALG------------LYAANYQLRTDTR-A
Q8ZYQ9_PYRAE/658-1029IASIIPYIEHNQSPRN-----------------------QYEA--AMAKQSLG------------LPQSNFLYKLDSR-G
RPB2_IIV3/689-1053VAGIIPFPDRTQSARN-----------------------CFYS--SMVKQAIG------------FVPC-HNLKTETV-S
RPB2_IIV6/724-1098MAAQIPFAEHTQSPRL-----------------------CYQS--SMAKQAIG------------NIPS-HHVKSDNT-T
A0CUT2_PARTE/741-1109CASVIPFANHNQGPRN-----------------------TLQS--AMGKQAMG------------LNSTNFNIRFDTL-V
Q583H5_TRYB2/724-1094CASIIPYPNHNQSPRN-----------------------TYQS--AMGKQAMG------------IYASNFNMRMDTT-A
A2E7H8_TRIVA/712-1082CGTIIPFPDHNQSPRN-----------------------TYQC--AMGKQAIG------------LYTTNYMIRMDSS-S
RPO2_MIMIV/726-1093ISSNIPFPDHNQSPRG-----------------------IFQY--NQARQAMG------------LYISDYRERTDIS--
E2RU19_GIAIC/792-1189ITSLIPFPDHNQSPRN-----------------------LYQA--SMGKQAVG------------IYALNYLKRFDTSGI
Q4A245_EHV8U/685-1058CVSQIPFCDHNQSPRI-----------------------AYQA--AQCKQAIG------------LYTTNFAERLDTV-G
C5WRS0_SORBI/754-1125-CGIIPFANHNFARRV-----------------------LYQS-EKHSQQAIG------------YSTTNPHIRVDTL-S
Q8QUS6_ISKNN/596-957MSAVIPFYNHTQSPRN-----------------------AYQS--NMGKQAVG------------LPCLNYMSRWDVT-L
Q4GZE8_TRYB2/675-1036VAGIIPFPHHNQSARN-----------------------TFQS--AMGKQALG------------TIAYNQYIRMDTV-L
Q5CPZ8_CRYPI/819-1197VSGLIPYPNHNQSPRN-----------------------TYQC--AMGKQVMG------------SVGFNQFLRCDSV-L
RPC2_MOUSE/668-1041CAGLIPYPHHNQSPRN-----------------------TYQC--AMGKQAMG------------TIGYNQRNRIDTL-M
NRPC2_ARATH/690-1065VAGLIPYPHHNQSPRN-----------------------TYQC--AMGKQAMG------------NIAYNQLNRMDTL-L
A0D7M6_PARTE/655-1033VTGLVPFPHHNQSARN-----------------------TFQC--QMGKQSLG------------IIGMNTQIRCDTQ-L
Q236N3_TETTS/664-1046VSGLVPYPHHNQASRN-----------------------TFQC--AMGKQALG------------IIGSTSMNRVDTI-L
A8B2N4_GIAIC/763-1143VVGLIPYPHHNQSPRN-----------------------CYQC--SMGKQASG------------AIAFNQLERFETA-M
Q4UB41_THEAN/766-1155VAGLIPFPNHNQSPRN-----------------------TYQC--AMGKQSIG------------SIGYNQLQRCDTV-V
A2E3T5_TRIVA/688-1052CAGVVPCPHHNQSPRN-----------------------TYQC--AMGKQAIG------------PTALNIMHRVDKS-T
RPA2_DICDI/664-1031LANLTPFSDYNQSPRN-----------------------MYQC--QMAKQTMG------------TPLHSYPFRTDNK-L
A0A1D8PQM4_CANAL/675-1039LANLTPFSDFNQSPRN-----------------------MYQC--QMGKQTMG------------TPGTALVHRSDNK-L
Q27493_CAEEL/649-1005AGNLIPFPDHNQSPRN-----------------------VYQC--QMGKQTMG------------TAVHAWHSRADNK-M
Q5CSG7_CRYPI/759-1165TASLIPYAHHNQSPRN-----------------------MYQC--QMLKQTMG------------TPCLNHPYRTDNK-M
A8B827_GIAIC/683-1140LGLLVPFSDHNQSPRN-----------------------MYEC--QMLKQTMG------------IPCRNLAYKYDTK-S
Q22C62_TETTS/684-1046LPSQIPFLNYNQSPRN-----------------------MYQC--QMAKQTMG------------TSMHNFPYRFDNR-I
Q8II17_PLAF7/944-1400LASLTPFSDHNQSPRN-----------------------IYQC--QMLKQTMG------------IQSLNNVYTFTNK-I
Q4N2L4_THEPA/739-1128SASLTPFSNHNQSPRN-----------------------MYQC--QMLKQSVG------------IPFHSQFYRSEVK-T
RPB2_ASFB7/782-1141AALVSPYANCTQPARV-----------------------TYET--NQGRQTGG------------WYCFSWPYRVDMN-R
RPOB_SALRD/696-1211VAEGEGVVEYVDAERL-----------------------VVRY----DEEQDKTDLTF--GEPVQEYELTKFRRTNQG-T
R7EM77_9BACE/681-1194TAEGDGVVEFVDATTI-----------------------RILY--DRTEEE-EFVSF---EPALKEYNIPKWRRTNQN-M
RPOB_UREPA/839-1300VAKNDGVVEFVDSQKI-----------------------IIRN----DNDK--L----------DDYKLIKYRKSNQD-T
A5IZ53_MYCAP/720-1106RARNEGKVEYVDGAKI-----------------------KIRN----NKGTLD------------TYSLKNFQRSNQD-T
S5LVD1_9MOLU/753-1138VATADGIVKYVDSKKI-----------------------IIEQ-----KDGIK------------TYDLNDFSRSNNG-T
RPOB_DESOH/725-1286VARRPGEVVYVDSGRI-----------------------VVRH--DTDDKDPEAK-------PVTVYNLSKFIRSNQN-T
RPOB_GEOLS/853-1417IARHNGVVDAVDAGRI-----------------------VIKI--DEEEYDETGT-------GVDIYNLVKFSRSNQN-T
RPOB_LACDA/681-1067LAEADGEVEYVDANEI-----------------------RVRR----EDQT--L----------DTYTLEKYRRSNAT-K
RPOB_DESAG/716-1278IAEADGVVRYADADRI-----------------------VVSY----EGDLYPRTG------GVRSYDLQKYHKSNQS-S
RPOB_SYNAS/719-1284VAKRSGIVESVDASRI-----------------------VIKC----ESAE--KTDR---DTGVDIYTLIKYQRSNQD-T
R5KT32_9FIRM/702-1129VAKRAGVVERSTSKEI-----------------------TLRY--DDNGEK-E------------TYKLLKFQRSNQS-N
D6Z3M9_DESAT/721-1284LAGGDGVVEEVDANRI-----------------------VVRY--DEP----GTDGF---TTGIGIYRLEKYKKSNQN-T
RPOB_NEOSM/713-1263VAKRAGVVQYIDARNI-----------------------VVAS----ESKD--DF-------WIDSYTLCKFRKSNHN-T
RPOB_EHRCR/741-1291LAKRGGIVHRVDGLYI-----------------------VIRA-FDQEKNEYLG---------VDIYNLRKFQRSNHN-T
RPOB_PARDP/741-1300MARRGGIIDQVDAQRI-----------------------VIRA----TEDLGAGDA------GVDIYRLRKFKRSNQS-S
RPOB_PELUB/727-1287VASRDGTVDKIDGKRI-----------------------VIKA----TEETDFTKS------GVDIYNLQKFKRSNQN-T
RPOB_FUSNN/675-1063TTKVSGKVTYVDGKKI-----------------------IIED----KDKKEH------------IYRLLNYERSNQS-M
RPOB_MAGMM/724-1281TARRTGVVDEVDAARI-----------------------VVKA----DEEPGSTEP------GVDIYNLTKFSRSNQN-T
RPOB_PHOPR/717-1263VAKRGGQVQSVDASRI-----------------------VVKV----NEDE--LVPG---EAGIDIYNLTKYTRSNQN-T
RPOB_FRATT/720-1276IARNAGEVAEVDSNRI-----------------------VIKV--DTEKSQTSNL--------VDIYSLTKFKRSNKN-T
RPOB_RUTMC/723-1282TAKHSGVVEAVDASRI-----------------------VIRV----DSKK--TKAS---ELGVDIYNLTKYSRSNQN-T
A0A454XJX6_COMT2/725-1292TAKRGGIVDYVDATRI-----------------------VIRV--NDDEAVAGEV-------GVDIYNLIKYQRSNQN-T
RPOB_KORVE/830-1399LARRSGIIDSVDSERV-----------------------IVRV----EGEHHPMQLSR--EVGSDIYQLTKFKRSNQN-T
RPOB_THEMA/760-1174LAEHDGIVKEVDAARV-----------------------VVHR--TDENG--NLMYDDKGNPVVDEYRLLKFVRSNQD-T
RPOB_DEIGD/619-1059ISDVTGRVTYVDARAI-----------------------QVTL----TEDAPQIGLV---KGNVRTFELVRFTRSNQG-T
RPOB_CORGL/631-1051ITPVAGVVENVSADFI-----------------------TIMA--DDGKRE--------------TYLLRKFQRTNQG-T
RPOB_AQUAE/798-1374VAKRGGVVEEVDSSKI-----------------------IIRV----NPEEINFDDPL--DIGIDIYELRKFQRTNQK-T
RPOB_DEHM1/652-1123FAKRAGVAASVTSEKI-----------------------IIRT--AEGQDD--------------EYLLKKFVRTNQG-T
RPOB_RHOBA/666-1160RARRAGKVTYADATRI-------------------------------------EI-------GSDHYPLKKYQGLNER-T
RPOB_BORBU/669-1059KAKRSGEVILATSSKI-----------------------VVKPFEAENAKDLD------------EYHIVKYERTNQD-T
RPOBC_HELPY/731-1296KANRAGVVEKIDSKNI-----------------------YILG----ESKE--EA-------YIDAYSLQKNLRTNQN-T
RPOB_OSTTA/587-1008VAKQNSYISYVDAQRIDYFTPVIGDTNLIDYQNLTAEDVFASN----------QF-------KHNTIWLTSYQRSNQD-T
RPOB_PHATC/876-1274NSYSNGVVSSVTANKI-----------------------VVND----KTGK--R----------LTYKLQKYLRSNQQ-T
RPOB_PLAF7/527-929ISYQEGIVIYVSCIKI-----------------------IIRD--LFNRQI--------------IYYLNNYKKINQN-I

PF04941

Q8B9K0_NPVR1/5-748L-SCVMHKCVPVIFGTRLDKQFRKPDNVDANNNING-TFMLDGRFLSFPNIMMNNNVLVHNFYDKLYAKH--CKRMFLYG
Q6JP89_NPVNC/3-721LQQCILHQCVVVALQSWLDRKFRDITTIDEDEQVLGCCFVMNGHYYTIPNIMMNNNIQLHNFRSAQFSSD--AKRLYLYG
Q91ES4_GVCPM/4-750LKKCVLHNCVVVIVGTWLDKRFRGD---ECNYGFEG-TFILDGRHFSFPNIMMNNNVLIHNFFDKQYARDKKMKRMFLYG

PF00562

F7A8L9_MACMU/487-847YRLQTPQSPLV-----------RPS-MYDYYD---------------MDNYPIGTNAIV---------------AVISYT
Q74MN2_NANEQ/133-507HVAQTLQKPLV-----------RTI-VHDLIR---------------FDERPAGYNMVV---------------AVMAYE
Q8TXI7_METKA/161-536HLLYYPHRPLV-----------KTR-GTEAFD---------------YDERPAGQNMIV---------------AVLTYE
A2SSM5_METLZ/137-540HMLHYAQVPMV-----------HTQ-AAELIG---------------SDNRPQGQNFCV---------------AIISYE
A0RXX0_CENSY/644-1018HFMLYPQTPIV-----------NTR-AMGLLG---------------LEDRPAGQNCVV---------------AVLPFD
Q980R1_SACS2/176-547HLLHYPQRPLV-----------QTR-ALDIIG---------------YTNRPAGNNAIL---------------AVMSFT
Q8ZYQ9_PYRAE/658-1029HMLYYPERPIV-----------TTR-GLELIG---------------YSKRPAGQNAVV---------------ALLTYT
RPB2_IIV3/689-1053HTLNYPQKPLV-----------TTS-FAEYNQ---------------LNEYPNGINAIV---------------AIACYT
RPB2_IIV6/724-1098RVMDYVQRPLV-----------TTQ-IAEMNR---------------FNDFPNGLNAMV---------------AVAIYT
A0CUT2_PARTE/741-1109HILHYPQKPLA-----------SSR-AVDFIT---------------VNEVPIGINCVT---------------SIACFT
Q583H5_TRYB2/724-1094HVLFYPQKPLV-----------RTK-AMSYMR---------------SNDLPAGHNAIV---------------AIACYS
A2E7H8_TRIVA/712-1082HVLWYPQKPLV-----------ATR-NMRYLN---------------FNKLPAGINVTV---------------AICCYT
RPO2_MIMIV/726-1093YILYHPQIPLV-----------TSR-ASKYTG---------------THIFPAGENSIV---------------AIASYT
E2RU19_GIAIC/792-1189NVMHYPQLPLV-----------TTR-SMPHVK---------------FRYLPAGQNVII---------------AIAVYS
Q4A245_EHV8U/685-1058HVLATPQKPLV-----------TTR-LEELLG---------------TSVVRSGAVPIV---------------AIMCYS
C5WRS0_SORBI/754-1125HQLYYPQRPLF-----------KTV-IADCLGRS-DYTTFGRKDDFMRPEYFNGQNAIV---------------AVNVHQ
Q8QUS6_ISKNN/596-957DVLMYPQVPLS-----------RSK-AMDALS---------------FDTMPHGACPIV---------------AVLTFD
Q4GZE8_TRYB2/675-1036MLGAYPQRPLC-----------RTK-AMNLTN---------------YEILGAGINAMV---------------CVMSYS
Q5CPZ8_CRYPI/819-1197YLLVYPQKPLC-----------KTR-TIEMIN---------------FEQLPAGQNSSV---------------AVMSFA
RPC2_MOUSE/668-1041YLLAYPQKPMV-----------KTK-TIELID---------------FEKLPAGQNATV---------------AVMSYS
NRPC2_ARATH/690-1065YLLVYPQRPLL-----------TTR-TIELVG---------------YDKLGAGQNATV---------------AVMSFS
A0D7M6_PARTE/655-1033YQLIYPQTPLV-----------RTV-SMEAVN---------------QHRLPAGHNAQV---------------AVMSYS
Q236N3_TETTS/664-1046YQLIYPQTPLL-----------KTK-VIEYAG---------------YDKFPAGHNASI---------------AVLSYS
A8B2N4_GIAIC/763-1143FLLDYPQQPLT-----------STK-ILKLTG---------------YERLPAGQNATV---------------CVMSYS
Q4UB41_THEAN/766-1155HLMNYTQQPLV-----------TTK-TIQLVN---------------FDKLPAGQNAIV---------------AVMSYQ
A2E3T5_TRIVA/688-1052YFNCYPQQPMV-----------QTR-TIRLSR---------------YHEMPCGQNAMV---------------AIMSYS
RPA2_DICDI/664-1031YKVQNVQKPIV-----------HTK-NQFKFR---------------CNDYPHGCNAVI---------------AVISNT
A0A1D8PQM4_CANAL/675-1039YRLQTGQTPIV-----------KAN-LYDDYG---------------MDNFPNGMNAIV---------------AVISYT
Q27493_CAEEL/649-1005YRLQFPQQPML-----------KLE-AYEKYE---------------MDEYPLGTNACV---------------AVISYT
Q5CSG7_CRYPI/759-1165YRLLTPQEPTI-----------ITK-GYSSFG---------------FSEYPTGTNAIV---------------AVMSYS
A8B827_GIAIC/683-1140YLLTTPQKPLV-----------RNAIIHDIGG---------------FDTHPTGTNLVV---------------AVSAYT
Q22C62_TETTS/684-1046YRLLNGQIPMV-----------KGM-DPESYG---------------LSDYPSGTNAIV---------------AVISYT
Q8II17_PLAF7/944-1400YRMITPQFPLV-----------VTR-DYEFYG---------------VDNFPSGTNAVV---------------AILAYT
Q4N2L4_THEPA/739-1128YVLTSLQRPLV-----------ATK-EYEKMG---------------FQDYPTGVNCVV---------------AIIAHS
RPB2_ASFB7/782-1141FFQFYNEMPLV-----------KTI-AHNYVI-------------------PNGLNTIV---------------AYMIYG
RPOB_SALRD/696-1211---CMNQKPIV-----------QAGDRVEEGEVLTD------GFAMEKGELALGKNVLC---------------AFMPWH
R7EM77_9BACE/681-1194---TIDLRPIC-----------EKGQRVTAGQILTE------GYSTEDGELALGKNLLV---------------AYMPWK
RPOB_UREPA/839-1300---CNNQIPIV-----------KVGQRVHKSETIGD------GPAMQNGELALGRNILV---------------GYTTWR
A5IZ53_MYCAP/720-1106---VIHQKPII-----------KVGQDVAKGDLLVD------GSSFKDGELALGKNLLV---------------AFSTYK
S5LVD1_9MOLU/753-1138---AITHLPIV-----------KLGDKVKARDILAD------GPSMEKGELALGQNVVV---------------AFTTWN
RPOB_DESOH/725-1286---CFNHRPIV-----------KKGQRVAPGDVLAD------GPATEKGELALGKNVTV---------------AFMPWG
RPOB_GEOLS/853-1417---CINQKPVV-----------KVGDKVKRGDVIAD------GPSTDMGELALGQNIIV---------------AFMPWG
RPOB_LACDA/681-1067---NYNQTPNV-----------KRGDKVVDGQVIAN------GPSMADGELALGQNPVI---------------AFTTWN
RPOB_DESAG/716-1278---CFGQKPLV-----------SRGQVIRKGDVLAD------GPGIEDGELALGKNLVV---------------AFMPWC
RPOB_SYNAS/719-1284---CFNQKAIV-----------NKGQRVRKGDIIAD------GPATDNGELALGHNVMV---------------AFMSWG
R5KT32_9FIRM/702-1129---CYNQRAIV-----------FKGDHVEAGEVIAD------GASTSNGEIALGKNPLI---------------GFMTWE
D6Z3M9_DESAT/721-1284---CFTQRPLV-----------EPGVRVKKGDILAD------GPACDHGELALAKNVTV---------------AFMPWR
RPOB_NEOSM/713-1263---CIHQRCVV-----------HQGQRVKKGDILAD------GPAIQKGELALGRNLVV---------------AFLSWR
RPOB_EHRCR/741-1291---CINQRPLV-----------KPGDYVKANDVIAD------GSAIDQGELALGKNVLV---------------AFMSWQ
RPOB_PARDP/741-1300---TINQRPLV-----------KVGDKVVKGQVVAD------GPSTDQGELAIGRNVVV---------------AFMPWN
RPOB_PELUB/727-1287---CINQKPLV-----------RVGDKVKSGDIIAD------GPSTKLGELALGKNVTV---------------AFMPWQ
RPOB_FUSNN/675-1063---CLHQTPLV-----------DLGDKVKAGDIIAD------GPATKLGDLSLGRNILM---------------GFMPWE
RPOB_MAGMM/724-1281---CINQVPLV-----------KNGERVTAGDIIAD------GPSTQIGELALGRNVLV---------------AFMPWN
RPOB_PHOPR/717-1263---CINQRPTV-----------MPGEPVARGDVLAD------GPSTDLGELALGQNIRI---------------AFMPWN
RPOB_FRATT/720-1276---CINQRPIV-----------NVGDKVEAGDILAD------GFATDFGELSLGHNLMV---------------AFMPWN
RPOB_RUTMC/723-1282---CINQKPLV-----------KTGDKISAADVLAD------GPSTDMGELALGQNMKI---------------AFMPWN
A0A454XJX6_COMT2/725-1292---NIHQRPIV-----------SRGDKLAKGDVLAD------GASTDLGEIAIGQNMLI---------------AFMPWN
RPOB_KORVE/830-1399---CINQKPIV-----------KQGDHVKKGQVIAD------GPCTDHGELGLGRNVLV---------------SFMPWR
RPOB_THEMA/760-1174---MINQKPIV-----------NEGDFVKKGDPIAD------GPATDMGELALGRNILV---------------AFMPWE
RPOB_DEIGD/619-1059---NLDQHPIV-----------SVGDEVVPGQVIAD------GPASDQGRLALGQNITI---------------AIMPFD
RPOB_CORGL/631-1051---SYNQKPLV-----------NLGERVEAGQVIAD------GPGTFNGEMSLGRNLLV---------------AFMPWE
RPOB_AQUAE/798-1374---CVNQRPIV-----------RKGEKVEKGQIIAD------GHSTDRGELALGKDVLV---------------AFMPWR
RPOB_DEHM1/652-1123---CINQHAVI-----------NKGQKIEAGQVLAD------SSATENGELALGQNCVV---------------AFMSWQ
RPOB_RHOBA/666-1160---CQNQKPLI-----------TVGDKVEKGQIIAD------GAATQKGELALGRNVLV---------------GFMSFD
RPOB_BORBU/669-1059---CFNQSVLV-----------KEGQKVERGEIIAD------GPATRYGELALGNNLLL---------------GVIPWN
RPOBC_HELPY/731-1296---SFNQVPIV-----------KVGDKVGAGQIIAD------GPSMDRGELALGKNVRV---------------AFMPWN
RPOB_OSTTA/587-1008---CLNHKPLV-----------EANTWVEAGDCLAD------NAATAKGELALGRNILI---------------GYMPWE
RPOB_PHATC/876-1274---CINHRPIV-----------WKGEQVKSGQILTD------GPAITSSELSLGQNVLI---------------GYMPWQ
RPOB_PLAF7/527-929---LLIYKPIV-----------WVGEKVNIGQILAI------NSNLLNSEYSLGNNLLV---------------GYGSYL

PF04941

Q8B9K0_NPVR1/5-748N-VDQEKHINR---AIQLVYDKQDDVLFARDVYASDYVVTEDLNSILETYLANSG--KWKPLDFLFEYNTLHKQQLVEHI
Q6JP89_NPVNC/3-721N-FCPDGDVKRYGQSIQLVYESSTDELHVRDVYGQDYFVDDKIIEKIVPYFQNNY--KWPELGFLFDNIDS------DLI
Q91ES4_GVCPM/4-750N-YDDDKTVNR---AIQLVYDKVDDVLYVRDVYAKDYIVDSGINQILREYLKCSG--KWPDMDFVFSFDDY--TELFDTL

PF00562

F7A8L9_MACMU/487-847G-YDMEDAM--------IVNKASWERGFAHGSVYKSEFIDL---------SEKIK--QGD-SSLVFGIKPG---------
Q74MN2_NANEQ/133-507G-YNTQDAL--------VINRNAIDFGFTRTMYFRP--YEAV--------ERKYA--LGLSDE-ITVP--S------PDV
Q8TXI7_METKA/161-536G-YNMEDAI--------IMNESAIERGLARSFFFKT--FEDE--------ARTYP--GGMKDK-FCIP--E------KEV
A2SSM5_METLZ/137-540G-YNIEDAL--------IFNKASVERGVGRSHFFRT--YEGE--------ERRYP--GGQVDR-IELP--E------EDV
A0RXX0_CENSY/644-1018G-YNIEDAI--------VLSKSSVDRGLARTFFYRI--YDAE--------AKQYP--GGMRDN-FEIPGAE------DNI
Q980R1_SACS2/176-547G-YNMEDSI--------IMNRSSVERGMYRSTFFRL--YSTE--------EVKYP--GGQEDK-IVMP--E------AGV
Q8ZYQ9_PYRAE/658-1029G-YNIEDAV--------ILNKASVERGMFRSVFYRTYETEE----------QKYP--GGE-EDRIEIPDSS------VK-
RPB2_IIV3/689-1053G-YNQEDSI--------ILNKSSIDRGLFGTITYNT--FTA----------QEKK--NGIIEERIEIPSNA------I--
RPB2_IIV6/724-1098G-FNQEDSI--------ILNKASIDRGMFHVVTYKT--IIV----------EERK--IGVNEKICMPVASV---------
A0CUT2_PARTE/741-1109G-YNQEDSI--------IINQYAIDRGFFRSVFYRT--YKES--------EDKDP--DNFTETKITKPIGD------N--
Q583H5_TRYB2/724-1094G-YNQEDSI--------IMSRSAVERGFFRSVFWRS--YKAS--------EEKKR--EGR-EM-FEIP--D------RKV
A2E7H8_TRIVA/712-1082G-YNQEDSL--------MLNASAIDRGLFRSYFFRT--YKET-------AEGDGT--EGASEV-FTFP--D------PQT
RPO2_MIMIV/726-1093GLMNQEDSL--------VINDSAIQKGYMRAQALKK--YMEI--------IKKNP--ASSQTSIFMKPDRN------KV-
E2RU19_GIAIC/792-1189G-FNQEDSL--------IMSQSAVDRGFMRATYYHT--YEEMIS---SAASSINA--PDRIEK-FCRP-IG------PNI
Q4A245_EHV8U/685-1058G-FNQDDSV--------LLNQSSIDRGLFTSFAYHT--IRD----------EEKG--TGADIERFENPKNI------PGC
C5WRS0_SORBI/754-1125G-FNQEDSL--------VMNRASLERGMFRTEHLRS--YKADVE----NKDG-TK-RLKLKEKIDFGKTES---------
Q8QUS6_ISKNN/596-957G-YNQEDSI--------ILNRSSVQRGMFVSTTYKT-LCEC---------EKHVK--RCEFERIMRVPVDK------R--
Q4GZE8_TRYB2/675-1036G-YDIEDAQ--------VYNRSSLDRGYGRCVVLRK--HEVE--------LERLP--NGEYDIILPADSNV---------
Q5CPZ8_CRYPI/819-1197G-YDIEDAI--------VMNKASVDRGFARCFVMKR--QTIE--------LQKLP--NGLSERVVRPISVG------SGN
RPC2_MOUSE/668-1041G-YDIEDAL--------VLNKASLDRGFGRCLVYKN-----AK-----CTLKRYT--NQTFDKVMGPMLDA------AT-
NRPC2_ARATH/690-1065G-YDIEDAI--------VMNKSSLDRGFGRCIVMKK--IVAM--------SQKYD--NCTADRIL--IPQR------T--
A0D7M6_PARTE/655-1033C-YDIEDAL--------IMNKSSLDRGFGRTAVYKK--SVTEC-----EINQRNK--ESRFNERIDEPPTK------THN
Q236N3_TETTS/664-1046G-YDIEDAT--------VLNKSSLDRGFGRTMVFKK--YETE--------IQKLK--MSGLTELLRGPPKE------AEG
A8B2N4_GIAIC/763-1143S-FDIEDAL--------ILNRNAIDRGFGRCSIYRS--VSTEL-----NSIGSKS--VDGIKDILLGPPKD------H--
Q4UB41_THEAN/766-1155G-YEIEDAI--------ILNKASIDRGFARCYTLRR--LTC----------EITP--GNATSINGYNPNKS---------
A2E3T5_TRIVA/688-1052G-HDIEDAL--------LMNKASLDRGFGRRYYLSK--LDLM--------LKNYQ--GGVIGDRIAPLDRE------RP-
RPA2_DICDI/664-1031G-YDMEDAM--------IINKSAYERGFGHGSVYKN--EYIDLDQGLSRFEQKKT--------FFGRPNTV---------
A0A1D8PQM4_CANAL/675-1039G-YDMDDAM--------IINKSADERGFGYGTVYKT--EKVDL------SQSRRR--GDPITQHFGFGSDE---------
Q27493_CAEEL/649-1005G-YDMEDAM--------TINKASYQRGFAHGTVIKV--ERIN-------LVTERE--RKTIFYRN---------------
Q5CSG7_CRYPI/759-1165G-YDMEDAM--------ILNKSSYDRGMFHACVYKT--KIISAA----PPSATKK--SDAESYFFHNIGPD---------
A8B827_GIAIC/683-1140S-YDMEDAA--------LINKASLERGLFHGTVYSV--HDIDCYDDKLMRYMRTV--ATAVPYLKRSPDYI------VT-
Q22C62_TETTS/684-1046G-YDMEDAM--------ILNKSSYERGFGHGCVYKNYSYDVA-------ELNKEK--NSKFKMLNEVKNID---------
Q8II17_PLAF7/944-1400G-YDMEDAL--------IINKASADRGIFRTHIYKT--EFIDLQ---KVGESSNFVFGNNIRYLNNNKNNN------KN-
Q4N2L4_THEPA/739-1128G-FDMEDAM--------ILNKASVDRGLFNSFIYKS--KVIDLN---SQASSTKE--RGGTVEYFNNMDKD---------
RPB2_ASFB7/782-1141G-YNQEDSV--------IVSQSFIDRGGFAGTFYRE---------------EKVE--LESDIESFGKPDPL------ITK
RPOB_SALRD/696-1211G-YNYEDAI--------VISERLVADDVYTSVHIEEFEHEV----------RDTK--RGE-EELTREIPNV---------
R7EM77_9BACE/681-1194G-YNYEDAI--------VLNERVVREDLLTSVHVEEYSLEV----------RETK--RGM-EELTSDIPNV---------
RPOB_UREPA/839-1300G-YNFEDAI--------IISERLVDQDVFTSIHIDEHTIQC----------MKTK--NGD-EEITRDMPNV---------
A5IZ53_MYCAP/720-1106G-YNYEDAI--------VLNERLAKKDVLTSIHIEEQTIQF----------RTSK--AGA-DELTRDIPNV---------
S5LVD1_9MOLU/753-1138G-YNYEDAV--------IVSERIVIDDRFTSIHIDEYTIER----------RQTK--QGP-EEVTRDIPNI---------
RPOB_DESOH/725-1286G-YNFEDSI--------LVGETLVRDGVFTSIHIEEFEVVA----------RDTK--LGK-EEITCDIPNV---------
RPOB_GEOLS/853-1417G-YNFEDSI--------LVSERLTKDDRYTSIHIEEFECVA----------RDTK--LGK-EEITADIPNL---------
RPOB_LACDA/681-1067M-YNFEDAI--------MLSERLVKEDVYTSIHIEDYDSEA----------RDTK--LGP-EEITREIPNV---------
RPOB_DESAG/716-1278G-YNFEDSI--------LISERCVKEDVFTSVHIEEFEVVA----------RDTK--LGP-EEITRDIPNV---------
RPOB_SYNAS/719-1284G-YNYEDSI--------LVSERIVKEDIYTSIHIEEFETMA----------RDTK--LGK-EDITRDIPNV---------
R5KT32_9FIRM/702-1129G-YNYEDAV--------LLSERLVQDDVYTSIHIEEYETEA----------RDTK--LGP-EEITNDVPGV---------
D6Z3M9_DESAT/721-1284G-YNYEDSI--------LVNERLLKNDTYTSFHIEVFETVA----------RDTK--LGK-EEVTRDIPNV---------
RPOB_NEOSM/713-1263G-YNFEDSV--------VISSNVVRDDLFTSVHLEGFECVV----------RDTR--LGP-EEITRDVSGV---------
RPOB_EHRCR/741-1291G-YNFEDSI--------VISSEVVKKDVFTSIHIEEFECVV----------RDTT--LGP-EKIMRSVPDI---------
RPOB_PARDP/741-1300G-YNYEDSI--------LISERIHRDDVFTSIHIDEYEVAA----------RDTK--LGP-EEITRDIPNV---------
RPOB_PELUB/727-1287G-YNFEDSI--------LISERCVTDDVFTSVHIVEYEVMA----------RDTK--LGE-EEITRDIPNV---------
RPOB_FUSNN/675-1063G-YNYEDAI--------LISDRLRKDDVFTSIHIEEYEIDA----------RTTK--LGD-EEITREIPNV---------
RPOB_MAGMM/724-1281G-YNFEDSI--------LISERLVAEDVFTSIHIDEFEVMA----------RDTK--LGA-EEITRDMPNV---------
RPOB_PHOPR/717-1263G-YNFEDSI--------LVSERVVQQDRLTTIHIQELSCVA----------RDTK--LGS-EEITADIPNV---------
RPOB_FRATT/720-1276G-YNFEDSI--------LLSERIVKDDKYTSIHIEEFTCVA----------RDTK--LGP-EEITADIPNV---------
RPOB_RUTMC/723-1282G-YNFEDSI--------LISEKVIQEDRYTTIHIEELTAYS----------RDTK--LGP-EEITADIPNV---------
A0A454XJX6_COMT2/725-1292G-YNYEDSV--------MINERIVADDRYTSIHIEELVVMA----------RDTK--LGA-EEITRDIPNL---------
RPOB_KORVE/830-1399G-YNFEDAI--------LVSEKLVKEDYYTSVHIEEFEIEA----------RDTK--LGP-EEITRDIPNV---------
RPOB_THEMA/760-1174G-YNYEDAI--------LVSQELLEEDVFTSIHIEVYETQA----------RETR--LGP-EEITADIPNV---------
RPOB_DEIGD/619-1059G-FNFEDAI--------CISEGLVRKDFYTSVHIEKDEIEA----------RDTK--LGP-EKITRDIPGL---------
RPOB_CORGL/631-1051G-HNYEDAI--------ILNQNIVEQDILTSIHIEEHEIDA----------RDTK--LGA-EEITRDIPNV---------
RPOB_AQUAE/798-1374G-YNFEDAI--------VISERLVKEDVYTSIHIEELEVEA----------RETK--VGE-EEITRQIPGV---------
RPOB_DEHM1/652-1123G-FNYEDAI--------ILSERLVREDAFTSIHITKHELEA----------HDTK--LGG-EEITRDIPNV---------
RPOB_RHOBA/666-1160G-FNYEDAI--------IISEELVRNDTYTSIHIEDFDVEI----------RETK--LGR-EEFTRDIPNV---------
RPOB_BORBU/669-1059G-FNYEDAI--------LISDRIVKEDLYTSIHIKEFSIEV----------RETK--LGP-EKVTGDIPNV---------
RPOBC_HELPY/731-1296G-YNFEDAI--------VVSECITKDDIFTSTHIYEKEVDA----------RELK--HGV-EEFTADIPDV---------
RPOB_OSTTA/587-1008G-YNFEDAV--------LVSERLVYDDVFTSIHISRYEVST----------ARLR--EGQ-EYFTNQVDRN---------
RPOB_PHATC/876-1274G-YNFEDAI--------LINERLVYDDVFTSIHIERYKIEI----------DRNS--DTL-ERTTKNIPNL---------
RPOB_PLAF7/527-929G-YEYEDAI--------IISRKILYNNLYTSLHLNIYEISL----------NIIN--NIP-EICSINLSKM---------

PF04941

Q8B9K0_NPVR1/5-748KIIMNH-DINYSIDSL--ANK----IVYKH----AYL------IELLLTSTILQNYQRVLDKTADDDAYTVVNKRRKIQS
Q6JP89_NPVNC/3-721KSTMRHICTDYHIDTL--SNK----LILSP----SQL------LE------------TFLLQTKKFILYLIDKQIPV--T
Q91ES4_GVCPM/4-750KSIMSV-DIPYQIDSL--SNK----IIYKH----SYL------IHL--------TYSTVLNKLRNLTVTDADNTKKK--C

PF00562

F7A8L9_MACMU/487-847--------DPRILQKL--DDD----GLPFI----GAK------LQ------------------YGDPYYSYL--------
Q74MN2_NANEQ/133-507----RGYKGEKHYRHL--ESD----GIVYP----EAE------VK------------------GKDVLIGRI-----SPP
Q8TXI7_METKA/161-536----RGYRSEDAYKHL--GED----GLAEV----GER------VE------------------GRDVIIGKT-----SPP
A2SSM5_METLZ/137-540----QGSHGIGSYANL--DVD----GIINP----ETV------VN------------------EKDVLIGKT-----SPP
A0RXX0_CENSY/644-1018----RGYKGEKSYRLL--EDD----GVIAS----EST------VL------------------GGDILIGKT-----SPP
Q980R1_SACS2/176-547----RGYKGKEYYRLL--EDN----GVVSP----EVE------VK------------------GGDVLIGKV-----SPP
Q8ZYQ9_PYRAE/658-1029-----GYRGPEAYSHL--DED----GIAPP----EVY------VS------------------SNEVLIGKTS-----PP
RPB2_IIV3/689-1053------KIRDCNYGLV--GPD----GIVRL----RQR------VK------------------KGDVLICKV--------
RPB2_IIV6/724-1098-------RRMNNYSLLEDNPESPYFGVVKV----KSF------VK------------------RNDVLVGK---------
A0CUT2_PARTE/741-1109-------FAGKLFIKL--DSD----GIVPP----GTK------VD------------------EEEPIIGK---------
Q583H5_TRYB2/724-1094-----CHVKRADYTKL--DTD----GLIKP----GMP------VI------------------GGDIIVGKT-----IPV
A2E7H8_TRIVA/712-1082----VKGIKLHDSSKI--DAD----GLAIP----GAV------VS------------------AQDVIIGKI-----SPD
RPO2_MIMIV/726-1093-----DNLRDANYDKL--SEE----GYAKV----ETV------IR------------------DGDVVIGVV-----NP-
E2RU19_GIAIC/792-1189----KGIKDPGCASYL--EAD----GLPRV----GNA------VN------------------SQRLIIGKI-----RPN
Q4A245_EHV8U/685-1058-----SGMKEADYSKI--DDK----GMPII----GKT------FY------------------NGDVLIGKV-----VSM
C5WRS0_SORBI/754-1125--------KRGRVDNL--DDD----GLPYI----GAS------LQ------------------TNDIVIGKV--------
Q8QUS6_ISKNN/596-957-------RPGLVYDYL--GDD----GIFDPALARGMF------VA------------------AGVVVVGKM--------
Q4GZE8_TRYB2/675-1036----------GRHSAL--NSD----GIASK----GAV------VR------------------QFDILVNKY-----TP-
Q5CPZ8_CRYPI/819-1197T--GNRRFSFKNDSIL--DND----GVCNV----GVQ------VS------------------EDDIIVNKM-----SPI
RPC2_MOUSE/668-1041------RKPIWRHEIL--DAD----GICSP----GEK------VE------------------NKQVLVNKS-----MPT
NRPC2_ARATH/690-1065------GPDAEKMQIL--DDD----GLATP----GEI------IR------------------PNDIYINKQV----PVD
A0D7M6_PARTE/655-1033----TKKKFIKKYHAL--DND----GITKV----GAQ------LH------------------HGDIYVNKK-----TP-
Q236N3_TETTS/664-1046SYKKKQNRVLKKFGAL--DDD----GTPIV----GAS------IN------------------NGDVLFNKY-----TPL
A8B2N4_GIAIC/763-1143------LKQYEGYHAI--EDD----GLCAV----GAH------LK------------------TGDIVINKGRHITNIP-
Q4UB41_THEAN/766-1155-------------QNK--DSDSTNEYVIGV----GEP------VK------------------PGQVLISTK-----APP
A2E3T5_TRIVA/688-1052-----ENIASPQYSLL--DAD----GIIRP----GER------IE------------------KGMIYANKY--------
RPA2_DICDI/664-1031--------VDELDKFI--DTD----GLPFV----GRL------IK------------------PGEPYYTY---------
A0A1D8PQM4_CANAL/675-1039-------WPEAWKEKL--DAD----GLPLI----GVK------VE------------------EGDPIVAY---------
Q27493_CAEEL/649-1005--------PREEIKTV--GPD----GLPIP----GRR------YF------------------LDEVYYVT---------
Q5CSG7_CRYPI/759-1165--------GELVVKEL--SAD----GLPNI----GQR------LT------------------KGSPICRV---------
A8B827_GIAIC/683-1140------HMDENYDTEL--DED----GLPPV----GAY------LS------------------HGSVFY-----------
Q22C62_TETTS/684-1046--------KSQIAEGL--EGD----GIPAI----GSV------IK------------------KGTAVFQIY--------
Q8II17_PLAF7/944-1400------LAYENKGKFL--NKD----GLPCV----QQK------IT------------------EGSPLYSY---------
Q4N2L4_THEPA/739-1128--------SKLIVKKL--DFD----GLPRL----GEK------LT------------------KNSPFYRI---------
RPB2_ASFB7/782-1141-----NLKPGANYEKL---VD----GFVPV----GTV------VK------------------KGDIIIGK---------
RPOB_SALRD/696-1211--------SEEATKDL--DER----GIVRV----GAE------IT------------------PGDIIVGKIT--PKGET
R7EM77_9BACE/681-1194--------SEEATKDL--DEN----GIVRV----GAR------IE------------------PGDILIGKIT--PKGES
RPOB_UREPA/839-1300--------SDTAKRFL--DNQ----GIVLV----GAE------VH------------------EGDVLVGKTT--PRGNV
A5IZ53_MYCAP/720-1106--------SKYAIRHL--DEH----GIVLV----GSE------VI------------------PGDVLVGRVS--PKGDD
S5LVD1_9MOLU/753-1138--------SEASKKYL--DED----GIVAI----GAE------VK------------------VGDILVGKVT--PKSQT
RPOB_DESOH/725-1286--------GEESLVDL--DES----GIVRL----GAE------VK------------------PGDVLVGKIT--PKGET
RPOB_GEOLS/853-1417--------GEEALKDL--DES----GIIRI----GAE------VK------------------PGDILVGKIT--PKGET
RPOB_LACDA/681-1067--------GEDALKDL--DEN----GIIRI----GAE------VH------------------DGDILVGKVT--PKGIT
RPOB_DESAG/716-1278--------GEDMLRNL--DGS----GIIRI----GAN------VK------------------PDDILVGKIT--PKGET
RPOB_SYNAS/719-1284--------GEEALRNL--DDS----GIVRM----GVS------VK------------------SGDILVGKIT--PKGET
R5KT32_9FIRM/702-1129--------GDDARKDL--DER----GIIRI----GAE------VR------------------AGDILVGKVT--PKGET
D6Z3M9_DESAT/721-1284--------SEEALRNL--DES----GIVRV----GAE------IK------------------AGDILVGKIT--PKGET
RPOB_NEOSM/713-1263--------AEEFLHCL--DEF----GIACV----GAN------VE------------------AGDVLVGKVT--PKSSS
RPOB_EHRCR/741-1291--------NEDSLSHL--DDV----GIVNV----GAE------VS------------------AGDILVGKVT--PRP--
RPOB_PARDP/741-1300--------GEEALRNL--DEA----GIVYI----GAE------VG------------------PGDILVGKIT--PKGES
RPOB_PELUB/727-1287--------NEEALKNL--DES----GIVYI----GAE------VK------------------AGDILVGKVT--PKGDS
RPOB_FUSNN/675-1063--------SESALRNL--DEN----GVIMI----GSE------VG------------------PGDILVGKTA--PKGET
RPOB_MAGMM/724-1281--------GEDALRNL--DES----GIIYV----GAE------VK------------------PGDILVGKVT--PKGET
RPOB_PHOPR/717-1263--------GEAALSKL--DES----GIVYI----GAE------VK------------------GGDILVGKVT--PKGET
RPOB_FRATT/720-1276--------SESSLAKL--DES----GIVHI----GAN------VE------------------AGDILVAKIT--PKAEQ
RPOB_RUTMC/723-1282--------SELALAKL--DEV----GVVYV----GAR------VK------------------GGDILVGKVT--PKSET
A0A454XJX6_COMT2/725-1292--------SEQQLNRL--DES----GIIYV----GAE------VQ------------------PGDVLVGKVT--PKGET
RPOB_KORVE/830-1399--------SESALRDL--DES----GVIRI----GAP------VK------------------AGDILVGKVT--PKGET
RPOB_THEMA/760-1174--------SKELLKNL--DEN----GIIRV----GAYVVSDYGVG------------------SQAILVGKVT--PKGEG
RPOB_DEIGD/619-1059--------SEAALRDL--DED----GIVRV----GAE------VK------------------PGDILVGKTS--FKGES
RPOB_CORGL/631-1051--------SEEVLKDL--DDR----GIVRI----GAD------VR------------------DGDILVGKVT--PKGET
RPOB_AQUAE/798-1374--------PERALAHL--DEH----GIVRV----GTY------VK------------------PGDILVGKVT--PKGET
RPOB_DEHM1/652-1123--------GEESLREL--DED----GIIRI----GAE------VG------------------PDDILVGKIT--PKGET
RPOB_RHOBA/666-1160--------SEKALRNL--DDT----GIVQT----GTY------VK------------------PGDILVGKVS--PKSKT
RPOB_BORBU/669-1059--------SEKILNKL--DEN----GIIRI----GTY------VK------------------PGDILVGKVT--PKSEG
RPOBC_HELPY/731-1296--------KEEALAHL--DES----GIVKV----GTY------VS------------------AGMILVGKTS--PKGEI
RPOB_OSTTA/587-1008-------------QYL--DEF----GVVKI----GTW------VE------------------AGDVLVGKIS--PQPDS
RPOB_PHATC/876-1274--------NPREIRHL--NDD----GIVTV----GTF------VR------------------PGDILVGKVI--SNNTS
RPOB_PLAF7/527-929--------YYKNIKHL--DKY----GIIKE----GTY------IL------------------ANNILISKLM---FMPF

PF04941

Q8B9K0_NPVR1/5-748VLYNKESKKIVDCIVNGRLIYCVSKTFSKQR----KVFPNQQDNSSNNNIEISLPVLKYRVGNEVARITNDSMRQKMLKQ
Q6JP89_NPVNC/3-721KLVNDSSRGVMQSIVDGQIFKGISKTLSTQKIF--KMNPRLQEHTSRTNRDVNVFDLNFKNIDEILKIVSKDVSYKANMQ
Q91ES4_GVCPM/4-750VLFATESKKINDTIVMGKLIQSVSKTLSKQKKY--D-----QEYNSNNN-NLEIFPLRHRIGNEVLRVINENLQQDMLKH

PF00562

F7A8L9_MACMU/487-847-----------------NLNT-GESFVMYYKSK--EN-CVVDNIKV----------------------------------
Q74MN2_NANEQ/133-507RFLE---GGELALLGAATLQ--KRDSSITVRSE--EE-GIVDSVLV----------------------------------
Q8TXI7_METKA/161-536RFL-----EEFRPEELPAEE--RRESSTAIRHT--DS-GIVDSVII----------------------------------
A2SSM5_METLZ/137-540RFL-----EEPTGELIAVEK--RRDTSITMRSN--ET-GIVDTVII----------------------------------
A0RXX0_CENSY/644-1018RFM-----EEYKEFEPSGPY--RRDTSIGVRPS--ET-GVVDTVVM----------------------------------
Q980R1_SACS2/176-547RFL-----QEFKELSPEQA---KRDTSIVTRHG--EM-GIVDLVLI----------------------------------
Q8ZYQ9_PYRAE/658-1029RFY-----TTLEAERILKER---RDASVAVRRG--EK-GIVDKVII----------------------------------
RPB2_IIV3/689-1053------------TIKNKNQDEKLVDSSVIVQHG--EE-GYVDRIVD----------------------------------
RPB2_IIV6/724-1098---------VI-TKISKDGTRQETDHSTIVSIS--EE-GKVDRIIR----------------------------------
A0CUT2_PARTE/741-1109---EL--IIDNIMLNTANGQKNTKECSLLTRRA--ER-GVVDSVLI----------------------------------
Q583H5_TRYB2/724-1094PKTL---SEE---SPVSDTRILKRDCSISSRAA--EK-GVVDRVML----------------------------------
A2E7H8_TRIVA/712-1082SP------TELDHRQ-------YKDTSCVVRPM--ET-GVVDLVLR----------------------------------
RPO2_MIMIV/726-1093------------KPTAREDEKQYKDASSIYKSL--IP-GAVDKVIT----------------------------------
E2RU19_GIAIC/792-1189KR-------SMNSRAVSTYD--FQDVSLKVKME--ET-GRVDSVIIAPDLREQS--------------------------
Q4A245_EHV8U/685-1058SLL------QADPKEGEVRRDTKRDRSHVLRTD--EP-VVVDAVFL----------------------------------
C5WRS0_SORBI/754-1125---------------SES----GEDHSIKLKHT--EK-GMVQKVLL----------------------------------
Q8QUS6_ISKNN/596-957-------------SFDQSRPE-GACCSLAVKPH--EE-GYFDDKLVF---------------------------------
Q4GZE8_TRYB2/675-1036-----------------VPSMEPRPNPLVYKYP--QP-AVVDHVVI----------------------------------
Q5CPZ8_CRYPI/819-1197NTR------EYVGDPSQFDLSEYKPSPVKYKGP--TS-SYIDRVIL----------------------------------
RPC2_MOUSE/668-1041VTQ------IPLEGSNVPQQPQYKDVPITYKGA--TD-SYIEKVMI----------------------------------
NRPC2_ARATH/690-1065TVT------KFTSALSDSQYR-PAREYFKGPEG--ET-QVVDRVAL----------------------------------
A0D7M6_PARTE/655-1033----------QVPDNPQTENIQIADTPSVFKEK--WP-YTVDRVLI----------------------------------
Q236N3_TETTS/664-1046LTLE---QQRGRDILNNNSVSEYIHNPTTFKGK--KL-ARIDRVIR----------------------------------
A8B2N4_GIAIC/763-1143-----------GLSDGTEATASLIKAPESLKSPLETI-TYVDKVLV----------------------------------
Q4UB41_THEAN/766-1155TDFTTNGSMNGKNGESNQSSGTNEDKYIVNKYDLNTG-GYIDRLIL----------------------------------
A2E3T5_TRIVA/688-1052-----------VPLNFEESPVKFMAQPARYNY---YP-VMIQNVSV----------------------------------
RPA2_DICDI/664-1031-------------IRPSDG----RQVTKDYKGK--EE-AYIEDVRIIFG-------------------------------
A0A1D8PQM4_CANAL/675-1039-------------YDDTLG----KTKVKTYHSS--EP-AYIEEVKLL---------------------------------
Q27493_CAEEL/649-1005-------------FNMETG----DFRTHKFHYA--EP-AYCGLVRIV---------------------------------
Q5CSG7_CRYPI/759-1165-------------ERIGSGGGPSNATIQTYHDD--EV-AFVEKINRIASGISIELQ------------------------
A8B827_GIAIC/683-1140----------------QTYDPTKQCYSTKLYHH--EP-GFVEKVIVIHKSAAKGEYWTDNDIATKKKRDSSFPAGDSNSS
Q22C62_TETTS/684-1046--------------DTQKN----AMKTFYHKDS--EL-GRLDGIAL----------------------------------
Q8II17_PLAF7/944-1400---------------INKGNELTTYESFRNHGE-----YFVDFVSI----------------------------------
Q4N2L4_THEPA/739-1128--------------EERGKNNIVNDKVVKYTE---EP-AIVDQITLVGKSE-----------------------------
RPB2_ASFB7/782-1141---------VAKIRGEKDELNKYIDRSVMYGFD--EP-AVVDAVMR----------------------------------
RPOB_SALRD/696-1211DPTPE--EKLLRAIFGDKAGD-VKDASLKAKPG--MEGGVVIDTRLFSRRELDPASKKMEEKRLENIESDHERKLADLNE
R7EM77_9BACE/681-1194DPSPE--EKLLRAIFGDKAGD-VKDASLKASPS--LK-GVVIGKRLFSRVVKTRSSKLADKALLPKIDDEFDAKIGDLKK
RPOB_UREPA/839-1300ETAPE--DRLLQTIFGDKSKT-VKDSSLKVKHG--QE-GIVAAVKRIKSS------------------------------
A5IZ53_MYCAP/720-1106NPSRE--EKLLAAILGQRQLN-VKDTSLKVKNG--HN-GTVIGVEILSR-------------------------------
S5LVD1_9MOLU/753-1138QLSPE--DKLLHAIFGEKSRN-VKDNSLRVPNG--GE-GIIKSIKRFSR-------------------------------
RPOB_DESOH/725-1286QLSPE--EKLLRAIFGEKGGN-VKDTSLRVPPG--VS-GTVIDAKVFTRRGVEKDTRTRMIEEEEIRVLEKNRDDEIAVI
RPOB_GEOLS/853-1417QLSPE--EKLLRAIFGEKAGD-VRDTSLTIPPG--VE-GTVIGAKVFSRKGNDKDARTELIEKIEEEKLRKDEQDEVRII
RPOB_LACDA/681-1067ELSAE--ERLLHAIFGEKARE-VRDTSLRVPHG--GG-GVVQDVQVFTR-------------------------------
RPOB_DESAG/716-1278QLTPE--EKLLRAIFGEKARD-VKNTSLKVPPG--IE-GTVIDVKLFNRRSGEKDERTRNIEDYELARLDQKEKDHIRAL
RPOB_SYNAS/719-1284QLSSE--EKLLRAIFGEKASD-VRDTSLRVPPG--VE-GTVIDAKVFTRKGAEKDHRSQYIEDEAIAMLQKDREDEIRII
R5KT32_9FIRM/702-1129ELTPE--ERLLRAIFGEKARE-VRDTSLKVPHG--ES-GIIVDAKVFKR-------------------------------
D6Z3M9_DESAT/721-1284QLSPE--EKLLRAIFGEKAGD-VKDTSLRVPPG--VE-GVVVDAKVFSRKGVEKDERSLAIEEAEIKALERDLEDELNLL
RPOB_NEOSM/713-1263PVTPE--EKLLRAIFGEKAID-VKDSSLYLPPG--VS-GCVVDVKVLQRRGIEKVGRALLIEKQAIDAEKTRRDHELAVL
RPOB_EHRCR/741-1291PVSLPPETKLLVTIFGEKVFD-CVDSSLYLPLD--VE-GTVVDVHVFVRRGVEENDRSLLIKQNEINGFIKERDYEIDVV
RPOB_PARDP/741-1300PMTPE--EKLLRAIFGEKASD-VRDTSLRLPPG--AY-GTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAIL
RPOB_PELUB/727-1287ASGPE--EKLLRSIFGEKAID-VTDTSLKMSRG--SS-GTVVDVRVFNRHGIEKDERSITIERAEIDTVQQDKIVEEEIL
RPOB_FUSNN/675-1063EPPAE--EKLLRAIFGEKARD-VRDTSLTMPHG--SK-GVVVDILELSR-------------------------------
RPOB_MAGMM/724-1281QLTPE--EKLLRAIFGEKASD-VRDTSLRLPPG--VA-GTVVDVRVFSRRGLEKDDRAKLIDQDEIALLRKDMAAERRII
RPOB_PHOPR/717-1263QLTPE--EKLLRAIFGEKASD-VKDSSLRVPNS--VS-GTIIDVQVFTRDGVEKDKRALEIEEMQLKEAKKDITEEFQIL
RPOB_FRATT/720-1276QLTPE--ERLLRAIFNEKASN-VADSSLRMPSG--TS-GTVINVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVI
RPOB_RUTMC/723-1282VLSPE--EKLLRAIFGEKANN-VKDSSLRVGAS--KS-GVVIDVQIFTRDRVEKDDRALSIDAERLERIKKDIDDEFGII
A0A454XJX6_COMT2/725-1292TLTPE--EKLLRAIFGEKASD-VKDTSLRVDQG--SQ-GTVIDVQVFTREGIQRDKRAQQIIDDELKRFRLDLNDQLRIV
RPOB_KORVE/830-1399QLTPE--EKLLRAIFGEKAGD-VRDASLTCPPG--IE-GVVVDVKIFSRKGQEKDERAKQIEGTQIAKLEKNLADEIRIL
RPOB_THEMA/760-1174DTTPE--EKIIRSVFGERGRD-VKDTSLRLPHG--VE-GRVIRVDVYDQ-------------------------------
RPOB_DEIGD/619-1059EPTPE--ERLLRSIFGEKARE-VKDTSLRVQSG--QG-GIVVKTVRFRR-------------------------------
RPOB_CORGL/631-1051ELTPE--ERLLRAIFGEKARE-VRDTSMKVPHG--ET-GKVIGVRHFSR-------------------------------
RPOB_AQUAE/798-1374RLTPE--EKLLQAIFGEKTRD-VKDASLRCPPG--VE-GIVIDVQVFTRKGTGKKDMLAEKVEREELEALEQELEKKKNL
RPOB_DEHM1/652-1123ELSAE--EKLLRAIFGEKARE-VKDTSLRMPHG--EW-GKVINVRVFSR-------------------------------
RPOB_RHOBA/666-1160ELTPE--EKLLHAIFGRAGED-VKNDSLEVPSG--IE-GIVIDTQKFSRRMSLGEDERKAFERELKQHETEGNEEIASTF
RPOB_BORBU/669-1059DITPE--FRLLTSIFGEKAKD-VKNNSLKVPHG--TE-GTVIDVQRITK-------------------------------
RPOBC_HELPY/731-1296KSTPE--ERLLRAIFGDKAGH-VVNKSLYCPPS--LE-GTVIDVKVFTKKGYEKDARVLSAYEEEKAKLDMEHFDRLTML
RPOB_OSTTA/587-1008DNDPE--SRLLRAIFGGVARN-TKTTSYCLSSG--VS-GRILDVRCEFKRQTK---------------------------
RPOB_PHATC/876-1274EQLPE--SKLLRAIFGAKAKG-VKDNSYRMSDG--EY-GRVIETVTFNR-------------------------------
RPOB_PLAF7/527-929IFNNKSLINIINFLFGSKLRI-FKNKPIISTIH--DI-GRVIKIEILPNHLY----------------------------

PF04941

Q8B9K0_NPVR1/5-748KKDFVKFIGSFFHGEMTVAGKKFFLCRNACLPNVDYEMVAQKFKYLLKHNLV---------------AFVDDLN------
Q6JP89_NPVNC/3-721YSDYRYFIDHCDHGELHAAGKTFTKTHDVILPNIDYSTIFRIFTTLINDQLI----------------------------
Q91ES4_GVCPM/4-750TADYIKFVDSFFHGEMTVAGKKFFLCHNVVLPDVDYKRVSLLFRELIHKNVLYTKKVGGEDESELTGEKVKILNFSKKSP

PF00562

F7A8L9_MACMU/487-847--------------------------------------------------------------------------------
Q74MN2_NANEQ/133-507--------------------------------------------------------------------------------
Q8TXI7_METKA/161-536--------------------------------------------------------------------------------
A2SSM5_METLZ/137-540--------------------------------------------------------------------------------
A0RXX0_CENSY/644-1018--------------------------------------------------------------------------------
Q980R1_SACS2/176-547--------------------------------------------------------------------------------
Q8ZYQ9_PYRAE/658-1029--------------------------------------------------------------------------------
RPB2_IIV3/689-1053--------------------------------------------------------------------------------
RPB2_IIV6/724-1098--------------------------------------------------------------------------------
A0CUT2_PARTE/741-1109--------------------------------------------------------------------------------
Q583H5_TRYB2/724-1094--------------------------------------------------------------------------------
A2E7H8_TRIVA/712-1082--------------------------------------------------------------------------------
RPO2_MIMIV/726-1093--------------------------------------------------------------------------------
E2RU19_GIAIC/792-1189--------------------------------------------------------------------------------
Q4A245_EHV8U/685-1058--------------------------------------------------------------------------------
C5WRS0_SORBI/754-1125--------------------------------------------------------------------------------
Q8QUS6_ISKNN/596-957--------------------------------------------------------------------------------
Q4GZE8_TRYB2/675-1036--------------------------------------------------------------------------------
Q5CPZ8_CRYPI/819-1197--------------------------------------------------------------------------------
RPC2_MOUSE/668-1041--------------------------------------------------------------------------------
NRPC2_ARATH/690-1065--------------------------------------------------------------------------------
A0D7M6_PARTE/655-1033--------------------------------------------------------------------------------
Q236N3_TETTS/664-1046--------------------------------------------------------------------------------
A8B2N4_GIAIC/763-1143--------------------------------------------------------------------------------
Q4UB41_THEAN/766-1155--------------------------------------------------------------------------------
A2E3T5_TRIVA/688-1052--------------------------------------------------------------------------------
RPA2_DICDI/664-1031--------------------------------------------------------------------------------
A0A1D8PQM4_CANAL/675-1039--------------------------------------------------------------------------------
Q27493_CAEEL/649-1005--------------------------------------------------------------------------------
Q5CSG7_CRYPI/759-1165--------------------------------------------------------------------------------
A8B827_GIAIC/683-1140NLDNDASD-------------------------------------------DEISNQPGSGSESNEDNQTATPRSHASKA
Q22C62_TETTS/684-1046--------------------------------------------------------------------------------
Q8II17_PLAF7/944-1400--------------------------------------------------------------------------------
Q4N2L4_THEPA/739-1128--------------------------------------------------------------------------------
RPB2_ASFB7/782-1141--------------------------------------------------------------------------------
RPOB_SALRD/696-1211RFWEKFFALVEDATSAGLEDREGEVLLT----EGADFEEDAFDEVDPSDLSTRAEFTEDEELNDQISTLLRNYKSRRRDI
R7EM77_9BACE/681-1194VLINKLLKLTENYTSEGVKDYMGADII-----SKGARFSASDFSDLDFTAVQLSNWTKDEHTNGLIRALVMNFIKKYKEL
RPOB_UREPA/839-1300--------------------------------------------------------------------------------
A5IZ53_MYCAP/720-1106--------------------------------------------------------------------------------
S5LVD1_9MOLU/753-1138--------------------------------------------------------------------------------
RPOB_DESOH/725-1286EEVTRERLKALLTGQKCDTPVKKGKKT-----ILAKGDKITAALFDEVPTSQFEKLAVTSDSVTEQAHRVFEWYRTQVDA
RPOB_GEOLS/853-1417RDSARGKLKRLLVGKTAGAKIEDRHGVT---VLAKGKKITDELLESLTMDRWATISVSDGTDVEEKVAEVLSKLNEQVEL
RPOB_LACDA/681-1067--------------------------------------------------------------------------------
RPOB_DESAG/716-1278TETTREKLAPVVVGKQLAYGLAGQKKGE---VIAEAGQTLTAEMLEGLPVKKLSGLFKSKDTNEAVQQALESYDRQIEFI
RPOB_SYNAS/719-1284TEAVKKEVGTLLQGKQSGAKIVDPKRKKI-YLKKGDIITPEILSEIPLHLWKEITVADDEETERAVGQMMANLYDKIEVV
R5KT32_9FIRM/702-1129--------------------------------------------------------------------------------
D6Z3M9_DESAT/721-1284ARSVRNGLADLLVGKKVKNAVKNRKGEEL--LAKDKKITREVLEKLSPSEIKKLDYAGRDSLEGEINLLFDRHDSQVKMV
RPOB_NEOSM/713-1263TNYIYSLLKEMLVGKVALSTLAPI------------SKGDLITEEALEKIDRENWWKISVDGISSIKLLRQRFVDRFDEI
RPOB_EHRCR/741-1291SEYFYDELKRVLVSSGVQYNNQ----------------NIDDYLASIPKKEWWDINLSDEAMLLQVKDLKEKFDSMIQNA
RPOB_PARDP/741-1300ERNIYARLKSLIMGKEVVKGPKGIR---------AGAVVDEDLLGQLSRGQWWQLAVADEDTAKEVEALNQQFDAQKRAL
RPOB_PELUB/727-1287ERSIKQRANQILSGASLTKKIKDLD---------EGTKLDLEIINKININDVFKITVGNVNDEASIAQLKDQYNQAKQDI
RPOB_FUSNN/675-1063--------------------------------------------------------------------------------
RPOB_MAGMM/724-1281ERDADERIRNLMNGKPVRSAPGLQP----------GDHISQSWLDKSPSSHLRDVVLDDDAITQQIEGIRHHVEKAADRL
RPOB_PHOPR/717-1263EGGLLARVRTLLLSIGYSE----------------------EKIASMDRERLFALTLDDESLQNQLEQLAEQYDELKAEF
RPOB_FRATT/720-1276ESVVKSSIEQEVVGAKIQKAKGLKK----------GAILTKEFLATLPFSKWLEISFEDEKLEEKVQNAREYYEEAKIAI
RPOB_RUTMC/723-1282DGDIFRRVRLKLSGNMLSKVAGDIK---------AGEKLSAKLMKKLDNKDISKLKVEDAAVNKEVAALIKQAKAKQIEF
A0A454XJX6_COMT2/725-1292EADAFDRIEKLLTGRVANGGPQKLS---------KGAKIDKAYLDGVEKFHWFDIRPAEDDVAAQLESIKNSIEQQRHTF
RPOB_KORVE/830-1399TDERLKRLEGLLGAKVVQADLHDERTNKRLLTKDAVLDRETIERISTRNLKRIKYADKDPRVNEQIDEIEEMTSRQIDVL
RPOB_THEMA/760-1174--------------------------------------------------------------------------------
RPOB_DEIGD/619-1059--------------------------------------------------------------------------------
RPOB_CORGL/631-1051--------------------------------------------------------------------------------
RPOB_AQUAE/798-1374IITGRDKVLKGLVLGRKVEKDAKVGRKTV--KKGTVIDEKVFEEFVNYILGRPENFFEDEDLIRKIREIAERTRTQIEML
RPOB_DEHM1/652-1123--------------------------------------------------------------------------------
RPOB_RHOBA/666-1160ESLIRDMEEASGVKLKDSTGTPLAD---------GQDPKFVAERATSFRLELVLEQIEDEEKRKAAEKVHQTQWQNVEQA
RPOB_BORBU/669-1059--------------------------------------------------------------------------------
RPOBC_HELPY/731-1296NREELLRVSSLLSQAILEEPFSHNGKDY----KEGDQIPKEEIASINRFTLASLVKKYSKEVQNHYEITKNNFLEQKKVL
RPOB_OSTTA/587-1008--------------------------------------------------------------------------------
RPOB_PHATC/876-1274--------------------------------------------------------------------------------
RPOB_PLAF7/527-929--------------------------------------------------------------------------------

PF04941

Q8B9K0_NPVR1/5-748----DVQDDSLLIAFNDRPT-NLKCLKSNTSFIVYTMKRNLAPIELKITDRILYVNHHEGMICI----KKKLRVNNEANI
Q6JP89_NPVNC/3-721----STSNSKYRIVFNSCPT-QYFV--HNVEKFVKIIKA--LPIEIRMFKSLICLNYHVGLIMK----KARLFVDDG-YI
Q91ES4_GVCPM/4-750NKVGLVSNSELVVAFNNRPT-KYYCNRDSLYQIYYTMKRGYAPVEIKLTNNILFVNHHEGMVML----KRVVYIDNEIHI

PF00562

F7A8L9_MACMU/487-847------------CSNDTGSG-K-----FKCVCITMRVPR-----NPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMVP
Q74MN2_NANEQ/133-507---------------TEGED-S-----NLKVRVRIRMER-----PTEIGDKFSSRHGQKGVIGLIVPPSDMPFTASGIVP
Q8TXI7_METKA/161-536---------------TETSD-G-----HKLVKVRIRDER-----VPELGDKFSSRHGQKGVIGMIVPEEDMPFTEDGITP
A2SSM5_METLZ/137-540---------------TESEN-S-----SRLVKVRTRDLR-----IPEIGDKFASRHGQKGVCGLITPQENMPFTAAGIAP
A0RXX0_CENSY/644-1018---------------TQSNE-G-----GKMYKIRVRDMR-----VPEIGDKFAARHGQKGVLGILAKNEDLPYTAEGVTP
Q980R1_SACS2/176-547---------------TETAE-G-----NKLVKVRVRDLR-----IPTIGDKFASRHGQKGVIGMLIPQVDMPYTVKGVVP
Q8ZYQ9_PYRAE/658-1029---------------TESPE-G-----NKLVKVRLRELR-----VPELGDKFASRHGQKGVVGMLLRQEDMPFTEDGIVP
RPB2_IIV3/689-1053----------------NVID-G-----CRIVKVVIGQMR-----TPEIGDKFCSGMAQKGTCGMIFPQEDMPFTASGMTP
RPB2_IIV6/724-1098----------------TSKK-G-----ILMFKIVIAQQK-----RPEIGDKFCSAMAQKGTVGMILEEVDMPFMEDGSIP
A0CUT2_PARTE/741-1109---------------SENQK-G-----YKLVKVKVRSLR-----IPQIGDKFCSRHGQKGTCGMTYRQEDLPYTLVGISP
Q583H5_TRYB2/724-1094---------------TENK--G-----NRFTKVRIRTIK-----IPNIGDKFCSRHGQKGTNGIQFRQEDMPFNHDGISP
A2E7H8_TRIVA/712-1082---------------TITKK-N-----LQLARVRTRQMR-----RPEIGDKFCSRHGQKGVCGMTYRQEDMPFTRDGMVP
RPO2_MIMIV/726-1093---------------EVNND-G-----YPIIKMRIRSER-----IPNVGDKFSSRAGQKGTIGYKAHRADMLFSKSGLIP
E2RU19_GIAIC/792-1189------FLSEGVDSNTTGAE-G-----SLLAKVRVRSSR-----VPQLGDKFSSRHGQKGTVGMLLRHEDLPFTLDGITP
Q4A245_EHV8U/685-1058---------------SKTPE-G-----HGYVKVRTRAIR-----IPMVGDKFSARHGQKGVCGVTMPAADFPCTADGVAP
C5WRS0_SORBI/754-1125---------------SANDE-G-----KNFAVVTLRQVR-----TPCLGDKFSSMHGQKGVVGFLESQENFPFTHKGIVP
Q8QUS6_ISKNN/596-957----------------NMAD-G-----CKCVKIKLRKIR-----IPEMGDKFASFTAQKGTCGMMYDQWDMPFTADGVVP
Q4GZE8_TRYB2/675-1036---------------SPPGDSDRSMDVEQKIKVVTREVR-----GPEPGDKFSSRHGQKGVVGLITDGVNMPFNEQGICP
Q5CPZ8_CRYPI/819-1197---------------TENAD-G-----NQIYKVITRQTR-----RPELGDKFSSRHGQKGVVGLIISQEDLPFSETGWCP
RPC2_MOUSE/668-1041---------------SSNAE-D-----AFLIKMLLRQTR-----RPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICP
NRPC2_ARATH/690-1065---------------CSDKK-G-----QLCIKYIIRHTR-----RPELGDKFSSRHGQKGVCGIIIQQEDFPFSELGICP
A0D7M6_PARTE/655-1033---------------INNTNDGT--EKIKTIKTIFRQIR-----RPEFGDKFSSRHGQKGVVGLIVNQEDMPFNERGWCP
Q236N3_TETTS/664-1046---------------SQQDG-------NVIIKTIVRETR-----RPEYGDKFSSRHGQKGIIGLIVNQEDMPFSEKGWVP
A8B2N4_GIAIC/763-1143---------------TTNGD-G-----NMLIKVLTREPR-----RPEVGDKFSSRHGQKGVCGLIVPQSDLPFTSQGIVP
Q4UB41_THEAN/766-1155---------------TENFN-G-----NTMYKIMVRQSR-----PPEIGDKFSSRHGQKGVVGLIAEHEDMPFTESGIVP
A2E3T5_TRIVA/688-1052---------------YTTET-------TQVIKIKTADFR-----RPELGDKFSSRHGQKGVIGLIVPQEDMPYTEDGICP
RPA2_DICDI/664-1031-----------PNGATRDPS-K-----INNICVKLRFNR-----NPVIGDKFSSRHGQKGVLSQLWPEINMPFTESGMKP
A0A1D8PQM4_CANAL/675-1039-------------GDDSNEQ-E-----GQQITIKYRITR-----QPLIGDKFSSRHGQKGVCSRKWPQIDMPFTESGMQP
Q27493_CAEEL/649-1005-------------EQGEGDS-G-----AKHALIQWRIER-----NPIIGDKFASRHGQKGINSFLWPVESLPFSETGMVP
Q5CSG7_CRYPI/759-1165---QDSLSGGGGDGASSSSG-Y-----GEKVSIKLRIVR-----NPMVGDKFASRHGQKGILSMLWPQENMPFSESGMVP
A8B827_GIAIC/683-1140ERKSSRQLQTRARTESSSLH-F-----IQRVRIVIRHDR-----TPVVGDKVASRHGQKGIMGIRWRQTDMPFTSSGIVP
Q22C62_TETTS/684-1046--------------VHDEKT-K-----EPRVEYRIRIPR-----NPIIGDKFSSRHGQKGVLSVLWPHIDMPFTESGITP
Q8II17_PLAF7/944-1400----------------GKNN-S-----NQVAVVKLRSTR-----QPQVGDKFASRHGQKGVVSRLFPQEDMPFAESGIVP
Q4N2L4_THEPA/739-1128--------ITVGDKISCPGL-K-----HDRAIIKLRVLR-----SPIVGDKFASRHGQKGILSAVWPTEDMPFLENGIVP
RPB2_ASFB7/782-1141---------------PHGPN-D-----EIFGLMRLRYER-----NLNIGDKMSSRSGNKGIAALALPTSDMPFTEDGLQP
RPOB_SALRD/696-1211EGTTKRQKHQVEMGDELPSG-V-----VQMAKVYVARKK-----KIEVGDKMAGRHGNKGVIAKIAPVEDMPFLDDGTPV
R7EM77_9BACE/681-1194DAELKRKKFAITIGDELPAG-I-----IQMAKVYIAKKR-----KIGVGDKMAGRHGNKGIVSRVVRQEDMPFLADGTPV
RPOB_UREPA/839-1300----------DENGSELPDD-V-----IEIIKVYIVQKR-----KIQVGDKMAGRHGNKGIVSKVVPIQDMPFLKDGTPL
A5IZ53_MYCAP/720-1106-----------ENKDLLEDG-I-----DMIVKVSIAVKR-----KIRVGDKMSGRHGNKGVVSVILPEEDMPHLEDGTPI
S5LVD1_9MOLU/753-1138-----------ADGHDLPAD-I-----LEIIKVYIVQKR-----KIQEGDKMAGRHGNKGVISKILPVEDMPHMEDGTPV
RPOB_DESOH/725-1286CREEFEARISRYGAGEELPPGV-----IKMVKVYVAMKR-----VLSTGDKMAGRHGNKGVVSRILPQEDLPYFEDGTTV
RPOB_GEOLS/853-1417IRGVFDDKVQKLRRGDDLPPGV-----IKMVKVYVAIKR-----KLQVGDKMAGRHGNKGVVSRILPEEDMPYMDDGRPV
RPOB_LACDA/681-1067-----------EAGDELAPG-V-----NTLVRVYIVQKR-----KIQVGDKMSGRHGNKGTVALIAPVEDMPYLPDGTPV
RPOB_DESAG/716-1278NAMYESKREKVTEGDDLPPG-V-----IKMAKVHIAVKR-----KLNVGDKMAGRHGNKGVVSCILPQEDMPFFADGRPV
RPOB_SYNAS/719-1284EAYFNEKTEKLKASDELPPG-V-----IKMVKVYIAIKR-----KLQAGDKMAGRHGNKGVLSRILPEEDMPYFKDGRPV
R5KT32_9FIRM/702-1129-----------ENGDELAPG-V-----NESVRIYIAQKR-----KISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPL
D6Z3M9_DESAT/721-1284RSRYEARIARLQKGDDLPPG-V-----IRMVKVYLAIKR-----KLAVGDKMAGRHGNKGVVSRILPEEDMPYFADGTAV
RPOB_NEOSM/713-1263NKTYEENFEKIRGDDDLAQG-V-----LMVVKVFVAVKH-----TLQPGDKMSGRHGNKGVISRIVPAEDMPYLADGTPV
RPOB_EHRCR/741-1291HSKFDQKIDKLNYGYDLPQG-V-----LCIVKVFVAVKH-----NLQPGDKMAGRHGNKGVISRIVPVEDMPYLEDGTPV
RPOB_PARDP/741-1300DNRFDDKVEKVRQGDDLPPG-V-----MKMVKVFVAVKR-----KLQAGDKMAGRHGNKGVVSKVVPIEDMPFLSDGTPV
RPOB_PELUB/727-1287QERFEDKVLKIRSGDDLLPS-V-----MKMVKVFVAIKR-----RLRPGDKMSGRHGNKGVVSKIVPVEDMPYREDGRPV
RPOB_FUSNN/675-1063-----------ENGDELKAG-V-----NKSIRVLVAEKR-----KITVGDKMSGRHGNKGVVSRVLPAEDMPFLEDGTHL
RPOB_MAGMM/724-1281KKRFESKVEKLERGDDLPPG-V-----LKMVKVYIAVKR-----KLQPGDKMAGRHGNKGVISKINPLEDMPYMANGTPV
RPOB_PHOPR/717-1263DKKFETKRRKITQGDDLAPG-V-----LKIVKVYLAVKR-----RIQPGDKMAGRHGNKGVISKICPVEDMPYDEKGQTV
RPOB_FRATT/720-1276DAKFEAKKKSITQSNELSPG-V-----LKTVKVFVAIKK-----RIQPGDKMAGRHGNKGVVSRVLPVEDMPYMEDGTPV
RPOB_RUTMC/723-1282KKFFEEEKAKINEGAELPPG-V-----MKMVKVYVATSK-----TLQVGDKMAGRHGNKGVISRVSPVEDMPYLVDGSTI
A0A454XJX6_COMT2/725-1292DLAFEEKRKKLTQGDELPAG-V-----LKMVKVYLAVKR-----RLQPGDKMAGRHGNKGVVSKITPVEDMPFLADGTTA
RPOB_KORVE/830-1399RKIVREKIEKLQKGDELPPG-V-----IKLVKVYIAMKR-----KLSVGDKMAGRHGNKGVIARILPEEDMPYLEDGTPV
RPOB_THEMA/760-1174-----------NDIAELGAG-V-----LKLVRVYVASRK-----TLDIGDKLAGRHGNKGVVSNILPKEDMPFLPDGTPV
RPOB_DEIGD/619-1059----------GDEGVDLKPG-V-----REMVRVYVAQKR-----QLQVGDKVANRHGNKGVVSKILPPEDMPYLEDGTPV
RPOB_CORGL/631-1051-----------EDDDDLAPG-V-----NEMIRIYVAQKR-----KIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPV
RPOB_AQUAE/798-1374NKVYEEKKETLLKRRDLPPG-V-----ITLVKVFIANKR-----KIKVGDKMAGRHGNKGVISVVLPVEDMPFLPDGTPV
RPOB_DEHM1/652-1123-----------ENGDDLPAR-V-----NKWVQVWVAQKR-----KVSVGDKLAGRHGNKGVISIIAPVEDMPYLPDGTPV
RPOB_RHOBA/666-1160IDERDRKLNSMKRGDELRSG-V-----LQMVKIYIATKR-----TISVGDKMAGRHGNKGVIAKILPIEDMPFLPDGTPI
RPOB_BORBU/669-1059-----------EDVGNLSPG-V-----EEILKVYVAKKR-----KLKEGDKMAGRHGNKGVVAKILPVEDMPYLADGTPL
RPOBC_HELPY/731-1296GEEHEEKLSILEKDDILPNG-V-----IKKVKLYIATKR-----KLKVGDKMAGRHGNKGIVSNIVPVADMPYTADGEPV
RPOB_OSTTA/587-1008------NIEDESIES------------TGSVYVYLVEKR-----RLQVGDKVAGRHGNKGIVSNILPRVDMPYLQSGKAL
RPOB_PHATC/876-1274-----------RTKLTY----K-----FEKIYVFIAQIR-----KIQVGDKIAGRHGNKGIISRILSRQDMPFLPDGTPL
RPOB_PLAF7/527-929--------NKTEKNN------I-----YLKFRIYIGIQK-----YLQLGDKICNRHGHKGIISYISEINDIPYLNNKIQP

PF04941

Q8B9K0_NPVR1/5-748NVLLTPYEYHYKHSIYYNPIIQCAIVENDDV-------------KSLMSKLEQYYYRNFIHLFHTTPVPKLIVSLTNLKN
Q6JP89_NPVNC/3-721DTYVTPFELHHESSCFKDKI----FLNESCV-------------RSLLSRTTLFYCNKHTDVFINIPPAKIMVFMRNLKN
Q91ES4_GVCPM/4-750KTLQTAYEYHNEHS----------LLNSEDVLLRCDETGPMNTTASLMSTMVLEYYKNYLHIFNTIPVAKLIVSLTNLKN

PF00562

F7A8L9_MACMU/487-847DILFNPHGFPSRMTI-----------------------------GMLIESMAGKSAAL----------------------
Q74MN2_NANEQ/133-507DLIFNPHGLPSRMTI-----------------------------GQIIELVAGKVASL----------------------
Q8TXI7_METKA/161-536DLILNPHALPSRETM-----------------------------AHILETLAGKAAAL----------------------
A2SSM5_METLZ/137-540DLVINPHAVPSRMTI-----------------------------GHMLEMIGGKAGAL----------------------
A0RXX0_CENSY/644-1018DVLINPHAFPSRMTV-----------------------------GMFMESITGKAAAL----------------------
Q980R1_SACS2/176-547DIILNPHALPSRMTL-----------------------------GQIMEGIAGKYAAL----------------------
Q8ZYQ9_PYRAE/658-1029DIIVNPHALPSRMTV-----------------------------AQLLESIAGKLGAS----------------------
RPB2_IIV3/689-1053DIIINPNCIPSRMTI-----------------------------NQIISTVMGKLYTVN---------------------
RPB2_IIV6/724-1098DMIINPHCLPSRMTI-----------------------------NQIMASIMGKTCCA----------------------
A0CUT2_PARTE/741-1109DLTINPHCIPSRMTI-----------------------------GHLIECLSSKLASI----------------------
Q583H5_TRYB2/724-1094DLIINPHAIPSRMTV-----------------------------AHLIETLAGKVACY----------------------
A2E7H8_TRIVA/712-1082DIIMNPHALPSRMTI-----------------------------GHLIECLLGKCTAID---------------------
RPO2_MIMIV/726-1093DIIINPNCMPKRMTI-----------------------------GQLIECLLGKLCAV----------------------
E2RU19_GIAIC/792-1189DIIMNPHAIPSRMTI-----------------------------GQLMESVASKLGAL----------------------
Q4A245_EHV8U/685-1058DIIINPHAIPSRMTI-----------------------------GMLMEMVLSKVACY----------------------
C5WRS0_SORBI/754-1125DIVINPHAFPTRQTP-----------------------------GQLLEAALGKGIAC----------------------
Q8QUS6_ISKNN/596-957DLVINPHAFPSRMTV-----------------------------HYLLQMCFELGAVA----------------------
Q4GZE8_TRYB2/675-1036DMIMNPHGFPSRMTV-----------------------------GKLLELVSSKVSAL----------------------
Q5CPZ8_CRYPI/819-1197DLIMNPHGFPSRMTV-----------------------------GKLLELISSKASVL----------------------
RPC2_MOUSE/668-1041DIIMNPHGFPSRMTV-----------------------------GKLIELLAGKAGVL----------------------
NRPC2_ARATH/690-1065DLIMNPHGFPSRMTV-----------------------------GKMIELLGSKAGVS----------------------
A0D7M6_PARTE/655-1033DLIMNPHGYPSRMTI-----------------------------AKLMELLCGKLGAL----------------------
Q236N3_TETTS/664-1046DLIMNPHGYPSRMTV-----------------------------GKLLELLGSKAAVL----------------------
A8B2N4_GIAIC/763-1143DLIMNPHGYPSRMTV-----------------------------AKLLELLSNKSGCF----------------------
Q4UB41_THEAN/766-1155DLIMNPHGFPSRMTV-----------------------------GKLLELVASKSSVF----------------------
A2E3T5_TRIVA/688-1052DMIMNPHGFPSRMTV-----------------------------GKMIELVSGKVGIL----------------------
RPA2_DICDI/664-1031DVIINPNAFPSRMTI-----------------------------GMLVEILAGKAGAI----------------------
A0A1D8PQM4_CANAL/675-1039DVIINPHAFPSRMTI-----------------------------GMFVESLAGKAGAL----------------------
Q27493_CAEEL/649-1005DIIFNPHGFPSRMTI-----------------------------GMMIESMAGKAAAT----------------------
Q5CSG7_CRYPI/759-1165DILFNPHGFPSRMTI-----------------------------GMLLESMGGKAACI----------------------
A8B827_GIAIC/683-1140DLIINPHAFPSRMTV-----------------------------GMLIESLASKIGVH----------------------
Q22C62_TETTS/684-1046DVIINPHAFPSRMTI-----------------------------GMLIESMAGKSGAL----------------------
Q8II17_PLAF7/944-1400DIIFNPHGIPSRMTI-----------------------------GMLIESICGKAASL----------------------
Q4N2L4_THEPA/739-1128DVIFNPHGLPSRMTI-----------------------------GKLIEGMAGKVASI----------------------
RPB2_ASFB7/782-1141DLIVNPHSHPSRMTN-----------------------------GQMIETTVGLANAL----------------------
RPOB_SALRD/696-1211DLVLNPLGVPSRMNL-----------------------------GQIYETLLGWAGDR----------------------
R7EM77_9BACE/681-1194DIVLNPLGVPSRMNI-----------------------------GQIFEAVLGRAGKN----------------------
RPOB_UREPA/839-1300DIMLNPLGVPSRMNI-----------------------------GQILELHLGYAAAEIGKKQLIQIAIDQLGYEKYISL
A5IZ53_MYCAP/720-1106DVMLNPQGVPSRMNI-----------------------------GQVLEVHLGMAARS----------------------
S5LVD1_9MOLU/753-1138DIMLNPQGVPSRMNI-----------------------------GQVLEIHLGMAAKK----------------------
RPOB_DESOH/725-1286DMVLNPLGVPSRMNV-----------------------------GQILEIHLGRAARVLGDQISTMLEEKKYKDLKKKLS
RPOB_GEOLS/853-1417EIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKGLGWKIQKMLEEHTSEENLKKFI
RPOB_LACDA/681-1067DICLNPMGVPSRMNI-----------------------------GQLLEIHLGRAARA----------------------
RPOB_DESAG/716-1278DIVLNPLGVPSRMNI-----------------------------GQIMETHLGWAAKEMGRKLALMLEHGQDLASVREQV
RPOB_SYNAS/719-1284DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKGLGEKLNDMLDSYQKGNQLRDEL
R5KT32_9FIRM/702-1129DIVLNPLGVPSRMNI-----------------------------GQVLEIHLSLAAKV----------------------
D6Z3M9_DESAT/721-1284DIVLNPLGVPSRMNV-----------------------------GQLLEIHLGLAAKKLGEQVQRLAQTRDLAAVKKKLA
RPOB_NEOSM/713-1263DIILNPLGVPSRMNV-----------------------------GQILETHLGWAAYNLGKKISKLLDEGNYSEVKSLVL
RPOB_EHRCR/741-1291DIILNSLGVPSRMNV-----------------------------GQILETHLGWASVNLGKKIGHILDNLDELTVSHLRN
RPOB_PARDP/741-1300DLVFNPLGVPSRMNV-----------------------------GQILETHMGWASRGLGIKIDEALQDYRRNGDMTPVR
RPOB_PELUB/727-1287DIVLNPLGVPSRMNV-----------------------------GQILETHLGWACKEFGEEVKRLVNENNKKFEKTEKI
RPOB_FUSNN/675-1063DVVLNPLGVPSRMNI-----------------------------GQVLEVHLGMAMR-T---------------------
RPOB_MAGMM/724-1281DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAARGMGFKIEEALKQHRKGVADVLRR
RPOB_PHOPR/717-1263EIVLNPLGVPSRMNI-----------------------------GQILETHMGLAAKGIGDKLNEMLKQQQELHKFRNFL
RPOB_FRATT/720-1276DVCLNPLGIPSRMNI-----------------------------GQILEAHLGLASYGLGKKIEKTLEKTRKAAELRKTL
RPOB_RUTMC/723-1282DVVLNPLGVPSRMNV-----------------------------GQVLEVHLGYAAKGLGYKITAMLDEKRTDMVKQIRD
A0A454XJX6_COMT2/725-1292DIVLNPLGVPSRMNI-----------------------------GQVLEVHLGWAGKGLGQRIGDMLQKEARAAEVRAFL
RPOB_KORVE/830-1399EIVLNPLGVPSRMNV-----------------------------GQILETHLGWAGHELGKKIAEFMVENSEAGQVRKHL
RPOB_THEMA/760-1174QMVLNPLGIPSRMNV-----------------------------GQILETHLGWLAKL----------------------
RPOB_DEIGD/619-1059DLVFNPLGVPSRMNL-----------------------------GQILETHLGEVARL----------------------
RPOB_CORGL/631-1051DIILNTHGVPRRMNI-----------------------------GQVLETHLGWLASAGWSVDPEDPENAE---------
RPOB_AQUAE/798-1374DIVLNPLGVPSRMNV-----------------------------GQILETHLGWAAKELGKKIGEMIEKGRDRKAITEYL
RPOB_DEHM1/652-1123DVVLNPIGVPSRMNL-----------------------------GQILETHLGWAGHL----------------------
RPOB_RHOBA/666-1160QIMLNPLGVPSRMNV-----------------------------GQILETHLGWAGAK----------------------
RPOB_BORBU/669-1059DICLNPLGVPSRMNI-----------------------------GQLMESQLGLAGKY----------------------
RPOBC_HELPY/731-1296DIVLNPLGVPSRMNI-----------------------------GQILEMHLGLVGKEFGKQIARMLEDKTKDFAKELRA
RPOB_OSTTA/587-1008DMVLNPLGVPSRMNV-----------------------------GQIFECLLGLAANT----------------------
RPOB_PHATC/876-1274DILLNPLGVPSRMNV-----------------------------GQLYECLLGLAGDK----------------------
RPOB_PLAF7/527-929DIFISAISIPSRINI-----------------------------GQIFEGIYGLNSLYLNTRYII---------------

PF04941

Q8B9K0_NPVR1/5-748AMPVF---EYKKENCVTGL--PNGYSVAVNKSVLLNNKMFKLWTLVRDNK-LMTAEDPYIPH------------------
Q6JP89_NPVNC/3-721ASPVFIPSSFVPEKYMKFMKNENKNCIVVDSKHYCNDKMIYLWTMIGDDR-LKTSEDPYVPN------------------
Q91ES4_GVCPM/4-750GMVV-------QKKGFKSL--PVGNSVVVEDSVYCNDRMFCLWTVVMDSR-LKTAEDPYVPH------------------

PF00562

F7A8L9_MACMU/487-847------------------------------------------------HG-LCHDATPFIF-------------------
Q74MN2_NANEQ/133-507------------------------------------------------RG-KAVDGTPWE--------------------
Q8TXI7_METKA/161-536------------------------------------------------SG-KRIDGSAFT--------------------
A2SSM5_METLZ/137-540------------------------------------------------EG-SRVNATSFR--------------------
A0RXX0_CENSY/644-1018------------------------------------------------RG-TQFDGSAFV--------------------
Q980R1_SACS2/176-547------------------------------------------------SG-NIVDATPFY--------------------
Q8ZYQ9_PYRAE/658-1029------------------------------------------------TG-QLIDATPFEG-------------------
RPB2_IIV3/689-1053-----------------------------------------------PNP-RFRNGNSFQE-------------------
RPB2_IIV6/724-1098-----------------------------------------------KNE-TFGDASPFQES------------------
A0CUT2_PARTE/741-1109------------------------------------------------KG-QFNDATPFA--------------------
Q583H5_TRYB2/724-1094------------------------------------------------KG-GEVYATPFC--------------------
A2E7H8_TRIVA/712-1082----------------------------------------------PQNA-DEGDATPFC--------------------
RPO2_MIMIV/726-1093------------------------------------------------KG-VYGDATPFT--------------------
E2RU19_GIAIC/792-1189------------------------------------------------SG-HEVDGTAFN--------------------
Q4A245_EHV8U/685-1058------------------------------------------------EG-ETQDGTPFT--------------------
C5WRS0_SORBI/754-1125------------------------------------------------KG-TMRYATPFTT-------------------
Q8QUS6_ISKNN/596-957------------------------------------------------GGGKGYDATAFN--------------------
Q4GZE8_TRYB2/675-1036------------------------------------------------TG-KFGDGTAFG--------------------
Q5CPZ8_CRYPI/819-1197------------------------------------------------DG-NYRYGTAFG--------------------
RPC2_MOUSE/668-1041------------------------------------------------DG-RFHYGTAFG--------------------
NRPC2_ARATH/690-1065------------------------------------------------CG-RFHYGSAFGE-------------------
A0D7M6_PARTE/655-1033------------------------------------------------EG-KFKYGTAFG--------------------
Q236N3_TETTS/664-1046------------------------------------------------SG-QFKYGTAFG--------------------
A8B2N4_GIAIC/763-1143------------------------------------------------RG-EQTDGTCFR--------------------
Q4UB41_THEAN/766-1155------------------------------------------------SG-NFVDSTPFS--------------------
A2E3T5_TRIVA/688-1052------------------------------------------------TG-RIGNGTAFS--------------------
RPA2_DICDI/664-1031------------------------------------------------HG-KFQDATAFQF-------------------
A0A1D8PQM4_CANAL/675-1039------------------------------------------------HG-IAQDSTPWKF-------------------
Q27493_CAEEL/649-1005------------------------------------------------HG-ENYDASPFVF-------------------
Q5CSG7_CRYPI/759-1165------------------------------------------------HGARSLDATPFNIN------------------
A8B827_GIAIC/683-1140------------------------------------------------YA-DFVDSSPFQW-------------------
Q22C62_TETTS/684-1046------------------------------------------------NG-NILETQPFQN-------------------
Q8II17_PLAF7/944-1400------------------------------------------------YG-KRIDATPFRKYTQQKSFNNPWIDNCGIKG
Q4N2L4_THEPA/739-1128------------------------------------------------YG-KPQDSTCFQAY------------------
RPB2_ASFB7/782-1141------------------------------------------------QG-VVTDGTAFL--------------------
RPOB_SALRD/696-1211------------------------------------------------LG-VKYATPIFDG-------------------
R7EM77_9BACE/681-1194------------------------------------------------LG-VKFATPIFDG-------------------
RPOB_UREPA/839-1300FGINEIIAKKLYENISNLIKHKQAKQAKDIDLIDVTIILKELGLSYDDIG-IKISTPVFDG-------------------
A5IZ53_MYCAP/720-1106------------------------------------------------LG-CKFVTPVFDG-------------------
S5LVD1_9MOLU/753-1138------------------------------------------------LG-IKVNTPVFEG-------------------
RPOB_DESOH/725-1286AVF--------------------NKEIPAAEIEAMSSARLCEFASEYKDG-VHMETPVFD--------------------
RPOB_GEOLS/853-1417RET-------------------YDNADFNKILDTMDREELLLVARRLSRG-VPMASPVFE--------------------
RPOB_LACDA/681-1067------------------------------------------------LG-IHVATPVFDG-------------------
RPOB_DESAG/716-1278KTV-------------------FASDAISSEVDNMDDETFVRSVRRLRDG-IVTKTPVFDG-------------------
RPOB_SYNAS/719-1284KGI-------------------YQSREFEKFVDGATEEETYQFVRKLRRG-IAVSSPVFDG-------------------
R5KT32_9FIRM/702-1129------------------------------------------------LG-FNIATPVFDG-------------------
D6Z3M9_DESAT/721-1284AVY--------------------SKEEYEQLLADLTDDDLLELASRMGKG-LHMATPVFDG-------------------
RPOB_NEOSM/713-1263EIY-------------------KNDRKMMARLNEMTDAEIVEYSRSLRGG-VPVAASVFEG-------------------
RPOB_EHRCR/741-1291FLYQ-----------------VYDGQDLKDNIQSMSDEDLLVFAERLRDG-VPMAAPVFEG-------------------
RPOB_PARDP/741-1300EAMQN----------------GYGDDFYAETFEGMEDETLLEHADAVRGG-VPISTPVFDG-------------------
RPOB_PELUB/727-1287SSFLK---------------SVYGKEVFDGGIEKLNKTEFSDLCENLQNG-IAISTPVFDG-------------------
RPOB_FUSNN/675-1063----------------------------------------------LNGG-TCIATPVFDG-------------------
RPOB_MAGMM/724-1281QFEE-----------------IYDNTRESAEIAALSDDQLVDMAKNLQYG-VPTATPVFDG-------------------
RPOB_PHOPR/717-1263QKVY-----------------DLGDTRQDVDIAALSDDQVHTLVQNLRDG-LPIATPVFDG-------------------
RPOB_FRATT/720-1276EEVY------------------NSVGDKKVNLEALNDEEILTLCDNLKGG-VPIATPVFDG-------------------
RPOB_RUTMC/723-1282FLDE-----------------VYNSYGKQENLASFSDEEIIELASNLREG-VPMATPVFDG-------------------
A0A454XJX6_COMT2/725-1292EEI-------------------YNRSGRKEELSQLDDGEVMSMAKELTTG-VPFATPVFDG-------------------
RPOB_KORVE/830-1399KQL-------------------FKDTAFVDHVTELDDEMLLKVAKGMQDG-VFFGSAVFDG-------------------
RPOB_THEMA/760-1174------------------------------------------------TG-KWFATPVFEG-------------------
RPOB_DEIGD/619-1059------------------------------------------------TG-QKFVTPVFDS-------------------
RPOB_CORGL/631-1051-----------------------------------LVKTLPADLLEVPAG-SLTATPVFDG-------------------
RPOB_AQUAE/798-1374KEIFAIGD----------KDGENAKFIEEFLNSLSEEEFWSVVRDYAERG-IPMATPAFEG-------------------
RPOB_DEHM1/652-1123------------------------------------------------LG-FRVATPVFDG-------------------
RPOB_RHOBA/666-1160------------------------------------------------LG-FQALTPIFDG-------------------
RPOB_BORBU/669-1059------------------------------------------------LG-ESYNVPVFES-------------------
RPOBC_HELPY/731-1296KMLEIAN------------AINEKDPLTIHALENCSDEELLEYAKDWSKG-VKMAIPVFEG-------------------
RPOB_OSTTA/587-1008------------------------------------------------LK-QNFKVLPFDEMH-----------------
RPOB_PHATC/876-1274------------------------------------------------LN-ARFKILPFDEMY-----------------
RPOB_PLAF7/527-929-----------------------------------------SNNLNKNY--YNNYNHIFNYYK-----------------

PF04941

Q8B9K0_NPVR1/5-748--------------------------------IALPICLYNNKVNKLKGKLVVGTKQSCLVKFTNSSDKNYVALDDGLVL
Q6JP89_NPVNC/3-721--------------------------------XNQPFVVYNLRSIILRG--ISTLNENEYFRITSNVENNVLNTLYGYKL
Q91ES4_GVCPM/4-750--------------------------------ARLPIKIYHNKINRIKGK-VSGDNNE--FVYEKSGANNIIEVEGGNCL

PF00562

F7A8L9_MACMU/487-847--------------------------------SE-----------------------------------------ENSAL
Q74MN2_NANEQ/133-507----------------------------------E--------------------------------------EP----V
Q8TXI7_METKA/161-536----------------------------------SN------------------------------------PKE-A--Y
A2SSM5_METLZ/137-540----------------------------------K--------------------------------------TQ----V
A0RXX0_CENSY/644-1018----------------------------------G--------------------------------------EK----M
Q980R1_SACS2/176-547----------------------------------K--------------------------------------TP----I
Q8ZYQ9_PYRAE/658-1029--------------------------------VK----------------------------------------E-----
RPB2_IIV3/689-1053--------------------------------NSN--------------------------------------TI----L
RPB2_IIV6/724-1098------------------------------SLEKPQ-------------------------------------DK----I
A0CUT2_PARTE/741-1109----------------------------------Q--------------------------------------IL----V
Q583H5_TRYB2/724-1094----------------------------------S--------------------------------------VV----V
A2E7H8_TRIVA/712-1082----------------------------------G--------------------------------------VT----V
RPO2_MIMIV/726-1093----------------------------------S--------------------------------------VD----L
E2RU19_GIAIC/792-1189----------------------------------AP------------------------------------PGS-T--D
Q4A245_EHV8U/685-1058----------------------------------G--------------------------------------NN----I
C5WRS0_SORBI/754-1125--------------------------------AS----------------------------------------V-----
Q8QUS6_ISKNN/596-957---------------------------------S----------------------------------------D----G
Q4GZE8_TRYB2/675-1036----------------------------------G--------------------------------------DK----A
Q5CPZ8_CRYPI/819-1197----------------------------------G--------------------------------------TP----L
RPC2_MOUSE/668-1041----------------------------------G--------------------------------------SK----V
NRPC2_ARATH/690-1065--------------------------------RSGH------------------------------------ADK----V
A0D7M6_PARTE/655-1033----------------------------------G--------------------------------------EN----V
Q236N3_TETTS/664-1046----------------------------------G--------------------------------------DK----M
A8B2N4_GIAIC/763-1143----------------------------------TKT-----------------------------------DET-F--L
Q4UB41_THEAN/766-1155----------------------------------NSYSDNL--------------------------CNDLNNTKTD-NM
A2E3T5_TRIVA/688-1052----------------------------------S--------------------------------------DR----V
RPA2_DICDI/664-1031--------------------------------DENN-------------------------------------TA----I
A0A1D8PQM4_CANAL/675-1039--------------------------------NEQD-------------------------------------TP----A
Q27493_CAEEL/649-1005--------------------------------NEDN-------------------------------------TA----I
Q5CSG7_CRYPI/759-1165------------------------------ISDDLSRSEENCE-----------------------DDKAGEKTT----V
A8B827_GIAIC/683-1140--------------------------------SDER-------------------------------------RA----I
Q22C62_TETTS/684-1046--------------------------------YQD--------------------------------------DD-I--V
Q8II17_PLAF7/944-1400FLEKNDTIKSDLDTCQKEKDKNKNINNNNNNKIKENKYNNSNDSNASIDSDDNTNNCNDKRDEEEKKANITYDEK----I
Q4N2L4_THEPA/739-1128------------------------------YSENPENGDE----------------------------EMEEVDV----V
RPB2_ASFB7/782-1141----------------------------------P--------------------------------------IN----V
RPOB_SALRD/696-1211--------------------------------AS----------------------------------------L-----
R7EM77_9BACE/681-1194--------------------------------AS----------------------------------------L-----
RPOB_UREPA/839-1300--------------------------------AN----------------------------------------H-----
A5IZ53_MYCAP/720-1106--------------------------------VK----------------------------------------K-----
S5LVD1_9MOLU/753-1138--------------------------------VK----------------------------------------E-----
RPOB_DESOH/725-1286----------------------------------GA-------------------------------------KE-----
RPOB_GEOLS/853-1417----------------------------------GA-------------------------------------GE-----
RPOB_LACDA/681-1067--------------------------------AS----------------------------------------E-----
RPOB_DESAG/716-1278--------------------------------AT----------------------------------------E-----
RPOB_SYNAS/719-1284--------------------------------AT----------------------------------------E-----
R5KT32_9FIRM/702-1129--------------------------------AD----------------------------------------E-----
D6Z3M9_DESAT/721-1284--------------------------------AQ----------------------------------------E-----
RPOB_NEOSM/713-1263--------------------------------PK----------------------------------------T-----
RPOB_EHRCR/741-1291--------------------------------PK----------------------------------------D-----
RPOB_PARDP/741-1300--------------------------------AK----------------------------------------E-----
RPOB_PELUB/727-1287--------------------------------AK----------------------------------------E-----
RPOB_FUSNN/675-1063--------------------------------AT----------------------------------------E-----
RPOB_MAGMM/724-1281--------------------------------AI----------------------------------------E-----
RPOB_PHOPR/717-1263--------------------------------AP----------------------------------------E-----
RPOB_FRATT/720-1276--------------------------------AK----------------------------------------E-----
RPOB_RUTMC/723-1282--------------------------------IK----------------------------------------E-----
A0A454XJX6_COMT2/725-1292--------------------------------AS----------------------------------------E-----
RPOB_KORVE/830-1399--------------------------------ST----------------------------------------E-----
RPOB_THEMA/760-1174--------------------------------AK----------------------------------------E-----
RPOB_DEIGD/619-1059--------------------------------AT----------------------------------------E-----
RPOB_CORGL/631-1051--------------------------------AS----------------------------------------N-----
RPOB_AQUAE/798-1374--------------------------------AE----------------------------------------E-----
RPOB_DEHM1/652-1123--------------------------------AD----------------------------------------D-----
RPOB_RHOBA/666-1160--------------------------------AS----------------------------------------E-----
RPOB_BORBU/669-1059--------------------------------AT----------------------------------------N-----
RPOBC_HELPY/731-1296--------------------------------IS----------------------------------------Q-----
RPOB_OSTTA/587-1008-----------------------------GAEVS----------------------------------------R-----
RPOB_PHATC/876-1274-----------------------------GLEIS----------------------------------------R-----
RPOB_PLAF7/527-929-----------------------------YNYNN----------------------------------------N-----

PF04941

Q8B9K0_NPVR1/5-748YMA-------------------------------GVLVT---------------------NAK-INW-------------
Q6JP89_NPVNC/3-721IGV-------------------------------CQITS---------------------QNA-INW-------------
Q91ES4_GVCPM/4-750CMF-------------------------------GTLLC---------------------NNK-INW-------------

PF00562

F7A8L9_MACMU/487-847EYF-------------------------------GEMLK---------------------AAG-YNF-------------
Q74MN2_NANEQ/133-507EDL-------------------------------RKQLL---------------------RLG-FRE-------------
Q8TXI7_METKA/161-536EEI-------------------------------KKMLR---------------------ELG-FEP-------------
A2SSM5_METLZ/137-540EKIFDSSFAQNRLLNDKEIGKDVKSSTLTREQVLRHQLA---------------------EAG-FAH-------------
A0RXX0_CENSY/644-1018EEV-------------------------------REVMD---------------------TAG-FKY-------------
Q980R1_SACS2/176-547EQL-------------------------------QNEIL---------------------RYG-YLP-------------
Q8ZYQ9_PYRAE/658-1029EDL-------------------------------RKLLL---------------------KLG-YKW-------------
RPB2_IIV3/689-1053KEL-------------------------------CHHLK---------------------LNG-FDP-------------
RPB2_IIV6/724-1098HAL-------------------------------CKELE---------------------ECG-YNY-------------
A0CUT2_PARTE/741-1109NDI-------------------------------ANELH---------------------KVG-WQK-------------
Q583H5_TRYB2/724-1094EDF-------------------------------GKALT---------------------QLK-LNR-------------
A2E7H8_TRIVA/712-1082DAI-------------------------------AKRLQ---------------------DAG-FEK-------------
RPO2_MIMIV/726-1093NAI-------------------------------NDELV---------------------AAG-YEE-------------
E2RU19_GIAIC/792-1189KQI-------------------------------AADLH---------------------ARG-YQK-------------
Q4A245_EHV8U/685-1058ELI-------------------------------ADRLE---------------------THG-MQR-------------
C5WRS0_SORBI/754-1125DVI-------------------------------AEQLH---------------------RAG-YSR-------------
Q8QUS6_ISKNN/596-957ADL-------------------------------LKTLE---------------------ELG-Y---------------
Q4GZE8_TRYB2/675-1036EDL-------------------------------GEELI---------------------RHG-YNY-------------
Q5CPZ8_CRYPI/819-1197EES-------------------------------AKCLV---------------------EHG-FHY-------------
RPC2_MOUSE/668-1041KDV-------------------------------CEDLV---------------------RHG-YNY-------------
NRPC2_ARATH/690-1065ETI-------------------------------SATLV---------------------EKG-FSY-------------
A0D7M6_PARTE/655-1033LQV-------------------------------GEELL---------------------KRG-FHY-------------
Q236N3_TETTS/664-1046ADL-------------------------------SSILV---------------------QNG-FSY-------------
A8B2N4_GIAIC/763-1143AEL-------------------------------YDSLR---------------------VAG-FSY-------------
Q4UB41_THEAN/766-1155SDI-------------------------------CNILI---------------------KNG-FHP-------------
A2E3T5_TRIVA/688-1052KDI-------------------------------ADDLI---------------------AAG-YSY-------------
RPA2_DICDI/664-1031DFF-------------------------------GEQLA---------------------KAG-FNR-------------
A0A1D8PQM4_CANAL/675-1039DYF-------------------------------GEQLL---------------------KAG-YNY-------------
Q27493_CAEEL/649-1005NHF-------------------------------GELLT---------------------KAG-YNY-------------
Q5CSG7_CRYPI/759-1165DYF-------------------------------GKALE---------------------RAG-FQY-------------
A8B827_GIAIC/683-1140DVF-------------------------------GEQLL---------------------KTGQFNR-------------
Q22C62_TETTS/684-1046NYF-------------------------------GKQLQ---------------------SHG-YNY-------------
Q8II17_PLAF7/944-1400DYF-------------------------------AKLLL---------------------NKG-YDY-------------
Q4N2L4_THEPA/739-1128DYF-------------------------------GKSLI---------------------KSG-YEY-------------
RPB2_ASFB7/782-1141QLL-------------------------------SERLA---------------------QEG-LRF-------------
RPOB_SALRD/696-1211EDV-------------------------------GDELE---------------------K-----AGL-----------
R7EM77_9BACE/681-1194DDL-------------------------------NEWTD---------------------KAG-LPR-------------
RPOB_UREPA/839-1300DDI-------------------------------VSIMN---------------------E-----ANID----------
A5IZ53_MYCAP/720-1106EAI-------------------------------QDVIS---------------------EAG-LPL-------------
S5LVD1_9MOLU/753-1138QEL-------------------------------QDIMV---------------------EAG-MDN-------------
RPOB_DESOH/725-1286AEI-------------------------------KALLK---------------------EGG-ADE-------------
RPOB_GEOLS/853-1417AKI-------------------------------KELLT---------------------RAG-FAT-------------
RPOB_LACDA/681-1067DDV-------------------------------WDFVR---------------------E-----AGV-----------
RPOB_DESAG/716-1278EQI-------------------------------WSWME---------------------Q-----AGL-----------
RPOB_SYNAS/719-1284SDI-------------------------------RNMLK---------------------L-----ANL-----------
R5KT32_9FIRM/702-1129YDI-------------------------------MDTLE---------------------LANDY-ANTEWEDFQAKYKD
D6Z3M9_DESAT/721-1284EEI-------------------------------RRLLV---------------------EAG-LDE-------------
RPOB_NEOSM/713-1263DEI-------------------------------ERLLV---------------------L-----AGK-----------
RPOB_EHRCR/741-1291SQI-------------------------------SNLLR---------------------LAD-LDV-------------
RPOB_PARDP/741-1300ADI-------------------------------NDALR---------------------R-----AGF-----------
RPOB_PELUB/727-1287KDV-------------------------------SEMLE---------------------L-----AKL-----------
RPOB_FUSNN/675-1063EQV-------------------------------KDYLE---------------------K-----QGY-----------
RPOB_MAGMM/724-1281SDI-------------------------------SSWLN---------------------K-----AGL-----------
RPOB_PHOPR/717-1263SSI-------------------------------KELLK---------------------L-----GDL-----------
RPOB_FRATT/720-1276EDI-------------------------------KSLLK---------------------IGG-FAT-------------
RPOB_RUTMC/723-1282KDI-------------------------------KSLLK---------------------L-----ADL-----------
A0A454XJX6_COMT2/725-1292AEI-------------------------------KDMLK---------------------LAY-PDDIAAAK--------
RPOB_KORVE/830-1399AEI-------------------------------KSLLD---------------------Q-----AGL-----------
RPOB_THEMA/760-1174DEI-------------------------------LRPLY---------------------EER-KKRGLHLG--------
RPOB_DEIGD/619-1059EAI-------------------------------KEMLEVAAAERLQRRKDEGFELDKREQEVLDRAGKLGVISPPNG--
RPOB_CORGL/631-1051EEL-------------------------------AGLLA---------------------NSR-PNRDGDV---------
RPOB_AQUAE/798-1374DAI-------------------------------KELLK---------------------K-----AGL-----------
RPOB_DEHM1/652-1123TAI-------------------------------EDALA---------------------RSW-LSAKAGATDMSPENKR
RPOB_RHOBA/666-1160SEI-------------------------------NDCLA---------------------E-----AGL-----------
RPOB_BORBU/669-1059EQI-------------------------------QEKLK---------------------TAG-FNP-------------
RPOBC_HELPY/731-1296EKF-------------------------------YKLFE---------------------L-----AKI-----------
RPOB_OSTTA/587-1008GFV-------------------------------YHYLY---------------------K-----SRLLTQQK------
RPOB_PHATC/876-1274ILI-------------------------------NKKLR---------------------Q-----ASIAKNES------
RPOB_PLAF7/527-929FNI-------------------------------NSKMS---------------------YNY-----------------

PF04941

Q8B9K0_NPVR1/5-748----------------------------------------------------------------------VYDGRRYKIE
Q6JP89_NPVNC/3-721----------------------------------------------------------------------NTLGKKIKIT
Q91ES4_GVCPM/4-750----------------------------------------------------------------------NHDGKKYKIE

PF00562

F7A8L9_MACMU/487-847------------------------------------------------------------------------YGTERLYS
Q74MN2_NANEQ/133-507------------------------------------------------------------------------DGTETMYD
Q8TXI7_METKA/161-536------------------------------------------------------------------------TGKEVMYD
A2SSM5_METLZ/137-540------------------------------------------------------------------------TGREVMYD
A0RXX0_CENSY/644-1018------------------------------------------------------------------------SGKEIMYD
Q980R1_SACS2/176-547------------------------------------------------------------------------DATEVVYD
Q8ZYQ9_PYRAE/658-1029------------------------------------------------------------------------DGKEVMYS
RPB2_IIV3/689-1053------------------------------------------------------------------------SGSEVMYS
RPB2_IIV6/724-1098------------------------------------------------------------------------NGTETMMC
A0CUT2_PARTE/741-1109------------------------------------------------------------------------WGNEVMTN
Q583H5_TRYB2/724-1094------------------------------------------------------------------------YGNERLYN
A2E7H8_TRIVA/712-1082------------------------------------------------------------------------YGNETLYN
RPO2_MIMIV/726-1093------------------------------------------------------------------------WGNETMYN
E2RU19_GIAIC/792-1189------------------------------------------------------------------------HNYEAMMN
Q4A245_EHV8U/685-1058------------------------------------------------------------------------YGNEMLYN
C5WRS0_SORBI/754-1125------------------------------------------------------------------------WGTENVLN
Q8QUS6_ISKNN/596-957-------------------------------------------------------------------------AKQVMYC
Q4GZE8_TRYB2/675-1036------------------------------------------------------------------------HGKDIFYS
Q5CPZ8_CRYPI/819-1197------------------------------------------------------------------------SGKEYLTS
RPC2_MOUSE/668-1041------------------------------------------------------------------------LGKDYVTS
NRPC2_ARATH/690-1065------------------------------------------------------------------------SGKDLLYS
A0D7M6_PARTE/655-1033------------------------------------------------------------------------QGKDCLIS
Q236N3_TETTS/664-1046------------------------------------------------------------------------TGKDVIIS
A8B2N4_GIAIC/763-1143------------------------------------------------------------------------SGKDVLYS
Q4UB41_THEAN/766-1155------------------------------------------------------------------------KGKEILYS
A2E3T5_TRIVA/688-1052------------------------------------------------------------------------SGKDMLMS
RPA2_DICDI/664-1031------------------------------------------------------------------------FGNEQMYS
A0A1D8PQM4_CANAL/675-1039------------------------------------------------------------------------HGNEPMYS
Q27493_CAEEL/649-1005------------------------------------------------------------------------YGNETFYS
Q5CSG7_CRYPI/759-1165------------------------------------------------------------------------YGCEPLYN
A8B827_GIAIC/683-1140------------------------------------------------------------------------YGSEVMYS
Q22C62_TETTS/684-1046------------------------------------------------------------------------YGNEVMYS
Q8II17_PLAF7/944-1400------------------------------------------------------------------------YGTELLYS
Q4N2L4_THEPA/739-1128------------------------------------------------------------------------YGTESMYC
RPB2_ASFB7/782-1141------------------------------------------------------------------------NGCQKMFN
RPOB_SALRD/696-1211----------------------------------------------------------------------PRDGKVQLYD
R7EM77_9BACE/681-1194------------------------------------------------------------------------YGKTTLYD
RPOB_UREPA/839-1300--------------------------------------------------------------------IENNKGKQVLYD
A5IZ53_MYCAP/720-1106------------------------------------------------------------------------SGKQTLID
S5LVD1_9MOLU/753-1138------------------------------------------------------------------------YGKVTLID
RPOB_DESOH/725-1286------------------------------------------------------------------------TGQAILYD
RPOB_GEOLS/853-1417------------------------------------------------------------------------NGQVTLFD
RPOB_LACDA/681-1067----------------------------------------------------------------------DSDGKTVLYD
RPOB_DESAG/716-1278----------------------------------------------------------------------ANDGKTELYD
RPOB_SYNAS/719-1284----------------------------------------------------------------------PSTGQAILYD
R5KT32_9FIRM/702-1129TLRPEVM---------------------------------------------EYLGEHLDHRDEWRGVPINRDGKVRLRD
D6Z3M9_DESAT/721-1284------------------------------------------------------------------------IGQLDLYD
RPOB_NEOSM/713-1263----------------------------------------------------------------------DPSGQEVLYD
RPOB_EHRCR/741-1291------------------------------------------------------------------------SGQVDLYD
RPOB_PARDP/741-1300----------------------------------------------------------------------DTSGQSIVFD
RPOB_PELUB/727-1287----------------------------------------------------------------------PTSGQTNLWD
RPOB_FUSNN/675-1063----------------------------------------------------------------------PRTGKVTLYD
RPOB_MAGMM/724-1281----------------------------------------------------------------------PTSGQIQLID
RPOB_PHOPR/717-1263----------------------------------------------------------------------PESGQLKMFD
RPOB_FRATT/720-1276------------------------------------------------------------------------NGQMKLFD
RPOB_RUTMC/723-1282----------------------------------------------------------------------PESGQEQLYD
A0A454XJX6_COMT2/725-1292-------------------------------------------------------------------GLTETRTQAYLYD
RPOB_KORVE/830-1399----------------------------------------------------------------------PTSGKTFLYD
RPOB_THEMA/760-1174------------------------------------------------------------------DDENNPNGKVVLRD
RPOB_DEIGD/619-1059-------------------------------------------------------------DYAAAQMQLARTGKSVLYD
RPOB_CORGL/631-1051--------------------------------------------------------------------MVNADGKATLID
RPOB_AQUAE/798-1374----------------------------------------------------------------------PENGKTTLYD
RPOB_DEHM1/652-1123PSTDTAKAVEWIKQQGFDGKKVFDERHPGLAKEVSLKLWLKDMGVDASSLSGAELEKKAYEVSSQSRLPSPIVGKSVLRD
RPOB_RHOBA/666-1160----------------------------------------------------------------------PAHGKIRLTD
RPOB_BORBU/669-1059------------------------------------------------------------------------TSKEILYD
RPOBC_HELPY/731-1296----------------------------------------------------------------------AMDGKMDLYD
RPOB_OSTTA/587-1008-----------------------------------------------------------------WLFKPNSPGKSIVFD
RPOB_PHATC/876-1274-----------------------------------------------------------------WLFNPYAPGKMVLID
RPOB_PLAF7/527-929-------------------------------------------------------------------------NKYYLKN

PF04941

Q8B9K0_NPVR1/5-748TCTNGNF--NVYKVYVYFRQ---IKNQKI----EKLDASMVVN-GDNVMLKIVIVT-STNDLE--GIKICGIHGQKGVFN
Q6JP89_NPVNC/3-721SLRSKNM--YIYKIMMYFHNNFDIRSLKVKCEFEKINKEYI--------VKIRHVF-EYKDCV--GIKICSVHGQKGVLN
Q91ES4_GVCPM/4-750FCTSKQW--CVYKFYMYFRK---VGGQVV----ERVDSEMTTDESGSVFVKLEMVY-SVSDLE--GLKICGVHGQKGVLH

PF00562

F7A8L9_MACMU/487-847GISGLELEADIFIGVVYYQR---LRHMVS----DKF-----------------QVR-TTGARD--RVTNQPIGGRN----
Q74MN2_NANEQ/133-507PITGEEYKVKIFVGVMWYHK---LKFLAA----NKL-----------------HAR-ARGPMA--ILTRQPTEGKSR---
Q8TXI7_METKA/161-536GRTGQKLEAEVFIGVCLYRK---LYHMVK----DKY-----------------HAR-SRGPVQ--VLTRQPTEGRAR---
A2SSM5_METLZ/137-540GITGRRFQADIYIGVIYYQK---LYHMVS----TKM-----------------HAR-SRGPVQ--VLTRQPTEGRAR---
A0RXX0_CENSY/644-1018GRTGKAFPVEVFIGVVYYQK---LHHMVA----DKI-----------------HAR-ARGQVQ--MLTKQPTEGRAR---
Q980R1_SACS2/176-547GRTGQKIKSRIYFGVVYYQK---LHHMVA----DKL-----------------HAR-ARGPVQ--ILTRQPTEGRAR---
Q8ZYQ9_PYRAE/658-1029GITGERLVADIFIGIVYYQK---LHHMVA----DKI-----------------HAR-ARGPVQ--ILTRQPTEGRSR---
RPB2_IIV3/689-1053GFTGERIQSTIFMGPTYYHR---LKHMVK----DKM-----------------HAR-SHGQVT--TLHRQPNCGRSQ---
RPB2_IIV6/724-1098GWNGKKLRAEIFFGPVYYHR---LTHMVS----DKI-----------------FSR-ASTNQKRHAITRQPLNGRAN---
A0CUT2_PARTE/741-1109PYTGNMFSIPIFVGPTYYQR---LRHLVD----DKM-----------------YAR-SRGPVT--GITRQPTHGRSR---
Q583H5_TRYB2/724-1094GHTGLPLDHLIFFGPTYYQR---LKHLSS----DKI-----------------HAR-PRGPLQ--PLVRQPTEGRAH---
A2E7H8_TRIVA/712-1082GRSGKRLKAKIYFGPTYYQR---LKHMVG----DKA-----------------HAR-ALGRKS--LILRQPVDGRAR---
RPO2_MIMIV/726-1093GMNGKKLPVKIFIGPTYYQR---LKQMVG----DKA-----------------HSR-ARGPTQ--LLTRQAPEGRSR---
E2RU19_GIAIC/792-1189GMTGEMMTYRIFIGPTFYQR---LKHMVL----DKI-----------------SSR-NTGPIV--TLTRQPNEGRSN---
Q4A245_EHV8U/685-1058GMSGEMLESMIFIAPCYYQR---LKHMVV----DKS-----------------HAR-NRGAQQ--LLTRAPTEGRSR---
C5WRS0_SORBI/754-1125GRTGERMQSLIFMGPTFYQR---LIHMSE----DKV-----------------KFR-NTGPVH--PLTRQPVADRKR---
Q8QUS6_ISKNN/596-957GRTGRRFESLVFMAPCPYQK---LKHLVA----NKV-----------------HAR-TTGPVD--PLTRQPVAGRSR---
Q4GZE8_TRYB2/675-1036GVTGEMLRAYVFFGPIYYQR---LKHMVT----DKM-----------------HAR-ATGPRS--MLTRQPTEGRSR---
Q5CPZ8_CRYPI/819-1197GTTGEAIEAYIFVGPIYYQK---LKHMVL----DKM-----------------HAR-GRGPRQ--ILTRQPTEGRSK---
RPC2_MOUSE/668-1041GITGEPLEAYIYFGPVYYQK---LKHMVL----DKM-----------------HAR-ARGPRA--VLTRQPTEGRSR---
NRPC2_ARATH/690-1065GISGEPVEAYIFMGPIYYQK---LKHMVL----DKM-----------------HAR-GSGPRV--MMTRQPTEGKSK---
A0D7M6_PARTE/655-1033GITGEYMECYVYQGPIFYQR---LKHMVI----DKI-----------------HAR-AKGPME--KLTRQPVEGRAK---
Q236N3_TETTS/664-1046GITGEYMQCYVFCGPVFYQR---LKHMVA----DKV-----------------HAR-AKGRVT--TLTRQPTEGRAK---
A8B2N4_GIAIC/763-1143GLTGDVIPVYIFNGPIYYQK---LKHMVK----DKI-----------------HSR-GTGPIT--MLTRQPTEGRRV---
Q4UB41_THEAN/766-1155GISGNPINTLIFIGPIYYQR---LKHMVT----DKI-----------------HAR-GRGPRQ--PITRQPTEGRSR---
A2E3T5_TRIVA/688-1052GITGEPLYAYIFFGPVFYQS---LKHMVK----DKM-----------------QAR-ATGQVQ--YLTRQPTQGRSR---
RPA2_DICDI/664-1031GTTGKEFECEIFFGVCYYQR---LRHMVK----DKY-----------------QVR-ALGKVN--ALTRQPIKGRKV---
A0A1D8PQM4_CANAL/675-1039GATGEELRCDIYIGCVYYQR---LRHMVN----DKF-----------------QVR-STGPVN--SLTMQPVKGRKR---
Q27493_CAEEL/649-1005GVDGRQMEMQIFFGIVYYQR---LRHMIA----DKF-----------------QVR-ATGPID--PITHQPVKGRKK---
Q5CSG7_CRYPI/759-1165GMTGVELPCHIFMGVIYYQR---LRHMVA----DKA-----------------QVR-ATGPID--ALTRQPVKGRKR---
A8B827_GIAIC/683-1140AITGDPMPADIFIGVVYYQR---LRHMVS----DKY-----------------QVR-AEGPSD--KITKQPIKGRKR---
Q22C62_TETTS/684-1046GTYGCMMKVDIYMGIVYYQR---LRHMVS----DKA-----------------QAR-STGPVD--MLTQQPIKGRKR---
Q8II17_PLAF7/944-1400GIYGVPLQAHIFIGVIYYQR---LRHMAY----DKA-----------------QVR-RTGPVC--NLTHQPLKGKRK---
Q4N2L4_THEPA/739-1128GTLGTEIQTHIFVGLIYYQR---LRHMVS----DKA-----------------QVR-STGPVD--TITKQPVKGRKN---
RPB2_ASFB7/782-1141GQTGEYFDAAIFIGPTYHQR---LQKFVL----DDR-----------------YAVASYGPTD--ALTGQPLDGKRS---
RPOB_SALRD/696-1211GRTGEPFDEKTTVGQIYMMK---LEHLVE----DKM-----------------HAR-SIGPYS--LITQQPLGGKAQ---
R7EM77_9BACE/681-1194GGTGEAFEQQATVGVTYMLK---LGHMVE----DKM-----------------HAR-SIGPYS--LITQQPLGGKAQ---
RPOB_UREPA/839-1300GRTGEPFDGLISVGLTYMLK---LDHMVD----DKI-----------------HSR-SVGPYS--KITQQPLGGKSQ---
A5IZ53_MYCAP/720-1106PITGEKFDNPVSVGVMYMFK---LNHMVD----DKM-----------------YAR-SVGPYS--LITQQPLGGKSQ---
S5LVD1_9MOLU/753-1138GKTGEAFDKPISVGVMYMLK---LSHMVD----DKL-----------------HTR-NIGPYS--LITQQPLGGKAQ---
RPOB_DESOH/725-1286GRTGQPFDERITVGTMYMLK---LHHLVD----DKL-----------------HAR-SIGPYS--LVTQQPLGGKAQ---
RPOB_GEOLS/853-1417GRTGEPFKHKVTVGIMYVLK---LHHLVD----DKI-----------------HAR-SIGPYS--LVTQQPLGGKAQ---
RPOB_LACDA/681-1067GRTGEPFHNRVSVGVMYYLK---LTHMVD----DKI-----------------HAR-SIGPYS--LVTQQPLGGKAQ---
RPOB_DESAG/716-1278GRTGVRFHNRVTTGVMYILK---LHHLVD----EKI-----------------HAR-STGPYS--LVTQQPLGGKAQ---
RPOB_SYNAS/719-1284GRTGEPFDQEITVGMIYMLK---LHHLVD----NKI-----------------HAR-SIGPYS--LVTQQPLGGKAQ---
R5KT32_9FIRM/702-1129GRTGEYFDSPVTIGFMHYLK---LHHLVD----DKI-----------------HAR-STGPYS--LVTQQPLGGKAQ---
D6Z3M9_DESAT/721-1284GLTGEKFDNQVTVGSMYMLK---LHHLVD----DKI-----------------HAR-STGPYS--LVTQQPLGGKAQ---
RPOB_NEOSM/713-1263GVTGEKFDRKVTVGCKYMLK---LHHLVN----DKI-----------------HAR-SIGSYS--LITQQPLGGKSH---
RPOB_EHRCR/741-1291GRIGEKFDRKVTVGYIYMLK---LHHLVD----DKI-----------------HAR-SVGPYG--LVTQQPLGGKS----
RPOB_PARDP/741-1300GRTGEQFARPVTVGMKYVLK---LHHLVD----DKM-----------------HAR-STGPYS--LVTQQPLGGKAQ---
RPOB_PELUB/727-1287GRTGEMFDRPVTVGIIYMLK---LHHLVE----DKI-----------------HAR-STGPYS--LVTQQPLGGKAQ---
RPOB_FUSNN/675-1063GRTGEKFDNKVTVGIMYMLK---LHHLVE----DKM-----------------HAR-AIGPYS--LVTQQPLGGKAQ---
RPOB_MAGMM/724-1281GRTGEPFDRHVTVGYIYMLK---LHHLVD----DKI-----------------HAR-SIGPYS--LVTQQPLGGKAQ---
RPOB_PHOPR/717-1263GRTGDMFERPVTVGYMYMLK---LNHLVD----DKM-----------------HAR-STGSYS--LVTQQPLGGKAQ---
RPOB_FRATT/720-1276GRTGKPFDRHVTVGYMYMLK---LDHLVD----DKM-----------------HAR-STGSYS--LVTQQPLGGKAQ---
RPOB_RUTMC/723-1282GRTGEPFDRHVTVGYMHMLK---LNHLVN----DKM-----------------HAR-STGPYS--LVTQQPLSGKAQ---
A0A454XJX6_COMT2/725-1292GRTGERFERPTTVGYMHYLK---LHHLVD----DKM-----------------HAR-STGPYS--LVTQQPLGGKAQ---
RPOB_KORVE/830-1399GMTGDRFEQPVTVGYIYMLK---LSHLVD----DKI-----------------HAR-SIGPYS--LITQQPLGGKAQ---
RPOB_THEMA/760-1174GRTGEPFDNPVVVGYMYMLK---LIHIAK----EKI-----------------HAR-STGPYS--LIHQQPLGGKS----
RPOB_DEIGD/619-1059GRTGEPISGPVVVGTMYVMK---LYHMVE----DKL-----------------HAR-STGPYS--LITQQPLGGKAQ---
RPOB_CORGL/631-1051GRSGEPYPYPVSIGYMYMLK---LHHLVD----EKI-----------------HAR-STGPYS--MITQQPLGGKAQ---
RPOB_AQUAE/798-1374GRTGEPFDFEVTVGYMHMLK---LIHMVD----DKI-----------------HAR-ATGPYS--LVTQQPLGGRAQ---
RPOB_DEHM1/652-1123GRTGETFDQPVTVGNMYILK---LIHLVE----DKV-----------------HAR-ATGPYS--LISQQPLGGKAQ---
RPOB_RHOBA/666-1160GRTGEPMEQETTVGYIYMLK---LHHLVD----DKV-----------------HAR-STGPYS--LITQQPLGGKAR---
RPOB_BORBU/669-1059GYTGEPFENEVMVGVIYMLK---LHHLVD----DKM-----------------HAR-STGPYS--LVSQQPLGGKAQ---
RPOBC_HELPY/731-1296GRTGEKMRERVNVGYMYMIK---LHHLVD----EKV-----------------HAR-STGPYS--LVTHQPVGGKAL---
RPOB_OSTTA/587-1008GRTGLNFDQPVTVGYPYILK---LVHLVD----DKI-----------------HAR-STGPYS--LVTQQPLGGRSK---
RPOB_PHATC/876-1274GRTGKEFENPVTVGNAYMLK---LIHLVD----DKM-----------------HAR-ATGPYS--LITQQPLRGKAQ---
RPOB_PLAF7/527-929PFTGNMINNSICLNNIYYYK---LIHMIK----DKF-----------------RYR-FIGLYS--ELTQQPIKGNTK---

PF04941

Q8B9K0_NPVR1/5-748RSEDLTEWMAEDG
Q6JP89_NPVNC/3-721IASDLNCWISEDG
Q91ES4_GVCPM/4-750QAEDLSRFVAEDD

PF00562

F7A8L9_MACMU/487-847-------------
Q74MN2_NANEQ/133-507-------------
Q8TXI7_METKA/161-536-------------
A2SSM5_METLZ/137-540-------------
A0RXX0_CENSY/644-1018-------------
Q980R1_SACS2/176-547-------------
Q8ZYQ9_PYRAE/658-1029-------------
RPB2_IIV3/689-1053-------------
RPB2_IIV6/724-1098-------------
A0CUT2_PARTE/741-1109-------------
Q583H5_TRYB2/724-1094-------------
A2E7H8_TRIVA/712-1082-------------
RPO2_MIMIV/726-1093-------------
E2RU19_GIAIC/792-1189-------------
Q4A245_EHV8U/685-1058-------------
C5WRS0_SORBI/754-1125-------------
Q8QUS6_ISKNN/596-957-------------
Q4GZE8_TRYB2/675-1036-------------
Q5CPZ8_CRYPI/819-1197-------------
RPC2_MOUSE/668-1041-------------
NRPC2_ARATH/690-1065-------------
A0D7M6_PARTE/655-1033-------------
Q236N3_TETTS/664-1046-------------
A8B2N4_GIAIC/763-1143-------------
Q4UB41_THEAN/766-1155-------------
A2E3T5_TRIVA/688-1052-------------
RPA2_DICDI/664-1031-------------
A0A1D8PQM4_CANAL/675-1039-------------
Q27493_CAEEL/649-1005-------------
Q5CSG7_CRYPI/759-1165-------------
A8B827_GIAIC/683-1140-------------
Q22C62_TETTS/684-1046-------------
Q8II17_PLAF7/944-1400-------------
Q4N2L4_THEPA/739-1128-------------
RPB2_ASFB7/782-1141-------------
RPOB_SALRD/696-1211-------------
R7EM77_9BACE/681-1194-------------
RPOB_UREPA/839-1300-------------
A5IZ53_MYCAP/720-1106-------------
S5LVD1_9MOLU/753-1138-------------
RPOB_DESOH/725-1286-------------
RPOB_GEOLS/853-1417-------------
RPOB_LACDA/681-1067-------------
RPOB_DESAG/716-1278-------------
RPOB_SYNAS/719-1284-------------
R5KT32_9FIRM/702-1129-------------
D6Z3M9_DESAT/721-1284-------------
RPOB_NEOSM/713-1263-------------
RPOB_EHRCR/741-1291-------------
RPOB_PARDP/741-1300-------------
RPOB_PELUB/727-1287-------------
RPOB_FUSNN/675-1063-------------
RPOB_MAGMM/724-1281-------------
RPOB_PHOPR/717-1263-------------
RPOB_FRATT/720-1276-------------
RPOB_RUTMC/723-1282-------------
A0A454XJX6_COMT2/725-1292-------------
RPOB_KORVE/830-1399-------------
RPOB_THEMA/760-1174-------------
RPOB_DEIGD/619-1059-------------
RPOB_CORGL/631-1051-------------
RPOB_AQUAE/798-1374-------------
RPOB_DEHM1/652-1123-------------
RPOB_RHOBA/666-1160-------------
RPOB_BORBU/669-1059-------------
RPOBC_HELPY/731-1296-------------
RPOB_OSTTA/587-1008-------------
RPOB_PHATC/876-1274-------------
RPOB_PLAF7/527-929-------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window