Sequence alignment for CL0411

PF06022

Q4Z0W5_PLABA/1-311M..NDY....V..C......RR---------FLLVRNWFPDQ.LNSEGK...YYFNDDKN.FKEYC.NNKI.........
Q7R9N0_PLAYO/1-297MA.DRL.......C......NQ---------FDTLRKLFQDE.LEESGK...YKFQKGT..FNKYC.PN.R.........
Q7R7Q4_PLAYO/1-261M..DKD....V..C......ET---------LIPLRNAFTY..VEENES...YQFTTVED.FKKYC.TN.E.......N.
Q4Z1P4_PLABA/1-258M..DDY....V..C......EQ---------FQIVSNWISDE.LGSDGN...YQIEDEHK.LNVYCVNN.E.........
Q7RPL7_PLAYO/1-266M..NKT....V..C......DR---------FLSVWDALPDT.LN.KGE...YEFKKNNF.LDGYC.RS.Y.......S.
Q7RB69_PLAYO/1-276M..NDE....L..C......RK---------FGVLKAYLPDE.LGETGT...LTFGENKN.FIKYC.PE.N.......GS
Q7RFC2_PLAYO/1-273M..DNR....L..C......GP---------FNVLRNYLPDE.LDNSAK...YEFDKNEY.LKKYC.PN.G.......DS
Q7RE48_PLAYO/1-296MAISNV.......C......QK---------FDNFRKLFQDD.LKESRE...YKFNSGT..FKKYC.PN.S.........
Q4Z522_PLABA/1-285M..DDT....L..C......SN---------FDILRMHLPAK.LGGTAK...RELKNIID.FQNYC.HN...........
Q4Z0P5_PLABA/1-308M..NKK.......C......EK---------FMNIWEDFPDT.LTNDRK...YQFKDKTF.LNSYC.GSYS.........
Q7R864_PLAYO/1-257M..NSK....V..C......GI---------INTADKYVVDD....PNN...PGEYNSTHLLKAAF.SN.I.........
Q7R9W7_PLAYO/1-296MTINNV.......C......YQ---------FKKLWKDFHDE.SNNSGK...SSFKDIV..FRKYC.PN.D.........
Q7R881_PLAYO/1-264M..DDS....I..C......SN---------FDILRKYLPDE.LNKSGE...LELETISN.YSNYC.PG...........
Q7RFB2_PLAYO/1-280M..DAE....I..C......RN---------FLLVKTDFPDK.LI.DGK...YQFKDDEH.SKKYC.DN.G.......N.
Q7RLH9_PLAYO/1-288M..DVE....I..C......KK---------FQDVREYLSDC.LHTSGS...YKFNDAEF.LNNHC.YG.K.........
Q7RBL1_PLAYO/1-257M..NKE....V..C......KR---------FKNIRESIPSQ.LDSNKE...YQINDNH..LDEYC.AS.G.........
Q7R7W7_PLAYO/1-274M..NKE....V..C......KR---------FKNVWEDFLDK.LDENKK...YQFNDGNF.FKEYC.NN.N.........
Q7RJC9_PLAYO/1-298M..DAE....V..C......KR---------FENVREWLPDK.LI.GGK...YKFNDNKS.LNNKC.NN.D.......NF
Q7RRG2_PLAYO/1-236M..DTE....I..C......RN---------FVYLTTKFPDN.LV.DGK...YNFVDDVH.FKEYC.YD.N.........
Q7RT28_PLAYO/1-292MSINNV.......C......GE---------FDTFWKFFRDG.LKESK....YDFTNGT..FKKYC.PN.N.........
Q7RDL9_PLAYO/1-222M.....................---------.....KNFEYD..SNSRN...YNFKDDQH.FQKYC.TN.N.........
Q7R7C1_PLAYO/1-249M..SKG....L..C......DA---------INLADNYIFGD....PNN...SRENGYESFFDSYC.PD.D.........
Q7RNM9_PLAYO/1-291M..DNT....L..C......RR---------FDTLRNYLPDD.LSKPIT...SDINRLGN.IKNYC.SN.E.......ES
Q4Z019_PLABA/1-277M..NDT....L..C......SN---------FVVLGYYLPDE.LNDTAT...FNFDDNSD.FKKYC.SS...........
Q7RSF9_PLAYO/9-311I.NFQY.......C......GE---------FESMWKFFSDE.LKGSGE...YDISLRV..FNKYC.PN.N.........
Q7R7D1_PLAYO/1-255M..DKD....V..C......EK---------FKSIWEFFSDI.LD.EGE...YEFKEQNF.LDGYC.NN.N.......K.
Q7RNI0_PLAYO/1-291M....................R---------FGTLRSFYPDE.LNLSTE...RDIHSIGG.VVKYC.PN.G.......GS
Q7R7X7_PLAYO/1-266M..NKE....V..C......GR---------FKNVWTNFT...YDSSKKS..YQIKNDND.FKKYC.NN.Q.......N.
Q7RFX2_PLAYO/1-264M..DRY....M..C......SI---------FQHITKNLKYD..SSDGK...YNLNDDAT.LKNYC.GN.G.........
Q7YZ88_PLACH/1-291M..SKK....L..C......GL---------INVIDHGVKLT.MNGTN....VQIKNDAT.FNDYC.PNEG.......MK
Q7RCT8_PLAYO/18-257M....................K---------ISEITALIKIA.ILISKR...LRL....D.FYGYL.NN...........
Q7RKC5_PLAYO/1-282M..N..................---------.............D.SGE...YIFKGRN..YTNYL.RK.S.........
Q7R8V9_PLAYO/1-298MAISKV.......C......RD---------FDTFWRFFPDE.LKDSGESKEYDFNSRM..LKKYC.PK.E.........
Q7YZ81_PLACH/1-272M..AEN....M..C......RN---------FISVWTDFPDQ.LD.KGD...YKFNDDG.....YC.EA.........LF
Q7RHL2_PLAYO/1-264M..NKD....V..C......EK---------FKNVTTNL.KY.DSNNES...YKFINNEY.FQEYC.TG.D.......S.
Q8WT16_PLACH/1-282M..NKD....L..C......DV---------IKGIDDLIEVE.VKAEGI...ETIRDEL..FNTYC.PT.NKGGKMRQQG
Q7R8B9_PLAYO/1-296MA.DVL.......C......RD---------FETIWKFFSDE.LNNSKE...YYFNSGM..LKNYC.PS.N.........
Q4X397_PLACH/5-171M..AHS.......T........---------..............................MKQNC..............
Q7RJD0_PLAYO/1-252M..SYK....E..C......DA---------INEIDNYFVDD....PNN...SRKDGSGDSLNVYC.PN.K.........
Q7RII1_PLAYO/1-285M..SKE....L..F......ST---------NKRLDNCFSREVLPKEGKC..YVP......YKEYC.PT.K......QNG
Q7YZ87_PLACH/1-262M..SEK....L..C......KL---------FSAIDNGVTVT.VNNSKAM..IKFDNI...FTEYC.YG.E......EDG
Q7RKR3_PLAYO/1-275M..DNQ....I..C......KK---------FQDLLKNFPDE.LDNNKK...YKFNDDKP.FQKYC.NS.N.........
Q7RRV5_PLAYO/1-265M..DDN....L..C......GQ---------IDFLRKYLPDD.SGNTKP...LDFYGYER.FENYC.PS...........
Q7RMJ7_PLAYO/1-291M..DKK....V..C......KK---------FQDVEDWFLDE.LGSDGE...NQFKHPED.LQKYC.IT.K.........
Q7RPH8_PLAYO/1-309M..NSK.......C......ST---------FDTLRKFFPDE.LD.SGE...YNFKAAK..YKDYF.SK.S.........
Q7RCT9_PLAYO/18-310M...KG.......C......NN---------FDTLWKIFPDE.LNNSGN...YNFPNGL..FKKYC.SS.E.........
Q4YH36_PLABA/1-256M..SFR....V..C......YI---------ISEIDNFANDP....KNQ...GGHNSIGY.FKYYC.PD.N.........
Q7RM73_PLAYO/23-317LEF.KA.......C......QK---------FDNFRKLFRDE.LKDSKE...YDFNNGA..FKKYC.PN.N.........
Q7RGU7_PLAYO/9-281M..NDD....L..C......SK---------FDLLRIHLPDE.LGETGR...LDFDENKD.LIQYC.PD.K.......DS
Q7R943_PLAYO/1-258M..NEY....M..W......NK---------FIFVRTNFTYD..QNNKN...YRFTNNKH.FEEHC.TN.K.........
Q7RAK5_PLAYO/1-296MAISKL.......C......QK---------FDNSRKGFPDK.LNGSGE...YDFKGGL..LKKYC.PN.N.........
Q4YCQ1_PLABA/1-303M..NDY....V..C......RR---------FLFVRNWFPDK.LI.DGN...YQFISDKE.FNKYC.NN.N.........
Q7R9C3_PLAYO/1-237M.....................---------.............LTNGN...YKLTN.NE.LKTHC.TN.K.........
Q7RIN7_PLAYO/1-266M..DDS....L..C......GQ---------IEHIRKHLPDN.LDATTK...LDFYQIED.IKKYC.PD.E.......N.
Q7R8U3_PLAYO/1-269M..DDD....L..C......GK---------FGSLRKYLPDD.LGQTSS...LDFYDNSK.FAKYC.PE...........
Q4YHL6_PLABA/1-288M..S.........C......SN---------FNILRMYLPDG.SGKTA....LDFYGNQS.FKNYC.PS...........
Q4YHA9_PLABA/1-253M..NDD....L..C......QK---------FDLLRMHLPDE.LTETAK...RNFDDDSD.FKKYC.PN...........
Q7RFZ7_PLAYO/1-278M..DKK....L..C......QQ---------FKSVLTYFPDE.LENGEN...YNFVYGDQNFKKYC.TN.S.........
Q7RTJ0_PLAYO/1-252M..NDN....M..C......RR---------LFLVRNSFPDK.LDKDEN...YQFKVDF..FETYC.DN.N.........
Q7RJE2_PLAYO/25-326F..NKN.......C......RR---------FGHLINYLPDE.LGTSPS...LKFNTLGK.VMNYC.SN.G.......ES
Q7R7P6_PLAYO/1-245M..NKD....L..C......NL---------FFAVRSWFPDE.LD.NGK...YKFKDDNE.YKQYF.NK.D.........
Q7RKA5_PLAYO/1-268M..DDS....L..C......GK---------FVLLRTYLPDE.LNNNIT...LEFHENSH.FKDYC.YN.K.......DS
Q7R9Q6_PLAYO/2-288M..DKT....L..C......EK---------FDELKKSLPDE.LKNHAL...VDFNKNEN.IKYYC.SN.G.......ES
Q7RK60_PLAYO/1-246M..LTS...RV..C......EQ---------FDTLRENLSDE.SDGPGN...Y.FSTSGM.LTSYC.PD.Q.......K.
Q7RK83_PLAYO/1-317M..DKE....M..C......KR---------FKNVREWISDE.LKVKGN...NEIKDDTI.LNTVC.NN.N.......NF
Q4Z1S0_PLABA/1-273M..NVS....L..C......KN---------FLLVTTDFPDK.LDNDGK...YYFKDDQH.LKKYC.DN.E.......N.
Q7RCJ0_PLAYO/1-265M..NDE....L..C......SK---------FVLLRNYLPDN.LRETPS...GFFNDSTS.LKNYC..............
Q7R9P0_PLAYO/1-271M..DDD....L..C......GH---------FVILRNYFPDE.LGKTPG...HEFHQNKN.INKYC.PI.G.......VS
Q7RAI9_PLAYO/1-299M..DNQ....I..C......LR---------FDKLRSYLPDD.LNNSTS...KDIHGLGN.IKNYC.PI.V.......GS
Q7RBK2_PLAYO/1-285M.....................---------....WKFFSDE.LDESGK...YNFSRGM..LGKYC.PK.S.........
Q7RA91_PLAYO/1-295MLTSKV.......C......KE---------FDTFWKIFPDD.LTKSGE...YDFKVEA..LNNYC.PK.K.........
Q7RCV4_PLAYO/1-300M..NKE....V..C......KR---------FKNVWNAFPDT.LDNSKN...YQFNDFVL.LNNNC.NH.N.......KF
Q4X890_PLACH/1-129M.....................---------.................................................
Q7RHS9_PLAYO/1-267M..DAE....I..C......KN---------FLLVRENFHDQ.LDSDEK...YTFKDEH..FKDYC.AS.G.........
Q7RHP0_PLAYO/1-282M..NKEVVYAF..C......QK---------FENVWGAFPDK.LDKDKY...YKFENNNI.LNSYC.DN.D.......Q.
Q7RQB7_PLAYO/1-303M..DYK....L..C......GR---------FDTLKKYLPDE.LNKSLS...YDFHGLGS.IRNYC.PN.G.......DS
Q4Z7R7_PLABA/1-277M..NDN....M..C......RR---------FLVVRNSFPDQ.LNREGK...YYFNDDKN.FNKYC.NN.N.........
Q7RHL9_PLAYO/1-326M..NKE....V..C......KX---------FKNVWDAFPDT.LXNNKN...YQFNDFVP.LNNDC.NH.N.......KF
Q7YZ86_PLACH/1-256M............CFICCIYKE---------FATIDGYFYVD.QD.DGSI..THVTNKA..IHNYC.DY.R......DRS
Q7RJ63_PLAYO/1-296MSISKV.......C......GE---------FTTLWKFFPDE.LNESKE...YNFNSRS..FNNYC.PKPG.........
Q7RHP5_PLAYO/1-274M..DIV....LVSC......TR---------FSTLRAFYPDE.LGKSTT...HDFHQNGN.IKNYC.PN.Q.......K.
Q7RA21_PLAYO/1-277M..DKQ....L..C......EK---------FDNVWEDFLNR.LTADGK...YQFKDKTF.LNSYC.DV.D.......K.
Q7REE4_PLAYO/1-252M.TNLE................---------............YDSNKKN..YKFKDADN.FKEYC.TG.G.........
Q7R7L0_PLAYO/1-205M..DKK....V..C......KK---------FQDVRGFL.DE.LDN...............IKKYC.NN.N.........
Q4YH17_PLABA/1-291MTIGDV.......C......GE---------FETIWKFFPDE.LNESGE...YDFRNEF..FNEYC.PD.E.........
Q7RM24_PLAYO/1-277M..NKQVVYAF..C......EK---------FDNLWYKFPDE.LDSDKN...YKFQTENF.LDNYC.FN.Y.......E.
Q7R8S4_PLAYO/1-292M.....................---------....WRVFPDE.LKNSGE...YDFKGGS..LNSYC.PN.R.........
Q7RDZ3_PLAYO/1-258M..AGF....M..C......KR---------FENIWIAFPDT.LS.NGN...YQFKDYEI.INSYC.NN.N.........
Q7RJ28_PLAYO/1-315MLTSKV.......C......GE---------FATLWKFFPDE.LNGSGE...YYISGKT..IKNYC.PN.N.........
Q7RDW3_PLAYO/1-274M..PIK....L..C......DG---------IDVIDRGLVFD....RDS...QNYNFTGSSTNMHC.PN.Q.........
Q7RQI7_PLAYO/1-298MAISKV.......C......SE---------FTTFWKLFPDG.LNDSKE...YKINPGS..FKKYC.PD.G.........
Q7RK85_PLAYO/1-254M..SKD....L..C......EL---------INAAVNYIVDD....PNN...PRGDHYGSLFNSYC.PD.D.........
Q7RS14_PLAYO/1-297M..DYD....L..C......KN---------FSTVIENYPDK.IDDSEE...YDIYDIPD.IDEYC.PD.G.......ES
Q7RGN4_PLAYO/1-299M..DNI....L..Y......GR---------FRHLRLFYPDE.LSESTD...YDFYGIAS.IRDYC.PN.G......DSG
Q7R8D0_PLAYO/1-281M..DKD....V..C......RT---------LIALRNSFSNN.WTKQGD...YQFIINADTLNGYC.SN.K.......Q.
Q4Z0V4_PLABA/1-324M..DDK....I..C......RT---------FFALRNSIYNN.LDATGG...YQLIMNQPVLNGYF.TN.N.......N.
Q7RKY7_PLAYO/1-277M..DDK....I..C......RK---------FFSLRTSISDK.LDNEKN...YKITNEQP.IKEYC.TN.G.......K.
Q4XE61_PLACH/265-545M.........C..C......EA---------FKKVDDCLQIG.MKSTGGS..CSIDYA...FTDYC.PT.K......IEG
Q7RHX9_PLAYO/1-284M..NRQ....M..C......EK---------FQEVRNSLPDQ.LNSSGY...YQFKDEEF.LNNYC.NS.N.......Q.
Q7R9W6_PLAYO/1-272M............C........---------.....NSFSKN.FDNKGN...YQIIINGSTLNTYC.AN.N.......T.
Q7R9Q4_PLAYO/9-276M..DDD....L..C......GK---------FVFLRTYFPDD.LSVTET...LEFKEHKN.FKKYC.PI.........DS
Q7R7X0_PLAYO/1-296M..TDY....M..C......GR---------FKLLRIYFPDE.LNRSTS...YDFHGLGN.IQNYC.PT.V......GSG
Q8WT02_9APIC/1-285M..DHH....R..C......IR---------FGTLRVFYPDE.LENSTG...IDFHGNGK.IRDYC.PI.V.......DS
Q7RMB8_PLAYO/2-270M..NDN....M..C......SK---------FLLVRNLLPDE.FENNGD...YQINDKNF.FSEYY.DN.N.........
Q7RSD0_PLAYO/1-255M..NKQ....V..C......EK---------FQVIRNAILDE.VDSKRN...YQFKNENF.LNSYC.DN.G.......S.
Q7REX1_PLAYO/1-255M..NKE....V..C......KK---------FKDLRNSLPDN.LNASGS...YEFTNDKD.FNEYC.TG.N.......K.
Q7RL45_PLAYO/1-297M..NKE....V..C......KK---------FQDVRTSLSDE.LEGNGI...PDFKDDSF.LNKYC.NS.G.......N.
Q7RI05_PLAYO/1-288M..NKQVVYTF..C......ES---------FQSVWDVFPDK.LTKNSEY..YEFNDDNF.LNGYC.FN.N.......K.
Q4YH25_PLABA/1-270M..NDT....L..C......LK---------FDFLRYYLPAE.LGGTAN...FEFKQITN.FNKYC.PS...........
Q7RL82_PLAYO/1-274M..NKK....V..C......EK---------FRSIWEFFPDK.LN.KGE...YEFNDQNF.LNGYC.DS.N.......S.
Q7RL75_PLAYO/1-259M..NKQ....M..C......SK---------FSFAKVNFNYQ..SNNKK...YIFGNDSL.FKENC.TN.Q.......K.
Q7RRS6_PLAYO/1-291M..DYK....L..C......GR---------FDHLRLFYSDE.LGKSAG...RDIHSLGS.INSYC.SN.E.......VP
Q8WT03_9APIC/1-293M..DHF....M..C......IK---------FGTLRTFYPDE.LGKLTK...YEFDNNGS.ISNYC.PN.V.......GS
Q7R9Y8_PLAYO/1-266M..DKN....L..C......SN---------FLLVKAKFPDE.LS.NGE...YQFIDEY..FKKYC.TS.G.........
Q7R8Q2_PLAYO/1-296MYINNV.......C......SG---------FDILWKYFPDE.SNNSGN...SGFRELI..FKEYC.NV.N.........
Q7RCK0_PLAYO/1-269M..DKR....V..C......KF---------FYSIRNSISDQ.LDNKKK...YKLINDQP.IKEYC.AG.N.......S.
Q7R7N7_PLAYO/1-246M..NKE....V..C......KR---------FKNVWEDFPDT.LN.NGD...YQFNIDRH.FKTYC.TN.N.......N.
Q7R925_PLAYO/1-251M..NKE....T..C......KT---------FAPLRNVI.SN.SDKGVT...YQFTTDED....YC.TG.V.......E.
Q7R8E2_PLAYO/1-255M..SSN....V..C......GV---------ISVIDNDIVFD....QNS...QNYTLKGQLINNYC.PN.S.........

PF05795

A5KD74_PLAVS/16-336L--PSY--------------KE.........YIKLDN........EDIKD........Y.-SDDFC----VKKLESTK..
A5K942_PLAVS/22-370L--PSY--------------KF.........YEQLTE........DTSES........I.-NSKYY----N.GLNDLT..
A5KD05_PLAVS/8-390N--YSD--------------LFLKDSFNYGLYKNLTR........NDINY........E.-DNRYC----SNNKRKFK..
A5KCZ5_PLAVS/13-363L--HTQ--------------YY.........YGKLDE........GWKNC........Q.-DYSFY----N.TAKEKL..
A5KDC7_PLAVS/13-362L--NTK--------------HY.........YGKLDK........GLELC........Q.-YYEFY----D.KAKTEL..
A5KD53_PLAVS/22-422L--KLK--------------TF.........YDDFFL........KSEQP........K.-PADPC----K.IFETPD..
A5KC97_PLAVS/22-304L--ASH--------------KI.........YEDFDK........EDDRGN.......K.-YDDVC----KIEIDGKI..
A5K691_PLAVS/16-331L--NLN--------------TI.........YEDFFS........KENVQ........SK-FEPEC----A.DLKKYN..
A5KAS2_PLAVS/244-559L--TAH--------------TK.........YKKLDDE....................SV-DENTC----TKYCEIPN..
A5KCQ8_PLAVS/25-314N--KVN--------------DF.........YRTSNS.....................E.-NIKTC----NNIFPTDA..
A5KD32_PLAVS/8-337G--DLE--------------QF.........YNNLDR........EHEDLT.......N.-YIKHC----D.KIKWGK..
A5K735_PLAVS/3-393Q--LAE--------------SS.........VNSMSG.......................-ITHYC----NKMIRDPM..
A5KCR3_PLAVS/9-294L--PSD--------------KF.........YVELNNK.......K..VV........D.-ISNSC----K.NFSTLL..
A5K8H5_PLAVS/21-452L--GYN--------------KL.........YDNFYV........VKSNG........K.-FLKDC----D.ELDSLD..
A5KD69_PLAVS/21-342L--PSE--------------YF.........YNTLIH........NTVGLE.......K.-YEIEC----N.SICKGN..
Q9N886_PLAVI/17-366F--PSY--------------NI.........YQRLNK........NEVTN........K.-YDTYC----K.TIQKFF..
A5KCT2_PLAVS/17-298Y--SSN--------------...........FEEATK........EDND.........S.-FKGHC----RIQITNDL.T
A5KD30_PLAVS/21-355L--FSG--------------TF.........YANL.N........NYEKLR.......L.-YYPDC----T.ALDAKY..
A5KBG3_PLAVS/140-414L--SFY--------------EY.........YNTLNNSN...................N.-LNGYT----DEYCSKVE..
Q9N887_PLAVI/22-345L--SLY--------------DF.........YEELNK........ELVKELKTSPDLQT.-KYQYC----Q.AKIASQ..
A5KD66_PLAVS/21-335L--NSE--------------NF.........YNRL.D........SFKNYS.......E.-YNKEC----E.SLTKLR..
Q9N8A0_PLAVI/10-445Y--ISY--------------KD.........YVNAKH........EFKRTMN......N.-RYPDN----E.RFEKII..
A5KBF9_PLAVS/37-328L--PSE--------------DL.........YYKFKF........DNENLA.......E.-YKEDC----S.SIELSP..
A5KBR5_PLAVS/12-313L--PSN--------------LI........FYDKFN......................K.-GWDRC----SHFPSSGEIK
A5KDE6_PLAVS/22-346L--NLY--------------DF.........YEKLDN........ELDKKIEETPEIKQ.-KCDYC----Q.GHIASQ..
A5KCW1_PLAVS/25-352I--HPE--------------NF.........FSKLGK..........SST..........-FDILC----NGIDDKVS..
A5KD28_PLAVS/16-416L--ELS--------------KA.........YDALFS........NASTS........K.-TYTEC----K.LFESGT..
A5KD65_PLAVS/22-478L--KLN--------------TL.........YEALFP........EKEKS........N.-FDDKC----K.QLDTHD..
Q9N8A3_PLAVI/13-292S--YEH--------------ES.........LFLLNN........TKVNQ........G.-HDHIC----E.KFMSAY..
A5KE77_PLAVS/14-291L--PSY--------------DL.........YKGFYEDV......EPGKK........GY-YENYC----E.AVKRYA..
Q9N899_PLAVI/13-363L--PTK--------------HN.........YYYLDN........GYTFC........E.-KDIFY----N.HAERKL..
A5K945_PLAVS/9-352L--PSY--------------EF.........YDGFNK........KNDLC........N.-SVDHC----K.KISEHF..
A5KCV9_PLAVS/16-436L--PSY--------------QK.........YKQLDS........VDIAD........Y.-SKDHC----K.NLKNSD..
A5KC95_PLAVS/23-424S--NLY--------------MY.........YDLFDN........GMGSP........G.-TTTLC----N.NKI.....
A5KE70_PLAVS/16-392L--PAY--------------KK.........YKELDN........VDISG........K.-SNDYC----INYLGISN..
A5KCL0_PLAVS/21-363E--TSY--------------SI.........YEELDRVVESSNVKSGEQV..........-DKKYC----A.........
A5K5E2_PLAVS/17-358L--PSY--------------KK.........YAQLNESE...................N.-IDNYC----D.DCNDIL..
A5K936_PLAVS/22-322L--PSY--------------KI.........HQKLNE........EINKN........D.-YDHYC----T.RINTYD..
A5KCW8_PLAVS/16-290S--ASF--------------EL.........YDEFNKEV......PDEKK........I.-NSNDC----N.EFKSTS..
A5KCU8_PLAVS/16-426L--PSH--------------GL.........YESFDK........DANDS........E.-YSGEC----N.........
Q9N884_PLAVI/13-362Y--TSN--------------FY.........YNYFER........GDDGC........E.-TFEFY----S.GIKDEI..
A5KBG4_PLAVS/18-346L--PSY--------------II.........YEKFKNKN...................NT-ETSST----LQKVNENSEN
A5KAS5_PLAVS/16-329L--PSS--------------DK.........YETLNA........EVSES........T.-YDDDC----K.........
A5KDD1_PLAVS/6-340I--FGK--------------QF.........YNYL.N........NYEDLN.......E.-YYLYC----T.SLGRLS..
Q9N888_PLAVI/8-385S--YSD--------------LFLKDSHPYGLYKKFFR........SVPEE........K.-YTPCC----RSYKYNFY..
A5KCU5_PLAVS/21-349L--PSY--------------KK.........YENFDN........VDIAN........E.-KSSHC----N.DLGSTD..
A5KDR2_PLAVS/20-353L--PSK--------------NF.........YDKWDS........HLNSI........KD-YYDIC----K........E
A5K1K8_PLAVS/20-397L--KKT--------------DL.........YTFYHH.....................H.-FDKIC----DNTADSLYFC
A5KD19_PLAVS/13-348L--PAY--------------KK.........YGEFNL........YDIND..........-RDGIC----E.........
A5KCT1_PLAVS/19-351L--PAN--------------QK.........YKELNTD.......EDVEY..........-NTDIC----K.........
A5KD97_PLAVS/20-353L--PSE--------------KF.........YNGMNI........EDKNLS.......D.-KSNIC----E.SITWHK..
A5KD24_PLAVS/19-471L--KLN--------------TL.........YEEFFK........KDEKI........N.-IDNRC----N.NLNNPN..
A5KD42_PLAVS/16-297L--PSY--------------KE.........YEKFDK........VDIKN........E.-NSNHC----N.NLGSKD..
A5KD93_PLAVS/15-447L--GFD--------------KL.........YEQIFS........KDGKS........DK-YNKHC----D.VFNGKD..
Q9N8A4_PLAVI/16-297F--PKN--------------KE.........YYESVT........PSSDR........T.-IVSAC----N.QIRSKI..
A5KCR2_PLAVS/16-444L--KLN--------------NI.........YETFFV........KNKTS........K.-FDSLC----S.TLSSHE..
A5KCZ2_PLAVS/21-348F--NSE--------------KF.........YNYL.N........NYDGLN.......E.-YYKYC----T.SLDPLS..
A5KC13_PLAVS/21-353L--FSE--------------KF.........YDQLNY........DIDNLN.......D.-YNKEC----D.KLNEPY..
A5KDP5_PLAVS/25-322V--HPE--------------NF.........FSELGK..........SST..........-FDGLC----NGIELKVG..
A5KCZ1_PLAVS/16-330L--PSY--------------KE.........YEKLDK........VDIKN........E.-NSSHC----N.DLGSTD..
A5KD49_PLAVS/23-351L--NSE--------------NY.........YDKL.D........NTTEFS.......K.-YFPLC----N.KLITYP..
A5KD48_PLAVS/21-346L--NSQ--------------YF.........YNQL.E........DIEDFK.......E.-YFPNC----E.TISSFQ..
A5KD50_PLAVS/14-324I--LTK--------------SFSDDLISEIIYKQL.D........NLSGFN.......E.-YLNQC----N.SLPQLR..
A5KCL3_PLAVS/174-499L--PSH--------------KT.........YEKLNSKE...................N.-VDKYC----S.DCMDII..
A5KCL7_PLAVS/29-304F--NYV--------------DE.........FTEFESKI......KEVTNAT......Q.-YEKNC----GSFKRMKL..
A5KDK0_PLAVS/15-278S--HLN--------------KN.........YEEFEKNV......SDSSK..........-ILNVC----D.SLKITN..
Q7K6M7_PLAVI/22-354S--EFY--------------KI.........YNEFNK........ECTEY..........-RTDNK----DSCYKKTS..
A5KCY1_PLAVS/24-359I--SAY--------------KT.........YEEFNNNK...................D.-CYKYC----H.HCKSIY..
Q9N879_PLAVI/21-298H--DFD--------------RE.........IKNLDS.....................E.-YMDHC----I.SISGQH..
Q9N893_PLAVI/16-337S--HLN--------------KK.........YEEFEKNV......RDSST..........-ISNVC----D.SLNITY..
A5KE76_PLAVS/272-715L--PSK--------------EI.........YDELNK........VEGST........Y.-YDNYC----K.YFDTKN..
A5KD21_PLAVS/16-354L--PSY--------------KK.........YTELDN........VVISG........D.-DNDYC----KKSLESTE..
A5KDG0_PLAVS/6-332L--YSV--------------KF.........YXLL.Y........KVKNPS.......E.-YNKYC----E.TLKHIG..
A5K733_PLAVS/31-364L--ASQ--------------EI.........YTELNKDI......AANDD........S.-VTKHC----K.........
A5KD00_PLAVS/31-351L--TLY--------------EF.........YELLDN........ELVKNYE..PD..D.-RCNHC----K.NQIASD..
A5KDQ9_PLAVS/9-353L--PSY--------------EF.........YKKLNET.......K..VN........G.-ISEYC----K.EISKNL..
A5KE78_PLAVS/66-466I--ESY--------------QK.........YETSAQE.......EKNDYFK......A.-SENYC----K.PEKANG..
Q9N890_PLAVI/21-313L--PSE--------------RF.........YEWLNS........YFLFIP.......R.-YYSDC----N.TLSAPY..
A5KCR5_PLAVS/246-528F--TEY--------------QK.........YDEFKKQT...................N.-DKNIC----VKYCDKII..
A5KD77_PLAVS/22-354S--NFY--------------EX.........YNVFYE........SCENF........A.-DNQA.----..SCYTGS..
A5KCN6_PLAVS/30-306L--KDL--------------TL.........YKKLDENV......KDPSK..........-IKTEC----S.FLSITL..
A5KDD8_PLAVS/3-324L--QSK--------------IV.........YKEIET........DNSDLY.......N.-YDQKC----D.IKLFRT..
Q9N891_PLAVI/29-310L--TYT--------------KI.........LEEWDQGY......VKVDS..........-..EKC----F.GFSQKF..
A5KD86_PLAVS/13-363L--PSN--------------FH.........YYYFDN........EIRDC........R.-NLNFH----S.NIKDEF..
A5KD96_PLAVS/3-408E--ETS--------------DT.........YYNYDDYIHFKSKFEDQDSVSIDIEIIK.-RNSVI----D.TINEHV..
A5KD33_PLAVS/16-309L--PSY--------------KE.........YKKLDD........LDIKD........Y.-SDNYC----EKDLGSPK..
A5KAR9_PLAVS/16-316L--PAY--------------QK.........YKEFDS........VDISK........E.-TTSQC----N.NLGSKE..
Q9N880_PLAVI/21-343L--TLD--------------DF.........YDKLNK........SDKDLD.......K.-YTDEC----R.ELCSKN..
A5KD07_PLAVS/16-341L--PSY--------------KK.........YTELDN........VVISG........D.-GNKYC----KENLGSTD..
A5KCX5_PLAVS/16-447L--GLD--------------KL.........YDQIFS........KDGQS........NK-LNKHC----D.VFNGKD..
A5K8H2_PLAVS/11-325L--PSH--------------KF.........YAAFDKDV......ENGYD..........-YDKYC----S.ELKSIN..
Q9N892_PLAVI/23-348F--NSK--------------QF.........YNEL.D........ELKKFS.......E.-YNKKC----K.PLNGTR..
A5KAS1_PLAVS/321-662L--PSF--------------KI.........YNELDENT...................D.-NTSNT----DIKCDEIK..
A5KD25_PLAVS/16-291L--PSY--------------EE.........YKKLDA........VDIKD........Y.-SDGFC----EKDLGSPK..
A5KDR1_PLAVS/21-363L--PTE--------------VF.........YYYLKH........DTANLK.......N.-YRKEC----S.ELSPLF..
A5KB35_PLAVS/10-413L--DVY--------------QI.........AEDYIKTQ......SDYGY.G......S.-IE..C----N.KFNKTD..
A5KC93_PLAVS/16-453L--PAY--------------QK.........YKELNE........VDITG........Y.-NNDKC----D.KLAKSD..
A5KDB2_PLAVS/34-401L--PAY--------------LF.........EEKLKG........DASTN........E.-YSSYY----N.GLNNFS..
A5KCT3_PLAVS/289-657S--TIS--------------NI.........YNSFSNH....................TL-DNTQC----AKYCHEII..
A5KBR2_PLAVS/254-616L--SSY--------------DI.........YKKLNNEDSI.................NN-YDSYC----T.NIGTTG..
A5K5E1_PLAVS/11-355L--PSY--------------KQ.........YTEFSN........DIDNDLS......E.-YSNYC----D.VIKSHF..
A5KCW5_PLAVS/22-437L--KLK--------------TF.........YDDFFL........KNEQP........K.-SADPC----K.IFDAEG..
A5KBG1_PLAVS/253-633L--PAY--------------QI.........YEKLNNTV...................D.-KDKYC----I.DCKKLK..
A5KD15_PLAVS/33-411L--PAY--------------KF.........EQELKE........DANGN........I.-YNTYF----N.SLSRTM..
Q9N8A2_PLAVI/21-355F--NSE--------------KF.........YNYL.N........NYDDLN.......K.-YYPYC----T.SLNPKS..
A5KD02_PLAVS/23-315F--NSK--------------YF.........YNEL.D........ELQDFK.......V.-YKENC----K.PLKGPP..
Q7RBM2_PLAYO/10-293L--PSY--------------EF.........YNKLNENVP.....DEDKE........K.-PNKYW----K.RIEPIF..
A5KD12_PLAVS/20-341V--PSY--------------LF.........YEDLKK........DASEN........V.-YSNYY----N.EISNLT..
Q9N882_PLAVI/13-362L--PTQ--------------KI.........YDKLNN........GKDGC........Q.-NDAFY----K.LAKGIL..
A5KCU2_PLAVS/3-296N--IHK--------------KF.........YDNLYD........DKEDLD.......L.-YSKDC----A.SVISLE..
A5KDH3_PLAVS/7-287L--KLN--------------KL.........YEEFFS........KDTTS........N.-FDGYC----N.DLKKYD..
A5KCY0_PLAVS/16-372S--TSE--------------KI.........YKDFKN........TVSSE........D.-YKKHC----KAIFNSPK..
A5KCV2_PLAVS/23-358S--NFY--------------KI.........YNELNW........DCNSV........N.-YNDSG----SSCFKGTL..
A5K697_PLAVS/19-332L--KLN--------------AI.........YEELFP........KDVKS........K.-FDKDC----E.LLNTHE..
A5KD10_PLAVS/16-340L--PAH--------------EI.........YSELNE........HVQSD........SR-FVKHC----K.KMHKFE..
A5KC12_PLAVS/18-313L--PSK--------------EL.........YDKWDK........HLESIV.......G.-THNAC----K.LTVIDY..
A5KD72_PLAVS/21-431L--GLN--------------KL.........FDGFYV........KKSSS........T.-FFKEC----D.ALNDYE..
A5KDR4_PLAVS/16-315S--KSY--------------DI.........YEIFNK........EVKEN..........-...DC----KECISKIG..
A5KD61_PLAVS/26-325L--PLY--------------DF.........YKKFDN........EFKNSISXH....E.-KCSVC----D.LSLTMI..
A5K8H3_PLAVS/281-557L--EAY--------------KV.........YKEFNKDD.....................-QDEYC----S.SCGSIF..
A5KCX3_PLAVS/16-418L--PSE--------------VF.........YNKLKN........VKNGV........D.-HPNYC----K.NIRNDL..
A5KD87_PLAVS/15-315L--PSE--------------RF.........YEWLNN........NLIYIW.......R.-YSSDC----N.SLNNIY..
A5KD90_PLAVS/13-364L--NTK--------------YY.........YGKLNT........GWDGC........Q.-FYGFY----E.EAKNIL..
A5KCK8_PLAVS/21-282L--PSS--------------KI.........YKKFND........NNNTD........N.-SDGNC----A.GVKSYN..
A5KCL1_PLAVS/23-389L--PLK--------------EL.........YELFSTYGSFP...SNGDFLCKGLPNIN.-APNTC----N.VLSPCI..

PF06022

Q4Z0W5_PLABA/1-311....CN..................TD..LE----KINAGCLLLFNQ.FFGSSTSFK....YHNNIN.I-----VDYIMIW
Q7R9N0_PLAYO/1-297...ECS..................AD..TD----IVNAGCLWLFNA.FFGTSGTSHYHDVYKD....V-----AVCIMIW
Q7R7Q4_PLAYO/1-261....CV..................DD..TD----KINARCLYIFDT.FFKDKVVFE..KDAKGNIN.I-----VEYIMIW
Q4Z1P4_PLABA/1-258....CD..................GD..LD----IINAGCLFLFEK.LFGSYGFFN....NHNRIN.I-----VEYILIW
Q7RPL7_PLAYO/1-266....CD..................ND..VE----KVNAGFFYLLNK.FFGSSESS...YSAQNDIN.V-----VDYIIIW
Q7RB69_PLAYO/1-276GGNECN..................ND..LD----RITAGFLWSLEQ.CYSGLV.NK..DHNANSNNAF-----FLYMISW
Q7RFC2_PLAYO/1-273DKK.CE..................TD..LD----KIKAGFLCLFEQXIVNNIDNLS.....KEEVKVF-----IIYIMIW
Q7RE48_PLAYO/1-296...NCG..................SD..TD----IVNAGCLWLFYE.FFGKLGTTVDPNTYKG....D-----VLCIMIW
Q4Z522_PLABA/1-285..DNCN..................TD..LE----KITVGFLWLLGK.YYSISQ.NR..SYNENNTNPF-----FLYMISW
Q4Z0P5_PLABA/1-308....CD..................TD..LQ----KMNAVFFYLVNE.FFGPSGVFK..NNEKSNIN.A-----VEYIIIW
Q7R864_PLAYO/1-257...DCN..................ID..DQ----KLSSGFIALLK..LLNDIDNNENLEGDK.....L-----VEYAILW
Q7R9W7_PLAYO/1-296...NCD..................TN..IK----KINAGCLWLFNA.YFGQFSISLDLPTYKD....A-----VVCIMIW
Q7R881_PLAYO/1-264..KDCN..................TE..LE----KITIGFLWLLGQ.YFGKYP.TK..GGIINDTKPF-----FLYIILW
Q7RFB2_PLAYO/1-280....CN..................GP..LD----KINTVCLYLFNE.FFGNSSVFE..SVSKSNVN.I-----VEYIMIW
Q7RLH9_PLAYO/1-288...QCY..................SD..YD----RLNAGFIYFFNE.FFGNLNSFN..VNPKKKPD.I-----VDYIIIW
Q7RBL1_PLAYO/1-257....CN..................TS..LD----KISAGCLYLFDS.FFKDKSKFE..SVAENKIY.I-----VEYILIW
Q7R7W7_PLAYO/1-274....CS..................SY..IN----KMNAGILYLLDG.FFKDSGSFE..SVAKNNIN.I-----VEYIIIW
Q7RJC9_PLAYO/1-298SNNYCNNNDFQ.............SD..LN----RISAGCLYLLDE.FIKDCGVNP..SPVKNIIN.I-----VDYILIW
Q7RRG2_PLAYO/1-236....CN..................NN..IG----KINAVSLYLFNE.FFGESSSFK....NHNKIN.I-----VEYIMIW
Q7RT28_PLAYO/1-292...SCV..................TD..TD----ILNAGCLWLFNA.FFGKTGTSHYENTYKD....V-----ALCVMIW
Q7RDL9_PLAYO/1-222...NCK..................TD..LE----KINAACLYIFNE.LFKDSSVFE..SVAKSNIN.I-----VEYIMIW
Q7R7C1_PLAYO/1-249...NCD..................TD..NN----KVSSTFISLLK..IFED....ESLESDK.....L-----AEYASLW
Q7RNM9_PLAYO/1-291GKTECK..................TD..LD----KINGGCIWLFEQLFVKN..........QNDIN.I-----VEYIIIW
Q4Z019_PLABA/1-277..ENCN..................TD..LE----KFSIGFLWLLEQ.CYSAFK.NK..SHDINSINAF-----FIHMLSW
Q7RSF9_PLAYO/9-311...NCN..................ND..IN----KINAGCLWLFNQ.FYGDVVNFS..RYADDKID.I-----VVFIMIW
Q7R7D1_PLAYO/1-255....CE..................GN..LD----KINAGFYFLLNQ.FFWNSGSS...HNVQNNIN.V-----VDYIILW
Q7RNI0_PLAYO/1-291KKNECK..................TD..LD----KIKAGFLWLFEQIIVNNIDSLS.....KDQIEIF-----TIYIIMW
Q7R7X7_PLAYO/1-266....CV..................DE..LE----KINAGCLYLLNE.FFLDSSSLK..NHAKSNPN.I-----VEYIMIW
Q7RFX2_PLAYO/1-264...KCE..................EE..IG----KISAACLYFFDE.LIGNSA.......AKSNIN.I-----VEYIMIW
Q7YZ88_PLACH/1-291TNGECD..................SN..IQ----NVNSAIIKLLT..YFKSVVDDILEDNK......L-----SEYAILW
Q7RCT8_PLAYO/18-257..MLLN..................TQ..IK----AI........................LKRALNHF-----FYILFHG
Q7RKC5_PLAYO/1-282....NY..................TD..ID----KINGYCLWLFKQ.FYGDRISFS..NNVNNNMY.V-----VTSIFGW
Q7R8V9_PLAYO/1-298...SCN..................ND..ID----KINAGCLWLINA.IFSTSNFTFDNNTLKD....D-----AVCIMIW
Q7YZ81_PLACH/1-272TNKKCD..................TD..LN----KINAVSFWLFNK.NFGDHSSLT..KKANSNIN.I-----VHYIMIW
Q7RHL2_PLAYO/1-264....CD..................ND..LD----KINAGCLYLFDA.FFKDISAFR..MTVKGNID.I-----VEYILIW
Q8WT16_PLACH/1-282QDGYCI..................GY..SE----TVISAFIHLQE..TLKNNDSQKKLDRDK.....L-----AQYAILW
Q7R8B9_PLAYO/1-296...NCD..................TN..IK----KINAGCLWLFNA.FFGRSGTSNYGDRYKD....V-----VLCIMIW
Q4X397_PLACH/5-171..............................----..................................-----.....II
Q7RJD0_PLAYO/1-252...NCS..................SD..EE----NIISGFIMLLK......MGDNENINSEK.....L-----VEYAILW
Q7RII1_PLAYO/1-285KKGECS..................TN..YE----KIRAGFTWLLN..MFEDHYDYN..NSENDIVK.Y-----AEYAILW
Q7YZ87_PLACH/1-262GKKECF..................SY..EV----LVTSYFIGLLN..YFMKVDDLKHNK........N-----AEYAILW
Q7RKR3_PLAYO/1-275....CD..................AD..LG----KINAGCLYLFNE.IFEDSSLKN.....HNKIS.I-----VEYIMIW
Q7RRV5_PLAYO/1-265..KNCH..................ND..IE----KITIGFLWLLEQ.YFTEYP.PK..GNTIGDAKPF-----FLYIILW
Q7RMJ7_PLAYO/1-291....CN..................SN..LD----KINAGCLYLLDQ.FYKHDGMFP..SPSKSNPY.I-----VDNIFIW
Q7RPH8_PLAYO/1-309....EY..................TD..ID----KINGYFLWLLNN.ILKKIYIC...GSKENCINVV-----VVYTFGW
Q7RCT9_PLAYO/18-310...KCE..................GD..VN----IVNAGCLWLFNE.FFGKTGTSSYHDVYKD....V-----TMCIMIW
Q4YH36_PLABA/1-256...NCD..................TD..VK----KVISTFIALVT..LFNGINHNEKLESDK.....I-----AEYAILW
Q7RM73_PLAYO/23-317...NCD..................GD..IN----KINAGCLWLFNS.MFGTGGYSFDTKYYKN....E-----TVCIVIW
Q7RGU7_PLAYO/9-281GGNECN..................NN..LD----NITAGFLWLLEQ.CYSTII.SK..TYNEDNTNAF-----FLYMISW
Q7R943_PLAYO/1-258....CN..................TD..ID----KINAVCLHLFNE.LFGTSNSFE..VNSKNNIN.I-----VEYIIIW
Q7RAK5_PLAYO/1-296...QCE..................SD..TD----KINAGCLGLFID.MFGTHGSSFSLRTYKD....E-----AACILIW
Q4YCQ1_PLABA/1-303....CD..................GD..LD----KINAGCLLLFNE.LFGNSELFK....YHNNIN.I-----VDYIIIW
Q7R9C3_PLAYO/1-237....CD..................KD..ID----KINAVCLWLFNV.FFESASVLS....NHNNIN.I-----VQYIMIW
Q7RIN7_PLAYO/1-266....CN..................TD..LD----KNTAGFLWLLGK.CYYEST.EK..NYDKNSINTF-----FIHMISW
Q7R8U3_PLAYO/1-269..KNCN..................TD..LE----QIAIGFLWLLEE.YFTKYL.DK..GSIEKNAKPF-----FLYIISW
Q4YHL6_PLABA/1-288..ANCN..................TE..LE----KITIGFLWLLEQ.YYSMSK.NK..SHDINSINAF-----FIHMISW
Q4YHA9_PLABA/1-253..GDCN..................TD..LE----KFSIGFLWLLEQ.WYSAII.SK..NYNEDNTNAF-----FLHMISW
Q7RFZ7_PLAYO/1-278....CD..................SN..LE----KINAVCLYLFNL.FFGNINSFK..DNAKNNLD.V-----VYYILIC
Q7RTJ0_PLAYO/1-252....CK..................TD..ID----KIKAGCLFWFSE.LFGSSSSFK..NHAKSNMN.V-----VAYIWAW
Q7RJE2_PLAYO/25-326KGAECK..................TD..ID----QIKAGFIWLFEQNIVSRISNLS.....KDQPKVF-----IVYITIW
Q7R7P6_PLAYO/1-245....SY..................DD..ID----KINGWCLFLFNK.IFMGYYLCE..YCPNSNTN.A-----VAYILAW
Q7RKA5_PLAYO/1-268GKNECI..................TD..ID----KITVGFLWLLSE.YYLMSQ.TK..NYNENIANPF-----FLYIISW
Q7R9Q6_PLAYO/2-288GKTDCE..................TD..LD----QIKAGCLWLFEQLFLEN..........KKNIS.T-----VEYIIIW
Q7RK60_PLAYO/1-246....CA..................ND..SN----QISGGCLWLLDR.FYGGRSVFS..HYADGKID.I-----VVYIIMW
Q7RK83_PLAYO/1-317LNNSCNDNNFQ.............SD..LD----KISAGCLYLLDE.FIKDCGLIP..PPAQNNIN.I-----VDYILIW
Q4Z1S0_PLABA/1-273....CG..................SD..LE----KVNAGCLYLLYT.FFGSSDMFK..SVAKSNID.I-----VEYIMIW
Q7RCJ0_PLAYO/1-265DNGECN..................TE..FD----KIKAGFLWLLAQ.NCSISQ.KE..NYNENNFNSF-----FLHIISW
Q7R9P0_PLAYO/1-271GNNECN..................TD..LD----KIKAVLLWLFER.NCSKFK.KA..YSDENQINPI-----FLYIVLW
Q7RAI9_PLAYO/1-299.ENKCK..................TE..AD----KINAGFLWLFEQNIINRITGFKGSSDKKHKV..F-----IIYIMIW
Q7RBK2_PLAYO/1-285..GNCD..................ND..IY----KIDAGCLWLFNK.FYGDSNNFS..NNANAKIG.V-----AVYIMVW
Q7RA91_PLAYO/1-295...ICE..................GD..IN----KIHAGCLWLFNK.FYGNSNNFS..SNANGNMN.I-----VTYIMTW
Q7RCV4_PLAYO/1-300SNNSCNNNDFQ.............SD..LD----RISAGCLYLLDE.FIKDCGLLP..PPARNNTN.I-----VDYILIW
Q4X890_PLACH/1-129..............................----..................................-----.......
Q7RHS9_PLAYO/1-267....CN..................ND..FE----KINAGCLYFFDA.FFKDSSLFK..QVAKNNIN.I-----VDYIIIW
Q7RHP0_PLAYO/1-282....CE..................DD..IK----KISAGFFYLLSG.FFGDPNSFN..FDEKSNND.I-----FYYIMIW
Q7RQB7_PLAYO/1-303KEKECK..................NE..VD----KINAACLWLFEQNIVNRISDFNGSNDEKHKV..F-----IIYIMIW
Q4Z7R7_PLABA/1-277....CD..................DD..LD----KINAGCLLLFNE.LFGSIYSFN..NHAKNNID.A-----VYYIIIW
Q7RHL9_PLAYO/1-326SNNYCNNNNNNNFPISYCNDNKIRND..LD----KISAGCLYLLDE.FIKDCGVVP..PPAKNNIN.I-----VDYILIW
Q7YZ86_PLACH/1-256RNCKCC..................GY..YE----MTSSGVIYLLEN.LKKKCNLDDDK.........L-----AEYAILW
Q7RJ63_PLAYO/1-296...NCN..................ND..ID----KINAGCLWLFNA.FFNKYGTSAINNTYKD....D-----TVCIMIW
Q7RHP5_PLAYO/1-274....CN..................TD..LD----KINAGCLWLLDQLFV.........KNKKSDIN.I-----ADYIIIW
Q7RA21_PLAYO/1-277....CD..................SD..IE----KINAGFFYLLNQ.FFG.SSVLS..HYGKNNIN.I-----VDYIILW
Q7REE4_PLAYO/1-252....CD..................ND..LD----KINAGCLYFFNA.FFKNSDLFS..KYANNYMN.I-----VEYIMIW
Q7R7L0_PLAYO/1-205....CN..................SD..LR----KINVVCLHFVDD.FFGRSSSFK....NHNNIN.I-----VDYIMIW
Q4YH17_PLABA/1-291...NCN..................ND..ID----KINAGYLWLFNK.FYGDSDKFS..NSANDNIN.I-----VVYFMMW
Q7RM24_PLAYO/1-277....CT..................SD..YG----KINAGFFYLFNG.LFGLSGLFN..PRETSNIN.V-----VEYIMIW
Q7R8S4_PLAYO/1-292...KCE..................ND..ID----KIKAGCLWLFKQ.FYESPYNFS..NNANGNMN.I-----VTYIMTW
Q7RDZ3_PLAYO/1-258....CT..................NE..LD----KVNAICLWLFEK.NFENNSSFV..NNAKSNID.I-----VEYIIIW
Q7RJ28_PLAYO/1-315...DCN..................TD..IN----KIHAGCLWLLNQ.FYGDYDKFA..NNANDKID.I-----VIYIMTW
Q7RDW3_PLAYO/1-274...NCD..................ND..DK----KISSAFIAFLA..FFNVIGVDENLDSDK.....I-----AEYAILW
Q7RQI7_PLAYO/1-298...NCN..................ND..ID----KINAGCLRLIYD.FFIKSGFSADPDTLKS....D-----TVCIIIW
Q7RK85_PLAYO/1-254...KCD..................TD..DK----KVSSTFISLLK..SFKNIDDKENLESDK.....F-----VEYTILW
Q7RS14_PLAYO/1-297GEGKCN..................TK..LD----KINAVCLWLLNSNIAYKVN.....YSSKEKVKSF-----IIYIMIW
Q7RGN4_PLAYO/1-299DQKECK..................TE..LD----KLNAACIWLFNQIVANKMDSLNGEQLKS.....I-----ITYIMIW
Q7R8D0_PLAYO/1-281....CN..................SD..LE----RINAGCLYLLDA.FYKDSNLFK..TLAKSNID.I-----VEYIMIW
Q4Z0V4_PLABA/1-324....CN..................IN..LE----KINAGCLYLLDA.FFKDSSVFS..SVAKNNIN.I-----VEYIIMW
Q7RKY7_PLAYO/1-277....CS..................NN..IG----KINAGCLFLFDS.LFKDSSVFS..YYTKNNIN.F-----VDYIIIW
Q4XE61_PLACH/265-545QNVNCE..................AN..NE----KMSAGFIWLLI..TFENLCVGQCSDNENEK...Y-----AEYAILW
Q7RHX9_PLAYO/1-284....CQ..................SD..YD----RISAGCLYLLDQ.LYKDSGVLP..SPKDSNPY.I-----VDYILIW
Q7R9W6_PLAYO/1-272....CS..................DN..LG----KINAGCLYLLDA.FFKDNSVFK..TDAKSNIN.I-----VEYIIIW
Q7R9Q4_PLAYO/9-276GKNECD..................ND..LG----KITAGFLWLLEE.CYSIPI.NK..TYNKDSTNPF-----FIHMISW
Q7R7X0_PLAYO/1-296NNKKCN..................TN..LD----KIKAGCLWLFEQNIINNTDSLS.....KEQIEII-----ITYIMTW
Q8WT02_9APIC/1-285GNKECR..................TD..LD----KIKAGFIWLFNQIIVNKINNLN.....KDQIEIF-----IIHIMIW
Q7RMB8_PLAYO/2-270..NGRN..................DE..LE----KINGGCLYLFKN.MFGDSYSFK..EYTNNNIK.V-----VEYIIIW
Q7RSD0_PLAYO/1-255....CD..................GS..FD----KISAGCLYLFDA.FFGGYKPFN..DVANRNIN.I-----VDYILIW
Q7REX1_PLAYO/1-255....CD..................ND..TG----KINAGCLYLLDA.FFKDNSVFN..SVAKSNIN.I-----VEYIMIW
Q7RL45_PLAYO/1-297....CI..................SD..FD----RISAGCLYLFDG.FFGNSSVFE..YIAKNNIN.L-----VEYILIW
Q7RI05_PLAYO/1-288....CD..................RDHPLD----KINAGCLFLLNK.FFG.SSGLS..NKAKNNIN.F-----VDYIMIW
Q4YH25_PLABA/1-270..ENCN..................TD..LE----KITIGFLWLLEQ.YFTISKDTD..DYNENNTNAF-----FLYIISW
Q7RL82_PLAYO/1-274....CD..................SA..FE----RINGGCLYLFKQ.IFGTSELFK..SVANSNIN.I-----VEYILIW
Q7RL75_PLAYO/1-259....CE..................SD..LA----KINAVCLFFFKH.FFGDSGSFE..INAKSSIN.I-----VDYIIIW
Q7RRS6_PLAYO/1-291KDKNCN..................TD..ID----KIKGAFLWLFEQSIIINIDSLS.....KDKSGAF-----IIYIMIW
Q8WT03_9APIC/1-293KNK.CE..................TD..LD----KIKAGFIWLFEQNIVSRISDLS.....TEQIDIF-----IIYIMIW
Q7R9Y8_PLAYO/1-266....CN..................DP..IA----KINAGCLYFFDE.FFGTSELFK..SVAKSNTN.I-----VDYIIIW
Q7R8Q2_PLAYO/1-296...SCD..................SD..IN----KINAGCLWLFNY.FFVTSAIPFYRDFYKH....V-----VVCIMIW
Q7RCK0_PLAYO/1-269....CD..................DD..LE----KINAGCLFLFDA.LFKDNSVFK....YHNNIN.M-----VKYIFIW
Q7R7N7_PLAYO/1-246....CE..................MP..LE----KINAACLYLFDG.FFKDADLFK..SVAKSNID.I-----VEYIMIW
Q7R925_PLAYO/1-251....CN..................ND..TD----RLNARCLHIFDA.FFKDKSGFE..TDAKGNIY.I-----VQYILMW
Q7R8E2_PLAYO/1-255...NCD..................ND..NL----KVSSAFITLVT..LLNGIDDKENLGSDK.....F-----AEYAILW

PF05795

A5KD74_PLAVS/16-336......------------------EE--DI....ALCNKVSKHLK..RLSGLP..D--NERKHG.........CYYFQYW
A5K942_PLAVS/22-370...TKY------------------PW--IN....DILKKLRRNIS..LVQNKH.DF--NDEFIK..KG.....CFDLHYW
A5KD05_PLAVS/8-390....GN------------------RE--IY....NLCNMYAKNLKQLSTIMEE.EK--DSK.....QH.....CRYLTFW
A5KCZ5_PLAVS/13-363N...EY------------------RV--PR....DDSDKILKALC.YVYRTSS.R.--.SEFYS..NT.....CIFLYFW
A5KDC7_PLAVS/13-362D...KN------------------AG--LE....KDSDKIISALC.YVYTMSS.N.--.AHFDT..NI.....CNFLYYW
A5KD53_PLAVS/22-422...KKK------------------EN--ER....NICLKLVRHLE..KIGEIT.EK--SKRDDY.........CNYLTYW
A5KC97_PLAVS/22-304....RY------------------TE--FR....EICNKFAKNLEDIFCNKYG.EK--TI......NY.....CILLEYW
A5K691_PLAVS/16-331..SIGN------------------GS--VQ....KLCNKLVYFLE..EIAKTQ.DE--QIRDDR.........CSYLTHW
A5KAS2_PLAVS/244-559PLEKNK------------------EA--FN....LLLAKHATNLE..KLSNIL.TD--TSSDDR.........CSYLLYW
A5KCQ8_PLAVS/25-314......------------------..--......EGRLNIIKHFKLIKKYFNH.YK--NNETHNSNKW.....CSYINFW
A5KD32_PLAVS/8-337KE....------------------KE--VK....EICTKFIRYLETS.KVLNV.EK--PKH.....DI.....CILLNYW
A5K735_PLAVS/3-393...END------------------TV--IA....KFCELFITYFW..NLNNYN.TS--NSSGHE..KY.....LEYMNYW
A5KCR3_PLAVS/9-294PQ...N------------------EK--IQ....TICTQLITNIF..YFRDVH.SK--NGSFLD..KH.....CYDLNYW
A5K8H5_PLAVS/21-452...KTY------------------KG--VK....EICIKLVSSLE..KIADIGKNK--TEYDDY.........CNYLPHW
A5KD69_PLAVS/21-342KF....------------------FN--N.....RLCKILLRYLENATKRSQI.DY--SAY.....DD.....CILFNYW
Q9N886_PLAVI/17-366...PLN------------------QE--IY....QLCRMFARNLKEMSTILND.VN--DNI.....DR.....CRYINFW
A5KCT2_PLAVS/17-298RFTHNS------------------DN--LI....EPCVKFVQFLT..RLSEKP.SK--DKVHG..........CIYLYYW
A5KD30_PLAVS/21-355SG.IKY------------------QK--LR....ILCAQLVKYLKTTHTTFKR.EE--NKY.....DP.....CILLNYW
A5KBG3_PLAVS/140-414RLKDKY------------------PW--IC....KLCRLFSKNLI..DISKLE.DE--QKRKEK.........CFYFQYW
Q9N887_PLAVI/22-345AE..NG------------------EK--LI....NLCKQICNIIF.NVHDILD.KC--NDKTGN..KA.....CNYMGYW
A5KD66_PLAVS/21-335HG....------------------SS--LK....KICAKLLNYLKTNTKS.NK.ED--VKY.....DV.....CILLNYW
Q9N8A0_PLAVI/10-445NKINNE------------------SH--KW....NLKNKTFTTLH.NVLANDL.AF--YGGMKH..HY.....CRFINYW
A5KBF9_PLAVS/37-328KN....------------------DK--VI....ELCKRVLRYLKTTYAISDH.KN--SDY.....DV.....CMLLNYW
A5KBR5_PLAVS/12-313DKLKEY------------------AD--IE....NYSDNIVKAMC...YVSKM.EK--SDPFYD..ER.....CYFLYYW
A5KDE6_PLAVS/22-346AE..NG------------------EK--LI....ELCKKICNIIL.NVHGILN.KC--NDRTDN..KA.....CSYMEYW
A5KCW1_PLAVS/25-352...SKR------------------KE--VK....DLCIKLVSHLD..KLSQAG.DP--ERNNY..........CIYLRYW
A5KD28_PLAVS/16-416...KQN------------------DG--AK....KLCNKLLYLLE..NIAKNP.KT--ADNVKR.........CSYLRYW
A5KD65_PLAVS/22-478...KTY------------------VG--VK....ALCSRFARALE..KAAEVKGNG--DERKNS.........CNYLHYW
Q9N8A3_PLAVI/13-292SIYKST------------------FN--LN......CKKSLNYLE..YLEESE.HT--DIRKSQ..GT.....L.YLYLW
A5KE77_PLAVS/14-291...FGK------------------EW--VN....DFCTKFVRNLK..QVNSEADAG--KKNR...........CLHLNYW
Q9N899_PLAVI/13-363S...SD------------------SG--LQ....KVFEKILKAMC.YMYTKKR.H.--.KIFDS..DM.....CKFFYYW
A5K945_PLAVS/9-352HN...N------------------ER--IR....EICNMLIANIF..YFRDKH.TD--NTPFFH..KH.....CYDLNYW
A5KCV9_PLAVS/16-436......------------------DQ--DR....QLCNKILKNLS..ILKKEK..G--KEQKHG.........CYYFQHW
A5KC95_PLAVS/23-424....KD------------------QN--FH....NLCYDLEGILN..NWHDIC.EG--KESNYD..KY.....CECLIYW
A5KE70_PLAVS/16-392......------------------GE--DE....KFCNQIAKNLR..KIFLEK.DP--LKRRYG.........CNYFKQW
A5KCL0_PLAVS/21-363.ATFNS------------------DD--VNRDEYKLCEKFERNLR..KISKMK.DE--RTRKDM.........CLHFIYW
A5K5E2_PLAVS/17-358PLEKDN------------------PG--IY....ELCKKAVKNLH..EVIKKG.KC--NEW............GEYFAYW
A5K936_PLAVS/22-322...SQY------------------NG--LS....TLCKKVAKGLK..ELTAIDGLN--QNADER.........CSNVTYW
A5KCW8_PLAVS/16-290NG..YK------------------KE--AY....ELCKKIIRNLN..NLHDIV.VP--ETRRYN.........CLHYKYW
A5KCU8_PLAVS/16-426KLSKKD------------------DE--IK....HLCSKFLRNLK..DLKNEK.AT--YDDKHR...........YLTFW
Q9N884_PLAVI/13-362KQRYQY------------------KN--LQ....DMAEKIVRALC.YIYNRKR.NF--PAYFNE..DL.....CWYLHYW
A5KBG4_PLAVS/18-346DETKYN------------------DN--VN....DFCNKFSWSLK..NLSEITGNE--LKHRDK.........CSYLSYW
A5KAS5_PLAVS/16-329.VLGSN------------------ET--IK....NLCKKFLRNID..ALPNSNGNE--KNYKDE.........HLYVIYW
A5KDD1_PLAVS/6-340SK.IKH------------------SN--LK....ILCEQLVKYLISTYIILNK.EK--LKY.....DP.....CILLNYW
Q9N888_PLAVI/8-385....KN------------------QE--FY....ELCKRYENNFKELSTIMNG.EL--DSN.....EQ.....CIFLKFW
A5KCU5_PLAVS/21-349......------------------EG--DK....KLCKKIVQNLS..QLSALK.DD--ENLKNS.........CYYFQHW
A5KDR2_PLAVS/20-353DKYKNN------------------DK--FL....KLCSMALLYLR.....NYD.KS--TERKSLPCNR.....CRLFNYW
A5K1K8_PLAVS/20-397DSFNGD------------------KS--LDSPLQEFYRKLDRNLKLIPKLLAQ.PA--EDISVDKHKL.....CFYLKYW
A5KD19_PLAVS/13-348KFGVTE------------------DK--AN....KFCKRAVTILK..KINDTH.ND--DKRNDE.........CVYFQHW
A5KCT1_PLAVS/19-351KHGLYW------------------GD--AQ....DFCDRAVSNLK..KVNSIS.NK--QRHNEE.........CSYFQHW
A5KD97_PLAVS/20-353KE....------------------DS--LI....RICKKYITYLETS.KVLNF.VR--PDY.....DV.....CILLNYW
A5KD24_PLAVS/19-471...GND------------------KD--VR....ELCSKVVSYLE..KIPMVS.DT--RKRNNY.........CSYLPYW
A5KD42_PLAVS/16-297......------------------EG--DK....TFCKQIVQNVS..QLSALE.ND--QKIKNS.........CYYFQHW
A5KD93_PLAVS/15-447.....K------------------EG--VK....KLCTKFVYFLE..KIAEIK.EY--YERGDH.........CNYMHYW
Q9N8A4_PLAVI/16-297SAHFSF------------------V.--......TTCVKITQYLV..HINHEY.AN--QDVN....DK.....CEFLNYW
A5KCR2_PLAVS/16-444...KKY------------------AG--VK....ELCSKLVLFSE..KIAEHK.NA--TERINY.........CSYLPYW
A5KCZ2_PLAVS/21-348ST.IKY------------------KN--LR....ILCAQLVKYLKTTYILFNK.EE--LKY.....NP.....CILLNYW
A5KC13_PLAVS/21-353NT....------------------PG--VK....KICKQVLKFLKTKAFRLDH.ED--SVR.....DD.....CVLLNYW
A5KDP5_PLAVS/25-322...FKR------------------TE--VK....ELCSKLVRVLE..KLSKAG.DS--ERNKY..........CSYVRYW
A5KCZ1_PLAVS/16-330......------------------EG--DK....TLCKKIVQNLN..QLSALK.DD--ENLDNS.........CYYFQHW
A5KD49_PLAVS/23-351NG....------------------RK--VK....IICAKLLKYLITNKILRSK..D--NEY.....DF.....CILLNYW
A5KD48_PLAVS/21-346ED....------------------IK--AK....KICAKLLKFLESDKISINK..N--DEY.....DV.....CMLLSFW
A5KD50_PLAVS/14-324MR....------------------QS--LR....ITCARLLKYLKT..YKFSK.ED--NEY.....DI.....CILLNYW
A5KCL3_PLAVS/174-499HLEFDH------------------PG--IN....HFCRMLSKNLR..ELSEMESAN--SKDR...........CEYFTHW
A5KCL7_PLAVS/29-304QRYSVH------------------DS--FK....DSCAKSLEYVK..KLKLDK.SS--SIV.....PF.....CKYMHYW
A5KDK0_PLAVS/15-278.....T------------------KI--TK....ELCNKVAANLQ..YVYDIK.EE--DKKKNT.........CRLYKYW
Q7K6M7_PLAVI/22-354ELMNDS------------------SD--VN....NLLKELYSHLYRIYVTIPV.LN--NTYFDGVELNDEKLGCLCLKYW
A5KCY1_PLAVS/24-359NFEESY------------------PG--IS....DFCRMLVRNLH..EIKYSK.DS--KGR............CGYLYYW
Q9N879_PLAVI/21-298.NNDQN------------------TE--FI....EPCQKLIQYLK..YIKKEY.LA--GIHIQS.........CKYFSYM
Q9N893_PLAVI/16-337.....T------------------KI--TK....ELCNKVAANLK..YVYDIK.EE--DKKKNT.........CRLYKYW
A5KE76_PLAVS/272-715QE....------------------..--LK....PLCRKIVRNLK..NISDNK.IM--KKLNQG..DR.....CLHFIFW
A5KD21_PLAVS/16-354......------------------EG--DK....AFCNKIAKNLS..ILKNEK.DM--QKRTYD.........CYYFNHW
A5KDG0_PLAVS/6-332RS....------------------RA--VK....NICIKLLNYLKTNEISNIQ..G--AQY.....DV.....CPLLNYW
A5K733_PLAVS/31-364DLKTKN------------------ED--IK....TLCKKIERNLN..KLNETD.KI--KDERYR..DR.....CLYFNWW
A5KD00_PLAVS/31-351QT..NG------------------AE--LI....DLCKKCCNIIL.NVNNILD.KY--KSSDDK..KK.....CQYMSHW
A5KDQ9_PLAVS/9-353PQ...K------------------DN--IQ....KICTLLITNLF..LLRDKH.YE--DTSFFN..KH.....CYDLNYW
A5KE78_PLAVS/66-466DE..NY------------------NK--IK....DLCKVFVPYFL..YLTFKN.VQ--NDPSGR..RR.....LGYLNYW
Q9N890_PLAVI/21-313KD...N------------------HE--IK....RLCAKVVKYITSKPSILNE.EH--LKD.....HH.....CNLFNYW
A5KCR5_PLAVS/246-528HLEKKY------------------KD--IK....IVSIKLAANLD..SLSSMTKIS--ADHSER.........CSYMNYW
A5KD77_PLAVS/22-354KISWNS------------------SV--IS....EIIEALYSNLFRIYDSITG.TN--NTYFENISSKDEKICCTSLKYW
A5KCN6_PLAVS/30-306.....K------------------SI--SP....DLCDKITKNAR..YTNGLS.TI--KKGDDD.........CLNYKNW
A5KDD8_PLAVS/3-324GN....------------------EH--IK....KICKKFLRFIEKS.SLWNI.QD--SSY.....DV.....CLQVNYW
Q9N891_PLAVI/29-310INQYNN------------------TF--TD....KDCSQALHYLN..TVDSTN.ES--QYIS....DA.....CKYFMYW
A5KD86_PLAVS/13-363PG...Y------------------YN--LN....GVFEKIVKALC.YIYNTKK.DK--KETFNN..DL.....CSYLYYW
A5KD96_PLAVS/3-408.....R------------------DA--LT....HQCHKLKEFLL..YIDSND.KN--NLT.....KC.....CSYINYH
A5KD33_PLAVS/16-309......------------------KE--DK....ELCNKVSKHLK..RLSGIS.NN--DDRKHG.........CFYFQYW
A5KAR9_PLAVS/16-316......------------------ES--DK....TLCKKIAQNLR..KLSTLQ..G--DELKNG.........CYYFQHW
Q9N880_PLAVI/21-343KS....------------------FT--NI....RLCSILLRFLNDSGKRTGN.IK--SNY.....DD.....CILFNYW
A5KD07_PLAVS/16-341......------------------EV--DK....TFCNKIAKNLS..ILKDEN.DK--QKRKYG.........CYYFNHW
A5KCX5_PLAVS/16-447.....K------------------EG--VK....KLCTKFVYFLE..KIAEVK.GY--TENNNH.........CSYMHYW
A5K8H2_PLAVS/11-325...HGY------------------DW--IN....DFCPKFVRNLK..YINEMDGSI--GKFR...........CLHLNYW
Q9N892_PLAVI/23-348WR....------------------KD--VI....NTCAKLLYYLKTSKKLYMQ..N--AQY.....DL.....CPLLNYW
A5KAS1_PLAVS/321-662EFKNGY------------------PL--FI....DLCKKVAKNLK..KLNETKLAA--DENIS..........CSYFTYW
A5KD25_PLAVS/16-291......------------------KE--DK....ELCYKVSKHLK..ILSGLS..G--DKLKHG.........CFYFQYW
A5KDR1_PLAVS/21-363NK...Y------------------PN--VI....KLCKQVLKYLKTNYSTLNN.QA--NDY.....DL.....CKLLNYW
A5KB35_PLAVS/10-413DT..VD------------------PL--IK....QICTDFRKLFI..TLAYSV.TN--EVKANI..KY.....HEYLNYW
A5KC93_PLAVS/16-453......------------------DG--DK....KLCKQILKNLS..VLKTKK..G--EEQERG.........CYYFQNW
A5KDB2_PLAVS/34-401...KRY------------------PW--LD....DIFKKLSRNIA..LVQESY.VE--GDDFNK..KR.....CYDLNYW
A5KCT3_PLAVS/289-657SPDENN------------------DE--IK....SLCVKLVTLLK..KLNTIDGVG--NNHRDR.........CSNLIYW
A5KBR2_PLAVS/254-616...GNT------------------SD--VK....KLCQKIVRNLI..NMYEIQ.DK--EKRNEC.........CLYFNYW
A5K5E1_PLAVS/11-355...AEY------------------PG--LE....TVCKKFARNFTSISTVFLH.DK--NKD.....KR.....CDYLNYW
A5KCW5_PLAVS/22-437...KKK------------------EN--EK....NICLKLVRHLE..KIGDIK.EK--ATRVDH.........CNYLTYW
A5KBG1_PLAVS/253-633ELESNY------------------PG--IY....QFCKKLARNLR.TNLSDIKSLE--KNVNDR.........CLYLIYW
A5KD15_PLAVS/33-411...ARF------------------QW--SQ....DLYNKLSRNIK..LVHDRF.VE--GDEFNK..KR.....CYDLNFW
Q9N8A2_PLAVI/21-355KD.IKY------------------TN--LR....ILCAQLVKYLKTTYTTLNK.GD--LKY.....DD.....CILLNYW
A5KD02_PLAVS/23-315WR....------------------QG--VI....NTCAKLLYYLKTSTKLNKK..V--NNY.....DV.....CPLLNYW
Q7RBM2_PLAYO/10-293EP...S------------------EW--VR....EIVYKLQRNVT...FLNEN.RD--GDKLYG..KH.....CYDLNYW
A5KD12_PLAVS/20-341...GKH------------------SW--ID....DLFKKLSRNIS..MIHNKH.NV--KDEFGK..KH.....CFDLNYW
Q9N882_PLAVI/13-362NHYYVH------------------PD--VH.......EKILKGLC...YAYGN.NI--QDETVN..DI.....CNFLYYW
A5KCU2_PLAVS/3-296KG....------------------NK--VN....NVCKSLVKYLKTKYQPPDK.EG--FAY.....ND.....CILLNYW
A5KDH3_PLAVS/7-287...GTH------------------KG--AK....ELCIKLVRFVK..KIAEWK.NK--PESVKY.........CDYLQYW
A5KCY0_PLAVS/16-372....EN------------------TK--LK....DLCYKYERNIK..ELSNEQ.DK--VRARDR.........CYHSMCW
A5KCV2_PLAVS/23-358DKWTNF------------------TD--VN....DLLKELYSTVYRIYIAIIG.NN--NDYFDKHQSELKKIGYIYLKYW
A5K697_PLAVS/19-332...GIY------------------KG--VK....ALCSKFGSSLE..YAADER.HR--EKHKNY.........CNYLRYW
A5KD10_PLAVS/16-340...NNN------------------DE--MI....NLCKKIARNLE..KLSGIL.SN--NAKDVK.........CSYFNHW
A5KC12_PLAVS/18-313KN...D------------------DK--FL....KLCSTALDYIK.....NYD.KS--TSRKQLSCND.....CKLFNYW
A5KD72_PLAVS/21-431...KTH------------------PG--VK....ELCTKLISSLE..KLAEMKPKN--KDYYDR.........CNYLPHW
A5KDR4_PLAVS/16-315QHKDKY------------------QD--IF....ATCNKIEKNLK..EIVAMQ.NV--NDRRSR.........CNQFQYW
A5KD61_PLAVS/26-325TE..ES------------------KK--LN....NLCKKVCYILL.NFKDMEN.LI--QTLTSV..KC.....CAYMSTW
A5K8H3_PLAVS/281-557KLEFEY------------------PG--IT....NLCKKLGRNLK..NIKNEAPKK--HYEK...........CGHLYYW
A5KCX3_PLAVS/16-418PE...R------------------EE--IL....KVCANLISNIK..HIESET.SK--EPSFIQ..KH.....CYDLNYW
A5KD87_PLAVS/15-315KR...K------------------PK--NK....ELCAKIVNYIKSKPKISTE.EH--LKD.....HH.....CNLFNYW
A5KD90_PLAVS/13-364D...KN------------------KV--LE....NDSDKILRALC.YIYKNRS.S.--.GSLDS..DK.....CNFLYFW
A5KCK8_PLAVS/21-282....GN------------------DE--VK....NLCKKFEKNSK..ELGTLVVNN--VNLGAR.........CSYLTYW
A5KCL1_PLAVS/23-389......------------------.S--VQ....NVLPKLNRMFPDKQIDNKI...--........KV.....CEHLNYW

PF06022

Q4Z0W5_PLABA/1-311LSYMLNL.KKNERNK..NLEYFNKIYINNDK..YQT..............SIDKV.G-----------D-----------
Q7R9N0_PLAYO/1-297LSYKLSL.KPPEKIT..TLKEFYSNYIENNTE.YIN..............HKSED.S-----------D-----------
Q7R7Q4_PLAYO/1-261LSYVLSL.IKSEEND..SIDSFYKKYIEKDGK.YTT.............NNIDYI.V-----------G-----------
Q4Z1P4_PLABA/1-258LSYMLSL.KSHDNIV..NLEEFYDQYINHGNE.YIN..............SINCD.D-----------Y-----------
Q7RPL7_PLAYO/1-266LSYMLNL.KANTRED..NLNYFYTISINSDNI.YKN..............PITGI.P-----------G-----------
Q7RB69_PLAYO/1-276ISYKLNQ.IKEKGFT..TINEFFTKNVKNSGK.YKQ..............FISDA.Y-----------K-----------
Q7RFC2_PLAYO/1-273LNYMLNL.KKVNDTN..NLNEFYIKYTEKNTD.YEY....CKTDGIDCDSALKNQ.L-----------G-----------
Q7RE48_PLAYO/1-296LSYILSL.KPPDNIT..KLNDFYSNHIQNNEK.YTT..............RNVND.E-----------G-----------
Q4Z522_PLABA/1-285FSYQLNK.ITGHNST..TINDFYNKKIKNNDK.YKK..............FRDDS.S-----------K-----------
Q4Z0P5_PLABA/1-308LSHMLNL.KDSTGNI...LTNFYKIYIKNQEK.YKN..............TINGV.E-----------G-----------
Q7R864_PLAYO/1-257LSYKLDQ.KKENETT..KLEDFYNKNIKTNSC.YDQ..............KINAD.S-----------N-----------
Q7R9W7_PLAYO/1-296LSYKLNQ.KSENGIN..TLKDFYSKHIENNEK.YTK..............SEIYN.K-----------K-----------
Q7R881_PLAYO/1-264LSYKLNQ.ITRKNFT..KINEFYTKHVDNNNK.YSK..............FIKHS.S-----------T-----------
Q7RFB2_PLAYO/1-280LNYMLNLMEPSGSTT..NLEYFYKLYINTGVK.YNE..............VINGD.K-----------P-----------
Q7RLH9_PLAYO/1-288LSYMLNL.KKSEGQD..IIKDFYNNYINDSDK.YNK..............EINGV.S-----------D-----------
Q7RBL1_PLAYO/1-257LIYMLNL.IKTKEND..SITIFYNTYIEGGDK.YTK..............KLDYI..-----------.-----------
Q7R7W7_PLAYO/1-274LSYMLNL.KDIPGIT..YINEFYDDFINDNK..YKN..............SIDDV.D-----------A-----------
Q7RJC9_PLAYO/1-298LSYMLNL.DKSEEKD..NINDFYITYIYNCDK.YNK..............KIYEL.T-----------D-----------
Q7RRG2_PLAYO/1-236LSYMLSL.IENNDNSVSNLDHFFKVYIDGGS..YYN.....................-----------.-----------
Q7RT28_PLAYO/1-292LSYKLNQ.KTEHATT..KLNDFYSNYIQNNAE.YDN..............HKPND.E-----------K-----------
Q7RDL9_PLAYO/1-222LSYMLSR.TKSVEKD..SLNEFYTKLIENGEG.RKK..............EID.V.T-----------A-----------
Q7R7C1_PLAYO/1-249LSHKANQ.KPQNGTT..KLYDFYTSYVLTNNK.YDD..............KIF...T-----------N-----------
Q7RNM9_PLAYO/1-291LSYKLNQ.KLHEGIN..NLNDFYEAHIMNNTY.YNK....CDNGGQDCSNSLKEI.M-----------G-----------
Q4Z019_PLABA/1-277FGYKLNQ.ITGQGST..KINDFYTNNIINSHK.YDN..............FTNTA.Y-----------K-----------
Q7RSF9_PLAYO/9-311LGYKLNQ.KLIKEFP..NLKDFYSKHIQNAEE.YNK..............TINGV.K-----------G-----------
Q7R7D1_PLAYO/1-255LSYMLNL.KNTQDNTITNLNYFYKLYIENHQK.YN......................-----------.-----------
Q7RNI0_PLAYO/1-291FSYMLNL.KNVKEFN..NINEFYDAHIKNITD.YIN....CNTDGKECNSILKNN.L-----------G-----------
Q7R7X7_PLAYO/1-266LSYILSLKKNTSTIS..HLQHYYDTYINGSEY.YKQ..............SINGV.E-----------D-----------
Q7RFX2_PLAYO/1-264XSYMLIQ.TKSGENN..SLNEVYTKHIENDER.YKK..............EINGV.T-----------A-----------
Q7YZ88_PLACH/1-291LCYKLNL.MSYEGIS..NINDFHNKYIKDKES.DIQ..............KIVDV.E-----------A-----------
Q7RCT8_PLAYO/18-257LSYKLKR.NSEHNIN..KINDFYTEYIKNSGK.YNE..............FISDS.G-----------K-----------
Q7RKC5_PLAYO/1-282LSYKLNQ.KAENGIT..KLDDFYNKYMQSVEE.YNT..............PIEND.T-----------Q-----------
Q7R8V9_PLAYO/1-298LGYILSL.KPPDNIK..TLNDFYSNHIEKNTM.YSE..............HKVNNQE-----------T-----------
Q7YZ81_PLACH/1-272LIYMLKL.KNDTKVE..NIMNFYNKCINVGDE.YIR..............SIADA.E-----------T-----------
Q7RHL2_PLAYO/1-264LSYMLSL.IKSKE.D..NRKHFYNTYIMDGDE.YTN..............NINYI.I-----------D-----------
Q8WT16_PLACH/1-282LSYKINQ.HPNQTF...GTNDIYNNFKQYG...YWN....................R-----------K-----------
Q7R8B9_PLAYO/1-296LSYKLSL.NPSDNIT..TLKDFYSNNIENNEE.YDK..............HKPND.E-----------N-----------
Q4X397_PLACH/5-171LAYNLLH..........NI....SNSIKDTNA........................N-----------A-----------
Q7RJD0_PLAYO/1-252LSYKLNQ.KTQNGTT..TLNDFYTNHIETNSC.YKG..............NIPND.S-----------N-----------
Q7RII1_PLAYO/1-285LSNIVNK.MPGEGIT..TLKGFYAKYIKNNTH.YTN....FNSDGKDFSNSLKEG.T-----------G-----------
Q7YZ87_PLACH/1-262LCHKLNK.NSQNKVS..NIKYIYDAYIKENEK.DIE..............KISGA.E-----------A-----------
Q7RKR3_PLAYO/1-275LSYMLSL.KENELKD..SLQHFYRTYINGSGH.YNK..............SIIGV.E-----------N-----------
Q7RRV5_PLAYO/1-265LSYKLNQ.NTEETFT..TINDFYTDHIKNGGK.YSN..............FNKDS.N-----------R-----------
Q7RMJ7_PLAYO/1-291LSYMLNM.DTTINYN..GIKYLYDNYITKRGT.YKE..............HINGL.I-----------G-----------
Q7RPH8_PLAYO/1-309LSYKLNQ.KTKNGIT..KLNEFYSKYMENANE.YKQ..............PIDGV.K-----------E-----------
Q7RCT9_PLAYO/18-310LSYKLSL.KTFNNIT..TLKDFYSNYIENNKE.YTK..............DKLND.E-----------T-----------
Q4YH36_PLABA/1-256LSYKLNQ.KTQNGNT..KLYDFYTEHINTNSK.YNE..............HIT...N-----------D-----------
Q7RM73_PLAYO/23-317LGYILNL.KSHGGIN..TLNDFYSKHIINNTE.YTD..............QKIYN.Q-----------K-----------
Q7RGU7_PLAYO/9-281FSYKLNQ.NSEPKST..KIYDFYTKNVINSNK.YNR..............FKKDA.Y-----------T-----------
Q7R943_PLAYO/1-258LSYILSL.KSHEGIT..NLNDFYNQYINKGDK.YNK..............KIDDV.T-----------A-----------
Q7RAK5_PLAYO/1-296LGYILTL.KPHNEIT..SLMDFYSNYMQNYEK.YTE..............HIIAN.Q-----------I-----------
Q4YCQ1_PLABA/1-303LSYMLSL.KSHDNIN..NLKEFFDQYINNGKE.YIK..............AINGV.S-----------D-----------
Q7R9C3_PLAYO/1-237LSYMLSL.KSHDKIN..NLNDYYETHIKNNND.YNK..............HISGV.X-----------S-----------
Q7RIN7_PLAYO/1-266FSYKLKQ.ISYDKNI..PLNDFYNEHVRNNYK.YNS..............FTTPA.Y-----------T-----------
Q7R8U3_PLAYO/1-269LSYKLNK.KSKGKFT..TINDFYTNHINHSDK.YKQ..............FRDDS.S-----------K-----------
Q4YHL6_PLABA/1-288FSYKLKQ.NSEHSFT..KINDFYTSYVKSNDK.YEK..............FISES.S-----------K-----------
Q4YHA9_PLABA/1-253FSYKLKQ.KSYYTTT..SLNDFYNEHIKNNDK.YSK..............FISDS.G-----------R-----------
Q7RFZ7_PLAYO/1-278L.......KKENGIN..KLNDFYTKHIETNTH.YIS..............KLGDA.R-----------G-----------
Q7RTJ0_PLAYO/1-252LSYKLNQ.KPQNAIT..TLNDFYTMYIETSKK.YKT..............SIENV.K-----------E-----------
Q7RJE2_PLAYO/25-326LSYMLNL.KGVTEFK..NMNEIYTKHIENNMH.HIN....CKKTDNDCNNSLKEK.T-----------E-----------
Q7R7P6_PLAYO/1-245LSYKLHQ.KTDNGIT..NLIDFYTNHMQNVKE.YKE..............SIKDS.A-----------E-----------
Q7RKA5_PLAYO/1-268FSYKLKK.YKEHSTT..KIYDFYNNNVINNHK.YNK..............FVTDA.Y-----------R-----------
Q7R9Q6_PLAYO/2-288LSYKLNQ.KTYDEIK..NLNDFYEAHIKNNTH.YIN....CKQGGVNCSDSLKKN.I-----------G-----------
Q7RK60_PLAYO/1-246LGYKLNQ.KLKTEFP..NINEFYEKNMKTYHG.YKK..............NIDYV.D-----------G-----------
Q7RK83_PLAYO/1-317LSYMLNL.GKSEGKD..NVNDFYSTYINSCNK.YND..............YINDL.S-----------G-----------
Q4Z1S0_PLABA/1-273LVYMLNL.KKQENKT..NLQYFYDTYINNDK..YKK..............PITGV.M-----------E-----------
Q7RCJ0_PLAYO/1-265LSYKLNQ.KSEYYFT..TINDFYTKHINDNEK.YTS..............LIKNG.N-----------N-----------
Q7R9P0_PLAYO/1-271LSYKLNQ.NSDHYFT..KINDFYIEYVNGDQQ.YNS..............LINDA.N-----------K-----------
Q7RAI9_PLAYO/1-299LSYMLSL.KKVNNIN..NLNEFYELHIKDNTH.YNTCKKYKNNNYNDCSNSLKDK.T-----------G-----------
Q7RBK2_PLAYO/1-285LGYKLNK.MLNTQFS..NLNEFYSKHMKTVNE.YKQ..............SITGV.T-----------E-----------
Q7RA91_PLAYO/1-295ISYKLNQ.KKQDGIT..TFNDFYSKHMQNVEE.YKN..............NIYGV.T-----------G-----------
Q7RCV4_PLAYO/1-300LRYMLNL.NKTIKNN..NINDFYNAYINNCDK.YKV..............QISEL.N-----------D-----------
Q4X890_PLACH/1-129.........................................................-----------.-----------
Q7RHS9_PLAYO/1-267LSYMLSL.MKSELNQ..SLGFFYKTYMKGGNK.YTN..............TIADI.S-----------E-----------
Q7RHP0_PLAYO/1-282LSYMLNL.KKNDLNN..SLQYFYDIDISNQNK.YKN..............PIVGF.T-----------E-----------
Q7RQB7_PLAYO/1-303LSYMLKL.KNVNDFK..SLKDFYEDHIKNNSH.YTNCKKRNNNNYDDCSSSLNAK.T-----------G-----------
Q4Z7R7_PLABA/1-277LSYMLSL.KSHNNIT..NLNDFYNQYINKNEK.YKQ..............SITGV.T-----------E-----------
Q7RHL9_PLAYO/1-326LSYMLNL.KISEEEQ..IITCFYSEYIHGCDR.YNT..............KINEI.T-----------D-----------
Q7YZ86_PLACH/1-256LSYKLKI.KDNPIIK..KLSDFYKSYIDTNNY.YNE..............NINGG.D-----------G-----------
Q7RJ63_PLAYO/1-296LGYILNL.KSHDGIN..TLNNFYSQHIQNNTK.YTE..............DIFIG.Q-----------A-----------
Q7RHP5_PLAYO/1-274LSYMLNL.KNDNNIN..NVNTFYDEYINKGEE.YKK..............STVDF.T-----------G-----------
Q7RA21_PLAYO/1-277LSYMLTL.KENPLKN..GMKYFYTTFINSNAK.YKM..............TVENV.E-----------D-----------
Q7REE4_PLAYO/1-252LSYMLTL.KENNNSSVSHLQHFYTTYINGSDQ.YKN..............SIISV.E-----------D-----------
Q7R7L0_PLAYO/1-205LSYMLNL.IENNSIS..NLQYFYDTYIKNDR..YNN.....................-----------.-----------
Q4YH17_PLABA/1-291LGYKLNQ.KPQSGIN..KFNDFYSNYMESVNE.YKQ..............NIADV.K-----------E-----------
Q7RM24_PLAYO/1-277LCYMLNL.KSTQDDSFTNLNNFYKTNIENHEK.........................-----------.-----------
Q7R8S4_PLAYO/1-292ISYKLNQ.KPQDGIT..KFNEFYSRHIKNVEE.YKK..............SIDNV.T-----------G-----------
Q7RDZ3_PLAYO/1-258LSYMLSL.KSHEEIT..NINDFYVKYIKDDAK.YNK..............KIDGV.N-----------A-----------
Q7RJ28_PLAYO/1-315LGYKLNQ.KLNTEFP..NINKFYNKHMKNANE.YQN..............HIDGV.T-----------K-----------
Q7RDW3_PLAYO/1-274LGHKLNQ.KTENGTT..TLNEFYTKHIKTNSH.YDQ..............KTIGN.T-----------N-----------
Q7RQI7_PLAYO/1-298LGYILSL.KSHEGIK..TINDFYSSHIKDNAE.YSK..............HKIGD.K-----------K-----------
Q7RK85_PLAYO/1-254LSYIINQ.ITQNGTT..KLYDFYTKNIESNSNYYEE..............DIFAD.N-----------N-----------
Q7RS14_PLAYO/1-297XSYMLNL.KKDGKIT..ALKDFYTNHIENNPN.YAN....CKSDGKDCNSTLKDN.L-----------G-----------
Q7RGN4_PLAYO/1-299LSYKLNK.ISDARIT..TLKKFYNEYIKNHTD.STS....CNKINAGCSSTLKNK.T-----------G-----------
Q7R8D0_PLAYO/1-281LSKMLSR.IKNEQND..SIEFFYKTYIKNDTK.YTN..............AIGGVDD-----------Y-----------
Q4Z0V4_PLABA/1-324LSYMLNL.IKNEQGN..SLEYFYDIYIKNHEK.YTD..............SITSVDA-----------Y-----------
Q7RKY7_PLAYO/1-277LSNMLSQ.IEDKEND..SLKFFYTTYI.NNDK.YTN..............PISGVED-----------H-----------
Q4XE61_PLACH/265-545LNYKLNQ.ISNEETT..TLKDFYTKYIKDNKE.HVD.....................-----------.-----------
Q7RHX9_PLAYO/1-284LSYMLNL.GKSENKI...MDDFYNPYINSCDK.YKT..............EISEL.K-----------E-----------
Q7R9W6_PLAYO/1-272LSYMLNLKQSEQNMS..NLQYFYKAYINNDM..YKK..............AINGI.T-----------E-----------
Q7R9Q4_PLAYO/9-276LSYKLKE.KSEHSFN..KIKDYYTKHIIDSGK.YNS..............FTSAA.Y-----------T-----------
Q7R7X0_PLAYO/1-296LSYKLNQ.NSPEKFL..KFKDFYTNHIENNTD.YNNCKKKIKNNNYEDCSNKLKEKM-----------G-----------
Q8WT02_9APIC/1-285FSYMLNI.KNVMEFE..DINEFYDKYIKNDDE.YNK..............SITNV.S-----------D-----------
Q7RMB8_PLAYO/2-270LSYMLSL.KSNGKIN..NLKDFYNQYIKNAEK.YTN..............HISGVES-----------H-----------
Q7RSD0_PLAYO/1-255LRYMLDL.TRIGEND..NIDPFYEIYIYNVKK.YNE..............KIDGV.S-----------G-----------
Q7REX1_PLAYO/1-255LSYMLIF.VIIDEND..SIELFYKTHINNDNK.YNQ..............EIGGV.T-----------D-----------
Q7RL45_PLAYO/1-297LSYMLNL.NKSEKHD..NIKDFYNYKINSYDN.YKQ..............GINGV.S-----------D-----------
Q7RI05_PLAYO/1-288LIYMLSL.KSNPDKN..SLKHFYTTFIKSDFK.YKS..............TVDHV.K-----------G-----------
Q4YH25_PLABA/1-270LSYQLKQ.NSEHNTT..TINDFYTKHVKNSGK.YSK..............FINDS.S-----------I-----------
Q7RL82_PLAYO/1-274LSYMLNL.KEQPGND.NNLNFFYSTTI.DNDK.YKI..............SITGVEN-----------D-----------
Q7RL75_PLAYO/1-259LSYMLSL.NKNMDYK..NIHDFYEANIKTNDK.YNE..............GISGV.N-----------A-----------
Q7RRS6_PLAYO/1-291LSYMLKI.KNVNTFK..NINEFYKEHIKDNTH.YTN....NKKCGDDCNSILKNK.L-----------E-----------
Q8WT03_9APIC/1-293FNYMLRL.KSYNNTN..NLNDFYTKYTEDNTH.YNY....CKKHNDDCTITLKSK.L-----------G-----------
Q7R9Y8_PLAYO/1-266LSYMLNL.KENTNSNISHLKHFYDTTINNDK..YTN..............PIDNV.S-----------E-----------
Q7R8Q2_PLAYO/1-296LSYKLNQ.KTENGTR..KLNDFYLNNIANETE.YTE..............HKIYG.K-----------T-----------
Q7RCK0_PLAYO/1-269LSYMLNLKEQVGDVN..NLQYFYNMYMKSGDK.YTN..............PITDV.T-----------E-----------
Q7R7N7_PLAYO/1-246LSYMVNL..KNNEPNLTNQQHFYTAYIKSGNK.YNN..............TINHV.S-----------G-----------
Q7R925_PLAYO/1-251LSYVLSL.IRINQDG..NRTFFYNNYIEKHHT.YKT..............PINGL.T-----------G-----------
Q7R8E2_PLAYO/1-255LSYILNQ.NPQNGTT..TLNDFYTNHIETHAN.YNQ..............KIPDD.N-----------D-----------

PF05795

A5KD74_PLAVS/16-336LYDQISKKYSAD.....NKINNKQ.VSDKLFDLVAT--------------TILKS-P...........NLEP........
A5K942_PLAVS/22-370LHKEVFNHLESK....ARYSEIKH.VITKIQEVWTN--------------VIDTE-F...........SKDDYK......
A5KD05_PLAVS/8-390LNDNISNIFKTHQVPKEDHNKIIQ.GFSSVSHLVNG--------------GLSKP-H...........C...........
A5KCZ5_PLAVS/13-363LGDILLKKLTAK..........EF.YSEIILKLFQI--------------L...K-N...........D.NGQV......
A5KDC7_PLAVS/13-362LGNILLEKLITK..........DL.FHEVILDLFNT--------------L....-I...........N.KNRK......
A5KD53_PLAVS/22-422FYDELGEIYK....DYSKKKEDIS.SFNELIGVVNK--------------VNIPQ-S...........RYPK........
A5KC97_PLAVS/22-304VYEQIKKIPKTG...........E.KKNEIFFLTEK--------------LKKVQ-Y...........S.IKKN......
A5K691_PLAVS/16-331LYDKIAGIHK....KTATNIDDIS.FATDIIKVAQN--------------VSKKI-T...........G...........
A5KAS2_PLAVS/244-559TYDKMLSIFN....KSTDISQYHS.IINKLNDTIIK--------------INTDL-T...........SDKT........
A5KCQ8_PLAVS/25-314LNNELKNEDN.............K.LGSKIFDLYQK--------------FINCD-N...........E.IKGI......
A5KD32_PLAVS/8-337LYDKLTKIFGVE....NNLDNIRV.AFGNFQRIWSI--------------HYYY.-S...........S.RINH......
A5K735_PLAVS/3-393LNHKLKDDER...............TPKYFIQFLNE--------------RLDKR-F...........S.AFGD......
A5KCR3_PLAVS/9-294LHDQLSMFLGRK....ANNANIYA.LFTEFKKVWES--------------LINQE-L...........F.DNTD......
A5K8H5_PLAVS/21-452LFDEVGKIYKPA...PSKKDDTIP.FFNKLADIGNK--------------VNWKI-P...........R.YR........
A5KD69_PLAVS/21-342IYGELETKYRYN....YN.NKLIP.ALGELHRAWND--------------LLEDI-S...........K.KSYH......
Q9N886_PLAVI/17-366KNYQIKKNHNTP....NDIKNIRN.IRLKFFSVASR--------------INTES-S...........I...........
A5KCT2_PLAVS/17-298LYHAVMSKDKST.......YNTFT.LFETFSKAYKQ--------------H....-............K.KD........
A5KD30_PLAVS/21-355FYSKLVSILDTE....DK.NVIVP.ALGILEGIWND--------------AVYNK-S...........D.KSLY......
A5KBG3_PLAVS/140-414IYDQIRKKLS......GKNNYEPD.VVLTLLDVALN--------------INFNL-R...........N.NH........
Q9N887_PLAVI/22-345LYYNVMSLTNN........QSLVL.NFYDPIFMYTT--------------VNKSK-F...........N...........
A5KD66_PLAVS/21-335VYNNFNIYLYPL....DS.SEIYR.IFAEIVRIWNE--------------FIEVK-L...........K.EREC......
Q9N8A0_PLAVI/10-445LNKEVQNI......NNHFDKSYFP.IFQKFSDEFSI--------------IKTNK-N...........D.QRCN......
A5KBF9_PLAVS/37-328TYNRLNEIFGSK....DT.KSIYR.AFAQIQLIWNT--------------YNEIK-L...........K.GVTY......
A5KBR5_PLAVS/12-313IGDILSNKLEDD..........IS.FSNIMNTIYKE--------------L..QK-F...........N.VENK......
A5KDE6_PLAVS/22-346LYYNVTRYTEE........QNIVS.KFYALVSMYTT--------------FKSSN-F...........N...........
A5KCW1_PLAVS/25-352LYEKIGEIHT....DKFANIDNVP.FFKHLIEAWKK--------------MNSEK-L...........K.NK........
A5KD28_PLAVS/16-416FYDEIWRLHT....EHSIKIGEIP.FVKELIDIRSK--------------VHTKE-L...........K.YT........
A5KD65_PLAVS/22-478LYDEIGRIKTVD...RSKKMDSIP.FFNVLIDAVNK--------------VNEQI-K...........V.GK........
Q9N8A3_PLAVI/13-292LYDKELKNVKNK.......GKHID.LYNNLLELCFE--------------YISYN-I...........G.TIYQ......
A5KE77_PLAVS/14-291IFHEIWKRHK....NKKDNPYDIP.VFNEIRKVGER--------------INRES-S...........T.YH........
Q9N899_PLAVI/13-363LADILINNLNDN..........HF.TSEVLINLYRI--------------L..NE-A...........G.AGKI......
A5K945_PLAVS/9-352LYDQLSTFRDQN....NKNITINS.TFTEFSKVWRS--------------FIEKE-L...........L.DGTN......
A5KCV9_PLAVS/16-436LHDKLGKKYYNG....NVKGNKYS.VAEEILDIVAD--------------AVSTN-S...........IDQA........
A5KC95_PLAVS/23-424LYGKIRTIKADA.......TNIYY.LYESLNSILKN--------------K..PL-K...........N.KNHA......
A5KE70_PLAVS/16-392FHDNIGKRYYVG....NEKGEKIH.VSDSLFNFVAA--------------ANIKY-I...........KDSA........
A5KCL0_PLAVS/21-363IYEEARKIIN....KGNQKFTNAD.FISKFRDVQTK--------------IYEEG-K...........KEYY........
A5K5E2_PLAVS/17-358INDEKRKIIN.....EQQKNIFEN.PIVKLDDVAYR--------------VMNRL-D...........H.ND........
A5K936_PLAVS/22-322MYGQIWKKLN....KMPDSINRKS.AINIFKDVEST--------------IYDAT-V...........GRGN........
A5KCW8_PLAVS/16-290INNELINIFK....NDSETKYDID.MIKKFLNMQDT--------------F..NN-E...........K.KYYS......
A5KCU8_PLAVS/16-426IYDKLYKMFGSS..EHMHEKQFIE.ILHVGNDYYKR--------------LSKQL-Y...........L.NDYE......
Q9N884_PLAVI/13-362LGDKIYPLVKNK..........TI.FSNIIRVIYEE--------------LYTNI-P...........E.LFTV......
A5KBG4_PLAVS/18-346AYEKIRSIFG....THDIYSNKRH.IINKLNETVRD--------------ISNST-S...........TKKP........
A5KAS5_PLAVS/16-329ILDELRRNAKPNSRHINGT......NINDIVYVGNM--------------YYNKT-H...........S.NV........
A5KDD1_PLAVS/6-340VYNRLVNIFGTD....DI.SVINP.SWSDLVLIWND--------------IVYKP-S...........Y.EFKN......
Q9N888_PLAVI/8-385LNEEIRKLFKSTGTISLNEIFILS.AFFSVSNMLNS--------------GLTEN-R...........C...........
A5KCU5_PLAVS/21-349FFDNIAKKYYNG....NERGNNYP.VAGKLFNIVST--------------ITSVL-P...........KMEP........
A5KDR2_PLAVS/20-353IVDQLNKTFGGE..........RNLAFGFLNFIVNK--------------VRDNS-Q...........FIKNNE......
A5K1K8_PLAVS/20-397FYDQVIAKEIKN...........A.QITQLLSIWER--------------...NK-R...........E.KSFE......
A5KD19_PLAVS/13-348FSDQVRKNFS....NNDKYFSNYE.LSNNLFDAINY--------------FNYNY-I...........TDKK........
A5KCT1_PLAVS/19-351FYDEIRKNYK....KKGWYINNTD.NSNNLFDVINE--------------FNLVD-K...........VNTNK.......
A5KD97_PLAVS/20-353LYEKLSEIFGFQ....DSLYDISL.AFGSLQHIWNQ--------------LYHYP-R...........T.RVNY......
A5KD24_PLAVS/19-471FYDEIGRIHK....DHSKKMDDIP.IFKDIMGVANK--------------VNVPP-K...........T.YK........
A5KD42_PLAVS/16-297FFDNIEKKYYNG....SKKGTNYA.VAEKLFNIVST--------------LASAS-S...........KMVP........
A5KD93_PLAVS/15-447LYDEIGKIHNKE...QSKTFGNLS.SSKEFIEVSKK--------------VNKEI-N...........RYTT........
Q9N8A4_PLAVI/16-297INSNINVINPGV.......DDTST.FFNDMISVYKE--------------QMSSK-I...........N.ICLN......
A5KCR2_PLAVS/16-444LYGEVGKIYKEK...PSEQFGKIP.FVKDLIKAREE--------------ANKKI-P...........N.FK........
A5KCZ2_PLAVS/21-348LYSRLVNILRTE....DS.SVIAL.TLGKLELIWND--------------IVGHA-S...........Y.KSSY......
A5KC13_PLAVS/21-353IYEKLYKYYSPT....DS.TKVPH.AFGSLLPKWYE--------------LVQDE-S...........N.ESYY......
A5KDP5_PLAVS/25-322LYEQISEIHT....NKSAKIADVP.FFDKLILAWTV--------------ISMAK-L.............SK........
A5KCZ1_PLAVS/16-330FFDNIAKKYYDG....DERGNNYP.VAEKLYNIVSE--------------ITPVS-S...........KMEP........
A5KD49_PLAVS/23-351VFNSLNLIFQSK....YN.SYIYR.AFGDIELIWNS--------------FIEDN-L...........K.ETKN......
A5KD48_PLAVS/21-346VYSKLYDILKTK....GE.NYVNI.AYGELQQLWTD--------------FIDVK-L...........K.KPKN......
A5KD50_PLAVS/14-324VYNRLNVILQSY....NY.SKIYQ.AFGEIGNIWSS--------------FIEDN-L...........K.EVEK......
A5KCL3_PLAVS/174-499MNEEIWKKLS....NSNSFTLNIP.LVNILLNIGHT--------------INNKL-R...........K.NH........
A5KCL7_PLAVS/29-304YYDMAKSNNGFP.............FYSSILLFFKE--------------F..EN-F...........N.DCKL......
A5KDK0_PLAVS/15-278TYDQMWKFLG....DNKDPNHVKS.VITDFLNVRDG--------------VSKKN-S...........N.YS........
Q7K6M7_PLAVI/22-354LYDKIITKNLKQG............QIIELFDGWEK--------------HIEKE-I...........S...........
A5KCY1_PLAVS/24-359IYENAWKLFG....PDWNKIHGKE.PIVSLFNVGYN--------------VINEL-K...........I.NE........
Q9N879_PLAVI/21-298LKNELQKIPH...............ICEGTKECYNT--------------MIKVQ-S...........SESHGI......
Q9N893_PLAVI/16-337TYDQMWKFLG....NNKDPNHVKS.VITDFLNVRDG--------------VSKKN-N...........N.YS........
A5KE76_PLAVS/272-715AYDEIGKKFNWPWRNVYNIPEAK.....SLLDVWSK--------------VSMEA-L...........Q.RGST.HRVHM
A5KD21_PLAVS/16-354LYDNIGKKYYDG....NTKGEKGN.VSENLFNFVSL--------------ANSKY-I...........FIPS........
A5KDG0_PLAVS/6-332VYSRLNMILKSY....DS.TDIKL.AFAQIVLTWNN--------------FIEDE-L...........K.NLKN......
A5K733_PLAVS/31-364VFDEIYKSFNGNGGKPINTADIDE.LLLEWNKINYH--------------LMNQD-Y...........N.KNYQSLLPAG
A5KD00_PLAVS/31-351LYDKVVSITQG........TNLFI.NFYAVLSMYSS--------------SNKDN-F...........K...........
A5KDQ9_PLAVS/9-353LYKRLSALLNGN....KQNTELYS.VIEEIHGSWKK--------------VVQNE-I...........L.DNTD......
A5KE78_PLAVS/66-466LNKKLKKKKI...............SATDFINVFNE--------------ILDNN-F...........S.AIDN......
Q9N890_PLAVI/21-313IYEQLVSGYD.N....NS.IEPAL.IFGDFLLALSM--------------L....-K...........Y.YPNN......
A5KCR5_PLAVS/246-528TYNIIMHTLS....SISNNDEKIY.LLKIINNLLFD--------------INDKL-T...........KEKK........
A5KD77_PLAVS/22-354LYDQILTKDLEE...........T.DINAIFKGWES--------------DLKGK-I...........K.DRSV......
A5KCN6_PLAVS/30-306VYDQIWKFYK.....SKDTIKLDE.VISDFLNIQNA--------------VNKVF-P...........K.KI........
A5KDD8_PLAVS/3-324LYDKLASILGSS....NT.DNIEI.TFGSFQLVGKY--------------NMNT.-R...........A.RITY......
Q9N891_PLAVI/29-310LYYYVLKNVSDK...............HNISKIYED--------------VLTGY-I...........D.RSDN......
A5KD86_PLAVS/13-363IGDKIYANISST..........QV.FSRIIQTIYDE--------------L..NS-T...........D.LLLI......
A5KD96_PLAVS/3-408LTNKIQGSVYKQ..............KEDTFAHFKK--------------FLQYD-P...........E.LKSN......
A5KD33_PLAVS/16-309FYDQISKXXXAD.....NKFNNKT.VSDKFFDLVEL--------------KIGEF-P...........NLQS........
A5KAR9_PLAVS/16-316FYEQIAKTYYDG....KNKNNKYH.VGETLFDIIAL--------------FISTY-P...........KLEP........
Q9N880_PLAVI/21-343MYGELEQRYKRK....YY.SELIP.IYGDLQTMWNS--------------LVENK-S...........K.TSYY......
A5KD07_PLAVS/16-341LYDNIGKKYYKG....NAKGEKDN.VSQNLFNFASL--------------AILQH-I...........KVSS........
A5KCX5_PLAVS/16-447LYDEIGKIHNKE...HSKTFGSLP.WSKEFIEVWRK--------------VNSEI-K...........K.NT........
A5K8H2_PLAVS/11-325VYDYIKKRIK....NKVENIYTIP.VFAKLYQIGER--------------VNKES-P...........KNYH........
Q9N892_PLAVI/23-348IYSKLNTILNSH....DS.TYIKL.TFGEIVGIWNN--------------FIDDE-L...........K.KTGN......
A5KAS1_PLAVS/321-662IYDKLWDTIK....NKPEYISGIP.AITKLLHLGYK--------------LNNKN-S...........K.VG........
A5KD25_PLAVS/16-291FYDQIRKHYSTG.....NTINNET.VSGKLFDLVQL--------------KIDKS-S...........NLLP........
A5KDR1_PLAVS/21-363VYNRLFEILGSN....EN.SYVYI.AFGELSRIWTT--------------FVDVN-L...........K.KTHR......
A5KB35_PLAVS/10-413LNRELRNHKK...............D.RIFREKFCK--------------FMEEN-N...........S.KVDI......
A5KC93_PLAVS/16-453LHDQIKGKYYNG....KEKTNKYPIIANKIFDLVAE--------------DISSG-N...........IHQA........
A5KDB2_PLAVS/34-401LYNEVYNKLQTS...EKDLVHFNE.ITTNLKAVWKK--------------IVDDT-F...........GGGDYK......
A5KCT3_PLAVS/289-657TYDQIMHIFG....SAENYYKNSS.IIHEINKVISR--------------VNDEL-K...........VNEN........
A5KBR2_PLAVS/254-616LHDQIKSIFG....TNLDNNNYKS.HAPKLLELQFP--------------INNKL-S...........R.HD........
A5K5E1_PLAVS/11-355VYDQIINIIKGK.....SDHIYYK.AFPKILTVWNN--------------MESRG-Y...........F.TNK.......
A5KCW5_PLAVS/22-437FYDEIGKIY.....DYSKKKEDIS.SFKELIGVENN--------------VKVPQ-S...........RYEK........
A5KBG1_PLAVS/253-633TYEEIKNIYK....GNKKRIYEIP.FFHEIFKVAHD--------------INYQL-TGNDILDKSEDIHNKFKEKFKSTR
A5KD15_PLAVS/33-411LYNEVFNNLKST..SENDTKFFKD.ISTRLQEVWKN--------------VVDAN-Y...........KGQPFQ......
Q9N8A2_PLAVI/21-355IYSRLVNILGTE....DK.TVIAP.IFGKLVRIWNS--------------IVANP-L...........Y.TSPY......
A5KD02_PLAVS/23-315VYNRLNMFLSSY....DP.SYIKE.TFGNIVQIWYK--------------FLEET-L...........S.KPDD......
Q7RBM2_PLAYO/10-293LYEQVYKNSGLN....DNSLSFFI.TLDILLNSWEN--------------MNADK-F...........N.GNKD......
A5KD12_PLAVS/20-341LYDQVYSNLQSS....KNVGELRT.IVPKVQEVWKN--------------IVDNT-F...........KNNDYK......
Q9N882_PLAVI/13-362LGYILYDNLNRI..........IH.FDSVINNIFSI--------------L...I-I...........R.DGKK......
A5KCU2_PLAVS/3-296VYNRLVTIYGSR....NS.PKFFP.AWGKLVYIWNT--------------IISDQ-S...........K.KFSH......
A5KDH3_PLAVS/7-287LYDEIKEIYK....EHTKKFGEIP.FSKELIDIANK--------------VNKEV-K...........P.ND........
A5KCY0_PLAVS/16-372IFDEIRKFIR....SNSYNFNHLD.VLKKFHDVEKR--------------IINDI-N...........STSD........
A5KCV2_PLAVS/23-358LYDKIMKANFDD...........S.KIEKLFQGWNN--------------FVERE-I...........K.RKPN......
A5K697_PLAVS/19-332LYDEIGKINKVD...RSNKLSAIP.FVEDLFTAVNK--------------INGKL-N...........A.NK........
A5KD10_PLAVS/16-340MYNEIWKLVR....TESNYEIDKD.AILKLASIGFD--------------INWEL-S...........R.DY........
A5KC12_PLAVS/18-313LLNKIKEEFK.........GKYQE.VFNVLVVLWKG--------------NNILN-H...........H.SRGN......
A5KD72_PLAVS/21-431LFDEIGKIYKSI...PSKNSDNVP.FFSKLSHIGNK--------------VNREL-T...........A.NK........
A5KDR4_PLAVS/16-315VYDQIRKFYI....KYEKDSVAKS.AVSKLYEVGSN--------------INRAK-T...........T.P.........
A5KD61_PLAVS/26-325LFNHITNI...........PNFNL.KSDDFYSAINI--------------ISKNE-L...........S.KIKN......
A5K8H3_PLAVS/281-557IYDQIWKRFG....NNLENNENIF.VVDKLIDALYK--------------FIYEL-K...........L.YE........
A5KCX3_PLAVS/16-418LFEEVSKAFNDH....EKNTNVYL.AIEELHKSWKE--------------AIQND-S...........Q.NTNN......
A5KD87_PLAVS/15-315IYEQLANDYD.N....NS.TEPAL.IFADILFVFSG--------------L....-Q...........Y.YPNN......
A5KD90_PLAVS/13-364LGNILLEKLLTN..........DL.FHEVILALFNT--------------L..VN-V...........N.QHKL......
A5KCK8_PLAVS/21-282IYDEIRKKLN....NISYENDRKS.IIKEFNEASSN--------------IFSSL-M...........HSIH........
A5KCL1_PLAVS/23-389IYDNIKNIADCK........EVEN.FYNKLNTMKSS--------------FLTDI-H...........N...........

PF06022

Q4Z0W5_PLABA/1-311--------------------------------------CS..NYKDLIDKKKYFLD..ISNENMSKIYNLFKILCNMYTD
Q7R9N0_PLAYO/1-297--------------------------------------YE..SHKKVIDEIKGYMD..INISHMAKFDELLKLLCNMNTS
Q7R7Q4_PLAYO/1-261--------------------------------------YK..CYKDLIDRNKYILS..MDMNIISKLYDAFNTLCDTYIE
Q4Z1P4_PLABA/1-258--------------------------------------NT..SYVNLIDKKLDLMN..MDIKDISKFYDAFKSLCDIYSE
Q7RPL7_PLAYO/1-266--------------------------------------YK..SYKDLIDEKKELMS..ISNEKMSKLYALFKILCNIYTE
Q7RB69_PLAYO/1-276--------------------------------------IG..ELKKFMDERDYLMN..INIEDLSKCYDSFKLLCNMYDD
Q7RFC2_PLAYO/1-273--------------------------------------YD..NFTEIINERKDLLN..IKFKDPSKVYDLFKLLCNMYYD
Q7RE48_PLAYO/1-296--------------------------------------YD..SYKDIIDKIKEYMD..ININHMSKFYELLKLLCNMNTA
Q4Z522_PLABA/1-285--------------------------------------FT..NLDEDLNKKSDFLN..INIKDLSKFYDPFKLLCSMYGN
Q4Z0P5_PLABA/1-308--------------------------------------CN..NYDDLIYKKNELMN..ITNEKLSKFYAPFKSLCNMYNE
Q7R864_PLAYO/1-257--------------------------------------SK..INKSVICKKIESMN..IDIKDISNFYDAFKSLCNMSSE
Q7R9W7_PLAYO/1-296--------------------------------------FK..GYKEIIDEIKEYLD..IDISHMSKFYELLKLLCSMDTA
Q7R881_PLAYO/1-264--------------------------------------FT..NLEEFINKEKYLMN..IDIEDLSKFYDASKLICSMYGN
Q7RFB2_PLAYO/1-280--------------------------------------YN..SYKDLIDKNNYFLT..MDKSIIIKLYNAFNILCNMYNE
Q7RLH9_PLAYO/1-288--------------------------------------YE..IYKDIVNKKKDLMN..MDKSIISELYDAFKKLCTMHLE
Q7RBL1_PLAYO/1-257--------------------------------------.D..SYKYLIDENKYFLS..MDMSIITKLYDVFNTLCDIYNG
Q7R7W7_PLAYO/1-274--------------------------------------YN..SYDDLINKKK.LMK..MKIKDISKFYDPFKLLCEMYAE
Q7RJC9_PLAYO/1-298--------------------------------------YK..DYKDLLDKKNYVLN..MDSNDVPKFYKAFKSLCELYTE
Q7RRG2_PLAYO/1-236--------------------------------------....SYKNLIEKKKYFLN..MDKSIISKFYNAFKSLCNLYTQ
Q7RT28_PLAYO/1-292--------------------------------------YD..SYIKILDEIKEYMD..ININHMSKFYELFKLLCNMNTA
Q7RDL9_PLAYO/1-222--------------------------------------CK..NYKDLIDRNYYFLS..IDKSIISKLYDALTSLCNMYNK
Q7R7C1_PLAYO/1-249--------------------------------------NK..INMEVISKKIESMD..IDIKDISNFYDAFKSLCNMYSE
Q7RNM9_PLAYO/1-291--------------------------------------YT..NYKEIIDNKKELLN..TNFEYMSKFYDAFKSLCNMYTE
Q4Z019_PLABA/1-277--------------------------------------FT..EIKDFMDERNYLMD..INIEDMSKFYDAFKLLCNMYGN
Q7RSF9_PLAYO/9-311--------------------------------------YT..SYIDLINKHDYVIN..ISNENMSKLYDLFKNLCKMYND
Q7R7D1_PLAYO/1-255--------------------------------------....SFIEVINKKKELMN..ISNDKVSKLYNLFKILCEMYTK
Q7RNI0_PLAYO/1-291--------------------------------------YN..NFKEIIDKKKDLLS..INLKDMSNFYGAFKLLCIVHTE
Q7R7X7_PLAYO/1-266--------------------------------------NR..NYMDLLNKKKHFLD..MDIKYISKFYEVFKLLCEIYAE
Q7RFX2_PLAYO/1-264--------------------------------------YK..DYKDLIDRNSYFLS..MDKNIIYKLYDALASLCSMYVN
Q7YZ88_PLACH/1-291--------------------------------------YN..IYKDLINKKGDLVN..MDIKIMSKFYETLKFLCKLYTG
Q7RCT8_PLAYO/18-257--------------------------------------YT..NLNEFIDEQNDLFN..INIEDLSKFYDAFKLICSMYSN
Q7RKC5_PLAYO/1-282--------------------------------------YK..TYIDFINKNKELMN..IDIKVMSKFYDALKNLCKMYSE
Q7R8V9_PLAYO/1-298--------------------------------------YN....KKIMDGIKEYMD..INISHMPRFYELLKLLCNMNSD
Q7YZ81_PLACH/1-272--------------------------------------YN..IYKDFINNKLYLMS..TGIKDISKFYCAFKSLCNMYNE
Q7RHL2_PLAYO/1-264--------------------------------------FD..GYKDLIDKNYYILN..MDISIISRLYDAFNTLCDIYNG
Q8WT16_PLACH/1-282--------------------------------------HN..NYIEQIKKY.......VDIKDMTKLHEAFILLCNMYTE
Q7R8B9_PLAYO/1-296--------------------------------------YT..NYKKMIDEMKDYMD..INISHMSKFYELLKLLCNMNTA
Q4X397_PLACH/5-171--------------------------------------YN..IYKKLIDNKLYLMN..RDIKDISKFYDAFKSLCNMYNG
Q7RJD0_PLAYO/1-252--------------------------------------SK..INKDVIENKIKSMN..MNIKDISNFYDAFKSLCNMCSE
Q7RII1_PLAYO/1-285--------------------------------------CA..HFKKFIEENENFMN..MNMNTVVMLYEAFETICNMYTG
Q7YZ87_PLACH/1-262--------------------------------------YN..SCKDIINKKIYSMS..FDIKEMSRLYEALKALCKLYTE
Q7RKR3_PLAYO/1-275--------------------------------------YS..SYKDLLNKKKYFED..MDNNIISNFYKAFKLLCELYTL
Q7RRV5_PLAYO/1-265--------------------------------------FP..FLEEFIEKNKDLLN..IDIKDLSKFYDASKLICSMYAN
Q7RMJ7_PLAYO/1-291--------------------------------------YN..TYEELIDERKGFLN..MDKTIVSKFYEALKSLCKLYNE
Q7RPH8_PLAYO/1-309--------------------------------------YT..NYIDFINKNKKLMD..IDIKAMSKFYNLFHNLCKMYNE
Q7RCT9_PLAYO/18-310--------------------------------------YS..SYKEIIDEIKEYMN..IDIINISKFYKLLKLLCDMNTS
Q4YH36_PLABA/1-256--------------------------------------FN..INKSVIENKIKLMN..MNIKDISKFYDAFKKLCEMYTE
Q7RM73_PLAYO/23-317--------------------------------------HK..SYKDVMDEIKEYMN..INISHMSKFYELLKLLCNLNTT
Q7RGU7_PLAYO/9-281--------------------------------------IS..GLEEFINKKKYLLD..ISIEDMSKFYDVFKLLCSMYAN
Q7R943_PLAYO/1-258--------------------------------------YN..SYKDLIDKKKNLMS..IGIKDMSRFYHAFNELCNMYYR
Q7RAK5_PLAYO/1-296--------------------------------------YK..NYKEIIDAIKEYMN..IDISNMAKFYELLKLLCDMNST
Q4YCQ1_PLABA/1-303--------------------------------------YK..SYKDLIDKKQELMS..IDIKDISKFYDSFILLCDMHTN
Q7R9C3_PLAYO/1-237--------------------------------------YS..NYKNLIDIYDYFLS..MDMKIISKFYDAFTTLCGMYTN
Q7RIN7_PLAYO/1-266--------------------------------------IA..DLGKFMDERTDLLN..INIEDLSKFYDASKLICIMYGN
Q7R8U3_PLAYO/1-269--------------------------------------FT..SFNEFIDGQKYLFD..INIEDLSKFYDVFKLICDMYGN
Q4YHL6_PLABA/1-288--------------------------------------FT..ELNEELNTKSDLLN..INIEDLSKFYDASKLICSMYGN
Q4YHA9_PLABA/1-253--------------------------------------YT..NFNEFIEKQKDLFN..INIEDLSKFYDASKLICSMYGN
Q7RFZ7_PLAYO/1-278--------------------------------------YN..CYKEIIDQKKDLLN..MDNSIISNFYKAFKSLCEMYSA
Q7RTJ0_PLAYO/1-252--------------------------------------YN..TYIELINKNKDLLN..INFKDMSNFYNSFTLLCDIHNG
Q7RJE2_PLAYO/25-326--------------------------------------YN..SFNELIESNKCLMK..FDINDMSKFYNGFKSLCKMHIE
Q7R7P6_PLAYO/1-245--------------------------------------NT..TYIELINKNNDFLN..INFEYMSKFYEAFILLCNMYNE
Q7RKA5_PLAYO/1-268--------------------------------------IT..NLKDILNKKNEFLN..ITIEDMSNYYDAFKLLCNMHDN
Q7R9Q6_PLAYO/2-288--------------------------------------YK..NYKEIINGRKGLLN..TNFEYMSKFYDAFKPLCNVYTE
Q7RK60_PLAYO/1-246--------------------------------------YS..TYKDLINKYNYVFN..IPNEDMSKFYDAFKSLCKLYTE
Q7RK83_PLAYO/1-317--------------------------------------YD..NYKGLIDTKRDFLY..MDSNIVSKFYKAFKSLCEMYNE
Q4Z1S0_PLABA/1-273--------------------------------------YN..SYKDLIDQKTYFMT..IDINDIFKFYDAFILLCEMYTG
Q7RCJ0_PLAYO/1-265--------------------------------------YT..KFKEIIDKRKNFLE..INIYDMAKFYDAFKFLCSMYDN
Q7R9P0_PLAYO/1-271--------------------------------------CT..NLKEIIDKTNYLLN..INIEDMSNFYDAFKLLCNVHDK
Q7RAI9_PLAYO/1-299--------------------------------------YN..NFKEFIEANKCLMN..IGIDDVSNLYAALKSLCKMYTE
Q7RBK2_PLAYO/1-285--------------------------------------YT..SYIDLINKHNYVVN..ISNENVPKFYDAFKILCNMINN
Q7RA91_PLAYO/1-295--------------------------------------YQ..NYIDLINKKEKLMD..IDISDMSKFYSLFKKSCNMFNN
Q7RCV4_PLAYO/1-300--------------------------------------YDYGNYKELIDTKKYLFN..MDDHIISNFYKAFKLLCELDDD
Q4X890_PLACH/1-129--------------------------------------................MN..MDIKDMSKFYASLKSLCDMQTK
Q7RHS9_PLAYO/1-267--------------------------------------YN..SYIELISKNHNLENVNMNKNIISKFYGAFKLLCEIYIE
Q7RHP0_PLAYO/1-282--------------------------------------YN..NYIDLLDKKK.IVN..MDIKDISKFYAPFKSLCTMYNE
Q7RQB7_PLAYO/1-303--------------------------------------YN..NFMEFIKGNECFMS..INITEMSKFYDAFKLLCEMYIG
Q4Z7R7_PLABA/1-277--------------------------------------YN..SYKEIIDKKMDLLN..MDNNIISKFYAPFKLLYEMYTN
Q7RHL9_PLAYO/1-326--------------------------------------YD..SYKDLLDKKNDVLN..MDSNYVPKFYEAFKSLCNLYNE
Q7YZ86_PLACH/1-256--------------------------------------LT...YKAIIDKKKDLMD..MNINDIFKLEAPFNILYYLYNV
Q7RJ63_PLAYO/1-296--------------------------------------HK..NYKGIIDAIKEYMD..INISHMSRFYNLLKVLCNMNSA
Q7RHP5_PLAYO/1-274--------------------------------------CK..SYIELINKKKNLMT..INIENISKFYAAFKPLCNMYTE
Q7RA21_PLAYO/1-277--------------------------------------CH..TFKDIIEKRHNLMNDDMDKNSISTLHDAFKLLCKMYTD
Q7REE4_PLAYO/1-252--------------------------------------NS..SYKDLLNKKNYF....LDIKDISKFYEAFKLLCETYTE
Q7R7L0_PLAYO/1-205--------------------------------------.................N..IN....................
Q4YH17_PLABA/1-291--------------------------------------YT..SYIDLINKKKELMN..ISNENMSNLYDAFKMLCNMINN
Q7RM24_PLAYO/1-277--------------------------------------YN..SFIDLINNKKKLMN..ISSDKVSKLYKLFKILCEMYTK
Q7R8S4_PLAYO/1-292--------------------------------------YT..SYIDLINKKNKFMD..IDIKLMSKFYGLFKILCNMHIN
Q7RDZ3_PLAYO/1-258--------------------------------------YN..SYKDLIDKKQYLMN..INKNVIYKFYNALKSLCNMYNE
Q7RJ28_PLAYO/1-315--------------------------------------YK..NYIELINKHNYVMD..ISNENIYKFYEAFKTLCNMINN
Q7RDW3_PLAYO/1-274--------------------------------------SK..INISVIENKIESMN..IDIKDIYNFYEVFKLLCKMDSE
Q7RQI7_PLAYO/1-298--------------------------------------YT..DYKKIIEETKEYMDINININDMSKFYELLKLLCNMYTS
Q7RK85_PLAYO/1-254--------------------------------------....IRKDVIDKKIGSMN..IDINDISNFYVAFKSLCNMYSE
Q7RS14_PLAYO/1-297--------------------------------------YN..NFKEIIFKNMDFSN..INIEDISKFYEAFKLLCKLHTE
Q7RGN4_PLAYO/1-299--------------------------------------YS..GFKEFIEKNEYLMN..IDMNFMPSFYDAFKLLFEIYDK
Q7R8D0_PLAYO/1-281--------------------------------------YK..SYKDLIDKKN.LLN..MNIKDISKLYDVFNTLCNMYLE
Q4Z0V4_PLABA/1-324--------------------------------------YN..SYKDLIDKKNDLIN..MDIKYISKFYDAFNTLCMMYIE
Q7RKY7_PLAYO/1-277--------------------------------------YS..SYKDLIDKKN.IMN..MDMKIISKLYDAFNTLCMLYIE
Q4XE61_PLACH/265-545--------------------------------------.....YKDHLDNKIYSMN..IDSEKIYNIYEAFGILCKIYTA
Q7RHX9_PLAYO/1-284--------------------------------------HV..NYKGLIDKRKEFLY..MDSNTVPKFYEAFKLLCNLYNE
Q7R9W6_PLAYO/1-272--------------------------------------YT..SYKNLIDKKLDLIN..MNIKDISKLYDAFYALCMMHFE
Q7R9Q4_PLAYO/9-276--------------------------------------IG..NLREFMNERNDLLN..INIEDISKFYDAFKLLCIMYGK
Q7R7X0_PLAYO/1-296--------------------------------------YK..NFKEFIEAKKCLMD..IDIKDMSKFYEALKLLCIMYTE
Q8WT02_9APIC/1-285--------------------------------------YN..SYKEIIDKKKDLLN..INFDDISNFYAAFKLLCSMHTD
Q7RMB8_PLAYO/2-270--------------------------------------YR..SYKDLIDKNNYLLN..MDMSIISKFYESFILLCEMNTK
Q7RSD0_PLAYO/1-255--------------------------------------YQ..NYKDLIDIKKNLMS..IDIKAMSKFYDAFILLCDICTG
Q7REX1_PLAYO/1-255--------------------------------------YN..SYKDLIDKKENLMS..ISIIDMSNFYYVFTLLCTMYDE
Q7RL45_PLAYO/1-297--------------------------------------YK..SYKDLIDRKKYLS...MDINIISKFYDPFKSLCNLYTE
Q7RI05_PLAYO/1-288--------------------------------------CS..NFKDIIENRHTLTNDDMDNKIISELYNAFKLLCEMYTD
Q4YH25_PLABA/1-270--------------------------------------CA..NLKEIIDKQKDLFN..IDIEDLSKFYDAFKLLCNIYGN
Q7RL82_PLAYO/1-274--------------------------------------YK..NYKDLIDKKKYFLG..MDKKIISNFYEAFKLLCEMYAE
Q7RL75_PLAYO/1-259--------------------------------------YN..SYNDLIDKKRDLLN..INFEDMSKFYDASNALCEIYSE
Q7RRS6_PLAYO/1-291--------------------------------------YN..NFNEFIEANEYLMN..IDIKDISNFYAPIKLLCKMHTG
Q8WT03_9APIC/1-293--------------------------------------YN..NFKEIIDKKKDLLN..ISFEDMPKFYDAFKLLCNMYTE
Q7R9Y8_PLAYO/1-266--------------------------------------YK..NYKDLIDKKHDLTNNDMNKNIISKLYEAFNILCNMYTE
Q7R8Q2_PLAYO/1-296--------------------------------------FK..SYKEIIDQINEYMD..IDINKISKFYELLKLLCNMITD
Q7RCK0_PLAYO/1-269--------------------------------------YK..SYKDLVDKTK.MMD..MDIKYISKFYDAFNALCMMYIE
Q7R7N7_PLAYO/1-246--------------------------------------YN..SYKKLIDKNNYFLS..MDKSIIFKFYDAFKSLCNLYNE
Q7R925_PLAYO/1-251--------------------------------------YQ..NYKDLIDRNNYILS..MDMSIISKFYDAFILLCDICIG
Q7R8E2_PLAYO/1-255--------------------------------------TK..INKDVINKKKELMK..MNINIISSFYDEFKSLCNMYSE

PF05795

A5KD74_PLAVS/16-336......................................CR--CYESGTPSV......WKEEKDLHDYFKNHKDIDCTKSD
A5K942_PLAVS/22-370......................................CY--PDKKLYINMGF....LQEIKDLFDFFEDFEVMKKEIID
A5KD05_PLAVS/8-390........................................--.DYYYDKGITMEI..WKKWKDLYDYIINRNHIQKVINT
A5KCZ5_PLAVS/13-363......................................CT--NPYPYMH...KDD..FEKVKLIFDCSEDYKNYSMHYIN
A5KDC7_PLAVS/13-362.....................................ICE--LPHSLMF...KED..FKDFKLIFDCSEDYKSYKVQYIN
A5KD53_PLAVS/22-422......................................C.--.TLKSETGVSLDE..WKKRKLSYIYKKNYNDIKSKVSS
A5KC97_PLAVS/22-304......................................CS--ENFECYDYYNDYFGDWKDEKELYEYFLNFDEIDSNIDK
A5K691_PLAVS/16-331......................................NK--CNLGHDVGVSLKD..LNERKMLFTYFKKYDSIKKRMES
A5KAS2_PLAVS/244-559......................................CP--YLISRN....IDE..WEKEKDMHDYFKNHQKISECNKA
A5KCQ8_PLAVS/25-314......................................TK--CESSDIYYFEENT..FDQVKKMYDLYDDYIYVDAFKTN
A5KD32_PLAVS/8-337...................................N.KCN--PNFETDN...HKD..WENRKKLYDYYVDYNDLDYLAKF
A5K735_PLAVS/3-393......................................YN--KFKEKVYDMDNNV..YHEMNILYNLYLNFNKINNQTIS
A5KCR3_PLAVS/9-294...................................YI.CM--PKPELF...KIPL..VKYMKYFLDYLENYETIKNEITT
A5K8H5_PLAVS/21-452......................................CN--.TLPSRNYVSLDE..RKNRKNAYIYLKKYEEIKPIINA
A5KD69_PLAVS/21-342...................................D.KCI--PDFDIPK...QYD..WKKRKQLYDYCVNYESLKKQSEF
Q9N886_PLAVI/17-366......................................DE--CFYIIRTDISLDL..WKKWKDLYDYITNKDEIQKIIDS
A5KCT2_PLAVS/17-298......................................AQ--IYLDYVKNITKDA..FLNIQTLAVLYENLENFKKHKSC
A5KD30_PLAVS/21-355...................................N.KCI--PEGRIAA...QND..WKKRKELYEYCVNYDTIEKTIPF
A5KBG3_PLAVS/140-414......................................CT--MIYDSS..ISMEG..WKEMKELHDYFEGYDNIKSYRPS
Q9N887_PLAVI/22-345.....................................NCT--LTNFKID...KNK..FYIKKILYEFNEIYDEIKNKISD
A5KD66_PLAVS/21-335...................................E.TCK--PLSNLII...HDD..WRERKDLYEYYVNYDQISKTIVN
Q9N8A0_PLAVI/10-445........................................--...NYIFNLSHKT..INIMDILYGLYDEYDKIKSHRED
A5KBF9_PLAVS/37-328...................................P.KCE--PYFEIHS...ERD..WEKRKEFCEYCLDYKTAHTLAGD
A5KBR5_PLAVS/12-313......................................CN--IIYSDIG...KNF..FKQRKIVYDYSQNYETIKRYFRD
A5KDE6_PLAVS/22-346.....................................NCS--LTNFAID...KNI..FDIKRTLYEFIEIYEGIKNEILQ
A5KCW1_PLAVS/25-352......................................CA--PE..ELTRVKLDE..LKNRIFSYIYFKNIEKIKKLNAS
A5KD28_PLAVS/16-416......................................C.--.DILYEKDVNLNE..WKKRILSYIYFKNHDDIKKISIS
A5KD65_PLAVS/22-478......................................C.--.TLKFDKNVTVDE..LIKRKISYIYFKKYNDIKVNIKP
Q9N8A3_PLAVI/13-292........................................--......SNVRADN..FEILKNLYDLYYKFDKIKYDNDC
A5KE77_PLAVS/14-291......................................CH--CYFHGI....LDD..WKKEKELHDYFKNFNHIKKKFSY
Q9N899_PLAVI/13-363......................................CD--PINSYID...KDN..FENIKLIFDYSEDYESYKLDLAI
A5K945_PLAVS/9-352...................................SSICM--PEPKFY...EKKL..IKHLKDLFDYAENYKRIENEITK
A5KCV9_PLAVS/16-436......................................CK--GYAFGDKES......WKKEKDLHDYFENFKQINCNETD
A5KC95_PLAVS/23-424......................................CN--KIYESKV...YDMRVLKDKRELYDFVEIYNIIETKLKE
A5KE70_PLAVS/16-392......................................CN--GDTFGDPEE......WKEEKDLHDYFINFKHIKCNDYD
A5KCL0_PLAVS/21-363......................................CK--IYFDDT....LDK..WKEQKVLHDYFRNYDKIKFKDSS
A5K5E2_PLAVS/17-358......................................CR--YFSSYA..VSLDN..WKEMKDLHGYFKNHSTISGCASD
A5K936_PLAVS/22-322.....................................SCY--IEFEEN....FDE..WNDQSILYDYNMNYSSILKCNKS
A5KCW8_PLAVS/16-290......................................CK--YDINKINLEYLQE..MSDRKDLNDYFNNYNTIKKNIKC
A5KCU8_PLAVS/16-426........................................--........HDFNR..IREMKHLHDYFKNCEKIINCKTP
Q9N884_PLAVI/13-362......................................CK--LVHSPID...QVR..FNHNKILFDYSKDYKNIEMDTSN
A5KBG4_PLAVS/18-346......................................CD--IYFGNK....FDH..WDEWKQLHDYFKNSEHILSLVTE
A5KAS5_PLAVS/16-329........................................--..LFSDYDFDLEE..AKKEKYLHDYFTNYEKILQCEND
A5KDD1_PLAVS/6-340...................................N.KCV--PDDSIVT...QND..WRKRKRLYEYCVNYDTIKKTIPN
Q9N888_PLAVI/8-385........................................--.IYNYSGRINMEL..WKKWKDLYDYIRNKDNLQDVIDS
A5KCU5_PLAVS/21-349......................................CK--CYESGSPDV......WKEEKYFHDYFENHKDIQCKNSD
A5KDR2_PLAVS/20-353......................................CE--LDLEVSS...DDK..WEEKKEFYEYVIDYFQINTRDKL
A5K1K8_PLAVS/20-397......................................CE--HDVKSLPI.......IKKLKEYYDYYLFFEAYNNTDNM
A5KD19_PLAVS/13-348....................................YRCY--ASRNAES........VKAEKDLHDYFRNVDYINCKDKG
A5KCT1_PLAVS/19-351......................................CN--LYSNRS....VED..VIEEKALHDYFKNFDRIGCDGLS
A5KD97_PLAVS/20-353...................................N.NCK--PEYETDN...HED..WINRKKLYDYYVDYNYLISMAKN
A5KD24_PLAVS/19-471......................................C.--.TLKYDKNVNLDE..LLKRKISHIYFKKHDNIKSFKQN
A5KD42_PLAVS/16-297......................................CK--CYESGSPDV......WKKEKYLHDYFENHQDIKCNDSD
A5KD93_PLAVS/15-447......................................C.--.TIKPENDVRLDE..LIKRKLSFIYLKKFNDIKKIIES
Q9N8A4_PLAVI/16-297........................................--....NMKYINNNV..LKDLKILMDLFGNFNKFKEINKE
A5KCR2_PLAVS/16-444......................................C.--.TSHFDEKASLDE..LIKRKISYIYLNKYDEIKQNVNA
A5KCZ2_PLAVS/21-348...................................N.KCV--PDNSIVT...QSD..WRKRKRLYDYCVNYDSIKKIIPN
A5KC13_PLAVS/21-353...................................K.KCK--PSTTIVT...EDN..WQERKELYEYCVDYKTVRGYADY
A5KDP5_PLAVS/25-322......................................CK--PE.NNIKDIKLDE..LKKRIFSYIYFKNIDKIKKISTE
A5KCZ1_PLAVS/16-330......................................CK--CYESGYPDV......WKEEKHLHDYFENHKDIKCNDSD
A5KD49_PLAVS/23-351...................................E.TCT--AISKLIT...PDD..WKYRKELYDYFADYNQIIQNIKL
A5KD48_PLAVS/21-346...................................K.TCR--PIFELVL...YND..WKKRKELYEYYVDYSALSKTLVG
A5KD50_PLAVS/14-324...................................D.TCK--RMHNIVN...HDD..WRERKKLYDYYVNYSTIEKTIPN
A5KCL3_PLAVS/174-499......................................CP--YDFNSD..YTYKE..LQERKDLHDFFKNYEKIETKDSS
A5KCL7_PLAVS/29-304........................................--....YMEDIDSKQ..YQKIADLVQMYDDFNDFKNESIT
A5KDK0_PLAVS/15-278......................................CQ--YYFHNKNFQDLKE..NLEKKILYDYFKDFQSIKSNVHS
Q7K6M7_PLAVI/22-354.....................................YNN--LKPCKFYNLKKDE..INNIKKIYAFYAIFYG.NISNAE
A5KCY1_PLAVS/24-359......................................CF--YNYDTK..ISFEE..WTEKKDLHDYFENYDSIENIIES
Q9N879_PLAVI/21-298....................................DVCN--EHIEEINDKIFEK..FENLDSLYDMFYKFTNTQEKMGD
Q9N893_PLAVI/16-337......................................CQ--YYFHNKDFQDLKE..NLEKKILYDYFKDFQSIKSNIHS
A5KE76_PLAVS/272-715ASRDIDRHCILRDRNGSCIKHKFITGDEDDYALKNYNTCL--YYINCSS....NE..CKEMKALYDYFYNFSDIKKKVTT
A5KD21_PLAVS/16-354......................................CN--GNSYGKPEE......WKVEKDLHDYFENHKDIKCNDSD
A5KDG0_PLAVS/6-332...................................K.ICK--PIDNIVS...YND..WEKRKELYEYYVDYYPIYISLPI
A5K733_PLAVS/31-364SNAAGGDNNGGSVDSRGRWKPKPPTRLFSNGEFSKYKPCF--YNPVCT....LDR..CKDIKELYDYFKKFEKIKENIST
A5KD00_PLAVS/31-351.....................................NCT--LKNFKVD...KEA..FNKKHILYEFIESYDDMKNKIDN
A5KDQ9_PLAVS/9-353...................................NR.CM--PEQKFY...EKKL..IKLLKDLFDYAENYKTIENEITK
A5KE78_PLAVS/66-466......................................YN--KFKTIVYNIDEEV..IEELDLLYNLHDYYNKI..ITKS
Q9N890_PLAVI/21-313...................................N.ICK--LDSSIAT...IKD..RKERKELYEYCIDYKTILNKSQI
A5KCR5_PLAVS/246-528......................................CI--YYVDND....LDK..WKEEKDLHDYFKNYSDIDKIASD
A5KD77_PLAVS/22-354........................................--.DPCIFFNLKKDE..INKLKNIYSLYAIFYGNNKYKQD
A5KCN6_PLAVS/30-306......................................CQ--FDFTSKDKKDLEE..KLEKKNLRDYIKNYENIKKEVTA
A5KDD8_PLAVS/3-324...................................NERCK--PDFEIFE...EDN..WDKRKELYEHYINYDILFSMAQG
Q9N891_PLAVI/29-310.......................................E--NFRNYVSSFSEKT..IDKIIKLAEIYDNSHKFKGDIKH
A5KD86_PLAVS/13-363......................................CR--PLYNKID...KET..FNNNKLLFDYSKDRDNIRLSTLH
A5KD96_PLAVS/3-408.....................................VCT--SQMKY.....LDDGIYKKMKLLYNLYDSYEVLNYKIDS
A5KD33_PLAVS/16-309......................................CK--CYVSGTPEI......WKEEKDLHDYFENYKDINCTNSD
A5KAR9_PLAVS/16-316......................................CR--CYVSGKPEY......WEEEKYLHDYFKNYQDIKCSNSS
Q9N880_PLAVI/21-343...................................D.KCK--PDNSIVS...QND..WKQRKELYDYCVNSGTIVNTANI
A5KD07_PLAVS/16-341......................................CN--GNTFGNPEG......WKEEKDLHDYFENYEKIKCNDSD
A5KCX5_PLAVS/16-447......................................C.--.TINPENGVSVDE..LIKRKLSFIYLKKFEDIKKITDS
A5K8H2_PLAVS/11-325......................................CS--CYFYGD....LDI..WNAEKELHDYFRNCSAIRKKIRT
Q9N892_PLAVI/23-348...................................K.ICE--PISNIVA...HDD..WRYRKELYEYYVDYYPISETVKR
A5KAS1_PLAVS/321-662......................................CY--YEINLN....LDL..WKEKKYLHGYFMNFDNINNITNP
A5KD25_PLAVS/16-291......................................CK--CYVFVTPEG......GKEEKDLHDYFENHKYIDCTKSD
A5KDR1_PLAVS/21-363...................................N.TCR--PMSEIVN...HFN..WEQRKELYDYQVNYASLRKLVDY
A5KB35_PLAVS/10-413......................................EG--ALKNKIYDLNDDE..YENMDILYNLYDYYYKI..ISEK
A5KC93_PLAVS/16-453......................................CS--GNSFGTLEI......WKKDKDLHDYFENFEKIKCNDTD
A5KDB2_PLAVS/34-401......................................CY--PDEKLLVNMGF....LQEIKDLFDFYEDFNEMKKEIIY
A5KCT3_PLAVS/289-657......................................CY--FYVDGD....FDQ..WNKERDLHYYFLIFDNLSSVKDD
A5KBR2_PLAVS/254-616......................................CY--YSFNNK....LDE..WEEIMYLLYYFKNYNTFSSITPE
A5K5E1_PLAVS/11-355......................................CN--RDNILLHVPVTD...IVKWKDLHDYCEDFETIKREITT
A5KCW5_PLAVS/22-437......................................C.--.TLKSENGVSLDE..WKKRKLSYIYMKNYNDIKSKVFS
A5KBG1_PLAVS/253-633DKLKSKHANKPYESYIDELNNESKERFYNNYEFTNYKPCF--YYFDCN....LDE..CGEMRDLFDYFKNYDSIKSKDST
A5KD15_PLAVS/33-411......................................CY--PDKALLLNMGY....LQEVKDLFDFFQDYNEMKKEIIA
Q9N8A2_PLAVI/21-355...................................N.KCM--PDSIIPT...QND..WRKRKELYDYCVNYDTIKNTLPY
A5KD02_PLAVS/23-315...................................E.TCK--PNYLIVV...QDD..WRYRKELYEYYVNYSPLRLIVNS
Q7RBM2_PLAYO/10-293.....................................ICQ--PDNTLVD...INY..LKEIKYLADYVENFETIKSAAIE
A5KD12_PLAVS/20-341......................................CY--PDQKLFSSMSF....LQEIKDLFDFFEDFDIMKKEIIA
Q9N882_PLAVI/13-362......................................CT--APPYYNM...SEGKYFKNIKLFFDYSKDYDIYKDQLDP
A5KCU2_PLAVS/3-296...................................N.KCK--PDDNIVN...HVD..WEKRKQLYDYCVNYETIKKALSF
A5KDH3_PLAVS/7-287......................................C.--.TLKHERDVTLDE..LIKRKFSHIYLKKYDEIKQNVDA
A5KCY0_PLAVS/16-372................................ANDKYLCR--SHFTYHD...LEE..RKNVKYMHDYIKNYVQIKQNIIS
A5KCV2_PLAVS/23-358........................................--.NLCIFYSLKKDE..IKKFQKIYAFNTILYASDKKSSI
A5K697_PLAVS/19-332......................................C.--.TLPFDKNVTLDD..LIKRKILYIYFNKYTNIKSNIKP
A5KD10_PLAVS/16-340......................................CS--YEYYKDEEFSD....WKKMKNLHDYFKNFDQIKEKIQS
A5KC12_PLAVS/18-313.....................................KCE--LDFNIAS...DDK..SDVKKQFYEYLEDYQEVHVRAKM
A5KD72_PLAVS/21-431......................................CT--.TLPISNSFSLAT..RKNIKNSYIYLQKYNXIXQIIND
A5KDR4_PLAVS/16-315......................................CA--YYSSEK....LKI..LKEEKDLYDYFNNHKSVKSKIST
A5KD61_PLAVS/26-325......................................CT--LENYKIN...KSV..FNNDQILYEFLEIYKKIEEKLTS
A5K8H3_PLAVS/281-557......................................CF--NNPLEKNDIYM....LKEKKILHDYFKNYDGISKCKNT
A5KCX3_PLAVS/16-418.....................................KCM--PERKLF...KTKL..LKPMKDVLDYIENFSTFKQESVK
A5KD87_PLAVS/15-315...................................K.TCK--LDDNIVI...NPD..RKKRKELYEYCIDYKTILEKSKL
A5KD90_PLAVS/13-364......................................CT--APHDYMY...KDD..FKDIKTIFDCSEDYKSYKEKHIY
A5KCK8_PLAVS/21-282.....................................GCR--INIEGN....FDE..LRDEKILYDYFQNCDSIVENAKK
A5KCL1_PLAVS/23-389......................................CE--IKNFAIS...KDQFIIKEKLFLHAEILHWIKEETKFIY

PF06022

Q4Z0W5_PLABA/1-311F.....DK.KNP-DC--AK-YI--------------------PKANEFVKNYQE.LYG.......DSSI.TEDS------
Q7R9N0_PLAYO/1-297Y........TKG-NS--ND-FS--------------------KHANNFVNKYNELLN........DDNN.HDDS------
Q7R7Q4_PLAYO/1-261L.....GT.NNS-DC--MQ-DS--------------------EKAHQFVEKYKK.III.......DHNI.GENI------
Q4Z1P4_PLABA/1-258F.....DG.KTS-NC--TK-CS--------------------DEAQEFAKKYDD.LNE.......NYNN.TKGS------
Q7RPL7_PLAYO/1-266L.....DD.KSS-NC--NK-HS--------------------GKAIEFVEKYKK.IKE.......DPSV.TEGS------
Q7RB69_PLAYO/1-276V......E.TNK-PG--DT-LS--------------------NNVTMFVNKYTE.LKD.......DY.N.IGDT------
Q7RFC2_PLAYO/1-273V.....NG.GDS-NP--EN-QL--------------------KIANQFFEKYKE.LNG.......YSDI.TEDS------
Q7RE48_PLAYO/1-296Y........TKS-KS--TD-FS--------------------QHANKFVYEYEKLLN........DDNN.IDNS------
Q4Z522_PLABA/1-285A......A.MNI-ND--AT-LS--------------------NTATSFVNTYTE.LNN.......NY.N.AKGT------
Q4Z0P5_PLABA/1-308F.....NE.NKK-DC--TN-CL--------------------NDAKEFVENFNE.LNK.......DYNN.GKDS------
Q7R864_PLAYO/1-257I.....DA.NDY-EC--NK-CL--------------------ENAGEFFEKCEK.LKN.......AFDI.NKGS------
Q7R9W7_PLAYO/1-296Y........TKN-KD--SE-FM--------------------QDANKFVEKYQELLD........GDNN.TDNS------
Q7R881_PLAYO/1-264G......V.QNK-KG--ET-LS--------------------NDATSFVQKYTN.LNN.......KY.K.TEGA------
Q7RFB2_PLAYO/1-280Y.....KE.DNT-YC--EK-YL--------------------NKAKEFVKIYDD.LNK.......NPNN.SDGS------
Q7RLH9_PLAYO/1-288Y.....DE.ESR-DC--NK-HS--------------------GKAKEFVEKYKQ.LKE.......NSSI.TKDS------
Q7RBL1_PLAYO/1-257L.....DT.NAL-NC--AE-YS--------------------QKANQFVERYKQ.III.......DHNI.TEDK------
Q7R7W7_PLAYO/1-274F.....DE.NKE-DC--SK-YL--------------------DKANQFVEKYKK.LNE.......GSNN.TDDS------
Q7RJC9_PLAYO/1-298F.....DK.NKS-NC--TN-CS--------------------EKAEEFVKTYKE.LYE.......DHSS.NKDS------
Q7RRG2_PLAYO/1-236I.....DK.DNH-NC--MN-YL--------------------KDDNEFNKNYEK.LKN.......DSNI.TKNE------
Q7RT28_PLAYO/1-292Y........DNK-NS--DQ-IS--------------------DYANKFVGEYGKLLN........DENN.IDNS------
Q7RDL9_PLAYO/1-222S.....GE.HET-DC--TK-YK--------------------EYANDFVSKYEEVIN........DSNI.TKKG------
Q7R7C1_PLAYO/1-249F.....DPEKNN-EC--KT-CL--------------------ETAGELVEKYEK.LKN.......ALDI.NKGS------
Q7RNM9_PLAYO/1-291L.....NA.NDT-TD--KK-YL--------------------ENAKEFVKKYKQ.LNE.......DSGI.SGDS------
Q4Z019_PLABA/1-277I......A.KNQ-TG--GI-LL--------------------NNANDFVNKYTE.LNN.......KYNN..EVA------
Q7RSF9_PLAYO/9-311S.....SK.ASN-NS--KK-YI--------------------EYAEEFVKKYKD.LNE.......DSNN.VEGS------
Q7R7D1_PLAYO/1-255I.....DE.DKK-KC--NN-YL--------------------NDDNEFFDEYRK.LLT.......DSDTDNGNS------
Q7RNI0_PLAYO/1-291F.....DA.NKP-EC--TK-YI--------------------ENAKNFVEKYNE.LNN.......GSDI.TESS------
Q7R7X7_PLAYO/1-266F.....DE.NTL-NC--TN-FS--------------------QKANTFAKKYNE.LCE.......NSDI.TSNS------
Q7RFX2_PLAYO/1-264E.....DG.HVP-TC--DE-CK--------------------KAANTFVERYEETIK........DPNI.SKNG------
Q7YZ88_PLACH/1-291C.....NE.KET-NY--PN-CS--------------------QDANAFVKEFQK.LND.......DCNI.TGNN------
Q7RCT8_PLAYO/18-257V........ETN-NH--DK-LP--------------------NNANDFIDKYKE.LNN.......NY.N.IKGT------
Q7RKC5_PLAYO/1-282L.....LD.AKY-KG--DE-YL--------------------KYVNNFADNYNILFND............TNSN------
Q7R8V9_PLAYO/1-298I........EKK-SS--DD-IL--------------------KHANNFLNIYKELLN........DNNN.DDGS------
Q7YZ81_PLACH/1-272F.....NN.DNP-NC--AT-CL--------------------VKANEFVKAYNE.LNS.......VSDI.TEDG------
Q7RHL2_PLAYO/1-264L.....DT.NSS-NC--AN-YS--------------------EKARQFIQKYEE.FNI.......DHNI.TKDK------
Q8WT16_PLACH/1-282I.....DE.NKS-NC--TK-CS--------------------QKASEFVKKFEI.LND.......DPNH.IKDS------
Q7R8B9_PLAYO/1-296N.......TKKD-ND--SV-FL--------------------QYANQFVNKYEELFN........DDNN.NDNN------
Q4X397_PLACH/5-171F.....NP.DDS-DC--TQ-CL--------------------DDTKKFAKKYEI.LFN.......DTDT..EDS------
Q7RJD0_PLAYO/1-252I.....NAETDT-KC--KK-CL--------------------ENAGEFFEKCEK.VKN.......GLDI.TKEY------
Q7RII1_PLAYO/1-285F.....DE.KTI-YC--KK-YL--------------------NYAKIFIDIYGY.LNQ.......ISDI.TEDS------
Q7YZ87_PLACH/1-262C.....NE.KKK-SY--TN-CS--------------------KDAQDFAKHFEG.LNQ.......DSNI.TGNS------
Q7RKR3_PLAYO/1-275F.....DK.NNQ-DC--KT-FS--------------------EKANQFVKKYNE.LSG.......DHNN.INVS------
Q7RRV5_PLAYO/1-265K......S.MNT-DG--NK-LL--------------------NDATMFVKTYAE.LK........GGSN.TEDT------
Q7RMJ7_PLAYO/1-291L.....DD.GNQ-NC--MN-YL--------------------NDDNEFSKKYKD.LNE.......DTNI.TKNS------
Q7RPH8_PLAYO/1-309L.....SN.ARK-DS--NK-YL--------------------EYVKNFAEKYNSLFNE.......TFND.TNDS------
Q7RCT9_PLAYO/18-310Y........KNN-NS--SK-IS--------------------EDGNKFVDEYQKLFD........DDNN.NGDN------
Q4YH36_PLABA/1-256F.....DD.DNK-NC--TN-CS--------------------GKAKEFVEKYKD.LNK.......DYNN.TNSS------
Q7RM73_PLAYO/23-317Y........TSN-NN--SK-IS--------------------EDAKKFADEYQTNFD........DDNN.NDGN------
Q7RGU7_PLAYO/9-281K......S.MNT-DA--NK-LL--------------------NAAIIFVKKYQE.LKR.......NYDN.TNDS------
Q7R943_PLAYO/1-258F.....DK.NKA-DC--KN-YL--------------------KDAKNFVKKYDE.LNE.......DYNN.GKDN------
Q7RAK5_PLAYO/1-296Y........TKD-KS--TE-CL--------------------QHANKFVDEYRMLLN........DDKN.IDNS------
Q4YCQ1_PLABA/1-303F.....DE.NKK-NC--AG-CS--------------------EKASQFAKKYKE.FNN.......GSNN.TDSI------
Q7R9C3_PLAYO/1-237F.....DK.NSP-DC--RN-YL--------------------KNAKEFVKKYDE.LNE.......DYNN.TKGS------
Q7RIN7_PLAYO/1-266V......A.KNE-KY--DI-LS--------------------NNANDFVQKYTE.LNK.......KY.N.DEDG------
Q7R8U3_PLAYO/1-269V........ETN-KH--EN-LP--------------------NNANDFINKYTE.LNN.......NC.N.IKGA------
Q4YHL6_PLABA/1-288V......A.MNK-H.--EN-LP--------------------DNAFNFVNKYAE.LN........NH.N.IEDT------
Q4YHA9_PLABA/1-253V......A.TNT-NG--TT-LS--------------------NNATSFVKKYTE.LK........GGNN.IEDT------
Q7RFZ7_PLAYO/1-278F.....GG.NTS-NC--KK-CS--------------------KNFNQFVEKYKE.LNE.......NYNN.TDNS------
Q7RTJ0_PLAYO/1-252L.....G..GNS-SC--DH-YL--------------------DKSKEFAKKYDE.LNE.......NYNN.TKGS------
Q7RJE2_PLAYO/25-326C.....NV.NKS-KC--TE-CL--------------------QIAEEFVKKYEK.LNE.......DPNN.IDNS------
Q7R7P6_PLAYO/1-245V.....DE.INP-KC--EK-YW--------------------EYYNEFFKKYEE.LKK.......DSSN.YGDD------
Q7RKA5_PLAYO/1-268V......A.SNE-YG--ET-FL--------------------NNATNFVSKYAN.LKY.......GC.N.IEST------
Q7R9Q6_PLAYO/2-288L.....GG.RNT-IS--EK-SL--------------------ENAKNFVEKYKE.LNE.......DSII.SGDS------
Q7RK60_PLAYO/1-246C.....DD.SES-DY--NK-YL--------------------EKTQEFVKKYEQ.LK........DLDI.TKNY------
Q7RK83_PLAYO/1-317L.....DD.ENN-DC--KK-YL--------------------EDNNEFFNKYEE.LKN.......DPHI.TDSN------
Q4Z1S0_PLABA/1-273F.....DT.KPS-NC--TK-CS--------------------DKASQFVKKYKE.LKE.......NSNI.TENS------
Q7RCJ0_PLAYO/1-265A........ETH-AY--EK-MV--------------------DNAVHFVNKYTD.LN........DYYN.VEGT------
Q7R9P0_PLAYO/1-271V......S.TNA-YD--NT-LL--------------------NNAIHFFNKYAE.IN........DYYN.IENT------
Q7RAI9_PLAYO/1-299V.....DA.NDR-TS--KN-YL--------------------VKANEFVKKYDE.LNK.......HPNI.TKYS------
Q7RBK2_PLAYO/1-285V.....DK..KD-GG--KA-YL--------------------EYANKFVDEYEKLFN........DNNN.VEGN------
Q7RA91_PLAYO/1-295A.....GK..QG-VG--KT-HF--------------------EYTKEFVAEHQK.LNN.........NIGTEDS------
Q7RCV4_PLAYO/1-300EDGDGDDD.ENK-DC--KK-YS--------------------EDNNEFFKKYKE.LEN.......DSDI.TGNN------
Q4X890_PLACH/1-129I.....DA.NKS-NC--AS-YL--------------------EDSQKFVDEYEK.LNE.......NYD..TKGV------
Q7RHS9_PLAYO/1-267F.....DE.NTS-NC--TK-CS--------------------GKADQFVEKYKE.LNG.......DSSI.TTNS------
Q7RHP0_PLAYO/1-282F.....ND.RTS-DC--KN-CS--------------------NNAKEFVNKYNE.LNE.......DHSI.TGNV------
Q7RQB7_PLAYO/1-303G.....NI.DKS-SC--IK-HL--------------------DDGKEFVKKYEK.LNE.......DSSI.NENS------
Q4Z7R7_PLABA/1-277F.....DE.NTS-NC--KT-CS--------------------GNAYQFFEKYKE.LNG.......DSNN.NDSS------
Q7RHL9_PLAYO/1-326L.....DD.EKK-NC--KN-YL--------------------NDNNEFFKKYEK.LKN.......DSDI.ADKS------
Q7YZ86_PLACH/1-256I.....HD.EHP-DC--EK-NL--------------------DYAKNFAEKYEILLNN.......NDTG.IDDS------
Q7RJ63_PLAYO/1-296Y........TSS-NS--ND-FS--------------------EYVKKFAEEYENLLN........DNDN.IDGS------
Q7RHP5_PLAYO/1-274L.....NA.NDT-TD--KS-YL--------------------ENANKFVEKYNE.LNE.......VSDI.TEDS------
Q7RA21_PLAYO/1-277F.....NE.DTS-NC--KK-CS--------------------ENAKKFVEKYKK.LNG.......DPNN.TNGS------
Q7REE4_PLAYO/1-252F.....DE.KKK-DC--TK-CL--------------------GKAIKFAEKYEE.LNK.......DPNI.TNDS------
Q7R7L0_PLAYO/1-205............-..--..-CV--------------------SDSNEFVAKYND.LNK.......YPNI.TNES------
Q4YH17_PLABA/1-291A.....KK..ND-NG--NT-CL--------------------EYANKFVNKHNE.LKN.......DSNN.IQGN------
Q7RM24_PLAYO/1-277I.....DD.DNK-KC--NN-YL--------------------KDANKFVDEYQK.LLN.......DKDTDNGNN------
Q7R8S4_PLAYO/1-292V.....DK..KS-MA--NT-YL--------------------ENANKFADEYKKLFND.......NDNN.VEGS------
Q7RDZ3_PLAYO/1-258F.....ND.DNP-DC--KT-YS--------------------EKAKEFVEKYKE.LNE.......YYNN.TKGS------
Q7RJ28_PLAYO/1-315A.....DK..TD-GG--KT-CL--------------------EHANKFVVEYQKLLN........DNDN..KDS------
Q7RDW3_PLAYO/1-274I.....VT.KKN-QC--NT-CL--------------------KNAGEFYEKYEK.LKN.......TLDI.NKGS------
Q7RQI7_PLAYO/1-298Y........DNN-NS--SQ-AS--------------------EHAEKFANGYTELFD........NDNN.NEGN------
Q7RK85_PLAYO/1-254F.....NE.ETI-NC--TK-YL--------------------QKANEFSEKYQK.VIG.......GSSV.DKHS------
Q7RS14_PLAYO/1-297Y.....DE.DNL-KC--TE-YL--------------------GYANDIVGKFNE.LNR.......NSSI.SGDS------
Q7RGN4_PLAYO/1-299C.....NG.NNS-DC--EE-CS--------------------KAANQFVAKFNE.LNN.......VFDI.IKNS------
Q7R8D0_PLAYO/1-281F.....DE.QNP-NC--VK-HL--------------------EKAKKFVDEYKK.LKE.......NYSI.TENS------
Q4Z0V4_PLABA/1-324F.....NE.KTL-HC--SN-CL--------------------QNANKFVNKYKE.MNQ.......NSVI.TSNN------
Q7RKY7_PLAYO/1-277F.....DD.KSP-DC--NK-YL--------------------KYADEFDKKYKK.LNK.......DPSI.TVNN------
Q4XE61_PLACH/265-545H.....NE.NDK-KC--TN-CS--------------------QNAEEFVQKIEK.LNK.......DPSI.TKNE------
Q7RHX9_PLAYO/1-284L.....DY.SSK-NC--EK-YL--------------------EDNSDFFKKYQE.LEQ.......DTSN.TRNG------
Q7R9W6_PLAYO/1-272F.....NE.ESP-DC--GK-YL--------------------GKAKEFVEKYKK.LNV........SDI.NKDS------
Q7R9Q4_PLAYO/9-276V......A.QNK-AD--DT-LL--------------------NDANDFVKKYTD.LNN.......NC.K.IEDT------
Q7R7X0_PLAYO/1-296Y.....NA.DKS-NC--TK-CL--------------------GDANNFVVKYDQ.LNK.......DHSI.TKDG------
Q8WT02_9APIC/1-285F.....SA.NNP-NC--TE-YI--------------------EKSNEFVSKYTS.LND.......DSNN.IDGS------
Q7RMB8_PLAYO/2-270L.....YA.NVS-NC--EE-YL--------------------GKAQKFVKKYDE.LNEKYYDFNDKYSI.IKGN------
Q7RSD0_PLAYO/1-255V.....DE.NSS-KC--DN-NL--------------------EKAKKFAKKYDE.LNE.......DYNN.GRDN------
Q7REX1_PLAYO/1-255F.....DE.ESP-NC--DN-YL--------------------KNAKKFAEAYDA.LNE.......DYNY.GKGS------
Q7RL45_PLAYO/1-297F.....DD.DNK-NC--KK-CS--------------------NKAKEFVEKYKG.LNE.......DSDI.NEKS------
Q7RI05_PLAYO/1-288F.....DE.NTL-NC--KK-CL--------------------EKANEFVEKYNE.LNG.......NSSI.TNDS------
Q4YH25_PLABA/1-270V......A.KNE-KS--GT-LS--------------------NNANNFVEKYTD.LN........DYYN.VENT------
Q7RL82_PLAYO/1-274F.....DD.KSS-YC--AN-CS--------------------KNASNFVNKYKE.MNQ.......DSVI.NSND------
Q7RL75_PLAYO/1-259L.....DI.DNS-KC--DN-CL--------------------EKAKKFAKKYDD.LNE.......SYNN.TKGS------
Q7RRS6_PLAYO/1-291C.....NA.QKS-NC--TE-CL--------------------QIANEFVETYEK.LYN.......DYNN.NENK------
Q8WT03_9APIC/1-293F.....NE.NDP-KC--TE-YL--------------------KIANQFVEKYKE.LNE.......NSDI.TEGS------
Q7R9Y8_PLAYO/1-266F.....DE.SKP-NC--EK-IL--------------------EKANKFVEKYKE.LDG.......NCNI.TGKS------
Q7R8Q2_PLAYO/1-296N........KDK-NS--SS-FS--------------------EHANKFVVEYEQLLN........DDNN.IDDS------
Q7RCK0_PLAYO/1-269F.....DD.ESS-NC--KQ-CL--------------------KYANAFIEKYKK.LTK.......DSNI.TDNS------
Q7R7N7_PLAYO/1-246L.....D..DNQ-NC--KK-YL--------------------DDDNDFFKKYEE.LKK.......DSSI.TGNN------
Q7R925_PLAYO/1-251V.....DE.DRS-NC--DN-YL--------------------EKAKEFAKKYDE.LNE.......DYNN.GKDS------
Q7R8E2_PLAYO/1-255L.....DA.NNN-QC--KK-CF--------------------DNAGEFFERYEK.LNN.......VLDI.AEGS------

PF05795

A5KD74_PLAVS/16-336K--------P...TC..EK.YE....................RYVTYINKLYEI..K....EYD..CCD-DDDLLD....
A5K942_PLAVS/22-370D--------TFN.SC..NK.YF....................KYIKQRIPAYYV..W....RDT..CKV-EG........
A5KD05_PLAVS/8-390S--------KDL..C..EK.YS....................TYYSYIKEIYSD..Y....EKE..CCI-KQY.......
A5KCZ5_PLAVS/13-363H--------NIS.CN..SK.YK....................TYFNTHMNIYGE..F....YNE..CEV-EEKEN.....
A5KDC7_PLAVS/13-362P--------IKS.CN..NN.YN....................SHLESNIEIYNR..F....YSE..CEV-HDLKK.....
A5KD53_PLAVS/22-422Q--------EKE.KC..DK.YS....................KYLDNINKLYIN..Y....KTK..KCS-WF........
A5KC97_PLAVS/22-304K--------EDV....NEN.YK....................RYLKHILDLYKK.......KKKSGCCN-IKYY......
A5K691_PLAVS/16-331L--------KPG.EC..DK.YT....................PYINDIKSVYNT..Y....RRN..ICH-RYLSS.....
A5KAS2_PLAVS/244-559E--------SGN..C..NQ.YC....................DYLNYINELYMN..Y....INV..CCT-CYTNPTSDCI
A5KCQ8_PLAVS/25-314T--------DNSIPC...........................SYAREFTEKFNNIIETGVHKNN.....-..........
A5KD32_PLAVS/8-337N--------DNE..C...K.YY....................RQIKDKISLYEY..F....EEE..CSP-KKS.......
A5K735_PLAVS/3-393E--------R...EC..SN.QFKKCADIFEQGMNLYYKTKNPKFFKELTKFWST..FNNYFKSDSKACK-LEDS......
A5KCR3_PLAVS/9-294S--------GEK.P...NN.YC....................PYISESVQLYHA..F....KAL..CST-VLN.......
A5K8H5_PLAVS/21-452K--------GKG.KC..DQ.YV....................KYLNYIDSLNKK..Y....KKD..DCR-VFFF......
A5KD69_PLAVS/21-342Y--------KNN..C..RH.IY....................SYVKSSAPLYKH..F....KTS..CVS-NDE.......
Q9N886_PLAVI/17-366D--------KYL..C..NI.YS....................MYFSYITKIYEK..Y....KEE..CCQ-ETN.......
A5KCT2_PLAVS/17-298G--------NNKCNC.............................AHNIVELYMK..Y....IDD..CRR-GVNT......
A5KD30_PLAVS/21-355F--------VQT..C..PK.YW....................SYVESHTSLFEY..F....KTL..CTK-QND.......
A5KBG3_PLAVS/140-414D--------GDG.....EKLLC....................EYLTHINELYEK..H....IKE..SCV-CIRKPNFFCL
Q9N887_PLAVI/22-345E--------INL.NI..QS.YC....................KHIKENFRFYNE..V....KDK..C.S-NTSC......
A5KD66_PLAVS/21-335Y--------PLR..C..KE.FY....................EYIENKIPLFDY..F....KPN..CPS-PDT.......
Q9N8A0_PLAVI/10-445S--------NYG.SC..DT.FLSWASNHNYAIDKYYENTNLYQKFEEIKKLIDNLKE....SSSSSCIK-SIY.......
A5KBF9_PLAVS/37-328F--------KDN.YC..QK.YY....................EYFEKKAELYKH..F....EQY..CST-SDR.......
A5KBR5_PLAVS/12-313Y--------GKS.CS..QE.YY....................YYVEKIVSTYNI..V....HDN..CEN-TSD.......
A5KDE6_PLAVS/22-346E--------NNV.NV..KT.YC....................KHIKENFRYYNI..I....KES..CKS-KDTC......
A5KCW1_PLAVS/25-352E--------NGT.DC..DK.YL....................TYLNSFKSVHDI..Y....KDK..HCR-RLFLFT....
A5KD28_PLAVS/16-416K--------NRT.EC..DK.RL....................KYVESFMPLYTE..Y....YDK..HCK-NRGFFLFS..
A5KD65_PLAVS/22-478E--------KKE.EC..SK.YF....................TYLTNFKSLYDK..L....KND..HCK-YSFWSFS...
Q9N8A3_PLAVI/13-292E--------NTKYKC.............................AKNCFDLYKE..Y....IED..CNK-KFND......
A5KE77_PLAVS/14-291Y--------NED..C..NL.YS....................QYVTEMNSTYFE..K....ESD..CCI-WVD.......
Q9N899_PLAVI/13-363P--------NRS.CN..EN.YK....................KYLQTYVNKYKE..L....HGY..CEV-EKRSD.....
A5K945_PLAVS/9-352S--------SEK.P...KI.YC....................SYILGKVHLYFM..G....KKL..CSY-GES.......
A5KCV9_PLAVS/16-436K--------D...KC..EK.YV....................DYVSYINKLYVD..N....IDN..CCE-EDDTD.....
A5KC95_PLAVS/23-424N--------DKN.K...EL.YC....................EYVQYIFELFKKVEA....KGKYGVYN-NEVMHFQNKF
A5KE70_PLAVS/16-392K--------D...KC..EK.YV....................DYVTYINRIYQK..K....IGK..CCD-EDDLGN....
A5KCL0_PLAVS/21-363S--------KDK..C..QK.YN....................RYIDFIRKIYDK..H....VKEEECCN-NYHIHYW...
A5K5E2_PLAVS/17-358L--------TKS.NC..HL.YC....................NYVKYISELYKK..Y....LKD..CCV-YYYSANNVVE
A5K936_PLAVS/22-322H--------NKD.NC..KH.YC....................KYVKYINDIYKK..Y....ENQ..CCG-SNY.......
A5KCW8_PLAVS/16-290G--------SGK..V..DT.FE....................EYVNHIKGLYDK..Y....KKN..CWD-HFDYWL....
A5KCU8_PLAVS/16-426P--------G...EC..NK.YI....................KYVSYIKELYEK..H....YRD..CCF-LY........
Q9N884_PLAVI/13-362A--------KNT.CD..KD.YK....................DYINKYISVYKE..A....YSD..CYS-GKGNN.....
A5KBG4_PLAVS/18-346S--------NCS.EC..TK.FC....................NYVKHIKTLYDK..Y....ERG..CCL-W.........
A5KAS5_PLAVS/16-329K--------CEK........YY....................KYVSYIRDIYYE.......IQP..ICF-..........
A5KDD1_PLAVS/6-340F--------GKA..C..PE.YW....................SYVKSHTSVFEY..F....EKY..CSE-KKY.......
Q9N888_PLAVI/8-385S--------KQL..C..DV.YP....................KYYRYIEGIYNN..Y....KEV..CCD-KKN.......
A5KCU5_PLAVS/21-349K--------Q...RC..EK.YV....................QFVTYIKSLFPP..K....EDK..CCD-EEELWDE...
A5KDR2_PLAVS/20-353N--------HET..C..KK.YI....................NYLQDKSSLNTYIKKILPDVKD.....-..........
A5K1K8_PLAVS/20-397N--------KEI..C.NKK.YC....................KYLEDARYSYLL..F....TTK..CFS-KNDNSVK...
A5KD19_PLAVS/13-348Y--------G...AC..EIVY.....................NYVNYINDLYKK..R....KENNLCCY-LANGEVE...
A5KCT1_PLAVS/19-351E--------E...TC..QM.YY....................NYVQYINDLYKK..Y....DNKYLCCY-TTDDVVE...
A5KD97_PLAVS/20-353Y--------PKG..C...I.YY....................KKIKEKHTVFDY..F....DRH..CVS-NAY.......
A5KD24_PLAVS/19-471P--------QTK.DC..NH.YF....................TYLTYIKSLYEK..Y....HKE..HCS-ISWLF.....
A5KD42_PLAVS/16-297K--------S...KC..EK.YV....................NYVTYIKTLYEN..K....EED..CCD-GEDLDAF...
A5KD93_PLAVS/15-447Q--------GQN.KC...K.YK....................TYLTNISPLYKK..Y....KEE..KCK-NLGIF.....
Q9N8A4_PLAVI/16-297K--------ETD..C...........................SLGEECVKSYIG..S....LDK..CKD-NNNT......
A5KCR2_PLAVS/16-444N--------TKD.KC..NS.YV....................TYLNYIDSLYKK..Y....KNS..DCN-VSFF......
A5KCZ2_PLAVS/21-348F--------GKS..C..PE.YW....................SYVESHTSLYKY..F....DTH..CPK-SNY.......
A5KC13_PLAVS/21-353F--------DK...C..KE.YY....................PYFQKKAELYKK..F....EKV..CSP-KTK.......
A5KDP5_PLAVS/25-322N--------GTD..C..DK.YL....................TYLKSFKSVHEE..Y....KDK..LCG-ESTVLSQ...
A5KCZ1_PLAVS/16-330K--------S...KC..EK.YI....................QYVTYINTLFQE..K....VDK..CCD-GEDLDEY...
A5KD49_PLAVS/23-351F--------PNR..C..ED.FY....................EYIESKAHLYEH..F....SNR..CQS-SNQ.......
A5KD48_PLAVS/21-346Y--------KQR..C..KE.FY....................KYVESKRSLYNH..F....KEP..CLL-GDT.......
A5KD50_PLAVS/14-324F--------TQK..C..PE.YW....................TYVDSHTSLYEY..F....EKH..CK.-..........
A5KCL3_PLAVS/174-499I--------SIS.....DQALC....................AYVSYIYKLYKR..H....IGG..CCE-YYDKNNHYE.
A5KCL7_PLAVS/29-304K--------SNN.EC...........................KHGDKYYTLYQK..Y....VGG..CKE-NHEN......
A5KDK0_PLAVS/15-278K--------AKY.....DL.YN....................KYITYIKSLYDE..Y....GED..CTD-PIDFME....
Q7K6M7_PLAVI/22-354R--------CSGDNC...........................KYMYYFGEGLDE..F....INSINSCS-ENLPTE....
A5KCY1_PLAVS/24-359F--------KKEGN...NK.YC....................EYFTYIKKMYKK..Y....IRK..CCR-YYDHYNYE..
Q9N879_PLAVI/21-298T--------....KC...........................DLGKSCSEKYIN..L....IKL..CNP-VSHI......
Q9N893_PLAVI/16-337K--------AKY.....DL.YN....................KYITYIKSLYDE..Y....GED..CTD-PIDFME....
A5KE76_PLAVS/272-715A--------S...TC..PT.HN....................AYLSYIAKLYEK..YRQSSKGD..CCR-R.........
A5KD21_PLAVS/16-354K--------S...KC..EK.YV....................NYVTYIKTLYEE..K....KEK..CCY-EEELDED...
A5KDG0_PLAVS/6-332I--------PDR..C..KD.FY....................HYVESKKPLYEY..F....KRP..CSS-YEK.......
A5K733_PLAVS/31-364K--------NEK..C..EK.YN....................KYLVYIQGLYEK..H....KKEYNCCD-IFWG......
A5KD00_PLAVS/31-351K--------SKL.YT..PL.YC....................KHIKENFLFYNV..V....KNE..CTS-NESC......
A5KDQ9_PLAVS/9-353S--------SEE.A...KK.YC....................SYILGKVPLYFM..S....KEL..CSS-GES.......
A5KE78_PLAVS/66-466S--------DEG.KC..SE.YSGKFIKLVEKGIQQCYVTKNKNFYIELLRIWSR..YNTEKDKQKFCNN-L.........
Q9N890_PLAVI/21-313G--------TDK..C..NK.YC....................TYVKSKIQFYEK..Y....QEF..CSS-EDK.......
A5KCR5_PLAVS/246-528N--------SKN.....TD.YC....................DYIIYINSLYEK..Y....VHS..CCT-YFFNNPYW..
A5KD77_PLAVS/22-354.--------CNSNTC...........................KYLKYFGKGLDE..F....INSINKCS-SDSLNN....
A5KCN6_PLAVS/30-306N--------VKS.....DM.YS....................KYLTYISKIFEI..H....KTK..CEG-PWNFYP....
A5KDD8_PLAVS/3-324Y--------SPI..C..EE.YY....................GKIQEMISVYKF..F....EEK..CNQ-DGY.......
Q9N891_PLAVI/29-310Q--------DKS.KC...........................DHAEECVRLYKK..N....IEV..CEE-DNDS......
A5KD86_PLAVS/13-363A--------HTT.CD..EH.YK....................KVIEKYKSAYKD..A....YLN..CNG-IGREK.....
A5KD96_PLAVS/3-408K--------NDTHFCTEFN.DLFTDYSKIIDAYKISDSKFLFMELKNIKCLIEKNKL....MSKRNCEK-KISDLTLPKE
A5KD33_PLAVS/16-309K--------S...TC..EK.YA....................RYVTYINNLFQN..K....EYD..CCY-DEDVE.....
A5KAR9_PLAVS/16-316K--------D...RC..EK.YI....................QYVTYINRLFPA..K....EDT..CCD-EGELIE....
Q9N880_PLAVI/21-343F--------KHT..C..KD.IY....................TYIKGKKHLYER..F....NEP..CLS-INE.......
A5KD07_PLAVS/16-341K--------S...KC..EK.YV....................NYVTYIKTLYDT..K....VEN..CCE-DDELDEE...
A5KCX5_PLAVS/16-447K--------DQN.KC...K.YK....................TYLTNISPLYKK..Y....NAE..KCK-SSWIF.....
A5K8H2_PLAVS/11-325Y--------NDK..C..QI.YS....................YYLNHIYSLYIE..E....EFD..CCI-WVH.......
Q9N892_PLAVI/23-348Y--------PDR..C..KE.FH....................KYVESKKNLYDY..F....KKR..CDS-SND.......
A5KAS1_PLAVS/321-662D--------NEN....YKS.YC....................DYLNYIGQLYEK..H....IGA..CCT-YFHKDDTVKE
A5KD25_PLAVS/16-291K--------P...TC..EK.YV....................RYVTYIDKLFQK..K....EDN..CCD-EDDLWD....
A5KDR1_PLAVS/21-363Y--------DVK..C..IK.YY....................DYIEKIANLYKY..F....DEP..CSS-NNK.......
A5KB35_PLAVS/10-413K--------EKN.NC..SK.YSEECNDLYKHGMKKCYETRNFEFYNALKNFRSL..YKNY.IYNSNLCK-KEIL......
A5KC93_PLAVS/16-453R--------D...EC..QK.YV....................NYVKYIDPMYDA..K....IDD..CCD-EDDLY.....
A5KDB2_PLAVS/34-401D--------TYN.SC..FK.YS....................DYLRQRIPVYYA..W....RDS..CQV-DD........
A5KCT3_PLAVS/289-657V--------AKI.....ET.YC....................DYLKYINGLYKE..H....IKS..CCT-RYIRPDEYMK
A5KBR2_PLAVS/254-616E--------EKR.....DK.YC....................VYFTKIKNLFEK..H....INY..CCT-CFTNPSKYCV
A5K5E1_PLAVS/11-355L--------DNG..C..NE.YC....................NFLLSKVDLFKH..F....DGI..CPN-ANT.......
A5KCW5_PLAVS/22-437Q--------KKE.QC..DK.YT....................TYLDNISKLYIK..Y....KTN..NCG-F.........
A5KBG1_PLAVS/253-633T--------GND.....DQIYC....................EYISHINTLYGK..Y....IEQ..CCS-CYHNSNECT.
A5KD15_PLAVS/33-411D--------TYK.SC..RR.YL....................DYLKQRIPVYYT..W....RDS..CKV-DE........
Q9N8A2_PLAVI/21-355F--------DQM..C..PK.YW....................NYVESHTSLFKY..F....KTL..CSK-SSD.......
A5KD02_PLAVS/23-315Y--------PDT..C..IK.FY....................KYVESKKELYKY..F....KKR..CRS-SDE.......
Q7RBM2_PLAYO/10-293D--------TNK.AC..NV.YI....................DYLRSAIPAYYE..W....NTV..CTI-DEE.......
A5KD12_PLAVS/20-341E--------TLK.SC..FK.YR....................EYLRQRIPIYYT..W....RDS..CRV-DG........
Q9N882_PLAVI/13-362K--------KTP.LCI.IE.YK....................KYLQTYVDTYNE..F....EGE..CKN-GRTPS.....
A5KCU2_PLAVS/3-296Y--------DNM..C..KE.YY....................TYVDSNAPLYTY..F....KTQ..CTT-PNY.......
A5KDH3_PLAVS/7-287K--------GKD.KC...........................NIMTVQNYIFGH..L............-..........
A5KCY0_PLAVS/16-372G--------KNN..C..GI.YR....................KYVEFIKILYKK..H....KEE..CCK-HWN.......
A5KCV2_PLAVS/23-358T--------CGNNQC...........................KYMDYFEEALTE..F....INSIKKFS-SVSSNN....
A5K697_PLAVS/19-332Q--------NKD.EC..SN.YF....................TYLTYMKSLYDK..Y....RRM..HCP-FIWSL.....
A5KD10_PLAVS/16-340A--------GDKY....EK.YS....................KYIKYISKIYDD..Y....EDE..CCD-SDLDKD....
A5KC12_PLAVS/18-313K--------DNE..C..KK.YK....................NYYDNNSLLGGYIKEILPDVEK.....-..........
A5KD72_PLAVS/21-431K--------GKG.KC..NQ.YI....................TYLXYIDSLHKK..Y....KTD..DCR-V.........
A5KDR4_PLAVS/16-315P--------NDK..C..DK.YK....................KYLNHIDMLYKK..HKDE.NGDHDCCF-FT........
A5KD61_PLAVS/26-325P--------DDS.SK..NI.YC....................KHIKQIFSHYHR..I....KNI..CAT-DDSC......
A5K8H3_PLAVS/281-557E--------TQK..C..TH.YC....................VYVNNIIKIYKK..Y....ITD..CCI-YFHNSEHYW.
A5KCX3_PLAVS/16-418N--------KEK.P...NK.YC....................PLILKIVPLFFM..F....QQL..CSE-MKI.......
A5KD87_PLAVS/15-315S--------KDN..C..KK.YH....................THVKDKIELYKK..Y....QTF..CSS-DDN.......
A5KD90_PLAVS/13-364P--------RMS.CN..NN.YK....................SYLDTNINIYNK..F....YGE..CEI-EKKEK.....
A5KCK8_PLAVS/21-282K--------DKN.GC..TD.YY....................TYLNSIKELYKK..K....KEEEYCCS-SNF.......
A5KCL1_PLAVS/23-389P--------NEH.....NL.YN....................EYIDECVNFYKA...............-..........

PF06022

Q4Z0W5_PLABA/1-311----------PYYKL...LSTL--SNDYDNFKKECSD...ANCK------------------------------------
Q7R9N0_PLAYO/1-297----------SYSKV...LLVL--SNYYSNFEKSRAI....HNT------------------------------------
Q7R7Q4_PLAYO/1-261----------RYFYV...LINL--LTDYDNLKTKCKK.......------------------------------------
Q4Z1P4_PLABA/1-258----------PYNKI...LSTL--SNDYNNFKNKCNG...AQSI------------------------------------
Q7RPL7_PLAYO/1-266----------PYYKL...LSTL--SKDYDNLKNKCDS.......------------------------------------
Q7RB69_PLAYO/1-276----------TRSKI...LPVL--STDYDNFKNYCTR.KGANCK------------------------------------
Q7RFC2_PLAYO/1-273----------PYYQV...LSTL--SNDYNNIINECSN...CQSS------------------------------------
Q7RE48_PLAYO/1-296----------SYDKI...LNVF--SNYYNQFEKGRAP....SKA------------------------------------
Q4Z522_PLABA/1-285----------AYSQI...LSAL--STDYNNLKTKCKDC......------------------------------------
Q4Z0P5_PLABA/1-308----------PYNQL...LSTL--STDYDNLKNKCNG.......------------------------------------
Q7R864_PLAYO/1-257----------SYLQL...LSSL--SNDYKKFKEKYNS....KCS------------------------------------
Q7R9W7_PLAYO/1-296----------IYSKV...LLVL--SKYYNNFESLRVT....IDT------------------------------------
Q7R881_PLAYO/1-264----------SHLQI...LSAL--LTDYNNLNE........KYS------------------------------------
Q7RFB2_PLAYO/1-280----------SYGQV...LCTL--SNDYNNFKNKCKD...IKCS------------------------------------
Q7RLH9_PLAYO/1-288----------PHYKL...LITL--SNDYDNFKKKCSD...VSCK------------------------------------
Q7RBL1_PLAYO/1-257----------LYSHV...FIIL--LIDYEKLKNKCKI.......------------------------------------
Q7R7W7_PLAYO/1-274----------SYKQI...FCTL--STDYDNLKKKFND...VNCS------------------------------------
Q7RJC9_PLAYO/1-298----------SNSKV...LCTL--SNDYDNFKKKYDE...SEYS------------------------------------
Q7RRG2_PLAYO/1-236----------SYRQL...LSTL--LNDYNNLKNKCNG.......------------------------------------
Q7RT28_PLAYO/1-292----------SYSKV...LSVL--SKSYENFGNYTVL....NGT------------------------------------
Q7RDL9_PLAYO/1-222----------LYIKVLSTLSTL--STDYDNFKKKYDG.......------------------------------------
Q7R7C1_PLAYO/1-249----------SYYKL...LSSL--SNDYKIYGQIYNS....VCN------------------------------------
Q7RNM9_PLAYO/1-291----------SYRQI...LSTL--SNDYNNFKNYCSR.SKVDCS------------------------------------
Q4Z019_PLABA/1-277----------PHSQI...LSVL--STDYDNIKKKCNNI......------------------------------------
Q7RSF9_PLAYO/9-311----------SYNKI...LSTL--SNEYTYFRNSYVK....SIK------------------------------------
Q7R7D1_PLAYO/1-255----------YYNQL...LSTL--STNYNKLKNECKQ.......------------------------------------
Q7RNI0_PLAYO/1-291----------PYYQV...LSTL--SKDYNNFKKYCNE.NKGDCN------------------------------------
Q7R7X7_PLAYO/1-266----------PYNQL...LSNL--STDYYNLKKKCEY.......------------------------------------
Q7RFX2_PLAYO/1-264----------LYNKVLSILSTL--STDYDNLKKKNDN.......------------------------------------
Q7YZ88_PLACH/1-291----------SYSQI...LYSL--STDYKNLKNDCAK.KCTGCK------------------------------------
Q7RCT8_PLAYO/18-257----------GRSKI...FSAL--STNYNNLKNYCTS.KGIKYK------------------------------------
Q7RKC5_PLAYO/1-282----------LLKQI...LSAA--SNDYNYIKNELNV....ESI------------------------------------
Q7R8V9_PLAYO/1-298----------TYNKV...LLVL--YRYYMNFGKGTNL....YSK------------------------------------
Q7YZ81_PLACH/1-272----------FYYQI...LSEL--SNDYGNFKKKCDN.....DQ------------------------------------
Q7RHL2_PLAYO/1-264----------PYFHA...LITI--LNGYDNLKNECED.......------------------------------------
Q8WT16_PLACH/1-282----------PYSQI...LLTL--SKDYDNFKNCCNK.KKGESC------------------------------------
Q7R8B9_PLAYO/1-296----------SYNKV...LGVF--SKYYNNFGSNTLF....SNT------------------------------------
Q4X397_PLACH/5-171----------LYSQI...LSIL--STDYHNFINQCYE...KKKG------------------------------------
Q7RJD0_PLAYO/1-252----------SYSQL...WLSL--SKDYKNFEGNYNS...IWCN------------------------------------
Q7RII1_PLAYO/1-285----------PYRQV...LSTL--LNDYNNFKKKHYE...VQCS------------------------------------
Q7YZ87_PLACH/1-262----------SYREI...LYNL--FNDYDHLKTDCAE.KCTDCK------------------------------------
Q7RKR3_PLAYO/1-275----------SYKQV...LCTL--STDYDNFINKCND...THCC------------------------------------
Q7RRV5_PLAYO/1-265----------SNNQI...LPAL--SADYNNIKEKFKHI......------------------------------------
Q7RMJ7_PLAYO/1-291----------YYSEI...LSTL--SNDYNDFKRECNSILSSLSK------------------------------------
Q7RPH8_PLAYO/1-309----------LFKQV...LSIT--SNDYNYIKSKLSE....EYI------------------------------------
Q7RCT9_PLAYO/18-310----------SYNKV...LLVL--SNWYNNFGKGTRY....NNT------------------------------------
Q4YH36_PLABA/1-256----------SYNKM...LSTL--STDYNNLKNKCKN.....VQ------------------------------------
Q7RM73_PLAYO/23-317----------SYNKV...LLVL--SKYYDNIGKGRKF....DNT------------------------------------
Q7RGU7_PLAYO/9-281----------SCKQI...LSIL--STDYDNLKN........KNT------------------------------------
Q7R943_PLAYO/1-258----------PYNQL...LSTL--SNDYNRFKNICND...AQSS------------------------------------
Q7RAK5_PLAYO/1-296----------TYSKV...LRVV--SNYYNNFEKGRDF....SKI------------------------------------
Q4YCQ1_PLABA/1-303----------SYKQI...LSNL--LTDYDNFKKYCNR.KGVNCN------------------------------------
Q7R9C3_PLAYO/1-237----------SYNKI...LSTL--SNDYNNFKKDYDS...VGCN------------------------------------
Q7RIN7_PLAYO/1-266----------PHSKI...LSAL--STDYNNLKK........KRK------------------------------------
Q7R8U3_PLAYO/1-269----------ARSKI...FSAL--STNYDNFKNYCTS.KGIGCK------------------------------------
Q4YHL6_PLABA/1-288----------SYSKI...LSVL--STDYNNLKNKCS........------------------------------------
Q4YHA9_PLABA/1-253----------ARSKI...FSVL--STDYNNLKNKCSDI......------------------------------------
Q7RFZ7_PLAYO/1-278----------PYRKI...LFTL--STDYNNLKNECKD.....AQ------------------------------------
Q7RTJ0_PLAYO/1-252----------PYNQV...LSTL--SNDYNNLKKRCNK.......------------------------------------
Q7RJE2_PLAYO/25-326----------SYSQM...LSTL--SADYDNFKKKYDD.....AQ------------------------------------
Q7R7P6_PLAYO/1-245----------SYIRM...LSIL--SNDYDNLKSKCNN.......------------------------------------
Q7RKA5_PLAYO/1-268----------LHNQI...LSAI--STDYNNLKNKCKSC......------------------------------------
Q7R9Q6_PLAYO/2-288----------SYKQV...LSTL--LNDYNNLTIFCDS.NGIDCN------------------------------------
Q7RK60_PLAYO/1-246----------PYSQL...FSIL--SKDYDNLKNKC.........------------------------------------
Q7RK83_PLAYO/1-317----------PYKEI...LSIL--SNDYDNFKKECTA...AQER------------------------------------
Q4Z1S0_PLABA/1-273----------PYYKL...LSTL--STDYDNFKNYCNS.KGVNCK------------------------------------
Q7RCJ0_PLAYO/1-265----------THSQI...LSTL--STNYNNFKAQYSS.KITSSK------------------------------------
Q7R9P0_PLAYO/1-271----------PYSKI...LSTL--STDYNKLKNKCAS...IDNN------------------------------------
Q7RAI9_PLAYO/1-299----------PYYQV...LSTL--SNDYNNFKNYCKE.NQFDCD------------------------------------
Q7RBK2_PLAYO/1-285----------SYNKL...LCTM--SNDYTVFGKTVAN....PKM------------------------------------
Q7RA91_PLAYO/1-295----------SYSKI...FSTL--SSDYSVLQKSDVI.....GT------------------------------------
Q7RCV4_PLAYO/1-300----------SYKQL...LLNL--SKDYDNLKKECTD...AQER------------------------------------
Q4X890_PLACH/1-129----------SYKKI...LSTL--FNDYDRLRKKCNN.......------------------------------------
Q7RHS9_PLAYO/1-267----------SYSKV...LCTL--SSDYDNLKNKCKS.......------------------------------------
Q7RHP0_PLAYO/1-282----------SYSQI...LCTL--STDYNNLKSKCSN.......------------------------------------
Q7RQB7_PLAYO/1-303----------SCSQI...LTTL--SNDYNNFKTKCNE...AGCN------------------------------------
Q4Z7R7_PLABA/1-277----------PYRKI...LSRL--STDYNNLKNKCKG...VNDS------------------------------------
Q7RHL9_PLAYO/1-326----------PYKEI...LFTL--STDYDNLKNECND.......------------------------------------
Q7YZ86_PLACH/1-256----------LYSQI...LSIL--STDYNNLQKKCTN.......------------------------------------
Q7RJ63_PLAYO/1-296----------PYSKV...LLVL--SRYYNNLVNGRPF.....ND------------------------------------
Q7RHP5_PLAYO/1-274----------PYYQV...LSTL--SNDYNNFKEFCNS.SNVDCN------------------------------------
Q7RA21_PLAYO/1-277----------SYNKM...LSTL--STDYNKLKDKCNN.......------------------------------------
Q7REE4_PLAYO/1-252----------SHNKI...LYTL--STDYNKLKDKCSN.......------------------------------------
Q7R7L0_PLAYO/1-205----------PYNKI...LSTL--STDYDNFEKYCGK.KGGVCS------------------------------------
Q4YH17_PLABA/1-291----------SYNKI...LSTL--SDGYTSFKNTYYD....SNI------------------------------------
Q7RM24_PLAYO/1-277----------SYNQL...LCTL--STDYDNLKSKCSD.......------------------------------------
Q7R8S4_PLAYO/1-292----------SYYQI...LTTL--SNDYNYFRNSYVS....SNI------------------------------------
Q7RDZ3_PLAYO/1-258----------PYDHV...LSTL--SNDYNILKSKCDS...DKSI------------------------------------
Q7RJ28_PLAYO/1-315----------SYNKI...LSTL--SNDYNSFKTYNIY....PTI------------------------------------
Q7RDW3_PLAYO/1-274----------SYFQL...WLSL--SKDYDKFKEKYKT....VCS------------------------------------
Q7RQI7_PLAYO/1-298----------SFNKI...LNVL--SNYYNNMGKGTRF....NNT------------------------------------
Q7RK85_PLAYO/1-254----------SYYKL...LYNL--SNDHEYFKNKYNS...EECN------------------------------------
Q7RS14_PLAYO/1-297----------SYSQV...WSTL--STDYENFKKEYNV....NCE------------------------------------
Q7RGN4_PLAYO/1-299----------SYYHV...MSTL--STDYNNLKNKSTI....QSS------------------------------------
Q7R8D0_PLAYO/1-281----------LYSKI...LSTL--STDYDNFKKKYDN...VQSC------------------------------------
Q4Z0V4_PLABA/1-324----------SYAQL...LSTL--SNDYDNFKNYCNS.KGVNCT------------------------------------
Q7RKY7_PLAYO/1-277----------SYNQL...LCTL--STDYDNFKKKYSN...VRSC------------------------------------
Q4XE61_PLACH/265-545----------SYSKI...LSTL--SDDYNCLKDHYDN.NCNGCT------------------------------------
Q7RHX9_PLAYO/1-284----------SYNKL...LSTL--STDYNDFKKECKDILSSLSA------------------------------------
Q7R9W6_PLAYO/1-272----------PYYRL...LFKL--SNDYDNFKKNCSV....KCS------------------------------------
Q7R9Q4_PLAYO/9-276----------ARSKI...FYAL--STDYNNLKI........KCE------------------------------------
Q7R7X0_PLAYO/1-296----------LYNKL...FSTL--STDYNSLKDICND.......------------------------------------
Q8WT02_9APIC/1-285----------SYRQV...LCTL--SNDYDNFKKKCND...VNCM------------------------------------
Q7RMB8_PLAYO/2-270----------SYNQL...LSTL--SNDYNNLKNRCKY...YKYI------------------------------------
Q7RSD0_PLAYO/1-255----------PYNQL...LSTL--SYDYYNFQSICND.......------------------------------------
Q7REX1_PLAYO/1-255----------PYNQL...LSTL--SNDYCNLKNKCNK.......------------------------------------
Q7RL45_PLAYO/1-297----------PYDQL...LSTL--STDYDNLKNKCKD...VQNS------------------------------------
Q7RI05_PLAYO/1-288----------SCNKL...LCTL--SNDYDNFKKKYDD...IQSC------------------------------------
Q4YH25_PLABA/1-270----------PHSQI...LSVL--LTDYNKLKTDKSG.KIDNSK------------------------------------
Q7RL82_PLAYO/1-274----------YYKQL...LSTL--SNDYINFKNHCNS..SGNCK------------------------------------
Q7RL75_PLAYO/1-259----------PYNQL...LSRL--SNDYDNFKNIYKN...AKSI------------------------------------
Q7RRS6_PLAYO/1-291----------SYSKV...LSIL--SNDYDNLKNKCND...VNFK------------------------------------
Q8WT03_9APIC/1-293----------PYYQI...WSTL--SNDYDNFKKKCXD...VNCN------------------------------------
Q7R9Y8_PLAYO/1-266----------SCSKI...LFTL--SSDYINFKNKCND.......------------------------------------
Q7R8Q2_PLAYO/1-296----------SYDKI...LRLL--SNYYNTFEKHIVF....PNI------------------------------------
Q7RCK0_PLAYO/1-269----------SYNQI...LSNL--STNYNNFKKKCND.......------------------------------------
Q7R7N7_PLAYO/1-246----------SYIKI...LYTL--SDDYDNLKNKCNN.......------------------------------------
Q7R925_PLAYO/1-251----------PYNQL...LSTL--SNDYNNLKNVCND.......------------------------------------
Q7R8E2_PLAYO/1-255----------SYSQI...LSSL--SNDYNKFKEKYNK...LGCN------------------------------------

PF05795

A5KD74_PLAVS/16-336..........PLCEP---YINC..KSQY.RPDDLLTKL..........................................
A5K942_PLAVS/22-370..........STCKR---YIDN..YMKY.HPASIASEL..........................................
A5KD05_PLAVS/8-390..........GNCPE---YLDF...REWCNDDNVLNKL.SCAHS....................................
A5KCZ5_PLAVS/13-363..........KYCEE---FKKY..FPVR.KQN.LLSKW.KCNLQ....................................
A5KDC7_PLAVS/13-362..........PYCDT---FRKY..FSDK.NGN.LLSQF.KCKLE....................................
A5KD53_PLAVS/22-422..........TLSPD---YADC..YDRY.NPNSIITELAKCKTQGSRSSQSSVLGWLWGSS...................
A5KC97_PLAVS/22-304..........HLCDH---YFRC..NPKY.DPEVLLSKLGEPKGE....................................
A5K691_PLAVS/16-331..........SSIPD---YFVC..KDTY.EPSNLLSLVEQCKSK....................................
A5KAS2_PLAVS/244-559..........DMCPN---YFKC..KKEY.YPPDLISKL.GCPNT....................................
A5KCQ8_PLAVS/25-314.............DH---LYNALQDIKHLFEKIGLASLKTCEPS....................................
A5KD32_PLAVS/8-337..........N.CPD---FYNQ..CLPY.NPKNVLHTL.KCYNQ....................................
A5K735_PLAVS/3-393..........QRLPK---IKTL..EEHE.RETSLKEALKSCDSLSSNNLDILPQ..........................
A5KCR3_PLAVS/9-294..........KYCNK---YVKD..YTEY.NPRTLLHML..........................................
A5K8H5_PLAVS/21-452..........SSRPN---YADC..DSKH.DPNSLISILKDCKGTDSARGGSTSGGSLFFGWLGSS...............
A5KD69_PLAVS/21-342..........NKCPK---FYNK..CKEY.DPDIVLPTL.SCYND....................................
Q9N886_PLAVI/17-366..........GKCPP---YINF...SEWCTQGNVLTKL.DCNHS....................................
A5KCT2_PLAVS/17-298..........EFCNE---LDNF..RNIY...NEHMEKPNECDKV....................................
A5KD30_PLAVS/21-355..........Q.CPN---FYDQ..CQKY.DPKHVLPTF.VCNEQ....................................
A5KBG3_PLAVS/140-414..........EKFPH---YFKC..DKKY.YPNALLSSF.KCNME....................................
Q9N887_PLAVI/22-345..........EYDTE---LQAF..KNKF.NKTDVLEFI.YEKCK....................................
A5KD66_PLAVS/21-335..........NLCPD---FYEK..CNEY.NPEKVLHKF.RCDNE....................................
Q9N8A0_PLAVI/10-445..........LHKPQ---VVKLREEEEA.RREAAEKQKRALEEAIRERE...............................
A5KBF9_PLAVS/37-328..........KGCPT---FYDK..CEKY.NPKNFLDKL.SCHPE....................................
A5KBR5_PLAVS/12-313..........TYCDE---LKTM..FDKY.NHQD.LSKL.KCTLV....................................
A5KDE6_PLAVS/22-346..........DYYDE---YIQF..KNKF.KEPSVINLI.CEKCD....................................
A5KCW1_PLAVS/25-352..........PNGPD---YFPC..KDKD.VLMSRITELGKCKGA....................................
A5KD28_PLAVS/16-416..........TGGTD---YFRC..LSSY.NAKDLLAALKKCEPPE...................................
A5KD65_PLAVS/22-478..........SSVPD---YFNC..TQSF.DPKDLLSKADACKSKGSGGS....GGSIWGIIFGGSSSGTSGTRSTAVSKE
Q9N8A3_PLAVI/13-292..........DFCNE---LENF...RNQ.FNRYISSEP.ECKDK....................................
A5KE77_PLAVS/14-291..........ENCHK---YFDC..DKEK.RPYILLSYL.KCYDKSL..................................
Q9N899_PLAVI/13-363..........TYCKE---FHKH..FSNK.EHN.LLSTW.SCNLE....................................
A5K945_PLAVS/9-352..........DRCTT---YIGN..YKQY.DPSTLLSQL..........................................
A5KCV9_PLAVS/16-436..........PFCNP---SVKC..ADEY.DPQKLLTIL..........................................
A5KC95_PLAVS/23-424..........LNKDD---TLES..LDKL.CPNMCIKSV..........................................
A5KE70_PLAVS/16-392..........LFCIP---SIKC..GAQY.QPYKLLIEL..........................................
A5KCL0_PLAVS/21-363..........DYC.D---YFKC..HDIY.NPNKIILKR.DCDNK....................................
A5K5E2_PLAVS/17-358..........RDCPS---YFLC..DKTY.NPYALLSKL.KCDDR....................................
A5K936_PLAVS/22-322..........MNCGE---YFDC....NY.DPNILINEL.NCNGN....................................
A5KCW8_PLAVS/16-290..........SDCRS---YFRR..GEEY.DPNILLSNL.KCDSE....................................
A5KCU8_PLAVS/16-426..........NCIDE---YFDC..DSKY.NPTTVLSVLRGNAVISHDGKENGQIVKDGQQNT..................
Q9N884_PLAVI/13-362..........FDCAY---FSEL...FDR.NQFSTLSSF.SCKQH....................................
A5KBG4_PLAVS/18-346..........GSCDD---YINC..DDKY.NPSELLKRL.KCEEE....................................
A5KAS5_PLAVS/16-329..........KLRCD---YFLY..DSKY.DPDDVLSKL..........................................
A5KDD1_PLAVS/6-340..........Q.CPK---FYDE..CKQH.DPKKVLETF.DCHNQ....................................
Q9N888_PLAVI/8-385..........GNCPN---ELYF...KEWCTPGKVLTKL.ACNNH....................................
A5KCU5_PLAVS/21-349..........GYCHH---YFKC..ESTY.NPKDLLTKL..........................................
A5KDR2_PLAVS/20-353..........NKLSK---IYGK..CRNV.NQKILLSKL..........................................
A5K1K8_PLAVS/20-397..........EYCNE---FIEY..IMEY.LKIYDKSSI.SCQPV....................................
A5KD19_PLAVS/13-348..........PECSH---YFSC..DKSS.NPEILLAEL..........................................
A5KCT1_PLAVS/19-351..........DACKR---FFKC..GKRY.NPQNLLVKL..........................................
A5KD97_PLAVS/20-353..........K.CPQ---FYYD..FKSY.DPENVISTL.PCHDQ....................................
A5KD24_PLAVS/19-471..........SSDPD---YFSC..TSAY.NPKDFLSTAEKCKAKENGGG....SGSFFDIFWGSSSSGTSSNRSGTSIQA
A5KD42_PLAVS/16-297..........GLCEH---YFKC..ENKY.SPQDLLTQL..........................................
A5KD93_PLAVS/15-447..........GSGPN---YADCSSTSKY.DPNKLIPKLNDCKGNEATGSGNRGTGSWFFGLLGSS...............
Q9N8A4_PLAVI/16-297..........KFCNI---LEVF...NKY.YNEEAPKIG.YCNNV....................................
A5KCR2_PLAVS/16-444..........TPTPK---YADCSYSAKY.DPKDLIYKANQCKAKATGSS....DTSFFGFLLGDSSPRQSANVKGAPTQA
A5KCZ2_PLAVS/21-348..........Q.CPE---FYKE..CKQY.DPRDVLESF.DCHAK....................................
A5KC13_PLAVS/21-353..........D.CPD---FYDR..CKEY.DPNKILENL.KCHNE....................................
A5KDP5_PLAVS/25-322..........KNGTD---YFHC..NDKD.VLMSRITELEKCKGS....................................
A5KCZ1_PLAVS/16-330..........GFCEP---YFKC..ENKY.SPQDLLAQL..........................................
A5KD49_PLAVS/23-351..........NMCPD---FYKD..CIEY.DPKKVLRTL.SCHDK....................................
A5KD48_PLAVS/21-346..........KKCPD---FYAK..CKQY.DPDIVLPHS.DCPNE....................................
A5KD50_PLAVS/14-324...............---...........NPK................................................
A5KCL3_PLAVS/174-499..........EHCQD---YFKC..DSKL.NPNNLLIKL.NCNEK....................................
A5KCL7_PLAVS/29-304..........PFCLK---LIHF...REY.YNEHKKDVK.YCTNK....................................
A5KDK0_PLAVS/15-278..........YNCDE---YFEQD.SKAY.DPNDLLTTLKKYKGQ....................................
Q7K6M7_PLAVI/22-354..........NYCNE---FNEF..IDIC.KNKNLDSGI..........................................
A5KCY1_PLAVS/24-359..........NKCSD---YFKC..DRIY.YPNEFLCKL.RCSS.....................................
Q9N879_PLAVI/21-298..........GFCKA---LDKF..KDTY...NNHMNDGPECVNV....................................
Q9N893_PLAVI/16-337..........YNCDE---YYEQD.SKDY.DPNVLLTTLKKYKGQ....................................
A5KE76_PLAVS/272-715..........RDCDD---FFKC..DEDL.NPKNL.QKLSVCGGVQTY.................................
A5KD21_PLAVS/16-354..........EFCEP---YFKC..ESTY.NPKDLLTKL..........................................
A5KDG0_PLAVS/6-332..........NGCPE---LYTK..YEQY.DPDKVLDTL.KCHKE....................................
A5K733_PLAVS/31-364..........NLCQD---YFKC..EKEY.DPNNLLRSL.KCDSD....................................
A5KD00_PLAVS/31-351..........GYFNE---LNEF..KEKF.RQQDVLSFI.YEKCE....................................
A5KDQ9_PLAVS/9-353..........DRCTT---YIGN..YEEY.NPSALLSQL..........................................
A5KE78_PLAVS/66-466..........PEPPK---IETF..HQIE.KAASLTETRVSCKKYTSKSLDTLQH..........................
Q9N890_PLAVI/21-313..........SKCPD---FFDK.ICHKC.DPSVLLSKL.KCDDI....................................
A5KCR5_PLAVS/246-528..........NDCKA---YFNC..EEQY.NPHNLYLKL.NCQEL....................................
A5KD77_PLAVS/22-354..........EYCNE---LKEF..LDLC.KEDNEHAGI..........................................
A5KCN6_PLAVS/30-306..........KQCNE---YFVL..STNPFKPKDLLDILQKHKAQ....................................
A5KDD8_PLAVS/3-324..........K.CPD---VFNK..CKEK.NIVSALEKL.PCHET....................................
Q9N891_PLAVI/29-310..........DFCYE---LDNL...KES.YDTYMKSNE.SCPNS....................................
A5KD86_PLAVS/13-363..........YDCSK---FGEL...LRN.ELNKELSSL.YCKDY....................................
A5KD96_PLAVS/3-408GDGDFL....KPCKE---IDEGEQPKNR.VSEQVITGV..........................................
A5KD33_PLAVS/16-309..........LVCEP---YIKC..EYKT.RPDDLLPKL..........................................
A5KAR9_PLAVS/16-316..........DFCKP---YFNC..ENKF.SPEKLLTQL..........................................
Q9N880_PLAVI/21-343..........NKCPK---FYSD..CEKY.HPDTMLPQL.YCYED....................................
A5KD07_PLAVS/16-341..........GFCES---YFKC..ENMY.NPKNLLIKL..........................................
A5KCX5_PLAVS/16-447..........SSDPN---YADCSSTSKY.DPNKLIPKLNDCKGNESTGGGNKGNGSWFFGLFGPS...............
A5K8H2_PLAVS/11-325..........PDCHK---YFNC..DIRC.KPNEVLKTL.RCNLN....................................
Q9N892_PLAVI/23-348..........NICTE---FYKD..YTKY.DPDDVLPEL.SCHDK....................................
A5KAS1_PLAVS/321-662GTDDDPPIKDDYCPD---FFKC..NKKY.NPYDLLSKF.HCDVK....................................
A5KD25_PLAVS/16-291..........PLCEP---YINC..NNKY.RPDGLLTKL..........................................
A5KDR1_PLAVS/21-363..........NICPD---FYNG..MKQY.NPNDFIHNL.RCYNK....................................
A5KB35_PLAVS/10-413..........TPLPI---LKTF..KEKS.EEKFMQKTVESCAMLKNDKENEHPQ..........................
A5KC93_PLAVS/16-453..........PFCVL---PVKC..DEKY.DTKKLLDEL..........................................
A5KDB2_PLAVS/34-401..........FACKR---YIDD..YMKY.RPASIVPEL..........................................
A5KCT3_PLAVS/289-657..........NKCPS---YFKC..DKKY.YPTDLMTKF.KCADN....................................
A5KBR2_PLAVS/254-616..........NYCPK---YFEC..EEKY.YPIDLIAKL.SCAGD....................................
A5K5E1_PLAVS/11-355..........SKCPK---FFET..CKEC.NPETLFKKL.NCKEQ....................................
A5KCW5_PLAVS/22-437..........FWSSN---YADC..SRKY.DPNPLITELAKCKTQGSNGSQSSFLGWFWGSS...................
A5KBG1_PLAVS/253-633..........DECPH---YFKC..DQKY.NPDKLYSKL.KCKDE....................................
A5KD15_PLAVS/33-411..........FACKR---YIDD..YMKY.RPASIVPDL..........................................
Q9N8A2_PLAVI/21-355..........Q.CPE---FYNE..CNQY.DPNVVLRTF.SCNET....................................
A5KD02_PLAVS/23-315..........NICPN---FFAK..CLQY.DPEEVLSTL.SCHEN....................................
Q7RBM2_PLAYO/10-293..........NLCNK---YIRD..YEKY.NPKGVLCNL..........................................
A5KD12_PLAVS/20-341..........STCKR---YIDN..YMKY.RPSGIILSL..........................................
Q9N882_PLAVI/13-362..........GYCKA---FNEY...FDS.KDRAKLSNW.TCNLQN...................................
A5KCU2_PLAVS/3-296..........K.CPE---FYNE..CEKY.DPIHVLKNF.PCHDV....................................
A5KDH3_PLAVS/7-287............LPN---YTDC..SSKH.DPSKLIPLLNNCKDEGSKGGSKPNSGSFLFGWWGSS...............
A5KCY0_PLAVS/16-372..........TECHK---YFSC..DPFY.DPDNLFPALESCGNG....................................
A5KCV2_PLAVS/23-358..........EYCKE---FNEF..LNVC.KDENPYAGI..........................................
A5K697_PLAVS/19-332..........SNESD---FLRC..SSAY.DPKALLLKVQQCKPEETG.................................
A5KD10_PLAVS/16-340..........EFAPI---YFKC..HKDY.RPHNLLSLLESNKA.....................................
A5KC12_PLAVS/18-313..........NGPSS---IYGE..NNNC.NSIKVLPRL..........................................
A5KD72_PLAVS/21-431..........RNLPE---V..........EVEVLNGGFQVCFWSS...................................
A5KDR4_PLAVS/16-315..........YECTN---YFMC..EDEY.DPDKLIKAL.KCEEQKVP.................................
A5KD61_PLAVS/26-325..........SKYKE---LLKF..KEKF.KELNIINLI.CEKCD....................................
A5K8H3_PLAVS/281-557..........DKCDN---FFKC..DKKY.NLFDLLSEF.NCIPE....................................
A5KCX3_PLAVS/16-418..........DICKK---YVEN..YDNY.NPSELLAKL..........................................
A5KD87_PLAVS/15-315..........SECPD---FFHK.FCENK.DPKNLLDQL.NCDDI....................................
A5KD90_PLAVS/13-364..........EYCKA---FRKY..FPDN.KPN.LLSEI.NCFLK....................................
A5KCK8_PLAVS/21-282..........LVCED---YFKC..EDKY.DPDVILSKL.KCNGN....................................
A5KCL1_PLAVS/23-389..........HICKN---ISTI..QEEHTKELAIFKSNFESAVSFL..................................

PF06022

Q4Z0W5_PLABA/1-311---------------------------DI..PPLQLIEK------TQVTVNLS....EHTSKQI----------------
Q7R9N0_PLAYO/1-297---------------------------QMKFSPLPTQKT------PKKDNSEG....PEVTKAT----------------
Q7R7Q4_PLAYO/1-261---------------------------.F..PSTPDIKK------IISE...............----------------
Q4Z1P4_PLABA/1-258---------------------------KF..PTLPTY..------...................----------------
Q7RPL7_PLAYO/1-266---------------------------.F..PDLLTIEK------K..................----------------
Q7RB69_PLAYO/1-276---------------------------YS..SSFPEISE------F..................----------------
Q7RFC2_PLAYO/1-273---------------------------NF..PSFLTY..------...................----------------
Q7RE48_PLAYO/1-296---------------------------QMERPQLPTEKT------SKNVEGGS.......SKEI----------------
Q4Z522_PLABA/1-285---------------------------....SSLPAIKT------TQNHVLSSKNNSEQSSGQS----------------
Q4Z0P5_PLABA/1-308---------------------------...NSSFPTIDK------PNITPKCPEQTSEQNSEQI----------------
Q7R864_PLAYO/1-257---------------------------NI...SLVA...------...................----------------
Q7R9W7_PLAYO/1-296---------------------------EMARPQLPSKKT------AQKVEVEI.......SNET----------------
Q7R881_PLAYO/1-264---------------------------DI..PSFSEIES------K..................----------------
Q7RFB2_PLAYO/1-280---------------------------NY..SSFPTIEK------KNNSLKCS...........----------------
Q7RLH9_PLAYO/1-288---------------------------DI..PPLQSIEK------TEITEDFS....GHTSKQA----------------
Q7RBL1_PLAYO/1-257---------------------------.F..PSIPDITT------IISE...............----------------
Q7R7W7_PLAYO/1-274---------------------------NS..SSFPTIEK------EKIPAKCS...........----------------
Q7RJC9_PLAYO/1-298---------------------------KS..SPLPTIET------EKISEICSEQTSKKT....----------------
Q7RRG2_PLAYO/1-236---------------------------....TSFP....------...................----------------
Q7RT28_PLAYO/1-292---------------------------PIKRPPLPTEKT------PQKVNLKD.......PKAT----------------
Q7RDL9_PLAYO/1-222---------------------------............------...................----------------
Q7R7C1_PLAYO/1-249---------------------------NS..SPFVA...------...................----------------
Q7RNM9_PLAYO/1-291---------------------------DI..PLLPDIKT------KENGVQNS...........----------------
Q4Z019_PLABA/1-277---------------------------....PSLLEKKI------EQTTVIKSENNF.......----------------
Q7RSF9_PLAYO/9-311---------------------------RSTVPELITKKT------THVSASNP...........----------------
Q7R7D1_PLAYO/1-255---------------------------.I..SSFQP...------...................----------------
Q7RNI0_PLAYO/1-291---------------------------DI..PSLLPIKT------KENAVQSS...........----------------
Q7R7X7_PLAYO/1-266---------------------------.S..SSLPEITT------...................----------------
Q7RFX2_PLAYO/1-264---------------------------...SSSLPSIKT------...................----------------
Q7YZ88_PLACH/1-291---------------------------DI..PTLPNIKT------PQNSIECSAQIRVQDKG..----------------
Q7RCT8_PLAYO/18-257---------------------------DF..PLIPDTEA------E..................----------------
Q7RKC5_PLAYO/1-282---------------------------KNQFPELQKEKK------EIQVPGPI....SVKSNVS----------------
Q7R8V9_PLAYO/1-298---------------------------TKVFPSLPTKKT------AENGGISD.......SKVT----------------
Q7YZ81_PLACH/1-272---------------------------SIKFPILSPIKK------A..................----------------
Q7RHL2_PLAYO/1-264---------------------------.F..PSTPDIT.------...................----------------
Q8WT16_PLACH/1-282---------------------------D..FPSLPQISP------KKSFAQNS....LESPG..----------------
Q7R8B9_PLAYO/1-296---------------------------PKNLPPLPTEKT------GKKGEAVD.......SKAT----------------
Q4X397_PLACH/5-171---------------------------CGRFPSLPD...------...................----------------
Q7RJD0_PLAYO/1-252---------------------------NV..PSVVA...------...................----------------
Q7RII1_PLAYO/1-285---------------------------KS..LSLPTIEK------I..................----------------
Q7YZ87_PLACH/1-262---------------------------DI..PTLSEVK.------...................----------------
Q7RKR3_PLAYO/1-275---------------------------KS..STLPTIDK------NKIPVNCP...........----------------
Q7RRV5_PLAYO/1-265---------------------------....QTIPEITA------D..................----------------
Q7RMJ7_PLAYO/1-291---------------------------ET..EENHGLTP------EQYSEQYS....ELYSGQE----------------
Q7RPH8_PLAYO/1-309---------------------------RNQFPELTKEKK------AQVSESSP.....KGTQMD----------------
Q7RCT9_PLAYO/18-310---------------------------SINLTPLPTKKT------PKKDNVES.......SKET----------------
Q4YH36_PLABA/1-256---------------------------NSKFPLLPEIKT------TQISVKSS....E......----------------
Q7RM73_PLAYO/23-317---------------------------EINLPTLPTQKI------SKTVDVEG.......SNRT----------------
Q7RGU7_PLAYO/9-281---------------------------NI..TSLPEITA------D..................----------------
Q7R943_PLAYO/1-258---------------------------NF..PSLPTY..------...................----------------
Q7RAK5_PLAYO/1-296---------------------------EITFPTLPTKKT------TPKVEVEG.......SDRT----------------
Q4YCQ1_PLABA/1-303---------------------------NF..PSLPSIEK------TKTTVNLP....EKAEQII----------------
Q7R9C3_PLAYO/1-237---------------------------NF..PSLPTY..------...................----------------
Q7RIN7_PLAYO/1-266---------------------------GF..QSLPDIPG------S..................----------------
Q7R8U3_PLAYO/1-269---------------------------DF..SSLPEITE------F..................----------------
Q4YHL6_PLABA/1-288---------------------------NI..QSLPDIKT------TQITIKNP....VKSSTTN----------------
Q4YHA9_PLABA/1-253---------------------------....PSLPEIKT------T..................----------------
Q7RFZ7_PLAYO/1-278---------------------------DVVFPSLPEIKT------SQNTTKIP....GETS...----------------
Q7RTJ0_PLAYO/1-252---------------------------.F..PTLPTY..------...................----------------
Q7RJE2_PLAYO/25-326---------------------------NCKSSPLPTIEK------KKIIVKDFEQIPEKTPE..----------------
Q7R7P6_PLAYO/1-245---------------------------............------...................----------------
Q7RKA5_PLAYO/1-268---------------------------....TSLPDITD------V..................----------------
Q7R9Q6_PLAYO/2-288---------------------------KI..LSLIPTET------EESDMLSS...........----------------
Q7RK60_PLAYO/1-246---------------------------....SYFPPL..------...................----------------
Q7RK83_PLAYO/1-317---------------------------KL..KADKETIT------PQYTIGGT....GEAGVTE----------------
Q4Z1S0_PLABA/1-273---------------------------DF..PLLPEIIT------...................----------------
Q7RCJ0_PLAYO/1-265---------------------------QF..PNLPTGRA------T..................----------------
Q7R9P0_PLAYO/1-271---------------------------PIQFPSLPTGRA------T..................----------------
Q7RAI9_PLAYO/1-299---------------------------DI..QSISPIKI------KENSIQDS...........----------------
Q7RBK2_PLAYO/1-285---------------------------RNKLPELTTKKK------TQITSSPN...........----------------
Q7RA91_PLAYO/1-295---------------------------SLNFPSLSTEKT------AENVVASN....YKETKI.----------------
Q7RCV4_PLAYO/1-300---------------------------KL..KADTDTNK------QQYPIEGT....EH.....----------------
Q4X890_PLACH/1-129---------------------------...FQSFPSMKI------T..................----------------
Q7RHS9_PLAYO/1-267---------------------------.F..TSLPEITT------...................----------------
Q7RHP0_PLAYO/1-282---------------------------.S..SSFPEIKT------PTNCVKRF....KQS....----------------
Q7RQB7_PLAYO/1-303---------------------------DY..PLLQEKKR------AQDSGEVS....EV.....----------------
Q4Z7R7_PLABA/1-277---------------------------DF..PTLPEIKT------TKSSVKSS....EQAEKIS----------------
Q7RHL9_PLAYO/1-326---------------------------.T..SSSTSTET------LKNSEQRS....VESFKQF----------------
Q7YZ86_PLACH/1-256---------------------------...FPSLPV...------...................----------------
Q7RJ63_PLAYO/1-296---------------------------KISLPSLPTEKK------KIEVIVEK.......SKET----------------
Q7RHP5_PLAYO/1-274---------------------------DI..QSLSPIKI------KENSVQDS...........----------------
Q7RA21_PLAYO/1-277---------------------------.T..LPFPSIET------IQNSELTS...........----------------
Q7REE4_PLAYO/1-252---------------------------.S..ASLPEISI------NIYAQMSG...........----------------
Q7R7L0_PLAYO/1-205---------------------------NF..PSIPVIKS------TKLCTNIW...........----------------
Q4YH17_PLABA/1-291---------------------------RSKLPSLIMEKK------TQISLRPN....GSQD...----------------
Q7RM24_PLAYO/1-277---------------------------.S..SSFPEIKT------PKNCVKRSEQSSQ......----------------
Q7R8S4_PLAYO/1-292---------------------------GNTLPKLITEKT------PQISVLNS...........----------------
Q7RDZ3_PLAYO/1-258---------------------------NF..PSLPTF..------...................----------------
Q7RJ28_PLAYO/1-315---------------------------RTSLPELITEKK------MEIPSSPNGPQDVSPSETT----------------
Q7RDW3_PLAYO/1-274---------------------------NT..ESLETCLR------SSVTKSPV...........----------------
Q7RQI7_PLAYO/1-298---------------------------SINRPSLPTEKT------PKKDNTEG.......TKVT----------------
Q7RK85_PLAYO/1-254---------------------------NF..SSLAD...------...................----------------
Q7RS14_PLAYO/1-297---------------------------GI..PLFPSIKT------TQHVQSYE....DHSE...----------------
Q7RGN4_PLAYO/1-299---------------------------NF..PSLPAIRK------TQGFVQRF....TYTSK..----------------
Q7R8D0_PLAYO/1-281---------------------------KS..LPLPKIEN------EKYVQSHI...........----------------
Q4Z0V4_PLABA/1-324---------------------------NF..PSLATIEE------IQTLEKNSEQLSAHSSEQT----------------
Q7RKY7_PLAYO/1-277---------------------------ES..SPLPTIEK------CVQSSELT...........----------------
Q4XE61_PLACH/265-545---------------------------NI..PNFPEIKT------SQISVEGSTPSHVQDNP..----------------
Q7RHX9_PLAYO/1-284---------------------------KTKEKPGPYVDG------SGQDVDVF...........----------------
Q7R9W6_PLAYO/1-272---------------------------DL...SFPTIEK------PKNYVETF....EKG....----------------
Q7R9Q4_PLAYO/9-276---------------------------NF..PSLPEITT------R..................----------------
Q7R7X0_PLAYO/1-296---------------------------...TSTFPPINT------TQVSVTNS....V......----------------
Q8WT02_9APIC/1-285---------------------------DI..PSLPTIKA------TQVSVNNP...........----------------
Q7RMB8_PLAYO/2-270---------------------------NY..PSLPTY..------...................----------------
Q7RSD0_PLAYO/1-255---------------------------.F..PLLPTY..------...................----------------
Q7REX1_PLAYO/1-255---------------------------.F..PTLPTY..------...................----------------
Q7RL45_PLAYO/1-297---------------------------NF..PALTEINT------LQDAGQTT....KQTGGTE----------------
Q7RI05_PLAYO/1-288---------------------------NS..SPLPTIEK------SEKCVQSS...........----------------
Q4YH25_PLABA/1-270---------------------------QF..PILPTEKA------T..................----------------
Q7RL82_PLAYO/1-274---------------------------DY..PDLPKIEN------M..................----------------
Q7RL75_PLAYO/1-259---------------------------DF..PILPTY..------...................----------------
Q7RRS6_PLAYO/1-291---------------------------DI..SSLRAIKT------KENGVQSS...........----------------
Q8WT03_9APIC/1-293---------------------------GF..PLLPEIKT------SQIPIKGS...........----------------
Q7R9Y8_PLAYO/1-266---------------------------.I..PPLPGIAS------EIFAQRLG...........----------------
Q7R8Q2_PLAYO/1-296---------------------------EMNRGPLPTKKI------AENDGVED.......SNEI----------------
Q7RCK0_PLAYO/1-269---------------------------.L..PSISTIDT------TDNSVYTS...........----------------
Q7R7N7_PLAYO/1-246---------------------------............------...................----------------
Q7R925_PLAYO/1-251---------------------------.F..PSLPTY..------...................----------------
Q7R8E2_PLAYO/1-255---------------------------NS..SPLVA...------...................----------------

PF05795

A5KD74_PLAVS/16-336..KKDLKALEAKEKEVLKAVGGGDAPGAVVVNKAAGRDV.........................................
A5K942_PLAVS/22-370.NYFTVILTYAY...............KPCYNDVYRVFV......DGKRRHKRQDALYQEIMEK....IELEEAEQDLLS
A5KD05_PLAVS/8-390..HHDDATPVKS...............PEDVAGEEQVA.......EEASEGNKEDKGQQAQSQGIGGEALSVGSEGGLFL
A5KCZ5_PLAVS/13-363..EIDPRIKNIE...............EEDEREEEEVHS......SPRSTEEGPGSTLSRGFTD....VRVPDAGISDAR
A5KDC7_PLAVS/13-362..TKDPRVRQLE...............KGHMEAQAQARG......RQIIGGLQGEEEFSVVPEI....EDSPAEFPSSTD
A5KD53_PLAVS/22-422..SPKTAPSKGSPGAQEPAKTAVVNNPGRISSAGGKATG......AEQAGGNKGLASVASSQSREVLGRTQNAVGVS...
A5KC97_PLAVS/22-304..NPPSKSDKDG...............IDVSAEIGENKK......YVDAYGKHIQPTRTDV...................
A5K691_PLAVS/16-331..EPITSARIANRYFGGHTELEYLLSEDEEGSGSDEDDDDALGSDSGGEEDEAEVGEDED....................
A5KAS2_PLAVS/244-559...........................NTNPTKSVDEVF.........................................
A5KCQ8_PLAVS/25-314................................................................................
A5KD32_PLAVS/8-337..IPEEK..SPA...............SAYSA..KESSS......HNPT.QESQFRAVG.....................
A5K735_PLAVS/3-393..SNDNYAELLK...............ALSADKAYTLLN......ANQYDKSICGKYCGKVTSS................
A5KCR3_PLAVS/9-294..SCEGGETSNI...............LHNKGFMPEKLN......FQRF..........NPNSM....IPGLSHIP....
A5K8H5_PLAVS/21-452..TGSSRSGKVSSPPENPKAASAAGDKGRQEVSQGVAGT......RDSPGLTSSTSLGA.........SARPVVGAAGGG
A5KD69_PLAVS/21-342..LHKEE...PT...............ATEKV......................SSVGP.....................
Q9N886_PLAVI/17-366..EELPEPILED...............SQDMGSTSRGSH......EGVAETEARNGGSEHA...................
A5KCT2_PLAVS/17-298................................................................................
A5KD30_PLAVS/21-355..MMKKKAENTA...............ANARS...............TLPAGMPAGQEA.....................
A5KBG3_PLAVS/140-414.ETSQSVESLFK...............S....................................................
Q9N887_PLAVI/22-345..YQKTSC............................................................KQGSNAEDDVPC
A5KD66_PLAVS/21-335..IGKAK...............................................AEAKA.....................
Q9N8A0_PLAVI/10-445..EAEKRQHEQE...............LKAEKELLQRQA......NNTVGDTASGEGTFQHTDD....RSDLRAPIISEL
A5KBF9_PLAVS/37-328..MQKKKEDAAA...............LAAKA..............RPTQHAESAAGEP.....................
A5KBR5_PLAVS/12-313..QHVPKPVAGE...............SDQVQSFGQGSL......RGHPLPEQPSNDRA.....................
A5KDE6_PLAVS/22-346..YIKTSC............................................................QKGSNGEDDVPC
A5KCW1_PLAVS/25-352..EKPAATTSHLETKNDKGEGDRGAPVDKNVSEGTTRPT.........................................
A5KD28_PLAVS/16-416..PPKSRISAGSASVSGRAGGSAPVSSAVTRGATSSVVS......RGSSSPVTTVRVAAVPVQV................
A5KD65_PLAVS/22-478TPRASGSEAKITGGAKNPSLDGPPKDKAAKEVTKATVAE......DRSKGLTSSTSYVTVGS......SPRPAAEATVRN
Q9N8A3_PLAVI/13-292................................................................................
A5KE77_PLAVS/14-291...........................VEPSDHVVQEEK......PPKLQLDNSIIIKHGRCIY................
Q9N899_PLAVI/13-363..GTKLQLNLIG...............DNQGKVVEEAQI......GKSSTGKERGAELKETKVE....GRAQAEPPVLTA
A5K945_PLAVS/9-352..SCLGGEIGNI...............PIDKDLITEVLK......FQES..........IPNFV....IPDLSKLT....
A5KCV9_PLAVS/16-436..NRDLLSLGKKIEQGRAQAVRAEAGREKVAPEMVPLQKLVAAADPQKEVVAAAAPAAAKPVAVKPTPVVREQEVVEEAA
A5KC95_PLAVS/23-424..FDKSSRTLCP...............SNRAVVAPVQLN......TKRCESTTTEYPDKSQSGM....EKYDRILKNLDA
A5KE70_PLAVS/16-392..NQSLLSLGKKREAALRQVPFREVALREEAPAKYVAAK......PGPGVSETARTLHYQETSS................
A5KCL0_PLAVS/21-363.....KARDDPE...............VERFAKSIKQVD......SKIFPLENSMIVKPARCVK................
A5K5E2_PLAVS/17-358.PTREEIETVYD...............EAIIDRKVKLIT......EKYNRSYEPHTTQMQQIWQ................
A5K936_PLAVS/22-322...........................QTETSDSTLSEP......EKPAETTTLTEIEKLKHNI................
A5KCW8_PLAVS/16-290.....NRTGEQA...............NRGGTGSVKYVP......KKRMT..............................
A5KCU8_PLAVS/16-426..IDISKLKTKM...............NIAYLKCFSSYN......EKINEKETDSKFAQCIYVN....PKHAVPSKKEVI
Q9N884_PLAVI/13-362...........................DNNGVLLENQKA......HEHPEPEPVHLYPQARVAL....PSTQQIVVQDAY
A5KBG4_PLAVS/18-346...........................GSEQRTSEEGQS......STPQSEKNHMRINYLKCYT................
A5KAS5_PLAVS/16-329...........................EKRIQQNSVEEN......KRTETLRNGTVQEPGRPKS................
A5KDD1_PLAVS/6-340..MMKKQPEDAA...............ANARS...............TLQAGMPAGQEA.....................
Q9N888_PLAVI/8-385..AENSGSSAER...............AQDLEEKSKGD.......REEEKSETVGGGKDLLTAEGGGNTKVPLTKDGIVL
A5KCU5_PLAVS/21-349..QKELELAEKRT.EAPREGGA..RAVEAGKALGSGGEE......REKKTHEDEVSAEATG...................
A5KDR2_PLAVS/20-353..QNNPNDLIYD...............DSEEEGGLQQLP......KLEGISEEDASDDGRINGP................
A5K1K8_PLAVS/20-397..ESSEEEDTSH...............QEEVKASGKVSP......PRGVRGVEEDEDDDDIAEE....PGTEEEGEEVKM
A5KD19_PLAVS/13-348..RRQMNLISSG...............QSNRITVNERVK......AYNTEGGYPDSSSYGLSVF................
A5KCT1_PLAVS/19-351...........................GGHIQQLQSQRIGNVDYGSQDNLNTYDSSEAGYLSPH................
A5KD97_PLAVS/20-353..VELTKSASPG...............PEEAT..KESSS......HHPAGPEAQNAVSG.....................
A5KD24_PLAVS/19-471PARAATSEAKMPGNAKNSSPGGLPENKGVKGATGVAAAG......NVSKGLSSSTSPVTAAS......STRPGAEAPVRD
A5KD42_PLAVS/16-297..KKELQSLDKKV.EAPRDRGT..GVVEAVKAPGGGEEE......REKKAKEDEVSAEATG...................
A5KD93_PLAVS/15-447..DGSSKENRESGASRVAKPTAQGGDKRAQDAPKTLSGS......PGPQSLTLSTSARGSGIKPAGAGADKGSISGP...
Q9N8A4_PLAVI/16-297................................................................................
A5KCR2_PLAVS/16-444QARVANVDTKVSGTGKSLSADGSQRDKETKGLAGITVGG......DGSRGLSSSTRSSGLESSVNKGGSARPGVEAT...
A5KCZ2_PLAVS/21-348..MKQKKDEEAA...............ANARP...............ALPASISADQEQ.....................
A5KC13_PLAVS/21-353..MKGKRVSDAL...............PKLLP..............DVEEEATEVDNTY.....................
A5KDP5_PLAVS/25-322..EKPTVATGHLDPKSVKGEGDPGAPKDKKVSEDTTRPT.........................................
A5KCZ1_PLAVS/16-330..KKELQELGKKA.EAPRDGGT..GAVEAGKAPGSGAEE......REKKTKE.EVTAEATG...................
A5KD49_PLAVS/23-351..MEEKKA..AL...............LKLKP...............EYSGAMRSDRQP.....................
A5KD48_PLAVS/21-346..IMKEH...LA...............AASRG...............QPREKALSGSEP.....................
A5KD50_PLAVS/14-324...MKQKKADTL...............AKARQ...............ELQEGRSANQEQ.....................
A5KCL3_PLAVS/174-499.ESDEDSQKIFE...............KLTIDRGVILFT......EKSKQRYKELVTGNYYHPS................
A5KCL7_PLAVS/29-304................................................................................
A5KDK0_PLAVS/15-278..TLDSNRGPSA...............DDMPPELKAFLA......MRSTGGRTENLPKGP....................
Q7K6M7_PLAVI/22-354..SIYHENKEHN...............ADGSNKYLLSVE......KYKDQLLY...........................
A5KCY1_PLAVS/24-359...........................TESVDSSSKIVK......NRVSEEQKGSGHLNSEMNT................
Q9N879_PLAVI/21-298................................................................................
Q9N893_PLAVI/16-337..TSDSNRGPSA...............DDMPAELKALLG......MRSTGGRTENLPKGP....................
A5KE76_PLAVS/272-715..SPRGVTPQGL...............TARVLTQPGLTQ......QGLTERGLTERGLTERGLT....QQDLTPRAGEET
A5KD21_PLAVS/16-354..QKELQALEKKLEAGGAEETLQPKKGEQTGPEKSGQEE....TKSEIAAAGDSTPKGEDG...................
A5KDG0_PLAVS/6-332..ITEKR...AA...............AAAKA...............SQKRVTYPSAGA.....................
A5K733_PLAVS/31-364..VSPVQEGEIS...............EDRTTITAGAAE......SPRPNISTSSEPEN.....................
A5KD00_PLAVS/31-351..YTKTSC............................................................KHGSNSEDDVPC
A5KDQ9_PLAVS/9-353..SCLGGEIGNI...............PLDKDLINEVLK......LQQS..........IPNLM....IRDLSQQT....
A5KE78_PLAVS/66-466..RNQEHEDVLK...............QLSAHEIYDKLN......KVTSDVNTCAKYCANIIHS....TEKIEDFKNL..
Q9N890_PLAVI/21-313..EGKEKQQLKG...............EP...................................................
A5KCR5_PLAVS/246-528...........................SSDKFKTLKRVT.........................................
A5KD77_PLAVS/22-354..SIHEESTKSK...............SEIAGKHLLSVV......KYQNKPLY...........................
A5KCN6_PLAVS/30-306...........................APVHKPEGPVVN......GHAQGRGGPTGSV......................
A5KDD8_PLAVS/3-324..MKAKS..VPT...............SE......DGSS......HHPPRP.....AEG.....................
Q9N891_PLAVI/29-310................................................................................
A5KD86_PLAVS/13-363....KPHTISTG...............GTEDRGQHGHSL......SEIGSKXMTXFSXLHPATX....RKIPPEXRTSAY
A5KD96_PLAVS/3-408..SGQEGTEPLA...............QHKTDRAPEEIT......GELAEQGKRLIVNGREELS....SEMHPSSSG...
A5KD33_PLAVS/16-309..QKELKALEAKPAEVPKGDVGVVGPGERAGSGVAGNGK.........................................
A5KAR9_PLAVS/16-316..KTELQSLGTKA.EAPREGGTVGGVVDAKAKPGAAESE.........................................
Q9N880_PLAVI/21-343..MKKEE...AA...............AAEKA......................LAEKQ.....................
A5KD07_PLAVS/16-341..QKELQSLGKEP.EVPREGGA....VEVRKAPGSGGEE......RVKKAKEDEVAAVTTG...................
A5KCX5_PLAVS/16-447..AGSSTGNRDRGASTVAKSTAEGGDKRAQDAPKTLSGS......PGPQSLTLSTSARGSGIKPAGAGVDKGSISGP...
A5K8H2_PLAVS/11-325.....KPNEDSE...............VIAYEEYEDDID......SEKFSLENSIIIKHGKCTN................
Q9N892_PLAVI/23-348..IMQER...EA...............DATRV...............SHNGGTFEGREP.....................
A5KAS1_PLAVS/321-662.SSSKDKEKVFE...............LATFDRYSKLLT.......KISEKSSKISTAHNVHQS....RQLSPVRNV...
A5KD25_PLAVS/16-291..QTELKALDAKVKEVPKAVGGEDAPGAVVENKAA.............................................
A5KDR1_PLAVS/21-363..IQEEKKAAAA...............ANKKAVAENLEG......RPTLQGRASSDTGP.....................
A5KB35_PLAVS/10-413..RNQKYDNILK...............GLTAQEQYNILN......TCNAEISLCSKYCGNIIPF....SEKPNGLNGLKT
A5KC93_PLAVS/16-453..KRKLQALDKKKADADAAAQEEAKAKQAEAEKAKQLEEDRKQAEKEKAKQLEEERRKAQAERDAQEAENRKKAAAAAAE
A5KDB2_PLAVS/34-401.SYLRVILTYPG...............NPCYSSVYELFI......DAKTQPKRNDDIYRRKMEK....LAKENPQGNLLS
A5KCT3_PLAVS/289-657.EYKESVEDIFN...............SITVDLNVIRYS.........................................
A5KBR2_PLAVS/254-616.VPTESAETLFK...............SVTVDHKAYLLS......NQPNKPQKSKSIESSEPIESSKSIKSSEPDEP...
A5K5E1_PLAVS/11-355..TECNATPIVP...............STRMEVGGQTLP......KEHILQGHVSQELT.....................
A5KCW5_PLAVS/22-437..SPKTAPSKGSPGAQEPAKTAVVKSSGGIVSIGGKVAG......AERAVANKGLSSVAPKQSREVLGGSQNAVVVA...
A5KBG1_PLAVS/253-633.IPRKFFKKVGL...............PAPIDHYAQYIK......NRKYEERHVSKTNAARPTT................
A5KD15_PLAVS/33-411..NPLIVLWYPY...............TPCYQSVYDLFV......KAKEQPKRNDGIYKKKMEK....LERLNPGGNLLL
Q9N8A2_PLAVI/21-355..MAKKKAEETS...............EKDKL...............QLQGGRSAGQEA.....................
A5KD02_PLAVS/23-315..IMKER...AA...............AAPSA...............LQRVNAPSDSEP.....................
Q7RBM2_PLAYO/10-293................................................................................
A5KD12_PLAVS/20-341..GWTIYFTYKN...............YPCYVEVHDIFA......EAKELPLRDDNLYKDLMEK....LSSLNSGHDLLS
Q9N882_PLAVI/13-362..KEPEKEREEE...............QVAGEPLLQRAQ......GMEVNPAKDVKQFSSGSGE....EEKPHG......
A5KCU2_PLAVS/3-296..MKKEMEEDAI...............AHALH................VKKVTMQDREN.....................
A5KDH3_PLAVS/7-287..SAQTSSSRNAPVAGDVKAPSVGKDKGAQGPSNNLAGS......AVSQGLTRSTSARV.....................
A5KCY0_PLAVS/16-372..KSIGMRGMGG...............ASVGKMSKNSSE......DSEKEINMKIKNVRCVAYK................
A5KCV2_PLAVS/23-358..SINYEYKSYS...............SDHSKKY.LSVE......EYKENPLY...........................
A5K697_PLAVS/19-332..RSSPSLWDIFFGSSPSRTPAKGRDTPAQEQGKVVVAR.........................................
A5KD10_PLAVS/16-340..TSGAQPLVKG...............PKELNTQGEASNKFTLEIQNPSDVSGATKLNQLKKGI................
A5KC12_PLAVS/18-313..LNNTFNLSGG...............YAINHIHEEGLV......EAIKDLQKEIPKLEEEETE....ASSEGA......
A5KD72_PLAVS/21-431..TESSRSGKVSSLPETAKAGGKEVDKGEKEAPKSLAGT......PDSRGLTHSTSLGGSGSQVEARPSARPVVAAAGGG
A5KDR4_PLAVS/16-315..LKPKVVSGST...............TTGGDPKTNRAG......ADTQKNQAALTPKKDVKDS....AGNAATSGG...
A5KD61_PLAVS/26-325..FKKSTC............................................................KHGSTVEDDVPC
A5K8H3_PLAVS/281-557.ENREDINNAYE...............NAVIDKKIKLLA.........................................
A5KCX3_PLAVS/16-418..SCVEGKTYEV...............QFDENLVREMIN......TYQSDLGNFFTKLGLPNLG....LSNLDLPSLDLS
A5KD87_PLAVS/15-315..WGKEKPP.HG...............DASGT................................................
A5KD90_PLAVS/13-364..LNERGSEKFA...............DGPESELVQLQE......EKSNRVSPQEEKLAVGLGS....GVQSHALPLESS
A5KCK8_PLAVS/21-282...............................QSTEEAAE.........................................
A5KCL1_PLAVS/23-389..GEKGVSINQG...............KLECQTVLQNQQ......ARERSAKEGKQQEGGPEEL....AEDGQRGAAGPS

PF06022

Q4Z0W5_PLABA/1-311-------------------------------------------SKQTVETSEQSPKQSPKQSPEQTVQ..TVQKLEQISE
Q7R9N0_PLAYO/1-297-------------------------------------------KGT...........EMSSEEDKSDI....ETI.QSYD
Q7R7Q4_PLAYO/1-261-------------------------------------------.....................................
Q4Z1P4_PLABA/1-258-------------------------------------------.....................................
Q7RPL7_PLAYO/1-266-------------------------------------------.............................QNFAKSSE
Q7RB69_PLAYO/1-276-------------------------------------------...............................SAQIYG
Q7RFC2_PLAYO/1-273-------------------------------------------.....................................
Q7RE48_PLAYO/1-296-------------------------------------------RTA...........EPSIEKGQSNT....VTTILSSN
Q4Z522_PLABA/1-285-------------------------------------------S............................RQFSAKTY
Q4Z0P5_PLABA/1-308-------------------------------------------HVNISTKNSEQTHVNISTKNYE.....QNLSSAVISE
Q7R864_PLAYO/1-257-------------------------------------------.....................................
Q7R9W7_PLAYO/1-296-------------------------------------------KTT...........GSSSETGNQDI....ETITLIPN
Q7R881_PLAYO/1-264-------------------------------------------...............................ISALAS
Q7RFB2_PLAYO/1-280-------------------------------------------.............................EKTAQGSE
Q7RLH9_PLAYO/1-288-------------------------------------------F............................GLTVKSSE
Q7RBL1_PLAYO/1-257-------------------------------------------.....................................
Q7R7W7_PLAYO/1-274-------------------------------------------................................EQISE
Q7RJC9_PLAYO/1-298-------------------------------------------...........................HATGYEEFSE
Q7RRG2_PLAYO/1-236-------------------------------------------.....................................
Q7RT28_PLAYO/1-292-------------------------------------------..............ETSSGSDKLDT....ETTALSSN
Q7RDL9_PLAYO/1-222-------------------------------------------.....................................
Q7R7C1_PLAYO/1-249-------------------------------------------.....................................
Q7RNM9_PLAYO/1-291-------------------------------------------............................DPSSEHISE
Q4Z019_PLABA/1-277-------------------------------------------.............................EQTSAQTS
Q7RSF9_PLAYO/9-311-------------------------------------------..IEGKDVSLGETSVSSSKTEVSIS....KDKVSDSD
Q7R7D1_PLAYO/1-255-------------------------------------------.............................KETMQSSE
Q7RNI0_PLAYO/1-291-------------------------------------------............................AHDNVQNYG
Q7R7X7_PLAYO/1-266-------------------------------------------.............................KFFEQSSQ
Q7RFX2_PLAYO/1-264-------------------------------------------.............................KIYLQKYG
Q7YZ88_PLACH/1-291-------------------------------------------.............................ESPGQGSE
Q7RCT8_PLAYO/18-257-------------------------------------------...............................IYALTS
Q7RKC5_PLAYO/1-282-------------------------------------------DNLSGMS.......SPSSDTKVSDS....ETEVLNSE
Q7R8V9_PLAYO/1-298-------------------------------------------KTI...........ESSSETGQSNI....VTTTFSSN
Q7YZ81_PLACH/1-272-------------------------------------------.............................QSSALSYD
Q7RHL2_PLAYO/1-264-------------------------------------------.............................NIISEHAS
Q8WT16_PLACH/1-282-------------------------------------------.............................HTSGHNSE
Q7R8B9_PLAYO/1-296-------------------------------------------EIT...........VSSSGTDKSNH....VKENPSSN
Q4X397_PLACH/5-171-------------------------------------------.....................................
Q7RJD0_PLAYO/1-252-------------------------------------------.....................................
Q7RII1_PLAYO/1-285-------------------------------------------.............................QASALSSK
Q7YZ87_PLACH/1-262-------------------------------------------.....................................
Q7RKR3_PLAYO/1-275-------------------------------------------.............................EQTIQISD
Q7RRV5_PLAYO/1-265-------------------------------------------..............................VSALISR
Q7RMJ7_PLAYO/1-291-------------------------------------------...........................YESNPESSSE
Q7RPH8_PLAYO/1-309-------------------------------------------DSSSETSKEISESKVPDSETKIPGS....ETRVTDSE
Q7RCT9_PLAYO/18-310-------------------------------------------KTT...........ESSNEAGKSDI....ATITLSQN
Q4YH36_PLABA/1-256-------------------------------------------.............................QTSAQTSE
Q7RM73_PLAYO/23-317-------------------------------------------KTD...........ESSSETDQTIN....VMTPLSSN
Q7RGU7_PLAYO/9-281-------------------------------------------........................I....SALASTFE
Q7R943_PLAYO/1-258-------------------------------------------.....................................
Q7RAK5_PLAYO/1-296-------------------------------------------KKV...........ESLSGTGKSDN....TMTTLSSN
Q4YCQ1_PLABA/1-303-------------------------------------------QIFKQSEQSSGEISEQ...........TAQQIVQISE
Q7R9C3_PLAYO/1-237-------------------------------------------.....................................
Q7RIN7_PLAYO/1-266-------------------------------------------.............................SALASTYE
Q7R8U3_PLAYO/1-269-------------------------------------------................................SALTS
Q4YHL6_PLABA/1-288-------------------------------------------SLQ...........NSEQTSAQSSG....QIFAQTSE
Q4YHA9_PLABA/1-253-------------------------------------------.................................KISV
Q7RFZ7_PLAYO/1-278-------------------------------------------.............................DKNVQNSD
Q7RTJ0_PLAYO/1-252-------------------------------------------.....................................
Q7RJE2_PLAYO/25-326-------------------------------------------.............................KTPEQSYE
Q7R7P6_PLAYO/1-245-------------------------------------------.....................................
Q7RKA5_PLAYO/1-268-------------------------------------------................................SVLAS
Q7R9Q6_PLAYO/2-288-------------------------------------------................................EEICY
Q7RK60_PLAYO/1-246-------------------------------------------.....................................
Q7RK83_PLAYO/1-317-------------------------------------------ETEVTEETGVTEETGVTG.........ITGVTGQIFE
Q4Z1S0_PLABA/1-273-------------------------------------------.............................KVSAQISE
Q7RCJ0_PLAYO/1-265-------------------------------------------....................................K
Q7R9P0_PLAYO/1-271-------------------------------------------....................................K
Q7RAI9_PLAYO/1-299-------------------------------------------................................GQKSE
Q7RBK2_PLAYO/1-285-------------------------------------------.........VSQMDTSSPGTSTSVS....EIEISDPD
Q7RA91_PLAYO/1-295-------------------------------------------..............VFSSETVESSS....KTKVSYSD
Q7RCV4_PLAYO/1-300-------------------------------------------............................IGETGEISE
Q4X890_PLACH/1-129-------------------------------------------.............................QSYVQDSD
Q7RHS9_PLAYO/1-267-------------------------------------------.............................KCSAQMSV
Q7RHP0_PLAYO/1-282-------------------------------------------...........................SQLISAQNSE
Q7RQB7_PLAYO/1-303-------------------------------------------.............................SEASEASE
Q4Z7R7_PLABA/1-277-------------------------------------------KQTVQK.....................IIQSSAQSSE
Q7RHL9_PLAYO/1-326-------------------------------------------FAEFGEDLGQEFGQGFGHD........SESDSEHFSE
Q7YZ86_PLACH/1-256-------------------------------------------.....................................
Q7RJ63_PLAYO/1-296-------------------------------------------KAH...........DLSDGTDQSDI....ETRIQSDD
Q7RHP5_PLAYO/1-274-------------------------------------------................................GQKFE
Q7RA21_PLAYO/1-277-------------------------------------------................................AQTSE
Q7REE4_PLAYO/1-252-------------------------------------------.....................................
Q7R7L0_PLAYO/1-205-------------------------------------------.....................................
Q4YH17_PLABA/1-291-------------------------------------------..............MFSSETLPSST....EIEVSISE
Q7RM24_PLAYO/1-277-------------------------------------------.............................LISGQNSE
Q7R8S4_PLAYO/1-292-------------------------------------------..IETQDVSLSGIPESKSETDVSSS....KDKVSDSD
Q7RDZ3_PLAYO/1-258-------------------------------------------.....................................
Q7RJ28_PLAYO/1-315-------------------------------------------ESGSENEISGSETEILGSETETLGP....EIEVSDSD
Q7RDW3_PLAYO/1-274-------------------------------------------.............................KECPVKES
Q7RQI7_PLAYO/1-298-------------------------------------------KAT...........GSSSEPDRSNI....ATTPQISN
Q7RK85_PLAYO/1-254-------------------------------------------.....................................
Q7RS14_PLAYO/1-297-------------------------------------------.............................HDSVQNYG
Q7RGN4_PLAYO/1-299-------------------------------------------.............................QASAPSFG
Q7R8D0_PLAYO/1-281-------------------------------------------.............................HGSGEISE
Q4Z0V4_PLABA/1-324-------------------------------------------VNSSLQDSEQIFTQSSKHIYTQGSEQISEQRSTQAPE
Q7RKY7_PLAYO/1-277-------------------------------------------...............................SSQTFE
Q4XE61_PLACH/265-545-------------------------------------------.............................DSSLQGSE
Q7RHX9_PLAYO/1-284-------------------------------------------.............................EQNADNSD
Q7R9W6_PLAYO/1-272-------------------------------------------...........................PEHLQAQDSE
Q7R9Q4_PLAYO/9-276-------------------------------------------...............................ISALTS
Q7R7X0_PLAYO/1-296-------------------------------------------.............................DNTVQGFE
Q8WT02_9APIC/1-285-------------------------------------------............................EETSLHNSG
Q7RMB8_PLAYO/2-270-------------------------------------------.....................................
Q7RSD0_PLAYO/1-255-------------------------------------------.....................................
Q7REX1_PLAYO/1-255-------------------------------------------.....................................
Q7RL45_PLAYO/1-297-------------------------------------------QTGGTEQTG..................GTEQTVQKSD
Q7RI05_PLAYO/1-288-------------------------------------------.............................HLILEQIS
Q4YH25_PLABA/1-270-------------------------------------------.................................KPFS
Q7RL82_PLAYO/1-274-------------------------------------------.............................QTSAHISE
Q7RL75_PLAYO/1-259-------------------------------------------.....................................
Q7RRS6_PLAYO/1-291-------------------------------------------................................EHSSE
Q8WT03_9APIC/1-293-------------------------------------------.............................EEIVQNSE
Q7R9Y8_PLAYO/1-266-------------------------------------------.....................................
Q7R8Q2_PLAYO/1-296-------------------------------------------KID...........EPSSETGNQDI....ETIALSPN
Q7RCK0_PLAYO/1-269-------------------------------------------.................................GLTS
Q7R7N7_PLAYO/1-246-------------------------------------------.....................................
Q7R925_PLAYO/1-251-------------------------------------------.....................................
Q7R8E2_PLAYO/1-255-------------------------------------------.....................................

PF05795

A5KD74_PLAVS/16-336...............................................................PGSGRPGSDGPGSEKNA
A5K942_PLAVS/22-370A........................................................RAADATPGSRLYIKHDKSRLKYY
A5KD05_PLAVS/8-390TEIDV....................................................RGGHLDTEVTESLGNKQFGTEDN
A5KCZ5_PLAVS/13-363S..........................................................PYFDGAVSENGSAATLSNDST
A5KDC7_PLAVS/13-362F...........................................................YVNREDSQMGSNSLPSDGTP
A5KD53_PLAVS/22-422.....................................PLGSSQAGVHMLHESKDIQQVSYTTLPTAPEVNPDTSNFLDKT
A5KC97_PLAVS/22-304................................................................................
A5K691_PLAVS/16-331................................................................................
A5KAS2_PLAVS/244-559............................................................ADLIIDSDVIRKTNMPYLGT
A5KCQ8_PLAVS/25-314..........................................................IPELLPITKGQADESTQSRTPS
A5KD32_PLAVS/8-337.........................................................SASRLQEDSANTEDTPSTSQSSD
A5K735_PLAVS/3-393.....................................PSNHLTKLLCAKLATNLTNLSDVLKSVASPDDRCSYLTYWTYD
A5KCR3_PLAVS/9-294...............................................DLPNVLMQSLSGLMENGIGPLNLESLLNTFPSL
A5K8H5_PLAVS/21-452LSG.........................QLVTTPPAVTLIPKAGEKPEQVVHATSSYSSGPGGNALPEPTASPAGALESV
A5KD69_PLAVS/21-342.........................................................HPELRADGTYSADGSQLQGDNTP
Q9N886_PLAVI/17-366.........................................................ELAKKEGELLDPVIDTGHSISEA
A5KCT2_PLAVS/17-298............................................................................QKIL
A5KD30_PLAVS/21-355.........................................................SSGMSNSSDISSGGLQSPHNGTH
A5KBG3_PLAVS/140-414................................................................................
Q9N887_PLAVI/22-345L........................................................RTKGNPFLFLIFGDDP.......
A5KD66_PLAVS/21-335.........................................................LSKEQESDMYLSEKSDTMPKNTK
Q9N8A0_PLAVI/10-445DQNAQRFGY................PERSESSRGLLLDNGHTREGQFIYTNEDTRQQGEGVYEQPGTDKTRSGMFGGSSG
A5KBF9_PLAVS/37-328.........................................................HSGLSTD.EGSPDSSSLMGVSPR
A5KBR5_PLAVS/12-313.........................................................LQEETASGFFPTPGEKVLPSADE
A5KDE6_PLAVS/22-346L........................................................REKGXSFLYXXFGNDA.......
A5KCW1_PLAVS/25-352..............................................................DSVAVASSSSSSDTVTTT
A5KD28_PLAVS/16-416..............................STLQPAKFLAPSTGGISGQGPHAALPPNLQIRNDAGHGATAAVPSTLDSA
A5KD65_PLAVS/22-478SAVAGKGLP................S..QSANLQPRVTLSSPVGGSPVQNALAAAPATLQIRDSTVPVPIVDSPNPLESA
Q9N8A3_PLAVI/13-292............................................................................DLYI
A5KE77_PLAVS/14-291................................................................................
Q9N899_PLAVI/13-363S............................................................SLETGSSLMSSSSEVEDSS
A5K945_PLAVS/9-352...............................................DLQGEFMKSLEGLMKNGFASIGIESLFNVFPSL
A5KCV9_PLAVS/16-436SENSALGPA................VRETTGNLQSIATFSPSPIEGTREAVHASPYFTTDAASNAVTLAVADSTNTLGTT
A5KC95_PLAVS/23-424DKIYEKLNN................NKDIKQYCSDCNDVLALEETYPGITVLCKKLARNLRTNMSDIQNDVTNARDRCSY
A5KE70_PLAVS/16-392........................................PSQRHDDEEENHAVSYYTSEHEGDAVPLDIDDSSVSLGTT
A5KCL0_PLAVS/21-363..............................................................TYNATNEHEGYSCLLPEY
A5K5E2_PLAVS/17-358.......................................................................NLFQAYGAL
A5K936_PLAVS/22-322............................................................................LRCA
A5KCW8_PLAVS/16-290................................................................................
A5KCU8_PLAVS/16-426VYTKYGKKY................NPEVPIKVVWTLPKALIDQNETSQDSQEVVSETVAEENDVEAASMSDIPVLWGGG
Q9N884_PLAVI/13-362L........................................................GMNHISDSSENPGTNENFPIEDT
A5KBG4_PLAVS/18-346.........................................................................SHKNTKK
A5KAS5_PLAVS/16-329...........................................................NVDMVIKYVICYKIQDADTTL
A5KDD1_PLAVS/6-340.........................................................SSGMSTSSEVSAGGSPLTRDGTH
Q9N888_PLAVI/8-385.........................................................PAVGSHVTMLDTAAHEDHADSEN
A5KCU5_PLAVS/21-349.............................................................KESKEKLVAGEVPKEKGA.
A5KDR2_PLAVS/20-353..................................................................MPFSVPQGKFDVSY
A5K1K8_PLAVS/20-397G................................................FGSPFTPGFHTPGRSISHRSTEIDNLMPIVY
A5KD19_PLAVS/13-348....................................................................KQFKPQDFYTLN
A5KCT1_PLAVS/19-351....................................................................NYQYNYDMEPEY
A5KD97_PLAVS/20-353.........................................................DHPGETDPNVSLHSTQSTPKSSD
A5KD24_PLAVS/19-471NVLSRGGLL................G..QAVTSNHKGALSPSPKEGPGQGINAVPPYTSDTGNGKKPALPADSPSTLESV
A5KD42_PLAVS/16-297.............................................................KESKEKLEAGEVPKEKAA.
A5KD93_PLAVS/15-447.............................SANLKPGTSMSPQTKEIPVHGIPSVPP.SSEIVRDAVALPIAESPSTSGTV
Q9N8A4_PLAVI/16-297............................................................................QRYL
A5KCR2_PLAVS/16-444...................................RRDTALTGVGVPGQGVHTVREYASETSSDAAPAIITIPPSTLETV
A5KCZ2_PLAVS/21-348.........................................................DSRI.......PGGLQSPHNGTH
A5KC13_PLAVS/21-353.........................................................GAPKPTGEVPSQFAATLRGRIPN
A5KDP5_PLAVS/25-322..............................................................DSAVVASSSSSSTTVTTT
A5KCZ1_PLAVS/16-330.............................................................KESKEKLVAGEVPKEKAA.
A5KD49_PLAVS/23-351.........................................................EAAVPEAVMLSSGDSELNRVNSH
A5KD48_PLAVS/21-346.........................................................ISEERDGRMLPHDAPK.FSGNPK
A5KD50_PLAVS/14-324.........................................................ISGIPGSSEVSAGGSLMTRDGTH
A5KCL3_PLAVS/174-499.........................................................................NLKTLFN
A5KCL7_PLAVS/29-304.............................................................................LQY
A5KDK0_PLAVS/15-278................................................................................
Q7K6M7_PLAVI/22-354.................................................................IYIKNEKLLNFVKTS
A5KCY1_PLAVS/24-359.................................................................NSLGRAGLLETQESI
Q9N879_PLAVI/21-298............................................................................LRYL
Q9N893_PLAVI/16-337................................................................................
A5KE76_PLAVS/272-715YDASQRSRL................GQRNPDESFSYDGDHYHYDGHSHGPGHMDDGRVGNTRHAVQDQSAENNSWLFDFS
A5KD21_PLAVS/16-354.............................................................ASAKASEKESGAAKHGETT
A5KDG0_PLAVS/6-332.........................................................NSEDTLVSTGPDGASQNLSGNPH
A5K733_PLAVS/31-364................................................................................
A5KD00_PLAVS/31-351L........................................................QAKGIPFILPILGNDP.......
A5KDQ9_PLAVS/9-353...............................................NLQGAFMKSLEGLMKNGFASIA...........
A5KE78_PLAVS/66-466..............................................CPILASNIKNLSETLKDTNLPYDRCTYLTYWAYE
Q9N890_PLAVI/21-313.............................................................................SIQ
A5KCR5_PLAVS/246-528................................................................................
A5KD77_PLAVS/22-354.................................................................IYLKDKKMLNFLKTS
A5KCN6_PLAVS/30-306................................................................................
A5KDD8_PLAVS/3-324.........................................................SLVHAGGPTAE.SNTQLESEDSG
Q9N891_PLAVI/29-310............................................................................PKTL
A5KD86_PLAVS/13-363L..........................................................TPGSETIHEQDGGHIHPVIET
A5KD96_PLAVS/3-408.................................................................TYPDVGFQEMRSMEA
A5KD33_PLAVS/16-309...............................................................VGPGDLGSKDPGTADQG
A5KAR9_PLAVS/16-316...................................................................GAESGIPKPAAAK
Q9N880_PLAVI/21-343.........................................................HPDISPGGTFSSDGSQSQHENTP
A5KD07_PLAVS/16-341.............................................................KETKEKLVATEVPKEKAA.
A5KCX5_PLAVS/16-447.............................SANLKSGTSMSPQTKEIPVLGIPSVPP.SSETVRGTVAVPIAETPSNLGTA
A5K8H2_PLAVS/11-325..........................................................................TTDGKG
Q9N892_PLAVI/23-348.........................................................NSEDSDGRMMPDDAPK.FSGNPK
A5KAS1_PLAVS/321-662.......................................................................DKTNELKNL
A5KD25_PLAVS/16-291.....................................................................GSDGPGSEKKA
A5KDR1_PLAVS/21-363.........................................................HSENPTNGMITPDSSQLMRDNSH
A5KB35_PLAVS/10-413F.............................................CAKFANNLINLSDKLKNVESAEDRCSYFTYWTYD
A5KC93_PLAVS/16-453ARKKELAAAANREKQLAATRGGQQTVRGDTGALQPEPSLGVPPRDSHEDSVNAATTYNSGISGDAGHASLAGVPSSLESV
A5KDB2_PLAVS/34-401T........................................................NMGDGLRGSEFFIPGDHDDYWLR
A5KCT3_PLAVS/289-657........................................................................IFMNSFNQ
A5KBR2_PLAVS/254-616................................................................DEPDEPNENDTSLKDI
A5K5E1_PLAVS/11-355.........................................................SQEDGRETPITGEDNSAPFKFEL
A5KCW5_PLAVS/22-437.....................................PLGNSQAGVHMPPGSKDIQNGSYTTLPTAFVVDPDTSNFLEKT
A5KBG1_PLAVS/253-633...............................................................LENERNSTSAPSISVDT
A5KD15_PLAVS/33-411T........................................................DMGDGLRGSEFFIPGDHDDYWLR
Q9N8A2_PLAVI/21-355.........................................................NHGMRTNPEFSSGGSHLTRDGTH
A5KD02_PLAVS/23-315.........................................................NSDVSDGRKMPDDAPI.......
Q7RBM2_PLAYO/10-293................................................................................
A5KD12_PLAVS/20-341V........................................................RADDVDTGPTFF...........
Q9N882_PLAVI/13-362.........................................................FSDNDLRGGTPELDRVSGPADTY
A5KCU2_PLAVS/3-296.........................................................HSEGSSSEDYSSDPADIAQGKSQ
A5KDH3_PLAVS/7-287................................................................................
A5KCY0_PLAVS/16-372..............................................................YEDYGFLSCFDTPITHNV
A5KCV2_PLAVS/23-358.................................................................IYIKNNEWIKFDKIA
A5K697_PLAVS/19-332........................................................................KPADVEST
A5KD10_PLAVS/16-340.........................................................FQTFNQPVITGGEDSQKYALASI
A5KC12_PLAVS/18-313................................................................................
A5KD72_PLAVS/21-431LPG.........................QLATTPAKVNLITATGKSNEQVVHATSSYNSGPGGNALPEPTASSPGTLESV
A5KDR4_PLAVS/16-315................................................................................
A5KD61_PLAVS/26-325L........................................................SSQKYGFLFLIFGYDP.......
A5K8H3_PLAVS/281-557................................................................................
A5KCX3_PLAVS/16-418GSVMSRFGS................HDFSFPGVDFQNFGLSGLNFPVNLQSMFMNNIVDLVQKGFDGSGIKALFNKIPYL
A5KD87_PLAVS/15-315.......................................................................TSNFFLSSQ
A5KD90_PLAVS/13-364V..........................................................TEPEAGGFQILGSLDHSERTT
A5KCK8_PLAVS/21-282................................................................................
A5KCL1_PLAVS/23-389ERVEELRGP................P...............................GPEMPLPVVGNNPTDQVTTDTAV

PF06022

Q4Z0W5_PLABA/1-311VTSSSSSIGNKL....FTILSIFG.AIAFFLGIS...YK-----------------------------------------
Q7R9N0_PLAYO/1-297TILSDSSLVNKL....VIVLPILA.AIAIFLGIS...YK-----------------------------------------
Q7R7Q4_PLAYO/1-261..ATSSSIASKL....IPILSILV.AIPIFLGIA...YK-----------------------------------------
Q4Z1P4_PLABA/1-258..SRRSVIKKTI....ISIVFIFV.AVSIFLGIA...YK-----------------------------------------
Q7RPL7_PLAYO/1-266DTPSSSSITTKL....FTVLSIFG.AIGFLLGIS...YK-----------------------------------------
Q7RB69_PLAYO/1-276VTSSSSSTGKKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7RFC2_PLAYO/1-273..SRRSVIKNTL....ISIAFIFA.SVSIFLGIA...YK-----------------------------------------
Q7RE48_PLAYO/1-296TTLSISSLVNKL....IPISFILV.ITIILLGIA...YK-----------------------------------------
Q4Z522_PLABA/1-285EVTSSSSIGNKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q4Z0P5_PLABA/1-308DAPLSSSITNKL....ISVLSIFG.AIAFLLGIS...YK-----------------------------------------
Q7R864_PLAYO/1-257.CPRSSIIKNTLIAIAITIAIIFI.AASIFLGIA...YK-----------------------------------------
Q7R9W7_PLAYO/1-296TALSDSSLASKL....IPVLSIFG.AIAIFLGIS...YK-----------------------------------------
Q7R881_PLAYO/1-264EDTSSSSIGNKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7RFB2_PLAYO/1-280VTSSSSSIGNTI....ISVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7RLH9_PLAYO/1-288VASSSSSITNNL....FIVLSIFA.AIPIFLGIA...YK-----------------------------------------
Q7RBL1_PLAYO/1-257.VTSSSSIARKL....IPVVSIFA.AIAIFLGIS...YK-----------------------------------------
Q7R7W7_PLAYO/1-274VASSSSSIASKL....IPVLSIFG.AIAILLGVS...YR-----------------------------------------
Q7RJC9_PLAYO/1-298VTLSESSLVSKL....FIVLSIFG.AIAIFLGIS...YK-----------------------------------------
Q7RRG2_PLAYO/1-236......SIASKL....FIVLSIFG.AIGIFLGVS...YK-----------------------------------------
Q7RT28_PLAYO/1-292ITLSESSLVNKL....IPVLSILV.AIPIFLGIV...YK-----------------------------------------
Q7RDL9_PLAYO/1-222.SSSLPDIKQRL....I....................YK-----------------------------------------
Q7R7C1_PLAYO/1-249.CPRSSVTKNTL....ITIAIIFV.AASILLVVS...YK-----------------------------------------
Q7RNM9_PLAYO/1-291VTSSSSSIKNKL....IPFVSIIV.AIPIFLGIF...YK-----------------------------------------
Q4Z019_PLABA/1-277RVTSSSPIGNKL....FTFLSIFG.AMAFFLGIS...YK-----------------------------------------
Q7RSF9_PLAYO/9-311SGSPSSSILNKL....ISIPFIFV.ATLILLGIV...YK-----------------------------------------
Q7R7D1_PLAYO/1-255DTSSSSSIGNKL....ISVLSIFG.AIGFLLGIS...YK-----------------------------------------
Q7RNI0_PLAYO/1-291VTSSSPSIANKL....IPFLLILA.TIPIFLGVS...YK-----------------------------------------
Q7R7X7_PLAYO/1-266VTLSSSTV.NKL....FIVLSIFG.AIGIFLGIS...YK-----------------------------------------
Q7RFX2_PLAYO/1-264FFSLSLLITNYF....YILLLIFG.TIVFFIGIY...YK-----------------------------------------
Q7YZ88_PLACH/1-291AILSGSSVASKL....IPALLVF..AMPVFLGIA...YK-----------------------------------------
Q7RCT8_PLAYO/18-257EDTSSSSIGNKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7RKC5_PLAYO/1-282TTLSSSLIINKL....ISIPFILV.VTLISLGIA...YK-----------------------------------------
Q7R8V9_PLAYO/1-298TTLSGSSLVNKL....IPVLSIFV.AIAILGGIS...YK-----------------------------------------
Q7YZ81_PLACH/1-272VASSSSSIATKL....IPVLLIFG.AIPIFLGVA...YK-----------------------------------------
Q7RHL2_PLAYO/1-264EVTSSSSIASKL....IPILSILV.AIAIFLGIS...YK-----------------------------------------
Q8WT16_PLACH/1-282DISSKSPMANKL....IPGLLIFA.AIPVFLGIA...YK-----------------------------------------
Q7R8B9_PLAYO/1-296ITLPGSSLVNKL....IPVLSILF.AIAIFWGIA...YK-----------------------------------------
Q4X397_PLACH/5-171.CSRCSLIKNAL....ISITFI...AIPIFLGVA...YK-----------------------------------------
Q7RJD0_PLAYO/1-252.CPRSSVTKNIL....ITIAIIFV.AASILLGVS...YK-----------------------------------------
Q7RII1_PLAYO/1-285FTLSNLSIEKKL....SIVLSIFG.VIVFFLGIS...YK-----------------------------------------
Q7YZ87_PLACH/1-262.APPSSSIAKTL....IPVLLTF..AIPVFLGIA...YK-----------------------------------------
Q7RKR3_PLAYO/1-275.AASSPSIAKKL....IIVLSIFA.AIPIFLGIA...YK-----------------------------------------
Q7RRV5_PLAYO/1-265VTSSSSSTGNKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7RMJ7_PLAYO/1-291VTSSSSSIVSKL....IPVLLILG.AIPIFFGIA...YK-----------------------------------------
Q7RPH8_PLAYO/1-309TTLSSSLIINKL....ISIPFILV.ITLILLGIA...YK-----------------------------------------
Q7RCT9_PLAYO/18-310TALSDSSLVSKL....IIVLSIFG.AIAIFLGIS...YK-----------------------------------------
Q4YH36_PLABA/1-256VASSRSSIGNNL.........................FT-----------------------------------------
Q7RM73_PLAYO/23-317SALSDSSLISKL....VPILSIFV.AIAIFFGIS...YK-----------------------------------------
Q7RGU7_PLAYO/9-281DASSSSPMGSKL....FTVLSIFG.AIAFFLGIS...YK-----------------------------------------
Q7R943_PLAYO/1-258..SRKFLIKRTL....IPIAFIFV.TVSIFLG