Sequence alignment for CL0412

PF10277

Q7QE61_ANOGA/3-230NLYLLPISVFLLFNFTFIGTYIAAVLQG.HVVPT...........................VPYISD.AATY--------
Q757Q5_ASHGO/5-206NGKHIVHLHSLFASSAFICALVVGYQLH.FHKIVRNAHYGYPD................EWFPSVSATIGDR--------
Q75DE7_ASHGO/9-286YFFLVPWIAVIPWCGMLIAMLVCWSVQGHPI.YWFMD.GDQF...................PVYISD.IGAT--------
Q4WNE6_ASPFU/5-224SFWIFPVISAGMWLAMLLAMLGNWAVIGTPI.YPSME.AGQT...................IAYISD.IGAQ--------
PGAP2_CAEBR/12-239PFKYFVFCIGGLPSSALLICVLLSLFLH.FDQATSTHCEVAN..................WLPSISAAVSTY--------
A5DLG3_PICGU/121-352HYYLVPLVALVVWWGMLTAMLICWGVQG.RPVYSFMD.EKQN...................PVYISD.VGAT--------
A5DAL2_PICGU/21-231NGSWVAYAHAFFAYSAFFAALIVGCWLH.YHKIVKNASFGYPD................EWFPSVSATIGDR--------
CWH43_SCHPO/11-220SAQYVALVHTICSFAAFFIPLALALYTH.YYQVVKNEFYGYPE................EWFPSVSATIGDW--------
A8WTJ4_CAEBR/43-270IRWLVCLGALLPGAGCYFVVAYTYVFQF.EKVSNFTECKECPNL..............NITLPPVSYSIGIW--------
Q7S513_NEUCR/18-228NGQWISWTHTVVAYAAFLSALIIGCALH.YHKIVKNEWYGYPD................EWFPSVSATIGDR--------
Q4PAD1_USTMA/365-592SGGLISHIHTVMGFLAFFGALITALSLH.YPKVVKNHVAQYPD................EWWPSVSATIGDW--------
Q5RGJ7_DANRE/7-226GMCFLPTFLVIWSSSTFIISYIIALYRQ.DVDVV...........................LPYISD.TGAT--------
Q6FIN1_CANGA/8-284YFFIVPWIAFIPWYGMLIAMLICWAAQGHPI.YWFMH.TEQF...................PVYISD.IGAT--------
T150B_BOVIN/4-207YLSLLPMCLAFWAIAGIWTVFSLAVVNK.AVNLTDG.........................FPYISV.CGNV--------
T150A_MOUSE/3-232AWILLPVSLSAFSITGIWTVYAMAVMNR.HVCPVENWSYNESCSPDPAEQGGPKSCCTLDDVPLISK.CGTY--------
A7TMD9_VANPO/12-290YFFIVPWIAFIPWWGMLIAMLACWAGQGHPI.YWFMN.GDQF...................PVYISD.IGAT--------
Q6FKB5_CANGA/8-272WFFVVPWIAFIPWYGMLITMLVCWAAQGHPI.YWFMH.TEQF...................PVYISD.IGAT--------
Q7PN15_ANOGA/41-264RFGRLAVATVMLPVAGFLFCVIWSLLYN.FEQANATHCLVYN..................FLPSLSAAIGNY--------
Q4E2S1_TRYCC/9-251RSSYAALIYAIIVGTGILFTLFVGIWKH.HDELLYTHCRVPE..................YWPSISTLTGDF--------
Q9XWR3_CAEEL/44-269PVE.VFLAGFIPPMFGSISAIAIALIFH.NDEISNYNWQCGRA.................RLPSLSR.IINL--------
Q2UMD7_ASPOR/5-224SFWIFPVISAFMWIAMLLAMLGSWAVQGTPV.YSSME.EGQT...................IAYISD.IGAQ--------
Q16JU8_AEDAE/31-253RFGKLAVITVLFPVVGFLFCVVWSLLYN.FDQANATHCMVYN..................FLPSLSAAIGNY--------
O77262_DROME/3-230QVYLLPVLTFLIFQVTFLGTYIFAVLEG.HVVPT...........................VPYISD.AATY--------
Q559G4_DICDI/11-218PFYILCIISLIVPI.TFITTYAITEVRG.DDDQI...........................IPYISD.TIDF--------
A1CK70_ASPCL/15-225NGKWVSWTHTIVAYTAFLSALVVGMSLH.FHKIVQNEHYGYPQ................EWFPSVSATIGDR--------
A2FGB6_TRIVA/10-214F...LYYFGSIFPFTIVIISWICYYSLG.HYTKGK..........................IPYISD.TVVK--------
Q54J51_DICDI/6-269SASLLPLSYGIIAMGSFITTLFLACYLH.FERVTKNHCKMYE..................FLPSISSTIGDF--------
A8X4A4_CAEBR/10-248GFGPVPTFIGLIFAVQMIIVYVIAVLKK.DVDAV...........................LPYISS.AANK--------
Q93319_CAEEL/9-241GFGPLPVLIALIFFVQSFFVYTIAVLKH.DVDPI...........................FPYLSS.AADK--------
Q17MC8_AEDAE/70-299SFRDICVFTLVLPLGTLFVCFVSAYVFQ.PEEIHETHCRVYN..................VIPSISA.ITGV--------
T150B_HUMAN/4-206YLSLMPVFLAVWAISGVWIVFAIAVTNR.TVDLSKG.........................FPYISI.CGSF--------
Q6CDS5_YARLI/4-220FLWIVPLFACVVWWGMLIALLAAWAAQGKPI.YDFMDPDDK....................VAYISD.VGAT--------
DRAM2_MOUSE/7-233GLSFLPSALVIWTFATFIFSYITAITLH.HVDPA...........................LPYISD.TGTI--------
Q4PDK8_USTMA/9-236LFYLLPIATFACWTTAIVGLLVIWAVRDRFREYES...EEAS...................VVFISD.VGAQ--------
Q01D47_OSTTA/14-220AST.LVRCACLGTLACLVIAYGFATTQS.RIASDA..........................FPIISE.TFMG--------
T150C_BOVIN/8-218VWMFLPLVFTVFTSAGLWIVYFIAVEDD.KIFPLNSAERKPGV................KHAPYISI.AGDE--------
A5DS39_LODEL/32-242NAKWISFAHTFLASLSFLAALVVGVYLH.YHKIVENASFGYPD................EWMPSVSATIGDR--------
A7S3L1_NEMVE/7-240SFALLPALLAILSISTFILTYTVSLVED.DVSPW...........................FPSISQ.TGDK--------
PGAP2_DROME/19-240PFARLALVALSLPLGGFFFCVIWSLTFD.FVRSTYTHCDVTN..................YLPSVSAAIGNY--------
DRAM1_MOUSE/7-226GMAFVPFLLVTWSSAAFIISYVVAVLSG.HVNPF...........................LPYISD.TGTT--------
Q6BKM3_DEBHA/21-231NASLIAYAHGIFAYSAFLAALVVGCWLH.YHKIVENSSFGYPD................EWFPSVSATIGDR--------
A3GGF7_PICST/12-243HYYLIPVVALVVWWGMLVALLVAWYIQGTPK.YSFMK.HNQS...................PAYISD.IGAT--------
A5E3J3_LODEL/22-254HYYLIPIIALIVWWGMLIAMLACWGAQGRPI.YKFMNGDYQN...................PVYLSD.IGAT--------
Q22Y36_TETTS/100-306VSMMVNISCYLAAF.AIFITYVVACSLG.HQQW............................FPCMITSAGTD--------
A7RFU0_NEMVE/9-235GCGYLPLFWCLFTCFTFVLCYAIAVNTG.HIYPF...........................VPAISD.TGAQ--------
A7RNE7_NEMVE/10-236RGSSVIALACALPFGSFVICILLSIFLH.WDQVTKTHCNVPN..................YVPSISAATGDF--------
Q6CTH9_KLULA/8-279YWFIFPWIAFIPWYGMLIAMLACWAGQGHPI.YWFMH.TDQF...................PVYISH.IGAT--------
Q5AF82_CANAL/13-246HYYLIPIIALIVWWGMLIAMLSCWGAQGRPI.YSFMNGEYQN...................PVYISD.IGAT--------
E9ADF4_LEIMA/115-359PSSYAALIYALTTGYALFACLYMAGVLH.WRDIIVTSCGEDHY................EFWPSISATVGEM--------
SFK1_SCHPO/21-232FFILFPLVSFLMWTIGLIVLLGLWSTQD.KWHTPSEPD.......................PVYLSD.MGAY--------
Q9VPT6_DROME/29-248VGPILALGLLQLPV.CMVYNLVMAITTD.FQSTTYTTCNAFN..................IFPSTSA...AA--------
A7SJV3_NEMVE/4-240FVRWLPAISCSLLLTSIVVSYSCAVALG.QVHPL...........................FPKISL.TAAY--------
T150B_DANRE/3-204AWALLPVFLAVFGTVGLWAVYAIAVSNN.SVNITIE.........................FPYIST.CGAY--------
A4RTY8_OSTLU/13-222ASA.LVRVACASTVACIVTTYAFATSQS.AIATNV..........................FPIISE.TFTG--------
T150B_MOUSE/4-207YLSLLPVILFLWAIAGIWIVFAIAVVNG.SVDLNEG.........................FPFISI.CGSY--------
Q3V5H7_CAEEL/25-251TTL.LFWVGFVPPLFAAVFAILTAIILH.QDKITNYAWICGRA.................FLPSLSR.IINL--------
Q6C3N0_YARLI/30-239NGKYVGWAHTIVAMSAFLGALIIGCALH.YKKIVQNEHFGYPD................EWFPSVSAAIGDR--------
T150B_XENTR/4-203.WALLPICLTIWATAGIWIVYGMSVSNG.SVNLTDG.........................FPFISL.CGTY--------
F1R7U0_DANRE/9-235.LCVLPVALVVWTAATFIFAYITAVVLR.HVDPL...........................VPYISD.TGTV--------
H0YDZ3_HUMAN/110-331.FTAMVWWAITFPVFGFFFCIIWSLVFH.FEYTVATDCGVPN..................YLPSVSSAIGGE--------
H3CLF5_TETNG/33-253.FTSFAVGTVLLPLTGLIACLFISLVYH.FEDATYTHCHVSN..................YLPSISA.AISR--------
H3D1L8_TETNG/4-231.WIVLPVSLSAFSITGIWIVYAMAVMNH.HVCPVENWSYNLTCTKELPRPGFPKSCCTIQDIPLISK.CGSY--------
SFK1_YEAST/10-286WLFIVPWIAFIPWYGMLIAMLICWASQGHPI.YWFMH.SEQF...................PVYISD.IGAT--------
Q1K6P7_NEUCR/10-223...IFPIISGVVWLGTLLGLLIYWCTDENRRHYASMD.ARQT...................IAYISD.VGAS--------
T150A_XENTR/4-231.WIVLPISLTVFSIPGIWIVYAMAVMNH.HVCPVENWTYNLTCTDDNTKAGTPKSCCTLEDVPLISK.CGTY--------
DRAM1_XENTR/10-226..AFLPSILVIWSSAGFLFSYIISVLIG.HVPPF...........................VPYISD.TGTS--------
Q5KJS6_CRYNJ/27-255.YVLFPIAAALTWLGGILALLGLWVVAG.KPRYRSN...EAS...................VVFISN.VGAT--------
PGP2L_DROME/75-300.FHELCVVTALLPLVTLFTCFVTAYVFQ.YDDVHETHCRVYN..................IIPSISA.ITGV--------

PF06197

B5HBV4_STRPR/2-171------VLVGGW......TVAALLQGPA-Y.DPA---------------------------TQTISVLAAYG........
Q6L2X2_PICTO/12-188------GITIIFIWIV..IMASAIV.NP-WFSIT---------------------------KNALSDLGGGNLINNGHPA
Q9HJI2_THEAC/17-194------SIAIASAWIT..ILISALL.NP-WFSVT---------------------------HNALSDLGGGNLLQNGHPA
A8MCR4_CALMQ/13-182------IAAAVLAWVI..ILTSISL.NP-WFNMF---------------------------SNALSDLGNPH........
Q970R2_SULTO/9-177------FISAILAWII..IFASISL.NP-WFNFT---------------------------KNAFSDLGGPF........
A1RZ19_THEPD/13-186------PLAFAAFPVV..VYFSASS.NP-WWSLY---------------------------KHAFSDLGGPR........
Q9Y8U9_AERPE/10-184------PAAALVAWLV..IGVSWAVNSD-WFVFT---------------------------EHAFSDLGGVK........
Q5JHD7_THEKO/10-182------LIAPLVAYSG..ILTAIYVNRS-WWRLT---------------------------DNAISDLGKLG........
Q8U4E0_PYRFU/10-182------IIGPIIAYLG..ILSAIYVQRS-WWRLT---------------------------ENAISDLGKIG........
Q9HK23_THEAC/11-184------VIGPVITILF..ILIDVAVSPW-F.SWS---------------------------RNALSDLGV..........
A2BLJ9_HYPBU/14-183------VAGPLIPLAG..IAVAATLASG-WWSFW---------------------------DNAFSDLGNPRY......D
Q8ZU94_PYRAE/9-176------TIGSLQFLIS..MAAAERLYPG-Y.DPL---------------------------RNYISDLGSLN........
Q5V2H6_HALMA/24-206------TLAGFIGFMG..IITAEVLYPN-Y..ST---------------------------RQDISDLGSTRPPN.PVIH
Q8DVX1_STRMU/11-196------ILCLVLYFYC..MVILHLKNKG-VYHPM---------------------------THAVSDYGI..........
A9KKH9_CLOPH/12-200------MIGVLSFLLL..DVFGKILWPE-Y.NPI---------------------------TTYVSKLVTDE........
Q21FK4_SACD2/11-194------VLAAFWIVMG..VAIAGARYPG-Y.SHL---------------------------RQLCSELGAAG.......S
D1CAZ9_SPHTD/27-219------IAGSAWWVAI..DMVGSIRYPG-Y.SYA---------------------------DQVVSELSAEG.......A
A0JTJ1_ARTS2/34-213------ALSSLLYVIA.TDGLAASMWDG-Y.RRT---------------------------EQMVSELFAVG........
D9QLM9_BRESC/12-196------LLGEGIQLAA..IVIGGALYPG-Y.DHL---------------------------RQYISELGATGAV....TG
A4AMV1_MARSH/11-200------SVGVFLFIIA..AIIGGLQIEG-Y.SHI---------------------------SQYISESYANG.......L
Q28UV2_JANSC/25-202------IIGCIIGILG..VIVAQAMVPG-H.DWI---------------------------ADTISDLGA..........
A8LJU0_DINSH/25-202------VIGVGALLTG..TVIGPLFVPA-H.DPM---------------------------ADTISDLAA..........
D9QK37_BRESC/20-202------VAAPVVALVA..VLIAAAAYAG-F.DHA---------------------------RQYLSELGGAT........
Q0W5U1_UNCMA/16-197------MAATAAFVLF..TLIAVYLYPG-PFSPL---------------------------ESTVSHLGNPSA......N
C5BVW0_BEUC1/45-235------VVVGPFYVVV..SLAQALTRDG-F.DLS---------------------------RHALSQLAL..........
D3Q5U6_STANL/20-208------AIGGPLFSLV..VVAQELTRPG-F.DPK---------------------------VNALSQLST..........
D2B9K9_STRRD/15-199------VIATPLFFTV..AFAQAFSRDG-F.DLS---------------------------RHMLSQLAM..........
D7AZL9_NOCDD/27-217------ALAAPLWAAV..SLAQAAAREG-F.DLT---------------------------RHPLSALST..........
D2AS92_STRRD/33-219------IAAGPLFLAV..GVIQGLTREG-F.DFT---------------------------RNAISQLSL..........
D2PMS1_KRIFD/36-226------VLAGPLNLVV..VTAQALTRDG-F.DPR---------------------------KHAGSMLTL..........
C8XD39_NAKMY/31-221------VIAGPFYVAV..ALAQALTRHG-F.ELS---------------------------RHSWSLLAN..........
D2B4R9_STRRD/12-208------AVAGPLFIVL..VLIQDYTRPG-F.DPR---------------------------RQPLSLLSL..........
C8XD67_NAKMY/16-200------VVAGPLFVGV..TAAGVLTRDG-F.DLR---------------------------RHGISLLSL..........
A7HVR6_PARL1/16-206------IVAGLLFFVV..PTILVFTRPG-F.DIE---------------------------RHAISMLSL..........
D3PXJ2_STANL/16-212------VVGPLLLLLV..ILADGATRPG-Y.SPW---------------------------SHGVSQLTQ..........
C5BVM4_BEUC1/10-201------AVGAVLFVVV..FTVDGATRPG-Y.RPA---------------------------EHAVSALAL..........
D3Q1F0_STANL/29-225------IVAGPLFLAV..AIVAGFTRED-Y.DPA---------------------------RHPVSSLSI..........
A4F7D5_SACEN/16-207------LAGAVLFVVV..FLVAGALRPG-Y.SAL---------------------------RHPVSSLAL..........
B8GH43_METPE/42-235------MAGSMLFAGA..FTIEGWFHPG-Y.NPL---------------------------SMYVSVLSL..........
Q9RJS0_STRCO/12-187------SGCAPVLLIAGWTGAAYAEGAS-Y.DPV---------------------------SQTISVLGAYG........
B1VPM0_STRGG/12-188------SGCAPVLLVGSWMIAQTRQGPE-Y.DPA---------------------------RQTLSVLASYG........
D9T5P6_MICAI/28-216------AAAAPALLVAGWTVAGARQGPG-Y.DPV---------------------------RDTISELAGEG........
Q0RZC5_RHOSR/71-245------AALSPVILVVTATAARWMQPPG-Y.SPL---------------------------GQTLSTLAAH.........
C0ZQ51_RHOE4/26-217------VIVSIVLFLS..LDVHAIVTTG-..SRL---------------------------EPTISAHGL..........
C8X6V7_NAKMY/31-224------LLGPLVAAALVGALHVLPETEA-I.SPI---------------------------RRTISEYAL..........
D3Q1Z4_STANL/35-216------LVAGILTMAI..LIAMHVIMAD-QVRVN---------------------------IDPVSVFAIN.........
D3Q759_STANL/3-179------IAGVVLAAAS..FVFMFVAMPE-V.DFL---------------------------RHPVSIYENKQ.......P
D2AUN0_STRRD/12-196------MAGAAAAAAS..TACAHVAAAG-AVDPM---------------------------KSLTSDYALL.........
D2B0Y0_STRRD/13-197------CAGIVIAAVA..TVIGQIDPDP-YLDPL---------------------------NLTISEYAA..........
C6W8D5_ACTMD/12-195------VAALVVSPFP..VVYLHLSSGG-TISPV---------------------------QNTISDYVSV.........
C8XCN7_NAKMY/38-227------LAGAVASVPP..IAALHLDAPS-GTSMA---------------------------RTTISDVVVTT........
D3EGW1_GEOS4/23-212------IFSGALFVLL..LCSLHLLQPE-F.DPT---------------------------WRFISEYAL..........
C8XKD4_NAKMY/21-199------ACTALGWLLW..VALQVLTDDP-F..PP---------------------------EISVSQYGL..........
D9SXQ4_MICAI/13-198------FAAVCLAAGAAAVTVAVIAGPG-..PGP---------------------------IAYVSEAGI..........
Q0SAA4_RHOSR/13-214------LILGAIGYAS..WLLEFVLDTG-I.DPL---------------------------RGYASELAAAD.......Q
D3Q0C1_STANL/5-190------LLASGVVYAS..WLLGGWVNPG-L.GPV---------------------------VSYASELAASD.......Q
D0L9X9_GORB4/20-220------IAAAGICYSS..WVLEFLWPSP-L.DPF---------------------------RSFLSELDAQH.......C
Q5Z3B7_NOCFA/14-211------IAVAGLSYSA..WVLQFVLPVH-A.DPV---------------------------HSFLSELDAEG.......K
C0ZM54_RHOE4/15-215------LALGGIVYSS..WILEFFLDTG-L.DPV---------------------------TSFLSELDAEN.......Q
D5UPX7_TSUPD/8-215------IIAGAIFYSA..WIFAPTMGSR-L.NGL---------------------------RSYVSEVAA..........
C6W9M9_ACTMD/22-202------LVAAAVLYAC..WLLELVLPTG-L.SVV---------------------------DGYVSELLADD........
D2B4U0_STRRD/15-212------FVIAGLCYSA..WLPAQFLNPG-I.GGP---------------------------DAYVSELAA..........
Q6NEW9_CORDI/11-191------VVASLTYASF..VWEIALGFPL-..DPH---------------------------RAYLSEYAAAD........
C5C1J0_BEUC1/20-217------VVAALAAVFQANFLLDWVLRGG-..DGM---------------------------QYIVSQLAAPG........
D9TA17_MICAI/14-189------..GIVLAAVL..AMVGHLEVSD-DLDPW---------------------------SLTVSDFAV..........
G8PFH7_PSEUV/15-189------...YLWLVTT..VAIGAQFYPG-Y.SHI---------------------------SHFMSVLGATG.......A
Q6A8J6_PROAC/18-214------.VLASLASLT..WAFAGVLNPA-M.SQL---------------------------HAFVSEYSARD........
Q833X7_ENTFA/13-203------VLGVLLDFFT..PYYVGFKDQG-Y.NQL---------------------------TEVISLLGDVN........
Q9PBG9_XYLFA/13-195------.IAAALFTAS..VTGFALALPG-Y.QHL---------------------------LHPVALLGAPG.......I

PF10277

Q7QE61_ANOGA/3-230SPESCVF--GQFINIGCVLLGI---TIYVRYRQ...............................................
Q757Q5_ASHGO/5-206YPERSLF--QVLIAVTAFPRFL---LLLMHWVR...............................................
Q75DE7_ASHGO/9-286NLQPLFV--TCVAWQGLWYCIM---VACEFFQRSGHWPLPWLARQRLPADVEPVSSSSYMGSELSMRVRYAELLSSSRFL
Q4WNE6_ASPFU/5-224GLKPLFI--TGSVITVVFLDLS---FVSERWLRHS...........................................GQ
PGAP2_CAEBR/12-239TPEKYIW--RILIGLHIGPRLV---VAVAFRNF...............................................
A5DLG3_PICGU/121-352NLQPLFI--SCAGFQAIFFVGS---LIMDFVLRKK...........................................HK
A5DAL2_PICGU/21-231YPERSLF--QVLIAVTSGPRFL---LLALNYFI...............................................
CWH43_SCHPO/11-220YPERSVF--QWLIALTATPRLL---VLLLWFTL...............................................
A8WTJ4_CAEBR/43-270SPQKYIW--MMIMFIHLPPRLA---FLTLYRRL...............................................
Q7S513_NEUCR/18-228YPERSIF--MIFIAITSGPRFA---LVGLWYLL...............................................
Q4PAD1_USTMA/365-592YPERNIF--QVGIALMAGPRFA---LVLLSALL...............................................
Q5RGJ7_DANRE/7-226PPESCVF--GFMSTITAFAAFA---TMYAEYKF...............................................
Q6FIN1_CANGA/8-284NLRPLFI--ACAGWQGLGYVIT---IACEYFQRAGRWPFRMPNSKSPHVEA...........EYDNVSSYTERLLHSRLL
T150B_BOVIN/4-207PPQSCIF--SQVLNIGAASAAW---ICILRYYQ...............................................
T150A_MOUSE/3-232PPESCLF--SLIGNMGAVMVAL---ICLLRYGQ...............................................
A7TMD9_VANPO/12-290NLQPLFI--SCSGWQGLGYVIS---IACEFFQRSGHWPFRLRSKKYLKSTVDEDC..DTMMTNDEMKSEYAEIMLKSNFY
Q6FKB5_CANGA/8-272NLRPLFI--SCAGWQGLGYVIT---VACEFFQRSGHWPGFLRSSSNKD................YSKVEYHETILSKKYF
Q7PN15_ANOGA/41-264QPQRFVW--QFSVLFHAPFRYA---IAFLYKNH...............................................
Q4E2S1_TRYCC/9-251QPERQIW--RAAFVLCTPFRLG---VTISLLLV...............................................
Q9XWR3_CAEEL/44-269PVERTFW--QLFLLFHVPIRVV---ELITGFSR...............................................
Q2UMD7_ASPOR/5-224GLKPLFI--TGSVITVVFLDLS---FISERWLRHA...........................................GQ
Q16JU8_AEDAE/31-253QPQRFVW--QASVLVHALPRYA---IAFLYKNF...............................................
O77262_DROME/3-230SPESCVF--GQLINIGSVLLGI---TIYVRYRQ...............................................
Q559G4_DICDI/11-218APESCIG--TFGLSIIAFLMII---VVFIKHLI...............................................
A1CK70_ASPCL/15-225YPERSFF--QVFIAITSGPRFA---LVFLWYIL...............................................
A2FGB6_TRIVA/10-214LPQRRIF--AAGMSIEGWFIIL---IFYLRISY...............................................
Q54J51_DICDI/6-269SPEMNVY--RYGMALTSGLRLG---TIYLNHHVST...........................................EE
A8X4A4_CAEBR/10-248QPQSCIF--AMGANISSLLIAV---MVHVRQTQ...............................................
Q93319_CAEEL/9-241RPQSCIF--AIGANISSVLLAL---VVFVRYRQ...............................................
Q17MC8_AEDAE/70-299SPQRYLW--RISIALHIGPRII---IAFVYKNY...............................................
T150B_HUMAN/4-206PPQSCIF--SQVLNMGAALAAW---ICIVRYHQ...............................................
Q6CDS5_YARLI/4-220SLKPVFI--ACAATQGGLFMFA---LIFERWMRHK...........................................GR
DRAM2_MOUSE/7-233PPERCLF--GVMLNIAAVLGIA---TMYVRYKQ...............................................
Q4PDK8_USTMA/9-236H.KTFFI--IFCSCTAGFYILT---TLAERHLRHQ...........................................RR
Q01D47_OSTTA/14-220TPQSYAS--EFLLGFAAWTLML---SVWAFKGY...............................................
T150C_BOVIN/8-218PPASCVF--SQVMNMAAFLALV---VAVLRFIQ...............................................
A5DS39_LODEL/32-242YPERNVF--QIIIALTAGPRFA---LLALNFIT...............................................
A7S3L1_NEMVE/7-240VPESNIF--SQLFNICSFVFVL---TLFVRFLQ...............................................
PGAP2_DROME/19-240EPQKTVW--RLAIFLHLPLRLA---VAKIYLEH...............................................
DRAM1_MOUSE/7-226PPESGIF--GFMINFSAFLGAA---TMYTRYKI...............................................
Q6BKM3_DEBHA/21-231YPERSIF--QILIAVTSGPRFL---LLLFNFIR...............................................
A3GGF7_PICST/12-243NLKPLFI--SCAGFQGIFFMWT---LIMEYYLRTH...........................................RK
A5E3J3_LODEL/22-254NLQPLFI--SCAGFQGIFFVGT---LVVGMYLRKK...........................................HK
Q22Y36_TETTS/100-306YPENIFF--RIGLLTNIFYWLI---MLVFQYWW...............................................
A7RFU0_NEMVE/9-235VPEANVF--SQLFNFSCLLLVA---NMFVRYLQ...............................................
A7RNE7_NEMVE/10-236SPEKYIW--RIGIAYHSLLRMV---FPFVNYNF...............................................
Q6CTH9_KLULA/8-279NLKPLFI--SCAAWQGLGYVIM---VALEYFQRSGHWPFKLPYTYHDDLEKS........NDSSIMESNYIEALIQKKYV
Q5AF82_CANAL/13-246NLQPLFI--SCSGFQAIFFVGT---LIMGFYLRYK..........................................SGK
E9ADF4_LEIMA/115-359MPERQTW--RVAFTLCVPFRVS---ASMSLFNV...............................................
SFK1_SCHPO/21-232T.KGFFI--PMCVITGVFYFLT---FIMIRLARQW...........................................GW
Q9VPT6_DROME/29-248KSQHKVW--ALACYLEFPFLIA---SAWLQFRF...............................................
A7SJV3_NEMVE/4-240EPGGSIF--SLVLILDVIATLL---LISLYHLH...............................................
T150B_DANRE/3-204TPQSCLF--AQICNICCVLALW---IVVIRFQQ...............................................
A4RTY8_OSTLU/13-222TPQSAVS--EFALGFASWVLFF---MVAVVKVY...............................................
T150B_MOUSE/4-207APQSCIF--GQVLNIGAALTVW---ICIVRHHQ...............................................
Q3V5H7_CAEEL/25-251TLEGLVW--QLCIFFHIPFRLL---ELSVGWVR...............................................
Q6C3N0_YARLI/30-239YPERSVF--QVFIAITSGPRFA---LVILWFLL...............................................
T150B_XENTR/4-203PPQSCVF--GQVLNVGAMLGVW---ISVIRFQQ...............................................
F1R7U0_DANRE/9-235APERCVF--GVMLNVSAFLGVA---TMYVRYKQ...............................................
H0YDZ3_HUMAN/110-331VPQRYVW--RFCIGLHSAPRFL---VAFAYWNH...............................................
H3CLF5_TETNG/33-253VPERYIW--RCCVGLHSAPRYL---VAAAYFNF...............................................
H3D1L8_TETNG/4-231PPESCLF--SLIGNVGAFMVVM---VCLLRYAQ...............................................
SFK1_YEAST/10-286NLRPLFI--SCAGWQGLGYVIT---VALEFFQRSGYLPFQLKKKDPSI................SDSTSYAEKLHSGKYL
Q1K6P7_NEUCR/10-223TLKPLFI--AGCSVTTVFLDLS---FGADRWLRHK...........................................GR
T150A_XENTR/4-231PPESCLF--SLIGNVGAFMVVI---ICLLRYSQ...............................................
DRAM1_XENTR/10-226PPESGVF--GFMISLSAMLGAA---TMYTRYKI...............................................
Q5KJS6_CRYNJ/27-255H.QALFI--AICCTVAAFYIIS---MFAERWLRHV...........................................DR
PGP2L_DROME/75-300SPQRYFW--RFSIALHIGPRIP---IAFVYKNY...............................................

PF06197

B5HBV4_STRPR/2-171AAGFWVM..TGALLTLGLCHLF...TAWGL...-----------------------------------------------
Q6L2X2_PICTO/12-188PALPEIY..NFGLIIEGILIAL...LSSLFILF-----------------------------------------------
Q9HJI2_THEAC/17-194PTDPFVY..NGGMILTGVFIAL...FSVDGIIN-----------------------------------------------
A8MCR4_CALMQ/13-182ANYYWLY..NYGLVLTATLMLL...FSLYLLFV-----------------------------------------------
Q970R2_SULTO/9-177AKDPWLY..NYGLIVVSLFAFL...YAVFLAKV-----------------------------------------------
A1RZ19_THEPD/13-186AANPWIF..NYGLMAMGLLVVV...YSFGVLLA-----------------------------------------------
Q9Y8U9_AERPE/10-184ARMPWIY..NYGLILVGLLVTL...YSLCPYRA-----------------------------------------------
Q5JHD7_THEKO/10-182LPHNWLL..NVPLVITAVLAIY...YALGVLDM-----------------------------------------------
Q8U4E0_PYRFU/10-182LQYNWLL..NVPLVLTAALMIY...YGLGLLSH-----------------------------------------------
Q9HK23_THEAC/11-184HPYGYLF..NSGLIIEGVLNIA...FVISL...-----------------------------------------------
A2BLJ9_HYPBU/14-183PVTAIVF..NSALYTGAVLITV...YAVL....-----------------------------------------------
Q8ZU94_PYRAE/9-176APTSTLF..NTSVFLLGLLGLL...SAYLL...-----------------------------------------------
Q5V2H6_HALMA/24-206EPSATIF..NTTMLVTGAMVLL...SAYFL...-----------------------------------------------
Q8DVX1_STRMU/11-196GQNKSYF..QLAGLANTFRNLFL.ILSLIFWK.-----------------------------------------------
A9KKH9_CLOPH/12-200APHVHLM..RFFLNTYTVCFLL...FSLGMTIL-----------------------------------------------
Q21FK4_SACD2/11-194PTEKFSP..LINNYPLGILFCV...FGGYVLYV-----------------------------------------------
D1CAZ9_SPHTD/27-219PTRTFMQ..VFSGIPYAALLTA...FGIGIWRA-----------------------------------------------
A0JTJ1_ARTS2/34-213SPGRDVL..LPFTWLYTVLFTA...FGVGVWNS-----------------------------------------------
D9QLM9_BRESC/12-196PAVSWLGFVPSGLLITAFCGLAG.WIL......-----------------------------------------------
A4AMV1_MARSH/11-200PDSQYL...RYAFILSGICFAI...FGFLMPFV-----------------------------------------------
Q28UV2_JANSC/25-202GENEIIM..DVALYAFAAGIFA...VALCAAHT-----------------------------------------------
A8LJU0_DINSH/25-202GRGEIIM..DVALYGFAAGLFA...LALACAHV-----------------------------------------------
D9QK37_BRESC/20-202AAHPWIF..NAGVLTAGVMTGFA.GLGFGLAVV-----------------------------------------------
Q0W5U1_UNCMA/16-197PDGHLVF..DAGCMVGGVLFLPF.VASLAFLRT-----------------------------------------------
C5BVW0_BEUC1/45-235GPGGWVQ..TVNLALSGLMVVA...AGIGIARA-----------------------------------------------
D3Q5U6_STANL/20-208GEGGWLQ..IANFVVAGLLVTA...SAVGIRRT-----------------------------------------------
D2B9K9_STRRD/15-199GDLGWLQ..IANFIVTGTLFMA...AAVGMRRT-----------------------------------------------
D7AZL9_NOCDD/27-217GELGWLQ..ITNFLVAGALTAA...GALGLRRS-----------------------------------------------
D2AS92_STRRD/33-219GDLGWIQ..VTNFVITGALLIA...GAIGTRRA-----------------------------------------------
D2PMS1_KRIFD/36-226GDLGWIQ..SANFVVTGVLVVL...GALGLRR.-----------------------------------------------
C8XD39_NAKMY/31-221GDWGWIQ..VANFILTGLMVIA...FAVGLDRA-----------------------------------------------
D2B4R9_STRRD/12-208GDLGWIQ..IANFVVTGLLYVA...FAVGMRRV-----------------------------------------------
C8XD67_NAKMY/16-200GDRGWIQ..IASFVAAGALSIG...FGVGVRRL-----------------------------------------------
A7HVR6_PARL1/16-206GEGGWMM..KAVFIVSGLFVLA...CAWGIHAE-----------------------------------------------
D3PXJ2_STANL/16-212GDRAGWE..RATYVICGLLVLG...FGGGVGRR-----------------------------------------------
C5BVM4_BEUC1/10-201GPRGWIQ..RWNFVTSGAATAA...GGVGVALA-----------------------------------------------
D3Q1F0_STANL/29-225GPGGWVQ..IANFIVAGLLTLV...FAVRLRAG-----------------------------------------------
A4F7D5_SACEN/16-207GESGRVQ..STSFVATGVLMFA...FAVGV...-----------------------------------------------
B8GH43_METPE/42-235GPSGWIQ..MGNFVISGSLLLI...FAWGIAPE-----------------------------------------------
Q9RJS0_STRCO/12-187AAGFWVM..TAAFLALGVCHLL...TAW.....-----------------------------------------------
B1VPM0_STRGG/12-188ATSYWLM..TGMLLVLGSCYVL...TAH.....-----------------------------------------------
D9T5P6_MICAI/28-216ATDPWLM..GGALVLLGCCYCA...TAA.....-----------------------------------------------
Q0RZC5_RHOSR/71-245GHGHAVM..TAGFLAVACCYVV...TAV.....-----------------------------------------------
C0ZQ51_RHOE4/26-217GGGRWIF..TAAVVLLAAGSAG...FLIALIGR-----------------------------------------------
C8X6V7_NAKMY/31-224TDTAWAF..NVGVVALALGSLA...ILIAT...-----------------------------------------------
D3Q1Z4_STANL/35-216REGVLLF..DLACLSIAVACVA...VLF.....-----------------------------------------------
D3Q759_STANL/3-179GFTGYII..ATAGIAVSCTALA...........-----------------------------------------------
D2AUN0_STRRD/12-196DTSAWAM..AGGTIMLAMGSLW...VAYGLAR.-----------------------------------------------
D2B0Y0_STRRD/13-197LDRGGAT..EFAMATLGVASFA...LVAGLRA.-----------------------------------------------
C6W8D5_ACTMD/12-195SGGTWLL..GFTALALAVGSIA...LLVGMVR.-----------------------------------------------
C8XCN7_NAKMY/38-227PAGEPLFALTAGALAVAGIALV...RAL.....-----------------------------------------------
D3EGW1_GEOS4/23-212GDFGWMM..HLAFGLLALAQIS...VAITIFPH-----------------------------------------------
C8XKD4_NAKMY/21-199GPTGWVF..TVWAVALGAAPLL...LL......-----------------------------------------------
D9SXQ4_MICAI/13-198TDSGYAGAYRLGIFSVAASLLL...LAG.....-----------------------------------------------
Q0SAA4_RHOSR/13-214PYGIWFR..TGDLLTGCIVAVA...GVLGLSRY-----------------------------------------------
D3Q0C1_STANL/5-190PGSLAFR..IGDLVAGAAACVA......GLW..-----------------------------------------------
D0L9X9_GORB4/20-220PHREVYV..AGDVTTSVCALIA...GAVALIPR-----------------------------------------------
Q5Z3B7_NOCFA/14-211PYRTVFA..AGDVLTGALLIPA...GLAGLLLF-----------------------------------------------
C0ZM54_RHOE4/15-215KYRDVFG..NADVLSAILMLIS...GALGLLIT-----------------------------------------------
D5UPX7_TSUPD/8-215TGQPYAHFFRGTDLLAGTCFVV...GAALWWR.-----------------------------------------------
C6W9M9_ACTMD/22-202QPHRWLF.RATDSLAACCVLLA...........-----------------------------------------------
D2B4U0_STRRD/15-212ADQPWSWLVRAADVVAGIACLA....AVALVPD-----------------------------------------------
Q6NEW9_CORDI/11-191SPHRTLF..AATDLITAVLVLV...ALLCLWRL-----------------------------------------------
C5C1J0_BEUC1/20-217QPNATLL..RATDVACAVLVLV...LVVPVRRA-----------------------------------------------
D9TA17_MICAI/14-189SDRGGVI..DTAMAVLAAASLV...LLPSL...-----------------------------------------------
G8PFH7_PSEUV/15-189PHGPTVN..FWGFLAVELLLLP...SFIICFSD-----------------------------------------------
Q6A8J6_PROAC/18-214QPWRYLF..QTTDVIMGTLLCLA.GLATLVWAR-----------------------------------------------
Q833X7_ENTFA/13-203SPVRENF..NRLTIIAGMLMLASLPRIYAIFSR-----------------------------------------------
Q9PBG9_XYLFA/13-195PNANAFN..LFGFLLPGLLAAV...LATYLMTR-----------------------------------------------

PF10277

Q7QE61_ANOGA/3-230IQELSFRHSDVRQA............LGRCSGIGFWIGIGSC.LG-ISIVG--NF......QETNVR.I-----------
Q757Q5_ASHGO/5-206S............................RSALGVMAGFTRT.MT-CGGWV--YI......TSSDDH.D-----------
Q75DE7_ASHGO/9-286MPPYYTKHERN..................LIFASFVLGLIGE.LA-ILMCA--IF......STAKFH.K-----------
Q4WNE6_ASPFU/5-224LVPNKGWFDKF..................CAVASIFFAVAGA.LG-LILLA--CY......DTLRHP.H-----------
PGAP2_CAEBR/12-239LMSSPLRPYTGSKQ............FKFLCNIACGLNLLEN.FF-LLALT--SI......SSSEDH.S-----------
A5DLG3_PICGU/121-352LQPFVSKRQPK..................LAIASIVCAIIGQ.LG-ILFVA--IF......NTNAFH.R-----------
A5DAL2_PICGU/21-231CAENGPL......................LATIGVVCGIMRT.FT-CGGWV--YI......TSTDDH.D-----------
CWH43_SCHPO/11-220SGISRP.......................SVIITTALGVLRT.AL-CGGWV--YV......TSTDDH.D-----------
A8WTJ4_CAEBR/43-270FLISAPKSQWYS................RINYIYMLTLWAEP.FG-LILVS--VV......DINGGF.I-----------
Q7S513_NEUCR/18-228TAKPGRV......................LPKAIAISGVIRT.LT-CGGWT--YI......TSTDDH.D-----------
Q4PAD1_USTMA/365-592VSLSTPIPSP...................KASILLCVGVLRT.LA-CGGWV--YV......TSTDDH.L-----------
Q5RGJ7_DANRE/7-226VERVHERTGAVP...............PTLNKVSFGFGIFSC.IG-MCLVA--TF......QETTVM.E-----------
Q6FIN1_CANGA/8-284MPPYYTKHERN..................LIFASFVLGCIGE.IA-LLMCS--IF......STAKYH.H-----------
T150B_BOVIN/4-207LRDWGVRKW....................HNQVILWTGLLCA.LG-TSIVG--NF......QEKNQR.A-----------
T150A_MOUSE/3-232LLEQSRHSW....................INTTALITGCTNA.AG-LVVVG--NF......QVDHAK.S-----------
A7TMD9_VANPO/12-290MPPWYTVHDRN..................FIFAAFIFGLLGE.VC-LLMAS--IF......STAHYH.H-----------
Q6FKB5_CANGA/8-272MPPYYTRHERN..................LIFAAVILGGLGE.VA-LLMCT--IF......STALYH.H-----------
Q7PN15_ANOGA/41-264HLTLLSRKHRK.................EWAYLACILNIVEL.SS-LVGLS--LW......TSSNNY.E-----------
Q4E2S1_TRYCC/9-251FWQRACGGMSELSSMRRSP.ISLVRSSAFLTLAIFSFDITRL.LG-ALTWT--MI......SSIENL.D-----------
Q9XWR3_CAEEL/44-269YKRMRNVNYKRVWL............YELSRYLYFVVGLLEL.IF-LSGLS--II......GERENI.Q-----------
Q2UMD7_ASPOR/5-224LVPNKGRFDKA..................CAVLSIFFSIAGA.LG-LILLS--IF......DTVRHP.H-----------
Q16JU8_AEDAE/31-253HIGLLRKRRKE..................LAYLACILNITEL.SS-LVGLT--MW......TSVSNY.D-----------
O77262_DROME/3-230VLQLYEHHPDLDGS............VLRQNRLALWFGLVSC.LG-ISFVG--NF......QETNVR.I-----------
Q559G4_DICDI/11-218IKNNIIEKEYFDDKKE........KKELRFNRFSTSMGFISG.LS-MHGVS--SF......QFHNAN.L-----------
A1CK70_ASPCL/15-225TARPNST......................LPKVVAGVGLFRT.FT-CGGWT--YV......TSTDDH.D-----------
A2FGB6_TRIVA/10-214CSELAHEANVYLTI............SYKIKVFILWILLVCAPIG-LFVLS--AI......TLEMNL.S-----------
Q54J51_DICDI/6-269KNNLLAQSNSGRKSFTSSSVLESVRRLGYLIPMSTVFDTIRV.FS-AGGWI--YI......SSSEHL.F-----------
A8X4A4_CAEBR/10-248IDYVLNTYDDDWRAWK........NKLFCVNTWASLVGYISA.FG-LFIVA--NV......QETAII.P-----------
Q93319_CAEEL/9-241LRGIFAFYDEANL..............QAWNWRQKWFGYIAA.LG-LFFVA--NV......QETAII.P-----------
Q17MC8_AEDAE/70-299YRALIRELNDLAQIK..........KATSLLRIVHGLNIVEI.SA-LCCVT--YV......SNKENY.P-----------
T150B_HUMAN/4-206LRDWGVRRW....................PNQLILWTGLLCA.LG-TSVVG--NF......QEKNQR.P-----------
Q6CDS5_YARLI/4-220LLRNHRQAEKW..................LSVGAIIFGILGQ.VG-IILVS--IF......DTKNHH.S-----------
DRAM2_MOUSE/7-233VHALNPEENLII................KLNKAGLVLGILSC.LG-LSLVA--NF......QKSTLF.I-----------
Q4PDK8_USTMA/9-236IPGSIRKKQTI..................LDICSVICAVIGC.VA-LILLS--VF......DAFNHS.T-----------
Q01D47_OSTTA/14-220LDAYATCEDKWF................TWSRKGLWFGVSSA.IL-LGLTA--AI......NYEESF.G-----------
T150C_BOVIN/8-218LKPKVLNPW....................LNISGLVALCLAS.FG-MTLLG--NF......QLTNDE.E-----------
A5DS39_LODEL/32-242LYKQSSY......................LPYIGLIAGLLRT.FT-AGGWM--YI......TSTDDH.D-----------
A7S3L1_NEMVE/7-240LRHDSDWNEEARPL............LLRLNITSLVFGLLAG.LG-ASLVA--NF......QVDAVT.I-----------
PGAP2_DROME/19-240YREHIRRSRRL..................LGILACFLNVVED.LA-LFCLS--FW......TSADHY.E-----------
DRAM1_MOUSE/7-226VEKQNETCYFST...............PVFNLVSLALGLVGC.IG-MGIVA--NF......QELAVP.V-----------
Q6BKM3_DEBHA/21-231LYKKNSV......................VPYLGLLSGVIRT.FT-CGGWV--YI......TSTDDH.D-----------
A3GGF7_PICST/12-243LQPYVSTKQPK..................FAIVSIVCGFIGQ.LG-ILFVS--IF......DTKRFH.D-----------
A5E3J3_LODEL/22-254IQPYISHHQPR..................LAIASIIMAIIGQ.LG-ILFVS--IF......NTKNFH.S-----------
Q22Y36_TETTS/100-306LRAQSEAMMGVVNV............SKKMNYFAFVGFFF...YG-LTIAT--ID......DGHIPT.Q-----------
A7RFU0_NEMVE/9-235FDLVTKGYDSIELG............FARLNRIAFGFGVVSA.FG-GTIIA--NF......PSQEMV.Y-----------
A7RNE7_NEMVE/10-236YKYKASSNIKSKW.............FPWLNFLNACVTVVEN.LA-LVLLT--YV......SSSENY.S-----------
Q6CTH9_KLULA/8-279MPPFFTKHERN..................LVWASFVLGSIGE.LA-LLMCT--IF......STNTYP.R-----------
Q5AF82_CANAL/13-246IQPYISKHQPR..................LAIASIICAAIGQ.LG-IVFVA--IF......NTKNFH.P-----------
E9ADF4_LEIMA/115-359FWQRASRGMEDLYSFRRSW.KAFLSSNAFLALLALGTDTWRF.IG-ASVYS--VV......SAKESL.T-----------
SFK1_SCHPO/21-232IYPTGRKVETY..................LGWFAALTGAAAA.SC-LISLS--IR......DDVHHD.N-----------
Q9VPT6_DROME/29-248YRRNLRRPVRG..................FGCLMAIIMAVSS.SS-VLLWG--TF......PQEDGDSL-----------
A7SJV3_NEMVE/4-240VSTIAKEEGL.VA.............WRALNNGALTSGVLLL.FG-VSAVA--TFRYASPTHADRSQ.I-----------
T150B_DANRE/3-204IRDLGRSSH....................LNTAGLVLGFISS.IG-ISILG--NF......QQTIIQ.E-----------
A4RTY8_OSTLU/13-222LDRYATSDARWR................AHGRRSARVGYVAA.IC-LALTA--AI......NYGESF.G-----------
T150B_MOUSE/4-207LRDWGVKTW....................QNQLILWSGILCA.LG-TSIVG--NF......QDKNQK.P-----------
Q3V5H7_CAEEL/25-251YGRLESRANTHRLW............YKMHRHLYLVFGVTEL.IL-LSGLS--AI......GEKEHG.I-----------
Q6C3N0_YARLI/30-239TVAHRPR......................LSMMILISGLMRT.LT-CGGWT--YV......TSTDDH.D-----------
T150B_XENTR/4-203IRDYGCHSV....................LNSVSLAMGLLCA.LG-TSIVG--NF......QQSNQL.E-----------
F1R7U0_DANRE/9-235LQALADVEDTRL...............NRLNVVGFVFGCCSS.FG-MCVVA--NF......QKTTLF.S-----------
H0YDZ3_HUMAN/110-331YLSCTSPCSCYR................PLCRLNFGLNVVEN.LA-LLVLT--YV......SSSEDF.T-----------
H3CLF5_TETNG/33-253YYGRFAKSLPEL................ILSGLALICSLSEN.TG-LLLLT--YV......SSSETY.S-----------
H3D1L8_TETNG/4-231VIEHSHQCW....................VNTSALVSGCTNA.LG-LVMVG--NF......QVDHAK.S-----------
SFK1_YEAST/10-286MPPYYTKDERN..................LIFAAFVLGSIGE.LA-LLFSS--IF......STALYH.R-----------
Q1K6P7_NEUCR/10-223LVPNTTVTEKV..................LSGITIVFAIVGT.CG-LILLS--IF......DTARYP.R-----------
T150A_XENTR/4-231VIEVSQRSW....................LNTTALIAGCTNA.AG-LVMVG--NF......QVDYAK.S-----------
DRAM1_XENTR/10-226LEKQNHSTDFLP...............YYFNKTSLAIGLLGC.IG-MGIVA--TF......QEMAVP.A-----------
Q5KJS6_CRYNJ/27-255LPTNIRRRELV..................FDWLAIFWCIVGC.VG-LILLS--CF......NAFTHG.T-----------
PGP2L_DROME/75-300YRSQLRRISPAQVP...........QTSLLITLILVLNCIEI.AS-LGGVT--YI......SNRENY.P-----------

PF06197

B5HBV4_STRPR/2-171......RAAAP------------------AGRLALG...GGG-VA.AFGVV..LI------PAPSSGGSL..........
Q6L2X2_PICTO/12-188....SENKIED------------------AGSSFFI...ISG-LF.LALIG..IY------HEGTY..............
Q9HJI2_THEAC/17-194....AQDKVEN------------------AGFSFFI...ISG-LF.LCLIG..IY------HEGTY..............
A8MCR4_CALMQ/13-182....SENKVEA------------------MGSSFVT...IAS-IF.LALIG..IF------HEGTY..............
Q970R2_SULTO/9-177....NGNKILI------------------IGSAFVM...VAA-IF.LALIG..IY------HEGTY..............
A1RZ19_THEPD/13-186....SKTKYES------------------FAAGLLF...VAG-VF.LFLIG..YY------PSGTK..............
Q9Y8U9_AERPE/10-184....AVERLEA------------------FGSGLLL...TAG-LF.LALIG..VY------PAGTR..............
Q5JHD7_THEKO/10-182....ARNSVEK------------------AGIWVLI...AGF-VF.LALIG..IF------PEGTS..............
Q8U4E0_PYRFU/10-182....LTTKIER------------------IGGAIFI...LGV-IF.LALIG..IF------PEGTS..............
Q9HK23_THEAC/11-184....KRIRTAG------------------YVQALMI...VSG-LA.LALVG..VF------NEHFGY.............
A2BLJ9_HYPBU/14-183....CIPRAGG------------------LEAVLLA...LVG-FT.LGLVA..VF------DETYGH.............
Q8ZU94_PYRAE/9-176.....RREIGR------------------ISAVLLA...LAS-IG.AMGVG..VF------PEDYGA.............
Q5V2H6_HALMA/24-206....YRTMDRR------------------GFPLALA...VFG-FA.AFGVG..VF------PGNVTP.............
Q8DVX1_STRMU/11-196....YSFSFKK------------------EAVLLLI...LAI-IG.YAGVA..LF------PTDIEGSKR..........
A9KKH9_CLOPH/12-200SFSKYHIYVKL------------------GYTVMFA...SAL-IS.VIGYG..GY------PISMVLIFS..........
Q21FK4_SACD2/11-194....SSSLLFT------------------TTGGLVI...AHG-MA.TFVAG..YF------PMDADPYTQT.........
D1CAZ9_SPHTD/27-219...AGESRAGH------------------VTGALVI...AEA-VWGLVGGI..AF------PMATREVMAAS........
A0JTJ1_ARTS2/34-213...VRGNRALR------------------ISGGLLT...AYG-LW.NIMGA..LY------PLTLGDNAS..........
D9QLM9_BRESC/12-196....RRNLLAV------------------VACLLLG...WYG-LS.LAGAG..LY------PCAFECARSE.........
A4AMV1_MARSH/11-200...LPKSRPIK------------------VLFLLFA..IFYG-LG.TIVTG..VF------PCDIGCVMDPN........
Q28UV2_JANSC/25-202...HLGGVGWS------------------GGVVILA...LLA-AA.VVVIG....------.........ARNE...YGD
A8LJU0_DINSH/25-202...HQGGLAWS------------------AGTLCLA...VLA-AT.IVVVG....------.........ARNE...YGD
D9QK37_BRESC/20-202I.LTRSPVSAI------------------AVGLLFV...LAG-IG.LVVSSLYAW------PDP................
Q0W5U1_UNCMA/16-197....ASKWQSR------------------LAAAAVVPGIVAS-VG.LALIG..LY------PETVRE.............
C5BVW0_BEUC1/45-235...LVPGRRVR------------------LAGGLVA...AFG-VG.MLGAA..LF------PTDPINGFPPGT.....EE
D3Q5U6_STANL/20-208...VRTGPGRT------------------WLPILFG...IYG-VG.LVWGG..VF------VTDPAFGYPAGTPQ.GAPE
D2B9K9_STRRD/15-199...LRQGPGAK------------------WGPRLIG...IVG-AG.LIAAG..VF------VTDPAAGYPVGSV....EG
D7AZL9_NOCDD/27-217...MRGAPGGT------------------WAPRLVL...VNG-LG.MIAAG..LL------VMDPADGFPVGTPA.GMPE
D2AS92_STRRD/33-219...LHGGPGGT------------------WAPRLVA...VFG-AS.FLVSA..VF------AADPGAGFPIGTPE.GPTG
D2PMS1_KRIFD/36-226....SGALGST------------------WAPRLLT...VFG-LG.TVAAG..LL------LPDPALGFPAGTPD.GQPV
C8XD39_NAKMY/31-221...LGRGPGAT------------------WVPRLIG...VFG-VS.MITAG..LF------RADPVAGFPVGSP...AGS
D2B4R9_STRRD/12-208...LHPGRGGT------------------WGPLLMG...AFG-TG.LVIAG..LF------RTAPGWGYPQGAPA.GVPT
C8XD67_NAKMY/16-200....GPGLPAA------------------AAPLIWG....YG-GA.LIATG..VF------LVDPGAGFPLDAAA..PGP
A7HVR6_PARL1/16-206...LARGQGGI------------------AAPLLIG...AYG-VG.LVLAG..IF------DAPAGLGFPQGTPD.DQQP
D3PXJ2_STANL/16-212...TAGAPGGK------------------WGPWLVG...AIG-AG.LVVAG..IF------PTDPALGYPPGE.....AD
C5BVM4_BEUC1/10-201....LDGFPGR------------------ATGVVIA...AFG-VA.LAASG..VW------SMDPMRDYPPGAPA..HPT
D3Q1F0_STANL/29-225L..KASGRRTF------------------AGPLLIG...VWA-VG.LLGAG..VF------VGDPISGYPAGTP...ATG
A4F7D5_SACEN/16-207....RRTAGGL------------------WLSRLLG...VYA-IG.LAGAG..FF------RTDPISGYPAGTP...ALG
B8GH43_METPE/42-235...FPTGKASK------------------TGALLLG...IIA-VC.LLFSG..PF------VMDPMGTLRG.........
Q9RJS0_STRCO/12-187....GLRPAAT------------------AGRVALG...GGG-LA.ALVLV..AL------PAPSSGGSL..........
B1VPM0_STRGG/12-188....ALRPAAP------------------AGRVALA...GGG-LC.ALALT..LV------PAPSSGGAL..........
D9T5P6_MICAI/28-216....ALHAAGL------------------PSRFLLA...VGG-VS.TVALI..AF------PRPQVGGSP..........
Q0RZC5_RHOSR/71-245....GLRVLRM------------------PARITLA...LAG-LC.GFVLT..VF------PPAPRAVP...........
C0ZQ51_RHOE4/26-217....QLTVWKS------------------GVAAAMA...MWI-IG.LICIA..AF------PKQDWSQPV..........
C8X6V7_NAKMY/31-224....AAAGLSR------------------VGSLGLVLGGAWV-LG.LLAVV..VF------PKHDWSVGP..........
D3Q1Z4_STANL/35-216....GPLGSER------------------VTRRCLA...GSA-VALLFVVG...F------DTDAGATVS..........
D3Q759_STANL/3-179......LTTTG------------------WPRLVLA...TAA-LA.FVVAA..VF------PTDPGTGVD..........
D2AUN0_STRRD/12-196....TDPTRSA------------------ATRVLFV...AGA-LG.LLLTA..AF------PLDAAPGAA..........
D2B0Y0_STRRD/13-197....AMAPIGA------------------AAERLML...AWS-AA.LVVIA..IV------PTTAPGLAM..........
C6W8D5_ACTMD/12-195....SGLPRRG------------------PVAVLIG...LWA-AG.LAVVA..VF------PTDPLGAPT..........
C8XCN7_NAKMY/38-227....AGLSGTA------------------WTRALLA...GWA-LA.LVAAA..VF------PTNLPGRPG..........
D3EGW1_GEOS4/23-212....IRTVTGY------------------IGLVILG...ISA-IG.VIIAG..IF------VTDPISASPD.........
C8XKD4_NAKMY/21-199....AGAAAPG------------------PTRPVLW...VGF-AG.AALMA..VV------RTDEGGGAM..........
D9SXQ4_MICAI/13-198....ALPPGLR------------------AAAGLLG...VGA-VA.TVLSG..AV------TCSEGCPLPPF.......E
Q0SAA4_RHOSR/13-214....SQGWVTA------------------VGWLALI...VFA-VA.TITDS..RL------PMSCAATNDPVCAAREAAG
D3Q0C1_STANL/5-190....ALRRRPW------------------LGWACVV...AFG-VF.TMLDA.GLF------NMSCAPSLDPTCATAEVAG
D0L9X9_GORB4/20-220P..LVRGRLAV------------------AAVVLLA...AFG-AS.TMADA..LL------PIECLAGIDPGCRA.EPSG
Q5Z3B7_NOCFA/14-211....PRRPLTT------------------LGWAALT...VFG-AA.TIADA..LI------PLRDCAPGEPGCGG..PRE
C0ZM54_RHOE4/15-215....PRRRLYV------------------TGWIALA...VFG-IA.TIADA..SF------PLECSGE..GCPSS.APDG
D5UPX7_TSUPD/8-215....AARPSSR------------------FAWGWMAGMIMLG-VG.TISDA..LL------PLSCTPTSDAACAFREANG
C6W9M9_ACTMD/22-202....ARHLRGR------------------WAVAAVL...VFA-LA.TLADT..AL------PLDCAPSTDRLCRDREAAG
D2B4U0_STRRD/15-212ERPGRWGAAGW------------------LGLALLG.....G-MT.VLDSG..LF------PLDCAALSDPVCAAAEAAG
Q6NEW9_CORDI/11-191W..PRWEASSR------------------IIAVALA...VMG-AA.TIGDV..FF------PMPCAESLPTC........
C5C1J0_BEUC1/20-217LRPGPWREVVT------------------WGTVAFA...VGA-IGAALAAS..TC------PLGTRCVGS..........
D9TA17_MICAI/14-189....RRAGAGR------------------VPLALLT...AWS-AG.LLAAA..VV------PTNEPGTPM..........
G8PFH7_PSEUV/15-189...LMRSRAER------------------VALVVFA...GYP-LF.IGLAA..FF------PCDFECRMAD.........
Q6A8J6_PROAC/18-214...HRPLGRQG------------------WSGVGFV...AGG-FF.SVLDA..LV------TMDCSPTRSQACMAAEEAG
Q833X7_ENTFA/13-203....KTKKGAW------------------LVVAMIG...AYG-LFDCIFSG..LF------SVDTSSAG...........
Q9PBG9_XYLFA/13-195P.MQHPSWSLR------------------IGIQLVM...LSG-LA.FAAMG..IL------PLDIGELEG..........

PF10277

Q7QE61_ANOGA/3-230-------VH-YVGAFLSFGLGTVYFWIQSYISYYIQPY.........................................M
Q757Q5_ASHGO/5-206-------AH-DVFMIAYIVLTIPWCVFVVR..................................................
Q75DE7_ASHGO/9-286-------VH-LSMVGVFVSMMYFSILCAAIEYLSMGRHYARLHPLAGSAA................HVGSASSRHGHVWN
Q4WNE6_ASPFU/5-224-------FH-NGFLLMFLVGYLISAVLICIEYLWLGIFYR....................................SQHR
PGAP2_CAEBR/12-239-------LH-AKCFGGFAISSIIYMILSTWLFSESGRRR......................................ATN
A5DLG3_PICGU/121-352-------VH-ISMVGVFIAFCFFACLFNFFNSFIFGNYPHRLSPNHE......................KVIFSNHRWGN
A5DAL2_PICGU/21-231-------WH-DIFMIAYILLTIPWTVCMSVLS...............................................P
CWH43_SCHPO/11-220-------WH-DIFMIGYLISNAPWFILVSKCS...............................................P
A8WTJ4_CAEBR/43-270-------LH-ALGFAIWIICFNFNMLFNILLHHFGGCRD......................................VHD
Q7S513_NEUCR/18-228-------WH-DILMILYIVFTIPWTTGCIALS...............................................P
Q4PAD1_USTMA/365-592-------VH-DIAMFVYLALTPPWMFITSGSLAQPPSVKNAA.................................KTDDQ
Q5RGJ7_DANRE/7-226-------VH-DIGALLFFICGVVYAVIQSVIGYRAFPY.........................................G
Q6FIN1_CANGA/8-284-------VH-ISMVAIFCIFMLLSIVCLTAEYFSMGRHYASIHPLAATKADFDPS......NPTNIDSLPWNKWTGHIWN
T150B_BOVIN/4-207-------TH-LTGAFLAFFVGIVYFWLQLFLSWRMKNLP.......................................QP
T150A_MOUSE/3-232-------LH-YIGTGVAFTAGLLFVCLHCVLFYHGATT.........................................P
A7TMD9_VANPO/12-290-------VH-IAMVVLFVILMFISVCCLIAEYASMGKHYALLHPLANPETTI............PFERLRWYQWSGHIWN
Q6FKB5_CANGA/8-272-------VH-LSMVGVFVVLMFFSVCCQTAQYFMMGRRYALFHPLSSENPDA.............IHALKWYQLAGYKYN
Q7PN15_ANOGA/41-264-------IH-KICFSAFVICSIIYMYLVVLINRLTRTEEL.....................................LTL
Q4E2S1_TRYCC/9-251-------RH-NVGFAFYVFLSFLVQVVIDIVVRRNAHNPEI..................................YASSD
Q9XWR3_CAEEL/44-269-------VH-VIFFYVFGICGIVHMISNIFCHAHSLYYL.......................................NP
Q2UMD7_ASPOR/5-224-------MH-DGFLVMFLVGYIISAILICAEYLRLGVFYR....................................SQHR
Q16JU8_AEDAE/31-253-------VH-KFCFSTFVVTSMLYMVVLIVINRVTREGDL.....................................LTA
O77262_DROME/3-230-------VH-FIGAFCCFGCGTLYFWMQALISYLIFPM.........................................S
Q559G4_DICDI/11-218-------VH-VIFAALFFLCGFIYLLTQTILDIKNSS..........................................D
A1CK70_ASPCL/15-225-------WH-DIFMISYLVATLPWTLGCLALS...............................................P
A2FGB6_TRIVA/10-214-------VH-LTGAAVFFFGSFIFYAVSDFTLM..............................................Q
Q54J51_DICDI/6-269-------SH-QVGFVSYVIFSFLYMYTHCAVLYHTKIKFRAGFENQSIS..................SIIFKGNYSPKTQ
A8X4A4_CAEBR/10-248-------LH-ITGALLAFGGFTIFMIFQCYLTHKFTGV.........................................I
Q93319_CAEEL/9-241-------VH-MSSAVASFGGFSIYMIFQCYLTHRVTPT.........................................I
Q17MC8_AEDAE/70-299-------VH-EKVFILFMTSSLSYMLATLKLLKVLQPNGP.....................................QTT
T150B_HUMAN/4-206-------TH-LAGAFLAFILGNVYFWLQLLL.WRLKRLP.......................................QP
Q6CDS5_YARLI/4-220-------VH-VGCLVLFIVGIGISAILNSAEFTLLDQNYP.....................................DVR
DRAM2_MOUSE/7-233-------VH-VCGAVLAFSMGSFYMFVQTILSYQMQPK.........................................I
Q4PDK8_USTMA/9-236-------VH-WSMTLIFVVFVALSVLFQVLQVFSLSHDYD.....................................RLA
Q01D47_OSTTA/14-220-------AH-VTAAFGFLFAMWIWTAMCVRQLAAHPG..........................................S
T150C_BOVIN/8-218-------IH-NVGTSLTFGFGTLTCWIQAALTLKVNIK.........................................N
A5DS39_LODEL/32-242-------AH-DVFMISYMVLTIPWTVCTTLLS...............................................P
A7S3L1_NEMVE/7-240-------VH-LTGAVMVFLCSVFYCWIQTLITYKMMNCG........................................L
PGAP2_DROME/19-240-------TH-RNAFVVFIACSECYMLVSYLLNRNIQKTV......................................LLP
DRAM1_MOUSE/7-226-------VH-DGGALLAFVCGVVYTLLQSIISYKSCPQ.........................................W
Q6BKM3_DEBHA/21-231-------WH-DIFMISYIVLTIPWTVCITKLS...............................................P
A3GGF7_PICST/12-243-------VH-LSMVGVFIAFSFFCCLFNFFNSFIFGNYPSRLSPDHE......................RVIFGSWRWAN
A5E3J3_LODEL/22-254-------VH-MSMVGIFIAFCFFACCCDFGITYIFGTRGDQLDPVHR......................TTVFGTSRRGN
Q22Y36_TETTS/100-306-------FH-GACAVIFFIFLCVYTQLNFNTCQQLRKLN......................................PAF
A7RFU0_NEMVE/9-235-------FH-DAGAVLLFGSGAVYCWIQTVLTYRMSLNG........................................L
A7RNE7_NEMVE/10-236-------VH-EASFITFQVSAMVYMLTNCIIFRWTLSSL......................................PTH
Q6CTH9_KLULA/8-279-------VH-SSMVGIFCAFVGLSVICHVAQYMTMGRHYAVVHPLTSSEDI..............GKDTRWNEWHGHVWN
Q5AF82_CANAL/13-246-------VH-ISMVGVFIAFCFLACVCDFTISFIFGTNPSKLDPVHD......................QVVFGTSKFAD
E9ADF4_LEIMA/115-359-------YH-NLGICPYLPFCLVLQAAVTMLVRRNQFNTAI..................................YPTPQ
SFK1_SCHPO/21-232-------VH-WKFTAAFVVLAFVSAASNIFEWLSATRYYP.....................................QSS
Q9VPT6_DROME/29-248-------LH-ITIALSLFVSCAIYMAGSFVCAKYYMSDRI.....................................GQL
A7SJV3_NEMVE/4-240-------LH-YVASSFIYIGGFPCLVFNTILTYKIA.HV.......................................GR
T150B_DANRE/3-204-------VH-LLGALMAFFLGLAYFWIQAFITYFSPPS.........................................R
A4RTY8_OSTLU/13-222-------AH-VTAAFGFLFALWIWLACVVAQLRKHED..........................................A
T150B_MOUSE/4-207-------TH-LAGAFLAFILGNLYFWLQFFLSWWVKGLP.......................................QP
Q3V5H7_CAEEL/25-251-------WH-VCFFYSFGVVALLFFISNTVCHSQSLYFL.......................................NP
Q6C3N0_YARLI/30-239-------WH-DIFMISYMVLTIPWTVGCTLCT................................................
T150B_XENTR/4-203-------TH-LAGAFLAFVIGNIYFWMQTVLTYMVKPK.........................................H
F1R7U0_DANRE/9-235-------MH-LVGAILTFGIGALYVFIQTALSYLMQPH.........................................I
H0YDZ3_HUMAN/110-331-------IH-ENAFIVFIASSLGHMLLTCILWRLTKKHT......................................VSQ
H3CLF5_TETNG/33-253-------IH-KNGFIVFIASSLLHMLITCRLWYVIRRHY......................................VNP
H3D1L8_TETNG/4-231-------LH-YVGAGVAFPAGLLFVCLQCVLTYRVAVT.........................................T
SFK1_YEAST/10-286-------VH-IAMVSVFVVFMFLSTCCLIAEYFLMGRHYASVHPLASPHFNPQSSEKSFNQDYNTVDELPWYKWKGHVWN
Q1K6P7_NEUCR/10-223-------LH-DIFLLLFIAGYVISAIFICWEYQRLGMRYR.....................................EHR
T150A_XENTR/4-231-------LH-YIGAGVAFPAGLLFVCLSSILSYQIAAS.........................................A
DRAM1_XENTR/10-226-------VH-DAGALITFICGVLYILLQSYISYKSCPA.........................................W
Q5KJS6_CRYNJ/27-255-------GH-WTMTIVFIVGVAISAVFQSAEIWSLHKEHP.....................................DRK
PGP2L_DROME/75-300-------VH-ERIFITFMVCSLCYMLATIKLNGILNAGQA.....................................LSE

PF06197

B5HBV4_STRPR/2-171.......QH.GSVAVVGFTLLAVWPV....LAA............--------------------------------.DR
Q6L2X2_PICTO/12-188.......PH.DFVSIWFFILSSISYI....TIG............--------------------------------...
Q9HJI2_THEAC/17-194.......PH.DFVSIWFFILSTISFA....TLG............--------------------------------...
A8MCR4_CALMQ/13-182.......PH.TFVSEWFFTQMDLAVV....TWS............--------------------------------...
Q970R2_SULTO/9-177.......PH.LFVSTWFFIQFDIAIL....TYG............--------------------------------...
A1RZ19_THEPD/13-186.......PH.TFVSLWFYLQSFIAST....ALG............--------------------------------...
Q9Y8U9_AERPE/10-184.......PH.VFVSTWFFLQMDMALV....ALS............--------------------------------...
Q5JHD7_THEKO/10-182.......PH.YYVSWGFFLTAGFGLL....IAG............--------------------------------...
Q8U4E0_PYRFU/10-182.......PH.YYVSWAFFIITSIGML....ITG............--------------------------------...
Q9HK23_THEAC/11-184.......LH.LIFALIYFVLFPISII....IASVR.........A--------------------------------SLP
A2BLJ9_HYPBU/14-183.......AH.FVASAAFFLAMIPYVI....AYS............--------------------------------...
Q8ZU94_PYRAE/9-176.......PH.WISALIAFLLGAIAVM....AMG............--------------------------------...
Q5V2H6_HALMA/24-206.......WH.GIFALLTFFSGGITVVLSSQVVS............--------------------------------...
Q8DVX1_STRMU/11-196..TVKGIIH.LLFAILQFTALAIFIFNVTEVLKP...........--------------------------------LNA
A9KKH9_CLOPH/12-200...KNDIIH.VVVTVTILCATALSIL....LIT............--------------------------------IGY
Q21FK4_SACD2/11-194.PSKKCEVH.TLAGVVMLFSLLIANI....LVI............--------------------------------...
D1CAZ9_SPHTD/27-219QDTLRNQMH.QWYGIGMPILFALAVGFGSRLLG............--------------------------------...
A0JTJ1_ARTS2/34-213.....VPMH.ILVTNIQLALMVAAMC....FVA............--------------------------------...
D9QLM9_BRESC/12-196.PTLDALMH.DLIGGTGYLTGVVGLA....LAG............--------------------------------.LS
A4AMV1_MARSH/11-200TFSLSQFIH.NLTGFLTYLIVPFSVI....LLG............--------------------------------...
Q28UV2_JANSC/25-202GDNEGVVVH.IYVVYALGVGFFAAPL....LLA............--------------------------------.NG
A8LJU0_DINSH/25-202GDAEGVVIH.EYLVYGLGVLFTAMPL....CLA............--------------------------------.PR
D9QK37_BRESC/20-202.......RH.MAINLGLGIQLAPAFL....LVA............--------------------------------...
Q0W5U1_UNCMA/16-197.......VH.VPAAMLTFLCLTAMLL....LVNL...........--------------------------------ALW
C5BVW0_BEUC1/45-235TMTASGMLH.LVLSGLGFLALGVGAILTGGALA............--------------------------------RRA
D3Q5U6_STANL/20-208TLTWHGILH.GLAPAAIGVALIAASI....IVAR..........R--------------------------------YRW
D2B9K9_STRRD/15-199ETSWHGMLH.NVAAMVGGLALLAASL....VFAR..........R--------------------------------FLA
D7AZL9_NOCDD/27-217QLTWHGYGH.MAAGSVSFAALIAACY....VLGH..........H--------------------------------YGR
D2AS92_STRRD/33-219SISTNGAVH.MFGGMIGYLALCAAFV....VLAR..........R--------------------------------FSA
D2PMS1_KRIFD/36-226AMSWHGVAH.FAAGGIGFLAFVIACV....AIGR..........R--------------------------------FAA
C8XD39_NAKMY/31-221VPSWTGLVH.LAAGGIGFTCLAIACT....LMAA..........R--------------------------------YRK
D2B4R9_STRRD/12-208DAGVSYVLH.GAGFSVVLVSLIAACS....VFTR..........R--------------------------------FAA
C8XD67_NAKMY/16-200AMSWHGVVH.AIAPPVAFGCLIGLGL....VFAR..........W--------------------------------FAA
A7HVR6_PARL1/16-206VMTTAATLH.SLAFMIAFGGLILSCF....VFAF..........H--------------------------------FWQ
D3PXJ2_STANL/16-212VVTVSGRLH.QVGGSLLFIGLIGGCF....VLAR..........Y--------------------------------FGH
C5BVM4_BEUC1/10-201TFSRAHERH.DQAGAVVFAALPVACV....TAA............--------------------------------...
D3Q1F0_STANL/29-225IHTWHGQLHDVPFSAAGFLAMTAACL....VFAF..........R--------------------------------FAT
A4F7D5_SACEN/16-207QSTLTGSLH.DTFSALVFAALPLACG....VLAR..........R--------------------------------CFK
B8GH43_METPE/42-235TESLHGMVH.GLLGGIVFICMAVSCF....VFLR..........C--------------------------------FRE
Q9RJS0_STRCO/12-187.......RH.GAVVVVGFTLLAVWPV....LAV............--------------------------------.NG
B1VPM0_STRGG/12-188.......EH.GAVSTVGLVLLAVWPP....LAA............--------------------------------VRD
D9T5P6_MICAI/28-216.......AH.GVVATVAVLALALWPA....GSALRLPRRVPREVA--------------------------------ASP
Q0RZC5_RHOSR/71-245.......VH.VAATAVGALLIAVWPI....LVI............--------------------------------.SR
C0ZQ51_RHOE4/26-217..SISGIIH.WAASALAFLSLPVAAI....LLARP.........W--------------------------------LRD
C8X6V7_NAKMY/31-224..STAGHVH.RVASLVAFVCLPVAVI....LLT............--------------------------------...
D3Q1Z4_STANL/35-216..SFSGYVH.RYAAGAVFVMITVATAHLWRRVP............--------------------------------.DP
D3Q759_STANL/3-179..TVAGYIH.RYASGTGFGLVIIAGFLAFATTT............--------------------------------..G
D2AUN0_STRRD/12-196..SAGGEIH.RWAAAVVFTALPCAGW....MMG............--------------------------------...
D2B0Y0_STRRD/13-197..DLTAQVH.RYVSIAAFVAMPVAGA....LMVA...........--------------------------------RLR
C6W8D5_ACTMD/12-195..SMTGLVH.RYAGAVMFASLPIAGW....LVS............--------------------------------...
C8XCN7_NAKMY/38-227..DTSSTIH.LIAGAAVFALLPLAAVRLWRRLA............--------------------------------...
D3EGW1_GEOS4/23-212DATFSGSMH.SIGAMLDYTPLAALLI....SLS............--------------------------------.LC
C8XKD4_NAKMY/21-199..SGHAQAH.MAGAVVALVFLPLGIV....LAL............--------------------------------...
D9SXQ4_MICAI/13-198ATTVADLVH.GGASIAATAAVVLAML....VLL............--------------------------------...
Q0SAA4_RHOSR/13-214HLPLTHDLH.AVTSASASTGGVVSSL....AFL............--------------------------------LAA
D3Q0C1_STANL/5-190KVPLRHQIH.TLSSSLAAAAPFVGLI....AFA............--------------------------------...
D0L9X9_GORB4/20-220LLPQLHHIH.ALTSTLAVFSIFGAMI....AAT............--------------------------------LVA
Q5Z3B7_NOCFA/14-211LFPQLHQPH.ALTSTLAVTAIAVAVA....AFS............--------------------------------LAA
C0ZM54_RHOE4/15-215LLPQLHHVH.ALTSSVAVFAIFTAMI....AFT............--------------------------------VGA
D5UPX7_TSUPD/8-215EVPFTHLAH.AYSSGIAGTGGAVAVL....AWA............--------------------------------AWL
C6W9M9_ACTMD/22-202AVSLSHHLH.QVTSVLTFVGALAAAA....VLE............--------------------------------...
D2B4U0_STRRD/15-212RVSPSHRIH.TATSALASAGAMISLV....ALP............--------------------------------VSA
Q6NEW9_CORDI/11-191PVDHFGSFHIVTSTVVVTAQVLLAAV....MLR............--------------------------------...
C5C1J0_BEUC1/20-217.GDLEVVIH.DLASAVSEVGLFGGVLGAWFATRR..........D--------------------------------GPA
D9TA17_MICAI/14-189..DTAAYVH.RYASVLSFLALPVAGW....LLA............--------------------------------...
G8PFH7_PSEUV/15-189.QSQSQLIH.SAAGLFAYFCAVVGLC....LLA............--------------------------------...
Q6A8J6_PROAC/18-214HVSVNHIVH.VGTSTIVVVGFALPIL....LLNS...........--------------------------------TMT
Q833X7_ENTFA/13-203..TVAAALH.NGGSAVGYTGFLLLSG....VLT............--------------------------------IIY
Q9PBG9_XYLFA/13-195...RTTQYH.ATVWLLWGIAFCTATA....LLT............--------------------------------...

PF10277

Q7QE61_ANOGA/3-230GTMQKANLRMALSVVCTVFFMIVAVTGVISHILFRGTDPRK.......WYPSDGGWEYHVASSISEWIVATAF-CFYV.L
Q757Q5_ASHGO/5-206HATHNRALRKVVGGAFFGTLVPLIYWFIQHNVKK....................RAGAYSIYAYFEWSLIILD-ILFD.G
Q75DE7_ASHGO/9-286KLTVSGTVKMVWLFLAAAWAICFGAVKNP..............................SISASFEWVLAFWL-CAYY.V
Q4WNE6_ASPFU/5-224ILFASFVIKLAFVIIEVALAIAFGICTRRSSGK.........................KNVAAILEWVIAFIF-TGYI.L
PGAP2_CAEBR/12-239LGERSYEYKILGASIFVVCFFLGGYLYWRHNTYC....................EPGIYTLFALVEYSAVLSN-IFFH.C
A5DLG3_PICGU/121-352LYMVSFWFKCFWLVCAAVFACFFGAYMKKDKN...........................SKSAVFEWLISYWY-GLLL.V
A5DAL2_PICGU/21-231KGSIVRRGRTWTAIAFFSTLVPLVYWFIQHKVHV....................RPGAYSIYAYFEWALILLD-VGFD.T
CWH43_SCHPO/11-220VNSMASRIRNIGSALFVLTIFPLIYWYIQHKFKH....................IPGAYTVYAFFEWSLILWD-ILFD.S
A8WTJ4_CAEBR/43-270RMETTWRIKCVIFLIGYFCAISTPITYPYFTAHC....................SPFAYNLFSLAELIEVGCN-SIFY.A
Q7S513_NEUCR/18-228PNAKAIKYRKWIAGSFFGTLVPLVYFFIQHKVHR....................VAGAYTVYAFFEWALILFD-VAFD.A
Q4PAD1_USTMA/365-592LASKARKMRRIACFSFFACTPFMGFFFYRHNALR....................IPGAYSYYAYFEWGLIIFD-LLFD.A
Q5RGJ7_DANRE/7-226SSKFMCHLRTFFSTVAILAAIPTIACGFLVGTSKLHWD............SNDKDYTRHIVSVACEWITTFSF-VFFF.L
Q6FIN1_CANGA/8-284KFTISATLKTIWCIAAIVWAICFGAIHDN..............................SKSACFEWLLAFWF-GIIF.M
T150B_BOVIN/4-207GAPWIGPLRLVLCSACFILEVAMVVLHSWS...........................MRSVSAICEWVAAMLL-FILF.G
T150A_MOUSE/3-232LDMAMAYLRSVLAVIAFITLVLSGVFFLHESSQ........................LQHGAALCEWVFVLDI-LIFY.G
A7TMD9_VANPO/12-290KFTLSAAFKAVWLTLGVVWAICFGACGD...............................SISACFEWLLAFWF-GLLF.I
Q6FKB5_CANGA/8-272KFIISASMKVVWLALAVVWAICFAAISDN..............................SKSACFEWLLAFWF-GVLF.M
Q7PN15_ANOGA/41-264AERKSLRYKRRLLLVNVASIMFAVYFFVRHNNHC....................EPGIYSLFALSEYVFVYSN-IGFH.M
Q4E2S1_TRYCC/9-251DYRLSSYWKRVFLIGQTTGALSHVIFYVRHINTC....................APGAYSLSTMSEWFFAACN-ICFD.A
Q9XWR3_CAEEL/44-269YGRLSYYLKILFTSLYVLSTPILIASFILYWRKC....................ITWAYDVFALCEYSGVFLN-ICFH.G
Q2UMD7_ASPOR/5-224VLFASFVIKLLFIIIEIALAIAFAVLGKKGPSK.........................RNAAAVLEWVIALIF-TFYV.L
Q16JU8_AEDAE/31-253SERKSIRYKRRLFLANLCSILLAVYFFVRHNSYC....................EPGVYSLFALSEYVFVYSN-IGFH.M
O77262_DROME/3-230GTRINAHLRLGMSVVCTILFILLAVTGVMSHILFKGQNPRK.......WYPSDGGWYFHVVSSISEWVIATVF-SFFI.L
Q559G4_DICDI/11-218IPLKVLIIRKILICISCL.FIGYIITQFF............................IDNLAAIFEIMSALSI-FAYM.V
A1CK70_ASPCL/15-225NNRRAVKYRKIMASLFFGTLVPLIYYFIQHKVHK....................VPGAYTKYAFFEWSLILFD-VGFD.A
A2FGB6_TRIVA/10-214CKVKLNIISLVLTWLVVGFLVLYTVFASFSKRS........................FVNAGAIFQYISSLCI-FGKL.F
Q54J51_DICDI/6-269KDLFSFKWKAILGIAHFLLFVGSLKYFVDHTFYC....................VYLSYSKYSIFEWLLATTN-ILYD.T
A8X4A4_CAEBR/10-248TVITVFRFRLVFTVLSAIFFVVGLSFGIIASRVFHSVYPDLPTPRPWSRKIYQPGYGYHQISAAAEWLCAFSQ-IIFM.Q
Q93319_CAEEL/9-241TLRTVFYYRVIFTIFSVICFCCSFGFGIAASKIFHKTYPDLPTPRPWSRRIYQPGYELHQISALAEWGCAISQ-IFFI.Q
Q17MC8_AEDAE/70-299QEETSLRYKRAFFALSIASTIGLILFFLKHRFLC....................HDLAFSWFALCEYIVASAN-MGFH.C
T150B_HUMAN/4-206GAAWIGPLRLGLCSVCTILIVAMIVLHACS...........................LRSVSAACEWVVAMLL-FALF.G
Q6CDS5_YARLI/4-220RLKTSYILRWIWVAIAIVLAIIFVSCNNRNEP...........................NVAAGFEWALSFFY-GFYL.L
DRAM2_MOUSE/7-233HSKQVFWVRLLLVIWCGVSALSMMTCSSILYSSDFGPDVVQK....LHWNPEDKGYVLHLVTTAAEWSMSFSF-FGFF.L
Q4PDK8_USTMA/9-236TLKVIAIIKAIILSLAIAGAIAFIICYGICRGDALPG..............NDRCDRIISAAAVCEWAIAFLL-AIFF.L
Q01D47_OSTTA/14-220VSAKSLRGKYLACGFGFMGVVGFAALSALVGKE.......................NAYSLVGASEWLGVLSM-IFAC.W
T150C_BOVIN/8-218EGRKVGIPRVILSASITLCVVLYFILMAQG...........................IHMYAARVQWGLVMCF-LSYF.G
A5DS39_LODEL/32-242RHSFQRKARFYSAVGFFSTIVPLIYWFIQHKVHV....................RAGAYSIYAYFEWGLIALD-ILFD.S
A7S3L1_NEMVE/7-240NSAGLFVIRSALSGASTVFFILTLVGRGYAQSKWQSGHPNSDL..RPTWKPGETGYKSHIMSDAAEWLMAITI-LVFI.T
PGAP2_DROME/19-240HEEKSLRYKRNLFLVNVIAFGLAGYCFVRHNSHC....................EAGVYTFFALFEYIVVLTN-MGFH.M
DRAM1_MOUSE/7-226NSLTTCHVRMAISAVSCAAVVPMIACASLISITKLEWN............PKEKDYIYHVVSAICEWTVAFGF-IFYF.L
Q6BKM3_DEBHA/21-231KGSKVRRGRAFTALTFFSMLVPLVYWFIQHKVHV....................RAGAYSVYAYFEWALILLD-VGFD.V
A3GGF7_PICST/12-243LYMVSFWMKFVWLFVAAAFAICFGYFMKDGNR...........................NLSASFEWSISFWY-GILL.V
A5E3J3_LODEL/22-254LYYIGFWAKIIWILAAICFAAAFGYYMNTGND...........................SRSARFEWTICFWY-GLLL.V
Q22Y36_TETTS/100-306MSNSSYNRKKFFAKAWYVVFFFIILLALKQKWA............................LAVAEWIGTYSI-IFYL.Q
A7RFU0_NEMVE/9-235APVPLFAVRLILTGILSVFGCSILSFVLSFQQSEHTVAHW.........QPDDPGYSLHVLSNMGEWLAALCF-GLFS.M
A7RNE7_NEMVE/10-236QESVSMRWKVICLLLNYSSFAMAVYFFFRHNWYC....................ESGVYSLFALCEYVTVLSN-IGFH.G
Q6CTH9_KLULA/8-279KYTISGLLKAFWVIAAFVWAICFACLEDR..............................STTACFEWLLAFWF-GLYF.I
Q5AF82_CANAL/13-246LYFVSFMLKLVWLFAAVAFAICFGVYMKNDQN...........................SKSAIFEWLISFWY-GLLL.V
E9ADF4_LEIMA/115-359DATASYAVKRVCLCVEVVAAVGIVCCYSHYLRTC....................ANGSLSLSSICEWVFSIFN-IIFD.G
SFK1_SCHPO/21-232LLRVSFIFKFVIIVVGIICAIAFGGLHHNYRGR............................SARFEWVVCFLW-SIYI.C
Q9VPT6_DROME/29-248HEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFC....................FPLAYSVFGMGEFISCECF-FIYL.C
A7SJV3_NEMVE/4-240ASNGIFLLRMFISVIYSISSLSFVVLQTFCHNKYNRHDNVGFE...SHWKKGEDGYAIHVGGALLELVSLLAL-ATYI.I
T150B_DANRE/3-204DNKWLVPVRFVLCSQCTCMVICMFVLHSTG...........................FRSAAAICEWILVMCF-FALF.G
A4RTY8_OSTLU/13-222VSRFSMRAKVAGLAFAGLGVGGFTALSALVGKDE....................SRTAYSLIGFCEWLAVLAL-VAAC.Y
T150B_MOUSE/4-207GPHWIKSLRLSLCSLSTILIVAMIVLHALH...........................MRSASAICEWVVAMLL-FMLF.G
Q3V5H7_CAEEL/25-251YGRISYHVKIVISICYFLSAPAIATFYALYWKAC....................FTWAYELFALVEYLDVFMV-IFYHGC
Q6C3N0_YARLI/30-239RDANARKWRKIVATCFFGSIPPLIYFFIQHKVHH....................IAGAYTTYAFLEWALVIFD-VMFD.A
T150B_XENTR/4-203GGCYIGPIRFCLSVACTALIVLMAVFLKL...........................NMKSISAICEWIVAMIL-FLLY.G
F1R7U0_DANRE/9-235HSKTMFWTRLSVGIWTLSSIISMFVSSVIMYSTLPGVEVNKK....LHWTPGEPGFTAHIVSTISEWSLALSF-ISFF.L
H0YDZ3_HUMAN/110-331EDRKSYSWKQRLFIINFISFFSALAVYFRHNMYC....................EAGVYTIFAILEYTVVLTN-MAFH.M
H3CLF5_TETNG/33-253EEITSQRWKVRLFLFNISCCLAAAYFFRRHNKFC....................EAGVYTLFAFFEYLVVCSN-MAFH.M
H3D1L8_TETNG/4-231LDYWMAHFRVALTLGALVSLILSGVFFVHESFV........................LQHAAAICEWVFTVDI-LVFY.G
SFK1_YEAST/10-286KFTISATLKVIWLTLAVVWAICFGAINDR..............................SKSACFEWLLAFWF-GIIF.M
Q1K6P7_NEUCR/10-223VLRISFWVKLAFVVVEIILAVAFASCSYT...........................GHYNPAAVLEWTIAFIF-SFYI.F
T150A_XENTR/4-231LDYWLGHLRVSLTIVALISLVLSGVFFIQESFL........................MQHLAAICEWIFVLDI-LVFY.G
DRAM1_XENTR/10-226NTRVTCHIRMAISVIAFIAVVPMSVFSVLSGRKRLDWK............PSDEGYHYHLTSAICEWIVAFGF-NMYF.L
Q5KJS6_CRYNJ/27-255SLKRNSILKLIIVLFAIVLAICFGITYGICQGNSSATSG..........HSANTCNNITSAAAAFEWAVAFVL-TFYF.L
PGP2L_DROME/75-300KQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYC....................HDLAFSWFAFFEYLIAIAN-MLFH.F

PF06197

B5HBV4_STRPR/2-171GGAGPWGLRLLPSVVATASIGIGAGWFLIE....------------.........MNRGGVPGIAERLVTCMQ.AMWP-L
Q6L2X2_PICTO/12-188.....IALVIQRIKYGIAMLVLIPVSWLLF....------------........IKIPWQSVAENEIFGIIII.EILV-I
Q9HJI2_THEAC/17-194....ISRLIRKRYGTGMIILSMLITSWIVE....------------........YLVRWGSVAESEIFGICII.DAAV-I
A8MCR4_CALMQ/13-182....IGLIVGRRLNYGIPLLLLGLIAPIPA....------------........LLIKWPSTAILETYGIVII.DAWA-I
Q970R2_SULTO/9-177.....IGLLMERRKLGIYMIILFIIANVVA....------------........GVIKWPSSATIEAWGISII.DIWV-I
A1RZ19_THEPD/13-186....IALLLSGRKAVGTALLALGLVPVPLGTL..------------......IEATVGWPSVAILELAGALFI.GASA-I
Q9Y8U9_AERPE/10-184....LGAYRACRNLANMAALALSLAAFPVYIL..------------......IGITLGWPSAAVAEAYGIVVI.DIVV-I
Q5JHD7_THEKO/10-182.IGMGLSGDRKMLYFTVVLFVLAWILAIWA....------------.........MRTFKGVAIPEFIGALAV.TIWH-Y
Q8U4E0_PYRFU/10-182.IGIGLARNRIVLYLTIGIFVVGWILGIIA....------------.........MKTFKGVAIPEFIGAISF.TLWH-Y
Q9HK23_THEAC/11-184AWIRVYGIAGSAAALAVIVIGIGFVFHFVT....------------..........IKNVGLAVPEFIEAVLL.AAWS-I
A2BLJ9_HYPBU/14-183....AKRSPKLLATAALGTASTSLLWYMHL....------------........VRDTPPGAAPPELTSIILL.LAFY-T
Q8ZU94_PYRAE/9-176.ARMGGFFKAFGLAAGVISLTALALFIPRV....------------..........HTPLGIGGLERLVAYPI.LVFF-V
Q5V2H6_HALMA/24-206..RPFSFLCGLFGGISLLVLVSVFVYGLLVGG..------------.......PSPVEPLGPGGIERWVVYPI.IIWL-P
Q8DVX1_STRMU/11-196TLFLIASYIKIVVEVGLYGLVIALFLPFVK....------------.............KYFGLFERLFLYSS.NLYI-L
A9KKH9_CLOPH/12-200LKQEKLKILGLITLVAFLFFVVFNLWHLYA....------------........ILNGYHILGFIERIIFYTV.HALT-V
Q21FK4_SACD2/11-194.FASVSSGLRVFSAVCLVLVVVFLILMAQA....------------.........YKQRGNVGLYQRLSYGAQ.LLWL-A
D1CAZ9_SPHTD/27-219......KRFRYYSYATILVILVAGFMMSQQNSA.------------......LAANEPTPWMGLNERVVGYLP.MIWY-A
A0JTJ1_ARTS2/34-213..AGFHGRMRAYSIVSLAASAVMGMVAFMA....------------........APGPNLVLGISERISIGAF.LLWV-I
D9QLM9_BRESC/12-196ARSGAAPWLAPLGLGCAAVALLGFGGIVAD....------------............VELGGLFQRLLESAM.AVFL-I
A4AMV1_MARSH/11-200VYCRKQQDTKKFARTSFVSGTIALVFVLVLF...------------........SNPESKFIGLFQRIIEASI.LFWI-M
Q28UV2_JANSC/25-202FGRDPMMSRRWLIGLAILWAAASPVFFFLP....------------............TSVDGLYERGLGLIA.CAII-S
A8LJU0_DINSH/25-202AARLLPWSRPALIGTGLLWAVMSPVFFLLP....------------............TDVDGGYERLLGGVA.CAQV-L
D9QK37_BRESC/20-202.LRNADRFLRLKQFLFLVFIAMAVLTVVTKHLV.------------......FPGTVNDFNVGYWERAFAIVL.VGWV-G
Q0W5U1_UNCMA/16-197GEPKYPGWLAFIGALAIVSNFAQIGLVLTG....------------.............SFPTIVEWLSAYLP.QAWV-L
C5BVW0_BEUC1/45-235EALAGIARASRVCGIVVLVAFVAGAAFGGT....------------..............ALGIALLWLAVLTGWAWL-L
D3Q5U6_STANL/20-208QQRGAAAVVSWVVPVVYLLSSGLAFGLGDF....------------.................RYLLAGGIII.WVWA-A
D2B9K9_STRRD/15-199GKRKGWAIYSTAGGIVYTVLPQTNPELMSL....------------..................LFAVASLIG.WTWI-S
D7AZL9_NOCDD/27-217TGHRGAAAASRVAGTVLLVGNGWAMTGGQY....------------...............GSLTLAVGAVTA.MLWV-S
D2AS92_STRRD/33-219QGRRGWAVASRIVPVAVLAGFAGSAASVLA....------------...................FSAGAALG.LVWL-T
D2PMS1_KRIFD/36-226TCRRGRAVASYATGVLFLAAFAGIASGSAG....------------.............AGVTLAFWAAIVLA.WTWL-A
C8XD39_NAKMY/31-221ERRPVFAAFSAITGIVFLAAFLALAGSGGA....------------.............PVATLAFVGAVVLV.WTWM-T
D2B4R9_STRRD/12-208LGERRWAASCAVTGVALPTIYALSGVLSER....------------.........GENSQPLSLLLRLVALVG.WGWA-S
C8XD67_NAKMY/16-200RGRTGWAVASLLMAVAALLLIFLPGGGGSV....------------..................RSALAVVLT.SAWL-T
A7HVR6_PARL1/16-206TEQLFWAVASLATGIVLPLLIGLGMSMVVA....------------...............PGIAFYWAAMLG.WLWL-A
D3PXJ2_STANL/16-212RSRRGWRLLSIVIGVAVSVTAMAAGLLYRLAT..------------.......VNDVTGAPVGALELTAFVLG.FGWL-A
C5BVM4_BEUC1/10-201.....FAYADAVPAFAIVSGVAAVGLGVASYRF.------------.....GVLWERESRRVGLVQRLYIVAG.WAWV-A
D3Q1F0_STANL/29-225WRQFGWAGYSGLSGLLVAVGIVLSSAGFAQ....------------.........GDLVDIAGLLQRATVAVG.LAWL-T
A4F7D5_SACEN/16-207SGRTGWAWYSVATAVVFLAGFVLAGVGFAQ....------------........NAALLPVAGLLQRLTLVVG.WVWV-G
B8GH43_METPE/42-235DPKWQWFRGPTLAAGAIIAASVILLTLVTKLP..------------......LAPEIFEPWLGLIQRGIIIPF.MIWL-F
Q9RJS0_STRCO/12-187GPAGPWALRLAPSIAVTTLMAAGGVWFLIE....------------.........MRQHGDAGVAERVVTSLQ.SLWP-F
B1VPM0_STRGG/12-188RRPVPWGLRLDVSLAASALMGASALWFLAE....------------.........LQSAGAPGVAERVVTFVQ.ALWP-F
D9T5P6_MICAI/28-216AGRPPWAFRRPVALAVTAVLLALFGWSVAE....------------.........VTGGSRTGLAERVAALAV.TLWP-L
Q0RZC5_RHOSR/71-245EPDAAAACRAPVAIAAAAVLLGLLGWLAGA....------------........AIDGWSLLGLAERVCVFAQ.PVWP-L
C0ZQ51_RHOE4/26-217RNHARCARRTLIAGVISILAFVPLVYALGVDAA.------------.....TGVDWWDVVTFGYTERLIAAAE.AATL-V
C8X6V7_NAKMY/31-224.RRRAAPVTNRASRSAFWLAVASLIWLGVLIGAW------------LISPVTGIPWYRALPIGLVERGLVLCE.VAAV-V
D3Q1Z4_STANL/35-216RLRRAFAVMTLINLVLLILNVWGTYLPDLA....------------..........YGGQWRGIPQRLLVVSQ.VVSI-V
D3Q759_STANL/3-179WRRPALLWLSVTNVVLMALVVINTFFPTFA....------------..........DGRDWRGLPQRLLLFTL.AAVL-V
D2AUN0_STRRD/12-196....RRFRNPALSAVSVLATGLLVAFLAARPGSL------------.....TADLIGGPDYYGLIERLLLLSE.TALV-F
D2B0Y0_STRRD/13-197EDERWRAVARPVEWLALAGGFGLLAITYVA....------------........LPGDRVLIGLVERVLLGAE.VALI-G
C6W8D5_ACTMD/12-195...RAFLPSPPLRRLSILAGFASGAFMLSHTAV.------------......LGAGGGMVLLGLFERVLFVVL.YALL-F
C8XCN7_NAKMY/38-227.RTLADGLRRTLLAVGLVSGALSTALIVNRIPG.------------.....VLGAADLSLPPGLLQRAAGAAQ.IVLA-A
D3EGW1_GEOS4/23-212RLDVWRPMKRVMLTIAMIAIVAMLVFVLQIPQ..------------......DGQFGPEVLAGMFGRFLILAE.ITWL-I
C8XKD4_NAKMY/21-199.RGAPPAARRLALALTALAAVLGVLVIMSATGL.------------.....DTAGLGAGGSWALWQGALVVVE.MILV-T
D9SXQ4_MICAI/13-198FSPATDQGLRRIAAVGAAVALPVAAVVAAAL...------------.......LLVGRSALLGVSERVLLVVV.AAWG-L
Q0SAA4_RHOSR/13-214FRYGWPAWLKITGVAVATVFVGGTIWTLTAAG..------------.......LRGDQDAWLGLGQRVQLLAF.CGWL-I
D3Q0C1_STANL/5-190.....WAWRTVTAWVLSGLMVAATAATMLA....------------.........VATDHLVGVAQRLQLLIV.SAWL-V
D0L9X9_GORB4/20-220WRTPAWPLLRTAGTVVFAIIVLSTAWMLIAD...------------........NLSGNYRLGLAQRIQVGGM.TVWL-V
Q5Z3B7_NOCFA/14-211FRYRRWRVLREFGIAAFLAGAVATVWMLVAD...------------........RLPGEYALGIAQRIQVGAM.SVWL-L
C0ZM54_RHOE4/15-215FRYREHRSLRTTGLTILILTSLATVWMLTTNSI.------------......EVSGGGNLGLGIAQRAQVLGM.SLWL-C
D5UPX7_TSUPD/8-215LRGGNDGALRTARPLTVAAFGAGMTYLITTVWTL------------....AAMAITDPELYLGLAQRLQIAGI.TSWL-V
C6W9M9_ACTMD/22-202......RGTRLPGARVVLILLAGTGVLSAV....------------.........LVNQPGAGLVQRVQLLTV.SAGL-L
D2B4U0_STRRD/15-212LRRRRWPLIGYGGAVLAVLMAVATVWTLAA....------------.........IASGAPVGLAQRFQVAVI.GLWL-L
Q6NEW9_CORDI/11-191....SRSWLAKVGGAGFLLSTVVLLVCTAV....------------............HIPAGFIQRAQVLFA.CVVI-F
C5C1J0_BEUC1/20-217WFHAAAQWVFVLGGVVSALMFAYFTWTATP....------------.........GTSSTAAALSQRLHILTV.SAWL-V
D9TA17_MICAI/14-189.RHPVAGAAAWLRGLTVASLVLAGAMIWSA....------------........YPGDRALLGLIERLLILTE.TAVI-T
G8PFH7_PSEUV/15-189...RAQEGRSYWFVPGLVLFALFLSLMLET....------------.............ALSGLLQRVLETGA.YLWF-V
Q6A8J6_PROAC/18-214RFRGFGLVVTWAWVVFTLLNGIGAVGWFVG....------------..........TPMDYTGIWQRFSLGLG.TLWW-L
Q833X7_ENTFA/13-203SKYGSQKNKNLFGFLFILCMLAAGLYGLARIPQ.------------......LQQVKPFNYLGLWQRVSSFCN.YLPM-L
Q9PBG9_XYLFA/13-195.....LALLSRPGVVMLTWATFIAGLIVAASS..------------.......FGPAERLHPGLVQRIGFAAW.LLWL-M

PF10277

Q7QE61_ANOGA/3-230TFTDEFRTM
Q757Q5_ASHGO/5-206LSYADMEDL
Q75DE7_ASHGO/9-286IVSVDFYMG
Q4WNE6_ASPFU/5-224SFVVDLLPS
PGAP2_CAEBR/12-239TLYYDFHGK
A5DLG3_PICGU/121-352MWSMDLFPS
A5DAL2_PICGU/21-231WSVVDFADI
CWH43_SCHPO/11-220ALYWDFKPL
A8WTJ4_CAEBR/43-270IAYFEFPKT
Q7S513_NEUCR/18-228VTALDFDTF
Q4PAD1_USTMA/365-592ASVYDLSRF
Q5RGJ7_DANRE/7-226TYIQEFQQF
Q6FIN1_CANGA/8-284IISADFYLG
T150B_BOVIN/4-207LLAVDFSRL
T150A_MOUSE/3-232TFSYEFGTI
A7TMD9_VANPO/12-290SISVDFYLG
Q6FKB5_CANGA/8-272IISWDFYMG
Q7PN15_ANOGA/41-264TAYWDFINA
Q4E2S1_TRYCC/9-251TLWFELKKT
Q9XWR3_CAEEL/44-269CAFFDIRYK
Q2UMD7_ASPOR/5-224SFVVDLLPS
Q16JU8_AEDAE/31-253TAYWDFISA
O77262_DROME/3-230SFTNEFRDV
Q559G4_DICDI/11-218TFFYEFSNL
A1CK70_ASPCL/15-225VTALDFEAF
A2FGB6_TRIVA/10-214CMQYDIPGH
Q54J51_DICDI/6-269LTYLDFDGL
A8X4A4_CAEBR/10-248SFTPEFEDI
Q93319_CAEEL/9-241SFGPEFEDI
Q17MC8_AEDAE/70-299TTMLDFPTE
T150B_HUMAN/4-206LLAVDFSAL
Q6CDS5_YARLI/4-220ILAFDLIPF
DRAM2_MOUSE/7-233TYIRDFQKI
Q4PDK8_USTMA/9-236TYLVDLWPA
Q01D47_OSTTA/14-220TVSWDFDDK
T150C_BOVIN/8-218TFAVEFRHY
A5DS39_LODEL/32-242WSYIDFQTI
A7S3L1_NEMVE/7-240TFFGEFRSI
PGAP2_DROME/19-240TSYWDFYAL
DRAM1_MOUSE/7-226TFIQDFQSV
Q6BKM3_DEBHA/21-231WSVIDFADM
A3GGF7_PICST/12-243MWSIDLFPS
A5E3J3_LODEL/22-254LWSVDLIPS
Q22Y36_TETTS/100-306TFATDLKDF
A7RFU0_NEMVE/9-235TFFDEFQLI
A7RNE7_NEMVE/10-236TVAIDIGGS
Q6CTH9_KLULA/8-279IVSVDWYIG
Q5AF82_CANAL/13-246MWSMDLLPS
E9ADF4_LEIMA/115-359SAWFDLKQE
SFK1_SCHPO/21-232LLCLDLAPA
Q9VPT6_DROME/29-248TVYFDFYHV
A7SJV3_NEMVE/4-240SFHGDFKTF
T150B_DANRE/3-204VFAAEFRHI
A4RTY8_OSTLU/13-222TMAWDLDAK
T150B_MOUSE/4-207FFAVDFSIL
Q3V5H7_CAEEL/25-251CVYWDIQHK
Q6C3N0_YARLI/30-239VTVLDFSAL
T150B_XENTR/4-203LFSVDFWH.
F1R7U0_DANRE/9-235TYIRDFKKI
H0YDZ3_HUMAN/110-331TAWWDFGN.
H3CLF5_TETNG/33-253TAFWDFGN.
H3D1L8_TETNG/4-231TFTYEFGT.
SFK1_YEAST/10-286ILSADFYL.
Q1K6P7_NEUCR/10-223SFWIDLYP.
T150A_XENTR/4-231TFAYEFGS.
DRAM1_XENTR/10-226TFIRDFQG.
Q5KJS6_CRYNJ/27-255TIAADLWP.
PGP2L_DROME/75-300TIIWDFP..

PF06197

B5HBV4_STRPR/2-171VVVAS----
Q6L2X2_PICTO/12-188LYMIS----
Q9HJI2_THEAC/17-194IYVLS----
A8MCR4_CALMQ/13-182AATIL----
Q970R2_SULTO/9-177LSFLD----
A1RZ19_THEPD/13-186VATLH----
Q9Y8U9_AERPE/10-184ILTLD----
Q5JHD7_THEKO/10-182AVLSK----
Q8U4E0_PYRFU/10-182IILLK----
Q9HK23_THEAC/11-184SAGSI----
A2BLJ9_HYPBU/14-183LHARE----
Q8ZU94_PYRAE/9-176VYGVA----
Q5V2H6_HALMA/24-206AFGGY----
Q8DVX1_STRMU/11-196LLCVM----
A9KKH9_CLOPH/12-200ILSWV----
Q21FK4_SACD2/11-194GVSVT----
D1CAZ9_SPHTD/27-219VLAVG----
A0JTJ1_ARTS2/34-213VLATA----
D9QLM9_BRESC/12-196AFGWA----
A4AMV1_MARSH/11-200TVAFY----
Q28UV2_JANSC/25-202LLGWM----
A8LJU0_DINSH/25-202ILATA----
D9QK37_BRESC/20-202VAAHL----
Q0W5U1_UNCMA/16-197LFCWH----
C5BVW0_BEUC1/45-235AVCVT----
D3Q5U6_STANL/20-208AVTAD----
D2B9K9_STRRD/15-199TISIH----
D7AZL9_NOCDD/27-217AVAAL----
D2AS92_STRRD/33-219ATTAR----
D2PMS1_KRIFD/36-226ATLQH----
C8XD39_NAKMY/31-221MVAID----
D2B4R9_STRRD/12-208LLAVR----
C8XD67_NAKMY/16-200GLARL----
A7HVR6_PARL1/16-206AVLIV----
D3PXJ2_STANL/16-212MVAWR----
C5BVM4_BEUC1/10-201ALCLV----
D3Q1F0_STANL/29-225ALAVH----
A4F7D5_SACEN/16-207ALAAH----
B8GH43_METPE/42-235VFALG----
Q9RJS0_STRCO/12-187VVAAS----
B1VPM0_STRGG/12-188LVVVS----
D9T5P6_MICAI/28-216AAVLS----
Q0RZC5_RHOSR/71-245AVAIT----
C0ZQ51_RHOE4/26-217VIGKW----
C8X6V7_NAKMY/31-224AVGVW----
D3Q1Z4_STANL/35-216AMAFV----
D3Q759_STANL/3-179MLASN----
D2AUN0_STRRD/12-196LAARG----
D2B0Y0_STRRD/13-197VLAVR----
C6W8D5_ACTMD/12-195TLAAA----
C8XCN7_NAKMY/38-227LLGLG----
D3EGW1_GEOS4/23-212VVGVH----
C8XKD4_NAKMY/21-199VLAVV----
D9SXQ4_MICAI/13-198VTSGY----
Q0SAA4_RHOSR/13-214FVALS----
D3Q0C1_STANL/5-190WLALR----
D0L9X9_GORB4/20-220LWGVT----
Q5Z3B7_NOCFA/14-211TLAAA----
C0ZM54_RHOE4/15-215TLAFA----
D5UPX7_TSUPD/8-215LIALP----
C6W9M9_ACTMD/22-202LGARV----
D2B4U0_STRRD/15-212LPGVA----
Q6NEW9_CORDI/11-191AASTI----
C5C1J0_BEUC1/20-217CLGVL----
D9TA17_MICAI/14-189TLALH----
G8PFH7_PSEUV/15-189LILL.----
Q6A8J6_PROAC/18-214ILA..----
Q833X7_ENTFA/13-203AL...----
Q9PBG9_XYLFA/13-195LAGWR----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window