Sequence alignment for CL0412

PF10277

Q7QE61_ANOGA/3-230NLYL....LPISVFLLFNFTFIGTYIAAVL.QG.HVVPT...........................VPYISD..AATY--
Q757Q5_ASHGO/5-206NGKH....IVHLHSLFASSAFICALVVGYQ.LH.FHKIVRNAHYGYPD................EWFPSVSA.TIGDR--
Q75DE7_ASHGO/9-286YFFL....VPWIAVIPWCGMLIAMLVCWSV.QGHPI.YWFMD.GDQF...................PVYISD..IGAT--
Q4WNE6_ASPFU/5-224SFWI....FPVISAGMWLAMLLAMLGNWAV.IGTPI.YPSME.AGQT...................IAYISD..IGAQ--
PGAP2_CAEBR/12-239PFKY....FVFCIGGLPSSALLICVLLSLF.LH.FDQATSTHCEVAN..................WLPSISA.AVSTY--
PGAP2_HUMAN/79-302RFTA....MVWWAITFPVFGFFFCIIWSLV.FH.FEYTVATDCGVPN..................YLPSVSS.AIGGE--
PGP2L_DROME/96-324SFHE....LCVVTALLPLVTLFTCFVTAYV.FQ.YDDVHETHCRVYN..................IIPSISA..ITGV--
A5DLG3_PICGU/121-352HYYL....VPLVALVVWWGMLTAMLICWGV.QG.RPVYSFMD.EKQN...................PVYISD..VGAT--
Q0U0X0_PHANO/1-149MLF...........................................................................--
A5DAL2_PICGU/21-231NGSW....VAYAHAFFAYSAFFAALIVGCW.LH.YHKIVKNASFGYPD................EWFPSVSA.TIGDR--
CWH43_SCHPO/11-220SAQY....VALVHTICSFAAFFIPLALALY.TH.YYQVVKNEFYGYPE................EWFPSVSA.TIGDW--
A8WTJ4_CAEBR/43-270IRWL....VCLGALLPGAGCYFVVAYTYVF.QF.EKVSNFTECKECPNL..............NITLPPVSY.SIGIW--
Q6FKX5_CANGA/5-205NAKL....IVAAHTVCAASAFLAALVTGYN.LH.FHKIVENAHYGYPD................EWFPSVSA.TIGDR--
Q7S513_NEUCR/18-228NGQW....ISWTHTVVAYAAFLSALIIGCA.LH.YHKIVKNEWYGYPD................EWFPSVSA.TIGDR--
Q4PAD1_USTMA/365-592SGGL....ISHIHTVMGFLAFFGALITALS.LH.YPKVVKNHVAQYPD................EWWPSVSA.TIGDW--
Q5RGJ7_DANRE/7-226GMCF....LPTFLVIWSSSTFIISYIIALY.RQ.DVDVV...........................LPYISD..TGAT--
Q6FIN1_CANGA/8-284YFFI....VPWIAFIPWYGMLIAMLICWAA.QGHPI.YWFMH.TEQF...................PVYISD..IGAT--
Q4SVF4_TETNG/19-241PFTS....FAVGTVLLPLTGLIACLFISLV.YH.FEDATYTHCHVSN..................YLPSISA..AISR--
T150B_BOVIN/4-207YLSL....LPMCLAFWAIAGIWTVFSLAVV.NK.AVNLTDG.........................FPYISV..CGNV--
T150A_MOUSE/3-232AWIL....LPVSLSAFSITGIWTVYAMAVM.NR.HVCPVENWSYNESCSPDPAEQGGPKSCCTLDDVPLISK..CGTY--
A7TMD9_VANPO/12-290YFFI....VPWIAFIPWWGMLIAMLACWAG.QGHPI.YWFMN.GDQF...................PVYISD..IGAT--
Q6FKB5_CANGA/8-272WFFV....VPWIAFIPWYGMLITMLVCWAA.QGHPI.YWFMH.TEQF...................PVYISD..IGAT--
Q7PN15_ANOGA/41-264RFGR....LAVATVMLPVAGFLFCVIWSLL.YN.FEQANATHCLVYN..................FLPSLSA.AIGNY--
Q4E2S1_TRYCC/9-251RSSY....AALIYAIIVGTGILFTLFVGIW.KH.HDELLYTHCRVPE..................YWPSIST.LTGDF--
Q5DAX3_SCHJA/13-237GLHL....LPILVCILSLVAVTTCYFLSLT.QD.HISPY...........................FPYISD..AGSK--
Q6IQJ3_DANRE/3-232LWVL....VPISLPIFTLPGIWIIYAMALH.NQ.HVCPVNNWVYNSTCEKSLDLQRGSDLCCTLDNIPLISK..CGGV--
Q9XWR3_CAEEL/44-269PVE.....VFLAGFIPPMFGSISAIAIALI.FH.NDEISNYNWQCGRA.................RLPSLSR..IINL--
Q4SA40_TETNG/3-249AWIV....LPVSLSAFSITGIWIVYAMAVM.NH.HVCPVENWSYNLTCTKELPRPGFPKSCCTIQDIPLISK..CGSY--
Q2UMD7_ASPOR/5-224SFWI....FPVISAFMWIAMLLAMLGSWAV.QGTPV.YSSME.EGQT...................IAYISD..IGAQ--
Q16JU8_AEDAE/31-253RFGK....LAVITVLFPVVGFLFCVVWSLL.YN.FDQANATHCMVYN..................FLPSLSA.AIGNY--
PGAP2_XENLA/19-242RFTT....FAVSTVCLPLFAFLFCIVWSLL.FN.FSETTETHCHVPN..................YLPSVSA.AIGGE--
T15BB_XENLA/3-204AWAL....LPICLTVWATGGIWIVYAMSVS.NG.SVNLSDG.........................FPYISV..SGTY--
Q54KE7_DICDI/3-196KKIL....FFLLASITPL.TLILSYILYFK.QN.PYENQDT.........................VPYISD..TIEY--
Q5DGL6_SCHJA/9-235GLQW....VALLLALIMSSTVLMTYLISVN.RG.HVNAE...........................LPFISS..TGAY--
Q4SKZ5_TETNG/531-722LWAI....LPISLPVLTITGIWVVYAMALY.NQ.HVCPVDN.............................CK..CGAL--
O77262_DROME/3-230QVYL....LPVLTFLIFQVTFLGTYIFAVL.EG.HVVPT...........................VPYISD..AATY--
Q559G4_DICDI/11-218PFYI....LCIISLIVPI.TFITTYAITEV.RG.DDDQI...........................IPYISD..TIDF--
A1CK70_ASPCL/15-225NGKW....VSWTHTIVAYTAFLSALVVGMS.LH.FHKIVQNEHYGYPQ................EWFPSVSA.TIGDR--
A2FGB6_TRIVA/10-214F.......LYYFGSIFPFTIVIISWICYYS.LG.HYTKGK..........................IPYISD..TVVK--
Q6CX54_KLULA/5-205RGSV....IAWTHTVCAASAFIAALVVGYT.LH.FEKIVANAWYRYPD................EWFPSVSA.TIGDR--
Q54J51_DICDI/6-269SASL....LPLSYGIIAMGSFITTLFLACY.LH.FERVTKNHCKMYE..................FLPSISS.TIGDF--
A2DNY5_TRIVA/47-242LISVPIFAFPLCVGIVCLGLFIMEGRLSGY....................................LPTISE..SGTE--
A8X4A4_CAEBR/10-248GFGP....VPTFIGLIFAVQMIIVYVIAVL.KK.DVDAV...........................LPYISS..AANK--
Q93319_CAEEL/9-241GFGP....LPVLIALIFFVQSFFVYTIAVL.KH.DVDPI...........................FPYLSS..AADK--
Q17MC8_AEDAE/70-299SFRD....ICVFTLVLPLGTLFVCFVSAYV.FQ.PEEIHETHCRVYN..................VIPSISA..ITGV--
T150B_HUMAN/4-206YLSL....MPVFLAVWAISGVWIVFAIAVT.NR.TVDLSKG.........................FPYISI..CGSF--
Q6CDS5_YARLI/4-220FLWI....VPLFACVVWWGMLIALLAAWAA.QGKPI.YDFMDPDDK....................VAYISD..VGAT--
DRAM2_MOUSE/7-233GLSF....LPSALVIWTFATFIFSYITAIT.LH.HVDPA...........................LPYISD..TGTI--
Q550K4_DICDI/13-193PTFL....LWIIVILVPV.TLITTYTMTDE.LH.PDSQI...........................IPFISS..SINN--
Q1N1S1_9GAMM/4-214LTG.....IPLICLLLSQGTIIISYLISIQ.FDRPKVETCNPFLQG....................CLNITD..AGIY--
Q8QGB2_ONCMY/7-226GICF....LPISLVIMSSSTFIVSYLIALF.EH.DVDVI...........................FPYISD..TGAE--
A6ZTJ7_YEAS7/5-207NGKI....IPIAHTICAFSAFFAALVTGYS.LH.FHKIVTNAHYTYPD................EWFPSVSA.TIGDR--
Q4PDK8_USTMA/9-236LFYL....LPIATFACWTTAIVGLLVIWAV.RDRFREYES...EEAS...................VVFISD..VGAQ--
Q01D47_OSTTA/14-220AST.....LVRCACLGTLACLVIAYGFATT.QS.RIASDA..........................FPIISE..TFMG--
T150C_BOVIN/8-218VWMF....LPLVFTVFTSAGLWIVYFIAVE.DD.KIFPLNSAERKPGV................KHAPYISI..AGDE--
A5DS39_LODEL/32-242NAKW....ISFAHTFLASLSFLAALVVGVY.LH.YHKIVENASFGYPD................EWMPSVSA.TIGDR--
A7S3L1_NEMVE/7-240SFAL....LPALLAILSISTFILTYTVSLV.ED.DVSPW...........................FPSISQ..TGDK--
PGAP2_DROME/19-240PFAR....LALVALSLPLGGFFFCVIWSLT.FD.FVRSTYTHCDVTN..................YLPSVSA.AIGNY--
DRAM1_MOUSE/7-226GMAF....VPFLLVTWSSAAFIISYVVAVL.SG.HVNPF...........................LPYISD..TGTT--
Q28IE8_XENTR/3-227GWVL....LPVTLPAFTITGMWIVYAMALS.NN.HICPVSNWIYNNTCDSLEDG.....ACCTMDHIPLVSK..CGNL--
A6SR76_BOTFB/5-222SYWM....IPVFSGMVWLAMLLAMLLTWVVADGSPI.ITPMD.DGQT...................IAYISD..IGAH--
DRAM1_XENLA/8-227GAAF....LPSILVIWSSAGFLFSYIISVL.IG.HVPPF...........................VPYISD..TGTS--
Q6BKM3_DEBHA/21-231NASL....IAYAHGIFAYSAFLAALVVGCW.LH.YHKIVENSSFGYPD................EWFPSVSA.TIGDR--
Q55T17_CRYNB/25-255PYIL....LPILATTVWFGGLTALMVLWVD.AGKPR.YDS...EVAS...................IAFISD..IGGA--
A3GGF7_PICST/12-243HYYL....IPVVALVVWWGMLVALLVAWYI.QGTPK.YSFMK.HNQS...................PAYISD..IGAT--
A5E3J3_LODEL/22-254HYYL....IPIIALIVWWGMLIAMLACWGA.QGRPI.YKFMNGDYQN...................PVYLSD..IGAT--
Q5DF06_SCHJA/6-229TFRH....ICLATSSLPLIALLICVLLCLF.TN...SCIKTHCTDTN..................ILPSLSA.AVGDD--
A7TRI4_VANPO/5-205NGKI....IPLTHTICAAAAFLVALIVGYS.LH.FHKIVENAHYGYPE................EWFPSVSA.TIGDR--
Q22Y36_TETTS/100-306VSMM....VNISCYLAAF.AIFITYVVACS.LG.HQQW............................FPCMIT.SAGTD--
Q55M70_CRYNB/8-234PAKW....VTQAHTLIGSLAFAVTLFVGWA.SGLWQPLCTNSVAKWPV................EWFPSVSATSIGDH--
T150A_XENLA/3-232GWIV....LPISLTAFSIPGIWIVYAMAVM.NH.HVCPVENWTYNLTCTDDNTKAGTPKSCCTLEDVPLISK..CGTY--
A7RFU0_NEMVE/9-235GCGY....LPLFWCLFTCFTFVLCYAIAVN.TG.HIYPF...........................VPAISD..TGAQ--
A7RNE7_NEMVE/10-236RGSS....VIALACALPFGSFVICILLSIF.LH.WDQVTKTHCNVPN..................YVPSISA.ATGDF--
Q6CTH9_KLULA/8-279YWFI....FPWIAFIPWYGMLIAMLACWAG.QGHPI.YWFMH.TDQF...................PVYISH..IGAT--
Q96U46_NEUCS/3-220LFQI....FPIISGVVWLGTLLGLLIYWCT.DENRRHYASMD.ARQT...................IAYISD..VGAS--
Q5AF82_CANAL/13-246HYYL....IPIIALIVWWGMLIAMLSCWGA.QGRPI.YSFMNGEYQN...................PVYISD..IGAT--
Q55WH1_CRYNB/26-256PYVL....FPIAAALTWLGGILALLGLWVV.AGKPR.YRS...NEAS...................VVFISN..VGAT--
E9ADF4_LEIMA/115-359PSSY....AALIYALTTGYALFACLYMAGV.LH.WRDIIVTSCGEDHY................EFWPSISA.TVGEM--
A6ZZR5_YEAS7/10-287WLFI....VPWIAFIPWYGMLIAMLICWAS.QGHPI.YWFMH.SEQF...................PVYISD..IGAT--
Q6IQI0_DANRE/7-234GLCV....LPVALVVWTAATFIFAYITAVV.LR.HVDPL...........................VPYISD..TGTV--
SFK1_SCHPO/21-232FFIL....FPLVSFLMWTIGLIVLLGLWST.QD.KWHTPSEPD.......................PVYLSD..MGAY--
Q9VPT6_DROME/29-248VGPI....LALGLLQLPV.CMVYNLVMAIT.TD.FQSTTYTTCNAFN..................IFPSTSA....AA--
A7SJV3_NEMVE/4-240FVRW....LPAISCSLLLTSIVVSYSCAVA.LG.QVHPL...........................FPKISL..TAAY--
T150B_DANRE/3-204AWAL....LPVFLAVFGTVGLWAVYAIAVS.NN.SVNITIE.........................FPYIST..CGAY--
Q86F93_SCHJA/5-228PVHY....FIIAFIVAIVGTFCISYLISTS.DN.HASIL...........................FPYISD..TGAL--
A4RTY8_OSTLU/13-222ASA.....LVRVACASTVACIVTTYAFATS.QS.AIATNV..........................FPIISE..TFTG--
T150B_MOUSE/4-207YLSL....LPVILFLWAIAGIWIVFAIAVV.NG.SVDLNEG.........................FPFISI..CGSY--
Q3V5H7_CAEEL/25-251TTL.....LFWVGFVPPLFAAVFAILTAII.LH.QDKITNYAWICGRA.................FLPSLSR..IINL--
Q6C3N0_YARLI/30-239NGKY....VGWAHTIVAMSAFLGALIIGCA.LH.YKKIVQNEHFGYPD................EWFPSVSA.AIGDR--

PF06197

B5HBV4_STRPR/2-171--------VLVGGW......TVAALLQGPA----Y.DPA---------------------------TQTISV--LAAYG.
Q5JHY1_PYRKO/12-178--------LTGGIVYWLF..VAWSISR.NG----WFSFF---------------------------HNALSD--LGDPS.
Q8U0G5_PYRFU/9-174--------FIGGIVYWLF..VSWSIHY.NP----WFSFF---------------------------ENVLSD--LGDPA.
Q6L2X2_PICTO/12-188--------GITIIFIWIV..IMASAIV.NP----WFSIT---------------------------KNALSD--LGGGNL
Q9HJI2_THEAC/17-194--------SIAIASAWIT..ILISALL.NP----WFSVT---------------------------HNALSD--LGGGNL
Q97BH7_THEVO/15-193--------IAAIICAWLT..IAISIHF.NP----WFRIN---------------------------VNALSD--LGGGNF
A8MCR4_CALMQ/13-182--------IAAAVLAWVI..ILTSISL.NP----WFNMF---------------------------SNALSD--LGNPH.
Q970R2_SULTO/9-177--------FISAILAWII..IFASISL.NP----WFNFT---------------------------KNAFSD--LGGPF.
A1RZ19_THEPD/13-186--------PLAFAAFPVV..VYFSASS.NP----WWSLY---------------------------KHAFSD--LGGPR.
Q9Y8U9_AERPE/10-184--------PAAALVAWLV..IGVSWAVNSD----WFVFT---------------------------EHAFSD--LGGVK.
Q5JHD7_PYRKO/10-182--------LIAPLVAYSG..ILTAIYVNRS----WWRLT---------------------------DNAISD--LGKLG.
Q8U4E0_PYRFU/10-182--------IIGPIIAYLG..ILSAIYVQRS----WWRLT---------------------------ENAISD--LGKIG.
O58000_PYRHO/24-191--------IIGPGISVGG..ILISYLIHRD----WWGIT---------------------------ENAISD--LGRIG.
Q9V235_PYRAB/6-172--------ILGPIIALAG..VVFAYLLNRD----WWSIT---------------------------ENAISD--LGRVG.
Q9HK23_THEAC/11-184--------VIGPVITILF..ILIDVAVSPW----F.SWS---------------------------RNALSD--LGV...
Q97AI7_THEVO/15-188--------IVGPIFAISL..VFIDVAVSPW----F.TWQ---------------------------HNALSD--LGV...
Q9V1S7_PYRAB/6-155--------SIALTLYFIL..GLALVVHENS----WFSFS---------------------------KNALSD--MGSLR.
O59449_PYRHO/6-155--------TIVMVIYFII..GLALVISQNP----WFSFT---------------------------KNALSD--MGSAK.
Q8TZZ1_PYRFU/8-157--------PIITAVYFAV..GLSIVISNNP----WFLFT---------------------------KNALSD--MGSIQ.
A3DLK8_STAMF/12-179--------IIFILSFSFPLTMIALAISMSS----WFNIW---------------------------NNALSD--LGHAV.
A2BLJ9_HYPBU/14-183--------VAGPLIPLAG..IAVAATLASG----WWSFW---------------------------DNAFSD--LGNPRY
Q3SA92_9EURY/13-189--------FLYQPVFLVF..TLTSIYLHPG----F.NLR---------------------------EHAVSD--LGAMG.
A4YES6_METS5/12-174--------ALGVMQFWIL..MLIAEELYPG----Y.NLN---------------------------NNYISD--LGV...
Q96ZU3_SULTO/14-171--------LIGISQFLLL..MIIAEILYPN----Y.SVK---------------------------YNYISD--LGV...
Q97UA8_SULSO/14-171--------LVGVSQFLLF..FIISEILYPN----Y.SVK---------------------------YNYISD--LGV...
Q4J885_SULAC/12-172--------LIGTSQFLIL..MIVAEALYPG----Y.SVK---------------------------NNYISD--LGV...
A4WJI6_PYRAR/3-170--------AIGSLQFIIA..MLVAEQLYPG----Y.NPL---------------------------HNYISD--LGALK.
A3MT35_PYRCJ/9-176--------ALGSLQFIVA..MLVAEQLYPG----Y.NPL---------------------------HNYISD--LGALK.
A1RR81_PYRIL/8-175--------VLGSLQFIVV..MLIAEQLYPG----Y.NPM---------------------------YNYISD--LGALK.
Q8ZU94_PYRAE/9-176--------TIGSLQFLIS..MAAAERLYPG----Y.DPL---------------------------RNYISD--LGSLN.
Q5V2H6_HALMA/24-206--------TLAGFIGFMG..IITAEVLYPN----Y..ST---------------------------RQDISD--LGSTRP
A3CTX5_METMJ/16-189--------FLLPVQFMIA..LMAGAAMAPG----Y.SIN---------------------------LNAISD--LGVT..
Q8DVX1_STRMU/11-196--------ILCLVLYFYC..MVILHLKNKG----VYHPM---------------------------THAVSD--YGI...
C6LHE9_9FIRM/14-201--------IISLLSYTAA..VIFSPAAYPG----Y.DWM---------------------------AQAVSD--LSADN.
A9KKH9_CLOPH/12-200--------MIGVLSFLLL..DVFGKILWPE----Y.NPI---------------------------TTYVSK--LVTDE.
A4C406_9GAMM/11-199--------LIATIWIFIG..VYVASRFYNG----Y.SHS---------------------------KQFCSE--LGATG.
Q21FK4_SACD2/11-194--------VLAAFWIVMG..VAIAGARYPG----Y.SHL---------------------------RQLCSE--LGAAG.
D1CAZ9_SPHTD/27-219--------IAGSAWWVAI..DMVGSIRYPG----Y.SYA---------------------------DQVVSE--LSAEG.
A0JTJ1_ARTS2/34-213--------ALSSLLYVIA.TDGLAASMWDG----Y.RRT---------------------------EQMVSE--LFAVG.
A9EN54_9RHOB/14-198--------VISGLWLAIG..VGILAALSPG----Y.SHV---------------------------SHFMSV--LGAAG.
B6R5G7_9RHOB/17-195--------AMSYLWLVTT..VAIGAQFYPG----Y.SHI---------------------------SHFMSV--LGATG.
A3Y9R4_9GAMM/13-198--------ILSLVWFAGT..IIIAGLYYPG----Y.SHI---------------------------TQFISE--LGATG.
A4BDB6_9GAMM/24-208--------VVSLGWLVIA..ILLAGAAYPG----Y.SHL---------------------------TQFMSE--LGATG.
D9QLM9_BRESC/12-196--------LLGEGIQLAA..IVIGGALYPG----Y.DHL---------------------------RQYISE--LGATGA
A4AMV1_MARSH/11-200--------SVGVFLFIIA..AIIGGLQIEG----Y.SHI---------------------------SQYISE--SYANG.
Q8PIW3_XANAC/13-196--------LIAATVFVLA..LAGFGVTLPG----Y.LQA---------------------------SHPVAL--LGAQG.
B0U375_XYLFM/12-195--------TIAAALFTAS..VTGFALALPG----Y.QHL---------------------------LHPVAL--LGAPG.
Q28UV2_JANSC/25-202--------IIGCIIGILG..VIVAQAMVPG----H.DWI---------------------------ADTISD--LGA...
A8LJU0_DINSH/25-202--------VIGVGALLTG..TVIGPLFVPA----H.DPM---------------------------ADTISD--LAA...
B7RKC5_9RHOB/26-203--------IFGSICLLVG..NIVGSMVVPN----H.DWV---------------------------ADTVSD--LAA...
Q2CCU1_9RHOB/24-201--------WLGCVSLVAG..TLIAPFYVPN----Y.DWV---------------------------ADTISD--LAA...
A3SUZ6_9RHOB/25-202--------IFGCILFSGM..ILIADFVVPG----H.DWI---------------------------ADTISD--LGA...
A9E2D4_9RHOB/9-186--------IIGCVVFAVS..ILIADFVVPD----H.DWI---------------------------ADTISD--LGA...
A4ELQ4_9RHOB/25-202--------IAGCVIFTIS..ILIADFVVPD----H.DWI---------------------------ADTISD--LGA...
D0D590_9RHOB/30-207--------IFGCVALAVS..IVIADFVVPD----H.DWI---------------------------ADTISD--LGA...
B6BBN4_9RHOB/25-202--------VLGCVLLAAS..VIAAGVIVPG----H.DWV---------------------------ADTISD--LGA...
A3WAS2_9SPHN/25-205--------IGGCLISVIM..DFIGTGMSEQ----V.GIM---------------------------RDTISD--LAASKD
A3IX19_9CHRO/26-204--------IASNLIVVLT..DFIGIIVVDS----Y.NPI---------------------------KQTISN--LAI...
B8KPW0_9GAMM/11-188--------VVAGVVFMLA..AHITALLLSG----Q.SAV---------------------------SSPISQ--LSR...
D9QK37_BRESC/20-202--------VAAPVVALVA..VLIAAAAYAG----F.DHA---------------------------RQYLSE--LGGAT.
Q0W5U1_UNCMA/16-197--------MAATAAFVLF..TLIAVYLYPG----PFSPL---------------------------ESTVSH--LGNPSA
C5BVW0_BEUC1/45-235--------VVVGPFYVVV..SLAQALTRDG----F.DLS---------------------------RHALSQ--LAL...
D3Q5U6_STANL/20-208--------AIGGPLFSLV..VVAQELTRPG----F.DPK---------------------------VNALSQ--LST...
D2B9K9_STRRD/15-199--------VIATPLFFTV..AFAQAFSRDG----F.DLS---------------------------RHMLSQ--LAM...
D7AZL9_NOCDD/27-217--------ALAAPLWAAV..SLAQAAAREG----F.DLT---------------------------RHPLSA--LST...
D2AS92_STRRD/33-219--------IAAGPLFLAV..GVIQGLTREG----F.DFT---------------------------RNAISQ--LSL...
D2PMS1_KRIFD/36-226--------VLAGPLNLVV..VTAQALTRDG----F.DPR---------------------------KHAGSM--LTL...
C8XD39_NAKMY/31-221--------VIAGPFYVAV..ALAQALTRHG----F.ELS---------------------------RHSWSL--LAN...
D2B4R9_STRRD/12-208--------AVAGPLFIVL..VLIQDYTRPG----F.DPR---------------------------RQPLSL--LSL...
C8XD67_NAKMY/16-200--------VVAGPLFVGV..TAAGVLTRDG----F.DLR---------------------------RHGISL--LSL...
C4RF79_9ACTO/74-259--------ALAGPVFFTT..TTVQAATRDG----F.DIT---------------------------RHPISQ--LAT...
A7HVR6_PARL1/16-206--------IVAGLLFFVV..PTILVFTRPG----F.DIE---------------------------RHAISM--LSL...
E8T0T3_GEOS2/14-211--------IAAPLLLNGV..ATIDALTRPE----F.SII---------------------------RHWISH--QSL...
D3PXJ2_STANL/16-212--------VVGPLLLLLV..ILADGATRPG----Y.SPW---------------------------SHGVSQ--LTQ...
C5BVM4_BEUC1/10-201--------AVGAVLFVVV..FTVDGATRPG----Y.RPA---------------------------EHAVSA--LAL...
D3Q1F0_STANL/29-225--------IVAGPLFLAV..AIVAGFTRED----Y.DPA---------------------------RHPVSS--LSI...
A4F7D5_SACEN/16-207--------LAGAVLFVVV..FLVAGALRPG----Y.SAL---------------------------RHPVSS--LAL...
B8GH43_METPE/42-235--------MAGSMLFAGA..FTIEGWFHPG----Y.NPL---------------------------SMYVSV--LSL...
B4SM32_STRM5/13-185--------LVPLPWFLFW..TSVAAVFAPG----Y.NPL---------------------------AQHASE--LLQ...
Q9RJS0_STRCO/12-187--------SGCAPVLLIAGWTGAAYAEGAS----Y.DPV---------------------------SQTISV--LGAYG.
B1VPM0_STRGG/12-188--------SGCAPVLLVGSWMIAQTRQGPE----Y.DPA---------------------------RQTLSV--LASYG.
D9T5P6_MICAI/28-216--------AAAAPALLVAGWTVAGARQGPG----Y.DPV---------------------------RDTISE--LAGEG.
Q0RZC5_RHOSR/71-245--------AALSPVILVVTATAARWMQPPG----Y.SPL---------------------------GQTLST--LAAH..
C0ZQ51_RHOE4/26-217--------VIVSIVLFLS..LDVHAIVTTG----..SRL---------------------------EPTISA--HGL...
C8X6V7_NAKMY/31-224--------LLGPLVAAALVGALHVLPETEA----I.SPI---------------------------RRTISE--YAL...
D3Q1Z4_STANL/35-216--------LVAGILTMAI..LIAMHVIMAD----QVRVN---------------------------IDPVSV--FAIN..
D3Q759_STANL/3-179--------IAGVVLAAAS..FVFMFVAMPE----V.DFL---------------------------RHPVSI--YENKQ.
D2AUN0_STRRD/12-196--------MAGAAAAAAS..TACAHVAAAG----AVDPM---------------------------KSLTSD--YALL..
D2B0Y0_STRRD/13-197--------CAGIVIAAVA..TVIGQIDPDP----YLDPL---------------------------NLTISE--YAA...
E8RZG0_MICSL/12-189--------LGGIVLAAVL..AMVGHLEVSD----DLDPW---------------------------SLTVSD--FAV...
C6W8D5_ACTMD/12-195--------VAALVVSPFP..VVYLHLSSGG----TISPV---------------------------QNTISD--YVSV..
C8XCN7_NAKMY/38-227--------LAGAVASVPP..IAALHLDAPS----GTSMA---------------------------RTTISD--VVVTT.
D3EGW1_GEOS4/23-212--------IFSGALFVLL..LCSLHLLQPE----F.DPT---------------------------WRFISE--YAL...
B4SRG7_STRM5/12-194--------MVALLLFVAT..ALWTQFARTD----L.DWV---------------------------RATLSL--YLH...
Q3BVQ6_XANC5/87-268--------AIAGMVFIGL..VLVLQWLRRD----L.WWV---------------------------DAQLSA--YLH...
C8XKD4_NAKMY/21-199--------ACTALGWLLW..VALQVLTDDP----F..PP---------------------------EISVSQ--YGL...
D9SXQ4_MICAI/13-198--------FAAVCLAAGAAAVTVAVIAGPG----..PGP---------------------------IAYVSE--AGI...
Q0SAA4_RHOSR/13-214--------LILGAIGYAS..WLLEFVLDTG----I.DPL---------------------------RGYASE--LAAAD.
D3Q0C1_STANL/5-190--------LLASGVVYAS..WLLGGWVNPG----L.GPV---------------------------VSYASE--LAASD.
D0L9X9_GORB4/20-220--------IAAAGICYSS..WVLEFLWPSP----L.DPF---------------------------RSFLSE--LDAQH.
Q5Z3B7_NOCFA/14-211--------IAVAGLSYSA..WVLQFVLPVH----A.DPV---------------------------HSFLSE--LDAEG.
C0ZM54_RHOE4/15-215--------LALGGIVYSS..WILEFFLDTG----L.DPV---------------------------TSFLSE--LDAEN.
D5UPX7_TSUPD/8-215--------IIAGAIFYSA..WIFAPTMGSR----L.NGL---------------------------RSYVSE--VAA...
C6W9M9_ACTMD/22-202--------LVAAAVLYAC..WLLELVLPTG----L.SVV---------------------------DGYVSE--LLADD.
D2B4U0_STRRD/15-212--------FVIAGLCYSA..WLPAQFLNPG----I.GGP---------------------------DAYVSE--LAA...
Q6NEW9_CORDI/11-191--------VVASLTYASF..VWEIALGFPL----..DPH---------------------------RAYLSE--YAAAD.
C5C1J0_BEUC1/20-217--------VVAALAAVFQANFLLDWVLRGG----..DGM---------------------------QYIVSQ--LAAPG.
E6GHX6_ENTFL/13-204--------VLGVLLDFFT..PYYVGFKDQG----Y.NQL---------------------------TEVISL--LGD...
Q1B6C0_MYCSS/20-192--------ILGATAYLTA.EAVTAAAYRPS----Y.SYV---------------------------RDYISE--LGA...
D1YC80_PROAA/17-217--------LVLASLASLT..WAFAGVLNPA----M.SQL---------------------------HAFVSE--YSA...
A2RL60_LACLM/11-196--------ATCAALLYNA..WILAFWLNPS----V..VN---------------------------SSLLSG--LSA...

PF10277

Q7QE61_ANOGA/3-230-------SPESCVF--GQFINIGCVLLGI--TIYVRYRQ.........................................
Q757Q5_ASHGO/5-206-------YPERSLF--QVLIAVTAFPRFL--LLLMHWVR.........................................
Q75DE7_ASHGO/9-286-------NLQPLFV--TCVAWQGLWYCIM--VACEFFQRSGHWPLPWLARQRLPADVEPVSSSSYMGSELSMRVRYAELL
Q4WNE6_ASPFU/5-224-------GLKPLFI--TGSVITVVFLDLS--FVSERWLRHS.......................................
PGAP2_CAEBR/12-239-------TPEKYIW--RILIGLHIGPRLV--VAVAFRNF.........................................
PGAP2_HUMAN/79-302-------VPQRYVW--RFCIGLHSAPRFL--VAFAYWNH.........................................
PGP2L_DROME/96-324-------SPQRYFW--RFSIALHIGPRIP--IAFVYKNY.........................................
A5DLG3_PICGU/121-352-------NLQPLFI--SCAGFQAIFFVGS--LIMDFVLRKK.......................................
Q0U0X0_PHANO/1-149-------.......--...IALTSGPRFA--LVGLWYCL.........................................
A5DAL2_PICGU/21-231-------YPERSLF--QVLIAVTSGPRFL--LLALNYFI.........................................
CWH43_SCHPO/11-220-------YPERSVF--QWLIALTATPRLL--VLLLWFTL.........................................
A8WTJ4_CAEBR/43-270-------SPQKYIW--MMIMFIHLPPRLA--FLTLYRRL.........................................
Q6FKX5_CANGA/5-205-------YPERSIF--QILIALTAFPRFL--LLLSHYYI.........................................
Q7S513_NEUCR/18-228-------YPERSIF--MIFIAITSGPRFA--LVGLWYLL.........................................
Q4PAD1_USTMA/365-592-------YPERNIF--QVGIALMAGPRFA--LVLLSALL.........................................
Q5RGJ7_DANRE/7-226-------PPESCVF--GFMSTITAFAAFA--TMYAEYKF.........................................
Q6FIN1_CANGA/8-284-------NLRPLFI--ACAGWQGLGYVIT--IACEYFQRAGRWPFRMPNSKSPHVEA...........EYDNVSSYTERL
Q4SVF4_TETNG/19-241-------VPERYIW--RCCVGLHSAPRYL--VAAAYFNF.........................................
T150B_BOVIN/4-207-------PPQSCIF--SQVLNIGAASAAW--ICILRYYQ.........................................
T150A_MOUSE/3-232-------PPESCLF--SLIGNMGAVMVAL--ICLLRYGQ.........................................
A7TMD9_VANPO/12-290-------NLQPLFI--SCSGWQGLGYVIS--IACEFFQRSGHWPFRLRSKKYLKSTVDEDC..DTMMTNDEMKSEYAEIM
Q6FKB5_CANGA/8-272-------NLRPLFI--SCAGWQGLGYVIT--VACEFFQRSGHWPGFLRSSSNKD................YSKVEYHETI
Q7PN15_ANOGA/41-264-------QPQRFVW--QFSVLFHAPFRYA--IAFLYKNH.........................................
Q4E2S1_TRYCC/9-251-------QPERQIW--RAAFVLCTPFRLG--VTISLLLV.........................................
Q5DAX3_SCHJA/13-237-------IPESCIF--GQLLNIISVLAGL--CFYSWHKH.........................................
Q6IQJ3_DANRE/3-232-------PPESCWF--SLLCSAASFIVIV--IGLLRYAQ.........................................
Q9XWR3_CAEEL/44-269-------PVERTFW--QLFLLFHVPIRVV--ELITGFSR.........................................
Q4SA40_TETNG/3-249-------PPESCLF--SLIGNVGAFMVVM--VCLLRYAQ.........................................
Q2UMD7_ASPOR/5-224-------GLKPLFI--TGSVITVVFLDLS--FISERWLRHA.......................................
Q16JU8_AEDAE/31-253-------QPQRFVW--QASVLVHALPRYA--IAFLYKNF.........................................
PGAP2_XENLA/19-242-------TPQRYLW--RLCIGLHSAPRFL--VAMAYLKY.........................................
T15BB_XENLA/3-204-------PPQSCVF--GQVLNVGAMLAVW--ISVIRFQQ.........................................
Q54KE7_DICDI/3-196-------LPMATF.--..GLAISSILSIG--LYIVKFQY.........................................
Q5DGL6_SCHJA/9-235-------PPESCIF--GEGLNLAAFLSFI--CAFFWYLI.........................................
Q4SKZ5_TETNG/531-722-------PPESCFF--SLICSTGSFMVMM--IVLLRYAH.........................................
O77262_DROME/3-230-------SPESCVF--GQLINIGSVLLGI--TIYVRYRQ.........................................
Q559G4_DICDI/11-218-------APESCIG--TFGLSIIAFLMII--VVFIKHLI.........................................
A1CK70_ASPCL/15-225-------YPERSFF--QVFIAITSGPRFA--LVFLWYIL.........................................
A2FGB6_TRIVA/10-214-------LPQRRIF--AAGMSIEGWFIIL--IFYLRISY.........................................
Q6CX54_KLULA/5-205-------YPERSIF--QILIALTALPRFL--LLFTHYYL.........................................
Q54J51_DICDI/6-269-------SPEMNVY--RYGMALTSGLRLG--TIYLNHHVST.......................................
A2DNY5_TRIVA/47-242-------YQNKALF--ASMIACGSVTTFF--IIFMYYNY.........................................
A8X4A4_CAEBR/10-248-------QPQSCIF--AMGANISSLLIAV--MVHVRQTQ.........................................
Q93319_CAEEL/9-241-------RPQSCIF--AIGANISSVLLAL--VVFVRYRQ.........................................
Q17MC8_AEDAE/70-299-------SPQRYLW--RISIALHIGPRII--IAFVYKNY.........................................
T150B_HUMAN/4-206-------PPQSCIF--SQVLNMGAALAAW--ICIVRYHQ.........................................
Q6CDS5_YARLI/4-220-------SLKPVFI--ACAATQGGLFMFA--LIFERWMRHK.......................................
DRAM2_MOUSE/7-233-------PPERCLF--GVMLNIAAVLGIA--TMYVRYKQ.........................................
Q550K4_DICDI/13-193-------APDNIIN--.............--.................................................
Q1N1S1_9GAMM/4-214-------GLEGFVF--RGGMIAACAFFIV--WWLMNHDF.........................................
Q8QGB2_ONCMY/7-226-------PPESCVF--GLMTVITAFAGMA--TMYARYKF.........................................
A6ZTJ7_YEAS7/5-207-------YPERSIF--QILIALTAFPRFL--LLLGHYYL.........................................
Q4PDK8_USTMA/9-236-------H.KTFFI--IFCSCTAGFYILT--TLAERHLRHQ.......................................
Q01D47_OSTTA/14-220-------TPQSYAS--EFLLGFAAWTLML--SVWAFKGY.........................................
T150C_BOVIN/8-218-------PPASCVF--SQVMNMAAFLALV--VAVLRFIQ.........................................
A5DS39_LODEL/32-242-------YPERNVF--QIIIALTAGPRFA--LLALNFIT.........................................
A7S3L1_NEMVE/7-240-------VPESNIF--SQLFNICSFVFVL--TLFVRFLQ.........................................
PGAP2_DROME/19-240-------EPQKTVW--RLAIFLHLPLRLA--VAKIYLEH.........................................
DRAM1_MOUSE/7-226-------PPESGIF--GFMINFSAFLGAA--TMYTRYKI.........................................
Q28IE8_XENTR/3-227-------PPESCFF--SLICSLGAFMVML--IGLLRYAF.........................................
A6SR76_BOTFB/5-222-------ELQPLFI--AMGTVTMVTFNMV--FIAERWLRHN.......................................
DRAM1_XENLA/8-227-------PPESGVF--GFMISVSAMLGAA--TMYTRYMI.........................................
Q6BKM3_DEBHA/21-231-------YPERSIF--QILIAVTSGPRFL--LLLFNFIR.........................................
Q55T17_CRYNB/25-255-------N.EGLFL--GICVIVIILYFSS--VCVIRWLRWK.......................................
A3GGF7_PICST/12-243-------NLKPLFI--SCAGFQGIFFMWT--LIMEYYLRTH.......................................
A5E3J3_LODEL/22-254-------NLQPLFI--SCAGFQGIFFVGT--LVVGMYLRKK.......................................
Q5DF06_SCHJA/6-229-------QPQKTIW--TLSVLISSAWRLL--ILPNHYIN.........................................
A7TRI4_VANPO/5-205-------YPERSLF--QILIALTAFPRFL--LLLGHYYL.........................................
Q22Y36_TETTS/100-306-------YPENIFF--RIGLLTNIFYWLI--MLVFQYWW.........................................
Q55M70_CRYNB/8-234-------APPRAPF--HILIALCATPRFC--LLLVQWLV.........................................
T150A_XENLA/3-232-------PPESCLF--SLIGNVGAFMVVI--ICLLRYSQ.........................................
A7RFU0_NEMVE/9-235-------VPEANVF--SQLFNFSCLLLVA--NMFVRYLQ.........................................
A7RNE7_NEMVE/10-236-------SPEKYIW--RIGIAYHSLLRMV--FPFVNYNF.........................................
Q6CTH9_KLULA/8-279-------NLKPLFI--SCAAWQGLGYVIM--VALEYFQRSGHWPFKLPYTYHDDLEKS........NDSSIMESNYIEAL
Q96U46_NEUCS/3-220-------TLKPLFI--AGCSVTTVFLDLS--FGADRWLRHK.......................................
Q5AF82_CANAL/13-246-------NLQPLFI--SCSGFQAIFFVGT--LIMGFYLRYK.......................................
Q55WH1_CRYNB/26-256-------H.QALFI--AICCTVAAFYIIS--MFAERWLRHV.......................................
E9ADF4_LEIMA/115-359-------MPERQTW--RVAFTLCVPFRVS--ASMSLFNV.........................................
A6ZZR5_YEAS7/10-287-------NLRPLFI--SCAGWQGLGYVIT--VALEFFQRSGYLPFQLKKKDPSI................SDSTSYAEKL
Q6IQI0_DANRE/7-234-------APERCVF--GVMLNVSAFLGVA--TMYVRYKQ.........................................
SFK1_SCHPO/21-232-------T.KGFFI--PMCVITGVFYFLT--FIMIRLARQW.......................................
Q9VPT6_DROME/29-248-------KSQHKVW--ALACYLEFPFLIA--SAWLQFRF.........................................
A7SJV3_NEMVE/4-240-------EPGGSIF--SLVLILDVIATLL--LISLYHLH.........................................
T150B_DANRE/3-204-------TPQSCLF--AQICNICCVLALW--IVVIRFQQ.........................................
Q86F93_SCHJA/5-228-------PPESCIF--GQLLNICSFLCFV--CVYCWYLHEC.......................................
A4RTY8_OSTLU/13-222-------TPQSAVS--EFALGFASWVLFF--MVAVVKVY.........................................
T150B_MOUSE/4-207-------APQSCIF--GQVLNIGAALTVW--ICIVRHHQ.........................................
Q3V5H7_CAEEL/25-251-------TLEGLVW--QLCIFFHIPFRLL--ELSVGWVR.........................................
Q6C3N0_YARLI/30-239-------YPERSVF--QVFIAITSGPRFA--LVILWFLL.........................................

PF06197

B5HBV4_STRPR/2-171.......AAGFWVM..TGALLTLGLCHLF..TAWGL...-----------------------------------------
Q5JHY1_PYRKO/12-178......KASSPWIY..NYGLIATSIFVLA..FAIYLILS-----------------------------------------
Q8U0G5_PYRFU/9-174......KATPPRIY..NYGLIVTSPFVLA..FSIYLIST-----------------------------------------
Q6L2X2_PICTO/12-188INNGHPAPALPEIY..NFGLIIEGILIAL..LSSLFILF-----------------------------------------
Q9HJI2_THEAC/17-194LQNGHPAPTDPFVY..NGGMILTGVFIAL..FSVDGIIN-----------------------------------------
Q97BH7_THEVO/15-193ISNGHPAPTYPFIY..NGGLMVTALLVFS..FSVLSISH-----------------------------------------
A8MCR4_CALMQ/13-182.......ANYYWLY..NYGLVLTATLMLL..FSLYLLFV-----------------------------------------
Q970R2_SULTO/9-177.......AKDPWLY..NYGLIVVSLFAFL..YAVFLAKV-----------------------------------------
A1RZ19_THEPD/13-186.......AANPWIF..NYGLMAMGLLVVV..YSFGVLLA-----------------------------------------
Q9Y8U9_AERPE/10-184.......ARMPWIY..NYGLILVGLLVTL..YSLCPYRA-----------------------------------------
Q5JHD7_PYRKO/10-182.......LPHNWLL..NVPLVITAVLAIY..YALGVLDM-----------------------------------------
Q8U4E0_PYRFU/10-182.......LQYNWLL..NVPLVLTAALMIY..YGLGLLSH-----------------------------------------
O58000_PYRHO/24-191.......LPYNWVM..NISLILGSVCLII..YGAW....-----------------------------------------
Q9V235_PYRAB/6-172.......LPNNWVM..NCGLIIGGLLLLG..YGAW....-----------------------------------------
Q9HK23_THEAC/11-184.......HPYGYLF..NSGLIIEGVLNIA..FVISL...-----------------------------------------
Q97AI7_THEVO/15-188.......HPYGYLF..NLGIIVEGFLNVL..FVMAL...-----------------------------------------
Q9V1S7_PYRAB/6-155.......NPKGWMF..NVFIIGLGLLGLV..TSLMLKRK-----------------------------------------
O59449_PYRHO/6-155.......NPKGWMF..NLYIIGLGIIGII..VANLLNRN-----------------------------------------
Q8TZZ1_PYRFU/8-157.......NPKGWMF..NTFIVILGILGAL..TALVHKRK-----------------------------------------
A3DLK8_STAMF/12-179......KSSVAPIF..NLGLAIGGILIVI..VGLR....-----------------------------------------
A2BLJ9_HYPBU/14-183......DPVTAIVF..NSALYTGAVLITV..YAVL....-----------------------------------------
Q3SA92_9EURY/13-189.......VENAWIF..NVGVLMSCLLGII..FALLFLRH-----------------------------------------
A4YES6_METS5/12-174.......GKTALIF..NSSIILLGIMVIA..SGILM...-----------------------------------------
Q96ZU3_SULTO/14-171.......GRTAIIF..NTSIVVMGILVML..GSLLL...-----------------------------------------
Q97UA8_SULSO/14-171.......GKTAIIF..NTSIVIMGILVII..ASILL...-----------------------------------------
Q4J885_SULAC/12-172.......GRTAVIF..NVSVALLGVLVIV..ASILM...-----------------------------------------
A4WJI6_PYRAR/3-170.......APTATLF..NTSVALLGIFGII..AAILL...-----------------------------------------
A3MT35_PYRCJ/9-176.......APTAPLF..NTSVILLGVLGLL..AVFLL...-----------------------------------------
A1RR81_PYRIL/8-175.......APTSTLF..NTSVILLGLLGLA..AATLL...-----------------------------------------
Q8ZU94_PYRAE/9-176.......APTSTLF..NTSVFLLGLLGLL..SAYLL...-----------------------------------------
Q5V2H6_HALMA/24-206PN.PVIHEPSATIF..NTTMLVTGAMVLL..SAYFL...-----------------------------------------
A3CTX5_METMJ/16-189.......GATAWLF..NSSLFLAGLLNVI..GGYFL...-----------------------------------------
Q8DVX1_STRMU/11-196.......GQNKSYF..QLAGLANTFRNLFLILSLIFWK.-----------------------------------------
C6LHE9_9FIRM/14-201.......APSKMLW..EQLSSLYGVCGIVSIMMVCVFVQ-----------------------------------------
A9KKH9_CLOPH/12-200.......APHVHLM..RFFLNTYTVCFLL..FSLGMTIL-----------------------------------------
A4C406_9GAMM/11-199......SPTEKLSP..LINNYPLGFLFCF..FGWYLAQL-----------------------------------------
Q21FK4_SACD2/11-194......SPTEKFSP..LINNYPLGILFCV..FGGYVLYV-----------------------------------------
D1CAZ9_SPHTD/27-219......APTRTFMQ..VFSGIPYAALLTA..FGIGIWRA-----------------------------------------
A0JTJ1_ARTS2/34-213.......SPGRDVL..LPFTWLYTVLFTA..FGVGVWNS-----------------------------------------
A9EN54_9RHOB/14-198......SPFAAWTN..YAVFIPTELWFLA..FLALLNTR-----------------------------------------
B6R5G7_9RHOB/17-195......APHGPTVN..FWGFLAVELLLLP..SFIICFSD-----------------------------------------
A3Y9R4_9GAMM/13-198......SPHGGYVN..FLGFIPTEIFILA..FVFTCFLV-----------------------------------------
A4BDB6_9GAMM/24-208......APHGIYVN..MAGFLVAELLVLG..FVVLAFGR-----------------------------------------
D9QLM9_BRESC/12-196V....TGPAVSWLGFVPSGLLITAFCGLAGWIL......-----------------------------------------
A4AMV1_MARSH/11-200......LPDSQYL...RYAFILSGICFAI..FGFLMPFV-----------------------------------------
Q8PIW3_XANAC/13-196......VPHALGFN..LVAFVLVGALGMA..TGVSLLAR-----------------------------------------
B0U375_XYLFM/12-195......IPNANAFN..LFGFLLPGLLAAV..LATYLMTR-----------------------------------------
Q28UV2_JANSC/25-202.......GENEIIM..DVALYAFAAGIFA..VALCAAHT-----------------------------------------
A8LJU0_DINSH/25-202.......GRGEIIM..DVALYGFAAGLFA..LALACAHV-----------------------------------------
B7RKC5_9RHOB/26-203.......GKYEIIQ..DVALYGYAAALIA..CALGAAHF-----------------------------------------
Q2CCU1_9RHOB/24-201.......GETEIIM..DIALYGYAAALFA..AAIGAGHL-----------------------------------------
A3SUZ6_9RHOB/25-202.......GEYEYIV..DIGIYGFSASLIS..VALLAAHI-----------------------------------------
A9E2D4_9RHOB/9-186.......GRYEFIV..DIGIYAFSASLVA..CALLCAHV-----------------------------------------
A4ELQ4_9RHOB/25-202.......GRYEFIV..DIGIYAYSAALVA..IALAAAHL-----------------------------------------
D0D590_9RHOB/30-207.......GRYEFIV..DIGLYAFSAALIG..LAVLAAHV-----------------------------------------
B6BBN4_9RHOB/25-202.......GRYEFIA..DSGLYAFSAALVA..IAVAAAHV-----------------------------------------
A3WAS2_9SPHN/25-205.....EGTPADELA..DLGIYAFVASVLA..TTAGLLRW-----------------------------------------
A3IX19_9CHRO/26-204.......GDYAWIQ..DIGLNLYGIGLIV..CAIALWRW-----------------------------------------
B8KPW0_9GAMM/11-188.......GSGAALH..TSGLLVLALVQPA..LAILLART-----------------------------------------
D9QK37_BRESC/20-202.......AAHPWIF..NAGVLTAGVMTGFAGLGFGLAVV-----------------------------------------
Q0W5U1_UNCMA/16-197......NPDGHLVF..DAGCMVGGVLFLPFVASLAFLRT-----------------------------------------
C5BVW0_BEUC1/45-235.......GPGGWVQ..TVNLALSGLMVVA..AGIGIARA-----------------------------------------
D3Q5U6_STANL/20-208.......GEGGWLQ..IANFVVAGLLVTA..SAVGIRRT-----------------------------------------
D2B9K9_STRRD/15-199.......GDLGWLQ..IANFIVTGTLFMA..AAVGMRRT-----------------------------------------
D7AZL9_NOCDD/27-217.......GELGWLQ..ITNFLVAGALTAA..GALGLRRS-----------------------------------------
D2AS92_STRRD/33-219.......GDLGWIQ..VTNFVITGALLIA..GAIGTRRA-----------------------------------------
D2PMS1_KRIFD/36-226.......GDLGWIQ..SANFVVTGVLVVL..GALGLRR.-----------------------------------------
C8XD39_NAKMY/31-221.......GDWGWIQ..VANFILTGLMVIA..FAVGLDRA-----------------------------------------
D2B4R9_STRRD/12-208.......GDLGWIQ..IANFVVTGLLYVA..FAVGMRRV-----------------------------------------
C8XD67_NAKMY/16-200.......GDRGWIQ..IASFVAAGALSIG..FGVGVRRL-----------------------------------------
C4RF79_9ACTO/74-259.......GGLGWIQ..ITTFVLTGLGGLA..LAAGIKRT-----------------------------------------
A7HVR6_PARL1/16-206.......GEGGWMM..KAVFIVSGLFVLA..CAWGIHAE-----------------------------------------
E8T0T3_GEOS2/14-211.......GERGWLG..TCNLLLSGVLFCA..YTVGLKWA-----------------------------------------
D3PXJ2_STANL/16-212.......GDRAGWE..RATYVICGLLVLG..FGGGVGRR-----------------------------------------
C5BVM4_BEUC1/10-201.......GPRGWIQ..RWNFVTSGAATAA..GGVGVALA-----------------------------------------
D3Q1F0_STANL/29-225.......GPGGWVQ..IANFIVAGLLTLV..FAVRLRAG-----------------------------------------
A4F7D5_SACEN/16-207.......GESGRVQ..STSFVATGVLMFA..FAVGV...-----------------------------------------
B8GH43_METPE/42-235.......GPSGWIQ..MGNFVISGSLLLI..FAWGIAPE-----------------------------------------
B4SM32_STRM5/13-185.......APTLASICARIAAIGSGVGFVA..FAIGAWR.-----------------------------------------
Q9RJS0_STRCO/12-187.......AAGFWVM..TAAFLALGVCHLL..TAW.....-----------------------------------------
B1VPM0_STRGG/12-188.......ATSYWLM..TGMLLVLGSCYVL..TAH.....-----------------------------------------
D9T5P6_MICAI/28-216.......ATDPWLM..GGALVLLGCCYCA..TAA.....-----------------------------------------
Q0RZC5_RHOSR/71-245.......GHGHAVM..TAGFLAVACCYVV..TAV.....-----------------------------------------
C0ZQ51_RHOE4/26-217.......GGGRWIF..TAAVVLLAAGSAG..FLIALIGR-----------------------------------------
C8X6V7_NAKMY/31-224.......TDTAWAF..NVGVVALALGSLA..ILIAT...-----------------------------------------
D3Q1Z4_STANL/35-216.......REGVLLF..DLACLSIAVACVA..VLF.....-----------------------------------------
D3Q759_STANL/3-179......PGFTGYII..ATAGIAVSCTALA..........-----------------------------------------
D2AUN0_STRRD/12-196.......DTSAWAM..AGGTIMLAMGSLW..VAYGLAR.-----------------------------------------
D2B0Y0_STRRD/13-197.......LDRGGAT..EFAMATLGVASFA..LVAGLRA.-----------------------------------------
E8RZG0_MICSL/12-189.......SDRGGVI..DTAMAVLAAASLV..LLPSL...-----------------------------------------
C6W8D5_ACTMD/12-195.......SGGTWLL..GFTALALAVGSIA..LLVGMVR.-----------------------------------------
C8XCN7_NAKMY/38-227.......PAGEPLFALTAGALAVAGIALV..RAL.....-----------------------------------------
D3EGW1_GEOS4/23-212.......GDFGWMM..HLAFGLLALAQIS..VAITIFPH-----------------------------------------
B4SRG7_STRM5/12-194.......GPWGLLL..RSAYCLLALAIAV..LGIALYRG-----------------------------------------
Q3BVQ6_XANC5/87-268.......GPYGLLL..RTAYCLLAASMAW..LARGLYAA-----------------------------------------
C8XKD4_NAKMY/21-199.......GPTGWVF..TVWAVALGAAPLL..LL......-----------------------------------------
D9SXQ4_MICAI/13-198.......TDSGYAGAYRLGIFSVAASLLL..LAG.....-----------------------------------------
Q0SAA4_RHOSR/13-214......QPYGIWFR..TGDLLTGCIVAVA..GVLGLSRY-----------------------------------------
D3Q0C1_STANL/5-190......QPGSLAFR..IGDLVAGAAACVA.....GLW..-----------------------------------------
D0L9X9_GORB4/20-220......CPHREVYV..AGDVTTSVCALIA..GAVALIPR-----------------------------------------
Q5Z3B7_NOCFA/14-211......KPYRTVFA..AGDVLTGALLIPA..GLAGLLLF-----------------------------------------
C0ZM54_RHOE4/15-215......QKYRDVFG..NADVLSAILMLIS..GALGLLIT-----------------------------------------
D5UPX7_TSUPD/8-215.......TGQPYAHFFRGTDLLAGTCFVV..GAALWWR.-----------------------------------------
C6W9M9_ACTMD/22-202.......QPHRWLF.RATDSLAACCVLLA..........-----------------------------------------
D2B4U0_STRRD/15-212.......ADQPWSWLVRAADVVAGIACLA...AVALVPD-----------------------------------------
Q6NEW9_CORDI/11-191.......SPHRTLF..AATDLITAVLVLV..ALLCLWRL-----------------------------------------
C5C1J0_BEUC1/20-217.......QPNATLL..RATDVACAVLVLV..LVVPVRRA-----------------------------------------
E6GHX6_ENTFL/13-204.......VNSPVRENFNRLTIIAGMLMLA...SLPRIYA-----------------------------------------
Q1B6C0_MYCSS/20-192.......PGQPWAALMNIAFVVQGVLFLS..GAVL....-----------------------------------------
D1YC80_PROAA/17-217.......RDQPWRYLFQTTDVIMGTLLCLAGLATLVWAR-----------------------------------------
A2RL60_LACLM/11-196.......LNQPYHQLFTLTDILSGSFCFL..LALGIFMT-----------------------------------------

PF10277

Q7QE61_ANOGA/3-230......IQELSFRHSDVRQA............LGRCSGIGFWIGIGSC.LG-ISIVG--NF......QETNVR.I-----
Q757Q5_ASHGO/5-206......S............................RSALGVMAGFTRT.MT-CGGWV--YI......TSSDDH.D-----
Q75DE7_ASHGO/9-286SSSRFLMPPYYTKHERN..................LIFASFVLGLIGE.LA-ILMCA--IF......STAKFH.K-----
Q4WNE6_ASPFU/5-224....GQLVPNKGWFDKF..................CAVASIFFAVAGA.LG-LILLA--CY......DTLRHP.H-----
PGAP2_CAEBR/12-239......LMSSPLRPYTGSKQ............FKFLCNIACGLNLLEN.FF-LLALT--SI......SSSEDH.S-----
PGAP2_HUMAN/79-302......YLSCTSPCSCYR................PLCRLNFGLNVVEN.LA-LLVLT--YV......SSSEDF.T-----
PGP2L_DROME/96-324......YRSQLRRISPAQVP...........QTSLLITLILVLNCIEI.AS-LGGVT--YI......SNRENY.P-----
A5DLG3_PICGU/121-352....HKLQPFVSKRQPK..................LAIASIVCAIIGQ.LG-ILFVA--IF......NTNAFH.R-----
Q0U0X0_PHANO/1-149......TRRPNST......................LPKFVAGVGIFRT.LT-CGGWT--YV......TSTDDH.D-----
A5DAL2_PICGU/21-231......CAENGPL......................LATIGVVCGIMRT.FT-CGGWV--YI......TSTDDH.D-----
CWH43_SCHPO/11-220......SGISRP.......................SVIITTALGVLRT.AL-CGGWV--YV......TSTDDH.D-----
A8WTJ4_CAEBR/43-270......FLISAPKSQWYS................RINYIYMLTLWAEP.FG-LILVS--VV......DINGGF.I-----
Q6FKX5_CANGA/5-205......N............................GSLTTFIIGTART.VT-CGGWV--YI......TSTDDH.D-----
Q7S513_NEUCR/18-228......TAKPGRV......................LPKAIAISGVIRT.LT-CGGWT--YI......TSTDDH.D-----
Q4PAD1_USTMA/365-592......VSLSTPIPSP...................KASILLCVGVLRT.LA-CGGWV--YV......TSTDDH.L-----
Q5RGJ7_DANRE/7-226......VERVHERTGAVP...............PTLNKVSFGFGIFSC.IG-MCLVA--TF......QETTVM.E-----
Q6FIN1_CANGA/8-284LHSRLLMPPYYTKHERN..................LIFASFVLGCIGE.IA-LLMCS--IF......STAKYH.H-----
Q4SVF4_TETNG/19-241......YYGRFAKSLPEL................ILSGLALICSLSEN.TG-LLLLT--YV......SSSETY.S-----
T150B_BOVIN/4-207......LRDWGVRKW....................HNQVILWTGLLCA.LG-TSIVG--NF......QEKNQR.A-----
T150A_MOUSE/3-232......LLEQSRHSW....................INTTALITGCTNA.AG-LVVVG--NF......QVDHAK.S-----
A7TMD9_VANPO/12-290LKSNFYMPPWYTVHDRN..................FIFAAFIFGLLGE.VC-LLMAS--IF......STAHYH.H-----
Q6FKB5_CANGA/8-272LSKKYFMPPYYTRHERN..................LIFAAVILGGLGE.VA-LLMCT--IF......STALYH.H-----
Q7PN15_ANOGA/41-264......HLTLLSRKHRK.................EWAYLACILNIVEL.SS-LVGLS--LW......TSSNNY.E-----
Q4E2S1_TRYCC/9-251......FWQRACGGMSELSSMRRSP.ISLVRSSAFLTLAIFSFDITRL.LG-ALTWT--MI......SSIENL.D-----
Q5DAX3_SCHJA/13-237......LLDPSHKFNQRCYR............QIKLARIALCFGFICA.FG-MSVVA--NF......QETAVW.S-----
Q6IQJ3_DANRE/3-232......LIHKHTNSV....................LNIEGLFAGWLCA.AG-LMIVG--NF......QVDHAK.V-----
Q9XWR3_CAEEL/44-269......YKRMRNVNYKRVWL............YELSRYLYFVVGLLEL.IF-LSGLS--II......GERENI.Q-----
Q4SA40_TETNG/3-249......VIEHSHQCW....................VNTSALVSGCTNA.LG-LVMVG--NF......QVDHAK.S-----
Q2UMD7_ASPOR/5-224....GQLVPNKGRFDKA..................CAVLSIFFSIAGA.LG-LILLS--IF......DTVRHP.H-----
Q16JU8_AEDAE/31-253......HIGLLRKRRKE..................LAYLACILNITEL.SS-LVGLT--MW......TSVSNY.D-----
PGAP2_XENLA/19-242......YQGTPCSNPYYP................RLCHINFLLNSCEI.FF-LMLLT--YV......SSSENH.E-----
T15BB_XENLA/3-204......IRDYNCHSV....................LNSVSLATGILCA.LG-TSIVG--NF......QQSNQL.Q-----
Q54KE7_DICDI/3-196......NRLQIKKCSPHSL.............VSTFSVVCLLIALIQS.IG-LLGVI--SF......PQHYIR.N-----
Q5DGL6_SCHJA/9-235......ALERTKFMGTHQP..............RCLLKFMVIISLIAA.IG-LTLVG--NF......QQVNVE.L-----
Q4SKZ5_TETNG/531-722......VIEKHQNCV....................LNTASLSTGWICA.AG-LIVLG--NF......QVDNAK.V-----
O77262_DROME/3-230......VLQLYEHHPDLDGS............VLRQNRLALWFGLVSC.LG-ISFVG--NF......QETNVR.I-----
Q559G4_DICDI/11-218......IKNNIIEKEYFDDKKE........KKELRFNRFSTSMGFISG.LS-MHGVS--SF......QFHNAN.L-----
A1CK70_ASPCL/15-225......TARPNST......................LPKVVAGVGLFRT.FT-CGGWT--YV......TSTDDH.D-----
A2FGB6_TRIVA/10-214......CSELAHEANVYLTI............SYKIKVFILWILLVCAPIG-LFVLS--AI......TLEMNL.S-----
Q6CX54_KLULA/5-205......N............................RSLFTLLVGIVRT.IT-CGGWV--YI......TSTDDH.D-----
Q54J51_DICDI/6-269....EEKNNLLAQSNSGRKSFTSSSVLESVRRLGYLIPMSTVFDTIRV.FS-AGGWI--YI......SSSEHL.F-----
A2DNY5_TRIVA/47-242......VKLNYNLSRL...................LNIVFILVIMISC.IG-VGGFG--FC......PINEVY.K-----
A8X4A4_CAEBR/10-248......IDYVLNTYDDDWRAWK........NKLFCVNTWASLVGYISA.FG-LFIVA--NV......QETAII.P-----
Q93319_CAEEL/9-241......LRGIFAFYDEANL..............QAWNWRQKWFGYIAA.LG-LFFVA--NV......QETAII.P-----
Q17MC8_AEDAE/70-299......YRALIRELNDLAQIK..........KATSLLRIVHGLNIVEI.SA-LCCVT--YV......SNKENY.P-----
T150B_HUMAN/4-206......LRDWGVRRW....................PNQLILWTGLLCA.LG-TSVVG--NF......QEKNQR.P-----
Q6CDS5_YARLI/4-220....GRLLRNHRQAEKW..................LSVGAIIFGILGQ.VG-IILVS--IF......DTKNHH.S-----
DRAM2_MOUSE/7-233......VHALNPEENLII................KLNKAGLVLGILSC.LG-LSLVA--NF......QKSTLF.I-----
Q550K4_DICDI/13-193......YQGEINQESKM.................KFNKFIASMGIISG.FS-LNGVA--SF......QYKNAS.V-----
Q1N1S1_9GAMM/4-214......SLGLPKW......................FNRLKTAMGILGSILL-IGSTA--VLI...PPRSAIPW.D-----
Q8QGB2_ONCMY/7-226......VEKLNEKAGGVR...............PSLNQAAFWIGMLSC.LG-MCFVA--TF......QETTIT.A-----
A6ZTJ7_YEAS7/5-207......N............................QSKVCFLVGVLRT.VS-CGGWV--YI......TSTDDH.D-----
Q4PDK8_USTMA/9-236....RRIPGSIRKKQTI..................LDICSVICAVIGC.VA-LILLS--VF......DAFNHS.T-----
Q01D47_OSTTA/14-220......LDAYATCEDKWF................TWSRKGLWFGVSSA.IL-LGLTA--AI......NYEESF.G-----
T150C_BOVIN/8-218......LKPKVLNPW....................LNISGLVALCLAS.FG-MTLLG--NF......QLTNDE.E-----
A5DS39_LODEL/32-242......LYKQSSY......................LPYIGLIAGLLRT.FT-AGGWM--YI......TSTDDH.D-----
A7S3L1_NEMVE/7-240......LRHDSDWNEEARPL............LLRLNITSLVFGLLAG.LG-ASLVA--NF......QVDAVT.I-----
PGAP2_DROME/19-240......YREHIRRSRRL..................LGILACFLNVVED.LA-LFCLS--FW......TSADHY.E-----
DRAM1_MOUSE/7-226......VEKQNETCYFST...............PVFNLVSLALGLVGC.IG-MGIVA--NF......QELAVP.V-----
Q28IE8_XENTR/3-227......VIERYGPSL....................LNTVAFILGWICA.AG-LTMVG--SF......QVDHAK.V-----
A6SR76_BOTFB/5-222....GRLHGNTSVFQKV..................LSALAIVFSVAGG.IG-LICLT--CL......NDVDHH.T-----
DRAM1_XENLA/8-227......LERQNLSIDFLP...............IYFNKISLAIGLFGC.IG-MGIVA--TF......QEMAVP.A-----
Q6BKM3_DEBHA/21-231......LYKKNSV......................VPYLGLLSGVIRT.FT-CGGWV--YI......TSTDDH.D-----
Q55T17_CRYNB/25-255....GRLPENIGRKEKI..................YGYLTIFFCFVGC.AG-LFVLA--KW......NCYDYP.T-----
A3GGF7_PICST/12-243....RKLQPYVSTKQPK..................FAIVSIVCGFIGQ.LG-ILFVS--IF......DTKRFH.D-----
A5E3J3_LODEL/22-254....HKIQPYISHHQPR..................LAIASIIMAIIGQ.LG-ILFVS--IF......NTKNFH.S-----
Q5DF06_SCHJA/6-229......LLNLFSSFTRQGR..............LYLCNSLCLSNFIEI.VS-LNMLS--IV......SSSDDY.I-----
A7TRI4_VANPO/5-205......N............................GSLFGLIVGVVRT.VT-CGGWV--YI......TSTDDH.L-----
Q22Y36_TETTS/100-306......LRAQSEAMMGVVNV............SKKMNYFAFVGFFF...YG-LTIAT--ID......DGHIPT.Q-----
Q55M70_CRYNB/8-234......HRNPPQTSTHSGNIRNA......ERSSAVLVDIELLVGVART.LC-CGGWV--YI......TSRDQH.D-----
T150A_XENLA/3-232......VIEISQRSW....................LNTTALIAGCTNA.AG-LVMVG--NF......QVDYAK.S-----
A7RFU0_NEMVE/9-235......FDLVTKGYDSIELG............FARLNRIAFGFGVVSA.FG-GTIIA--NF......PSQEMV.Y-----
A7RNE7_NEMVE/10-236......YKYKASSNIKSKW.............FPWLNFLNACVTVVEN.LA-LVLLT--YV......SSSENY.S-----
Q6CTH9_KLULA/8-279IQKKYVMPPFFTKHERN..................LVWASFVLGSIGE.LA-LLMCT--IF......STNTYP.R-----
Q96U46_NEUCS/3-220....GRLVPNTTVTEKV..................LSGITIVFAIVGT.CG-LILLS--IF......DTARYP.R-----
Q5AF82_CANAL/13-246...SGKIQPYISKHQPR..................LAIASIICAAIGQ.LG-IVFVA--IF......NTKNFH.P-----
Q55WH1_CRYNB/26-256....DRLPTNIRRRELV..................FDWLAIFWCIVGC.VG-LILLS--CF......NAFTHG.T-----
E9ADF4_LEIMA/115-359......FWQRASRGMEDLYSFRRSW.KAFLSSNAFLALLALGTDTWRF.IG-ASVYS--VV......SAKESL.T-----
A6ZZR5_YEAS7/10-287HSGKYLMPPYYTKDERN..................LIFAAFVLGSIGE.LA-LLFCS--IF......STALYH.R-----
Q6IQI0_DANRE/7-234......LQALADVDDTRL...............NRLNVVGFVFGCCSS.FG-MCVVA--NF......QKTTLF.S-----
SFK1_SCHPO/21-232....GWIYPTGRKVETY..................LGWFAALTGAAAA.SC-LISLS--IR......DDVHHD.N-----
Q9VPT6_DROME/29-248......YRRNLRRPVRG..................FGCLMAIIMAVSS.SS-VLLWG--TF......PQEDGDSL-----
A7SJV3_NEMVE/4-240......VSTIAKEEGL.VA.............WRALNNGALTSGVLLL.FG-VSAVA--TFRYASPTHADRSQ.I-----
T150B_DANRE/3-204......IRDLGRSSH....................LNTAGLVLGFISS.IG-ISILG--NF......QQTIIQ.E-----
Q86F93_SCHJA/5-228....SVIRARHGPYSHI.................IFSRVTCIVGCLCS.LG-MSMVA--NF......QEASLI.V-----
A4RTY8_OSTLU/13-222......LDRYATSDARWR................AHGRRSARVGYVAA.IC-LALTA--AI......NYGESF.G-----
T150B_MOUSE/4-207......LRDWGVKTW....................QNQLILWSGILCA.LG-TSIVG--NF......QDKNQK.P-----
Q3V5H7_CAEEL/25-251......YGRLESRANTHRLW............YKMHRHLYLVFGVTEL.IL-LSGLS--AI......GEKEHG.I-----
Q6C3N0_YARLI/30-239......TVAHRPR......................LSMMILISGLMRT.LT-CGGWT--YV......TSTDDH.D-----

PF06197

B5HBV4_STRPR/2-171------......RAAAP------------------AGRLALG...GGG-VA.AFGVV..LI------PAPSSGGSL....
Q5JHY1_PYRKO/12-178------....AKNKLQT------------------VGGAYIS...ISA-IF.LALIG..IF------HGGTR........
Q8U0G5_PYRFU/9-174------....AENKIQT------------------VGGAYLS...ISS-LF.LALIG..IF------HGGTR........
Q6L2X2_PICTO/12-188------....SENKIED------------------AGSSFFI...ISG-LF.LALIG..IY------HEGTY........
Q9HJI2_THEAC/17-194------....AQDKVEN------------------AGFSFFI...ISG-LF.LCLIG..IY------HEGTY........
Q97BH7_THEVO/15-193------....VNSKVEI------------------MGLSFFI...ISA-LF.LALIG..IY------HEGTY........
A8MCR4_CALMQ/13-182------....SENKVEA------------------MGSSFVT...IAS-IF.LALIG..IF------HEGTY........
Q970R2_SULTO/9-177------....NGNKILI------------------IGSAFVM...VAA-IF.LALIG..IY------HEGTY........
A1RZ19_THEPD/13-186------....SKTKYES------------------FAAGLLF...VAG-VF.LFLIG..YY------PSGTK........
Q9Y8U9_AERPE/10-184------....AVERLEA------------------FGSGLLL...TAG-LF.LALIG..VY------PAGTR........
Q5JHD7_PYRKO/10-182------....ARNSVEK------------------AGIWVLI...AGF-VF.LALIG..IF------PEGTS........
Q8U4E0_PYRFU/10-182------....LTTKIER------------------IGGAIFI...LGV-IF.LALIG..IF------PEGTS........
O58000_PYRHO/24-191------....RFKKSKD------------------IGWLLYM...LGS-VF.LGLIG..IF------PEGTN........
Q9V235_PYRAB/6-172------....RLKKSKN------------------PGWAIYV...VGS-VF.LVLIG..VF------PEGTE........
Q9HK23_THEAC/11-184------....KRIRTAG------------------YVQALMI...VSG-LA.LALVG..VF------NEHFGY.......
Q97AI7_THEVO/15-188------....FEIGLKK------------------RIGALLI...ISG-IA.LALVG..VF------NEDHPP.......
Q9V1S7_PYRAB/6-155------...........------------------....ILT...LSM-AF.LVLVG..VF------PEEKP........
O59449_PYRHO/6-155------...........------------------....LLK...ISM-IL.LILVG..IF------PEEEP........
Q8TZZ1_PYRFU/8-157------...........------------------....ILT...MAM-LF.LIMVG..IF------PEEYT........
A3DLK8_STAMF/12-179------....NLYSWSR------------------VKGSLII...SMG-VF.LNLIG..VF------DEVYGW.......
A2BLJ9_HYPBU/14-183------....CIPRAGG------------------LEAVLLA...LVG-FT.LGLVA..VF------DETYGH.......
Q3SA92_9EURY/13-189------....LPRPFGS------------------VGIWLTV...SSA-L..FFIVA..VV------PDNAPIYIY....
A4YES6_METS5/12-174------........SRR------------------SFTPLLV...VGG-LG.MMGVG..LF------PETTGT.......
Q96ZU3_SULTO/14-171------.........RT------------------YYYPLLF...LIG-LG.SAIVG..IF------PETTGL.......
Q97UA8_SULSO/14-171------.........RA------------------NYSPLVF...LVG-LG.AALVG..IF------PENTGL.......
Q4J885_SULAC/12-172------......RKVFS------------------YASYLVL...LNG-IG.ALIVG..LF------PETTGL.......
A4WJI6_PYRAR/3-170------.....RKEIGI------------------VGSALLA...LAS-AG.AIGVG..AF------PEDYGT.......
A3MT35_PYRCJ/9-176------.....RRELGR------------------AGASLLG...LAS-LG.AMGVG..FF------PEDYGL.......
A1RR81_PYRIL/8-175------.....RKELGS------------------LGAAILA...IAA-MG.AVGVG..IF------PEDYGT.......
Q8ZU94_PYRAE/9-176------.....RREIGR------------------ISAVLLA...LAS-IG.AMGVG..VF------PEDYGA.......
Q5V2H6_HALMA/24-206------....YRTMDRR------------------GFPLALA...VFG-FA.AFGVG..VF------PGNVTP.......
A3CTX5_METMJ/16-189------....YRSYGRG------------------WILPVFV...LTG-AG.AMGAA..VF------TLDIPG.......
Q8DVX1_STRMU/11-196------....YSFSFKK------------------EAVLLLI...LAI-IG.YAGVA..LF------PTDIEGSKR....
C6LHE9_9FIRM/14-201------...GKLNKTIR------------------IGIYLFA...VMN-WVSNVGYA..MF------PLSDSGNAG....
A9KKH9_CLOPH/12-200------SFSKYHIYVKL------------------GYTVMFA...SAL-IS.VIGYG..GY------PISMVLIFS....
A4C406_9GAMM/11-199------...SSVSILVN------------------IAGWLVI...AHG-IG.TWVAG..YF------PMDADPFTKN...
Q21FK4_SACD2/11-194------....SSSLLFT------------------TTGGLVI...AHG-MA.TFVAG..YF------PMDADPYTQT...
D1CAZ9_SPHTD/27-219------...AGESRAGH------------------VTGALVI...AEA-VWGLVGGI..AF------PMATREVMAAS..
A0JTJ1_ARTS2/34-213------...VRGNRALR------------------ISGGLLT...AYG-LW.NIMGA..LY------PLTLGDNAS....
A9EN54_9RHOB/14-198------...LPDRRLTR------------------VSLILLA...AYA-GL.LMLAA..GL------PCDAGCDGGDA..
B6R5G7_9RHOB/17-195------...LMRSRAER------------------VALVVFA...GYP-LF.IGLAA..FF------PCDFECRMAD...
A3Y9R4_9GAMM/13-198------...APKTKKNL------------------IGFSFIV...VYA-VT.LGISA..LY------PCDFECRPVE...
A4BDB6_9GAMM/24-208------...LQGAVLLR------------------ASVLMIA...VYA-LL.IIVAS..FF------TCDFQCRPES...
D9QLM9_BRESC/12-196------....RRNLLAV------------------VACLLLG...WYG-LS.LAGAG..LY------PCAFECARSE...
A4AMV1_MARSH/11-200------...LPKSRPIK------------------VLFLLFA..IFYG-LG.TIVTG..VF------PCDIGCVMDPN..
Q8PIW3_XANAC/13-196------M.PPKASWSLR------------------VGGQLIV...LAG-LA.FLGMG..ML------PLDPADLDG....
B0U375_XYLFM/12-195------P.MQHPSWSLR------------------IGIQLVM...LSG-LA.FAAMG..IL------PLDIGELEG....
Q28UV2_JANSC/25-202------...HLGGVGWS------------------GGVVILA...LLA-AA.VVVIG....------.........ARNE
A8LJU0_DINSH/25-202------...HQGGLAWS------------------AGTLCLA...VLA-AT.IVVVG....------.........ARNE
B7RKC5_9RHOB/26-203------...HAHTLRWN------------------GGILSLA...ILA-AS.VIVIG....------.........ARNE
Q2CCU1_9RHOB/24-201------...HLGGNGWS------------------VGTLSLA...LLA-AT.VIVVG....------.........ARNE
A3SUZ6_9RHOB/25-202------...HLGNWRWS------------------VGIVGFT...VLG-LI.VFLVG....------.........ARNE
A9E2D4_9RHOB/9-186------...HFGGGRWS------------------TGTIGLA...VLG-LI.VFLVG....------.........ARNE
A4ELQ4_9RHOB/25-202------...HLGGPRWS------------------IGVVGLS...MLA-LL.VFLIG....------.........ARNE
D0D590_9RHOB/30-207------...HLGAWDWS------------------VGIIALI...VFG-LL.VFLIG....------.........ARNE
B6BBN4_9RHOB/25-202------...HLGGRGWS------------------FGIVAFA...LMG-LI.VFLVG....------.........ARNE
A3WAS2_9SPHN/25-205------...RIDRLDWK------------------IGSWLLV...IVA-VC.VVLIA..GY------EAYTTGEGP....
A3IX19_9CHRO/26-204------...NLGDWRWQ------------------LGATLLF...FLG-ID.ILIIS....------EHDQYAKLP....
B8KPW0_9GAMM/11-188------...ALDSRMWT------------------IACWLMA...LNG-VC.LLFIA..VY------FLRAPDSLL....
D9QK37_BRESC/20-202------I.LTRSPVSAI------------------AVGLLFV...LAG-IG.LVVSSLYAW------PDP..........
Q0W5U1_UNCMA/16-197------....ASKWQSR------------------LAAAAVVPGIVAS-VG.LALIG..LY------PETVRE.......
C5BVW0_BEUC1/45-235------...LVPGRRVR------------------LAGGLVA...AFG-VG.MLGAA..LF------PTDPINGFPPGT.
D3Q5U6_STANL/20-208------...VRTGPGRT------------------WLPILFG...IYG-VG.LVWGG..VF------VTDPAFGYPAGTP
D2B9K9_STRRD/15-199------...LRQGPGAK------------------WGPRLIG...IVG-AG.LIAAG..VF------VTDPAAGYPVGSV
D7AZL9_NOCDD/27-217------...MRGAPGGT------------------WAPRLVL...VNG-LG.MIAAG..LL------VMDPADGFPVGTP
D2AS92_STRRD/33-219------...LHGGPGGT------------------WAPRLVA...VFG-AS.FLVSA..VF------AADPGAGFPIGTP
D2PMS1_KRIFD/36-226------....SGALGST------------------WAPRLLT...VFG-LG.TVAAG..LL------LPDPALGFPAGTP
C8XD39_NAKMY/31-221------...LGRGPGAT------------------WVPRLIG...VFG-VS.MITAG..LF------RADPVAGFPVGSP
D2B4R9_STRRD/12-208------...LHPGRGGT------------------WGPLLMG...AFG-TG.LVIAG..LF------RTAPGWGYPQGAP
C8XD67_NAKMY/16-200------....GPGLPAA------------------AAPLIWG....YG-GA.LIATG..VF------LVDPGAGFPLDAA
C4RF79_9ACTO/74-259------...LTEGIGRR------------------ALPILVG...IFG-VG.LIAAG..LF------TMDPENGFPPGSP
A7HVR6_PARL1/16-206------...LARGQGGI------------------AAPLLIG...AYG-VG.LVLAG..IF------DAPAGLGFPQGTP
E8T0T3_GEOS2/14-211------...LCSGKGSK------------------WGPILIG...AYG-IG.LLLAA..LF------PIDPSLGWPPGA.
D3PXJ2_STANL/16-212------...TAGAPGGK------------------WGPWLVG...AIG-AG.LVVAG..IF------PTDPALGYPPGE.
C5BVM4_BEUC1/10-201------....LDGFPGR------------------ATGVVIA...AFG-VA.LAASG..VW------SMDPMRDYPPGAP
D3Q1F0_STANL/29-225------L..KASGRRTF------------------AGPLLIG...VWA-VG.LLGAG..VF------VGDPISGYPAGTP
A4F7D5_SACEN/16-207------....RRTAGGL------------------WLSRLLG...VYA-IG.LAGAG..FF------RTDPISGYPAGTP
B8GH43_METPE/42-235------...FPTGKASK------------------TGALLLG...IIA-VC.LLFSG..PF------VMDPMGTLRG...
B4SM32_STRM5/13-185------....ESGRRIA------------------VGAICWM...IFG-IS.MLTNG..LW------PMGHPMHGF....
Q9RJS0_STRCO/12-187------....GLRPAAT------------------AGRVALG...GGG-LA.ALVLV..AL------PAPSSGGSL....
B1VPM0_STRGG/12-188------....ALRPAAP------------------AGRVALA...GGG-LC.ALALT..LV------PAPSSGGAL....
D9T5P6_MICAI/28-216------....ALHAAGL------------------PSRFLLA...VGG-VS.TVALI..AF------PRPQVGGSP....
Q0RZC5_RHOSR/71-245------....GLRVLRM------------------PARITLA...LAG-LC.GFVLT..VF------PPAPRAVP.....
C0ZQ51_RHOE4/26-217------....QLTVWKS------------------GVAAAMA...MWI-IG.LICIA..AF------PKQDWSQPV....
C8X6V7_NAKMY/31-224------....AAAGLSR------------------VGSLGLVLGGAWV-LG.LLAVV..VF------PKHDWSVGP....
D3Q1Z4_STANL/35-216------....GPLGSER------------------VTRRCLA...GSA-VALLFVVG...F------DTDAGATVS....
D3Q759_STANL/3-179------......LTTTG------------------WPRLVLA...TAA-LA.FVVAA..VF------PTDPGTGVD....
D2AUN0_STRRD/12-196------....TDPTRSA------------------ATRVLFV...AGA-LG.LLLTA..AF------PLDAAPGAA....
D2B0Y0_STRRD/13-197------....AMAPIGA------------------AAERLML...AWS-AA.LVVIA..IV------PTTAPGLAM....
E8RZG0_MICSL/12-189------....RRAGAGR------------------VPLALLT...AWS-AG.LLAAA..VV------PTNEPGTPM....
C6W8D5_ACTMD/12-195------....SGLPRRG------------------PVAVLIG...LWA-AG.LAVVA..VF------PTDPLGAPT....
C8XCN7_NAKMY/38-227------....AGLSGTA------------------WTRALLA...GWA-LA.LVAAA..VF------PTNLPGRPG....
D3EGW1_GEOS4/23-212------....IRTVTGY------------------IGLVILG...ISA-IG.VIIAG..IF------VTDPISASPD...
B4SRG7_STRM5/12-194------....SVGPRRS------------------SAAPLLFTVSALG-LA.TVAIGDSWL------PEATPLLAP....
Q3BVQ6_XANC5/87-268------L.APAARSRTV------------------LGLFWMA...AVG-LC.VVSIGDSWM------PELAPEAAA....
C8XKD4_NAKMY/21-199------....AGAAAPG------------------PTRPVLW...VGF-AG.AALMA..VV------RTDEGGGAM....
D9SXQ4_MICAI/13-198------....ALPPGLR------------------AAAGLLG...VGA-VA.TVLSG..AV------TCSEGCPLPPF..
Q0SAA4_RHOSR/13-214------....SQGWVTA------------------VGWLALI...VFA-VA.TITDS..RL------PMSCAATNDPVCA
D3Q0C1_STANL/5-190------....ALRRRPW------------------LGWACVV...AFG-VF.TMLDA.GLF------NMSCAPSLDPTCA
D0L9X9_GORB4/20-220------P..LVRGRLAV------------------AAVVLLA...AFG-AS.TMADA..LL------PIECLAGIDPGCR
Q5Z3B7_NOCFA/14-211------....PRRPLTT------------------LGWAALT...VFG-AA.TIADA..LI------PLRDCAPGEPGCG
C0ZM54_RHOE4/15-215------....PRRRLYV------------------TGWIALA...VFG-IA.TIADA..SF------PLECSGE..GCPS
D5UPX7_TSUPD/8-215------....AARPSSR------------------FAWGWMAGMIMLG-VG.TISDA..LL------PLSCTPTSDAACA
C6W9M9_ACTMD/22-202------....ARHLRGR------------------WAVAAVL...VFA-LA.TLADT..AL------PLDCAPSTDRLCR
D2B4U0_STRRD/15-212------ERPGRWGAAGW------------------LGLALLG.....G-MT.VLDSG..LF------PLDCAALSDPVCA
Q6NEW9_CORDI/11-191------W..PRWEASSR------------------IIAVALA...VMG-AA.TIGDV..FF------PMPCAESLPTC..
C5C1J0_BEUC1/20-217------LRPGPWREVVT------------------WGTVAFA...VGA-IGAALAAS..TC------PLGTRCVGS....
E6GHX6_ENTFL/13-204------IFSRKTKKGAW------------------LVVVMIG...AYG-LFDCIFSG..LF------SVDTSSAGT....
Q1B6C0_MYCSS/20-192------....VSGSRHR------------------MLTAFAV...ANA-VG.NILVG..TV------PAG..........
D1YC80_PROAA/17-217------...HRPLGRQG------------------WSGVGFV...AGG-FF.SVLDA..LV------TMDCSPTRSQACM
A2RL60_LACLM/11-196------....NKKEDKR------------------LLMILFS...IAG-FG.ITTALAALF------PYADLTHSEGIP.

PF10277

Q7QE61_ANOGA/3-230-------------VH-YVGAFLSFGLGTVYFWIQSYISYYIQPY....................................
Q757Q5_ASHGO/5-206-------------AH-DVFMIAYIVLTIPWCVFVVR............................................
Q75DE7_ASHGO/9-286-------------VH-LSMVGVFVSMMYFSILCAAIEYLSMGRHYARLHP.........LAGSAA.HVGSAS......SR
Q4WNE6_ASPFU/5-224-------------FH-NGFLLMFLVGYLISAVLICIEYLWLGIFY...................R.S.............
PGAP2_CAEBR/12-239-------------LH-AKCFGGFAISSIIYMILSTWLFSESGRRR...................A...............
PGAP2_HUMAN/79-302-------------IH-ENAFIVFIASSLGHMLLTCILWRLTKKHT.....................V.............
PGP2L_DROME/96-324-------------VH-ERIFITFMVCSLCYMLATIKLNGILNAGQ...................A.L.............
A5DLG3_PICGU/121-352-------------VH-ISMVGVFIAFCFFACLFNFFNSFIFGNYPHRLS............PNHE.KVIFS.........
Q0U0X0_PHANO/1-149-------------WH-DIFMISYLVATLPWTLGCLALS..........................................
A5DAL2_PICGU/21-231-------------WH-DIFMIAYILLTIPWTVCMSVLS..........................................
CWH43_SCHPO/11-220-------------WH-DIFMIGYLISNAPWFILVSKCS..........................................
A8WTJ4_CAEBR/43-270-------------LH-ALGFAIWIICFNFNMLFNILLHHFGGCRD.....................V.............
Q6FKX5_CANGA/5-205-------------IH-DIFMIAYIILTLPWYILVTK............................................
Q7S513_NEUCR/18-228-------------WH-DILMILYIVFTIPWTTGCIALS..........................................
Q4PAD1_USTMA/365-592-------------VH-DIAMFVYLALTPPWMFITSGSLAQPPSVKN.................AA.KT............
Q5RGJ7_DANRE/7-226-------------VH-DIGALLFFICGVVYAVIQSVIGYRAFPY....................................
Q6FIN1_CANGA/8-284-------------VH-ISMVAIFCIFMLLSIVCLTAEYFSMGRHYASIHPLAA....TKADFDPS.NPTNIDSLP.WNKW
Q4SVF4_TETNG/19-241-------------IH-KNGFIVFIASSLLHMLITCRLWYVIRRHY.....................V.............
T150B_BOVIN/4-207-------------TH-LTGAFLAFFVGIVYFWLQLFLSWRMKNLP...................................
T150A_MOUSE/3-232-------------LH-YIGTGVAFTAGLLFVCLHCVLFYHGATT....................................
A7TMD9_VANPO/12-290-------------VH-IAMVVLFVILMFISVCCLIAEYASMGKHYALLHPL.......ANPETTI.PFERLRW....YQW
Q6FKB5_CANGA/8-272-------------VH-LSMVGVFVVLMFFSVCCQTAQYFMMGRRYALFHPL.......SSENPDA.IHALKWY.....QL
Q7PN15_ANOGA/41-264-------------IH-KICFSAFVICSIIYMYLVVLINRLTRTEE...................L.L.............
Q4E2S1_TRYCC/9-251-------------RH-NVGFAFYVFLSFLVQVVIDIVVRRNAHNPE..................I.YA............
Q5DAX3_SCHJA/13-237-------------MH-LFGAGLLFGGGSIYALIVTYITYKY.......................................
Q6IQJ3_DANRE/3-232-------------LH-YVGAGLAFPASLLFVCVQTLLSYRASET....................................
Q9XWR3_CAEEL/44-269-------------VH-VIFFYVFGICGIVHMISNIFCHAHSLYYL...................................
Q4SA40_TETNG/3-249-------------LH-YVGAGVAFPAGLLFVCLQCVLTYRVAVT....................................
Q2UMD7_ASPOR/5-224-------------MH-DGFLVMFLVGYIISAILICAEYLRLGVFY...................R.S.............
Q16JU8_AEDAE/31-253-------------VH-KFCFSTFVVTSMLYMVVLIVINRVTREGD...................L.L.............
PGAP2_XENLA/19-242-------------VH-KLGFMSFMFFSLGYMFVTCTLWRMTRKWS.....................G.............
T15BB_XENLA/3-204-------------TH-LAGAFLAFIIGNVYFWMQTALTYMVKPK....................................
Q54KE7_DICDI/3-196-------------VH-LVFSAIYFIFDYNLHLN...............................................
Q5DGL6_SCHJA/9-235-------------IH-DIGAGMAFYGTTCYILLCALVSQRYL......................................
Q4SKZ5_TETNG/531-722-------------LH-YVGAGIAFPTSMLFVCLQSALTYRLAKT....................................
O77262_DROME/3-230-------------VH-FIGAFCCFGCGTLYFWMQALISYLIFPM....................................
Q559G4_DICDI/11-218-------------VH-VIFAALFFLCGFIYLLTQTILDIKNSS.....................................
A1CK70_ASPCL/15-225-------------WH-DIFMISYLVATLPWTLGCLALS..........................................
A2FGB6_TRIVA/10-214-------------VH-LTGAAVFFFGSFIFYAVSDFTLM.........................................
Q6CX54_KLULA/5-205-------------AH-DVFMISYIVLTIPWDYMIIK............................................
Q54J51_DICDI/6-269-------------SH-QVGFVSYVIFSFLYMYTHCAVLYHTKIKFRAGFE..........NQSIS.SIIFKG.......N
A2DNY5_TRIVA/47-242-------------YH-FLFAFSGFTGILVFETLCYVVC..........................................
A8X4A4_CAEBR/10-248-------------LH-ITGALLAFGGFTIFMIFQCYLTHKFTGV....................................
Q93319_CAEEL/9-241-------------VH-MSSAVASFGGFSIYMIFQCYLTHRVTPT....................................
Q17MC8_AEDAE/70-299-------------VH-EKVFILFMTSSLSYMLATLKLLKVLQPNG...................P.Q.............
T150B_HUMAN/4-206-------------TH-LAGAFLAFILGNVYFWLQLLL.WRLKRLP...................................
Q6CDS5_YARLI/4-220-------------VH-VGCLVLFIVGIGISAILNSAEFTLLDQNY...................P.D.............
DRAM2_MOUSE/7-233-------------VH-VCGAVLAFSMGSFYMFVQTILSYQMQPK....................................
Q550K4_DICDI/13-193-------------PH-LIFAALFFICGFIFILTQTIIDDQIS......................................
Q1N1S1_9GAMM/4-214-------------EH-IFFATFFFLITFVAQALDLAGHYLFRAEK...................................
Q8QGB2_ONCMY/7-226-------------VH-DAGAILFFVSGVLYTILQSIISYKAFPY....................................
A6ZTJ7_YEAS7/5-207-------------IH-DIFMITYIVLTLPWDIMITRYS..........................................
Q4PDK8_USTMA/9-236-------------VH-WSMTLIFVVFVALSVLFQVLQVFSLSHDY...................D.R.............
Q01D47_OSTTA/14-220-------------AH-VTAAFGFLFAMWIWTAMCVRQLAAHPG.....................................
T150C_BOVIN/8-218-------------IH-NVGTSLTFGFGTLTCWIQAALTLKVNIK....................................
A5DS39_LODEL/32-242-------------AH-DVFMISYMVLTIPWTVCTTLLS..........................................
A7S3L1_NEMVE/7-240-------------VH-LTGAVMVFLCSVFYCWIQTLITYKMMNCG...................................
PGAP2_DROME/19-240-------------TH-RNAFVVFIACSECYMLVSYLLNRNIQKTV.....................L.............
DRAM1_MOUSE/7-226-------------VH-DGGALLAFVCGVVYTLLQSIISYKSCPQ....................................
Q28IE8_XENTR/3-227-------------LH-YIGAGVAFPTSMLFIFLQSLLTYRMAHA....................................
A6SR76_BOTFB/5-222-------------AH-DICLAIFIGGYILSAIFICWEYQRLGIHY...................R.E.............
DRAM1_XENLA/8-227-------------VH-DAGALITFICGVMYILLQSYISYKSCPT....................................
Q6BKM3_DEBHA/21-231-------------WH-DIFMISYIVLTIPWTVCITKLS..........................................
Q55T17_CRYNB/25-255-------------VH-WDGTLVFIIGVALSAIFQTLEVWQLNKGH...................E.E.............
A3GGF7_PICST/12-243-------------VH-LSMVGVFIAFSFFCCLFNFFNSFIFGNYPSRLS............PDHE.RVIFG.........
A5E3J3_LODEL/22-254-------------VH-MSMVGIFIAFCFFACCCDFGITYIFGTRGDQLD............PVHR.TTVFG.........
Q5DF06_SCHJA/6-229-------------RH-RNYFGIFVLSSVVYMIIDVYISQLINKLC.....................Q.............
A7TRI4_VANPO/5-205-------------TH-DVFMISYMVLTIPWNIVITK............................................
Q22Y36_TETTS/100-306-------------FH-GACAVIFFIFLCVYTQLNFNTCQQLRKLN.....................P.............
Q55M70_CRYNB/8-234-------------VH-DLFMIFYLLLTVPWMFLSSG............................................
T150A_XENLA/3-232-------------LH-YIGAGVAFPAGLLFVCLSSILSYQLAAS....................................
A7RFU0_NEMVE/9-235-------------FH-DAGAVLLFGSGAVYCWIQTVLTYRMSLNG...................................
A7RNE7_NEMVE/10-236-------------VH-EASFITFQVSAMVYMLTNCIIFRWTLSSL.....................P.............
Q6CTH9_KLULA/8-279-------------VH-SSMVGIFCAFVGLSVICHVAQYMTMGRHYAVVHPL........TSSEDI.GKDTRWN.....EW
Q96U46_NEUCS/3-220-------------LH-DIFLLLFIAGYVISAIFICWEYQRLGMRY...................R.E.............
Q5AF82_CANAL/13-246-------------VH-ISMVGVFIAFCFLACVCDFTISFIFGTNPSKLD............PVHD.QVVFG.........
Q55WH1_CRYNB/26-256-------------GH-WTMTIVFIVGVAISAVFQSAEIWSLHKEH...................P.D.............
E9ADF4_LEIMA/115-359-------------YH-NLGICPYLPFCLVLQAAVTMLVRRNQFNTA..................I.YP............
A6ZZR5_YEAS7/10-287-------------VH-IAMVSVFVVFMFLSTCCLIAEYFLMGRHYASVHPLASPHFNPQSSEKSFNQDYNTVDELPWYKW
Q6IQI0_DANRE/7-234-------------MH-LVGAILTFGIGALYVFIQTALSYLMQPH....................................
SFK1_SCHPO/21-232-------------VH-WKFTAAFVVLAFVSAASNIFEWLSATRYY...................P.Q.............
Q9VPT6_DROME/29-248-------------LH-ITIALSLFVSCAIYMAGSFVCAKYYMSDR...................I.G.............
A7SJV3_NEMVE/4-240-------------LH-YVASSFIYIGGFPCLVFNTILTYKIA.HV...................................
T150B_DANRE/3-204-------------VH-LLGALMAFFLGLAYFWIQAFITYFSPPS....................................
Q86F93_SCHJA/5-228-------------VH-LIGAIMTFNLGVIFAALVTFSTRKHL......................................
A4RTY8_OSTLU/13-222-------------AH-VTAAFGFLFALWIWLACVVAQLRKHED.....................................
T150B_MOUSE/4-207-------------TH-LAGAFLAFILGNLYFWLQFFLSWWVKGLP...................................
Q3V5H7_CAEEL/25-251-------------WH-VCFFYSFGVVALLFFISNTVCHSQSLYFL...................................
Q6C3N0_YARLI/30-239-------------WH-DIFMISYMVLTIPWTVGCTLCT..........................................

PF06197

B5HBV4_STRPR/2-171.............QH.GSVAVVGFTLLAVWPV....LAA......--------------------------------...
Q5JHY1_PYRKO/12-178.............PH.VFVSTYFFVQFFLGAL....VYG......--------------------------------...
Q8U0G5_PYRFU/9-174.............PH.VFVSTYFFVQFFLGML....IYG......--------------------------------...
Q6L2X2_PICTO/12-188.............PH.DFVSIWFFILSSISYI....TIG......--------------------------------...
Q9HJI2_THEAC/17-194.............PH.DFVSIWFFILSTISFA....TLG......--------------------------------...
Q97BH7_THEVO/15-193.............PH.AFVSIWFFILSSISFV....TIG......--------------------------------...
A8MCR4_CALMQ/13-182.............PH.TFVSEWFFTQMDLAVV....TWS......--------------------------------...
Q970R2_SULTO/9-177.............PH.LFVSTWFFIQFDIAIL....TYG......--------------------------------...
A1RZ19_THEPD/13-186.............PH.TFVSLWFYLQSFIAST....ALG......--------------------------------...
Q9Y8U9_AERPE/10-184.............PH.VFVSTWFFLQMDMALV....ALS......--------------------------------...
Q5JHD7_PYRKO/10-182.............PH.YYVSWGFFLTAGFGLL....IAG......--------------------------------...
Q8U4E0_PYRFU/10-182.............PH.YYVSWAFFIITSIGML....ITG......--------------------------------...
O58000_PYRHO/24-191.............LH.YEVSWGFFVSMFLAIL....LLS......--------------------------------...
Q9V235_PYRAB/6-172.............WH.YEVSWGFFVSMFAAML....IIS......--------------------------------...
Q9HK23_THEAC/11-184.............LH.LIFALIYFVLFPISII....IASVR....--------------------------------...
Q97AI7_THEVO/15-188.............YH.LIFALIYFLLFPIGII....VASIP....--------------------------------...
Q9V1S7_PYRAB/6-155.............LH.TPSAILTYILAFTDMV....IYG......--------------------------------...
O59449_PYRHO/6-155.............PH.TPSAILMYLLSFIDMG....LYS......--------------------------------...
Q8TZZ1_PYRFU/8-157.............PH.TPSAILFYILSFIDIA....TNG......--------------------------------...
A3DLK8_STAMF/12-179.............IH.FLVSVLFFLSIIAYFI....AIS......--------------------------------...
A2BLJ9_HYPBU/14-183.............AH.FVASAAFFLAMIPYVI....AYS......--------------------------------...
Q3SA92_9EURY/13-189.........GDMTVH.RFFAITGFTIGSIIVL....LFA......--------------------------------...
A4YES6_METS5/12-174.............PH.LVSALIAFLFSGLASFPAFRLTK......--------------------------------...
Q96ZU3_SULTO/14-171.............PH.LIGALLAFLFGGISAI....LTS......--------------------------------...
Q97UA8_SULSO/14-171.............PH.LIASLITFLFGGIGAL....VTS......--------------------------------...
Q4J885_SULAC/12-172.............PH.LIGALSAFLFGGLAAI....LTS......--------------------------------...
A4WJI6_PYRAR/3-170.............PH.GISALITFLFGALAVM....VIG......--------------------------------...
A3MT35_PYRCJ/9-176.............PH.SISALIAFLFGALAVI....VIG......--------------------------------...
A1RR81_PYRIL/8-175.............PH.GVSALIAFLFGAITVI....IMG......--------------------------------...
Q8ZU94_PYRAE/9-176.............PH.WISALIAFLLGAIAVM....AMG......--------------------------------...
Q5V2H6_HALMA/24-206.............WH.GIFALLTFFSGGITVVLSSQVVS......--------------------------------...
A3CTX5_METMJ/16-189.............IH.GLFALAAFVFFNVEAI....ACA......--------------------------------...
Q8DVX1_STRMU/11-196........TVKGIIH.LLFAILQFTALAIFIFNVTEVLKP.....--------------------------------...
C6LHE9_9FIRM/14-201........AFQDIMHIYVVTVSVVLLSIISLV....VIM......--------------------------------...
A9KKH9_CLOPH/12-200.........KNDIIH.VVVTVTILCATALSIL....LIT......--------------------------------...
A4C406_9GAMM/11-199.......PTFNCKIH.SWAGFIMLLSLVVAPI....LVS......--------------------------------...
Q21FK4_SACD2/11-194.......PSKKCEVH.TLAGVVMLFSLLIANI....LVI......--------------------------------...
D1CAZ9_SPHTD/27-219......QDTLRNQMH.QWYGIGMPILFALAVGFGSRLLG......--------------------------------...
A0JTJ1_ARTS2/34-213...........VPMH.ILVTNIQLALMVAAMC....FVA......--------------------------------...
A9EN54_9RHOB/14-198......GHSAIHIAH.MIAAATAYPLALIGLF....LLV......--------------------------------...
B6R5G7_9RHOB/17-195.......QSQSQLIH.SAAGLFAYFCAVVGLC....LLA......--------------------------------...
A3Y9R4_9GAMM/13-198.......PTISHNIH.MLSAFPGYLCGVISIF....ILS......--------------------------------...
A4BDB6_9GAMM/24-208.......PTLSHSTH.MASAALAYLSALFAVL....LAA......--------------------------------...
D9QLM9_BRESC/12-196.......PTLDALMH.DLIGGTGYLTGVVGLA....LAG......--------------------------------...
A4AMV1_MARSH/11-200......TFSLSQFIH.NLTGFLTYLIVPFSVI....LLG......--------------------------------...
Q8PIW3_XANAC/13-196.........RASQAH.ATAWLLWAVAFVPGML....LIA......--------------------------------...
B0U375_XYLFM/12-195.........RTTQYH.ATVWLLWGIAFCTATA....LLT......--------------------------------...
Q28UV2_JANSC/25-202...YGDGDNEGVVVH.IYVVYALGVGFFAAPL....LLA......--------------------------------...
A8LJU0_DINSH/25-202...YGDGDAEGVVIH.EYLVYGLGVLFTAMPL....CLA......--------------------------------...
B7RKC5_9RHOB/26-203...YGDQDSDGIVIH.VYLVYVLGVFFTALFV....LMA......--------------------------------...
Q2CCU1_9RHOB/24-201...YGDDDSDGIVIH.VYLTYILGVFFALGPL....VMA......--------------------------------...
A3SUZ6_9RHOB/25-202...YGDNDSDGVVIH.SYLVYALGLLMAILPW....SMS......--------------------------------...
A9E2D4_9RHOB/9-186...YGDRDSDGVVIH.VYLVYALGVIMLTVPW....LLS......--------------------------------...
A4ELQ4_9RHOB/25-202...YGDNDNEGVVIH.IYLVYGLGVLMALVPW....LMS......--------------------------------...
D0D590_9RHOB/30-207...YGDNDNEGWVIH.TYLVYALGAAMTVACF....SLA......--------------------------------...
B6BBN4_9RHOB/25-202...YGDSDNEGVVIH.IYLVYALGVLMAVAPW....VMA......--------------------------------...
A3WAS2_9SPHN/25-205............VIH.YRLVYVLGLAFPLTVL....LTA......--------------------------------...
A3IX19_9CHRO/26-204.......NSSGFSVH.LYAVYVLGLIFPLICF....LLS......--------------------------------...
B8KPW0_9GAMM/11-188.........FGPDANDPLAVLASNVGLIMGLL.............--------------------------------...
D9QK37_BRESC/20-202.............RH.MAINLGLGIQLAPAFL....LVA......--------------------------------...
Q0W5U1_UNCMA/16-197.............VH.VPAAMLTFLCLTAMLL....LVNL.....--------------------------------...
C5BVW0_BEUC1/45-235....EETMTASGMLH.LVLSGLGFLALGVGAILTGGALA......--------------------------------...
D3Q5U6_STANL/20-208Q.GAPETLTWHGILH.GLAPAAIGVALIAASI....IVAR.....--------------------------------...
D2B9K9_STRRD/15-199....EGETSWHGMLH.NVAAMVGGLALLAASL....VFAR.....--------------------------------...
D7AZL9_NOCDD/27-217A.GMPEQLTWHGYGH.MAAGSVSFAALIAACY....VLGH.....--------------------------------...
D2AS92_STRRD/33-219E.GPTGSISTNGAVH.MFGGMIGYLALCAAFV....VLAR.....--------------------------------...
D2PMS1_KRIFD/36-226D.GQPVAMSWHGVAH.FAAGGIGFLAFVIACV....AIGR.....--------------------------------...
C8XD39_NAKMY/31-221...AGSVPSWTGLVH.LAAGGIGFTCLAIACT....LMAA.....--------------------------------...
D2B4R9_STRRD/12-208A.GVPTDAGVSYVLH.GAGFSVVLVSLIAACS....VFTR.....--------------------------------...
C8XD67_NAKMY/16-200A..PGPAMSWHGVVH.AIAPPVAFGCLIGLGL....VFAR.....--------------------------------...
C4RF79_9ACTO/74-259D.GPVARMSWHSVVH.SVAAAVAFTALAVAAI....VLT......--------------------------------...
A7HVR6_PARL1/16-206D.DQQPVMTTAATLH.SLAFMIAFGGLILSCF....VFAF.....--------------------------------...
E8T0T3_GEOS2/14-211....PAVRSTSGLMH.DIAGALVFGALTAVCF....VLAGR....--------------------------------...
D3PXJ2_STANL/16-212....ADVVTVSGRLH.QVGGSLLFIGLIGGCF....VLAR.....--------------------------------...
C5BVM4_BEUC1/10-201A..HPTTFSRAHERH.DQAGAVVFAALPVACV....TAA......--------------------------------...
D3Q1F0_STANL/29-225...ATGIHTWHGQLHDVPFSAAGFLAMTAACL....VFAF.....--------------------------------...
A4F7D5_SACEN/16-207...ALGQSTLTGSLH.DTFSALVFAALPLACG....VLAR.....--------------------------------...
B8GH43_METPE/42-235......TESLHGMVH.GLLGGIVFICMAVSCF....VFLR.....--------------------------------...
B4SM32_STRM5/13-185................YTIGIANIIAPAMSHI....ELS......--------------------------------...
Q9RJS0_STRCO/12-187.............RH.GAVVVVGFTLLAVWPV....LAV......--------------------------------...
B1VPM0_STRGG/12-188.............EH.GAVSTVGLVLLAVWPP....LAA......--------------------------------...
D9T5P6_MICAI/28-216.............AH.GVVATVAVLALALWPA....GSALRLPRR--------------------------------VPR
Q0RZC5_RHOSR/71-245.............VH.VAATAVGALLIAVWPI....LVI......--------------------------------...
C0ZQ51_RHOE4/26-217........SISGIIH.WAASALAFLSLPVAAI....LLARP....--------------------------------...
C8X6V7_NAKMY/31-224........STAGHVH.RVASLVAFVCLPVAVI....LLT......--------------------------------...
D3Q1Z4_STANL/35-216........SFSGYVH.RYAAGAVFVMITVATAHLWRRVP......--------------------------------...
D3Q759_STANL/3-179........TVAGYIH.RYASGTGFGLVIIAGFLAFATTT......--------------------------------...
D2AUN0_STRRD/12-196........SAGGEIH.RWAAAVVFTALPCAGW....MMG......--------------------------------...
D2B0Y0_STRRD/13-197........DLTAQVH.RYVSIAAFVAMPVAGA....LMVA.....--------------------------------...
E8RZG0_MICSL/12-189........DTAAYVH.RYASVLSFLALPVAGW....LLA......--------------------------------...
C6W8D5_ACTMD/12-195........SMTGLVH.RYAGAVMFASLPIAGW....LVS......--------------------------------...
C8XCN7_NAKMY/38-227........DTSSTIH.LIAGAAVFALLPLAAVRLWRRLA......--------------------------------...
D3EGW1_GEOS4/23-212......DATFSGSMH.SIGAMLDYTPLAALLI....SLS......--------------------------------...
B4SRG7_STRM5/12-194............FIH.GLAANTAFLCASVGML....LQAW.....--------------------------------...
Q3BVQ6_XANC5/87-268............MVH.VLSADTTFLCVIAAVL....LQSW.....--------------------------------...
C8XKD4_NAKMY/21-199........SGHAQAH.MAGAVVALVFLPLGIV....LAL......--------------------------------...
D9SXQ4_MICAI/13-198.....EATTVADLVH.GGASIAATAAVVLAML....VLL......--------------------------------...
Q0SAA4_RHOSR/13-214AREAAGHLPLTHDLH.AVTSASASTGGVVSSL....AFL......--------------------------------...
D3Q0C1_STANL/5-190TAEVAGKVPLRHQIH.TLSSSLAAAAPFVGLI....AFA......--------------------------------...
D0L9X9_GORB4/20-220A.EPSGLLPQLHHIH.ALTSTLAVFSIFGAMI....AAT......--------------------------------...
Q5Z3B7_NOCFA/14-211G..PRELFPQLHQPH.ALTSTLAVTAIAVAVA....AFS......--------------------------------...
C0ZM54_RHOE4/15-215S.APDGLLPQLHHVH.ALTSSVAVFAIFTAMI....AFT......--------------------------------...
D5UPX7_TSUPD/8-215FREANGEVPFTHLAH.AYSSGIAGTGGAVAVL....AWA......--------------------------------...
C6W9M9_ACTMD/22-202DREAAGAVSLSHHLH.QVTSVLTFVGALAAAA....VLE......--------------------------------...
D2B4U0_STRRD/15-212AAEAAGRVSPSHRIH.TATSALASAGAMISLV....ALP......--------------------------------...
Q6NEW9_CORDI/11-191......PVDHFGSFHIVTSTVVVTAQVLLAAV....MLR......--------------------------------...
C5C1J0_BEUC1/20-217.......GDLEVVIH.DLASAVSEVGLFGGVLGAWFATRR.....--------------------------------...
E6GHX6_ENTFL/13-204.........VAAALH.NGGSAVGYTGFLLLSG....VLT......--------------------------------...
Q1B6C0_MYCSS/20-192..........GGVLH.IVGAALAIGGGNAAALAGASLRP......--------------------------------...
D1YC80_PROAA/17-217AAEEAGQVSVNHIVH.VGTSTIVVVGFALPIL....LLN......--------------------------------...
A2RL60_LACLM/11-196....NPLREPKLFIH.DGLSVLALLFILLGVV....ISL......--------------------------------...

PF10277

Q7QE61_ANOGA/3-230.....MGTMQKANLRMALSVVCTVFFMIV.................AVTGVISHILFRGTDPRK.......WYPSDGGWE
Q757Q5_ASHGO/5-206......HATHNRALRKVVGGAFFGTLVPL.................IYWFIQHNVKK....................RAG
Q75DE7_ASHGO/9-286HGHVWNKLTVSGTVKMVWLFLAAAWAICF.................GAVKNP............................
Q4WNE6_ASPFU/5-224...QHRILFASFVIKLAFVIIEVALAIAF.................GICTRRSSGK........................
PGAP2_CAEBR/12-239....TNLGERSYEYKILGASIFVVCFFLG.................GYLYWRHNTYC....................EPG
PGAP2_HUMAN/79-302....SQEDRKSYSWKQRLFIINFISFFSA.................LAVYFRHNMYC....................EAG
PGP2L_DROME/96-324....SEKQLLSIKWKKILFAVSILSTVGL.................LVFFAKHRFYC....................HDL
A5DLG3_PICGU/121-352NHRWGNLYMVSFWFKCFWLVCAAVFACFF.................GAYMKKDKN.........................
Q0U0X0_PHANO/1-149.....PRNPTALGYRKLFAGSFFATLVPL.................IYFFIQHKVHH....................VAG
A5DAL2_PICGU/21-231.....PKGSIVRRGRTWTAIAFFSTLVPL.................VYWFIQHKVHV....................RPG
CWH43_SCHPO/11-220.....PVNSMASRIRNIGSALFVLTIFPL.................IYWYIQHKFKH....................IPG
A8WTJ4_CAEBR/43-270....HDRMETTWRIKCVIFLIGYFCAIST.................PITYPYFTAHC....................SPF
Q6FKX5_CANGA/5-205.......HSNYKQAKTIVGTTFFSTLVPM.................IYWYIQHQVHH....................VAG
Q7S513_NEUCR/18-228.....PPNAKAIKYRKWIAGSFFGTLVPL.................VYFFIQHKVHR....................VAG
Q4PAD1_USTMA/365-592...DDQLASKARKMRRIACFSFFACTPFM.................GFFFYRHNALR....................IPG
Q5RGJ7_DANRE/7-226.....GSSKFMCHLRTFFSTVAILAAIPT.................IACGFLVGTSKLHWD............SNDKDYT
Q6FIN1_CANGA/8-284TGHIWNKFTISATLKTIWCIAAIVWAICF.................GAIHDN............................
Q4SVF4_TETNG/19-241....NPEEITSQRWKVRLFLFNISCCLAA.................AYFFRRHNKFC....................EAG
T150B_BOVIN/4-207....QPGAPWIGPLRLVLCSACFILEVAM.................VVLHSWS...........................
T150A_MOUSE/3-232.....PLDMAMAYLRSVLAVIAFITLVLS.................GVFFLHESSQ........................
A7TMD9_VANPO/12-290SGHIWNKFTLSAAFKAVWLTLGVVWAICF.................GACGD.............................
Q6FKB5_CANGA/8-272AGYKYNKFIISASMKVVWLALAVVWAICF.................AAISDN............................
Q7PN15_ANOGA/41-264....TLAERKSLRYKRRLLLVNVASIMFA.................VYFFVRHNNHC....................EPG
Q4E2S1_TRYCC/9-251...SSDDYRLSSYWKRVFLIGQTTGALSH.................VIFYVRHINTC....................APG
Q5DAX3_SCHJA/13-237.....IVRSRIWIARLVLAFISLFSFILQ.................PTTGLIARFMYDGDNIRK.......WKPTDKGYS
Q6IQJ3_DANRE/3-232.....HRDVQIAHLRLILTAMAFTTLTLS.................GVFFIQESFV........................
Q9XWR3_CAEEL/44-269....NPYGRLSYYLKILFTSLYVLSTPIL.................IASFILYWRKC....................ITW
Q4SA40_TETNG/3-249.....TLDYWMAHFRVALTLGALVSLILILRLLYGSAFLSSHLPPGGVFFVHESFV........................
Q2UMD7_ASPOR/5-224...QHRVLFASFVIKLLFIIIEIALAIAF.................AVLGKKGPSK........................
Q16JU8_AEDAE/31-253....TASERKSIRYKRRLFLANLCSILLA.................VYFFVRHNSYC....................EPG
PGAP2_XENLA/19-242....SPEERTSYAWKKRLFGFYLLMFLAS.................IVVYIWHNMYC....................EPG
T15BB_XENLA/3-204.....HGGCYIGPIRFCLSIACTALIVAM.................AVFLKMN...........................
Q54KE7_DICDI/3-196.....ILAPKLFIFRIILSVLYTVAILIF.................QSTNYKEYNN........................
Q5DGL6_SCHJA/9-235.....GTHWCIWIFRLLLGIAATIATIMF.................SVCHTVSRINFNGTQEESL....IYRHPGQGGFS
Q4SKZ5_TETNG/531-722.....QGEHNVAHLRLCLALLAFVAL..........................ESFV........................
O77262_DROME/3-230.....SGTRINAHLRLGMSVVCTILFILL.................AVTGVMSHILFKGQNPRK.......WYPSDGGWY
Q559G4_DICDI/11-218.....DIPLKVLIIRKILICISCL.FIGY.................IITQFF............................
A1CK70_ASPCL/15-225.....PNNRRAVKYRKIMASLFFGTLVPL.................IYYFIQHKVHK....................VPG
A2FGB6_TRIVA/10-214.....QCKVKLNIISLVLTWLVVGFLVLY.................TVFASFSKRS........................
Q6CX54_KLULA/5-205.......HSQYKEWKKILMTAFFGTLIPL.................IYWFIQHQVHR....................RAG
Q54J51_DICDI/6-269YSPKTQKDLFSFKWKAILGIAHFLLFVGS.................LKYFVDHTFYC....................VYL
A2DNY5_TRIVA/47-242.....RKDTNLAMVRLFLISFATIGYLIF.................GFTDAVFEPN.......................M
A8X4A4_CAEBR/10-248.....ITVITVFRFRLVFTVLSAIFFVVG.................LSFGIIASRVFHSVYPDLPTPRPWSRKIYQPGYG
Q93319_CAEEL/9-241.....ITLRTVFYYRVIFTIFSVICFCCS.................FGFGIAASKIFHKTYPDLPTPRPWSRRIYQPGYE
Q17MC8_AEDAE/70-299....TTQEETSLRYKRAFFALSIASTIGL.................ILFFLKHRFLC....................HDL
T150B_HUMAN/4-206....QPGAAWIGPLRLGLCSVCTILIVAM.................IVLHACS...........................
Q6CDS5_YARLI/4-220....VRRLKTSYILRWIWVAIAIVLAIIF.................VSCNNRNEP.........................
DRAM2_MOUSE/7-233.....IHSKQVFWVRLLLVIWCGVSALSM.................MTCSSILYSSDFGPDVVQK....LHWNPEDKGYV
Q550K4_DICDI/13-193.....NNSNRIKNIRKVLIFICCL.FIPY.................VILQFIQNPI........................
Q1N1S1_9GAMM/4-214.....QVLTVPLKIKWICVLMQGIMIASV.................FVLRELDTGD........................
Q8QGB2_ONCMY/7-226.....GCSLALCRVRTGMATIAFLAVFPT.................VVCAIFVTQTTLHRK............TEDEDNV
A6ZTJ7_YEAS7/5-207.......SPLTSKNKGLTATIFFGTLFPM.................IYWYIQHSVQQ....................RAG
Q4PDK8_USTMA/9-236....LATLKVIAIIKAIILSLAIAGAIAF.................IICYGICRGDALPG..............NDRCDR
Q01D47_OSTTA/14-220.....SVSAKSLRGKYLACGFGFMGVVGF.................AALSALVGKE.......................N
T150C_BOVIN/8-218.....NEGRKVGIPRVILSASITLCVVLY.................FILMAQG...........................
A5DS39_LODEL/32-242.....PRHSFQRKARFYSAVGFFSTIVPL.................IYWFIQHKVHV....................RAG
A7S3L1_NEMVE/7-240.....LNSAGLFVIRSALSGASTVFFILT.................LVGRGYAQSKWQSGHPNSDL..RPTWKPGETGYK
PGAP2_DROME/19-240....LPHEEKSLRYKRNLFLVNVIAFGLA.................GYCFVRHNSHC....................EAG
DRAM1_MOUSE/7-226.....WNSLTTCHVRMAISAVSCAAVVPM.................IACASLISITKLEWN............PKEKDYI
Q28IE8_XENTR/3-227.....YWGCYVGHIRTLLTLFGLVILVLS.................GVFFIQEGFV........................
A6SR76_BOTFB/5-222....HSVLRISFWVKLAFIFVELGLAIGF.................GVCNRKSWW.........................
DRAM1_XENLA/8-227.....WNTRATCHIRMTVSLIAFIAVVPM.................SVFSILSGRKRLDWK............PSDEGYP
Q6BKM3_DEBHA/21-231.....PKGSKVRRGRAFTALTFFSMLVPL.................VYWFIQHKVHV....................RAG
Q55T17_CRYNB/25-255....RKHLKRNTYFKLAIVAGDVILATAF.................GATYMYCHGKATATNG..........HTTSQCDD
A3GGF7_PICST/12-243SWRWANLYMVSFWMKFVWLFVAAAFAICF.................GYFMKDGNR.........................
A5E3J3_LODEL/22-254TSRRGNLYYIGFWAKIIWILAAICFAAAF.................GYYMNTGND.........................
Q5DF06_SCHJA/6-229....YSPWSKILKKKIYVMATYVTCLLII.................MLCHYIHMRFC....................PPY
A7TRI4_VANPO/5-205.......NSSTKLKHTSVASMFYITLFPL.................IYWYIQHQVHH....................IPG
Q22Y36_TETTS/100-306....AFMSNSSYNRKKFFAKAWYVVFFFI.................ILLALKQKWA........................
Q55M70_CRYNB/8-234.....NANRDSQHKRRLPFYGFLATIPPL.................MWFYYRHSALR....................IPG
T150A_XENLA/3-232.....ALDYWLGHLRVSLTIVALISLVLT.................GVFFIQESFL........................
A7RFU0_NEMVE/9-235.....LAPVPLFAVRLILTGILSVFGCSI.................LSFVLSFQQSEHTVAHW.........QPDDPGYS
A7RNE7_NEMVE/10-236....THQESVSMRWKVICLLLNYSSFAMA.................VYFFFRHNWYC....................ESG
Q6CTH9_KLULA/8-279HGHVWNKYTISGLLKAFWVIAAFVWAICF.................ACLEDR............................
Q96U46_NEUCS/3-220....HRVLRISFWVKLAFVVVEIILAVAF.................ASCSYTGHY.........................
Q5AF82_CANAL/13-246TSKFADLYFVSFMLKLVWLFAAVAFAICF.................GVYMKNDQN.........................
Q55WH1_CRYNB/26-256....RKSLKRNSILKLIIVLFAIVLAICF.................GITYGICQGNSSATNG..........HSANTCNN
E9ADF4_LEIMA/115-359...TPQDATASYAVKRVCLCVEVVAAVGI.................VCCYSHYLRTC....................ANG
A6ZZR5_YEAS7/10-287KGHVWNKFTISATLKVIWLTLAVVWAICF.................GAIDDS............................
Q6IQI0_DANRE/7-234.....IHSKTMFWTRLSVGIWTLSSIISM.................FVSSVIMYSTLPGVEVNKK....LHWTPGEPGFT
SFK1_SCHPO/21-232....SSLLRVSFIFKFVIIVVGIICAIAF.................GGLHHNYRGR........................
Q9VPT6_DROME/29-248....QLHEEFSLRLKSGLVLTYYVWVVVM.................WIFYFIHQKFC....................FPL
A7SJV3_NEMVE/4-240....GRASNGIFLLRMFISVIYSISSLSF.................VVLQTFCHNKYNRHDNVGFE...SHWKKGEDGYA
T150B_DANRE/3-204.....RDNKWLVPVRFVLCSQCTCMVICM.................FVLHSTG...........................
Q86F93_SCHJA/5-228.....DYNFRIYIFRIILTIFGFLANVGV.................FIFGRLSGGLSGPFPRK........WDPSEPGYT
A4RTY8_OSTLU/13-222.....AVSRFSMRAKVAGLAFAGLGVGGF.................TALSALVGKDE....................SRT
T150B_MOUSE/4-207....QPGPHWIKSLRLSLCSLSTILIVAM.................IVLHALH...........................
Q3V5H7_CAEEL/25-251....NPYGRISYHVKIVISICYFLSAPAI.................ATFYALYWKAC....................FTW
Q6C3N0_YARLI/30-239......RDANARKWRKIVATCFFGSIPPL.................IYFFIQHKVHH....................IAG

PF06197

B5HBV4_STRPR/2-171....DRGGAGPWGLRLLPSVVATASIGIG-----------------AGWFLIE....------------.........MN
Q5JHY1_PYRKO/12-178..........AGSEKREVKYGSILIFLLA-----------------LFGTFVH....------------...........
Q8U0G5_PYRFU/9-174...........LGSKTDIRLTSIIIFILA-----------------LLGIFIP....------------...........
Q6L2X2_PICTO/12-188...........IALVIQRIKYGIAMLVLI-----------------PVSWLLF....------------........IKI
Q9HJI2_THEAC/17-194..........ISRLIRKRYGTGMIILSML-----------------ITSWIVE....------------........YLV
Q97BH7_THEVO/15-193..........IGMYLVGDKKFGITIILII-----------------LASWIVY....------------........SSV
A8MCR4_CALMQ/13-182..........IGLIVGRRLNYGIPLLLLG-----------------LIAPIPA....------------........LLI
Q970R2_SULTO/9-177...........IGLLMERRKLGIYMIILF-----------------IIANVVA....------------........GVI
A1RZ19_THEPD/13-186..........IALLLSGRKAVGTALLALG-----------------LVPVPLGTL..------------......IEATV
Q9Y8U9_AERPE/10-184..........LGAYRACRNLANMAALALS-----------------LAAFPVYIL..------------......IGITL
Q5JHD7_PYRKO/10-182.......IGMGLSGDRKMLYFTVVLFVLA-----------------WILAIWA....------------.........MR
Q8U4E0_PYRFU/10-182.......IGIGLARNRIVLYLTIGIFVVG-----------------WILGIIA....------------.........MK
O58000_PYRHO/24-191........ISFLIRGNKLGIVGLMLFLLG-----------------VPLALWS....------------.........LK
Q9V235_PYRAB/6-172.........ISILKKSRLGFLGLAVFCVS-----------------LPLALFS....------------.........LK
Q9HK23_THEAC/11-184..ASLPAWIRVYGIAGSAAALAVIVIGIG-----------------FVFHFVT....------------..........I
Q97AI7_THEVO/15-188..RLFPFYVKLYSMLASILSLIDIFIGIG-----------------FVFKFIS....------------..........I
Q9V1S7_PYRAB/6-155...............GIWRVVGIGTFMVM-----------------LFLINLK....------------...........
O59449_PYRHO/6-155...............RTWRIIATITFTIM-----------------VILVSFK....------------...........
Q8TZZ1_PYRFU/8-157...............KKAGLLAFATFLTM-----------------IGLVAVG....------------...........
A3DLK8_STAMF/12-179...........ILDKSWIAVLLIIGHIAM-----------------WYLHFAS....------------..........E
A2BLJ9_HYPBU/14-183..........AKRSPKLLATAALGTASTS-----------------LLWYMHL....------------........VRD
Q3SA92_9EURY/13-189.........IFWILTPRWRVVGAIMLIIC-----------------FLPALAW....------------.........IY
A4YES6_METS5/12-174...........TPVRYSYPVLGLISLASL-----------------FLFISHN....------------..........Y
Q96ZU3_SULTO/14-171...........IRRNYFWTVLGLITLISL-----------------VLYVLKD....------------..........Y
Q97UA8_SULSO/14-171...........IKRNYFWGILGIATLVSL-----------------ILFILKD....------------..........Y
Q4J885_SULAC/12-172...........IKRNYFWTVLGAITLISL-----------------FLYLGKM....------------..........Y
A4WJI6_PYRAR/3-170.......LRRGGAFKPFGLAMGAIALIAL-----------------ALFIPRV....------------..........Q
A3MT35_PYRCJ/9-176.......LRRGGIFKPLGITLGAISLIAL-----------------ALFIPRV....------------..........S
A1RR81_PYRIL/8-175.......FRKGGIYKLLGIAMGAISLVAL-----------------MLFIPRT....------------..........Q
Q8ZU94_PYRAE/9-176.......ARMGGFFKAFGLAAGVISLTAL-----------------ALFIPRV....------------..........H
Q5V2H6_HALMA/24-206........RPFSFLCGLFGGISLLVLVSV-----------------FVYGLLVGG..------------.......PSPV
A3CTX5_METMJ/16-189...........SLVRGPLKAISIIAGIVG-----------------LVFLVTHAASD------------....FGIMSLY
Q8DVX1_STRMU/11-196...LNATLFLIASYIKIVVEVGLYGLVIA-----------------LFLPFVK....------------...........
C6LHE9_9FIRM/14-201...IGGYRDKKYRSIAIWATIALLLMFAG-----------------AIGTNIV....------------...........
A9KKH9_CLOPH/12-200...IGYLKQEKLKILGLITLVAFLFFVVF-----------------NLWHLYA....------------........ILN
A4C406_9GAMM/11-199...ISPTTEAIPLYFRIFSVVSVIAAVYY-----------------LFAMVKA....------------.........VK
Q21FK4_SACD2/11-194.......FASVSSGLRVFSAVCLVLVVVF-----------------LILMAQA....------------.........YK
D1CAZ9_SPHTD/27-219............KRFRYYSYATILVILVA-----------------GFMMSQQNSA.------------......LAANE
A0JTJ1_ARTS2/34-213........AGFHGRMRAYSIVSLAASAVM-----------------GMVAFMA....------------........APG
A9EN54_9RHOB/14-198......LTLPRPSLLRRLALPSMAVGFGL-----------------FGAIIAV....------------...........
B6R5G7_9RHOB/17-195.........RAQEGRSYWFVPGLVLFALF-----------------LSLMLET....------------...........
A3Y9R4_9GAMM/13-198.........SGSSPSGQLNVFKFVSFTVG-----------------GTCIYAFL...------------.......NLDP
A4BDB6_9GAMM/24-208....LSPSQHSSRAFRLYSLLTWLACSVV-----------------MGYLISE....------------...........
D9QLM9_BRESC/12-196....LSARSGAAPWLAPLGLGCAAVALLG-----------------FGGIVAD....------------...........
A4AMV1_MARSH/11-200......VYCRKQQDTKKFARTSFVSGTIA-----------------LVFVLVLF...------------........SNP
Q8PIW3_XANAC/13-196...........AALLNDATTRRLAWLSLA-----------------AGLLVAVLA..------------.......FGPP
B0U375_XYLFM/12-195...........FALLSRPGVVMLTWATCI-----------------AGLIVAASS..------------.......FGPA
Q28UV2_JANSC/25-202....NGFGRDPMMSRRWLIGLAILWAAAS-----------------PVFFFLP....------------...........
A8LJU0_DINSH/25-202....PRAARLLPWSRPALIGTGLLWAVMS-----------------PVFFLLP....------------...........
B7RKC5_9RHOB/26-203....QGMAAVDKSFAYISYACAMLWGAGA-----------------PIFFVLP....------------...........
Q2CCU1_9RHOB/24-201....PGAGHAGRGWRWVFLFAGIAWAILA-----------------PIFYFLP....------------...........
A3SUZ6_9RHOB/25-202....DGARCCGAIYGRLLVGLSALWTVSA-----------------PVFFMLP....------------...........
A9E2D4_9RHOB/9-186....KGFAEASPSLAKALKIISILWLISA-----------------PPFFFLP....------------...........
A4ELQ4_9RHOB/25-202....GGASKVDPAAGNALIGISIVWTISA-----------------PVFFYLP....------------...........
D0D590_9RHOB/30-207....RGSARVSPVYRTVFIATGIVWSASA-----------------PLFFFLP....------------...........
B6BBN4_9RHOB/25-202....GAAGQMGQGYTRMLRGISVLWTLTA-----------------PVFFFLP....------------...........
A3WAS2_9SPHN/25-205....GQFWEINKWLGRSLYLGGVAWAVLG-----------------PLFFFVP....------------...........
A3IX19_9CHRO/26-204....FGFRKISRRWQYFSLAIAVVWLIFA-----------------PPFFQIS....------------...........
B8KPW0_9GAMM/11-188...QRGLRQRAPRCARLNGVMFVLWLALI-----------------PVIPFIE....------------...........
D9QK37_BRESC/20-202.......LRNADRFLRLKQFLFLVFIAMA-----------------VLTVVTKHLV.------------......FPGTV
Q0W5U1_UNCMA/16-197...ALWGEPKYPGWLAFIGALAIVSNFAQ-----------------IGLVLTG....------------...........
C5BVW0_BEUC1/45-235...RRAEALAGIARASRVCGIVVLVAFVA-----------------GAAFGGT....------------...........
D3Q5U6_STANL/20-208..RYRWQQRGAAAVVSWVVPVVYLLSSGL-----------------AFGLGDF....------------...........
D2B9K9_STRRD/15-199..RFLAGKRKGWAIYSTAGGIVYTVLPQT-----------------NPELMSL....------------...........
D7AZL9_NOCDD/27-217..HYGRTGHRGAAAASRVAGTVLLVGNGW-----------------AMTGGQY....------------...........
D2AS92_STRRD/33-219..RFSAQGRRGWAVASRIVPVAVLAGFAG-----------------SAASVLA....------------...........
D2PMS1_KRIFD/36-226..RFAATCRRGRAVASYATGVLFLAAFAG-----------------IASGSAG....------------...........
C8XD39_NAKMY/31-221..RYRKERRPVFAAFSAITGIVFLAAFLA-----------------LAGSGGA....------------...........
D2B4R9_STRRD/12-208..RFAALGERRWAASCAVTGVALPTIYAL-----------------SGVLSER....------------.........GE
C8XD67_NAKMY/16-200..WFAARGRTGWAVASLLMAVAALLLIFL-----------------PGGGGSV....------------...........
C4RF79_9ACTO/74-259...VRSARRRAVPAAVLNGAAALVLLLPV-----------------SPEHMSV....------------...........
A7HVR6_PARL1/16-206..HFWQTEQLFWAVASLATGIVLPLLIGL-----------------GMSMVVA....------------...........
E8T0T3_GEOS2/14-211..FRGEREWKGWHAYSLLSGLGVFIAFSI-----------------CSVLVSMDF..------------.......AQTW
D3PXJ2_STANL/16-212..YFGHRSRRGWRLLSIVIGVAVSVTAMA-----------------AGLLYRLAT..------------.......VNDV
C5BVM4_BEUC1/10-201...........FAYADAVPAFAIVSGVAA-----------------VGLGVASYRF.------------.....GVLWER
D3Q1F0_STANL/29-225..RFATWRQFGWAGYSGLSGLLVAVGIVL-----------------SSAGFAQ....------------.........GD
A4F7D5_SACEN/16-207..RCFKSGRTGWAWYSVATAVVFLAGFVL-----------------AGVGFAQ....------------........NAA
B8GH43_METPE/42-235..CFREDPKWQWFRGPTLAAGAIIAASVI-----------------LLTLVTKLP..------------......LAPEI
B4SM32_STRM5/13-185..........AWSANRRAYAVTAAVSIAG-----------------IVYLWLNV...------------.......VGAD
Q9RJS0_STRCO/12-187....NGGPAGPWALRLAPSIAVTTLMAAG-----------------GVWFLIE....------------.........MR
B1VPM0_STRGG/12-188...VRDRRPVPWGLRLDVSLAASALMGAS-----------------ALWFLAE....------------.........LQ
D9T5P6_MICAI/28-216EVAASPAGRPPWAFRRPVALAVTAVLLAL-----------------FGWSVAE....------------.........VT
Q0RZC5_RHOSR/71-245....SREPDAAAACRAPVAIAAAAVLLGL-----------------LGWLAGA....------------........AID
C0ZQ51_RHOE4/26-217..WLRDRNHARCARRTLIAGVISILAFVP-----------------LVYALGVDAA.------------.....TGVDWW
C8X6V7_NAKMY/31-224.......RRRAAPVTNRASRSAFWLAVAS-----------------LIWLGVLIGAW------------LISPVTGIPWY
D3Q1Z4_STANL/35-216....DPRLRRAFAVMTLINLVLLILNVWG-----------------TYLPDLA....------------..........Y
D3Q759_STANL/3-179.....GWRRPALLWLSVTNVVLMALVVIN-----------------TFFPTFA....------------..........D
D2AUN0_STRRD/12-196..........RRFRNPALSAVSVLATGLL-----------------VAFLAARPGSL------------.....TADLIG
D2B0Y0_STRRD/13-197...RLREDERWRAVARPVEWLALAGGFGL-----------------LAITYVA....------------........LPG
E8RZG0_MICSL/12-189.......RHPVAGAAAWLRGLTVASLVLA-----------------GAMIWSA....------------........YPG
C6W8D5_ACTMD/12-195.........RAFLPSPPLRRLSILAGFAS-----------------GAFMLSHTAV.------------......LGAGG
C8XCN7_NAKMY/38-227.......RTLADGLRRTLLAVGLVSGALS-----------------TALIVNRIPG.------------.....VLGAAD
D3EGW1_GEOS4/23-212....LCRLDVWRPMKRVMLTIAMIAIVAM-----------------LVFVLQIPQ..------------......DGQFG
B4SRG7_STRM5/12-194...YLRREPGWKTAAGLLWGWAWLAFVLL-----------------WLHVLWR....------------...........
Q3BVQ6_XANC5/87-268...YFRRDVRWRAHFPSAFLLGWAAFAVL-----------------LFHVTVT....------------...........
C8XKD4_NAKMY/21-199.......RGAPPAARRLALALTALAAVLG-----------------VLVIMSATGL.------------.....DTAGLG
D9SXQ4_MICAI/13-198......FSPATDQGLRRIAAVGAAVALPV-----------------AAVVAAAL...------------.......LLVG
Q0SAA4_RHOSR/13-214...LAAFRYGWPAWLKITGVAVATVFVGG-----------------TIWTLTAAG..------------.......LRGD
D3Q0C1_STANL/5-190...........WAWRTVTAWVLSGLMVAA-----------------TAATMLA....------------.........VA
D0L9X9_GORB4/20-220...LVAWRTPAWPLLRTAGTVVFAIIVLS-----------------TAWMLIAD...------------........NLS
Q5Z3B7_NOCFA/14-211...LAAFRYRRWRVLREFGIAAFLAGAVA-----------------TVWMLVAD...------------........RLP
C0ZM54_RHOE4/15-215...VGAFRYREHRSLRTTGLTILILTSLA-----------------TVWMLTTNSI.------------......EVSGG
D5UPX7_TSUPD/8-215...AWLLRGGNDGALRTARPLTVAAFGAG-----------------MTYLITTVWTL------------....AAMAITD
C6W9M9_ACTMD/22-202............RGTRLPGARVVLILLAG-----------------TGVLSAV....------------.........LV
D2B4U0_STRRD/15-212...VSALRRRRWPLIGYGGAVLAVLMAVA-----------------TVWTLAA....------------.........IA
Q6NEW9_CORDI/11-191..........SRSWLAKVGGAGFLLSTVV-----------------LLVCTAV....------------...........
C5C1J0_BEUC1/20-217..DGPAWFHAAAQWVFVLGGVVSALMFAY-----------------FTWTATP....------------.........GT
E6GHX6_ENTFL/13-204...IIYSKDGSQKNKNLFGFLFILCMLAA-----------------GLYGLARIPQ.------------......LQQVK
Q1B6C0_MYCSS/20-192.......GRTFRLFSRVIGGFGLASLGAL-----------------GVQTWTG....------------..........I
D1YC80_PROAA/17-217............STMTRFRGFGLVVTWAW-----------------VVFTLLNGIGA------------....VGWFVGT
A2RL60_LACLM/11-196...........LVYRNFFLLILVITFVIT-----------------TLLSFVA....------------........GAI

PF10277

Q7QE61_ANOGA/3-230YHVASSISEWIVATAF-CFYV.LTFTDEFRTM
Q757Q5_ASHGO/5-206AYSIYAYFEWSLIILD-ILFD.GLSYADMEDL
Q75DE7_ASHGO/9-286..SISASFEWVLAFWL-CAYY.VIVSVDFYMG
Q4WNE6_ASPFU/5-224.KNVAAILEWVIAFIF-TGYI.LSFVVDLLPS
PGAP2_CAEBR/12-239IYTLFALVEYSAVLSN-IFFH.CTLYYDFHGK
PGAP2_HUMAN/79-302VYTIFAILEYTVVLTN-MAFH.MTAWWDFGNK
PGP2L_DROME/96-324AFSWFAFFEYLIAIAN-MLFH.FTIIWDFPSQ
A5DLG3_PICGU/121-352..SKSAVFEWLISYWY-GLLL.VMWSMDLFPS
Q0U0X0_PHANO/1-149AYTIYAFFEWALVLLD-VAFD.AVTISEFKDF
A5DAL2_PICGU/21-231AYSIYAYFEWALILLD-VGFD.TWSVVDFADI
CWH43_SCHPO/11-220AYTVYAFFEWSLILWD-ILFD.SALYWDFKPL
A8WTJ4_CAEBR/43-270AYNLFSLAELIEVGCN-SIFY.AIAYFEFPKT
Q6FKX5_CANGA/5-205AYSIYAYFEWSLIILD-ITFD.ATAYKDFKKL
Q7S513_NEUCR/18-228AYTVYAFFEWALILFD-VAFD.AVTALDFDTF
Q4PAD1_USTMA/365-592AYSYYAYFEWGLIIFD-LLFD.AASVYDLSRF
Q5RGJ7_DANRE/7-226RHIVSVACEWITTFSF-VFFF.LTYIQEFQQF
Q6FIN1_CANGA/8-284..SKSACFEWLLAFWF-GIIF.MIISADFYLG
Q4SVF4_TETNG/19-241VYTLFAFFEYLVVCSN-MAFH.MTAFWDFGNK
T150B_BOVIN/4-207MRSVSAICEWVAAMLL-FILF.GLLAVDFSRL
T150A_MOUSE/3-232LQHGAALCEWVFVLDI-LIFY.GTFSYEFGTI
A7TMD9_VANPO/12-290..SISACFEWLLAFWF-GLLF.ISISVDFYLG
Q6FKB5_CANGA/8-272..SKSACFEWLLAFWF-GVLF.MIISWDFYMG
Q7PN15_ANOGA/41-264IYSLFALSEYVFVYSN-IGFH.MTAYWDFINA
Q4E2S1_TRYCC/9-251AYSLSTMSEWFFAACN-ICFD.ATLWFELKKT
Q5DAX3_SCHJA/13-237YHVVSSIMEWITALSF-ICFI.FTLVWELKDY
Q6IQJ3_DANRE/3-232LQHAAAILEWIFAIIV-LVFY.SSFSLEFGSI
Q9XWR3_CAEEL/44-269AYDVFALCEYSGVFLN-ICFH.GCAFFDIRYK
Q4SA40_TETNG/3-249LQHAAAICEWVFTVDI-LVFY.GTFTYEFGTV
Q2UMD7_ASPOR/5-224.RNAAAVLEWVIALIF-TFYV.LSFVVDLLPS
Q16JU8_AEDAE/31-253VYSLFALSEYVFVYSN-IGFH.MTAYWDFISA
PGAP2_XENLA/19-242VYTLFAFLEYLVVLSN-MAFH.MTAWWDFGNK
T15BB_XENLA/3-204MKSVSAICEWIVAMIL-FLLY.GLFAVDFWHL
Q54KE7_DICDI/3-196...LCALSEITCVTLY-YLFF.ISFYHEYKTV
Q5DGL6_SCHJA/9-235FYLCSTSFEWVAGFFI-ILFF.ITWAYEFRLY
Q4SKZ5_TETNG/531-722LQHASAIFEWVFCVII-ILFY.GTFAFEFASM
O77262_DROME/3-230FHVVSSISEWVIATVF-SFFI.LSFTNEFRDV
Q559G4_DICDI/11-218IDNLAAIFEIMSALSI-FAYM.VTFFYEFSNL
A1CK70_ASPCL/15-225AYTKYAFFEWSLILFD-VGFD.AVTALDFEAF
A2FGB6_TRIVA/10-214FVNAGAIFQYISSLCI-FGKL.FCMQYDIPGH
Q6CX54_KLULA/5-205AYSVYAYFEWSLIVLD-IAFD.ALACQDFEQI
Q54J51_DICDI/6-269SYSKYSIFEWLLATTN-ILYD.TLTYLDFDGL
A2DNY5_TRIVA/47-242DATASAIGEWILLFCL-QFVF.VTYGQEMKHL
A8X4A4_CAEBR/10-248YHQISAAAEWLCAFSQ-IIFM.QSFTPEFEDI
Q93319_CAEEL/9-241LHQISALAEWGCAISQ-IFFI.QSFGPEFEDI
Q17MC8_AEDAE/70-299AFSWFALCEYIVASAN-MGFH.CTTMLDFPTE
T150B_HUMAN/4-206LRSVSAACEWVVAMLL-FALF.GLLAVDFSAL
Q6CDS5_YARLI/4-220..NVAAGFEWALSFFY-GFYL.LILAFDLIPF
DRAM2_MOUSE/7-233LHLVTTAAEWSMSFSF-FGFF.LTYIRDFQKI
Q550K4_DICDI/13-193AKNISAIFEISSASCI-FIYM.VSFFFEFSKV
Q1N1S1_9GAMM/4-214..WIGNAIEWWLALLI-GIYY.ASNHGEWKRK
Q8QGB2_ONCMY/7-226FHLVSAVSEWIVAFSF-ILFF.FTYIHDLKKF
A6ZTJ7_YEAS7/5-207AYSIYAYFEWSLILLD-IAFD.AFAYADFKKI
Q4PDK8_USTMA/9-236IISAAAVCEWAIAFLL-AIFF.LTYLVDLWPA
Q01D47_OSTTA/14-220AYSLVGASEWLGVLSM-IFAC.WTVSWDFDDK
T150C_BOVIN/8-218IHMYAARVQWGLVMCF-LSYF.GTFAVEFRHY
A5DS39_LODEL/32-242AYSIYAYFEWGLIALD-ILFD.SWSYIDFQTI
A7S3L1_NEMVE/7-240SHIMSDAAEWLMAITI-LVFI.TTFFGEFRSI
PGAP2_DROME/19-240VYTFFALFEYIVVLTN-MGFH.MTSYWDFYAL
DRAM1_MOUSE/7-226YHVVSAICEWTVAFGF-IFYF.LTFIQDFQSV
Q28IE8_XENTR/3-227LQHLAALCEWTFIINV-LIFY.GTFSFEFGAI
A6SR76_BOTFB/5-222..NTAAILEWIIALIY-TFYV.WSFAIDFIPA
DRAM1_XENLA/8-227YHLTSAICEWTVAFGF-NMYF.LTFIRDFQGV
Q6BKM3_DEBHA/21-231AYSVYAYFEWALILLD-VGFD.VWSVIDFADM
Q55T17_CRYNB/25-255VSSKAAILEWAIAYGL-NLYF.LTLAADLWPA
A3GGF7_PICST/12-243..NLSASFEWSISFWY-GILL.VMWSIDLFPS
A5E3J3_LODEL/22-254..SRSARFEWTICFWY-GLLL.VLWSVDLIPS
Q5DF06_SCHJA/6-229TYTVFAVFEYVAIISN-VTYH.YTTSQIYEDI
A7TRI4_VANPO/5-205AYSVYAYFEWALIIFD-VTFD.SLSYTDFSDI
Q22Y36_TETTS/100-306....LAVAEWIGTYSI-IFYL.QTFATDLKDF
Q55M70_CRYNB/8-234AYTYYSMFEWSLVFWD-LAFD.ALSVLELNHL
T150A_XENLA/3-232MQHLVAICEWIFVLDI-LVFY.GTFAYEFGSV
A7RFU0_NEMVE/9-235LHVLSNMGEWLAALCF-GLFS.MTFFDEFQLI
A7RNE7_NEMVE/10-236VYSLFALCEYVTVLSN-IGFH.GTVAIDIGGS
Q6CTH9_KLULA/8-279..STTACFEWLLAFWF-GLYF.IIVSVDWYIG
Q96U46_NEUCS/3-220..NPAAVLEWTIAFIF-SFYI.FSFWIDLYPA
Q5AF82_CANAL/13-246..SKSAIFEWLISFWY-GLLL.VMWSMDLLPS
Q55WH1_CRYNB/26-256ITSAAAAFEWAVAFVL-TFYF.LTIAADLWPA
E9ADF4_LEIMA/115-359SLSLSSICEWVFSIFN-IIFD.GSAWFDLKQE
A6ZZR5_YEAS7/10-287..SKSACFEWLLAFWF-GIIF.MILSADFYLG
Q6IQI0_DANRE/7-234AHIVSTISEWSLALSF-ISFF.LTYIRDFKKI
SFK1_SCHPO/21-232....SARFEWVVCFLW-SIYI.CLLCLDLAPA
Q9VPT6_DROME/29-248AYSVFGMGEFISCECF-FIYL.CTVYFDFYHV
A7SJV3_NEMVE/4-240IHVGGALLELVSLLAL-ATYI.ISFHGDFKTF
T150B_DANRE/3-204FRSAAAICEWILVMCF-FALF.GVFAAEFRHI
Q86F93_SCHJA/5-228YHAMSSFCEWLMSFIF-LLFF.FSMIFELKNY
A4RTY8_OSTLU/13-222AYSLIGFCEWLAVLAL-VAAC.YTMAWDLDAK
T150B_MOUSE/4-207MRSASAICEWVVAMLL-FMLF.GFFAVDFSIL
Q3V5H7_CAEEL/25-251AYELFALVEYLDVFMV-IFYHGCCVYWDIQHK
Q6C3N0_YARLI/30-239AYTTYAFLEWALVIFD-VMFD.AVTVLDFSAL

PF06197

B5HBV4_STRPR/2-171RGGVPGIAERLVTCMQ.AMWP-LVVVAS----
Q5JHY1_PYRKO/12-178.WPSLALEETYEIALV.MAFT-LLVALK----
Q8U0G5_PYRFU/9-174.WPSVALEETYEIVLI.MLFT-LFVAVR----
Q6L2X2_PICTO/12-188PWQSVAENEIFGIIII.EILV-ILYMIS----
Q9HJI2_THEAC/17-194RWGSVAESEIFGICII.DAAV-IIYVLS----
Q97BH7_THEVO/15-193RWGSVAEGEVFGISVIDIVVS-IYLANL----
A8MCR4_CALMQ/13-182KWPSTAILETYGIVII.DAWA-IAATIL----
Q970R2_SULTO/9-177KWPSSATIEAWGISII.DIWV-ILSFLD----
A1RZ19_THEPD/13-186GWPSVAILELAGALFI.GASA-IVATLH----
Q9Y8U9_AERPE/10-184GWPSAAVAEAYGIVVI.DIVV-IILTLD----
Q5JHD7_PYRKO/10-182TFKGVAIPEFIGALAV.TIWH-YAVLSK----
Q8U4E0_PYRFU/10-182TFKGVAIPEFIGAISF.TLWH-YIILLK----
O58000_PYRHO/24-191KFEGVAVAETISIVVF.LIWH-YLMLGD----
Q9V235_PYRAB/6-172AFSGVAVAETVSILAF.LIFQ-TLTLVV----
Q9HK23_THEAC/11-184KNVGLAVPEFIEAVLL.AAWS-ISAGSI----
Q97AI7_THEVO/15-188KNVGLSIPEIIEALLL.GSWS-VLVSVY----
Q9V1S7_PYRAB/6-155..VGLAIPELIGAASI.LAYI-LYLGER----
O59449_PYRHO/6-155..IGLAIPELIGAAAI.LSYI-LYLGWK----
Q8TZZ1_PYRFU/8-157..IGLAIPELIGGTVI.LGYM-IYLGLR----
A3DLK8_STAMF/12-179IPRGAAIPELLAVFSF.LPFY-IRDYFK----
A2BLJ9_HYPBU/14-183TPPGAAPPELTSIILL.LAFY-TLHARE----
Q3SA92_9EURY/13-189GGPGIAMFELVFSFAV.LVWS-YLSIFF----
A4YES6_METS5/12-174LGLGPGGMERMIVLPD.IIWS-ISFGSS----
Q96ZU3_SULTO/14-171GPLGPGGMERMIVYPE.IIWG-ISFATY----
Q97UA8_SULSO/14-171GPLGPGGLERMIVYPE.IIWG-ISFATY----
Q4J885_SULAC/12-172GPLGNGGLERLIVYPE.LVWG-ISLGTY----
A4WJI6_PYRAR/3-170TPLGIGGIERLIAYPT.LIFL-LVYGLS----
A3MT35_PYRCJ/9-176TPLGIGGIERLVAYPV.LIFL-AIYGLS----
A1RR81_PYRIL/8-175TPLGIGGLERLIVYPV.LLYF-IRYGLS----
Q8ZU94_PYRAE/9-176TPLGIGGLERLVAYPI.LVFF-VVYGVA----
Q5V2H6_HALMA/24-206EPLGPGGIERWVVYPI.IIWL-PAFGGY----
A3CTX5_METMJ/16-189GPIGHGGSERMIVYPA.LLWL-AGFGGY----
Q8DVX1_STRMU/11-196..KYFGLFERLFLYSS.NLYI-LLLCVM----
C6LHE9_9FIRM/14-201PRDFFGIPERFSVFAA.AGFN-AVLGIY----
A9KKH9_CLOPH/12-200GYHILGFIERIIFYTV.HALT-VILSWV----
A4C406_9GAMM/11-199SQSNPGIQQRISYGIQ.LIWL-SAFSLV----
Q21FK4_SACD2/11-194QRGNVGLYQRLSYGAQ.LLWL-AGVSVT----
D1CAZ9_SPHTD/27-219PTPWMGLNERVVGYLP.MIWY-AVLAVG----
A0JTJ1_ARTS2/34-213PNLVLGISERISIGAF.LLWV-IVLATA----
A9EN54_9RHOB/14-198.PEAQGLFQRLLEAWI.YAHF-IALGVH----
B6R5G7_9RHOB/17-195..ALSGLLQRVLETGA.YLWF-VLILLQ----
A3Y9R4_9GAMM/13-198NSPLVGVYQRSLDLMI.YSWF-IYFAYS----
A4BDB6_9GAMM/24-208.PQWIGFWQRVYELLI.YTWM-IVFAFQ----
D9QLM9_BRESC/12-196.VELGGLFQRLLESAM.AVFL-IAFGWA----
A4AMV1_MARSH/11-200ESKFIGLFQRIIEASI.LFWI-MTVAFY----
Q8PIW3_XANAC/13-196GLMRQAIAQRLAFLAW.VGWL-AVAGWS----
B0U375_XYLFM/12-195ERLHPGLAQRIGFAVW.LLWL-MLAGWR----
Q28UV2_JANSC/25-202.TSVDGLYERGLGLIA.CAII-SLLGWM----
A8LJU0_DINSH/25-202.TDVDGGYERLLGGVA.CAQV-LILATA----
B7RKC5_9RHOB/26-203.TNIDGAFERGLGVVT.MVWV-CSFGWM----
Q2CCU1_9RHOB/24-201.THIDGVYERMLGGIT.LVWL-GALGWI----
A3SUZ6_9RHOB/25-202.TDVDGLYERYLGVIA.MATV-ITLAVL----
A9E2D4_9RHOB/9-186.TGIDGIYERYLGLIA.MAMV-VLIGRF----
A4ELQ4_9RHOB/25-202.TDVDGIFERYLGLIS.FALV-IVLARV----
D0D590_9RHOB/30-207.TDIDGIYERFLGAVS.FVLV-LTLAHL----
B6BBN4_9RHOB/25-202.TGVDGLYERGLGLLA.LAAV-CTLAHL----
A3WAS2_9SPHN/25-205.TDYDGAYERMLAGGM.LAWF-ITMGVM----
A3IX19_9CHRO/26-204.TAFNGLYERFVALIL.LCWT-TAISWL----
B8KPW0_9GAMM/11-188.ASWLGAYERTVGGIL.LLWL-ATLALL----
D9QK37_BRESC/20-202NDFNVGYWERAFAIVL.VGWV-GVAAHL----
Q0W5U1_UNCMA/16-197..SFPTIVEWLSAYLP.QAWV-LLFCWH----
C5BVW0_BEUC1/45-235...ALGIALLWLAVLTGWAWL-LAVCVT----
D3Q5U6_STANL/20-208......RYLLAGGIII.WVWA-AAVTAD----
D2B9K9_STRRD/15-199.......LFAVASLIG.WTWI-STISIH----
D7AZL9_NOCDD/27-217....GSLTLAVGAVTA.MLWV-SAVAAL----
D2AS92_STRRD/33-219........FSAGAALG.LVWL-TATTAR----
D2PMS1_KRIFD/36-226..AGVTLAFWAAIVLA.WTWL-AATLQH----
C8XD39_NAKMY/31-221..PVATLAFVGAVVLV.WTWM-TMVAID----
D2B4R9_STRRD/12-208NSQPLSLLLRLVALVG.WGWA-SLLAVR----
C8XD67_NAKMY/16-200.......RSALAVVLT.SAWL-TGLARL----
C4RF79_9ACTO/74-259.......QIAVNGLVA.FTWT-TVVALR----
A7HVR6_PARL1/16-206....PGIAFYWAAMLG.WLWL-AAVLIV----
E8T0T3_GEOS2/14-211PGAPSGLFERISMLIG.NLWI-LLFSVR----
D3PXJ2_STANL/16-212TGAPVGALELTAFVLG.FGWL-AMVAWR----
C5BVM4_BEUC1/10-201ESRRVGLVQRLYIVAG.WAWV-AALCLV----
D3Q1F0_STANL/29-225LVDIAGLLQRATVAVG.LAWL-TALAVH----
A4F7D5_SACEN/16-207LLPVAGLLQRLTLVVG.WVWV-GALAAH----
B8GH43_METPE/42-235FEPWLGLIQRGIIIPF.MIWL-FVFALG----
B4SM32_STRM5/13-185PEGYRGLTQRLFSSIN.SLWP-FLVALY----
Q9RJS0_STRCO/12-187QHGDAGVAERVVTSLQ.SLWP-FVVAAS----
B1VPM0_STRGG/12-188SAGAPGVAERVVTFVQ.ALWP-FLVVVS----
D9T5P6_MICAI/28-216GGSRTGLAERVAALAV.TLWP-LAAVLS----
Q0RZC5_RHOSR/71-245GWSLLGLAERVCVFAQ.PVWP-LAVAIT----
C0ZQ51_RHOE4/26-217DVVTFGYTERLIAAAE.AATL-VVIGKW----
C8X6V7_NAKMY/31-224RALPIGLVERGLVLCE.VAAV-VAVGVW----
D3Q1Z4_STANL/35-216GGQWRGIPQRLLVVSQ.VVSI-VAMAFV----
D3Q759_STANL/3-179GRDWRGLPQRLLLFTL.AAVL-VMLASN----
D2AUN0_STRRD/12-196GPDYYGLIERLLLLSE.TALV-FLAARG----
D2B0Y0_STRRD/13-197DRVLIGLVERVLLGAE.VALI-GVLAVR----
E8RZG0_MICSL/12-189DRALLGLIERLLILTE.TAVI-TTLALH----
C6W8D5_ACTMD/12-195GMVLLGLFERVLFVVL.YALL-FTLAAA----
C8XCN7_NAKMY/38-227LSLPPGLLQRAAGAAQ.IVLA-ALLGLG----
D3EGW1_GEOS4/23-212PEVLAGMFGRFLILAE.ITWL-IVVGVH----
B4SRG7_STRM5/12-194AGPPRGLGQKVVIAVI.VGWL-LYLALA----
Q3BVQ6_XANC5/87-268.SAPLGISQKIAIVLI.VVWM-VRAGTV----
C8XKD4_NAKMY/21-199AGGSWALWQGALVVVE.MILV-TVLAVV----
D9SXQ4_MICAI/13-198RSALLGVSERVLLVVV.AAWG-LVTSGY----
Q0SAA4_RHOSR/13-214QDAWLGLGQRVQLLAF.CGWL-IFVALS----
D3Q0C1_STANL/5-190TDHLVGVAQRLQLLIV.SAWL-VWLALR----
D0L9X9_GORB4/20-220GNYRLGLAQRIQVGGM.TVWL-VLWGVT----
Q5Z3B7_NOCFA/14-211GEYALGIAQRIQVGAM.SVWL-LTLAAA----
C0ZM54_RHOE4/15-215GNLGLGIAQRAQVLGM.SLWL-CTLAFA----
D5UPX7_TSUPD/8-215PELYLGLAQRLQIAGI.TSWL-VLIALP----
C6W9M9_ACTMD/22-202NQPGAGLVQRVQLLTV.SAGL-LLGARV----
D2B4U0_STRRD/15-212SGAPVGLAQRFQVAVI.GLWL-LLPGVA----
Q6NEW9_CORDI/11-191.HIPAGFIQRAQVLFA.CVVI-FAASTI----
C5C1J0_BEUC1/20-217SSTAAALSQRLHILTV.SAWL-VCLGVL----
E6GHX6_ENTFL/13-204PFNYLGLWQRVSSF...CNYL-PMLALC----
Q1B6C0_MYCSS/20-192VMLPDPVWERASVYPI.LTWQ-VCAAAS----
D1YC80_PROAA/17-217PMDYTGIWQRFSLGLGTLWWL-ILAADD----
A2RL60_LACLM/11-196PQLVGPLGQQINALLG.GIWL-VFISWR----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window