Sequence alignment for CL0416

PF04547

CACLC_ARATH/188-630IYSYF.....GAK...IGVYFSFLGMYTQWLIFP--------------------ALLGFIV---QMVDFG..........
ANO2_HUMAN/352-944IRKYF.....GEK...IGLYFAWLGLYTSFLIPS--------------------SVIGVIV---FLYGCATIEEDIPSRE
ANO9_HUMAN/179-740IRNYF.....GEK...VALYFVWLGWYTYMLVPA--------------------ALTGLLV---FLSGFSLFEASQISKE
Q9VYS8_DROME/350-933IKDYF.....GAK...VALYFAWLGFYTQMLIPI--------------------SVFGVLC---FLYGFITWNSDPISRD
ANO6_HUMAN/287-872IRKYY.....GEK...IGIYFAWLGYYTQMLLLA--------------------AVVGVAC---FLYGYLNQDNCTWSKE
A5DIJ8_PICGU/65-553VKESH.....GVQ...VALYFEFVQFYLYWLAGL--------------------AVVGLIS---YFVSKH..........
A0CKQ3_PARTE/818-1263IASYY.....GPV...IAWYIAFNVQIVGWLILP--------------------ALVGSAI---QLYQLI..........
Q6NUA4_XENLA/167-596IQHYF.....GDT...LGLYFAFLEYFTMALIPM--------------------ALIGIPY---YFFAWE..........
Q16MH2_AEDAE/199-778IKEYF.....GVK...VAMYFAWLGFYTHMLIWA--------------------SIVGLLC---FFYGLLTFRDNRISQD
Q2UDH7_ASPOR/180-663IRNTF.....GESLSQVGFYFAFLQSYFRFLMFP--------------------AIFGFSC---WLLLGS..........
Q2U154_ASPOR/174-639IRALY.....GEK...VAYYFAFIQCYSTFLVFP--------------------AAWGIFT---WLYLGP..........
A0DD09_PARTE/537-1000LSSYF.....GAE...IGMFFVFLCFFTTWLFLP--------------------AVPGLFI---GIFHFI..........
Q4SPC5_TETNG/131-466INEYF.....GSS...VAFYFSFLDFYTWSLLLP--------------------AILGLFI---TCFSGEVQTEIIGS..
YNG5_SCHPO/170-627INAEY.....GSQ...VALYFAFADFFKTGVFVL--------------------SFWGILG---YYFLRP..........
A6RD03_AJECN/171-655IRNHH.....GEK...IGFYFAFLQSYFSFLIFP--------------------ASFGVAC---WVLLGN..........
A0CE73_PARTE/768-1287IREYY.....GEK...IALYFTFLGYYTMMLLPI--------------------GFIGLII---SIIQLLV.........
A7S3G0_NEMVE/17-561VKNYF.....GEQ...IALYFAWLGSLTFSLIIP--------------------MLLGLAI---FLWGLIVASIEKMSMH
A7RKU7_NEMVE/244-824VKGYY.....GTA...IALYFAWLGFYTAMLIPL--------------------AIVGLLV---FIYGIGSSATSPTVRD
Q86P24_DROME/304-882IKEYF.....GVK...IGLYFAWLGYYTYMLLLA--------------------SIVGVIC---FLYSWFSLKNYVPVKD
ANO3_MOUSE/384-951IRMYF.....GEK...IGLYFAWLGWYTGMLIPA--------------------AVVGLCV---FFYGLVTMNESQVSQE
A7REV0_NEMVE/214-763IRDYF.....GEK...IGIYFAWLGQYTAWLIMP--------------------SFLGLLV---FLYGVATINSSDNKPA
ANO10_DANRE/200-629IRSYF.....GEG...LGLYFGFLEYFTFALIPM--------------------ALIGIPY---YLFDWE..........
ANO8_HUMAN/237-880ICDYF.....GVK...IAMYFAWLGFYTSAMVYP--------------------AVFGSVL---YTFTEA..........
ANO10_MOUSE/200-629IRSYF.....GET...IALYFGFLEYFTFALIPM--------------------AIIGLPY---YLFVWE..........
A1D9V1_NEOFI/173-637IRALF.....GEK...TAFYFAFIHSYSLFLVVP--------------------AVWGVIC---WSYFGP..........
A4HVK2_LEIIN/428-971VASYL.....GEE...VMFFYAWMNHYARWLLGA--------------------GLLGVLV---SMLSSLRLVPDTAAAA
A4H763_LEIBR/371-928VASYL.....GEE...VMFYYAWMNHYARWLLGT--------------------GLLGVLV---SMLSSLRLASDAAMAA
Q6DDQ3_XENLA/273-852IRKYY.....GEK...IGIYFAWLGFYTEMLFYA--------------------AVVGFFC---FLYGWITMDDSISSKE
A0DPP4_PARTE/705-1145ICDYY.....GQK...IGLYFYYQTYYTKMLLKI--------------------AFIALGC---NLVQWVI.........
A0CIB0_PARTE/859-1305YRDYF.....GEK...VAIYFLFLTFYTKQLWYL--------------------SVVGVIF---QGLQSL..........
Q24E70_TETTS/215-696IRSYF.....GDN...ISIYFAFVEFFQKQLLPL--------------------VGIGILI---GILNNF..........
A0DHW5_PARTE/686-1116ICSYF.....GEK...IGLFLEFTTHHILCYSVL--------------------SILGFLF---TIAMITS.........
A3LWT2_PICST/162-656IKDKY.....GVQ...VALYFEFLKYYTTWLVFL--------------------VVVGITS---YLKSGK..........
A0CMD7_PARTE/544-1006LSTYF.....GPE...VGMFFVFLCFFSTWLFLP--------------------AIPGLIL---GIISYF..........
ANO4_BOVIN/304-887VRRYF.....GEK...IGLYFAWLGWYTGMLFPA--------------------AFIGLFV---FLYGVITLDHCQVSKE
ANO5_HUMAN/292-870IKNYY.....GEK...IGIYFVFLGFYTEMLFFA--------------------AVVGLAC---FIYGLLSMEHNTSSTE
A0D751_PARTE/565-1028IKAYF.....GAE...VGFFFVFLSFFTTWLFLP--------------------AVPGIML---GVYVYA..........
Q8JFT1_DANRE/232-825IKKYY.....GEK...IGIYFAWLGFYTEMLFYA--------------------AVMGVIC---FVYGVLSYEDNITSKE
Q1AP35_STRPU/306-885IRRYF.....GEK...IGIYFCWLGFYTEMLTWA--------------------GFVGLIV---FLYGCISLPSSVVVQE
Q17BF8_AEDAE/268-729IAAYF.....GVK...VALYFAWLGHYTCALCVP--------------------AVLGTIL---YVGMWG..........
A0CZD5_PARTE/224-675IERYF.....GGN...LAVYFEFMNFYQSMLKYL--------------------AVAAIIT---LVIDHQ..........
Q4SBN7_TETNG/194-870ICDYF.....GVK...ISMYFAWLGFYTNSMLYP--------------------AVIGFLL---WILAES..........
A7RKU9_NEMVE/227-807IKDYF.....GTE...IGLYFAWLGFYAAMLVPA--------------------AIFGVAV---FIYGIAQSTIFPPVKD
A0EDB1_PARTE/707-1149LRDYF.....GEK...IALYFAFLGFYTQQLWYI--------------------GLVGILC---QSLLSE..........
Q7S8J4_NEUCR/182-650IRDKF.....GER...VAFYFAFLQSYFAFLLFP--------------------AAFGFAA---WLILGK..........
A7STD6_NEMVE/128-561IKEYF.....GET...MAMYFAFLQFYSMTLIPP--------------------VLLIVVF---ALSNAH..........
Q55GA1_DICDI/227-693IKDYF.....GEE...VTFYFLFLRFYNVGLGIV--------------------SLFGLAV---AIVSYT..........
A0DK82_PARTE/835-1351MRLYF.....GEQ...ISFYFAWISYLSCVQLII--------------------AIPGLAL---QLYAIL..........
A0D675_PARTE/863-1384MRLYF.....GEQ...ISFFFAWISYLSCISLII--------------------AIPGLIL---QIYVIL..........
A5DTZ8_LODEL/154-649IKKVY.....GIQ...IALYFEFLKYYIYWLAGL--------------------SVVGIFQ---YLKKTR..........
Q234J3_TETTS/795-1263IRDYF.....GEK...IAIYFKFLSSYTFHLSYI--------------------SFIGVII---EIIIASL.........
A0EHC2_PARTE/551-1015IKAYF.....GSE...GGFFFVFLSFFTTWLFLP--------------------AIPGIML---GVYIYS..........
Q16TH0_AEDAE/334-773IRDYF.....GES...VGMYFSFLGFYTYALIVP--------------------TVLGLLQ---MLLSEE..........
Q233Y7_TETTS/365-837IEDYY.....GEN...ISSYFEFLDFYQKWLLYP--------------------AILGLIT---YVLSNK..........
A0CY40_PARTE/679-1119ICSYF.....GEK...IGLYFEFTSYFIKFSTPM--------------------AALGLLF---SVLMYIS.........
Q4T7R8_TETNG/234-891ICDYF.....GVK...VAMYFAWLGFYTTSMLYP--------------------AVIGFVL---WMLTES..........
Q4SUU1_TETNG/210-658VRRYF.....GEG...QALYFGFLEFFTFALVPM--------------------ALIGVPY---YLFDWE..........
A0BSX3_PARTE/784-1228IRDYF.....GEK...IALYFDFLSYYAKQLWYM--------------------AVISIIT---QGIMSS..........
ANO1_HUMAN/320-928VRKYF.....GEK...IGLYFAWLGVYTQMLIPA--------------------SIVGIIV---FLYGCATMDENIPSME
Q4P618_USTMA/365-904IREHF.....GED...IALYFGFLNFYFQALAPA--------------------ALLGASF---WLLGRP..........
Q29GT2_DROPS/198-624IRNYF.....GSS...IGLYFGFIEFYTKALIFP--------------------AVFGILQ---YLFDLN..........
A1C9M0_ASPCL/169-650IRNTF.....GEH...VGFYFAFLQSYFRFLIFP--------------------AVFGFSC---WLLLGS..........
Q0IEX5_AEDAE/469-1043IRKYF.....GDK...IALYFCWLGFYTKMLYAP--------------------AIVGFFC---FLYGLASMDSSDNIPT
Q59PV1_CANAL/157-651IKKTY.....GVE...VALYFEYIKHYTFWLLLL--------------------SIIGLVS---HFRKDK..........
A0DPK7_PARTE/690-1130ICEYY.....GEK...IGLYFYYTTYYTQMLLKI--------------------AFIALAC---NLIQWVI.........
Q4SSV5_TETNG/402-1010VRKYF.....GEK...IGLYFAWLGVYTQLLIPA--------------------SIVGIIV---FGYGMATMNTNIPSQE
A0BM99_PARTE/778-1230IASYF.....GPV...VAWYIALNVQIIGWLMIP--------------------SVFGAAL---GIYIII..........
Q22HF6_TETTS/2687-3155LRDYF.....GEK...LALYFKFVQFFTFHLSYL--------------------AFIGIII---YILKVI..........
ANO7_MOUSE/277-825VRRYF.....GEK...VALYFAWLGFYTGWLLPA--------------------AVVGTVV---FLVGCFLVFSDIPTQE
Q5BAF3_EMENI/273-754IRGKF.....GES...VGFYFAFLQSYFKFLLFP--------------------AVFGFSC---WLLLGS..........
Q8I4C3_CAEEL/218-758VKDYF.....GTE...IAMYFAWLGHMTTALWFP--------------------SLLGILM---WFLGGFKYKNS.....
A0DMZ8_PARTE/532-1006LRLYF.....GEQ...IAYFFAFKSYLTCFMIFA--------------------AFPGLIL---QLYILA..........
A7F670_SCLS1/199-673IKNRF.....GER...IGFYFAFLQSYFKFLVFP--------------------AAFGFCA---WVLLGE..........
A0D6S4_PARTE/669-1110ICGYY.....GEK...IGLYFYFMSYFTEMTTPI--------------------AISGLAC---SLIQWII.........
A0CHM6_PARTE/689-1129ICLYF.....GEK...VGLYFEFTSYFIKFSTPM--------------------AAFGLLF---SVLLYTS.........
Q0CVZ6_ASPTN/174-638VRALF.....GEK...VAFYYAFFHCYNRFMAFG--------------------ALWGIVS---WYFFGP..........
Q4REV7_TETNG/320-956IRKYF.....GEQ...IGLYFAWLGVYTQLLIPP--------------------SVLGIIV---FLYGIFTVDDNVPSQE
A7RKU8_NEMVE/172-744IKSYF.....GTE...IGLYFAWLGFYTGMLVPL--------------------AIAGLVV---FIYGIVDATMSPPVRD
A7REU8_NEMVE/125-679IRQAYEREGGGLK...IAIYFAWLGQYTAWLIMP--------------------SVVGLIV---FIYSFATINGPNNMPA
A0DBP1_PARTE/583-1035ICSYY.....GER...IALYFMFLQFFVHELLPI--------------------SYFGILT---FIVQILY.........
A0BSX4_PARTE/787-1230MRDYF.....GEK...IALYFSFLSYFTKQLWYM--------------------AIIGIIA---QGLISA..........
A0DMG8_PARTE/258-772IRSQM.....GEQ...IAFYFGFLLYLIKNMLIL--------------------VVFGMIT---YSLDEY..........
Q175J3_AEDAE/362-937IKEYF.....GVK...IGLYFAWLGYYTYMLLLA--------------------SIVGILC---FIYSWKTLRYNTPSEE
A0E006_PARTE/685-1125ICSYF.....GEK...IGLYFEFSAYYIKYYGLL--------------------SLIGIIY---TIFTYLS.........
A0BM92_PARTE/792-1345IREYY.....GEK...LAIYFHFVGYNASMLFPI--------------------GILGLTI---SIIQFIF.........
A0EAT8_PARTE/668-1109ICGYY.....GEK...IGLYFYFMSYFTEMTTPL--------------------AFSGLAC---SLIQWII.........
A7SBX8_NEMVE/221-663ICEYF.....GVK...IAMYFAWLGMYTKWLIAP--------------------AILGIVT---FVLSMR..........
A0C896_PARTE/868-1320VREYY.....GEK...IALYFTFLGHYTKSLLIP--------------------GIIGLIC---TIIQSL..........
Q5AX15_EMENI/167-626IRSLF.....GEK...VAFYFAFIQSYSSFLVFP--------------------AIWGAVT---WWYMGP..........
Q4SV37_TETNG/23-638VKSYF.....GEK...VALYYLWLGWYTWLLVPA--------------------SILGVIV---FLYGLAFFNTNPLIRE
Q16MH3_AEDAE/340-935VKDYF.....GTH...VGMYFAWQGFYTNMLIWA--------------------SSAGMLC---FLFGLVTFRSNQVSQD
Q6CB66_YARLI/1924-2410INDLY.....GEQ...VAFYFGFSQFYLQWLIVP--------------------SIVGVLA---HFLLPS..........
A0DAH3_PARTE/688-1129ICSYY.....GEK...IGLYFFFMSYYTKMLTFI--------------------SVCGFGC---SLAEWIL.........
Q4S1F6_TETNG/540-1136VRKYY.....GEK...IGIYFAWLGFYTEMLLFA--------------------AIVGTIC---FIYGFLTYDDNQWSKE
Q2H0D1_CHAGB/191-672IRDRF.....GER...VAFYFAFLQSYFLFLVFP--------------------AALGFAA---WLLLGP..........
A0C1K4_PARTE/730-1174MRDYF.....GEK...IGLYFRFLQFYSQQLWQV--------------------VILAIIC---EGVIDN..........
A7RJQ8_NEMVE/222-776IKSYF.....GTR...VGFYFAWLGTYNLMLVIA--------------------ALVGLFC---FIGGLASVESFVPAKE
Q23AS7_TETTS/863-1350LRQYF.....GEK...IAFFFGWKSFITCFMTLI--------------------AVPGLAL---QIYVIL..........
A2R347_ASPNC/170-649IRNTF.....GEN...VGFYFAFLQSYFRFLIFP--------------------AVFGFSC---WLLLGS..........
A0C5J6_PARTE/679-1109ICIYF.....GEK...IGLYFKFSSYYIQFSTIM--------------------AALGVIF---NMIMYST.........
Q0CNB9_ASPTN/169-648IRNTF.....GES...VGFYFAFLQSYFRFLLFP--------------------AAFGFSC---WVLLGS..........
Q08BD4_DANRE/215-664IHNYF.....GGT...IAYYFSFLDFYTLSLFPP--------------------AILGIFI---TFFLPSANFSTAIET.

PF02714

YAB9_SCHPO/387-708------------------AFITFESMATAQIVAQ....................THIDSKS..LMGL..H----------
Q756H9_ASHGO/339-665------------------VFVEFESQFYAQEAQR....................SLPHHMP...YCL.RP----------
Q0V7D2_PHANO/253-586------------------GFASYTHIEDAHAVAY....................ATRKKGP...GGC..D----------
Q6BLR7_DEBHA/320-645------------------IFVEFEDQYTAQLALQ....................SVTHHNP...LRM.GP----------
Q0P5M3_BOVIN/53-397------------------AFVTFHNETITAIILKDFNVCKCQGCTCRGEPRSSSCSESLHI...SNW..T----------
Q28ZW6_DROPS/345-661------------------AFLTVSTVQEAQNIVT....................HFTPGTY...RQW..E----------
Q0UCF6_PHANO/629-953------------------AFIQFNHQVAAHMACQ....................SVTHHIP...RQM.TP----------
Q6BHX0_DEBHA/347-676------------------AFITMDSVASAQMAAQ....................TVLDPRV...HKL..I----------
Q0V4S6_PHANO/338-663------------------VFVEFRTQAAAQHACQ....................QVASADI...LSL.TP----------
Q6BI49_DEBHA/417-734------------------AFITMKSVSQAQTVAQ....................AVLDPKI...NHL..I----------
Q6BHN0_DEBHA/405-733------------------LFVEFQTQTGAYIAHQ....................CLLSQIQ...GNL.DS----------
Q0UJ62_PHANO/323-659------------------GFASYETIESAHTVAY....................AARNKHP...KGT..T----------
TM63A_HUMAN/350-693------------------AFVTFQEKSMATYILKDFNACKCQ...SLQCKGEPQPSSHSRELYTSKW..T----------
Q7S914_NEUCR/334-669------------------GFASYSDISEAHAIAY....................LCRSKKP...QGA..R----------
Q2QLP9_ORYSJ/304-621------------------AFVYFRTRYAALVASE....................ILQTSNP...MKW..V----------
Q5JLH8_ORYSJ/319-642------------------AFVSFRSRWGAAVCAQ....................TQQTSNP...TVW..L----------
Q7SFU1_NEUCR/389-716------------------AFVTMDSIAACQMAIQ....................ALIDPHP...GQL..L----------
Q5B9A0_EMENI/329-664------------------GFVSWDKIEHAHAVAY....................VARNKHP...RGT..T----------
A1CSW7_ASPCL/614-938------------------AFIQFNHQVAAHMACQ....................AVSHHLP...KQM.AP----------
Q4RLY6_TETNG/333-656------------------AFVTFRDERMTAVIVKDYSCVSC.....RRRPQQSSVTTVVQS...HKW..G----------
Q9SY14_ARATH/320-643------------------AFVSFRSRWGTAVCAQ....................TQQCHNP...TIW..L----------
Q75JX3_DICDI/409-732------------------GFIIFKERNSQKELVQ....................TIIEKRD...NIL.LK----------
Q55HL4_CRYNB/375-703------------------AFIRFSSQFEAHAFAK....................LASKTDK...SNMHIR----------
SPO75_YEAST/420-748------------------MFITFKSTLLSNVIGE....................LLSYRLP...TQN.LK----------
Q5KMP4_CRYNJ/407-736------------------AFIHFNQQIAAHMAVQ....................CLAHNQP...YAM.NN----------
Q6FVT6_CANGA/437-765------------------AFLLFNSVSQAMQFYQ....................LLQSSSV...CQW.NY----------
Q6CTP0_KLULA/338-664------------------AFIEFKTQYDAQRAYQ....................SIPYLFD...KDIYDS----------
Q9C792_ARATH/233-550------------------AFVSFKSRYGAATALH....................MPQSINP...TYW..L----------
Q5A2N5_CANAL/333-659------------------VFIEFPSQLEMQKAYQ....................AIPYQPD...FKG.VK----------
Q2TX45_ASPOR/301-610------------------ALLHFSDLFTAHLLLQ....................ARASSIP........L----------
O15741_DICDI/138-463------------------SFVIFNQRKVQKEMVQ....................TIMHAK....YHVLFS----------
Q4P7M9_USTMA/339-676------------------GFASLAAVPYAHAAAK....................VLQNKKP...RGM..R----------
Q0CNN2_ASPTN/330-664------------------GFVSWEMIEHAHAVAY....................TARRKHP...EGT..T----------
Q55X91_CRYNB/416-752------------------AFVTVPSAKQAREILK....................NVKDDMKRAGYHI...----------
Q5ANH1_CANAL/429-746------------------AFLTMKTVAEAQMLAQ....................AVLDPKV...NHL..I----------
Q6FQA3_CANGA/332-658------------------VFLIFDTQLEAQRCFQ....................SVPDILG...FTNYGK----------
Q0UR74_PHANO/337-666------------------VFLEFDTQRHAQDAWQ....................MMQNKKTKPNSKL.EA----------
A1C5G9_ASPCL/369-694------------------LFIEFNTQSDAQIALQ....................TLSHHQP...LHM.TP----------
Q7SA72_NEUCR/715-1042------------------AFIQFNHQVAAHMACQ....................SVTYHIP...KQM.AP----------
Q16T32_AEDAE/332-653------------------AFVTLNSAQEAQH.......................VILHFKPGTYRNW..D----------
Q6CNN9_KLULA/328-653------------------VFVEFNTQYDAQKAVQ....................MVSHHSP...LSL.TP----------
PHM7_YEAST/330-656------------------CFIQFETQLEAQRCYQ....................SVEAILG...KKNFGK----------
Q9FVQ5_ARATH/322-645------------------AFVSFDSRWGAAVCAQ....................TQQSKNP...TLW..L----------
Q29VG6_PICAN/391-712------------------AFITMDSVATAQMVAQ....................AVLDPRV...SFL..I----------
Q2QN15_ORYSJ/290-606------------------AFVSFRSRYGAANAIY....................IRQSDKP...TEW..Q----------
YA7D_SCHPO/319-647------------------VFIRFRSQTDLQTAYQ....................AFLYSKKFRKYRF.GR----------
Q2H2M5_CHAGB/343-667------------------VFVEFRTQSDAEGASQ....................ILAHHRG...LHM.TP----------
Q4PBK2_USTMA/367-698------------------AFILFNTQIAAHMAVK....................TQAHHQP...YRM.TN----------
Q6CQA3_KLULA/381-702------------------AFVTMDSVANAQMAAQ....................AVLDPRV...LYF..I----------
Q55IG1_CRYNB/356-687------------------GFVTFKTIAEAHRIART..................HRGKLKEL...FGA..E----------
Q2GZW7_CHAGB/335-670------------------GFSSYSDIAEAHAIAY....................ACRKKKP...HGT..I----------
Q5BGH8_EMENI/1921-2251------------------AFVTMKSIAAAQMLVQ....................AILDPHP...MKL..L----------
Q94II2_ARATH/227-551------------------AVVFFTTRVAAASAAQ....................SLHCQMV...DKW..T----------
Q6CJU8_KLULA/487-816------------------AFIVFRKVSFAHIFDQ....................MLLSNKD...SEMSDD----------
Q8SV30_ENCCU/436-763------------------GFVTFKDQRSANIVKQ....................SQIGSRI...FSV..T----------
A0JP96_XENTR/352-691------------------VFVTFQDERMTAVIIKDYNRLPC.....HRAPQQSSVTPLLKS...HKW..K----------
Q5JKX1_ORYSJ/300-617------------------AFVSFKSQLDAAQAAE....................MQQHVNP...LSL..V----------
TM63C_MOUSE/341-680------------------IFVTFQDARTVRRIYDDYKYIHC.....GRHPKQSSVTTIVKN...YHW..R----------
Q6AU79_ORYSJ/320-643------------------AFVSFKSRWGAAVCAQ....................TQQTSNP...TLW..L----------
Q757I3_ASHGO/332-658------------------CFVIFSTQRDAQEAYQ....................RAPVALP...KGSYDR----------
Q7RWN3_NEUCR/470-795------------------AFVEFDSQASAEAAYQ....................ILSHHQP...MHM.SP----------
Q6CA07_YARLI/344-669------------------CMIQFNTQLDAHVACQ....................SLSYHNP...NFM.DT----------
Q55T89_CRYNB/445-776------------------AFVTFEDARDAQVACQ......................VTHYP...HHSQAV----------
Q2HEX8_CHAGB/384-711------------------AFVTMDSIAACQMAIQ....................ALVDPHP...GRL..Q----------
Q9M1H6_ARATH/298-615------------------AFVTFKSRRNAALAAQ....................TQQHSNP...LEL..I----------
A1CS74_ASPCL/381-711------------------AFVTMESIAASQMVVQ....................AILDPHP...MQL..F----------
Q4P987_USTMA/583-906------------------GFVTFQSAASAQIASQ....................TVHYPMP...AYC..A----------
O65460_ARATH/249-572------------------AFVSFKTRWAAAVCAQ....................TQQTRNP...TQW..L----------
YGV8_SCHPO/320-656------------------GFITYKSSYIAHDTAR........................HNS...RVAGAS----------
Q59MD1_CANAL/360-689------------------AFITMDSVASAQMAAQ....................TILDPRV...YKL..I----------
Q6C0S9_YARLI/412-736------------------AFVTMDSVASAQMVAQ....................AVLDPSP...YHL..I----------
RSN1_YEAST/335-660------------------VFVEFESQYQAQVAAQ....................ITTYHAP...LFM.TP----------
Q6C266_YARLI/333-657------------------AFVLFNTQEDAQVAYQ....................LLAHHKA...LHA.AP----------
Q75GI5_ORYSJ/304-621------------------AIVFFKTRYAAIVASR....................ILQSSNP...MLW..V----------
Q59TM5_CANAL/389-717------------------IFIEFTSQEGSYIAHQ....................CLLSQSQ....GFLDK----------
Q7SAG4_NEUCR/349-673------------------VFIEFRTQADAEGAAQ....................ILAHHRG...LHM.TP----------
Q2H842_CHAGB/434-758------------------AFIEFDSQASAQAGFQ....................ILAHHQP...LHM.SP----------
Q5APG0_CANAL/320-645------------------IFVEFENQYYAQLAYQ....................STVHHNP...MRM.SP----------
Q54RR3_DICDI/361-689------------------GFITFSRMAFASQAAQ....................CLFSKNI...EKF..K----------
Q6FSA1_CANGA/317-642------------------IFIEFESQYQAQIALQ....................IRAYHAP...LYM.SP----------
Q6ZLQ0_ORYSJ/321-643------------------AIVFFNRRSAAASASQ....................TLHAQMF...DKW..T----------
Q75FA6_ASHGO/525-853------------------AVVVFKNVILAHFFDQ....................LLLSAST...SSM.KE----------

PF07810

TMC3_HUMAN/499-614--------------------------------------------------------------------------------
TMC4_HUMAN/475-585--------------------------------------------------------------------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------------------------------------
Q571H8_MOUSE/303-413--------------------------------------------------------------------------------
Q5YCC6_CHICK/187-293--------------------------------------------------------------------------------
Q6GPL8_XENLA/460-566--------------------------------------------------------------------------------
Q16VL2_AEDAE/432-538--------------------------------------------------------------------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------------------------------------
Q7Z015_ANOGA/481-596--------------------------------------------------------------------------------
Q7Z014_ANOGA/399-515--------------------------------------------------------------------------------
Q6NUU5_DANRE/502-612--------------------------------------------------------------------------------
Q7Z013_ANOGA/385-495--------------------------------------------------------------------------------
TMC7_HUMAN/486-597--------------------------------------------------------------------------------
Q4T0I6_TETNG/432-547--------------------------------------------------------------------------------
TMC7_CHICK/480-590--------------------------------------------------------------------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------------------------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------------------------------------
Q3MI88_HUMAN/482-597--------------------------------------------------------------------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------------------------------------
TMC5_RAT/683-789--------------------------------------------------------------------------------
A7RLV1_NEMVE/180-290--------------------------------------------------------------------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------------------------------------
Q4S012_TETNG/224-335--------------------------------------------------------------------------------
A7SUG1_NEMVE/384-492--------------------------------------------------------------------------------
A2BFV3_DANRE/430-545--------------------------------------------------------------------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------------------------------------

PF04547

CACLC_ARATH/188-630................................................................................
ANO2_HUMAN/352-944MCDQQNAFTM......................................................................
ANO9_HUMAN/179-740ICEAHDILMC......................................................................
Q9VYS8_DROME/350-933ICDDNGTIMC......................................................................
ANO6_HUMAN/287-872VCHPDIGGKII.....................................................................
A5DIJ8_PICGU/65-553................................................................................
A0CKQ3_PARTE/818-1263................................................................................
Q6NUA4_XENLA/167-596................................................................................
Q16MH2_AEDAE/199-778ICNDNTTIMC......................................................................
Q2UDH7_ASPOR/180-663................................................................................
Q2U154_ASPOR/174-639................................................................................
A0DD09_PARTE/537-1000................................................................................
Q4SPC5_TETNG/131-466................................................................................
YNG5_SCHPO/170-627................................................................................
A6RD03_AJECN/171-655................................................................................
A0CE73_PARTE/768-1287................................................................................
A7S3G0_NEMVE/17-561VFSSHGILNYMIFSWPYAHQHFNPAHVFLLCVCVLSTILKTPSLHSCMSSICISSRPDCMLSLSLTCILHNLPHSLTFFS
A7RKU7_NEMVE/244-824ACDTNNKFYMC.....................................................................
Q86P24_DROME/304-882ICQSGNTNIT......................................................................
ANO3_MOUSE/384-951ICKATEVFMC......................................................................
A7REV0_NEMVE/214-763LEVCDNPPWTFRM...................................................................
ANO10_DANRE/200-629................................................................................
ANO8_HUMAN/237-880................................................................................
ANO10_MOUSE/200-629................................................................................
A1D9V1_NEOFI/173-637................................................................................
A4HVK2_LEIIN/428-971VL..............................................................................
A4H763_LEIBR/371-928VPDKVVRSA.......................................................................
Q6DDQ3_XENLA/273-852ICDPGIGGQII.....................................................................
A0DPP4_PARTE/705-1145................................................................................
A0CIB0_PARTE/859-1305................................................................................
Q24E70_TETTS/215-696................................................................................
A0DHW5_PARTE/686-1116................................................................................
A3LWT2_PICST/162-656................................................................................
A0CMD7_PARTE/544-1006................................................................................
ANO4_BOVIN/304-887VCQATDIIMC......................................................................
ANO5_HUMAN/292-870ICDPEIGGQMI.....................................................................
A0D751_PARTE/565-1028................................................................................
Q8JFT1_DANRE/232-825ICDPKIGGMI......................................................................
Q1AP35_STRPU/306-885ICAGTDIIMC......................................................................
Q17BF8_AEDAE/268-729................................................................................
A0CZD5_PARTE/224-675................................................................................
Q4SBN7_TETNG/194-870................................................................................
A7RKU9_NEMVE/227-807ICNKAYEAEFY.....................................................................
A0EDB1_PARTE/707-1149................................................................................
Q7S8J4_NEUCR/182-650................................................................................
A7STD6_NEMVE/128-561................................................................................
Q55GA1_DICDI/227-693................................................................................
A0DK82_PARTE/835-1351................................................................................
A0D675_PARTE/863-1384................................................................................
A5DTZ8_LODEL/154-649................................................................................
Q234J3_TETTS/795-1263................................................................................
A0EHC2_PARTE/551-1015................................................................................
Q16TH0_AEDAE/334-773................................................................................
Q233Y7_TETTS/365-837................................................................................
A0CY40_PARTE/679-1119................................................................................
Q4T7R8_TETNG/234-891................................................................................
Q4SUU1_TETNG/210-658................................................................................
A0BSX3_PARTE/784-1228................................................................................
ANO1_HUMAN/320-928MCDQRHNITM......................................................................
Q4P618_USTMA/365-904................................................................................
Q29GT2_DROPS/198-624................................................................................
A1C9M0_ASPCL/169-650................................................................................
Q0IEX5_AEDAE/469-1043KEICDENGPGNI....................................................................
Q59PV1_CANAL/157-651................................................................................
A0DPK7_PARTE/690-1130................................................................................
Q4SSV5_TETNG/402-1010MCDDSLNFTM......................................................................
A0BM99_PARTE/778-1230................................................................................
Q22HF6_TETTS/2687-3155................................................................................
ANO7_MOUSE/277-825LCHSSDSFDM......................................................................
Q5BAF3_EMENI/273-754................................................................................
Q8I4C3_CAEEL/218-758................................................................................
A0DMZ8_PARTE/532-1006................................................................................
A7F670_SCLS1/199-673................................................................................
A0D6S4_PARTE/669-1110................................................................................
A0CHM6_PARTE/689-1129................................................................................
Q0CVZ6_ASPTN/174-638................................................................................
Q4REV7_TETNG/320-956TCNDSLNITM......................................................................
A7RKU8_NEMVE/172-744VCDSKNEGRWIM....................................................................
A7REU8_NEMVE/125-679LEMCDHPAWTYP....................................................................
A0DBP1_PARTE/583-1035................................................................................
A0BSX4_PARTE/787-1230................................................................................
A0DMG8_PARTE/258-772................................................................................
Q175J3_AEDAE/362-937ICSKENNIMM......................................................................
A0E006_PARTE/685-1125................................................................................
A0BM92_PARTE/792-1345................................................................................
A0EAT8_PARTE/668-1109................................................................................
A7SBX8_NEMVE/221-663................................................................................
A0C896_PARTE/868-1320................................................................................
Q5AX15_EMENI/167-626................................................................................
Q4SV37_TETNG/23-638VCESNITMC.......................................................................
Q16MH3_AEDAE/340-935ICRDNSTIMC......................................................................
Q6CB66_YARLI/1924-2410................................................................................
A0DAH3_PARTE/688-1129................................................................................
Q4S1F6_TETNG/540-1136ICSEAIGGNIV.....................................................................
Q2H0D1_CHAGB/191-672................................................................................
A0C1K4_PARTE/730-1174................................................................................
A7RJQ8_NEMVE/222-776ICDKA...........................................................................
Q23AS7_TETTS/863-1350................................................................................
A2R347_ASPNC/170-649................................................................................
A0C5J6_PARTE/679-1109................................................................................
Q0CNB9_ASPTN/169-648................................................................................
Q08BD4_DANRE/215-664................................................................................

PF02714

YAB9_SCHPO/387-708--------------------------------------------------------------------------------
Q756H9_ASHGO/339-665--------------------------------------------------------------------------------
Q0V7D2_PHANO/253-586--------------------------------------------------------------------------------
Q6BLR7_DEBHA/320-645--------------------------------------------------------------------------------
Q0P5M3_BOVIN/53-397--------------------------------------------------------------------------------
Q28ZW6_DROPS/345-661--------------------------------------------------------------------------------
Q0UCF6_PHANO/629-953--------------------------------------------------------------------------------
Q6BHX0_DEBHA/347-676--------------------------------------------------------------------------------
Q0V4S6_PHANO/338-663--------------------------------------------------------------------------------
Q6BI49_DEBHA/417-734--------------------------------------------------------------------------------
Q6BHN0_DEBHA/405-733--------------------------------------------------------------------------------
Q0UJ62_PHANO/323-659--------------------------------------------------------------------------------
TM63A_HUMAN/350-693--------------------------------------------------------------------------------
Q7S914_NEUCR/334-669--------------------------------------------------------------------------------
Q2QLP9_ORYSJ/304-621--------------------------------------------------------------------------------
Q5JLH8_ORYSJ/319-642--------------------------------------------------------------------------------
Q7SFU1_NEUCR/389-716--------------------------------------------------------------------------------
Q5B9A0_EMENI/329-664--------------------------------------------------------------------------------
A1CSW7_ASPCL/614-938--------------------------------------------------------------------------------
Q4RLY6_TETNG/333-656--------------------------------------------------------------------------------
Q9SY14_ARATH/320-643--------------------------------------------------------------------------------
Q75JX3_DICDI/409-732--------------------------------------------------------------------------------
Q55HL4_CRYNB/375-703--------------------------------------------------------------------------------
SPO75_YEAST/420-748--------------------------------------------------------------------------------
Q5KMP4_CRYNJ/407-736--------------------------------------------------------------------------------
Q6FVT6_CANGA/437-765--------------------------------------------------------------------------------
Q6CTP0_KLULA/338-664--------------------------------------------------------------------------------
Q9C792_ARATH/233-550--------------------------------------------------------------------------------
Q5A2N5_CANAL/333-659--------------------------------------------------------------------------------
Q2TX45_ASPOR/301-610--------------------------------------------------------------------------------
O15741_DICDI/138-463--------------------------------------------------------------------------------
Q4P7M9_USTMA/339-676--------------------------------------------------------------------------------
Q0CNN2_ASPTN/330-664--------------------------------------------------------------------------------
Q55X91_CRYNB/416-752--------------------------------------------------------------------------------
Q5ANH1_CANAL/429-746--------------------------------------------------------------------------------
Q6FQA3_CANGA/332-658--------------------------------------------------------------------------------
Q0UR74_PHANO/337-666--------------------------------------------------------------------------------
A1C5G9_ASPCL/369-694--------------------------------------------------------------------------------
Q7SA72_NEUCR/715-1042--------------------------------------------------------------------------------
Q16T32_AEDAE/332-653--------------------------------------------------------------------------------
Q6CNN9_KLULA/328-653--------------------------------------------------------------------------------
PHM7_YEAST/330-656--------------------------------------------------------------------------------
Q9FVQ5_ARATH/322-645--------------------------------------------------------------------------------
Q29VG6_PICAN/391-712--------------------------------------------------------------------------------
Q2QN15_ORYSJ/290-606--------------------------------------------------------------------------------
YA7D_SCHPO/319-647--------------------------------------------------------------------------------
Q2H2M5_CHAGB/343-667--------------------------------------------------------------------------------
Q4PBK2_USTMA/367-698--------------------------------------------------------------------------------
Q6CQA3_KLULA/381-702--------------------------------------------------------------------------------
Q55IG1_CRYNB/356-687--------------------------------------------------------------------------------
Q2GZW7_CHAGB/335-670--------------------------------------------------------------------------------
Q5BGH8_EMENI/1921-2251--------------------------------------------------------------------------------
Q94II2_ARATH/227-551--------------------------------------------------------------------------------
Q6CJU8_KLULA/487-816--------------------------------------------------------------------------------
Q8SV30_ENCCU/436-763--------------------------------------------------------------------------------
A0JP96_XENTR/352-691--------------------------------------------------------------------------------
Q5JKX1_ORYSJ/300-617--------------------------------------------------------------------------------
TM63C_MOUSE/341-680--------------------------------------------------------------------------------
Q6AU79_ORYSJ/320-643--------------------------------------------------------------------------------
Q757I3_ASHGO/332-658--------------------------------------------------------------------------------
Q7RWN3_NEUCR/470-795--------------------------------------------------------------------------------
Q6CA07_YARLI/344-669--------------------------------------------------------------------------------
Q55T89_CRYNB/445-776--------------------------------------------------------------------------------
Q2HEX8_CHAGB/384-711--------------------------------------------------------------------------------
Q9M1H6_ARATH/298-615--------------------------------------------------------------------------------
A1CS74_ASPCL/381-711--------------------------------------------------------------------------------
Q4P987_USTMA/583-906--------------------------------------------------------------------------------
O65460_ARATH/249-572--------------------------------------------------------------------------------
YGV8_SCHPO/320-656--------------------------------------------------------------------------------
Q59MD1_CANAL/360-689--------------------------------------------------------------------------------
Q6C0S9_YARLI/412-736--------------------------------------------------------------------------------
RSN1_YEAST/335-660--------------------------------------------------------------------------------
Q6C266_YARLI/333-657--------------------------------------------------------------------------------
Q75GI5_ORYSJ/304-621--------------------------------------------------------------------------------
Q59TM5_CANAL/389-717--------------------------------------------------------------------------------
Q7SAG4_NEUCR/349-673--------------------------------------------------------------------------------
Q2H842_CHAGB/434-758--------------------------------------------------------------------------------
Q5APG0_CANAL/320-645--------------------------------------------------------------------------------
Q54RR3_DICDI/361-689--------------------------------------------------------------------------------
Q6FSA1_CANGA/317-642--------------------------------------------------------------------------------
Q6ZLQ0_ORYSJ/321-643--------------------------------------------------------------------------------
Q75FA6_ASHGO/525-853--------------------------------------------------------------------------------

PF07810

TMC3_HUMAN/499-614--------------------------------------------------------------------------------
TMC4_HUMAN/475-585--------------------------------------------------------------------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------------------------------------
Q571H8_MOUSE/303-413--------------------------------------------------------------------------------
Q5YCC6_CHICK/187-293--------------------------------------------------------------------------------
Q6GPL8_XENLA/460-566--------------------------------------------------------------------------------
Q16VL2_AEDAE/432-538--------------------------------------------------------------------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------------------------------------
Q7Z015_ANOGA/481-596--------------------------------------------------------------------------------
Q7Z014_ANOGA/399-515--------------------------------------------------------------------------------
Q6NUU5_DANRE/502-612--------------------------------------------------------------------------------
Q7Z013_ANOGA/385-495--------------------------------------------------------------------------------
TMC7_HUMAN/486-597--------------------------------------------------------------------------------
Q4T0I6_TETNG/432-547--------------------------------------------------------------------------------
TMC7_CHICK/480-590--------------------------------------------------------------------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------------------------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------------------------------------
Q3MI88_HUMAN/482-597--------------------------------------------------------------------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------------------------------------
TMC5_RAT/683-789--------------------------------------------------------------------------------
A7RLV1_NEMVE/180-290--------------------------------------------------------------------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------------------------------------
Q4S012_TETNG/224-335--------------------------------------------------------------------------------
A7SUG1_NEMVE/384-492--------------------------------------------------------------------------------
A2BFV3_DANRE/430-545--------------------------------------------------------------------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------------------------------------

PF04547

CACLC_ARATH/188-630...........................SLQFLALPSFFVGTILWAAL-FLQFWKRK.NAALLARWQINCLV.........
ANO2_HUMAN/352-944...CPLCDKSCDYWNLSSACGTAQASHLFDNPATVFFSIFMALWATM-FLENWKRL.QMRLGYFWDLTGIEEE.......
ANO9_HUMAN/179-740....PLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATV-FLEIWKRQ.RARVVLHWDLYVWD.........
Q9VYS8_DROME/350-933....PQCDRSCDYWRLNETCTSSKFNYLIDNNMTVVFAFSMAIWAVV-YLEFWKRY.SAGLVHRWGLTGFT.........
ANO6_HUMAN/287-872..MCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTL-FLEFWKRR.QAELEYEWDTVELQ.........
A5DIJ8_PICGU/65-553...............................TFSLSYTCINLLWGTF-FISLWKRR.ENFITNKWGVVNCH.........
A0CKQ3_PARTE/818-1263.........................ADKMHASILPSFALFMSLWATL-FMEKWKNR.ESELKYIWDMHKFK.........
Q6NUA4_XENLA/167-596.............................DYDKYVIFATFNLVWSTV-ILEVWKRL.SSVMTYRWGSLIMK.........
Q16MH2_AEDAE/199-778....PQCDAKCDYWRLNDTCTTSQLAHIFDNNFTIVFAVFMSIWATL-YLEMWKRY.SSAIQHRWGITDYCS........
Q2UDH7_ASPOR/180-663................................FSVIYTVGNALWCIV-FIEYWKHQ.EEDLSCRWQSKGVS.........
Q2U154_ASPOR/174-639................................YSITSALVNCLWCIV-FVEYWKIR.ETDLSLRWNVRGVG.........
A0DD09_PARTE/537-1000.........................NGDSINSVAPIYTLCMAVWATI-FFEFWKRK.QSETMYNFDMHVTK.........
Q4SPC5_TETNG/131-466................LSGSHDSHLEHDSGVSGHMVQAVFSMLWSTV-VMELWKRR.SSTQSYRWGTLHLA.........
YNG5_SCHPO/170-627................................YSYIFAIGVALWGAF-FIQFWRVQ.EHKLTNHWSTVNCQ.........
A6RD03_AJECN/171-655................................FSIVYAIVNCLSCVV-FTEMWKRQ.ESDLRIRWQVKNVS.........
A0CE73_PARTE/768-1287......................WNQNDYNYIMPQIIFGMIQIQWANL-IYDLWQQR.EKVFAAQYGQGEGG.........
A7S3G0_NEMVE/17-561TLQCVNESPLRTPNATASTIINKWAKKAFDNNATPYFALIICLWGTI-FLELWKRT.TARLAYQWDVDMYE.........
A7RKU7_NEMVE/244-824...PLCDRTCSYWDLVSTTCMYARVTHFFDNDGTVFLAIFTSVWATL-FLEFWKRR.QAVLAYEWHVANFEE........
Q86P24_DROME/304-882...MCPLCDWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATL-FLELWKRY.SAEITHRWDLTGFDV........
ANO3_MOUSE/384-951....PLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWATV-FLEFWKRR.RSILTYTWDLIEWEE........
A7REV0_NEMVE/214-763.CPLCDEELGCQYWDLHISCKSGKIAYLFDNASTVFFAVFVSFWSCF-FLEYWKRK.EVTLAYHWDVLEYEE........
ANO10_DANRE/200-629.............................DYDKYVLFAVFNLVWSTV-FLEVWKRC.SATLAYSWGTLGRK.........
ANO8_HUMAN/237-880.........................DQTSRDVSCVVFALFNVIWSTL-FLEEWKRR.GAELAYKWGTLDSP.........
ANO10_MOUSE/200-629.............................DYDKYVIFASFNLIWSTV-ILEVWKRG.CANMTYRWGTLVMK.........
A1D9V1_NEOFI/173-637................................YSINYAVVNCLWCIV-FVEYWKIR.ETDLSLQWNVKGVG.........
A4HVK2_LEIIN/428-971...........VPAASSSITLRRTVQHCLDVALLPLFSTTMIIGSVL-CIKMWERR.CSALCMRYHLFQQE.........
A4H763_LEIBR/371-928.....GTTLVLAPAASSSMTLRRTVQYCPDVALLPLGNAFMVIASVL-CIKMWERR.CSVLCMKYHLFQQ..........
Q6DDQ3_XENLA/273-852..MCPLCDKRCEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTL-FLEFWKRR.QARLEYEWDLVDFEE........
A0DPP4_PARTE/705-1145......................QDDKSDLTYLLRIIFAFVQIQWTNL-FVVIWQKQ.QMIFNLQFGQSGKD.........
A0CIB0_PARTE/859-1305........................ATPGLSDTLTVIFSSLIIIWSTF-LIEYWRQE.QVIFSLQYGQQNIE.........
Q24E70_TETTS/215-696.......................FDYDSKTSPFDSIYSAIVILWGSF-FFATW.KKHERQIKVQSCSQSQK.........
A0DHW5_PARTE/686-1116......................KELDKQTYTAIISIFSLLVVLWNSF-VTDYWKTT.QIKFNIRQGFNKRA.........
A3LWT2_PICST/162-656...............................IFSLSYSFINLVWGVF-FIGFWERR.QRYLANCWGVQNSH.........
A0CMD7_PARTE/544-1006.........................DEEAIQAIAPIYTLCMAVWATI-FFEFWKRK.QSETMYNFDMHVAK.........
ANO4_BOVIN/304-887....PVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATV-FLEFWKRR.RAVIAYDWDLIDWEE........
ANO5_HUMAN/292-870..MCPLCDQVCDYWRLNSTCLASKFSHLFDNESTVFFAIFMGIWVTL-FLEFWKQR.QARLEYEWDLVDFEE........
A0D751_PARTE/565-1028.........................TNEINSLFVPIYTIALAVWATI-FFEFWKRK.QSEMMFQFDMHVET.........
Q8JFT1_DANRE/232-825....VMCPLCDKKCSYWKLNSTCL......NPISLIMKGLCFLPCSW-AFGFWKRR.QARLEYEWDLVDFEE........
Q1AP35_STRPU/306-885....PLCDKRCPYWTLSDSCFYSKLTYLFDNEATVFFACFMSLWATM-FCEFWKRR.QNTIDYDWDLFGFEE........
Q17BF8_AEDAE/268-729........................RGQTAQDIGHVIFSLFNVAWASL-YLEAWRRY.SVELAFRWGTLSTP.........
A0CZD5_PARTE/224-675........................SSLFKITNVASFYAVLTMVWSTF-FIIAWRRK.ENELSIEWGVFG...........
Q4SBN7_TETNG/194-870.........................DQTSQDICCVVFALFNVVWATL-FLERWKRR.EAELAYRWGTLDTP.........
A7RKU9_NEMVE/227-807..MCPLCDKQCPYWSLVVNCPYAIWVHAFDNDSTVVFAIFMSIWATV-FLEFWKRR.QAVLAYEWHMMHYED........
A0EDB1_PARTE/707-1149........................STGQYKKPIVILFSFTIVIWSSL-FIVYWRRK.QFLFSVQFGQLNFE.........
Q7S8J4_NEUCR/182-650................................FSWFYAVVNALWSVV-FFEHWKTK.EVDLAVRWGVRGVS.........
A7STD6_NEMVE/128-561.............................DQTKNTVFAVLNLLWATI-FLEAWKRR.CSEMSFKWGTLKGG.........
Q55GA1_DICDI/227-693..........................RDSYKFASSSFSIALAVLSTL-FFEIWKRY.GSIYSWKWDQEDYI.........
A0DK82_PARTE/835-1351..........................YDFHSDLIPYWVLFVTIWSTV-QIELWKRK.TSEINTRWGCIDQML........
A0D675_PARTE/863-1384..........................YDFHSEILPYWVLIVTIWSTV-QTELWKRK.TSEINTRWGCIDQML........
A5DTZ8_LODEL/154-649...............................SFSLTYTFINLIWGTL-FLAFWHRR.EQYLTNLWGVQNCH.........
Q234J3_TETTS/795-1263......................KYKHPETSAGFRFFFAIIIIIWQCA-FIEFWKRE.QAVFSLTYGQENFQ.........
A0EHC2_PARTE/551-1015.........................TNRFDTLFVPIYTIALAVWATI-FFEFWKRK.QSETMFQFDMHVET.........
Q16TH0_AEDAE/334-773..............................TETVPFFCVFYVVWIKV-FLELWKRK.SSAHAYRWGTITMT.........
Q233Y7_TETTS/365-837........................FFTKQYLYFYFFYTVFICIWSSL-FYIFWKRY.ESELQVKWGVFGKK.........
A0CY40_PARTE/679-1119......................QNYNNEVYTATVSVFSILIVHWNSF-QTDCWHQQ.QLTFNLKFGQNRNV.........
Q4T7R8_TETNG/234-891.........................DQTSRDICCVVFALFNVVWATL-FLERWKRR.EAELAYKWGTLDPP.........
Q4SUU1_TETNG/210-658.............................GYDKYVIFAGFNLVWCTV-ILELWKRY.SASLAYRWGTLSRK.........
A0BSX3_PARTE/784-1228........................SSLELRQTAIIGFSIIIIIWSTF-FMEFWKRE.QVYFSVRFGQQNFE.........
ANO1_HUMAN/320-928...CPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAAT-FMEHWKRK.QMRLNYRWDLTGFEEEE......
Q4P618_USTMA/365-904................................FSPIYSLGLVAWSCL-FVELWRMK.QRKLAVRWGTLGVG.........
Q29GT2_DROPS/198-624.................................LSIVCSFYVVWTTI-FLELWKRK.CAGYSYRWGTIEMS.........
A1C9M0_ASPCL/169-650................................FSIIYTVVNCLWTIV-FIEYWKRQ.ENDLSCRWQTKGVS.........
Q0IEX5_AEDAE/469-1043.TLCPLCDRACSYQQLSESCLFAQLTYLFDNPSTVFFAIFMSFWATT-FLEMWKRK.QSVLIWEWDLQNIEN........
Q59PV1_CANAL/157-651...............................RFSLTFAFINLLWGVL-FLASWHRR.EQHLVNVWGVQNSH.........
A0DPK7_PARTE/690-1130......................QDSESDLYYLLRIIFAFLQIQWTNL-FVVLWQKK.QLIFNIQFGQTAKE.........
Q4SSV5_TETNG/402-1010...CPLCDGACDYWHLSTACGTARASHLFDNPGTVFFAIFMSLWAVL-FLEQWKRR.QISLSFSWDLTGIEE........
A0BM99_PARTE/778-1230.........................TKEVNSSIVPFYALLMTLWSTL-FMEKWKNR.ESELKFCWDMHKFR.........
Q22HF6_TETTS/2687-3155.......................IISDIVEFYLNTLFACFIILWSTL-FVEFWKRQ.QILFTIEFGQQKFE.........
ANO7_MOUSE/277-825....CPLCSDCSFWLLSSACTLAQAGRLFDHGGTVFFSLFMALWAVL-LLEYWKRK.NATLAYRWDCSDYED........
Q5BAF3_EMENI/273-754................................FSIIYTVVNCLWGVI-FIEYWKRQ.EEDLSCRWQTKGVS.........
Q8I4C3_CAEEL/218-758..................PGDKQDLYQLISDICFVLFAFFNCIWSTI-YLEWWKRV.QAELAFKWGTYDATQ........
A0DMZ8_PARTE/532-1006.........................VNDYNSLFLPLYVIYMSIWSTI-TVEFWKRK.QCEMNARWGLLDQM.........
A7F670_SCLS1/199-673................................YSPIYAIVNGIWCIV-YTEYWKKQ.ETDLAVQWGVRGVS.........
A0D6S4_PARTE/669-1110......................WDNESDFYILITMIFAFVQIQWSNV-FTDLWKQK.QIFFNLKYGQNNQD.........
A0CHM6_PARTE/689-1129......................QDYDNEVYTATMSVFSILLVHWSSF-QTDCWYQQ.QLTFNLKFGQNRDV.........
Q0CVZ6_ASPTN/174-638................................YSITCALVNCFWHIV-FVEYWKIR.QTDLSVRWNVKGVG.........
Q4REV7_TETNG/320-956...CPLCDGVCDYWHLSTVCSLARASYLFDNGATVLFAIFMSLWAAC-FLEHWKRR.QMCLKHSWDLTSLEDEEVLRTLQ
A7RKU8_NEMVE/172-744..CPLCDKQCSYWDLAKTTCAYAYVTHFFDNSLTVALAVVSSIWATL-FLELWKRR.QASLANKWHVSDFE.........
A7REU8_NEMVE/125-679..MCPNCEVGCSVWDLKKSCSRAKHAYLFDNPMTVAYSIFVSFWAVL-FLEFWKRK.EVTIGHAWDVLEFES........
A0DBP1_PARTE/583-1035.......................DVEALANKVSIIFFTIMIVFWSST-FQALWIRQ.EMQFQTMFGLEDME.........
A0BSX4_PARTE/787-1230........................STEEAKSTMIILFSLAIIIWSTF-FIEFWKRE.QILFSVQFGQQNFE.........
A0DMG8_PARTE/258-772.......................FGYDVTKSPFEPLYATLTVLWAAY-FVSQWNQK.QKEYQVKWRSHGKNYDYMSSKIE
Q175J3_AEDAE/362-937...CPLCDHWCDYWELSETCLHARATYLFDNPTTVLFAIFMSFWATL-FLELWKRY.SAEITHRWDLTGFDV........
A0E006_PARTE/685-1125......................KFYDEDVFTGIVSSFSILLIHWSSF-VTDYWNQM.QLTFNIKYGQNKNA.........
A0BM92_PARTE/792-1345......................SDTKSSLYVYLYIIFGFIQIQWSNL-IHDMWQTK.EKVFAMQFGQFNQS.........
A0EAT8_PARTE/668-1109......................WDNESDFYILVTIIFAFVQIHWSNV-FTDLWKQK.QIYFNLKYGQNDQD.........
A7SBX8_NEMVE/221-663.........................GEVTRDWCVLAFNIFNIVWATL-YLEAWKRK.SAELAYRWGTLDMP.........
A0C896_PARTE/868-1320.......................T.EPRVSIVIAMMFGILHSSFLTL-MLGSWKLK.EKQIVAQFAQNIKQ.........
Q5AX15_EMENI/167-626................................YSITFAVGNCLWAMV-FVEYWKIR.ETDLSLRWQVKGVG.........
Q4SV37_TETNG/23-638....PRCDKTCKVWQLSDTCTYAKISHLFDNEGTVGFAMFMAIWATL-FLELWKRH.RAIHVTNWKVYDWCEE.......
Q16MH3_AEDAE/340-935....PQCDAICDYWKLGDTCLSSRLAYLFDNKLTIWFALFMSVWASV-YLKMWKRY.VSHLQHKWGVRDYDA........
Q6CB66_YARLI/1924-2410................................YSFFYTLVIQIWSIV-FVRAWRKR.ETNLAIRFGATNAS.........
A0DAH3_PARTE/688-1129......................NNQDGEASIIITMIFTFVLIQWNSI-VTDYWKQQ.QVRFNLKYGQLNEK.........
Q4S1F6_TETNG/540-1136..MCPLCDKKCGYWKLSSTCNSSWQSHLFDNVATVFFAIFMGIWVTL-FLEFWKRR.QARLEYEWDLVDFEE........
Q2H0D1_CHAGB/191-672................................FSWVYAVVNCLWAVV-FFEHWKMK.EVDLAVQWGVRGVG.........
A0C1K4_PARTE/730-1174........................TTGDAKKAFIVIFSVILISWSSY-FICHWKRQ.QTMFQIQFGQNNKS.........
A7RJQ8_NEMVE/222-776.........NENYWSLHTSCRYSKITHLFDHEGTVFFAAFMALWSSL-FLEVWKRQ.QTSLAFEWDMLDFDE........
Q23AS7_TETTS/863-1350.......................QDSDDYNNYLVSFYVLYVMIWSTI-IVEFWKRK.TSEINYRWGTLDMMNN.......
A2R347_ASPNC/170-649................................FSIIYAVVNSLWCII-FIEYWKRQ.EEDLSCRWQTKGVS.........
A0C5J6_PARTE/679-1109......................NIQHNDISLVAQSIFSILIINLNCF-LTDYWNQT.QFAFNIQNGQNNNY.........
Q0CNB9_ASPTN/169-648................................FSTIYTVVNALWCII-FIEYWKRQ.EEDLSCRWQTRGVS.........
Q08BD4_DANRE/215-664...............DSNASSKISDDDHLSVSSYMVQAVFSMLWSTI-FMELWKRR.SASLSYHWGTFNLA.........

PF02714

YAB9_SCHPO/387-708--------------------------------IELAPAANDIQWHNT.YIGRWHKFFQGWFITLV---------------
Q756H9_ASHGO/339-665--------------------------------AYVGIRPADIIWFNM.RKFWFERIAAKLIAGVS---------------
Q0V7D2_PHANO/253-586--------------------------------VYLAPKPHDLLWQNL.AMSRRTRRVRKFWDGLW---------------
Q6BLR7_DEBHA/320-645--------------------------------VHTGIEPSDVYWNNL.RLFWWEKFFRRLFACAD---------------
Q0P5M3_BOVIN/53-397--------------------------------VSYAPDPQNIYWEHL.SIRGFIWWLRCLVINVV---------------
Q28ZW6_DROPS/345-661--------------------------------MMFAPSPDDLFWENL.NVNKSHWYLKFFFVNFV---------------
Q0UCF6_PHANO/629-953--------------------------------RTVEVNPAYVLWENL.SMKWWERYVRMFSVIVL---------------
Q6BHX0_DEBHA/347-676--------------------------------VKLAPAPKDIRWKNF.RLTRYEKLLKSYVITFI---------------
Q0V4S6_PHANO/338-663--------------------------------RYTGVKPNEVIWENL.TLAPARRLSQEGIALAL---------------
Q6BI49_DEBHA/417-734--------------------------------TTLAPAPHDIIWDHL.CLTRRERNLRIFFVTLF---------------
Q6BHN0_DEBHA/405-733--------------------------------TLIEIHPKDILWDNIARNNTIACLIEKYFVSLI---------------
Q0UJ62_PHANO/323-659--------------------------------VRLAPKPKDVIWKNL.LLDAKTRRWRRFINHGW---------------
TM63A_HUMAN/350-693--------------------------------VTFAADPEDICWKNL.SIQGLRWWLQWLGINFT---------------
Q7S914_NEUCR/334-669--------------------------------VTLAPKPNDIVWENM.PLSSASRATRRLWNNLW---------------
Q2QLP9_ORYSJ/304-621--------------------------------TDLAPEPDDVYWSNL.WLPYKQLWIRRIATLLG---------------
Q5JLH8_ORYSJ/319-642--------------------------------TEWAPEPRDVYWDNL.SIPFVYLTIRRLIIAVA---------------
Q7SFU1_NEUCR/389-716--------------------------------TKPAPAPSDIEWRNT.YASRLTRRVRSVAVTLF---------------
Q5B9A0_EMENI/329-664--------------------------------IRLATRPHDLIWENL.SLSKSARKWKAFVMFLW---------------
A1CSW7_ASPCL/614-938--------------------------------RIVEISPDDVIWDNM.SLKWWERYLRTFGILTV---------------
Q4RLY6_TETNG/333-656--------------------------------VSYAPAPSDIIWENL.SVCGSRWWLRCVLLNIL---------------
Q9SY14_ARATH/320-643--------------------------------TEWAPEPRDVFWDNL.AIPYVELSIRRLLTTVA---------------
Q75JX3_DICDI/409-732--------------------------------RYYAPDPNDVYWPNI.HIGGKQLYIRGLIIMVL---------------
Q55HL4_CRYNB/375-703--------------------------------GGIEVVPEDIEWSNI.SMSPWERHARTIVSWCL---------------
SPO75_YEAST/420-748--------------------------------VIIGPNVNDIIWRNILDSSPLWKSAKYFSANIL---------------
Q5KMP4_CRYNJ/407-736--------------------------------RYIEQSPANVIWRNL.SLNQYERNVRQAISWAA---------------
Q6FVT6_CANGA/437-765--------------------------------PMIGAHPKDIIWINIVGRNPITITLRKLAGRLI---------------
Q6CTP0_KLULA/338-664--------------------------------ALIGYGPDDVIWEST.SMNRKTRKVKRLGGNTI---------------
Q9C792_ARATH/233-550--------------------------------TEPAPEPHDVHWPFF.SASFMQKWLAKILVVFA---------------
Q5A2N5_CANAL/333-659--------------------------------TVINAAPEDIIWENL.QLTSMKRRIKSIIANTI---------------
Q2TX45_ASPOR/301-610--------------------------------ALEAHDTDLKTLDPILYYGKLSRTLRSISILVT---------------
O15741_DICDI/138-463--------------------------------RYYAPDPNDVFWKNI.HIGLKSYYVRSLIVAIL---------------
Q4P7M9_USTMA/339-676--------------------------------ITLAPPPTGIIWQNL.VKSRASRAKSSFFGFLM---------------
Q0CNN2_ASPTN/330-664--------------------------------IRLAPRPSDLIWENL.PLSKQARRWKRFVNRIW---------------
Q55X91_CRYNB/416-752--------------------------------.QRAPRSHNVLWKNL.EKDVKSRHSHAIIGKFA---------------
Q5ANH1_CANAL/429-746--------------------------------TNLAPAPHDIRWDNL.SLTRQDRNTKILAVTIF---------------
Q6FQA3_CANGA/332-658--------------------------------CLIGCTPDDLNWDNL.NLTKKARYMKRLTANSI---------------
Q0UR74_PHANO/337-666--------------------------------QQLGVIPQEVVWQNL.RIKPAEHLVRWTAATAF---------------
A1C5G9_ASPCL/369-694--------------------------------RFIGISPREVVWSSL.NLSWWQRIVRKFAIKGG---------------
Q7SA72_NEUCR/715-1042--------------------------------RTVEISPNDVIWDNM.AIKWWHEWARSALVFAV---------------
Q16T32_AEDAE/332-653--------------------------------LAYAPAPSDIFWENL.NIDTAQWYFKWIAVNLV---------------
Q6CNN9_KLULA/328-653--------------------------------AYVGISPTDVQWFNL.RMFWLERLVRKFGSIAA---------------
PHM7_YEAST/330-656--------------------------------RLIGYSPEDVNWGSM.RLSSKERHSRRAVANTI---------------
Q9FVQ5_ARATH/322-645--------------------------------TSSAPEPRDIYWQNL.AIPFISLTIRKLVIGVS---------------
Q29VG6_PICAN/391-712--------------------------------TRTAPAPKDIIWENV.TLPRKDRVLKIYYITIL---------------
Q2QN15_ORYSJ/290-606--------------------------------TEHAPDPHDVYWPFF.STSFMDRWISKFVVSVA---------------
YA7D_SCHPO/319-647--------------------------------ALVGIAPEDIVWSNL.DLSMYTRRGKKTISNTI---------------
Q2H2M5_CHAGB/343-667--------------------------------KYVGIRPGEVIWKSL.AIPWWQKVIRRYAVLGF---------------
Q4PBK2_USTMA/367-698--------------------------------RYVEAHPDDVVWANM.NMNPYERKIRTVVGWAI---------------
Q6CQA3_KLULA/381-702--------------------------------TRLAPAPHDINWDNI.SLSRRERLFKVYSVTVF---------------
Q55IG1_CRYNB/356-687--------------------------------LQLAPMPHDIVWENI.SKEPAELGSKNTFGFII---------------
Q2GZW7_CHAGB/335-670--------------------------------IKLAPKPNDIIWDNM.PLNSSTRSSRRLWNNLW---------------
Q5BGH8_EMENI/1921-2251--------------------------------ARLAPAPADVIWKNT.YLPRARRMFQSWSITVL---------------
Q94II2_ARATH/227-551--------------------------------VTEAPEPRQLLWQNL.NIKLFSRIIRQYFIYFF---------------
Q6CJU8_KLULA/487-816--------------------------------KALGINPTDIIWCNIQTINRPWALLRVAISNFL---------------
Q8SV30_ENCCU/436-763--------------------------------TEDAPAPNDVIWENI.TNSEVENYMYSIFGTVF---------------
A0JP96_XENTR/352-691--------------------------------VHYAPAPSDIIWENL.AVSGALWWFRFLALNLL---------------
Q5JKX1_ORYSJ/300-617--------------------------------TTYAPEPPDALWTNL.AIPFCRIAIYKLGVFIA---------------
TM63C_MOUSE/341-680--------------------------------VAHAPHPKDIIWKHL.SIRRFSWWTRFIAINTF---------------
Q6AU79_ORYSJ/320-643--------------------------------TEWAPEPRDVFWPNL.AIPFVELSVRRLIMAVA---------------
Q757I3_ASHGO/332-658--------------------------------CIIGCAPDDVNWDSL.SMSKSVRRSKRLVGNSI---------------
Q7RWN3_NEUCR/470-795--------------------------------RYIGVRPEQVIWSSL.RIRWWEQIMRQFLMLAL---------------
Q6CA07_YARLI/344-669--------------------------------RLIETDHRDVIWANM.RGSFYEEKVRFAIATAL---------------
Q55T89_CRYNB/445-776--------------------------------TTPAPEPRDIVWQHV.SMSIRESQIRDFIVMGI---------------
Q2HEX8_CHAGB/384-711--------------------------------TKPAPAPSDVVWKNT.YATRFSRRARSWTVTTF---------------
Q9M1H6_ARATH/298-615--------------------------------TEMAPEPRDVSWRNL.AIPQKILPLNKIGVILA---------------
A1CS74_ASPCL/381-711--------------------------------ARLAPSPADVVWKNT.YVPRSRRMMQSWFITGV---------------
Q4P987_USTMA/583-906--------------------------------TSMAQEPRDIIWSNI.DLSNNDRRVRQVLVSIF---------------
O65460_ARATH/249-572--------------------------------TEWAPEPRDVFWSNL.AIPYVSLTVRRLIMHVA---------------
YGV8_SCHPO/320-656--------------------------------VSMAPEPSDFLWDNL.SLAWSTRLFNRMIGNIL---------------
Q59MD1_CANAL/360-689--------------------------------ASLAPAPKDIIWENL.KLTYFERKIKSYFITLV---------------
Q6C0S9_YARLI/412-736--------------------------------AKLAPAPHDIIWKNI.YMSTMKREVRTYAVTIA---------------
RSN1_YEAST/335-660--------------------------------VYIGIEPSDVVWFNL.RMFWWERLGREVSAVSA---------------
Q6C266_YARLI/333-657--------------------------------RYTGISPDEVIWSNL.RVKWWERVTKAMVVKAF---------------
Q75GI5_ORYSJ/304-621--------------------------------TDFAPEPRDVYWSNL.WIPYRQIWLRKIATLAA---------------
Q59TM5_CANAL/389-717--------------------------------TTIEINPNDIIWRNVCRNDGIACKFEKYLVTIA---------------
Q7SAG4_NEUCR/349-673--------------------------------KYIGIRPNEIVWKSL.AIPWWQRVIRRYAVYAF---------------
Q2H842_CHAGB/434-758--------------------------------CYIGLQPDEIIWSTL.RIRWWEHIMRRFFMMGV---------------
Q5APG0_CANAL/320-645--------------------------------RFIGLEPKDIIHSNL.RMFWWERITRRFLAFAA---------------
Q54RR3_DICDI/361-689--------------------------------VTPAPEIKNIKWKNM.IVPNRSRFLRRIVSSII---------------
Q6FSA1_CANGA/317-642--------------------------------AYVGIEPKNVVWFNL.RLFWWERMVRELGSVGA---------------
Q6ZLQ0_ORYSJ/321-643--------------------------------VEQAPEPRQIIWSNL.SKKIYERQIRQVVVYTI---------------
Q75FA6_ASHGO/525-853--------------------------------KILGIKPEDIHWKNITLTNRLVLMSRVALSNFL---------------

PF07810

TMC3_HUMAN/499-614------------------------------------------CWETY---------------------------------
TMC4_HUMAN/475-585------------------------------------------CWETV---------------------------------
Q29CY9_DROPS/1115-1230------------------------------------------CWETS---------------------------------
Q571H8_MOUSE/303-413------------------------------------------CWENS---------------------------------
Q5YCC6_CHICK/187-293------------------------------------------CWETC---------------------------------
Q6GPL8_XENLA/460-566------------------------------------------CWETF---------------------------------
Q16VL2_AEDAE/432-538------------------------------------------CWETS---------------------------------
Q7T1T6_TAKRU/445-555------------------------------------------CWETR---------------------------------
Q7Z015_ANOGA/481-596------------------------------------------CWETM---------------------------------
Q7Z014_ANOGA/399-515------------------------------------------CWETA---------------------------------
Q6NUU5_DANRE/502-612------------------------------------------CWETH---------------------------------
Q7Z013_ANOGA/385-495------------------------------------------CWETF---------------------------------
TMC7_HUMAN/486-597------------------------------------------CWETQ---------------------------------
Q4T0I6_TETNG/432-547------------------------------------------CWETA---------------------------------
TMC7_CHICK/480-590------------------------------------------CWESA---------------------------------
Q7T1U0_TAKRU/540-646------------------------------------------CWESY---------------------------------
Q0VCU9_BOVIN/548-654------------------------------------------CWENF---------------------------------
Q3MI88_HUMAN/482-597------------------------------------------CWETM---------------------------------
Q7T1T9_TAKRU/475-577------------------------------------------CWESF---------------------------------
TMC5_RAT/683-789------------------------------------------CWETL---------------------------------
A7RLV1_NEMVE/180-290------------------------------------------CWENA---------------------------------
Q7T1T8_TAKRU/369-471------------------------------------------CWESM---------------------------------
Q4S012_TETNG/224-335------------------------------------------CRENR---------------------------------
A7SUG1_NEMVE/384-492------------------------------------------CWEDE---------------------------------
A2BFV3_DANRE/430-545------------------------------------------CWETM---------------------------------
Q4S7Q9_TETNG/466-576------------------------------------------CWETR---------------------------------

PF04547

CACLC_ARATH/188-630.....GPSQG....YRFLGMEWSSLPFP...............KELIKNLGNERAKE..................KE..A
ANO2_HUMAN/352-944.EERAQEHSR....PEYETKVREKMLKESN...........QSAVQKLETNTTECGD..................ED..D
ANO9_HUMAN/179-740....EEQ............EEM............................ALQLINC..................PD..Y
Q9VYS8_DROME/350-933...HHVEHPR....PQYLARIS............................RTKKLAGKAYEQD......HTGKRTIL..D
ANO6_HUMAN/287-872....QEEQAR....PEYEA.RCT.........................HVVINEITQ..................EE..E
A5DIJ8_PICGU/65-553....LVEEHK....EELARLNK............................NYEEKSS..................YK..H
A0CKQ3_PARTE/818-1263....QQEPQR....VMYTGLYT.............................VEPCKN......................K
Q6NUA4_XENLA/167-596...RQFEEPR....PGFHG.VL............................GINPVTG..................RK..E
Q16MH2_AEDAE/199-778..LAEPP..R....PQYLSRLKDS.......................KKTIFNIITG..................TQ..E
Q2UDH7_ASPOR/180-663....VLREKR....REFKPERE............................IRDETTG..................EI..R
Q2U154_ASPOR/174-639....ALKVNR....PQYVWDKE............................VRDSVTG..................ET..V
A0DD09_PARTE/537-1000....EQRRTI....PQYKGAFI.............................IEDVTH..................TI..E
Q4SPC5_TETNG/131-466...ERFAEPR....PGFQG.DI............................GVNPVTG..................RV..E
YNG5_SCHPO/170-627....SLAKSM....TEFKPQSY............................RVDSLLG..................TA..R
A6RD03_AJECN/171-655....EIHTKR....REFKYLSK............................SIDPATG..................EE..S
A0CE73_PARTE/768-1287..SGEQAQQR....SDFVGNYER.........................SIENDNLN.......................T
A7S3G0_NEMVE/17-561....EQEPNR....PQFYGTKI.........................................................K
A7RKU7_NEMVE/244-824..EEEQI..R....PEFAA.TAP.........................TLKKNIITG..................KL..E
Q86P24_DROME/304-882..HEEHP..R....PQYLARLEHI.......................PPTRVDYVTN..................IK..E
ANO3_MOUSE/384-951..EEETL..R....PQFEAKYYR.........................MEVINPITG..................KP..E
A7REV0_NEMVE/214-763..EAERP..R....PTFAA.LAP.........................TVERNPVTG..................IL..E
ANO10_DANRE/200-629...KAFEEPR....AGFHG.PL............................GLNPVTG..................RE..E
ANO8_HUMAN/237-880..GEAVEEPR....PQFRG.VR............................RISPITR..................AE..E
ANO10_MOUSE/200-629...RQFEEPR....PGFHG.VL............................GINSVTG..................RE..E
A1D9V1_NEOFI/173-637....TLKVNR....PQYVWDKE............................VKDPITG..................ET..V
A4HVK2_LEIIN/428-971....GKDVLR....HDFRGTPG.............................TDPVTG..................EP..Q
A4H763_LEIBR/371-928....EEDELK....HDSRGTPG.............................ANSLTG..................ES..Q
Q6DDQ3_XENLA/273-852..EQQQLQLR....PEYEA.KCT.........................DKKKNPVTQ..................EM..E
A0DPP4_PARTE/705-1145....EIQVQR....SNFIGKHRR.........................SVENDQMN.......................N
A0CIB0_PARTE/859-1305....QVAAER....PAFQGKFIR.........................SITSDALN.......................E
Q24E70_TETTS/215-696....QLKKTQ....KMLVSQEEASL......................FIPKIDYVTG..................QK..D
A0DHW5_PARTE/686-1116....QEKLIL....MSFKGQYIR.........................SVENDELN.......................S
A3LWT2_PICST/162-656....LVDEHN....AELAQINK............................SFESKSS..................YS..H
A0CMD7_PARTE/544-1006....EQRRTI....PQYKGSFI.............................IEDVTH..................TI..E
ANO4_BOVIN/304-887..EEEEI..R....PQFEAKYSK.........................KERMNPISG..................KP..E
ANO5_HUMAN/292-870..EQQQLQLR....PEFEA.MCK.........................HRKLNAVTK..................EM..E
A0D751_PARTE/565-1028....EEKQTI....PSFKGQFW.............................IEDVTH..................KI..E
Q8JFT1_DANRE/232-825..EQQQLQIR....PEYEQ.KCT.........................GRRLNRITQ..................EM..E
Q1AP35_STRPU/306-885..QEENI..R....PEFEA.KAP.........................DRRVSPITN..................LT..E
Q17BF8_AEDAE/268-729..PELLEPPR....PLYKG.PL............................EESPVTG..................RL..E
A0CZD5_PARTE/224-675....QQHIKRLDLNPEYKGNPK.............................MNYITGL................I....K
Q4SBN7_TETNG/194-870..AESLEEPR....PQFRG.VK............................RCSPITG..................CE..E
A7RKU9_NEMVE/227-807..QEEQP..R....PEFIV.TVT.........................TLKKDKASQ..................WGGMV
A0EDB1_PARTE/707-1149....TGEALR....PAFQGDFLR.........................SITDDDLN.......................E
Q7S8J4_NEUCR/182-650....RIQHPR....PQFQFERE............................AQDPVTG..................EI..V
A7STD6_NEMVE/128-561...IEVEEPR....PNYWG.PL............................RISPITG..................HQ..E
Q55GA1_DICDI/227-693....DDEEQL....PSFKPGNFSEGVYHKGIFL......KSKHFGKKVKYVQKNITT......................R
A0DK82_PARTE/835-1351..QAESSYYEGPLKDKFSGDEE.............................IHFITR..................KL..T
A0D675_PARTE/863-1384..QAESSYYEGPLKDKFSGDEE.............................INNITK..................RL..T
A5DTZ8_LODEL/154-649....EIEDHL....AELAQINK............................NFEKKSS..................YT..H
Q234J3_TETTS/795-1263....QSEQER....PSFKGYFKR.........................SIANDQIN.......................Y
A0EHC2_PARTE/551-1015....EQKKKI....QSFQGQFW.............................IDDVTH..................KI..E
Q16TH0_AEDAE/334-773....NLDEPR....VGYYG.KL............................GRDPVTG..................KV..T
Q233Y7_TETTS/365-837....IYKEDR...NVNFKGQKR...........................IKVTTMCE......................E
A0CY40_PARTE/679-1119....KESIIR....SSFKGQNVR.........................SIESDELN.......................S
Q4T7R8_TETNG/234-891..PESLEEPR....PQFRG.VK............................RCSPITG..................RE..E
Q4SUU1_TETNG/210-658...KAFEEPR....PGFHG.VL............................GLNPVTG..................RQ..E
A0BSX3_PARTE/784-1228....ADEAER....PAFEGDFIR.........................SVLNDDLN.......................E
ANO1_HUMAN/320-928EAVKDHP..R....AEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAG..................VKLTD
Q4P618_USTMA/365-904....QVDRRR....HDFVARTT............................RIDPATD..................EP..E
Q29GT2_DROPS/198-624....SLDKPR....SAYQG.QL............................KPDPITG..................KM..T
A1C9M0_ASPCL/169-650....AVQEKR....REFAPERQ............................VVDESTG..................EV..C
Q0IEX5_AEDAE/469-1043..EE...DTR....PEFET.SVK.........................TFRTNPVTR..................EK..E
Q59PV1_CANAL/157-651....LIEEHN....SELAKVNE............................RYEEKST..................YF..H
A0DPK7_PARTE/690-1130....EIQKQR....SNFIGSYKR.........................SVENDYMN.......................S
Q4SSV5_TETNG/402-1010..DEEHP..R....PKYETILLQKRQRKQTKK.......KHKKKTEPEKQEDGTVTGKDRWRQKLLSAMGAGLPAAV..E
A0BM99_PARTE/778-1230....QTQPQR....VMYTGQYI.............................INEATN......................K
Q22HF6_TETTS/2687-3155....EDEAER....PEFIGVYQR.........................SIVNDKIN.......................E
ANO7_MOUSE/277-825..IEERP..R....PQFAA.TAP.........................MTALNPITG..................ED..E
Q5BAF3_EMENI/273-754....VVRSKR....REFKPERE............................VYDQVTG..................ET..R
Q8I4C3_CAEEL/218-758..DSYLQDPR....PAFQGDYL............................APNPVSG..................RL..E
A0DMZ8_PARTE/532-1006..NQQELTTR....LEFQGDEY.............................MNHITH..................QI..E
A7F670_SCLS1/199-673....KIQRKR....VDFKPDSE............................ITDPITG..................EQ..I
A0D6S4_PARTE/669-1110....QQQVQR....SKFKGKHIR.........................SLVNDQLN.......................S
A0CHM6_PARTE/689-1129....KESIIR....SSFKGQNIR.........................SIENDQLN.......................S
Q0CVZ6_ASPTN/174-638....VLKVNR....PEYVWDKE............................VRDPITG..................EV..V
Q4REV7_TETNG/320-956DAGGTHLIKK...LTEIVSQRVQPEKGSPAAKAC....KQHTRLRAAAAIITNVWRDIFSVLFTLILFASSPLSDILTEE
A7RKU8_NEMVE/172-744..EEETI..R....PEFAA.TAP.........................RLKKNPVTG..................LQ..E
A7REU8_NEMVE/125-679..EEERP..R....PTFAA.LAP.........................AVERNPITG..................LL..E
A0DBP1_PARTE/583-1035....LNQVEL....IGFVGKPKR.........................SIANDKLN.......................D
A0BSX4_PARTE/787-1230....EDEAER....PAFQGKYIR.........................SITNDDLN.......................E
A0DMG8_PARTE/258-772LSLLKCLKHK....KHFAIQESVKKI....................IYSNEMDPVT.......................G
Q175J3_AEDAE/362-937..HEEHP..R....PQYLARLAHV.......................RRKKINAVTN..................TE..E
A0E006_PARTE/685-1125....KESFTR....TAFKGKHIR.........................SVGNDQLN.......................S
A0BM92_PARTE/792-1345..GEDTTQQR....SQFYGYYSR.........................SIETDNLN.......................V
A0EAT8_PARTE/668-1109....QQQVQR....SKFKGKHIR.........................SLVNDQLN.......................S
A7SBX8_NEMVE/221-663..SEALKDPR....PLFRG.EF............................KPSEITG..................QM..E
A0C896_PARTE/868-1320..GNEQQEQR....PAFQGEYRR.........................DPCNDEAN.......................T
Q5AX15_EMENI/167-626....VLKVTR....NKYVWDKE............................VRDPITG..................EM..V
Q4SV37_TETNG/23-638EVSVTQSKAKQHLKPCSVSAGEK.........................TTKNHRWETYFPINSRDALNFPHKTFSTDALN
Q16MH3_AEDAE/340-935..QVEPP..R....PQYLARLLERNSKITNSASMN.GVDEQTVKADCAKTVLNTYTG..................KK..E
Q6CB66_YARLI/1924-2410....AVGERR.....AFIAEGA............................KIDMISD..................IK..R
A0DAH3_PARTE/688-1129....EKSTER....SSFKGTFIR.........................SLENDQLN.......................S
Q4S1F6_TETNG/540-1136..EQQQLQLR....PEYET.KCS.........................KRKLNRITQVSVCLGNIGTIVCVRRSVHL..E
Q2H0D1_CHAGB/191-672....RIQLPR....SQFKFERE............................GIDSVTG..................EV..V
A0C1K4_PARTE/730-1174...EGGEIER....PAFEGDFVR.........................SLITDQLN.......................E
A7RJQ8_NEMVE/222-776..ELEPA..R....PQFVE.AVK.........................ERRPNPITG..................IL..E
Q23AS7_TETTS/863-1350.PDILNKTLK....EDFIGDEC.............................ISTVTG..................GL..T
A2R347_ASPNC/170-649....AVRPKR....REFQPERE............................VQDESTG..................EV..R
A0C5J6_PARTE/679-1109....KYNLIR....SSFKGEQIR.........................SISTDQLN.......................F
Q0CNB9_ASPTN/169-648....FLRPKR....REFQPEME............................VRDEDTG..................EI..R
Q08BD4_DANRE/215-664...EQFQEPR....PGFHG.EI............................GTNPVTG..................RL..E

PF02714

YAB9_SCHPO/387-708--------------------------------------------------------------------------------
Q756H9_ASHGO/339-665--------------------------------------------------------------------------------
Q0V7D2_PHANO/253-586--------------------------------------------------------------------------------
Q6BLR7_DEBHA/320-645--------------------------------------------------------------------------------
Q0P5M3_BOVIN/53-397--------------------------------------------------------------------------------
Q28ZW6_DROPS/345-661--------------------------------------------------------------------------------
Q0UCF6_PHANO/629-953--------------------------------------------------------------------------------
Q6BHX0_DEBHA/347-676--------------------------------------------------------------------------------
Q0V4S6_PHANO/338-663--------------------------------------------------------------------------------
Q6BI49_DEBHA/417-734--------------------------------------------------------------------------------
Q6BHN0_DEBHA/405-733--------------------------------------------------------------------------------
Q0UJ62_PHANO/323-659--------------------------------------------------------------------------------
TM63A_HUMAN/350-693--------------------------------------------------------------------------------
Q7S914_NEUCR/334-669--------------------------------------------------------------------------------
Q2QLP9_ORYSJ/304-621--------------------------------------------------------------------------------
Q5JLH8_ORYSJ/319-642--------------------------------------------------------------------------------
Q7SFU1_NEUCR/389-716--------------------------------------------------------------------------------
Q5B9A0_EMENI/329-664--------------------------------------------------------------------------------
A1CSW7_ASPCL/614-938--------------------------------------------------------------------------------
Q4RLY6_TETNG/333-656--------------------------------------------------------------------------------
Q9SY14_ARATH/320-643--------------------------------------------------------------------------------
Q75JX3_DICDI/409-732--------------------------------------------------------------------------------
Q55HL4_CRYNB/375-703--------------------------------------------------------------------------------
SPO75_YEAST/420-748--------------------------------------------------------------------------------
Q5KMP4_CRYNJ/407-736--------------------------------------------------------------------------------
Q6FVT6_CANGA/437-765--------------------------------------------------------------------------------
Q6CTP0_KLULA/338-664--------------------------------------------------------------------------------
Q9C792_ARATH/233-550--------------------------------------------------------------------------------
Q5A2N5_CANAL/333-659--------------------------------------------------------------------------------
Q2TX45_ASPOR/301-610--------------------------------------------------------------------------------
O15741_DICDI/138-463--------------------------------------------------------------------------------
Q4P7M9_USTMA/339-676--------------------------------------------------------------------------------
Q0CNN2_ASPTN/330-664--------------------------------------------------------------------------------
Q55X91_CRYNB/416-752--------------------------------------------------------------------------------
Q5ANH1_CANAL/429-746--------------------------------------------------------------------------------
Q6FQA3_CANGA/332-658--------------------------------------------------------------------------------
Q0UR74_PHANO/337-666--------------------------------------------------------------------------------
A1C5G9_ASPCL/369-694--------------------------------------------------------------------------------
Q7SA72_NEUCR/715-1042--------------------------------------------------------------------------------
Q16T32_AEDAE/332-653--------------------------------------------------------------------------------
Q6CNN9_KLULA/328-653--------------------------------------------------------------------------------
PHM7_YEAST/330-656--------------------------------------------------------------------------------
Q9FVQ5_ARATH/322-645--------------------------------------------------------------------------------
Q29VG6_PICAN/391-712--------------------------------------------------------------------------------
Q2QN15_ORYSJ/290-606--------------------------------------------------------------------------------
YA7D_SCHPO/319-647--------------------------------------------------------------------------------
Q2H2M5_CHAGB/343-667--------------------------------------------------------------------------------
Q4PBK2_USTMA/367-698--------------------------------------------------------------------------------
Q6CQA3_KLULA/381-702--------------------------------------------------------------------------------
Q55IG1_CRYNB/356-687--------------------------------------------------------------------------------
Q2GZW7_CHAGB/335-670--------------------------------------------------------------------------------
Q5BGH8_EMENI/1921-2251--------------------------------------------------------------------------------
Q94II2_ARATH/227-551--------------------------------------------------------------------------------
Q6CJU8_KLULA/487-816--------------------------------------------------------------------------------
Q8SV30_ENCCU/436-763--------------------------------------------------------------------------------
A0JP96_XENTR/352-691--------------------------------------------------------------------------------
Q5JKX1_ORYSJ/300-617--------------------------------------------------------------------------------
TM63C_MOUSE/341-680--------------------------------------------------------------------------------
Q6AU79_ORYSJ/320-643--------------------------------------------------------------------------------
Q757I3_ASHGO/332-658--------------------------------------------------------------------------------
Q7RWN3_NEUCR/470-795--------------------------------------------------------------------------------
Q6CA07_YARLI/344-669--------------------------------------------------------------------------------
Q55T89_CRYNB/445-776--------------------------------------------------------------------------------
Q2HEX8_CHAGB/384-711--------------------------------------------------------------------------------
Q9M1H6_ARATH/298-615--------------------------------------------------------------------------------
A1CS74_ASPCL/381-711--------------------------------------------------------------------------------
Q4P987_USTMA/583-906--------------------------------------------------------------------------------
O65460_ARATH/249-572--------------------------------------------------------------------------------
YGV8_SCHPO/320-656--------------------------------------------------------------------------------
Q59MD1_CANAL/360-689--------------------------------------------------------------------------------
Q6C0S9_YARLI/412-736--------------------------------------------------------------------------------
RSN1_YEAST/335-660--------------------------------------------------------------------------------
Q6C266_YARLI/333-657--------------------------------------------------------------------------------
Q75GI5_ORYSJ/304-621--------------------------------------------------------------------------------
Q59TM5_CANAL/389-717--------------------------------------------------------------------------------
Q7SAG4_NEUCR/349-673--------------------------------------------------------------------------------
Q2H842_CHAGB/434-758--------------------------------------------------------------------------------
Q5APG0_CANAL/320-645--------------------------------------------------------------------------------
Q54RR3_DICDI/361-689--------------------------------------------------------------------------------
Q6FSA1_CANGA/317-642--------------------------------------------------------------------------------
Q6ZLQ0_ORYSJ/321-643--------------------------------------------------------------------------------
Q75FA6_ASHGO/525-853--------------------------------------------------------------------------------

PF07810

TMC3_HUMAN/499-614--------------------------------------------------------------------------------
TMC4_HUMAN/475-585--------------------------------------------------------------------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------------------------------------
Q571H8_MOUSE/303-413--------------------------------------------------------------------------------
Q5YCC6_CHICK/187-293--------------------------------------------------------------------------------
Q6GPL8_XENLA/460-566--------------------------------------------------------------------------------
Q16VL2_AEDAE/432-538--------------------------------------------------------------------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------------------------------------
Q7Z015_ANOGA/481-596--------------------------------------------------------------------------------
Q7Z014_ANOGA/399-515--------------------------------------------------------------------------------
Q6NUU5_DANRE/502-612--------------------------------------------------------------------------------
Q7Z013_ANOGA/385-495--------------------------------------------------------------------------------
TMC7_HUMAN/486-597--------------------------------------------------------------------------------
Q4T0I6_TETNG/432-547--------------------------------------------------------------------------------
TMC7_CHICK/480-590--------------------------------------------------------------------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------------------------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------------------------------------
Q3MI88_HUMAN/482-597--------------------------------------------------------------------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------------------------------------
TMC5_RAT/683-789--------------------------------------------------------------------------------
A7RLV1_NEMVE/180-290--------------------------------------------------------------------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------------------------------------
Q4S012_TETNG/224-335--------------------------------------------------------------------------------
A7SUG1_NEMVE/384-492--------------------------------------------------------------------------------
A2BFV3_DANRE/430-545--------------------------------------------------------------------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------------------------------------

PF04547

CACLC_ARATH/188-630Y.QRYEWF...AYRKRFRNDVLVIMS-IICLQLPFELAYAH............................IFEIIT.....
ANO2_HUMAN/352-944E.DKLTWK...DRFPGYLMNFASILF-MIALTFSIVFGVIV............................YRITTAAALSL
ANO9_HUMAN/179-740K.LRPYQH...SYLRS.TVILVLTLL-MICLMIGMAHVLVV............................YRVLASALFSS
Q9VYS8_DROME/350-933P.DVPFWS...FKFLPNFTSYSIMVL-FICISVIAIAGIII............................YRMAQRASHSI
ANO6_HUMAN/287-872RIPFTAWG...KCIRI.TLCASAVFF-WILLIIASVIGIIV............................YRLSVFIVFSA
A5DIJ8_PICGU/65-553K.GNGEAF...LYLKE.LGFIPIALG-FTIVLVSYQLLCFV............................LEIFLTEIYDG
A0CKQ3_PARTE/818-1263VEVYDSFT...TFKRRLIAEFSVIML-GFSIILVSFLAFNQ............................WQGQQD.....
Q6NUA4_XENLA/167-596P.IYSSFK...RQLRIYLVSVPFVCV-CLYLASYVMMIYFD............................LEHWALAYHQE
Q16MH2_AEDAE/199-778P.SPPFWT...KKLPSFLYSYSVIFL-FITLAIAAVFGIVI............................YRMSLMTSRNI
Q2UDH7_ASPOR/180-663G.VYPATK...RLQTQ.LLQVPFALV-AAVALGVIIATCFA............................IEIFISEIYNG
Q2U154_ASPOR/174-639R.VFPAHK...QFLRQ.LLLLPFASI-AGLALGSLIVVTFA............................MEILISEVYTG
A0DD09_PARTE/537-1000I..MDTRN...VQWKYFKSNFPLVLI-AIIFIGGEQFGYYY............................LKQINE.....
Q4SPC5_TETNG/131-466P.LFPGMA...ERPDH..........-.....................................................
YNG5_SCHPO/170-627P.YYPQWE...IIVRSTIANVPLFLI-SGCILLFLIAIAFI............................VDVTLSEVYSG
A6RD03_AJECN/171-655F.VFPSTT...RLGRQ.LLQAPFAIA-AVLALGTLIATCFA............................IEIFISEVYTG
A0CE73_PARTE/768-1287L.NYSDLK...KFMRI.LLTLLIQIG-ILGVYVGIVIGIFY............................FSEKLQTTKEI
A7S3G0_NEMVE/17-561P.........................-.VCLVLASLVGVII............................YRIIARVDFFA
A7RKU7_NEMVE/244-824P.HIPRRT...LYQRY.GAIGSVVAF-MILLVIAAVIGVVV............................YRAAVFAALSG
Q86P24_DROME/304-882P.TAPFWR...MKLPATVFSFSVVLL-LIALAFVALLAVVV............................YRMSMLAALKV
ANO3_MOUSE/384-951P.HQPSSD...KVTRL.LVSVSGIFF-MISLVITAVFAVVV............................YRLVVMEQFAS
A7REV0_NEMVE/214-763P.HFPDEK...RKPRL.FSGIAIVFT-MVSLVLVFMVGVIV............................YKLLVYRPLAR
ANO10_DANRE/200-629P.IYPSSK...RHLRIYLVSVPFVLL-CLYLSFYVMMVYFD............................MEFWAISIYHE
ANO8_HUMAN/237-880F.YYPPWK...RLLFQLLVSLPLCLA-CLVCVFLLMLGCFQ............................LQELVLSVKG.
ANO10_MOUSE/200-629P.LYSSYK...RQLRIYLVSLPFVCL-CLYFSLYVMMIYFD............................MEDWALSLHED
A1D9V1_NEOFI/173-637R.VFSMRK...QLLRQ.LLLIPFATV-AAVALGSLIVVTFA............................LEVFISEVYVG
A4HVK2_LEIIN/428-971L.CYPACY...RLTAAQSLTWGIVAL-FMGGTLGLMVCSLN............................LDGMVTDPASR
A4H763_LEIBR/371-928L.CHPTKY...QAMLPQSLTWGVVAL-FMAGSLGLMVCSLN............................LDGMVSDPASR
Q6DDQ3_XENLA/273-852P.YLPPSS...KAVRF.CFSGATVLF-WISLIIASIIAIIV............................YRLWVYAAFAS
A0DPP4_PARTE/705-1145V.GINELE...LYSRM.VLATLILML-LILLYCGIVICLYI............................LTIALKLKMQE
A0CIB0_PARTE/859-1305R.FYSPFK...RQITK.LCAFGVSLL-IIGMVVGCVIAIFI............................FKNKMIEEDQ.
Q24E70_TETTS/215-696L.HFPFKR...RLVRY.IVGGIKLLP-FITAAILFLIVSLN............................IRGYVDPDHEF
A0DHW5_PARTE/686-1116L.GSSQAQ...IISKL.IISIFILIL-LIGSDFGVIIAKFN...........................EFNNKFYN....
A3LWT2_PICST/162-656K.DNSDAY...RFIRQ.MLFIPVAAI-FAAVLVSYQLLCFT............................IEIFLTDVYDG
A0CMD7_PARTE/544-1006I..MDTRN...VQWKYFKSNTPLVLL-ALVFIAGQQTGYYY............................LKQVYE.....
ANO4_BOVIN/304-887P.YQAFAD...KCSRL.IVSASGIFF-MICVVIAAVFGIVI............................YRVVTVSTFAA
ANO5_HUMAN/292-870P.YMPLYT...RIPWY.FLSGATVTL-WMSLVVTSMVAVIV............................YRLSVFATFAS
A0D751_PARTE/565-1028I.KYSTRD....RWKYYKSVTPLVLL-AVILIAGEQIGYYY............................IIQLKE.....
Q8JFT1_DANRE/232-825P.YLPFPS...KCARF.CLSGATVLF-WTCLIVACIMGVIA............................YRLAVYAAFAS
Q1AP35_STRPU/306-885P.YMKFSR...KFPRF.SASIASIFF-MILLVMAAVMTVIV............................YRIVVKTAIFA
Q17BF8_AEDAE/268-729PREAPAWQ...RRAFRYLVSFPIIGL-CLVLVFVVMFLMLR............................LQDWWDEKLPE
A0CZD5_PARTE/224-675N.SYPTSS...RIFYY.MISLFEAIP-ILIIAGLIKIVVFN............................INGLIRNEDSI
Q4SBN7_TETNG/194-870F.YYPPWK...RALFRWLVSLPVCLL-CLCFVFLAMLLCLE............................LQEVVMEIQE.
A7RKU9_NEMVE/227-807P.HVPKLQ...QYRKL.AGVVSLVAF-MIALVLSAVVGVVI............................YRASVYGSLMA
A0EDB1_PARTE/707-1149Q.FYPPIK...RKITQ.LFGLAVSFL-IILCVIGCVLGIFF............................FKNYMIETKA.
Q7S8J4_NEUCR/182-650R.VYSPFK...RLARQ.LLQIPFALA-CVVVLGGLIVSCFS............................IEVFITEIYTG
A7STD6_NEMVE/128-561Q.YYSPLK...RKLKTYGISYPIVLL-CMKVATVVMLLYFK............................LQFYMEEKYGK
Q55GA1_DICDI/227-693P.YLTSYQQKMKLLKT.IGTFSVVVT-LVLIVPIFTISIFT............................LRIALESIE..
A0DK82_PARTE/835-1351K.HQQITK...MAVYF.ILFIFLLAV-FLFCSFAIVYGIDL............................LKQELI.....
A0D675_PARTE/863-1384K.HQQITK...LAVYF.VIFLILLAV-FLLGSFGIVYGIDL............................LRKEVQ.....
A5DTZ8_LODEL/154-649K.SNNGGY...RFVKE.LLFIPIALV-FVAVLISYQLGCFF............................IEIFLTDIYDG
Q234J3_TETTS/795-1263Q.YYNSLK...RKAFF.VFSLILSAL-VICIVIAIIFALFF............................FKAWLLENGYL
A0EHC2_PARTE/551-1015I.QYSKRD....KWKYYKTSFPLVLL-AVIMIAGEQIAYQY............................IISLQN.....
Q16TH0_AEDAE/334-773P.QYPKWK...TYVQMYCVTAPIILF-CISIAGFVTIFQFY............................VESYLAEMFG.
Q233Y7_TETTS/365-837E.YYPRSK...RLYLY.IISTLESLP-LLVMAFLLKVIIFN............................LNGLIHKNSML
A0CY40_PARTE/679-1119I.GVIHSK...FIQRL.VISIFILIF-LIGSDIGRIIGLYF............................FNLYLKSEFID
Q4T7R8_TETNG/234-891F.YYPPWR...RRLFRWLVSLPVCIL-CICFVFLVMLICFELQVSHGDHNQRRVGVPDLSLQKHAQPVTLQEFVMGIKE.
Q4SUU1_TETNG/210-658P.LYPNAK...RQLRIYLVSLPFVLL-CLYLSLYVMMIYFQ............................MEGWAISLHED
A0BSX3_PARTE/784-1228E.FYSPLK...RKMKQ.LLALSISAI-IIGCVIGCVIGINI............................LKNTLIEQKL.
ANO1_HUMAN/320-928K.VKLTWR..DRFPAY.LTNLVSIIF-MIAVTFAIVLGVII............................YRISMAAALAM
Q4P618_USTMA/365-904E.VFEWWR...RELRV.ILSLPIVAF-FASVLAATMTLMFV............................VEIFVTQLYHG
Q29GT2_DROPS/198-624L.HYPMRY...TYLQMYCISYPVVLV-CVVAAGWFALYQFQ............................IEAEVLADFG.
A1C9M0_ASPCL/169-650G.VFPAMK...RMYRQ.LLQVPFALL-AVIALGAIIATCFA............................IEIFISEVYSG
Q0IEX5_AEDAE/469-1043P.YMPTWD...RAIRF.FATSSAVLF-MIAVVLGAVLGTII............................YRISLVSVIYS
Q59PV1_CANAL/157-651A.NNTNGF...RFLKQ.LAFIPIALV-FVGVLISYQLSCFC............................IEIFLTDIYDG
A0DPK7_PARTE/690-1130I.GINSFE...LFTRM.LFATSTLIF-IIGLYAAIMIGLYI............................LTTTLKASFQN
Q4SSV5_TETNG/402-1010K.HDLEMT...DWLDT.CINVSSILF-MFGLTFSAVFGVII............................YRITVSALMAM
A0BM99_PARTE/778-1230IQIYDYFT...TFKRRLIAEGPVILI-GIAIIVVSFYAFNL............................WLRLWK.....
Q22HF6_TETTS/2687-3155K.YFSPVK...RRMIM.LAGMVGSFF-IIFLVVLTMYNIFN............................LRQEWTTNPPA
ANO7_MOUSE/277-825P.YFPEKN...RVRRM.LAGSVVLLM-MVAVVIMCLVSVIL............................YRAVMAIIVSR
Q5BAF3_EMENI/273-754G.VFPATT...RLQRQ.LLQVPFALV-ALVALGAIIATCFA............................IEIFISEVYTG
Q8I4C3_CAEEL/218-758P.FYPAWK...HTVMRYVITYPITFL-CVVGMFAAMLAIFT............................VQDLADFYFGD
A0DMZ8_PARTE/532-1006K.YEQKGH...STIMF.MISIPVLIL-FSSFIVGLFVTIDY............................IQQTYT.....
A7F670_SCLS1/199-673K.FYSPVK...RLSRQ.LLQIPFALC-ATVLLGSLIASCFA............................IEIFISEVYDG
A0D6S4_PARTE/669-1110I.EVLFGE...YLKRT.LISSMLLFI-FILFYIGIIVSLFV............................FTVYLHNKYSE
A0CHM6_PARTE/689-1129I.GVIHSK...FIQRL.IISIFILIF-LIGSDIGIFVGLYY............................FNLYLKTKLDD
Q0CVZ6_ASPTN/174-638Q.VFSPYR...QVMRQ.LLLIPFATV-AALALGTLIVVTFA............................LEVFISEVYTG
Q4REV7_TETNG/320-956E.LRPEYE..EALQEKKIKLKAQMKK-KIFVTFSAVFGVAV............................YRICMLSVWSM
A7RKU8_NEMVE/172-744P.YVPKRT...LYQRY.GTTGSIIVM-MCLLVIAAVVGVVI............................YRAAVFASLSG
A7REU8_NEMVE/125-679P.YFPDEK...RSPRV.LSGIAIICG-MVSLVMLFMVGVIV............................YKLLVIHPLYK
A0DBP1_PARTE/583-1035L.QYSSKE...TWFKF.FFNMILVAI-FLVIEIVIIVALQL............................LSLYLENNPDV
A0BSX4_PARTE/787-1230E.FYSPFL...RKMKQ.LFSLAVSFL-IIGCVIGSVLGIFF............................FKNLMLQQKA.
A0DMG8_PARTE/258-772L.KVQIKQ...NIFSIYLNSIIRIIG-YVIALVVFLIVSLN............................MRGYVDSKQQL
Q175J3_AEDAE/362-937P.QVPYWR...MKLPATILSFSVVLL-LVCLAIVAVLAVVL............................YRMSVLATLSV
A0E006_PARTE/685-1125Q.EAIHSE...IIKRI.IISVSVLIF-LIGSDIGIIIGLYF............................FNLFLKTILDQ
A0BM92_PARTE/792-1345L.FFSDLQ...RVMKK.IVSFAFLFL-MVILYVGIIVSIFI............................ISDALQDVDTF
A0EAT8_PARTE/668-1109I.EVLYHE...YLKRT.LVSSMLLFF-FILFYIGIIVSLFV............................FTVQLHNKYQE
A7SBX8_NEMVE/221-663P.HYPSIK...RNIFRYCVSLPAIIG-SLGVVVISMLCCFE............................FQRWVDMMDN.
A0C896_PARTE/868-1320L.YYPMSK...LLIHM.LKNGLILGF-VFSIYIGSVIGLFY............................MTKFFYEYDIF
Q5AX15_EMENI/167-626Q.VFSPYK...QFLRQ.LLLIPFASV-ASLALGGLIVVTFA............................MEVFISEVYTG
Q4SV37_TETNG/23-638ACHHSVLH...SYLRS.....TVVLI-LVTLMVRSTQLIIQ...........................PIVLIIWVSFKL
Q16MH3_AEDAE/340-935P.APRFWS...TKLPSLLYSYSVILL-FIGLAVAAVFGFVI............................YRMSLLTARHI
Q6CB66_YARLI/1924-2410P.WYSPSK...RVAKE.LAFIPVAFT-LAALLVVGHTIIFA............................FEIYTRQIYHG
A0DAH3_PARTE/688-1129A.AQDDSD...LVLRL.FLASILLVL-LISAYSGLVVGLFT............................LTTALRNSFGS
Q4S1F6_TETNG/540-1136G.CVSAMS...LSCRWCCVS....VL-KISLIIACIIGVIA............................YRLAVFAAFAS
Q2H0D1_CHAGB/191-672K.VYSPFK...RLARQ.LLQGPFALA-CVVVLGGLIVSCFS............................IEIFINEVYNG
A0C1K4_PARTE/730-1174E.FYPTWK...KQFKL.CYSSLITLI-IITMVVASVIGVFI............................LKNYLIEEYPD
A7RJQ8_NEMVE/222-776P.FVPYAK...QLIKQ.TCAFVVVLL-MILLVIAAVVGVIV............................YRAAMSAALHS
Q23AS7_TETTS/863-1350K.YQKKSR...TIIKF.LISMPILFG-LMALVVYIFIAIDD............................FKQKYTSPDST
A2R347_ASPNC/170-649G.VFPATR...RMYRQ.LLIVPFALL-SAVALGVIIATCFA............................IEIFISEIYNG
A0C5J6_PARTE/679-1109T.GIIHFQ...FFWRI.SISIFVLIL-IFGSDVCITIGLYF............................FNLYLESIFAS
Q0CNB9_ASPTN/169-648G.VFPQSK...RIQRQ.LLQIPFTVV-AVIGLGVIIATCFA............................IEIFISEIYNG
Q08BD4_DANRE/215-664P.LFPDWK...RKMRMGLVSVPVVGF-FLGLVILGMAGFYF............................CERLVSSWHKE

PF02714

YAB9_SCHPO/387-708-----------TFMIILLWTVPVGAI.AVFINLDTIRRLWP----------------------------ELGRM..IE..
Q756H9_ASHGO/339-665-----------ITGVIVLWAIPVGAI.GIFPQKIRSAKSDP----------------------------NNKWG..RL..
Q0V7D2_PHANO/253-586-----------IVLFTIAFIVPNILTSVFLSDFSHLGLVWP----------------------------AFQQN..LL..
Q6BLR7_DEBHA/320-645-----------VVLLIIFWAVPVALV.GVISNITYITKVLP----------------------------WLDWI..NN..
Q0P5M3_BOVIN/53-397-----------LFILLFFLTTPAIII.TTMDKFNVTKPVEY----------------------------LNNPI......
Q28ZW6_DROPS/345-661-----------LFLFLFFLTTPVMVV........NLLNSRP----------------------------WLKDT......
Q0UCF6_PHANO/629-953-----------IVALVIFWGIPVSAT.GALSQVNTLTEKVH----------------------------FLRFI..NA..
Q6BHX0_DEBHA/347-676-----------VMLSCVILLFPVSSL.AALINVKTITKLWP----------------------------ALGKF..IA..
Q0V4S6_PHANO/338-663-----------VIATIIFWSIPVSLV.GAVSNIGYLAENFK----------------------------WLAFL..NK..
Q6BI49_DEBHA/417-734-----------IGIFSLILVIPVRYL.AQFLSLKSISKVWP----------------------------SLGKF..LE..
Q6BHN0_DEBHA/405-733-----------FISVILLYVIPVSFI.GLVSQVPLLTKLIP----------------------------SLKWI..YK..
Q0UJ62_PHANO/323-659-----------ISLLTILYFIPNALIAIFLSKLPNLALVWE----------------------------AFSVE..LN..
TM63A_HUMAN/350-693-----------LFLGLFFLTTPSIIL.STMDKFNVTKPIHA----------------------------LNNPI......
Q7S914_NEUCR/334-669-----------ITVLTVVWVAPNAMIAIFLVNLSNLARVWP----------------------------DFQKS..LE..
Q2QLP9_ORYSJ/304-621-----------SIVFMLFFLIPVTFI.QGLSQLEQLQQRLP----------------------------FLKGI......
Q5JLH8_ORYSJ/319-642-----------FFFLNFFYVLPIAFV.QSLANIEGIEKAAP----------------------------FLKPL......
Q7SFU1_NEUCR/389-716-----------VAFLTVVWLVPVAFL.ASFLSICTIEAYFK----------------------------GFAMW..LK..
Q5B9A0_EMENI/329-664-----------VTALTVVWIAPNALIAVFLSNLSNLGSVWP----------------------------AFQTE..LD..
A1CSW7_ASPCL/614-938-----------VCAMVVGWAFPVAFT.GLLSQLSYLENAFT----------------------------WLEWI..SK..
Q4RLY6_TETNG/333-656-----------LFLLLFFLTTPAIIV.NTMDKFNVTRPVES----------------------------LRSPV......
Q9SY14_ARATH/320-643-----------LFFLIFCFMIPIAFV.QSLANLEGIQKVLP----------------------------FLKPV......
Q75JX3_DICDI/409-732-----------TFLLIFFYTIPITFI.SGFSNLGTLAKIKA----------------------------FSWLFTLIN..
Q55HL4_CRYNB/375-703-----------TVGLIIVWAIPVAFV.GMVSNVDTLCANAS----------------------------WLAWI..CE..
SPO75_YEAST/420-748-----------RIFVIIGWILPVAFL.GLISQIPNISSLIP----------------------------FTKII..HF..
Q5KMP4_CRYNJ/407-736-----------TFGLILLWATPVAFI.GALSNVTTLTEKYH----------------------------WLAWINGTS..
Q6FVT6_CANGA/437-765-----------GVLVILGWIVPIAFI.GLVTQIPYLTNLLP----------------------------YSNHF......
Q6CTP0_KLULA/338-664-----------LTLMIIFWAIPVAVV.GCISNINFLTDKVP----------------------------FLRFI..DN..
Q9C792_ARATH/233-550-----------CLLLTILFLVPVVLV.QGLTNLPALEFMFP----------------------------FLSLI......
Q5A2N5_CANAL/333-659-----------LTLLIIFWCIPVAVV.GAISNINVLTDKVP----------------------------FLKFI..LK..
Q2TX45_ASPOR/301-610-----------LNVLAILWAIPISLT.GLLSQLVYLDSIDS----------------------------HLHNL......
O15741_DICDI/138-463-----------TFALVFLWGIPVAFL.SGFSNLETISRVKA----------------------------F.SWITDII..
Q4P7M9_USTMA/339-676-----------LLVLFFMNIFPLIIV.SLLSNMARLTS.IS----------------------------WLRWLKDWQ..
Q0CNN2_ASPTN/330-664-----------VSILTVVWIAPNALIAIFLSNLNNLGLVWP----------------------------AFQTS..LS..
Q55X91_CRYNB/416-752-----------LVIICFVNTIPLMIV.TVLANLGTAIDRWP----------------------------TLAKLEDSS..
Q5ANH1_CANAL/429-746-----------IGIMSLLLVYPVRFM.ASFLNTKSISKIWP----------------------------SLGKA..IE..
Q6FQA3_CANGA/332-658-----------LTAMIIFWAIPVAVV.GCISNVNFLVEKIH----------------------------FLHFL..NN..
Q0UR74_PHANO/337-666-----------ISVMIIFFAVPVAFV.GLVSNINYLQQQFS----------------------------WLRWI..GS..
A1C5G9_ASPCL/369-694-----------IAALIIFWSIPSAAV.GTISNITYLTHLIP----------------------------ILGFI..DK..
Q7SA72_NEUCR/715-1042-----------VTGMLVLWAFPVAWT.ASLAQLDALVEKYS----------------------------WLHWLVENK..
Q16T32_AEDAE/332-653-----------LFLFLFFLTTPVIIV.NQLDTLSLTKNTTS----------------------------QISKI......
Q6CNN9_KLULA/328-653-----------IVALVILWAFPVAFV.GMVSNITYLTNKLP----------------------------WLKFI..YN..
PHM7_YEAST/330-656-----------MVLLIIFWAFPVAVV.GIISNVNFLTDKVP----------------------------FLRFI..NN..
Q9FVQ5_ARATH/322-645-----------VFALVFFYMIPIAFV.QSLANLEGLDRVAP----------------------------FLRPV......
Q29VG6_PICAN/391-712-----------TGIMGVAFIFPVGYL.ATLLNLKTISKFWP----------------------------DLGEL..LE..
Q2QN15_ORYSJ/290-606-----------SILLILVFLLVSAFV.QGLTYMEQLETWLP----------------------------FLRNI......
YA7D_SCHPO/319-647-----------LTLMIIFWAFPVAVV.GCISNVNYLIEKVH----------------------------FLKFI..DH..
Q2H2M5_CHAGB/343-667-----------IAAMILFWAIPVAFV.GIVSNIDFLSS.IS----------------------------FLRWL..NE..
Q4PBK2_USTMA/367-698-----------TIGLIIFWAIPVAFV.GIISNVKGLADNVP----------------------------FLGWL..ND..
Q6CQA3_KLULA/381-702-----------IGICSVFLVIPVSYL.ATLLNLKTISKFWP----------------------------GLGKF..LK..
Q55IG1_CRYNB/356-687-----------IGIVCFFNTLPLLVV.SLLANLSSLTVYVT----------------------------FLADW..KDAG
Q2GZW7_CHAGB/335-670-----------MAVLTILWIAPNAMIAIFLVSLSNLGQVWQ----------------------------AFDVS..LK..
Q5BGH8_EMENI/1921-2251-----------ICFLSVFWSVLLVPV.GTLLKWETLHKVLP----------------------------QLADA..LA..
Q94II2_ARATH/227-551-----------VAVTILFYMIPIAFV.SAITTLKNLQRIIP----------------------------FIKPV......
Q6CJU8_KLULA/487-816-----------NVAIIIGWVVPVAIV.GFVSQIPIITKIVP----------------------------ILTNF..QD..
Q8SV30_ENCCU/436-763-----------FILFIVLFSSMVTSIVTLLVNFEGFKESKL----------------------------ISSFL......
A0JP96_XENTR/352-691-----------LFVLLFFLTTPAVIV.STMDRFNVTYPVEK----------------------------LRNPV......
Q5JKX1_ORYSJ/300-617-----------AFLLIVFFTIPVTAV.QGIVQFEKIKIWFP----------------------------PARAV......
TM63C_MOUSE/341-680-----------LFFLFFFLTTPAIII.NTIDIYNVTRPIEK----------------------------LQSPI......
Q6AU79_ORYSJ/320-643-----------LFFLTFFFMIPIAIV.QSMANLDDIERMLP----------------------------FLKPI......
Q757I3_ASHGO/332-658-----------LTAMIIFWAIPVAVV.GCISNINFLTEKVH----------------------------FLRFI..NN..
Q7RWN3_NEUCR/470-795-----------VVVAIIFWSIPSAAV.GIISNIDFLSEKVP----------------------------FLFWI......
Q6CA07_YARLI/344-669-----------NLALIIGWAIPVSVV.GLISQISYLTQLLP----------------------------FLSFL..ND..
Q55T89_CRYNB/445-776-----------MGVLILTWIVPVSSL.ATLMSYEEIKKIMP----------------------------WLARF..IG..
Q2HEX8_CHAGB/384-711-----------VAILSVVWLVPVAFL.ASVLSICTINKFLP----------------------------AFGDW..LK..
Q9M1H6_ARATH/298-615-----------AALLTIFFAIPVTAV.QGIAKYEKLKKWFP----------------------------PAMAI......
A1CS74_ASPCL/381-711-----------IGFLTVFWSVLLVPV.AYLLELETLHKVFP----------------------------QLAEA..LA..
Q4P987_USTMA/583-906-----------MVAVLVFYIPPLVFL.ASFVSPGAIKKYAP----------------------------WLDRL..LD..
O65460_ARATH/249-572-----------FFFLTFFFIVPIAFV.QSLATIEGIVKAAP----------------------------FLKFI......
YGV8_SCHPO/320-656-----------FIILIIAWIIETALVAIFISNLYHLGSVWP----------------------------WLQQQ..LT..
Q59MD1_CANAL/360-689-----------IVLSYGFIIFLVIPL.TSLLDLKTISKFWP----------------------------ALGEF..IG..
Q6C0S9_YARLI/412-736-----------IGFLTVALVPPVLGV.AKLMDTKTISKSWP----------------------------ALGQL..LK..
RSN1_YEAST/335-660-----------IVALVILWAFPVAFV.GMISNITSLTNEVK----------------------------WLKFI..YK..
Q6C266_YARLI/333-657-----------LTALIVLWAIPVAVV.GSFSNIKSLTGLVP----------------------------FLDFL..NN..
Q75GI5_ORYSJ/304-621-----------SVAFMFVFIVPVAFV.QSMMQLDQIEQLFP----------------------------SLKNM......
Q59TM5_CANAL/389-717-----------FISIIILYVIPVSLI.GLVSQIPLLTQLLP----------------------------FLEWI..YQ..
Q7SAG4_NEUCR/349-673-----------ITAMIIFWAIPVGVV.GIISNVNYLKT.IS----------------------------FLTWL..DD..
Q2H842_CHAGB/434-758-----------IAVAIVFWSIPAALA.GMVTNIKSLSETIF----------------------------FLEWV..ML..
Q5APG0_CANAL/320-645-----------IVALVVFWAIPVAAV.GTISNITFLTNKLP----------------------------WLRWI..LK..
Q54RR3_DICDI/361-689-----------FFVIFCFYTIPVTAI.SAVSNIQTLSK.VP----------------------------VLNWLLEVV..
Q6FSA1_CANGA/317-642-----------IIALVILWAIPVAFV.GMISNITYLTNKLH----------------------------WLRFI..YH..
Q6ZLQ0_ORYSJ/321-643-----------VFLTVVFYMIPITAI.SALTTLEKLREKLP----------------------------FLKVV......
Q75FA6_ASHGO/525-853-----------SVMVIVGWVIPVAFV.GLISQIPFLAKLVP----------------------------LPSWS..AN..

PF07810

TMC3_HUMAN/499-614--------------------------------------------------------------------------------
TMC4_HUMAN/475-585--------------------------------------------------------------------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------------------------------------
Q571H8_MOUSE/303-413--------------------------------------------------------------------------------
Q5YCC6_CHICK/187-293--------------------------------------------------------------------------------
Q6GPL8_XENLA/460-566--------------------------------------------------------------------------------
Q16VL2_AEDAE/432-538--------------------------------------------------------------------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------------------------------------
Q7Z015_ANOGA/481-596--------------------------------------------------------------------------------
Q7Z014_ANOGA/399-515--------------------------------------------------------------------------------
Q6NUU5_DANRE/502-612--------------------------------------------------------------------------------
Q7Z013_ANOGA/385-495--------------------------------------------------------------------------------
TMC7_HUMAN/486-597--------------------------------------------------------------------------------
Q4T0I6_TETNG/432-547--------------------------------------------------------------------------------
TMC7_CHICK/480-590--------------------------------------------------------------------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------------------------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------------------------------------
Q3MI88_HUMAN/482-597--------------------------------------------------------------------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------------------------------------
TMC5_RAT/683-789--------------------------------------------------------------------------------
A7RLV1_NEMVE/180-290--------------------------------------------------------------------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------------------------------------
Q4S012_TETNG/224-335--------------------------------------------------------------------------------
A7SUG1_NEMVE/384-492--------------------------------------------------------------------------------
A2BFV3_DANRE/430-545--------------------------------------------------------------------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------------------------------------

PF04547

CACLC_ARATH/188-630...................SD.IIKYVLTAIYLLIIQYLTRLGGKVSVKLINREINE...........SVEYRANSLIYK
ANO2_HUMAN/352-944NKAT...........RSNVRV.TVTATAVIINLVVILILDEIYGAVAKWLTKIEVPK...........TEQTFEERLILK
ANO9_HUMAN/179-740SAVPF.........LEEQVTT.AVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPR...........TFSERESRFTIR
Q9VYS8_DROME/350-933LGSEN.........SMTFKVM.ILPMTAGIIDLIVISLLDMVYSNLAVKLTNYEYCR...........TQTEYDESLTIK
ANO6_HUMAN/287-872KLPKNINGT.DPIQKYLTPQT.ATSITASIISFIIIMILNTIYEKVAIMITNFELPR...........TQTDYENSLTMK
A5DIJ8_PICGU/65-553PG................VSL.L.ALLPTILISVFVPILTIIYNFVTDKVLIFESHP...........TSYSKNNSVLIK
A0CKQ3_PARTE/818-1263..................PQSVYMPIIINSLNGVSMTVLCDLYKRLCKFVVNWENHK...........YNSEMEHSYVLK
Q6NUA4_XENLA/167-596QQS..............TFSS.LILYVPSIIYAVVIEIMNRIYKIAAELLTSWENHR...........LESSYQNHLVLK
Q16MH2_AEDAE/199-778YGDPD.........AVSTKLL.LLPATAAIINLIVSTILNFAYDYVAVYMTDIEYRR...........TQSEYNESLNLK
Q2UDH7_ASPOR/180-663PL................KTY.L.VFIPTILLSALIPTMSTVLVSVATRLNDYENYE...........TQGAYDVALTQK
Q2U154_ASPOR/174-639PF................KEY.L.EFLPTVLFSLSLPWINDTLTDMATKLTDYENYR...........TQDQYDIAQTTK
A0DD09_PARTE/537-1000..................GEQ.FYDSLWACVLAFSILITNEIFNFFAKHTLNYENHQ...........YQDERENVYILK
Q4SPC5_TETNG/131-466..............................................CCGVSASENHR...........EESSFQNHLTAK
YNG5_SCHPO/170-627PL................KSI.V.SLLPAVVFQVLTLPFTFIYSIVAERLTKLENRR...........TKTDFQASLSGK
A6RD03_AJECN/171-655PF................KSY.L.VFIPTILLSLFVPTISAVLTSIAKRLTDYENYE...........TQDSYDLALTHK
A0CE73_PARTE/768-1287ENLI...........GNGVAQ.LSVTIPALVNLIVILILDPFFDKTAGSLTDYENHK...........TITEYETNFVFK
A7S3G0_NEMVE/17-561KEG.............LLGPT.LASLTSTFLNTCSIMFMGKVYQVLANKLTDWENHR...........TQTSYDDALIIK
A7RKU7_NEMVE/244-824NSDSTIRAR..YAMIAIGSRI.ITSMTAALINLLCINILKLFYNRLAVWLTNWENPR...........TKTDYEDSFTYK
Q86P24_DROME/304-882GASPM.........TTSSAIV.LATASAAFVNLCLLYILNYMYNHLAEYLTELEMWR...........TQTQFDDSLTLK
ANO3_MOUSE/384-951FKWNF.........VKQHWQF.ATSGAAVCINFIIIMLLNLAYEKIAYLLTNLEYPR...........TESEWENSFALK
A7REV0_NEMVE/214-763NPST...........RAYALQ.IANSTGAFVNLTIIMILSRVYERVALALTHWEMHR...........TQTEYEDSLTFK
ANO10_DANRE/200-629NPN..............FATS.VLLFVPSIIYAVVIEIMNLLYRYAAEFLTDWENHR...........LESSFQNHLVPK
ANO8_HUMAN/237-880..................LPR.LARFLPKVMLALLVSVSAEGYKKLAIWLNDMENYR...........LESAYEKHLIIK
ANO10_MOUSE/200-629SGS..............EWTS.LLLYVPSIVYAVVIEIMNRLYRYAAEFLTSWENHR...........LESAYQNHLVLK
A1D9V1_NEOFI/173-637PL................KGY.L.EFLPTVLFSLSLPTITSKLTDIATQLTEYENYR...........TQDQYDLAQTAK
A4HVK2_LEIIN/428-971LAIPFLRRLAVDGGLLDKTAHPIAGMLPPLAYSVCIGALSFIFTDLAKYLTRMENNR...........YRGEYMRSLTLK
A4H763_LEIBR/371-928LAIPSLRRLAADGGLLDKTVHPIAALFPSLVYSVCIAALSFTFKNLAKHRMRIENYR...........DRGEYVRALTLK
Q6DDQ3_XENLA/273-852IMENNLTLE..PVRNLLTPQL.ATSVTASVLNFITIMILNFLYERVAIWITDMEIPR...........THLEYENRLTMK
A0DPP4_PARTE/705-1145DKT.............IRDAT.FEVMVTATINIVIIQFLDRVYNIIATRLTDFENQK...........TVKDYEESFVTK
A0CIB0_PARTE/859-1305..................SAL.LSQTLPGIMMSAQINIFTTVYANVAKIFNFLENHK...........ILQSFENSLVVK
Q24E70_TETTS/215-696LFIKVLYDQSQAGGFFDKSVG.WRKLLATILHVNIFQKLNGFYRAVAEETCKKELHS...........THVKKNNSLVLK
A0DHW5_PARTE/686-1116......................LEIIISSSLNFGIQKLIEQYYEQIATFLTDFENLQ...........ISNQYETSYTIK
A3LWT2_PICST/162-656PG................KSF.L.TLIPTILISVFVPILTIVYNIVSDAAISWENHD...........SVYSRDRSQLIK
A0CMD7_PARTE/544-1006..................DDD.FYQTLWACLLALTVLITNEIFNFFSKHTLIYENHQ...........FQDERENVYILK
ANO4_BOVIN/304-887FKWAL.........IRNNSQV.ATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPR...........TESEWENSFTLK
ANO5_HUMAN/292-870FMESDASLK..QVKSFLTPQI.TTSLTGSCLNFIVILILNFFYEKISAWITKMEIPR...........TYQEYESSLTLK
A0D751_PARTE/565-1028..................RTT.EFTILCSIGLGISIKITNEIFNYFARLSLEYENHQ...........YQNELEDVYIIK
Q8JFT1_DANRE/232-825VMKDSSTSKIQLVGSLITPQL.ATSVTASCINFVIILILNFLYEHVAIWITDMGETKPHPLFTRNKIWTHLEYENKLTMK
Q1AP35_STRPU/306-885IDQEF.........ISSYASI.ITSVTASMISLILIMILQILYERIAVRLTNLELHR...........TETEYEDSFTFK
Q17BF8_AEDAE/268-729QG................IFS.CLSVIPKVLLAGAITLMDEAYYKLAVWLNDRESYR...........LQSKYENHLIAK
A0CZD5_PARTE/224-675FYIRVAAKLNQAGGLLYYK...YTTNILDIFTILLIFYINTLYTKVCINSTKRENHR...........TNLRFYNSLILK
Q4SBN7_TETNG/194-870..................LPG.ITRFVPKILLALTVTICDEVYKKIAYWLNNMENYR...........LQSAYENNLIIK
A7RKU9_NEMVE/227-807YPDPQ.........VRKQAKM.TTSITAAILNLICINLLKFVYEKLAMFLTEWENPR...........TETDFKDSFTYK
A0EDB1_PARTE/707-1149..................DPF.FSQQLPGLLNSVLIAVFNFIYQNLVMIFNSLENHK...........ILSSYENSLVAK
Q7S8J4_NEUCR/182-650PF................KQY.L.TFLPTVLLTIFMPTFSGLLTNLAEKLTKAENYE...........THDAHQASFIEK
A7STD6_NEMVE/128-561DDS..............IIAT.VLLMIPSVSYSVMIAVLNNIYHRIALWLTEWENHR...........LESSYNNHLIVK
Q55GA1_DICDI/227-693..................NKT.VESGIGSVINALFILFFNFIYKNIAYFLTKFESHR...........VASSFNASYSTK
A0DK82_PARTE/835-1351..................VYK.GFIFLLGALQAIAIQILNILFLYFSKWYADQENHK...........FELSYQKSLIYK
A0D675_PARTE/863-1384..................SYK.GVVFLLGALQAIAIQVLNILFHYFSKWYADVENHK...........FELSYEKSLIYK
A5DTZ8_LODEL/154-649PG................KSL.L.TLLPTVLIVVFVPILTIIYNAVTDIVIKFEGHD...........NQYTKNNSILVK
Q234J3_TETTS/795-1263LN...............APFI.NPNTLIGILNSIQIIIFNQLYLYMNDWLSEKENHQ...........TLMSYENSYISK
A0EHC2_PARTE/551-1015..................RTT.NYTIICSIGLGISIKITNEIFNYFAKLSMKYENHQ...........YQNELEDVYIIK
Q16TH0_AEDAE/334-773..................IDS.YIMYVPSIVNAIYIAISTIAYDRLATYLTDKENHR...........TQSQYERHRVNK
Q233Y7_TETTS/365-837YIESIASL...TEVGGILAKLPLKETIFNVIMIVFILKINEFYNTISSKSTQRENHR...........TNNDFNSSLVIK
A0CY40_PARTE/679-1119LGN..............YFQY.FEIIVTASLNYVIQLLISSFYEQIATILTDFENFQ...........TSYQYETSYIIK
Q4T7R8_TETNG/234-891..................MPR.LARFIPKIMLAITVTACDEVYRKIACWLNDMENYR...........LQSAYEKNLIIK
Q4SUU1_TETNG/210-658EPS..............FWTG.TLLFIPSIIYAVVIEMMNLAYRYAAEFLTEWENHR...........LESSYQNHLILK
A0BSX3_PARTE/784-1228..................DQT.LSNTIPSILQAVSINFFNFIYNKVGQTFNVLENHK...........ILSTYENSLVAK
ANO1_HUMAN/320-928NSSPS.........VRSNIRV.TVTATAVIINLVVIILLDEVYGCIARWLTKIEVPK...........TEKSFEERLIFK
Q4P618_USTMA/365-904PL................KQA.V.PFIPTALLVVAVPQIMAAWQATAVAITKWENHY...........SAKSYDYSMTLK
Q29GT2_DROPS/198-624..................ADS.WLLYVPVIVQSILIAIFSWAYEKLATFLTKLENHR...........TRSQYDRHRVNK
A1C9M0_ASPCL/169-650PF................KQY.L.VFIPTVLLSALVPTMSAVLLSVATKLNDYENYE...........TQDAYNAALTQK
Q0IEX5_AEDAE/469-1043GGGRF.........FRKHAKL.FTTMTAALINLIIIMILTRIYHKLAIYLTNLENPR...........TQTEYEDSYTIK
Q59PV1_CANAL/157-651PG................KSL.L.TLLPTVLISVFVPILTIVYNAVTDIIIKWENHD...........NQYSKNNSILVK
A0DPK7_PARTE/690-1130IQA.............LQSGF.FEILVTASINIVIIQFLDQVYDIIAIHLTDFENQK...........SVKDYEESFIVK
Q4SSV5_TETNG/402-1010SPDPE.........IKSNVRV.TVTATAVIINLVVILILDEIYGSVALWLTELEIPK...........TETNFEERLILK
A0BM99_PARTE/778-1230..................GTT.IMPIVINSLNGVSMTVFCDLYKRLCTSLVTWENHM...........YESEQEYSYILK
Q22HF6_TETTS/2687-3155F.................IGS.NAILATNVMNSLQIVIFTQIYNVFANFLNKIENHK...........ILSSYENSYIAK
ANO7_MOUSE/277-825SDNAF.........LSAWASR.IASLTGSVVNLVFILILSKVYVLLAQVLTRWEMHR...........TQTEFEDAFTLK
Q5BAF3_EMENI/273-754PL................KSY.L.VFIPTILLSALIPTMSGVLVSIATKLNDYENYE...........TQTAYDTALTQK
Q8I4C3_CAEEL/218-758SW................MLS.WLCYFPMIFYALMIVISDKIYRRLALILNDLENYR...........TDDEYEDFLITK
A0DMZ8_PARTE/532-1006..................NSS.YYKLLVGVLQGICVSVLNIIYTALVHYFVEKENHK...........FEEHYESSLIYK
A7F670_SCLS1/199-673PF................KTY.LETFLPTVILTVFLPTLTVLLNGIASKLTALENYQ...........IVAAHEAAMVQK
A0D6S4_PARTE/669-1110ELKQ............MDVAT.IEVTSAAAMNFIAQQLFDIIFDKISSQLTEYENYK...........TVDAYETSFVLK
A0CHM6_PARTE/689-1129LGN..............DFQY.FEVIVTASLNYIIQLVIDQFYEQIATILTDFENFQ...........TSYQYETSYIIK
Q0CVZ6_ASPTN/174-638PW................KSY.L.EFFPTVLFSLSLPSISSVLTTIATRMTKYENYR...........TQDQYDVAQTTK
Q4REV7_TETNG/320-956NPDPE.........AKASVRM.TVTTTGIILNMLVVLVLEEVYGAIAVWLTELELPK...........TTEEFEERLIVK
A7RKU8_NEMVE/172-744SEILT.........IRMRART.VTSITAAIINLICINILKFVYSWLAVKLTNWENPR...........TRTDYEDSFTYK
A7REU8_NEMVE/125-679NPNL...........QPYANQ.FASGTGAVLNLIIIMILSRVYEKLALLLNHWEMHR...........TQTEYEDNLTLK
A0DBP1_PARTE/583-1035PNI..............EFIE.LSVFIPALIWVFIGILLDNIYRPVAFFLTKWENHK...........YLSQFETSFIIK
A0BSX4_PARTE/787-1230..................DPF.YAQNVPALLNFIQINFFNFVYQKLSDIFNMYENHK...........ILSSYENSLIAK
A0DMG8_PARTE/258-772YIEQIQ........IPYCKNI.YVSYLLAIIHVVVVNYLNSKYKQVSITTSLSEDHK...........CLQTFERSLIIK
Q175J3_AEDAE/362-937YGDEV.........TTSVAIL.FTTATAATINLCLIVVFNWMYTYLAEWLTERELLR...........TQTEFDDSLTLK
A0E006_PARTE/685-1125AGN..............EFQC.LEVIISGSLNYGIQYLIDSYYEQIATILTDFENYQ...........TSLQYETSYIMK
A0BM92_PARTE/792-1345TEPG............YSTAL.FEVTVPALINLILVLLLDTVFDRLAIALTDYENHK...........TIKMYEANFIYK
A0EAT8_PARTE/668-1109ELKQ............FDIAT.IEVTSAAAMNFIAQLIADNIFDKIACQLTEYENYK...........TVESYETSFVLK
A7SBX8_NEMVE/221-663..................PPK.PLKFAPKIALAVCIGMLDDNYKKLAYKLNDKENYR...........LQETYENHLIIK
A0C896_PARTE/868-1320TSLE...........RLNFLK.LEVSIPCSINVLILNIFEYIYERLAESMTDQENHQ...........TVADFEANFIIK
Q5AX15_EMENI/167-626SL................KGY.L.EFLPTIVFSLCLPSITGLLTSIATRLTKYENYR...........TQDQYDLAQTAK
Q4SV37_TETNG/23-638CEIG...........KNQKQASQQSMSASVHHFKCLK......RRQMCLFVSQEKTN...........SFAATERSFTVK
Q16MH3_AEDAE/340-935YGDPA.........DVANKRL.MFSAVAAIIDLALSIALDVAYNAVAVRMTNIEYHR...........TQNDYNESLNLK
Q6CB66_YARLI/1924-2410PF................SDY.A.PLVPTALLVVFLGVFKVIYGIIAKKMTDWENHE...........FEGVYTRSLTIK
A0DAH3_PARTE/688-1129EFSN............VSVMS.LEVTLSATINVFVQLFVDKFYDYISTSVTDFENHK...........TMQKYETSFVVK
Q4S1F6_TETNG/540-1136IMKDSPTTHLKVVGPLITPQL.ATSVTASCINFVIIMILNLMYEKVAIWITDMEIPK...........THLEYDNKLTMK
Q2H0D1_CHAGB/191-672PF................KQY.L.AFLPTILLTILNPTLTTLLTRLAQNLTEFENYR...........THDAHQASFVQK
A0C1K4_PARTE/730-1174..................NQF.LVSFVPSMINAIVIQLFNLIYFNVSNNLNDFENHK...........YEQSYEDSLILK
A7RJQ8_NEMVE/222-776YPRED.........VRRGARV.ITSITASTINLVAITILSYVYNYIAVFLTNWENPR...........TRTQYTDALTFK
Q23AS7_TETTS/863-1350DF................QNN.LYKAIAGALQGVGIQVLNFIYTYLARYFAQQENHK...........YIFQYERSIIYK
A2R347_ASPNC/170-649PL................KTY.L.VFIPTILLSALIPTMSSVLVSIATKLNDYENYE...........TQPAYDVALTQK
A0C5J6_PARTE/679-1109TSI..............QFRN.FEIIVTAILNYVIQIIVEYYYESIAIVLTDFENFQ...........TVEHYENSYCLK
Q0CNB9_ASPTN/169-648PL................KGY.L.VFIPTILLSALIPTMTTILVSVATRLNNYENYE...........TQAAYDVALTRK
Q08BD4_DANRE/215-664SGS..............YFTA.PLLYLPSIAHIVYTNVLGNVYRNVALKLTEAENHR...........EESSFDYHHTTK

PF02714

YAB9_SCHPO/387-708.D----------------LPFLN.SLLRTFLPTLVYSLFISISPFLFRWLSSMQGLS-----------SRAEEEIYAVGK
Q756H9_ASHGO/339-665.V----------------PPEPMDGILISLLPTILLYVLMMLLPIFIRRMAIFAGAP-----------SVQHVEYYTQRA
Q0V7D2_PHANO/253-586.A----------------HPTGW.GIAQGILAPLVQTLMYMGVPVVFRRLFTHSGDV-----------SRTSRERHVTAR
Q6BLR7_DEBHA/320-645.M----------------PDQLL.GIITGLLPTAMLSLLNTFLPIFIRYMAKVAGCP-----------TLQSIEFYTQDA
Q0P5M3_BOVIN/53-397..----------------........ITQFFPTLLLWCFSALLPTIVYYSAFFEAHW-----------TRSGENRTTMHK
Q28ZW6_DROPS/345-661..----------------EGKIS.PLVSEFLPTLMLWTLSALMPVIVAISDKWMGHY-----------TRSKQNYSIMTK
Q0UCF6_PHANO/629-953.F----------------PTWAI.SFVQGVLPPLFLAILFAILPILLRFLAGFTGTT-----------TAGERELLVQNF
Q6BHX0_DEBHA/347-676.K----------------SKWLT.TFVTGILPPLLFSLLNISLPYFYRFLSQYQGYS-----------SNSDIELSTLSK
Q0V4S6_PHANO/338-663.L----------------PPTAI.SLLSGLLPPLLLSMLASYVPKIFRYIFKTFGEA-----------TNTSAELRVVKW
Q6BI49_DEBHA/417-734.S----------------NRLAA.TLVTTLLPTYLFTILNIIMPYFYIWISSIQGYT-----------SHSDEELSTVSK
Q6BHN0_DEBHA/405-733.F----------------PEEAR.DTISSILPSLLLAILTDIVLIVFRFLTYFKGML-----------SGADLELNLQQW
Q0UJ62_PHANO/323-659.R----------------HPGFW.AVVQGILAPALTSLFYYFLPIIFRRLSMRAGDF-----------TKTSRERHVTAQ
TM63A_HUMAN/350-693..----------------........ISQFFPTLLLWSFSALLPSIVYYSTLLESHW-----------TKSGENQIMMTK
Q7S914_NEUCR/334-669.T----------------NRNFW.AIVQGIASPALTSLVYMVLPIIFRRLSMKAGDM-----------TKTGRERHVVAK
Q2QLP9_ORYSJ/304-621.L----------------EKKYMSQLVTGYLPSVILQIFLYAVAPIMILFSTLEGPI-----------SHSERKRSACCK
Q5JLH8_ORYSJ/319-642.I----------------EMRTIKSFIQGFLPGIALKIFLILLPSILMFMSKVEGLT-----------SVSSLERRSAFK
Q7SFU1_NEUCR/389-716.Q----------------YDLAR.ALVQTGLPTAVVSLLNVAVPYFYDYLSYQQGML-----------SRGDAALSTISK
Q5B9A0_EMENI/329-664.R----------------NRKVW.AAVQGILSPAVTSLFYLLLPIIFRRLSARTGDA-----------TKTLREQHVLRH
A1CSW7_ASPCL/614-938.L----------------PDWLI.SAIQGILPPLFLAILMALLPLILRFLCRAQGAH-----------TGMAIELTVQNY
Q4RLY6_TETNG/333-656..----------------........ITQFLPTLLLWAMSVLLPFIVYYSAFFESHW-----------TRSGENQVTMHK
Q9SY14_ARATH/320-643.I----------------EMKTVKSVIQGFLPGIALKIFLIILPTILMTMSQIEGYT-----------SLSYLDRRSAEK
Q75JX3_DICDI/409-732.K----------------SPTLT.SFLTGFLPGLALMIFLALLVPILTMFSRFSGYY-----------SKSAIEASIFSK
Q55HL4_CRYNB/375-703.L----------------PPAAL.GIIKGVLPPALLAVLFMLLPVVLRLMVKMQGEI-----------RKSDIELKLFSR
SPO75_YEAST/420-748.Q----------------SPFIR.EVAKNLIPIVTLIIIIEIVPYFFRWLSYLRGLK-----------TGAQIEADVQNW
Q5KMP4_CRYNJ/407-736.F----------------GKKVLQGVISGILPPVLLALLMELVPFILRQLAAFEGFP-----------SRTEVEINLMTR
Q6FVT6_CANGA/437-765NV----------------TSKCLRDVTKAVFPLVTLIFLTEFVPYIFRVISYLKGCR-----------TGAEIEMDIQRW
Q6CTP0_KLULA/338-664.M----------------PDVLM.GVITGLLPTILLALLMSLVPVFIKKVAMMTGAL-----------TRQEIELYCHAW
Q9C792_ARATH/233-550.L----------------SMKVVSQIITGYLPSLILQTSLKVVPPTMEFLSSIQGHI-----------CHSDIQKSACNK
Q5A2N5_CANAL/333-659.M----------------PDVIM.GVITGLLPVVALAILMSLVPPFIKWMGKISGRL-----------TIQQVESYCQSW
Q2TX45_ASPOR/301-610..----------------SDKEL.GAIQGLAPQMAASILMYCFPVVLQFLMKYYIAF-----------ERPAVEVLLQRH
O15741_DICDI/138-463.S----------------KSKILQGFLSGFLPNLILIIFMILLIPIIYALSRACGYF-----------SNSRIEASVFSK
Q4P7M9_USTMA/339-676.T----------------ASSFTFAAVSGLGAPIIMGIASFFFPIAMRKIAKYRGVQ-----------TRYRLDRLLVGQ
Q0CNN2_ASPTN/330-664.A----------------SPNVW.AAVQGILSPAITSLFYLILPIIFRRLAIRAGDL-----------TKTSRERHVLHH
Q55X91_CRYNB/416-752.E----------------IWKAIFTVLAGVLPATISAMFSYILPYIMRRLSRWSGAL-----------TRGQLDKAVIRQ
Q5ANH1_CANAL/429-746.S----------------HKWAE.TLITGLLPTYLFTILNIVIPFFYVWISEKQGYL-----------SHSDEELSSVSK
Q6FQA3_CANGA/332-658.V----------------PNVIM.GIITGLVPSLALSILMSLVAPFIKKIGEMSGDI-----------TRQETDQYCQKW
Q0UR74_PHANO/337-666.I----------------PPVIL.GVITGLLPTVMLAVLMALVPIFCRFLAKTAGYV-----------TWSQVELKTQSW
A1C5G9_ASPCL/369-694.L----------------PDTLK.GVIAGLLPSAALVLLMSLVPIICRFCARRAGSP-----------STAHVELFTQSA
Q7SA72_NEUCR/715-1042.T----------------IHNVI.KGVAGVLPAAVLAILLILVPIALDWLATFQGAK-----------TGSQTTETVQTY
Q16T32_AEDAE/332-653..----------------.....SPLISEFLPTLLLWSMSALMPVIVAYSDTWLSHW-----------TRSRQNYVIMTK
Q6CNN9_KLULA/328-653.M----------------PDQLL.GIITSLAPTIALAVLMMLLPIFIRKMALIAGAP-----------SYQHVEYFTQQA
PHM7_YEAST/330-656.M----------------PTFLM.GVITGLLPTIALVVLMSLVPPFIVMLGKLSGCV-----------TRQETDLYSQAW
Q9FVQ5_ARATH/322-645.T----------------RLDFIKSFLQGFLPGLALKIFLWILPTVLLIMSKIEGYI-----------ALSTLERRAAAK
Q29VG6_PICAN/391-712.K----------------HEWAQ.KFVTELLPVYLFTLLNFVIPYLYVWLSSRQGFV-----------SHGEEELSVVSK
Q2QN15_ORYSJ/290-606.L----------------EIAVVSQLVTGYLPSVILHFLSSYVPSIMKLFSTMQGFI-----------SVSGIERSACNK
YA7D_SCHPO/319-647.M----------------PPKLL.GIITGILPSVALSILMSLVPPFIKFLGKFGGAL-----------TVQEIENYCQNW
Q2H2M5_CHAGB/343-667.I----------------PDVIM.GVVTGLLPSVLLSILMSLVPIVMRLCAKLAGEP-----------SVSRVELFTQNA
Q4PBK2_USTMA/367-698.I----------------PNVVV.GIIQGILPTVLLAVLNMLLPIFLRLLSRLSGTP-----------TRSAIELDLQGR
Q6CQA3_KLULA/381-702.D----------------NDWAQ.NLVTGLLPTYIFTLFNVVIPYFYEFLTKRQGML-----------SYSDEELSLVSK
Q55IG1_CRYNB/356-687SW----------------GQWTF.SMVSGILPSVVSALFGYLLPIIIRKISKYQGAP-----------TRSRLDRAVTAR
Q2GZW7_CHAGB/335-670.E----------------NPGIW.SIIQGIASPALMSLVYLVLPIIFRRLSIKAGDQ-----------TKTGRERHVVAK
Q5BGH8_EMENI/1921-2251.R----------------HPLVK.SLVTTGLPTLAFSLLTVAVPYLYNWLSNHQGMM-----------SRGDIELSVISK
Q94II2_ARATH/227-551.V----------------EITAIRTVLESFLPQIALIVFLAMLPKLLLFLSKAEGIP-----------SQSHAIRAASGK
Q6CJU8_KLULA/487-816.L----------------PEFMS.KPIASIVPAVTLIFLTEGVPLFFRWFSVVKCLK-----------TGAQIEMDVQKW
Q8SV30_ENCCU/436-763.S----------------RYETIADSLRGALSPLIYNSMLLLVPTVITALMNMEGIY-----------SYSTLQQKLMDK
A0JP96_XENTR/352-691..----------------........ITQFLPTFLLWMFSVCLPFLVYYSAFFECHW-----------TRSSENQHTMHK
Q5JKX1_ORYSJ/300-617EL----------------IPGLN.SVVTGYLPSMILNGFIYLIPFAMLGMASFEGCI-----------AKSQKEIKACNM
TM63C_MOUSE/341-680..----------------........VTQFFPSVLLWAFTVTMPLLVYLSAFLEAHW-----------TRSSQNLIIVHK
Q6AU79_ORYSJ/320-643.I----------------ERNSLKSIVQGFLPGIALKIFLILLPTFLVMMSKIEGHT-----------SLSGLDRRTASK
Q757I3_ASHGO/332-658.L----------------PDVLM.GLITSLLPTIMLAVLMSLVPIFIQLVANKTGSI-----------SRQETQLYCQRW
Q7RWN3_NEUCR/470-795PL----------------LPKVILGVIKGLLPAVALSMLMAIVPAGLRVCARVAGCP-----------SHALVELYCQSA
Q6CA07_YARLI/344-669.L----------------PEAIK.GAISGILPPLLLALLMMLVPPILTLLAYLKGIS-----------TGIRVQLDVQKY
Q55T89_CRYNB/445-776.S----------------SPRLA.AIVQNSLPSLALITFNGLLPFLLEWLSYMQAFK-----------SRSATEYSLMKK
Q2HEX8_CHAGB/384-711.E----------------HEIAR.TLVQTGLPTLVASLLNVAVPYLYDYLSWHQGML-----------SQGDIALSAISK
Q9M1H6_ARATH/298-615EF----------------IPGLS.SVVTGYLPSAILKGFMYIIPFAMLGLAYLGGSI-----------SNSKEEIKACNM
A1CS74_ASPCL/381-711.R----------------NPILS.SLVQTGLPTLVLSLLTVAVPYLYNWLSNQQGMM-----------SRGDVELSVISK
Q4P987_USTMA/583-906.T----------------DQRLR.ALVQNNLPSLVVIGFNALLPLVLEYSSYLQGLK-----------ARSLVEYSLLKK
O65460_ARATH/249-572.V----------------DDKFMKSVIQGFLPGIALKLFLAFLPSILMIMSKFEGFT-----------SISSLERRAAFR
YGV8_SCHPO/320-656.S----------------RSGFW.SIVQGILSPAVAGFTFMILEIIMRRISYWQGSF-----------TKSSRERGVLNK
Q59MD1_CANAL/360-689.Q----------------SKWLT.TFVTGILPPLLFTLLNFSFPYFYQYLSQLQGYT-----------SNSDVELSTLSK
Q6C0S9_YARLI/412-736.D----------------TPWLE.KLVTGILPPYLFTILNFALPYFYVYLASLQGFI-----------SHGDEELSVISK
RSN1_YEAST/335-660.L----------------PKQLL.GLLTSLAPTVALAVLMSFLPKFIRGMAITQGAP-----------SKQNVEYFTQQA
Q6C266_YARLI/333-657.L----------------PSQLQ.GLVSGLLPTILMAVLMMLLPIIIRQCAKQAGCP-----------TTTRVEYYTQNA
Q75GI5_ORYSJ/304-621.L----------------KKPFFVKLVTGYLPSVVLLLSLYTVPPLMMFFSSIEGSI-----------SRSGRKKSACCK
Q59TM5_CANAL/389-717.F----------------PEEAR.ETIAGFLPSILLGVLTEIVMIIFRFLTYFKGRT-----------TGCEVEIDLQKW
Q7SAG4_NEUCR/349-673.I----------------PGFIL.GAVTGLLPSIALSILMSLVPIVIRICAKLSGEP-----------SLSRVELFTQHA
Q2H842_CHAGB/434-758.L----------------PGPIL.GVIQGLLPALALSWLMAAVPWMLRGCARVAGVP-----------SRALVELYVQHA
Q5APG0_CANAL/320-645.M----------------PHALL.GLVTGLLPTILLSLLMFLLPIIIRVFARISGEI-----------SAVGVEKWTQNA
Q54RR3_DICDI/361-689.N----------------LDDTLRGFVEGYLPSLALVLFLALLPLFIKIIIHFNKED-----------TRTQFYHKVFTV
Q6FSA1_CANGA/317-642.L----------------PDVLL.GLLTSLAPTVALSLLMMLLPMFIRGMAKIQGAT-----------SSQQVEYFTQQS
Q6ZLQ0_ORYSJ/321-643.V----------------DQPKIKTVLQAYLPQLALIVFLALLPSLLMFLSKLEGIP-----------SQGHTVRAAAGK
Q75FA6_ASHGO/525-853..----------------STSILDKSLSSIVPVMTLIFLTEGVPFLFRWFGWLKCCR-----------SGSSTELDVQKW

PF07810

TMC3_HUMAN/499-614--------------------------------------------------VGQEMLK-----------------------
TMC4_HUMAN/475-585--------------------------------------------------LGQEMYK-----------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------LGQELSK-----------------------
Q571H8_MOUSE/303-413--------------------------------------------------VGEELYK-----------------------
Q5YCC6_CHICK/187-293--------------------------------------------------VGQDLYR-----------------------
Q6GPL8_XENLA/460-566--------------------------------------------------VGQELYR-----------------------
Q16VL2_AEDAE/432-538--------------------------------------------------VGQEIYR-----------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------VGQEMYK-----------------------
Q7Z015_ANOGA/481-596--------------------------------------------------FGQELAK-----------------------
Q7Z014_ANOGA/399-515--------------------------------------------------IGQELYR-----------------------
Q6NUU5_DANRE/502-612--------------------------------------------------VGQEMYK-----------------------
Q7Z013_ANOGA/385-495--------------------------------------------------VGQQFYK-----------------------
TMC7_HUMAN/486-597--------------------------------------------------VGQEMYK-----------------------
Q4T0I6_TETNG/432-547--------------------------------------------------VGIEFVK-----------------------
TMC7_CHICK/480-590--------------------------------------------------VGQEMYK-----------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------VGQELYR-----------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------VGQELYR-----------------------
Q3MI88_HUMAN/482-597--------------------------------------------------VGQEFVR-----------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------VGQELYR-----------------------
TMC5_RAT/683-789--------------------------------------------------IGQDIYR-----------------------
A7RLV1_NEMVE/180-290--------------------------------------------------IAAEMYK-----------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------VGQALYR-----------------------
Q4S012_TETNG/224-335--------------------------------------------------LGKEMYK-----------------------
A7SUG1_NEMVE/384-492--------------------------------------------------LAAQMYM-----------------------
A2BFV3_DANRE/430-545--------------------------------------------------VGQEFVR-----------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------VGQEMYK-----------------------

PF04547

CACLC_ARATH/188-630------VFG..............................LYFMQTYIGIFY-HVLLHR......................
ANO2_HUMAN/352-944------AFL..............................LKFVNAYSPIFY-VAFFKGRFVGRPG...............
ANO9_HUMAN/179-740------FFT..............................LQFFTHFSSLIY-IAFILGRINGHPGK..............
Q9VYS8_DROME/350-933------NYV..............................FQFVNYYSSLFY-IAFLKGKFVGYPA...............
ANO6_HUMAN/287-872------MFL..............................FQFVNYYSSCFY-IAFFKGKFVGYPGD..............
A5DIJ8_PICGU/65-553------SYV..............................LTFLTSYMPLLI-TSFIYLPFAHLVEPHLGDIKYNIATRLN
A0CKQ3_PARTE/818-1263------VFL..............................FEFLISYISVVY-AVLFKT......................
Q6NUA4_XENLA/167-596------VLV..............................FNIVNCFSSLFY-IAFVMC......................
Q16MH2_AEDAE/199-778------IYL..............................FQFINYYSSIFY-IAFVKGKFPGYPA...............
Q2UDH7_ASPOR/180-663------IFV..............................INFITSYLPVFL-TAFVYVPFAHSIVPYLDIF........H
Q2U154_ASPOR/174-639------TFV..............................MNFITSFLPTIL-TAFVYVPFGARLLPYL............
A0DD09_PARTE/537-1000------VFA..............................FTFLNSFGRLFY-RSLIRP......................
Q4SPC5_TETNG/131-466------VLV..............................FTFFNYFAVLFH-IAFFKQ......................
YNG5_SCHPO/170-627------MFL..............................QNFMLSYTALFL-ISYIYGPFAEYFVPHYIQNRM....SQS
A6RD03_AJECN/171-655------IFV..............................LNFITSYLPVLL-TAFVYVPFGKVIVPYLDLFNL.....TG
A0CE73_PARTE/768-1287------KYF..............................LSFFALCGPVVE-IMFGHK......................
A7S3G0_NEMVE/17-561------LFG..............................FQFVNSYTSLFY-IAFFRQQTAKDG................
A7RKU7_NEMVE/244-824------MYL..............................FQFVNTYASIFY-IAFFKSEIVVGTPG..............
Q86P24_DROME/304-882------IYL..............................LQFVNYYASIFY-IAFFKGKFVGHPG...............
ANO3_MOUSE/384-951------MFL..............................FQFVNLNSSIFY-IAFFLGRFVGHPG...............
A7REV0_NEMVE/214-763------VFV..............................FQFANFYSSIFY-VAFFKGKLVGYPG...............
ANO10_DANRE/200-629------VLV..............................FNFVNCFASLFY-IAFVMQ......................
ANO8_HUMAN/237-880------VVL..............................FQFVNSYLSLFY-IGFYLK......................
ANO10_MOUSE/200-629------VLV..............................FNFLNCFASLFY-IAFVLK......................
A1D9V1_NEOFI/173-637------TFV..............................MNFITAFLPTLL-TAFVYVPFGAKIIPYL............
A4HVK2_LEIIN/428-971------RAA..............................FEFVNSYGKLLF-IAFGRC......................
A4H763_LEIBR/371-928------RVA..............................FELFNSYGKLLF-IVFGRG......................
Q6DDQ3_XENLA/273-852------MFL..............................FQFVNYYSSCFY-VAFFKGKFVGYPA...............
A0DPP4_PARTE/705-1145------KYI..............................LYFISYVGPLVI-IAFLNE......................
A0CIB0_PARTE/859-1305------NFI..............................FRFVNNFNSFFL-VSFLSGFFP...................
Q24E70_TETTS/215-696------RFL..............................FEMLYTFTDLSY-IAFVRF......................
A0DHW5_PARTE/686-1116------KYT..............................LYSLSGLFPLLV-IQFLNS......................
A3LWT2_PICST/162-656------TFV..............................LNFLTSYMPLLI-TSFVYLPYAHLVQPHLGDIKDAI.SANV
A0CMD7_PARTE/544-1006------VFA..............................FTFLNSFGRLFY-RSIIKP......................
ANO4_BOVIN/304-887------MFL..............................FQFVNLNSSTFY-IAFFLGRFTGHPG...............
ANO5_HUMAN/292-870------MFL..............................FQFVNFYSSCFY-VAFFKGKFVGYPG...............
A0D751_PARTE/565-1028------VFS..............................FAFLNSFGRLFY-KSVIDP......................
Q8JFT1_DANRE/232-825------MFM..............................FQFVNYYSSCFY-VAFFKGKFVGYPGNY.............
Q1AP35_STRPU/306-885------MYL..............................FAFVNYYSTSFY-IAFFKGRLPGTPA...............
Q17BF8_AEDAE/268-729------VAL..............................FQFVNSFLSLFY-IAFYLR......................
A0CZD5_PARTE/224-675------RFI..............................FELINRFFHLFY-IAFVEF......................
Q4SBN7_TETNG/194-870------MVFVRRISGFCLTQTVDFDWTSCNLSGFMVVFQFEFINSYLSLFY-IGFYLK......................
A7RKU9_NEMVE/227-807------MYL..............................FQFVNNYASIFY-IAFFKLNLVIGTPG..............
A0EDB1_PARTE/707-1149------VFI..............................FRFVNTFNSFFI-ISFLSNYFS...................
Q7S8J4_NEUCR/182-650------IFV..............................LNFITSYLPIFL-TAFVYVPFGKLLVPYLDVF.........
A7STD6_NEMVE/128-561------LVL..............................FYFVNCFYSLFY-IAFYLQ......................
Q55GA1_DICDI/227-693------LFL..............................FQFVNSFSGLFY-IAFLKNNVYLWGDI..............
A0DK82_PARTE/835-1351------NVF..............................FRFINSYMPLMY-IIVTSN......................
A0D675_PARTE/863-1384------NVF..............................FRFINSYMPLMY-IIVTSN......................
A5DTZ8_LODEL/154-649------QFI..............................LNFLTSYVPLII-TSFLYLPFAHLIGPHLGDLQLTI.SSYV
Q234J3_TETTS/795-1263------VFM..............................FTFCNTFNSCFI-IAFFNDLFLIEKG...............
A0EHC2_PARTE/551-1015------VFS..............................FTFLNSFVRLFY-KSIINP......................
Q16TH0_AEDAE/334-773------LIV..............................LEFVNNFLCLFY-IAFILQ......................
Q233Y7_TETTS/365-837------RFI..............................FDLINRFTHFFF-IAFVVR......................
A0CY40_PARTE/679-1119------KYT..............................LHCSSQVVPLLM-VSFLNS......................
Q4T7R8_TETNG/234-891------MVL..............................FQFVNSYLSLFY-IGFYLK......................
Q4SUU1_TETNG/210-658------VLV..............................FNFFNCFASLFY-IAFVMQ......................
A0BSX3_PARTE/784-1228------FTI..............................FRFVNNFIQFFI-TSFLSSYFV...................
ANO1_HUMAN/320-928------AFL..............................LKFVNSYTPIFY-VAFFKGRFVGRPG...............
Q4P618_USTMA/365-904------RFA..............................MQAITAYGALTL-SAYVYIPFGELIMETMVQRGF.....FQ
Q29GT2_DROPS/198-624------LML..............................FEIVNNFFSQFY-IAFVLQ......................
A1C9M0_ASPCL/169-650------IFV..............................VNFITSYLPVFL-TAFVYVPFASRIVPYLDVF........Q
Q0IEX5_AEDAE/469-1043------IFV..............................FEFMNFYSSLIY-IAFFKGRFFDYPGDD.............
Q59PV1_CANAL/157-651------TFV..............................LNFLTGYVPLII-TSFIYLPFAHLVQPHLGDIKTTI.ATYA
A0DPK7_PARTE/690-1130------KYI..............................LYFFSYVGPLIV-IAFLNG......................
Q4SSV5_TETNG/402-1010------AFL..............................LKFMNAYAPIFY-VAFFKGRRFAGRPG..............
A0BM99_PARTE/778-1230------VFL..............................FEFLISYVSVVY-VAIFES......................
Q22HF6_TETTS/2687-3155------LFL..............................FQFFNTFNSLIL-ISFFNSIPPFSSLNLCAS..........
ANO7_MOUSE/277-825------VFI..............................FQFVNFYASPVY-IAFFKGRFVGYPG...............
Q5BAF3_EMENI/273-754------IFV..............................INFITSYFPILL-TAFVYIPFASLIVPHLDVF........H
Q8I4C3_CAEEL/218-758------IVL..............................FQFVTAFGSLFY-IAFVLR......................
A0DMZ8_PARTE/532-1006------NVL..............................FKFINSYIAVFY-TAFIKL......................
A7F670_SCLS1/199-673------IFV..............................LNFITSYVPIFL-TAFVYVPFAQVIVPHLDILQ.......M
A0D6S4_PARTE/669-1110------KFI..............................FQFFSYIAPLLF-LDYLNR......................
A0CHM6_PARTE/689-1129------KYT..............................LYCFSQLIPLLM-ISFLHS......................
Q0CVZ6_ASPTN/174-638------TFI..............................MHFITTFLPTIL-TAFVYVPFGARLMPYL............
Q4REV7_TETNG/320-956------SFF..............................LKSMNAFAPIFY-VAFFKGRFAGRPG...............
A7RKU8_NEMVE/172-744------MYL..............................FQFVNTYASIFY-IAFFKSGLVIGTPG..............
A7REU8_NEMVE/125-679------VFI..............................FQFTNFYSSIFY-IAFFKGKFVGYPG...............
A0DBP1_PARTE/583-1035------NLL..............................FSTVNRLGQPFI-IAFFYE......................
A0BSX4_PARTE/787-1230------IFI..............................FMFVNNFNSFFI-ISFLSGYFS...................
A0DMG8_PARTE/258-772------RFT..............................FEIFSAFFDFFY-IGFVND......................
Q175J3_AEDAE/362-937------IYL..............................LQFVNYYASIFY-IAFFKGKFIGYPG...............
A0E006_PARTE/685-1125------KYT..............................LYWFSQLFPLMI-VCFLHS......................
A0BM92_PARTE/792-1345------KFF..............................LCFFALCVPILE-IQFLHT......................
A0EAT8_PARTE/668-1109------KFI..............................FQFFSYIAPLLF-LDYLNQ......................
A7SBX8_NEMVE/221-663------LVS..............................FQFFNAYLSLFY-IAFYIQ......................
A0C896_PARTE/868-1320------KFT..............................LMLLSYFAPIFM-IAFLNQ......................
Q5AX15_EMENI/167-626------QFV..............................MHFITAFLPTIL-TAFVYVPFGATIV...............
Q4SV37_TETNG/23-638------MFT..............................FQFFTLFSSLFY-VAFFLGRINGHPG...............
Q16MH3_AEDAE/340-935------VFL..............................FQFVNYYSSIFY-IAFLKGKFPGYPA...............
Q6CB66_YARLI/1924-2410------LFV..............................VDFLSSYFGLFL-TGFIYLPFGQNLVGYLN...........
A0DAH3_PARTE/688-1129------KFI..............................LYFCSYVVPLLF-IGYLNG......................
Q4S1F6_TETNG/540-1136------MFL..............................FQFVNYYSSCFY-VAFFKGKFVGYPGDY.............
Q2H0D1_CHAGB/191-672------IFV..............................INFITSYLPIFL-TAFIYVPFGKILVPYLDVF.........
A0C1K4_PARTE/730-1174------TYI..............................FTFINTFNCLAI-IAFLNEQFP...................
A7RJQ8_NEMVE/222-776------MFL..............................FQSVNMYSSLFY-IAFFKSAMIVGVP...............
Q23AS7_TETTS/863-1350------LMS....................................FKTLFY-M...........................
A2R347_ASPNC/170-649------IFI..............................INFITSYLPIFL-TAFVYVPFASRIVPYLDVF........H
A0C5J6_PARTE/679-1109------KYA..............................LICFSQLFPLLI-LCFLNG......................
Q0CNB9_ASPTN/169-648------IFI..............................INFITSYLPIIL-TAFVYLPFASYIVPYLDVF........S
Q08BD4_DANRE/215-664------VLV..............................FTFFNNFAVLFH-IAFFKE......................

PF02714

YAB9_SCHPO/387-708......NYA------------------------------YLFVNFFLVYVI.AGSTSI----------------------
Q756H9_ASHGO/339-665......FFA------------------------------FQLIQIFLIRTV.SSVAYV----------------------
Q0V7D2_PHANO/253-586......LYA------------------------------FFVFNNLLVFSV.FGSAWR----------------------
Q6BLR7_DEBHA/320-645......YFA------------------------------YLMVNAFLVVAL.ASSAVS----------------------
Q0P5M3_BOVIN/53-397......CYT------------------------------FLLFMVLLLPSL.GLSSLD----------------------
Q28ZW6_DROPS/345-661......CFS------------------------------YLLLMILILPSL.GLTSAQ----------------------
Q0UCF6_PHANO/629-953......YFA------------------------------FVFVQLFLVVSI.STGLTT----------------------
Q6BHX0_DEBHA/347-676......NFF------------------------------YLFVNLFLVFTF.AGTFSN----------------------
Q0V4S6_PHANO/338-663......YFV------------------------------FQVLQVFLVTTL.ASGAAA----------------------
Q6BI49_DEBHA/417-734......NFF------------------------------YIFVNLFLVFTM.AGTASL----------------------
Q6BHN0_DEBHA/405-733......YFA------------------------------FLFVQQFLVVTI.SSSITV----------------------
Q0UJ62_PHANO/323-659......LYN------------------------------FFVFNNLFVFSL.FSAAFG----------------------
TM63A_HUMAN/350-693......VYI------------------------------FLIFMVLILPSL.GLTSLD----------------------
Q7S914_NEUCR/334-669......LYS------------------------------FFVFNNLFVFSL.FSALWS----------------------
Q2QLP9_ORYSJ/304-621......VLY------------------------------FTVWNIFFGNVL.SGTVIS----------------------
Q5JLH8_ORYSJ/319-642......YYI------------------------------FLFFNVFLGSII.AGSALE----------------------
Q7SFU1_NEUCR/389-716......NFF------------------------------FTFFNIFLIFTV.FGAVTS----------------------
Q5B9A0_EMENI/329-664......LYS------------------------------FFVFNNLIVFSL.FSAVWT----------------------
A1CSW7_ASPCL/614-938......YFA------------------------------FLFVQLFLVVAI.SSSFST----------------------
Q4RLY6_TETNG/333-656......CFL------------------------------LLIFMVIILPSL.GLTSLD----------------------
Q9SY14_ARATH/320-643......YFW------------------------------FIIVNVFLGSII.TGTAFQ----------------------
Q75JX3_DICDI/409-732......YFL------------------------------FLVFNVFLVSAI.AGTIFQ----------------------
Q55HL4_CRYNB/375-703......FWL------------------------------FQVIHGFLIVTL.ASGLIN----------------------
SPO75_YEAST/420-748......YFV------------------------------FVFIHLFVVVTI.SSGFSI----------------------
Q5KMP4_CRYNJ/407-736......YFL------------------------------FLVIHTFFIVTL.ASGLIS----------------------
Q6FVT6_CANGA/437-765......FFM------------------------------FLLVHIFFVVTI.SSGLSL----------------------
Q6CTP0_KLULA/338-664......YYA------------------------------FQVVQVFIVVTL.ASSASS----------------------
Q9C792_ARATH/233-550......VIW------------------------------FTIWNVFFATVF.SGSAFY----------------------
Q5A2N5_CANAL/333-659......YFA------------------------------FQVVNVFLAIAL.GSSAAA----------------------
Q2TX45_ASPOR/301-610......YFL------------------------------FLYTQLFIVVSI.SSGVTT----------------------
O15741_DICDI/138-463......YFL------------------------------FLVFNVFLVSAI.AGTIFQ----------------------
Q4P7M9_USTMA/339-676......YFG------------------------------FLVISQFLFFSL.IGVVLS----------------------
Q0CNN2_ASPTN/330-664......LYS------------------------------FFVFNNLIVFSL.FSAAWT----------------------
Q55X91_CRYNB/416-752......LFI------------------------------FQLVSNFIVFSL.LGVVYE----------------------
Q5ANH1_CANAL/429-746......NFF------------------------------YIFVNLFLVFTT.FGTASF----------------------
Q6FQA3_CANGA/332-658......YFA------------------------------FQVLNTFIVTTL.ASSASS----------------------
Q0UR74_PHANO/337-666......YFA------------------------------FQVVQVFLITTV.ASAATT----------------------
A1C5G9_ASPCL/369-694......HFC------------------------------FQVVQVFLVTTL.TSAASA----------------------
Q7SA72_NEUCR/715-1042......YFA------------------------------FLFVQVFLVVSI.TSSTFQ----------------------
Q16T32_AEDAE/332-653......TFG------------------------------YLLFMILILPSL.GLTSAE----------------------
Q6CNN9_KLULA/328-653......YFA------------------------------FQVIQVFLVTTL.ASSATS----------------------
PHM7_YEAST/330-656......YYA------------------------------FAVIQIFLVVTA.TSSASS----------------------
Q9FVQ5_ARATH/322-645......YYY------------------------------FMLVNVFLGSII.AGTAFE----------------------
Q29VG6_PICAN/391-712......NFF------------------------------YVFVNLFLVFTM.AGTASN----------------------
Q2QN15_ORYSJ/290-606......MLR------------------------------FTIWSVFFANVL.TGSVLG----------------------
YA7D_SCHPO/319-647......YYA------------------------------FQVVQVFLVTTM.TSAATS----------------------
Q2H2M5_CHAGB/343-667......YFA------------------------------FQVIQVFLVATL.SSSATA----------------------
Q4PBK2_USTMA/367-698......FAA------------------------------FQIVQNFLFLTLVSGNAGQ----------------------
Q6CQA3_KLULA/381-702......NFF------------------------------YILVNLFLVFTL.AGTASN----------------------
Q55IG1_CRYNB/356-687......YFF------------------------------FMIISNLVIFSL.LGVVYT----------------------
Q2GZW7_CHAGB/335-670......LYA------------------------------FFVFNNLIVFSI.FSALWT----------------------
Q5BGH8_EMENI/1921-2251......NFF------------------------------FSFFNLFVIFTV.IGTATN----------------------
Q94II2_ARATH/227-551......YFY------------------------------FSVFNVFIGVTL.AGTLFN----------------------
Q6CJU8_KLULA/487-816......FFA------------------------------FLFVHIFLVVTI.SSDISV----------------------
Q8SV30_ENCCU/436-763......LCN------------------------------FLFFNGFASVFF.VTSFYR----------------------
A0JP96_XENTR/352-691......CYF------------------------------FLVFMVIVLPSL.GLTSLN----------------------
Q5JKX1_ORYSJ/300-617......VFY------------------------------FLLGNVFFLSIL.SGSLLH----------------------
TM63C_MOUSE/341-680......CYI------------------------------FLVFMVVILPSM.GLTSLH----------------------
Q6AU79_ORYSJ/320-643......YYL------------------------------FLFVNVFLGSVI.TGTAFQ----------------------
Q757I3_ASHGO/332-658......FYA------------------------------FQVVHVVLVVML.ASSAAS----------------------
Q7RWN3_NEUCR/470-795......YFA------------------------------FQVIQVFLVTTI.TSAASA----------------------
Q6CA07_YARLI/344-669......YYA------------------------------FQYIQLFLVITV.SSGLTT----------------------
Q55T89_CRYNB/445-776HVDLTSYHL------------------------------FLLISVLLIFLL.TSTYWA----------------------
Q2HEX8_CHAGB/384-711......NFF------------------------------FTFFNIFLIFTI.FGAVTS----------------------
Q9M1H6_ARATH/298-615......VFY------------------------------FLMGNVFFLSLI.SGSLLD----------------------
A1CS74_ASPCL/381-711......NFF------------------------------FTFFNLFLVFTV.FGTATT----------------------
Q4P987_USTMA/583-906......YYL------------------------------FLMVSVVFIFLI.ATTAWG----------------------
O65460_ARATH/249-572......YYI------------------------------FNLVNVFLASVI.AGAAFE----------------------
YGV8_SCHPO/320-656......LHI------------------------------IFTLDNFIIYTL.MAVFWR----------------------
Q59MD1_CANAL/360-689......NFF------------------------------FIFFNLFLIYVA.AGTFWD----------------------
Q6C0S9_YARLI/412-736......NFF------------------------------YIFVNLFLIFTV.AGAAID----------------------
RSN1_YEAST/335-660......YFA------------------------------FQVIQVFLVTTL.SSAATS----------------------
Q6C266_YARLI/333-657......YFA------------------------------FQFVNVFLITTF.ASSAAA----------------------
Q75GI5_ORYSJ/304-621......ILF------------------------------FTIWNVFFVNVL.SGSVLN----------------------
Q59TM5_CANAL/389-717......YFA------------------------------FLFVQQFLVVTI.SSSVTV----------------------
Q7SAG4_NEUCR/349-673......YFA------------------------------FQVIQVFLVATV.ASSATA----------------------
Q2H842_CHAGB/434-758......YFF------------------------------FQVVQVFLVTTL.TSAASA----------------------
Q5APG0_CANAL/320-645......YFA------------------------------FLMVNGFLVTAL.ASSATA----------------------
Q54RR3_DICDI/361-689......YWA------------------------------FLVTNVFLVVSI.AGTVLG----------------------
Q6FSA1_CANGA/317-642......YFA------------------------------FQVIQVFLVTTI.TSAATS----------------------
Q6ZLQ0_ORYSJ/321-643......YFY------------------------------FIVFNVFLGVTI.SSTLFS----------------------
Q75FA6_ASHGO/525-853......FFA------------------------------FLFVHIFLVVTI.SSGISV----------------------

PF07810

TMC3_HUMAN/499-614------LSI------------------------------IDMLFTVASILL-IDFFRG----------------------
TMC4_HUMAN/475-585------LLL------------------------------FDLLTVLAVALL-IQFPRK----------------------
Q29CY9_DROPS/1115-1230------VIV------------------------------FDGLMSIVAPLC-IDFLRA----------------------
Q571H8_MOUSE/303-413------LII------------------------------FNFLLTVAFAFL-VSLPRR----------------------
Q5YCC6_CHICK/187-293------FVV------------------------------MDFIFTLLDTGF-GELLWR----------------------
Q6GPL8_XENLA/460-566------FVI------------------------------MDLLFSLLDTLV-GEFLWR----------------------
Q16VL2_AEDAE/432-538------LIV------------------------------IDFVVSVIFLAC-LQASRY----------------------
Q7T1T6_TAKRU/445-555------LTV------------------------------FDLLVTIATLVL-VEFPRR----------------------
Q7Z015_ANOGA/481-596------LTV------------------------------MDLLVTIVSTLI-LDFLRA----------------------
Q7Z014_ANOGA/399-515------LLV------------------------------VDFFISTVLLSA-VRGVRY----------------------
Q6NUU5_DANRE/502-612------LVI------------------------------FDLLIVAAVTVF-VEFPRK----------------------
Q7Z013_ANOGA/385-495------LFI------------------------------VDFATHFLVTFF-VNFPRA----------------------
TMC7_HUMAN/486-597------LMI------------------------------FDFIIILAVTLF-VDFPRK----------------------
Q4T0I6_TETNG/432-547------LTV------------------------------SDIQVSYLTILI-GDFARA----------------------
TMC7_CHICK/480-590------LLI------------------------------FDFMIIIAMTLF-VDFPRK----------------------
Q7T1U0_TAKRU/540-646------FLI------------------------------MEFIFTLLDTLF-GELLWR----------------------
Q0VCU9_BOVIN/548-654------LMV------------------------------MDFIFTLLDTLL-GELVWR----------------------
Q3MI88_HUMAN/482-597------LTV------------------------------SDVLTTYVTILI-GDFLRA----------------------
Q7T1T9_TAKRU/475-577------LLL------------------------------VDFVFTALHTFL-GEFLWG----------------------
TMC5_RAT/683-789------LLL------------------------------MDFVFSLADSLL-GEFLRR----------------------
A7RLV1_NEMVE/180-290------LIW------------------------------MDFIMSVLVVLL-FHTPRR----------------------
Q7T1T8_TAKRU/369-471------LVF------------------------------FDFLFLLLGSFF-GEFLSK----------------------
Q4S012_TETNG/224-335------LSI------------------------------FNFLATICNAFL-FNFPRK----------------------
A7SUG1_NEMVE/384-492------LVW------------------------------MDFFVVILTTLG-LETLRK----------------------
A2BFV3_DANRE/430-545------LII------------------------------SDTMTTYITLLI-GDFMRA----------------------
Q4S7Q9_TETNG/466-576------LTI------------------------------FDFIIIAANTIF-VEFPRK----------------------

PF04547

CACLC_ARATH/188-630............-------------...........NF--M------TLRQVLIQRLIISQVF...WTLMDGSLPYLKYS
ANO2_HUMAN/352-944.....SYVYVFD-------------GYRMEECAPGGCL--M------ELCIQLSIIMLGKQLI..QNNIFEIGVPKLKKL
ANO9_HUMAN/179-740.....STRLAGL-------------W.KLEECHASGCM--M------DLFVQMAIIMGLKQTL...SNCVEYLVPWVTHK
Q9VYS8_DROME/350-933.....KYNRVLG-------------F.RQEECNPGGCL--M------ELCMQLVIIMAGKQAV...NAIVEMLIPYLMRT
ANO6_HUMAN/287-872.....PVYWLGK-------------Y.RNEECDPGGCL--L------ELTTQLTIIMGGKAIW...NNIQEVLLPWIMNL
A5DIJ8_PICGU/65-553ENRFYYKYMTAV-------------K.RQEDFKI..NQ--N------RLNAQFFFFVVTSQVI...QLVMKYVLPIVLPK
A0CKQ3_PARTE/818-1263............-------------...........DQ--T------QLTLSVASIIITRGLI...SNLQSNCLPYLLYN
Q6NUA4_XENLA/167-596............-------------...........DM--K------LLRQSLATLLITSQIL...NQFVEALLPYWLQK
Q16MH2_AEDAE/199-778......KYNRIL-------------TLRQEECSPGGCL--M------ELCIQLAIIMIGKQII...SLILEILVPFLLQK
Q2UDH7_ASPOR/180-663LTVRPFVSKKDA-------------ITTRAEFSI..DP--G------RLKKQVIYFTVTAQAV...NFAQETIVPMLKQR
Q2U154_ASPOR/174-639..DVIRVGKLAT-------------AFDTRRVHI..DP--S------RLQQEVIYLSVMGQVM...SFGEEIVLPYVKRV
A0DD09_PARTE/537-1000............-------------...........DS--E------ELDLLSISFTITWSLV...HLIRYTLYPLISFA
Q4SPC5_TETNG/131-466............-------------...........DV--P------LLRKRLASLLIITQLV...NQATEVVIPFIVDR
YNG5_SCHPO/170-627FFSVGYIAKSTF-------------KL.........NP--L------RLRNQYIYFLTNAQVI...NYITILAVPQLISY
A6RD03_AJECN/171-655NPFAQTSEKDQL-------------QTSATPFQI..NP--S------RLRKQVIYFTVTAQIV...NQGLEIVLPYAKRK
A0CE73_PARTE/768-1287............-------------.KVGLHCINDDCL--K------HAQYHFSTIFLIQFSLNIWEIIKPKVIVFLRQL
A7S3G0_NEMVE/17-561......ILDLGA-------------EYNDSCGPSNDCM--T------LLSLQVAMLMIMKPLP...KTITDIILPWLKRM
A7RKU7_NEMVE/244-824.....RYKRIAG-------------KYRLEGCSAQGCF--L------ELCVQMLIIMVGQQII...GNITEVAIPAIMTW
Q86P24_DROME/304-882......EYNKLF-------------DYRQEECSSGGCL--T------ELCIQLAIIMVGKQAF...NTILEVYLPMFWRK
ANO3_MOUSE/384-951.....KYNKLFE-------------RWRLEECHPSGCL--I------DLCLQMGVIMFLKQIW...NNFMELGYPLIQNW
A7REV0_NEMVE/214-763......HYRRLF-------------GLRQEECSPGGCL--M------ELAQQLVIIMVGKQMI...NNVQEIAIPLVKQW
ANO10_DANRE/200-629............-------------...........DM--V------LLRQSLATLLITSQIL...NQVMEAFLPYWLQR
ANO8_HUMAN/237-880............-------------...........DM--E------RLKEMLATLLITRQFL...QNVREVLQPHLYRR
ANO10_MOUSE/200-629............-------------...........DM--K------LLRQSLATLLITSQIL...NQVVESLLPYWLQR
A1D9V1_NEOFI/173-637...DIFHVRGLH-------------SSISTEFQV..DT--S------RFQQEVIYLSVTGQVL...SFGEEVVLPYVKKV
A4HVK2_LEIIN/428-971............-------------...........RV--A------ELSAHLRSMFYVAVLS...RMMSHTVIPFVVTH
A4H763_LEIBR/371-928............-------------...........SI--S------ELASQLQIIFYVAAVS...RMMSDTIVPLVVTH
Q6DDQ3_XENLA/273-852.....DYTYLFG-------------KWRNEECDPAGCL--I------ELTTQLTIVMAGKQIW...GNIQEAFVPWTWNW
A0DPP4_PARTE/705-1145............-------------.PFNLYCKATNCQ--E------HIQYHFATMIIWVFFF........KTVKIFQLI
A0CIB0_PARTE/859-1305.........NLN-------------ICKVNEEITNDCF--L------LLSNQLSTIFSSN.LT...GSIPKLITPFVKEF
Q24E70_TETTS/215-696............-------------...........DI--E------ALKRELIAIYSADEIR...RVVTESVIPYFTKL
A0DHW5_PARTE/686-1116............-------------.PFYLYCWEESCK--N------EIQYFFATTIFWIFTL........QFIKYFRLY
A3LWT2_PICST/162-656AESRFFYKYLIK-------------LKKQEDFKM..NQ--E------RLNAQFFYFIVTNQVI...QLILKYVLPLIITK
A0CMD7_PARTE/544-1006............-------------...........DE--V------ELKLFSISFTITWSLI...HLIRYTIYPWISFS
ANO4_BOVIN/304-887.....AYLRLIN-------------RWRLEECHPSGCL--I------DLCMQMGIIMVLKQTW...NNFMELGYPLIQNW
ANO5_HUMAN/292-870.....KYTYLFN-------------EWRSEECDPGGCL--I------ELTTQLTIIMTGKQIF...GNIKEAIYPLALNW
A0D751_PARTE/565-1028............-------------...........DA--D------ELNIMSITFTIVWAVM...HYLRFTIVPLIHYS
Q8JFT1_DANRE/232-825....SYMFGKWS-------------TLRNEECAPGGCL--I------ELTTQLLIVMAGKQMV...GNVQEALLPLVRNW
Q1AP35_STRPU/306-885.....DYGRVFG-------------IWRQEECDPAGCM--Q------ELFINIAITMCGKQFF...NNFMELAMPVLMNF
Q17BF8_AEDAE/268-729............-------------...........DQ--D------KLKEQLAGLLISRQII...GNLRESAWPYLVEQ
A0CZD5_PARTE/224-675............-------------...........DI--P------TLRSLLIKLFVMDQIR...RVLLESLLPMLMKQ
Q4SBN7_TETNG/194-870............-------------...........DM--E------RLKEMLATLLIFRQFL...QNIKEVLQPYLYEQ
A7RKU9_NEMVE/227-807.....NYRRFAG-------------EYRLDGCSSGGCL--M------DLCIQLVIIMVGQQII...GNITEIAIPGLLKW
A0EDB1_PARTE/707-1149.........SLE-------------LCKVNDGI.SDCF--Q------ILSLQLSTIFISN.FS...GLVTAVVVPYVQEK
Q7S8J4_NEUCR/182-650KVTAQSFTTMEK-------------PV.TKSWEI..NP--D------RLTTQVIYFTVTAQIV...NFLTEVIVPYAKRK
A7STD6_NEMVE/128-561............-------------...........DI--A------LLRTHLAALMITSQVI...GQITESLVPYLMFR
Q55GA1_DICDI/227-693.....DLEDTCS-------------TPNKIDGLWKGCT--E------DLQFQLFSILAVNFIA...SIFSELLGPWIQYY
A0DK82_PARTE/835-1351............-------------.........KYTL--E------DIFYFIIPLVLVKKAY...YILVSFLIPVILLR
A0D675_PARTE/863-1384............-------------.........DYNL--E------DIFYFLIPLVLVKKAY...YILIDFLIPALIIR
A5DTZ8_LODEL/154-649GENRFFSKYLTK-------------LKSQRDFQI..NQ--G------RLNAQFFYFIVTNQVI...QIVLKYVLPLIITK
Q234J3_TETTS/795-1263.....NTTYIDF-------------CKSDQKDGQRDCF--D------VLRTQMISIFLINLI....KNIPELVVPLLKTF
A0EHC2_PARTE/551-1015............-------------...........DS--D------ELNIMSITLTIVWAIV...HLTRFTIIPLIKHQ
Q16TH0_AEDAE/334-773............-------------...........DM--K------MLKTQLMMQLIVLQFV...QNVLENLLPYLKKK
Q233Y7_TETTS/365-837............-------------...........DI--N------SLKSLLGSLFLLDEVR...KVATESVVPWVMKK
A0CY40_PARTE/679-1119............-------------.PLQLYCKEENCR--H------NVEYYFGTTMMLMFLM........QVIKFLMTF
Q4T7R8_TETNG/234-891............-------------...........DM--E------RLKEMLATLLIIRQFL...QNVKEVLQPYLYER
Q4SUU1_TETNG/210-658............-------------...........DM--V------LLRQSLATLLITSQIL...NQFMEAFLPYWLQR
A0BSX3_PARTE/784-1228.........QLK-------------LCQVNLEIQNDCF--Q------ILSNQMTTIFLTNIIS...LQIPKLVAPHIKAF
ANO1_HUMAN/320-928.....DYVYIFR-------------SFRMEECAPGGCL--M------ELCIQLSIIMLGKQLI..QNNLFEIGIPKMKKL
Q4P618_USTMA/365-904HSIQEAIKQGRI-------------SPKGIDFHI..NP--D------RMHTQLFAVSVTSQFV...NAFTELALPVLMRK
Q29GT2_DROPS/198-624............-------------...........DL--K------QLKYQLMMQLLIFQLL...CIAQEIGIPLMAVL
A1C9M0_ASPCL/169-650MTVRPFVSKEHA-------------TKLRTNFTI..DP--D------RLRKQVIYFTVTAQIV...GFALENIVPFVKQR
Q0IEX5_AEDAE/469-1043....VARKSEFF-------------RLKGDICDPAGCL--S------ELCIQLAIIMVGKQCW...NNLMEYFFPAFYNW
Q59PV1_CANAL/157-651GENRFYTKYLLK-------------LKSQEEFKI..NQ--G------RLDAQFFYFIVTNQVI...QLVLKYILPLGLRF
A0DPK7_PARTE/690-1130............-------------.PFDLYCKETNCS--D------HVQYHFATMIIWIFIF........KTFKIIKLL
Q4SSV5_TETNG/402-1010.....NYVYVFN-------------DYRMEECAPGGCL--I------ELCIQLSIIMLGKQLI..QNNIFEIGIPKLKKL
A0BM99_PARTE/778-1230............-------------...........DA--S------QLSVSVASIIITRGVI...SNVTSNFLPYFFFK
Q22HF6_TETTS/2687-3155.QVVQTQVVNGK-------------TVKTTVPGEINCF--N------VLQANIITIFLTMII....KTVLEVVIPFATQN
ANO7_MOUSE/277-825......NYHTLF-------------GIRNEECPAGGCL--S------ELAQELLVIMVGKQII...NNVQEVLVPKLKGC
Q5BAF3_EMENI/273-754LTVRPFVSKEKA-------------TTAHENFTI..NP--D------RLRKQVIYFTVTAQVV...GFAMETIVPFLKQR
Q8I4C3_CAEEL/218-758............-------------...........DM--K------RLQETLATLLITRQVT...QNIMETVVPFMIEK
A0DMZ8_PARTE/532-1006............-------------.........DSTY--E------EIFYILVPVLVIKQLS...YLCAIMMIPQIIYK
A7F670_SCLS1/199-673AVKPFAENDEQM-------------TVSTAGFQI..DP--D------RLKKQIIYQNVTAQLV...NFAVEVIIPYAKRM
A0D6S4_PARTE/669-1110............-------------.PLNLYCSITNCE--R------HVKYYFSTIVILILFK........QIVKFGIFL
A0CHM6_PARTE/689-1129............-------------.PLGLYCKDENCQ--H------NVEYYFGTTMMWIFLM........QVIRFLKTF
Q0CVZ6_ASPTN/174-638..QTFTVGRLAK-------------SVDMSRLHI..DP--S------RLQQEIIYLSITGQVM...NFGEEVVLPYVKRV
Q4REV7_TETNG/320-956.....DYVYVFG-------------DYRMEECAPPGCL--I------ELCIQLSMIMLGKQLI..QNNVFEVLIPKLKKM
A7RKU8_NEMVE/172-744.....RYKRIAG-------------KYRLDGCSEQGCF--L------ELCIQLIIIMVGQQII...GNITEIAIPALMEW
A7REU8_NEMVE/125-679......NYGTIF-------------GLRNEECSPGGCL--I------ELAQQLAVIMIGKQVI...GNIQEVFIPELKKY
A0DBP1_PARTE/583-1035............-------------.QTIGCVNDNYCY--S------QLQIYMRVVFIIEFGK...HILFGFIFPIIKQI
A0BSX4_PARTE/787-1230.........QLQ-------------LCKVSEEVQNDCF--Q------VLSNQMTVIFLSN.IG...KNIPELATPYIKAF
A0DMG8_PARTE/258-772............-------------...........DI--N------QLKQEMIQMFMVDELR...RIMTETILPSISKL
Q175J3_AEDAE/362-937......NYNRFF-------------NFRQEECGFGGCL--M------ELCIQLGIIMIGKQAV...NTVLEMAIPIFYKW
A0E006_PARTE/685-1125............-------------.PLSLYCQEENCK--Q------QVQYLFGTTICWIFCA........QVIKFVKLF
A0BM92_PARTE/792-1345............-------------.KFGLHCAHSDCL--K------HSCYHFATMFILQFLINVFLKTRIFVFNFLKDL
A0EAT8_PARTE/668-1109............-------------.PLNLYCARTNCE--R------HVKYYFSAIVILILFK........QIVNFCIFL
A7SBX8_NEMVE/221-663............-------------...........DL--T------RLKNTLGALLITKQVV...GNVKEALVPFVKQK
A0C896_PARTE/868-1320............-------------.ELGIDCAYGDCN--L------NAKYFFSSLFIILFVF....NIKEVVTPVINKL
Q5AX15_EMENI/167-626.....PYLDFTR-------------RTEKQDFHV..DN--A------RLQQEVIYLSMTGQVV...DFGTEVVLPYVQRV
Q4SV37_TETNG/23-638......NYKRIA-------------GWRLEECHPSGCL--T------DLFIQMSIIMLLKQTL...NNIFEFTVPWVKNC
Q16MH3_AEDAE/340-935......KYNRIL-------------GFRQEECQPGGCL--M------ELSVQLAIIMIGKQTV...SLIRDFSIPYFVKQ
Q6CB66_YARLI/1924-2410.VFQELINFLVG-------------DTVVKPFTV..DS--S------RLYDQMIYFLGTAQVI...NFVLSRALPIVIRF
A0DAH3_PARTE/688-1129............-------------.PLNLYCSKSNCS--R------HVQYYFSTIIIWQFLF........KILQLFKFI
Q4S1F6_TETNG/540-1136....AYMFSKWS-------------KLRNEECDPGGCL--I------ELTTQLVIVMTGKQVW...GNIQEALVPWLMNW
Q2H0D1_CHAGB/191-672QLTVQRFTAEGQ-------------PLPTKEWEI..NP--N------RLTKQVIYLTVTAQVV...NLATEFIVPYAKRK
A0C1K4_PARTE/730-1174.........SLS-------------LCKTSEGIN..CY--R------ALKDQMVTIFMVNFA....KTLPQLITPCIKAF
A7RJQ8_NEMVE/222-776.....GRYTRIG-------------GGRLEGCDPSGCL--I------ELCIQLAIILGGKQAI...SLIIKIVLPCLWRW
Q23AS7_TETTS/863-1350............-------------.............--.------.....LLPIMLIKQIN...YTILNVWLPIFLYN
A2R347_ASPNC/170-649LTVRPFVSKEDA-------------NSRRTEFSI..DP--D------RLRKQVIYFTVTAQAV...NFAMETIVPMLKQR
A0C5J6_PARTE/679-1109............-------------.ELNLKCSQNNCI--G------QAQYFFGTTLLLTIIN.................
Q0CNB9_ASPTN/169-648LTVRPFVSKEHA-------------TKARTKFTI..NP--D------RLRKQVIYFTVTAQAV...NFAQETIVPMLKQR
Q08BD4_DANRE/215-664............-------------...........DM--P------LLRKRLSSLLIVTQVV...GQFTEVVVPFLVDR

PF02714

YAB9_SCHPO/387-708--W.....ELAK.............DTTSFAHFLANRL..P......HQAQFFIDLIVLQGIG-MFPLKLIQLGKLSSYF
Q756H9_ASHGO/339-665--L...IKELIN.............NPTAIMNELALKV..P......QASNFYLGYIVTILLS-LSSSLLLQLAPLVLFY
Q0V7D2_PHANO/253-586--F...VASVIAAQDRG...VWQAIQDGHLFSQLMTGL..C......NVSTFWLTWQMQRNL.-GAAIDLSQAWIFTWSW
Q6BLR7_DEBHA/320-645--V...VEKIID.............NPTSAMKILATNL..P......KSSNFFISYIALQGLT-VSSGALLQIVGLFLYY
Q0P5M3_BOVIN/53-397--LFFRWLFDKK............FLAEAAIRFECVFL..P......DNGAFFVNYVIASAFI-GNAMDLLRIPGLLMYM
Q28ZW6_DROPS/345-661--A...LLEWGV..............TNGTGRWQCIFL..P......DRGSFYVNYIITAAFI-GTALELLRFPELIVYI
Q0UCF6_PHANO/629-953--A...IQKIVD.............NPISVPQTLAENL..P......KAANYFFSYMILQALS-ISSGTLLQIGAVVVIV
Q6BHX0_DEBHA/347-676--Y...WSFLSD..............TTKIAYQLASSL..K......SLSLFYVDLILLQGLA-MFPVRLLQIGDVVILN
Q0V4S6_PHANO/338-663--V...VSQIAN.............NPTSIPQLLADKL..P......SASNTYLTYFIIQGLS-NAPSNVLNYSDVLSWA
Q6BI49_DEBHA/417-734--S......................DTTEIAYQLAQSL..R......KLSLFYVDLIILQGLG-IFPYKLLSLGNLFKFS
Q6BHN0_DEBHA/405-733--I...FKQIVD.............QPTSIPVLLATNL..P......KAATFFFQYITLKAFA-FCGNNFLRIGPLMLHL
Q0UJ62_PHANO/323-659--M...ITLVVKYARDEHQPFMQIIREIQIFDTIMQTL..C......NVSPFWVTWLVQRNL.-GAAIDLSQVANLAWGS
TM63A_HUMAN/350-693--FFFRWLFDKT.............SSEASIRLECVFL..P......DQGAFFVNYVIASAFI-GNGMELLRLPGLILYT
Q7S914_NEUCR/334-669--F..GATVIKNTATDD..DAWQAILDADFGTTVFVSL..C......GISPFWVVWLIQRQL.-GAAIDLSQLWKLIYGS
Q2QLP9_ORYSJ/304-621--Q....LNVLS.............SPKDIPVQLARAI..P......VQATFFITYVLTSGWA-SLSSELMQLFGLIWNF
Q5JLH8_ORYSJ/319-642--Q...LKTFLH............QSANEIPRTIGEAI..P......MKATFFITYVMVDGWA-GVAGEILRLKPLIIFH
Q7SFU1_NEUCR/389-716--IIDVLRESLK.............DTTYIAYVLASKI..E......NLGVFYTNFIMLQGIG-LFPFRLLQFGSVSLYP
Q5B9A0_EMENI/329-664--F...IAAVIDLKNKNEDPWQAVQDGQFYIKAFSAMC.........NVSPFWVTYLLQRNM.-GAAIDLVQFVHLIWVW
A1CSW7_ASPCL/614-938--I...IDNVTN..............VTSWPELLAQNI..P......SSSNYFFSYMILQALS-VSAGALVQIFGLVSWF
Q4RLY6_TETNG/333-656--LFFTWLFDIN............FLDEKDVKFQCVFL..P......DNGAFFVNYVITSSLI-GTSMELLRIPALSVYM
Q9SY14_ARATH/320-643--Q...LKSFLE............QPPTEIPKTVGVSI..P......MKATFFITYIMVDGWA-GIAAEILRVVPLVIFH
Q75JX3_DICDI/409-732--S...ISAIID.............NPPSITTTLANSL..G......GLSYAMINYVLLAA.T-SLTMNLLRISDLLVDQ
Q55HL4_CRYNB/375-703--A...LGNLGD.............TAGEVPTLLATKL..P......GASIFFLTFILTATLS-GAAKTYARLVPWIMYL
SPO75_YEAST/420-748--I...IERLLN.............NPVSIPALLANDL..P......KCANFFCSFVLIRGMA-YAGGNLLRIKELL.FE
Q5KMP4_CRYNJ/407-736--S...IQQFAD.............NPGSAATTLATQM..P......TASTFFITLILTQ.FT-GTMGSLLRVVNLLLYY
Q6FVT6_CANGA/437-765--L...LEKLLI.............SPVSIPNILAHDL..P......KSSNFFCSFILLRGFA-YSGGNIIRLKELFFEI
Q6CTP0_KLULA/338-664--T...VTDIID.............EPDSAMTLLAQNL..P......KASNFYIAYFLLQGLT-VPSGALLQVVALILSK
Q9C792_ARATH/233-550--K...LSVILD..............PKQIPLKLAVAV..P......AQASFFIAYVVTTGWT-DTLTELFRVVPFMVSY
Q5A2N5_CANAL/333-659--V...ATQIVQ.............NPGEALQKLSSSF..P......KSVNFYYSYLCLEGLT-ISSGVLLQIVALILSH
Q2TX45_ASPOR/301-610--M...IPEIVN.............NVQSVPALLAKNL..P......KSGNYFYSYFLLQTVT-QTALILFRLPDSLWMC
O15741_DICDI/138-463--S...IEQIAN.............DPTSIIGSIANSL.........GGLSFQMINYILIAAA-GSFGAILRIVGLIIQL
Q4P7M9_USTMA/339-676--LVSQLVVEINH...........DSALAIIKKLGRNAAYATKQQYLNQSNYWLTWLPLRGY.-LAVFDLAQVIKLLLVW
Q0CNN2_ASPTN/330-664--F...VAAVVDAQRDE..NAWQAIKDGDFYQKIMSAL..C......QVSPFWVTYLLQRNL.-GAAVDLVQLVNVFWVW
Q55X91_CRYNB/416-752--TYLTISEDIGKESW....STIYAGLGDVPAKVTQAY..I......SESLYWLSWYPIRSV.-VACLQLLQIPRLILKT
Q5ANH1_CANAL/429-746--V......................DTTKIAFDLARSL..R......DLSMFYVDLIILQGLG-IFPFKLLLVGNLL.RF
Q6FQA3_CANGA/332-658--T...VTAIID.............EPGSAMTLLANNL..P......KASNFFITYFLLQGLT-MPTGQLLQVANLILSK
Q0UR74_PHANO/337-666--V...VRSVIN.............DPGSALTVLSENL..P......KASNFYISYFILLGLS-SAAGTLLNIGGFVVVV
A1C5G9_ASPCL/369-694--A...TAQIIK.............DPLSAKDLLAENL..P......KATNFYISYFLLQGLT-MSSMAVVQVAGMIVFK
Q7SA72_NEUCR/715-1042--T...IANITQ.............DITSTPEVLAENL..P......KAANYFFSYMILQALS-TSSGTLLQIGTLFMWY
Q16T32_AEDAE/332-653--AFLQWTIHYN................ETYRWECIFL..P......DKGAFFVNYIITAAFI-GTALELIRFPDLICYI
Q6CNN9_KLULA/328-653--T...VTAIVE.............EPTSAMNLLAENL..P......KSSNFYVGYIILQGLS-ISSGALLQIVPLILFF
PHM7_YEAST/330-656--T...VDSIID.............RPRSAMTLLANNL..P......KASNFYIMYFILKGLT-GPTWTILQAVNLLLSK
Q9FVQ5_ARATH/322-645--Q...LHSFLH............QSPSQIPRTIGVSI..P......MKATFFITYIMVDGWA-GIAGEILRLKPLVIFH
Q29VG6_PICAN/391-712--Y...WGYLSD..............SKKLALQLATSL..R......GLSSFYVDTILLQGLA-LMPLKLLITGHVLRFM
Q2QN15_ORYSJ/290-606--Q...LEIFLD..............PKEIPKRLAVVV..P......AQASFFITYVVTS.WT-SIASELTQTAALLFHL
YA7D_SCHPO/319-647--A...VVQVIK.............EPASSMTLLASNL..P......KASNFYISYFLLQGLS-IPGGALLQIVTLLLSK
Q2H2M5_CHAGB/343-667--V...AEQIVN.............NPTSAPSILASNL..P......KASNLYISYFIVQGLT-IATSVLTQVVGFFIFS
Q4PBK2_USTMA/367-698--IAEYVQRVAS.............QPTQFPGLLAEAI..P......KGSLFFLSFIALQGLS-GAAGLFAQIAPLIVYY
Q6CQA3_KLULA/381-702--Y...WGYLSD..............TTKIAYQLSTSV..K......EFSLFYVDLIIFQGIG-MFPFKLLLVGSLIGFP
Q55IG1_CRYNB/356-687--AIARIVVQVG.............GHQSVGTILKGFEDIP......DQIQ..GTYVQQSTCF-LVIFELIQLIKLAMVS
Q2GZW7_CHAGB/335-670--F..TATVVQKTEKGI..DAWEAFVDADIGQTLFMSL..C......GVSPFWVTWLLQRQL.-GAAIDLAQLWALLSSF
Q5BGH8_EMENI/1921-2251--FYGLWEHLRDS..........FKDATTIATALANSL..E......NLAPFYMNVFVLQGLG-LFPLKLLEVGSVFLYP
Q94II2_ARATH/227-551--T...VKDIAKN...........PKLDMIINLLATSL..P......KSATFFLTYVALKFFI-GYGLELSRIIPLIIFH
Q6CJU8_KLULA/487-816--V...VETVVN.............NPINIPHLLGTNL..P......KCSNFFCSFVLIRGIA-YFGGNLLQSKNLFFYL
Q8SV30_ENCCU/436-763--L...FSDVLS.............RNKEIYDIVEAFSKES.....LESSVFFANIIIQKSLV-GTALTLLKPAPLLINY
A0JP96_XENTR/352-691--LFFRWLFDIH............FLDEANIKFQCVFL..P......NNGAFFVNYVITASLI-GTAMELLRFPGLTVYA
Q5JKX1_ORYSJ/300-617--Q...IGESFT.............HPKDIPSRLARAV..S......AQSDFFITYILTDGMS-GFSLEVLQFGLLTWHF
TM63C_MOUSE/341-680--VFLRWLFDIY............YLEHATIRFQCVFL..P......DNGAFFINYVITAALL-GTGMELMRLGSLC.TY
Q6AU79_ORYSJ/320-643--Q...LNNFIH............QSANKIPEIVGESI..P......MKATFFITYVMVDGWA-GVAAEVLRLKPLVMFH
Q757I3_ASHGO/332-658--T...VTAIID.............DPNNAFEQLAQNM..P......LSANFYLSYVMLFAFI-FASGVLLQLTGFVLSF
Q7RWN3_NEUCR/470-795--A...IIDVIK.............QPMSAPNLLAQNL..P......KASNFYLSYILVQCLG-AGAGKLANVSDLLRHY
Q6CA07_YARLI/344-669--T...VQQIVD.............TPTSTPTILANNL..P......KAANFFMSYLILQGMI-TSMNNMLRVDELIFHL
Q55T89_CRYNB/445-776--L...VRDLVD.............TPMKIPEKLARALQGS......NVRNFMVSYVMLQALG-LMPLQLLNLGPLFSLA
Q2HEX8_CHAGB/384-711--IFDVLRNSLK.............DTTYIAYTLARKI..E......ELSVFYTNFIMLQGLG-LFPFRLLELGSIAQYL
Q9M1H6_ARATH/298-615--E...IGEYLT.............HPRDIPSHLAAAV..S......AQAEFFMTYILTDGLS-GFSLEILQLGLILFDI
A1CS74_ASPCL/381-711--FYQFWETLRDA..........FKDATAIAFALAKSL..E......SFAPFYINLIMLQGLG-LFPFRLLEFGSVAMYP
Q4P987_USTMA/583-906--V...LQELAE.............NPMRVIDKLAASL..P......KARFFSLSYVILQGIA-LQPLQLLQLPTLILRA
O65460_ARATH/249-572--Q...LNSFLN............QSANQIPKTIGVAI..P......MKATFFITYIMVDGWA-GVAGEILMLKPLIMFH
YGV8_SCHPO/320-656--LGVIIAYKTKEEGNFAEGMSAFATFDTVGLSVSSFV.........QFSTFWIMFIAHSTCS-FF.VEIAQPITLTIRL
Q59MD1_CANAL/360-689--Y...MSYISD..............TTKIAVQLATSL..R......RMALFYVDLILLQGLT-MFPVKLLQVSDFFLLN
Q6C0S9_YARLI/412-736--I...FQYLKD..............TTSIAYKLASSL..K......KWALFYVDLIVLQGIG-MFPFRLLEFGNLLRFG
RSN1_YEAST/335-660--T...VTEIVK.............EPTKAMDLLASNL..P......KASNFFMSYVILQGLS-ISSGALLQIVPLILFY
Q6C266_YARLI/333-657--T...VKAIKD.............NPGSVMTMLSGNL..P......KSSNFFVSYIMLQALS-FPGGALLQIVALILFK
Q75GI5_ORYSJ/304-621--Q...LNVFTR..............PRDMPSMLAELV..P......KQATFFITYVLTSGWA-SLCSEILQVYNLVYNF
Q59TM5_CANAL/389-717--I...LKQIID.............QPTSIPVLLATNL..P......KSATFFFQYISLRAFA-FCGNNFLRISPLIQSL
Q7SAG4_NEUCR/349-673--V...AKQIAD.............NPGSVTKLLSENL..P......KSSNFYISYFIVQGLS-IATSVLTQVVGFFVFN
Q2H842_CHAGB/434-758--A...VFDIIQ.............NPLMVKDMLSENL..P......KASNFYLSYILIQCLA-AGTTRLANVGDLIRHE
Q5APG0_CANAL/320-645--T...ITEIID.............KPTSAMSILANKL..P......LSSNFYISYLVLQGFS-IAGGSLFQVVGLFLYY
Q54RR3_DICDI/361-689--ILFKMLENLT..............LKDIATLLGQSL..P......KQSSFFINYILVQALT-SVPMDIVRPIELIAGI
Q6FSA1_CANGA/317-642--T...VTQIVE.............EPTSAMRLLAENL..P......KASNFFIAYIILQGMS-IASGSLLQISPLAMFY
Q6ZLQ0_ORYSJ/321-643--A...LTTIIN.............NPPGIVNMLASSL..P......GSATFFLTFVALKFFV-GYGLELSRLVPLIIFH
Q75FA6_ASHGO/525-853--I...VEKLVN.............NPVSIPDLLGTNL..P......KSSNFFCSFMLIRGLS-YFGGNFMQVKSLL.FE

PF07810

TMC3_HUMAN/499-614-----------------------------------------------LFVRYLSD.YWCWDLE-----------------
TMC4_HUMAN/475-585-----------------------------------------------LLCGLC......PGAL-----------------
Q29CY9_DROPS/1115-1230-----------------------------------------------LFVRYVNQ.NWCWDME-----------------
Q571H8_MOUSE/303-413-----------------------------------------------LLVERF......SGWF-----------------
Q5YCC6_CHICK/187-293-----------------------------------------------LILE..........KK-----------------
Q6GPL8_XENLA/460-566-----------------------------------------------IILE..........KK-----------------
Q16VL2_AEDAE/432-538-----------------------------------------------AMNRYY..........-----------------
Q7T1T6_TAKRU/445-555-----------------------------------------------MLVDNW......SNKL-----------------
Q7Z015_ANOGA/481-596-----------------------------------------------LFVRYMNS.CWCWDLE-----------------
Q7Z014_ANOGA/399-515-----------------------------------------------LLHARYGPARGRAGPL-----------------
Q6NUU5_DANRE/502-612-----------------------------------------------MVVQHW......RCGV-----------------
Q7Z013_ANOGA/385-495-----------------------------------------------LFARHS......SSRL-----------------
TMC7_HUMAN/486-597-----------------------------------------------LLVTYC.....SSCKL-----------------
Q4T0I6_TETNG/432-547-----------------------------------------------VIVRFLNY.CWCWDLE-----------------
TMC7_CHICK/480-590-----------------------------------------------LLVTYC......SWKL-----------------
Q7T1U0_TAKRU/540-646-----------------------------------------------LFSE..........RV-----------------
Q0VCU9_BOVIN/548-654-----------------------------------------------LFSE..........KQ-----------------
Q3MI88_HUMAN/482-597-----------------------------------------------CFVRFCNY.CWCWDLE-----------------
Q7T1T9_TAKRU/475-577-----------------------------------------------..............QL-----------------
TMC5_RAT/683-789-----------------------------------------------LIGM..........KF-----------------
A7RLV1_NEMVE/180-290-----------------------------------------------YAADHL......GKGI-----------------
Q7T1T8_TAKRU/369-471-----------------------------------------------WL..............-----------------
Q4S012_TETNG/224-335-----------------------------------------------FLQEAC.....PSSLL-----------------
A7SUG1_NEMVE/384-492-----------------------------------------------VFYNKF........SC-----------------
A2BFV3_DANRE/430-545-----------------------------------------------VLVRFLNN.CWCWDLE-----------------
Q4S7Q9_TETNG/466-576-----------------------------------------------LIVRHC......DWGL-----------------

PF04547

CACLC_ARATH/188-630................................................................................
ANO2_HUMAN/352-944................................................................................
ANO9_HUMAN/179-740................................................................................
Q9VYS8_DROME/350-933................................................................................
ANO6_HUMAN/287-872................................................................................
A5DIJ8_PICGU/65-553................................................................................
A0CKQ3_PARTE/818-1263................................................................................
Q6NUA4_XENLA/167-596................................................................................
Q16MH2_AEDAE/199-778................................................................................
Q2UDH7_ASPOR/180-663................................................................................
Q2U154_ASPOR/174-639................................................................................
A0DD09_PARTE/537-1000................................................................................
Q4SPC5_TETNG/131-466................................................................................
YNG5_SCHPO/170-627................................................................................
A6RD03_AJECN/171-655................................................................................
A0CE73_PARTE/768-1287................................................................................
A7S3G0_NEMVE/17-561................................................................................
A7RKU7_NEMVE/244-824................................................................................
Q86P24_DROME/304-882................................................................................
ANO3_MOUSE/384-951................................................................................
A7REV0_NEMVE/214-763................................................................................
ANO10_DANRE/200-629................................................................................
ANO8_HUMAN/237-880LGRGELGLRAVWELARALLGLLSLRRPAPRRLEPQADEGGGGGSGGGGRRCLSGGCGAPEEEEEAALVERRRAGEGGEEG
ANO10_MOUSE/200-629................................................................................
A1D9V1_NEOFI/173-637................................................................................
A4HVK2_LEIIN/428-971................................................................................
A4H763_LEIBR/371-928................................................................................
Q6DDQ3_XENLA/273-852................................................................................
A0DPP4_PARTE/705-1145................................................................................
A0CIB0_PARTE/859-1305................................................................................
Q24E70_TETTS/215-696................................................................................
A0DHW5_PARTE/686-1116................................................................................
A3LWT2_PICST/162-656................................................................................
A0CMD7_PARTE/544-1006................................................................................
ANO4_BOVIN/304-887................................................................................
ANO5_HUMAN/292-870................................................................................
A0D751_PARTE/565-1028................................................................................
Q8JFT1_DANRE/232-825................................................................................
Q1AP35_STRPU/306-885................................................................................
Q17BF8_AEDAE/268-729WKLAKLSF........................................................................
A0CZD5_PARTE/224-675................................................................................
Q4SBN7_TETNG/194-870NKLGVFTPKVLWELFQAIVLKYGRLALGKAQASMTGYSFL.......................................G
A7RKU9_NEMVE/227-807................................................................................
A0EDB1_PARTE/707-1149................................................................................
Q7S8J4_NEUCR/182-650................................................................................
A7STD6_NEMVE/128-561................................................................................
Q55GA1_DICDI/227-693................................................................................
A0DK82_PARTE/835-1351................................................................................
A0D675_PARTE/863-1384................................................................................
A5DTZ8_LODEL/154-649................................................................................
Q234J3_TETTS/795-1263................................................................................
A0EHC2_PARTE/551-1015................................................................................
Q16TH0_AEDAE/334-773V...............................................................................
Q233Y7_TETTS/365-837................................................................................
A0CY40_PARTE/679-1119................................................................................
Q4T7R8_TETNG/234-891HKLGELTPRAVWDLLLSVLLKYARLAAGKAQSSPSDQTEQGLGLRSS.........................RPGEKKCL
Q4SUU1_TETNG/210-658................................................................................
A0BSX3_PARTE/784-1228................................................................................
ANO1_HUMAN/320-928................................................................................
Q4P618_USTMA/365-904................................................................................
Q29GT2_DROPS/198-624................................................................................
A1C9M0_ASPCL/169-650................................................................................
Q0IEX5_AEDAE/469-1043................................................................................
Q59PV1_CANAL/157-651................................................................................
A0DPK7_PARTE/690-1130................................................................................
Q4SSV5_TETNG/402-1010................................................................................
A0BM99_PARTE/778-1230................................................................................
Q22HF6_TETTS/2687-3155................................................................................
ANO7_MOUSE/277-825................................................................................
Q5BAF3_EMENI/273-754................................................................................
Q8I4C3_CAEEL/218-758LKLSS...........................................................................
A0DMZ8_PARTE/532-1006................................................................................
A7F670_SCLS1/199-673................................................................................
A0D6S4_PARTE/669-1110................................................................................
A0CHM6_PARTE/689-1129................................................................................
Q0CVZ6_ASPTN/174-638................................................................................
Q4REV7_TETNG/320-956................................................................................
A7RKU8_NEMVE/172-744................................................................................
A7REU8_NEMVE/125-679................................................................................
A0DBP1_PARTE/583-1035................................................................................
A0BSX4_PARTE/787-1230................................................................................
A0DMG8_PARTE/258-772R...............................................................................
Q175J3_AEDAE/362-937................................................................................
A0E006_PARTE/685-1125................................................................................
A0BM92_PARTE/792-1345Y...............................................................................
A0EAT8_PARTE/668-1109................................................................................
A7SBX8_NEMVE/221-663................................................................................
A0C896_PARTE/868-1320................................................................................
Q5AX15_EMENI/167-626................................................................................
Q4SV37_TETNG/23-638................................................................................
Q16MH3_AEDAE/340-935................................................................................
Q6CB66_YARLI/1924-2410A...............................................................................
A0DAH3_PARTE/688-1129................................................................................
Q4S1F6_TETNG/540-1136................................................................................
Q2H0D1_CHAGB/191-672................................................................................
A0C1K4_PARTE/730-1174................................................................................
A7RJQ8_NEMVE/222-776................................................................................
Q23AS7_TETTS/863-1350................................................................................
A2R347_ASPNC/170-649................................................................................
A0C5J6_PARTE/679-1109................................................................................
Q0CNB9_ASPTN/169-648................................................................................
Q08BD4_DANRE/215-664................................................................................

PF02714

YAB9_SCHPO/387-708--------------------------------------------------------------------------------
Q756H9_ASHGO/339-665--------------------------------------------------------------------------------
Q0V7D2_PHANO/253-586--------------------------------------------------------------------------------
Q6BLR7_DEBHA/320-645--------------------------------------------------------------------------------
Q0P5M3_BOVIN/53-397--------------------------------------------------------------------------------
Q28ZW6_DROPS/345-661--------------------------------------------------------------------------------
Q0UCF6_PHANO/629-953--------------------------------------------------------------------------------
Q6BHX0_DEBHA/347-676--------------------------------------------------------------------------------
Q0V4S6_PHANO/338-663--------------------------------------------------------------------------------
Q6BI49_DEBHA/417-734--------------------------------------------------------------------------------
Q6BHN0_DEBHA/405-733--------------------------------------------------------------------------------
Q0UJ62_PHANO/323-659--------------------------------------------------------------------------------
TM63A_HUMAN/350-693--------------------------------------------------------------------------------
Q7S914_NEUCR/334-669--------------------------------------------------------------------------------
Q2QLP9_ORYSJ/304-621--------------------------------------------------------------------------------
Q5JLH8_ORYSJ/319-642--------------------------------------------------------------------------------
Q7SFU1_NEUCR/389-716--------------------------------------------------------------------------------
Q5B9A0_EMENI/329-664--------------------------------------------------------------------------------
A1CSW7_ASPCL/614-938--------------------------------------------------------------------------------
Q4RLY6_TETNG/333-656--------------------------------------------------------------------------------
Q9SY14_ARATH/320-643--------------------------------------------------------------------------------
Q75JX3_DICDI/409-732--------------------------------------------------------------------------------
Q55HL4_CRYNB/375-703--------------------------------------------------------------------------------
SPO75_YEAST/420-748--------------------------------------------------------------------------------
Q5KMP4_CRYNJ/407-736--------------------------------------------------------------------------------
Q6FVT6_CANGA/437-765--------------------------------------------------------------------------------
Q6CTP0_KLULA/338-664--------------------------------------------------------------------------------
Q9C792_ARATH/233-550--------------------------------------------------------------------------------
Q5A2N5_CANAL/333-659--------------------------------------------------------------------------------
Q2TX45_ASPOR/301-610--------------------------------------------------------------------------------
O15741_DICDI/138-463--------------------------------------------------------------------------------
Q4P7M9_USTMA/339-676--------------------------------------------------------------------------------
Q0CNN2_ASPTN/330-664--------------------------------------------------------------------------------
Q55X91_CRYNB/416-752--------------------------------------------------------------------------------
Q5ANH1_CANAL/429-746--------------------------------------------------------------------------------
Q6FQA3_CANGA/332-658--------------------------------------------------------------------------------
Q0UR74_PHANO/337-666--------------------------------------------------------------------------------
A1C5G9_ASPCL/369-694--------------------------------------------------------------------------------
Q7SA72_NEUCR/715-1042--------------------------------------------------------------------------------
Q16T32_AEDAE/332-653--------------------------------------------------------------------------------
Q6CNN9_KLULA/328-653--------------------------------------------------------------------------------
PHM7_YEAST/330-656--------------------------------------------------------------------------------
Q9FVQ5_ARATH/322-645--------------------------------------------------------------------------------
Q29VG6_PICAN/391-712--------------------------------------------------------------------------------
Q2QN15_ORYSJ/290-606--------------------------------------------------------------------------------
YA7D_SCHPO/319-647--------------------------------------------------------------------------------
Q2H2M5_CHAGB/343-667--------------------------------------------------------------------------------
Q4PBK2_USTMA/367-698--------------------------------------------------------------------------------
Q6CQA3_KLULA/381-702--------------------------------------------------------------------------------
Q55IG1_CRYNB/356-687--------------------------------------------------------------------------------
Q2GZW7_CHAGB/335-670--------------------------------------------------------------------------------
Q5BGH8_EMENI/1921-2251--------------------------------------------------------------------------------
Q94II2_ARATH/227-551--------------------------------------------------------------------------------
Q6CJU8_KLULA/487-816--------------------------------------------------------------------------------
Q8SV30_ENCCU/436-763--------------------------------------------------------------------------------
A0JP96_XENTR/352-691--------------------------------------------------------------------------------
Q5JKX1_ORYSJ/300-617--------------------------------------------------------------------------------
TM63C_MOUSE/341-680--------------------------------------------------------------------------------
Q6AU79_ORYSJ/320-643--------------------------------------------------------------------------------
Q757I3_ASHGO/332-658--------------------------------------------------------------------------------
Q7RWN3_NEUCR/470-795--------------------------------------------------------------------------------
Q6CA07_YARLI/344-669--------------------------------------------------------------------------------
Q55T89_CRYNB/445-776--------------------------------------------------------------------------------
Q2HEX8_CHAGB/384-711--------------------------------------------------------------------------------
Q9M1H6_ARATH/298-615--------------------------------------------------------------------------------
A1CS74_ASPCL/381-711--------------------------------------------------------------------------------
Q4P987_USTMA/583-906--------------------------------------------------------------------------------
O65460_ARATH/249-572--------------------------------------------------------------------------------
YGV8_SCHPO/320-656--------------------------------------------------------------------------------
Q59MD1_CANAL/360-689--------------------------------------------------------------------------------
Q6C0S9_YARLI/412-736--------------------------------------------------------------------------------
RSN1_YEAST/335-660--------------------------------------------------------------------------------
Q6C266_YARLI/333-657--------------------------------------------------------------------------------
Q75GI5_ORYSJ/304-621--------------------------------------------------------------------------------
Q59TM5_CANAL/389-717--------------------------------------------------------------------------------
Q7SAG4_NEUCR/349-673--------------------------------------------------------------------------------
Q2H842_CHAGB/434-758--------------------------------------------------------------------------------
Q5APG0_CANAL/320-645--------------------------------------------------------------------------------
Q54RR3_DICDI/361-689--------------------------------------------------------------------------------
Q6FSA1_CANGA/317-642--------------------------------------------------------------------------------
Q6ZLQ0_ORYSJ/321-643--------------------------------------------------------------------------------
Q75FA6_ASHGO/525-853--------------------------------------------------------------------------------

PF07810

TMC3_HUMAN/499-614--------------------------------------------------------------------------------
TMC4_HUMAN/475-585--------------------------------------------------------------------------------
Q29CY9_DROPS/1115-1230--------------------------------------------------------------------------------
Q571H8_MOUSE/303-413--------------------------------------------------------------------------------
Q5YCC6_CHICK/187-293--------------------------------------------------------------------------------
Q6GPL8_XENLA/460-566--------------------------------------------------------------------------------
Q16VL2_AEDAE/432-538--------------------------------------------------------------------------------
Q7T1T6_TAKRU/445-555--------------------------------------------------------------------------------
Q7Z015_ANOGA/481-596--------------------------------------------------------------------------------
Q7Z014_ANOGA/399-515--------------------------------------------------------------------------------
Q6NUU5_DANRE/502-612--------------------------------------------------------------------------------
Q7Z013_ANOGA/385-495--------------------------------------------------------------------------------
TMC7_HUMAN/486-597--------------------------------------------------------------------------------
Q4T0I6_TETNG/432-547--------------------------------------------------------------------------------
TMC7_CHICK/480-590--------------------------------------------------------------------------------
Q7T1U0_TAKRU/540-646--------------------------------------------------------------------------------
Q0VCU9_BOVIN/548-654--------------------------------------------------------------------------------
Q3MI88_HUMAN/482-597--------------------------------------------------------------------------------
Q7T1T9_TAKRU/475-577--------------------------------------------------------------------------------
TMC5_RAT/683-789--------------------------------------------------------------------------------
A7RLV1_NEMVE/180-290--------------------------------------------------------------------------------
Q7T1T8_TAKRU/369-471--------------------------------------------------------------------------------
Q4S012_TETNG/224-335--------------------------------------------------------------------------------
A7SUG1_NEMVE/384-492--------------------------------------------------------------------------------
A2BFV3_DANRE/430-545--------------------------------------------------------------------------------
Q4S7Q9_TETNG/466-576--------------------------------------------------------------------------------

PF04547

CACLC_ARATH/188-630.......................................YRKY..............RARTKKKMED.............
ANO2_HUMAN/352-944.......................................FRKL..............KDETEAGETD.............
ANO9_HUMAN/179-740.......................................CRSL..............RASESGHLPR.............
Q9VYS8_DROME/350-933.......................................FKEL..............SYRHGWYKSH.............
ANO6_HUMAN/287-872.......................................IGRF..............HRVSGSEKIT.............
A5DIJ8_PICGU/65-553.......................................IKAL...............ISKKEPFNP.............
A0CKQ3_PARTE/818-1263.......................................YLKW..............GLKDKFETFK.............
Q6NUA4_XENLA/167-596.......................................RSSR..............KIKKKVKSLN.............
Q16MH2_AEDAE/199-778.......................................FREF..............RSVLGIESEE.............
Q2UDH7_ASPOR/180-663.......................................GLQK...............YKEY.KKRT.............
Q2U154_ASPOR/174-639.......................................VMQK...............WRDYRQKNV.............
A0DD09_PARTE/537-1000.......................................FIKI..............KFNWDFNKYK.............
Q4SPC5_TETNG/131-466.........................................................LLSAPHRTES.............
YNG5_SCHPO/170-627.......................................VKKH...............YMSKPTREL.............
A6RD03_AJECN/171-655.......................................LTRK...............YQKYTEENA.............
A0CE73_PARTE/768-1287.......................................REKKEENVEVQKNKKLTSQIDEIREDDE.............
A7S3G0_NEMVE/17-561.......................................WRQGCCC.......CRSNKVEEAGEVNS.............
A7RKU7_NEMVE/244-824.......................................IKER.................KEPKNKQ.............
Q86P24_DROME/304-882.......................................VLAI..............QVGLSRLFNN.............
ANO3_MOUSE/384-951.......................................WSRH..............KIKRGIQDAS.............
A7REV0_NEMVE/214-763.......................................IKRK..............KRGTSKDEIK.............
ANO10_DANRE/200-629.......................................RRNK..............RVYKRMRRLM.............
ANO8_HUMAN/237-880DGPPGGKEEDEDDEEEEDEEEEEDEEEGEEGGLLDCGLRLKKV..............SFAERGAGRRRPGP.SPEAL.LE
ANO10_MOUSE/200-629.......................................KYCA..............RVKRKVQALK.............
A1D9V1_NEOFI/173-637.......................................IWRK...............WRDYRLQKT.............
A4HVK2_LEIIN/428-971.......................................RRRVVRRLF....RASGGDTSSTPSEGS.............
A4H763_LEIBR/371-928.......................................RRRVVCRLF....RTGSVEPSSRPSHTS.............
Q6DDQ3_XENLA/273-852.......................................LKRR..............KARNHPENLY.............
A0DPP4_PARTE/705-1145.......................................INVK..............KIPIFKYKFE.............
A0CIB0_PARTE/859-1305.......................................SMKQ...............IKNKLFVEK.............
Q24E70_TETTS/215-696.........................................................KYRKQQEAQQ.............
A0DHW5_PARTE/686-1116.......................................FKVK.............EQFHINQQIQN.............
A3LWT2_PICST/162-656.......................................ASKL...............VKDVLNKGK.............
A0CMD7_PARTE/544-1006.......................................FIKL..............KFNWDFNKQK.............
ANO4_BOVIN/304-887.......................................WTRR..............KVRQEHGPER.............
ANO5_HUMAN/292-870.......................................WRRR..............KARTNSEKLY.............
A0D751_PARTE/565-1028.......................................IKKY..............FLNKEFELFL.............
Q8JFT1_DANRE/232-825.......................................WSSR..............KGRSHPESTY.............
Q1AP35_STRPU/306-885.......................................WRSR..............TGRKEEKSGK.............
Q17BF8_AEDAE/268-729...............................KMWGALSPTQEA..............PPPPSENKQL.............
A0CZD5_PARTE/224-675.........................................................QYEKQKEQYR.............
Q4SBN7_TETNG/194-870PRGVPVGQGGNPEPRRRGDLKAGFRLTEEEWDMSDSGLKQRKV..............SFTEKVDYQDVGTETQAGYESFL
A7RKU9_NEMVE/227-807.......................................WKMR..............QAQKEAFEEI.............
A0EDB1_PARTE/707-1149.......................................LMKK.................MKAIDEI.............
Q7S8J4_NEUCR/182-650.......................................VFKK...............VQEVQSEFT.............
A7STD6_NEMVE/128-561.......................................SRVT..............TLSKEGKKIV.............
Q55GA1_DICDI/227-693.......................................IKII..............RQKPTGFREK.............
A0DK82_PARTE/835-1351.......................................GSIRSY..........FKKVKDITIEQK.............
A0D675_PARTE/863-1384.......................................AKIKIY..........FSKVKEVSQDQR.............
A5DTZ8_LODEL/154-649.......................................VTNI...............IQTKVQKKP.............
Q234J3_TETTS/795-1263.......................................AKKA.................LRDSHKN.............
A0EHC2_PARTE/551-1015.......................................IRSY..............FLNTEYQQYM.............
Q16TH0_AEDAE/334-773.....................................ALISNK..............LFVKSNYERL.............
Q233Y7_TETTS/365-837.......................................IISM..............KKQKETNPEE.............
A0CY40_PARTE/679-1119.......................................QNDM.............VKNPQKLYPNN.............
Q4T7R8_TETNG/234-891NGGCGVPEEEEGVDRDEADSGRFSEGETEEESLIDCGLKLRKV..............SFIEKVEEKSGGHAMDSSFMEEG
Q4SUU1_TETNG/210-658.......................................RRNK..............KMLRKVQKRR.............
A0BSX3_PARTE/784-1228.......................................ITNL.................LTKKDEK.............
ANO1_HUMAN/320-928.......................................IRYL..............KLKQQSPPDH.............
Q4P618_USTMA/365-904.......................................FNEW...............REQRSEKTS.............
Q29GT2_DROPS/198-624.........................................................RQKYAKFRHR.............
A1C9M0_ASPCL/169-650.......................................LCRK...............YKAYAQKQH.............
Q0IEX5_AEDAE/469-1043.......................................WRQR..............KHKQLTKDET.............
Q59PV1_CANAL/157-651.......................................VFNF...............IETKIQKKP.............
A0DPK7_PARTE/690-1130.......................................YYVK..............KIPIFKYTFY.............
Q4SSV5_TETNG/402-1010.......................................LREL..............KNKNPAVAER.............
A0BM99_PARTE/778-1230.......................................QEKK..............MFSDKFFEFK.............
Q22HF6_TETTS/2687-3155.......................................AMKL...............LKKKLLSRG.............
ANO7_MOUSE/277-825.......................................WQKF..............SRGKKAGTGT.............
Q5BAF3_EMENI/273-754.......................................FARE...............YKEYKKKKY.............
Q8I4C3_CAEEL/218-758..................................LTYKMTRSMSDGTLRRHVENVRNKRQNSVEQEE.............
A0DMZ8_PARTE/532-1006.......................................YKESSY..........FKLFKEKLNLKQ.............
A7F670_SCLS1/199-673.......................................VFRK...............YKEIQADRT.............
A0D6S4_PARTE/669-1110.......................................FKLT..............KIKIKCYDYN.............
A0CHM6_PARTE/689-1129.......................................FHEL.............VKSPQKLYPYN.............
Q0CVZ6_ASPTN/174-638.......................................LRQK...............WRDYREKKT.............
Q4REV7_TETNG/320-956.......................................YRTIQ...........EEKGKKKASEKN.............
A7RKU8_NEMVE/172-744.......................................MKRR.................KEPKDKQ.............
A7REU8_NEMVE/125-679.......................................LKNR..............KRQNSKDEDE.............
A0DBP1_PARTE/583-1035.......................................YQRARYGF......VSIVDFGGSLQKKT.............
A0BSX4_PARTE/787-1230.......................................ITKQ.................MKSKTTK.............
A0DMG8_PARTE/258-772.....................................LIRYEK..............SIVKSLPESQ.............
Q175J3_AEDAE/362-937.......................................LNSL..............KVRIGKQRNQ.............
A0E006_PARTE/685-1125.......................................FQEK.............KNYESNKQQSL.............
A0BM92_PARTE/792-1345.....................................LKIKNPKRSDTKYTHLNLNVNSHQSKSQNT.............
A0EAT8_PARTE/668-1109.......................................FKLT..............KIKIKSYDYN.............
A7SBX8_NEMVE/221-663.......................................VKEW..............KMKKQAAKAK.............
A0C896_PARTE/868-1320.......................................FNRT...............QEQPETIDE.............
Q5AX15_EMENI/167-626.......................................IWQK...............WRDYQSRKE.............
Q4SV37_TETNG/23-638.......................................LSRS..............TANKLQRKCG.............
Q16MH3_AEDAE/340-935.......................................YREW..............RKRNSKEEDD.............
Q6CB66_YARLI/1924-2410.....................................LPVISK...............IRGVVVAAP.............
A0DAH3_PARTE/688-1129.......................................SDLA..............KYPKIKYEIN.............
Q4S1F6_TETNG/540-1136.......................................WGSR..............KARRHPESLY.............
Q2H0D1_CHAGB/191-672.......................................IFRT...............VERVQSELS.............
A0C1K4_PARTE/730-1174.......................................IRGK.................TKQVDEN.............
A7RJQ8_NEMVE/222-776.......................................WNRR..............SQRNLLETGE.............
Q23AS7_TETTS/863-1350.......................................RAEKNY..........FKQVNKKIMDHE.............
A2R347_ASPNC/170-649.......................................LSRE...............YKEYNRRKQ.............
A0C5J6_PARTE/679-1109.......................................VKRRI............QQIKEKSYSSK.............
Q0CNB9_ASPTN/169-648.......................................FAQK...............YKEYLKKRN.............
Q08BD4_DANRE/215-664.........................................................FLTSANRNLK.............

PF02714

YAB9_SCHPO/387-708---------------------------------------VRRS--------------FVP.....YS-------------
Q756H9_ASHGO/339-665---------------------------------------VMGL--------------LFD......S-------------
Q0V7D2_PHANO/253-586---------------------------------------IQRK--------------CFS......P-------------
Q6BLR7_DEBHA/320-645---------------------------------------ILGA--------------LLD......S-------------
Q0P5M3_BOVIN/53-397---------------------------------------IRLC--------------LAR.....SA-------------
Q28ZW6_DROPS/345-661---------------------------------------WSLL--------------KAN......S-------------
Q0UCF6_PHANO/629-953---------------------------------------FLR.--------------FLD......T-------------
Q6BHX0_DEBHA/347-676---------------------------------------VIGK--------------IFLLKNIILK-------------
Q0V4S6_PHANO/338-663---------------------------------------FFDK--------------FFD......K-------------
Q6BI49_DEBHA/417-734---------------------------------------IGAL--------------FWC......K-------------
Q6BHN0_DEBHA/405-733---------------------------------------TVHK--------------IKD......K-------------
Q0UJ62_PHANO/323-659---------------------------------------FSRK--------------FLN......P-------------
TM63A_HUMAN/350-693---------------------------------------FRMI--------------MAK......T-------------
Q7S914_NEUCR/334-669---------------------------------------IMRK--------------FTN......P-------------
Q2QLP9_ORYSJ/304-621---------------------------------------VRKY--------------ILR.....MP-------------
Q5JLH8_ORYSJ/319-642---------------------------------------LKNF--------------FLV......K-------------
Q7SFU1_NEUCR/389-716---------------------------------------INR.--------------.LG.....AK-------------
Q5B9A0_EMENI/329-664---------------------------------------FAKT--------------FLA......P-------------
A1CSW7_ASPCL/614-938---------------------------------------ILAP--------------LLD......T-------------
Q4RLY6_TETNG/333-656---------------------------------------LRLC--------------FAR.....SQ-------------
Q9SY14_ARATH/320-643---------------------------------------LKNT--------------FLV......K-------------
Q75JX3_DICDI/409-732---------------------------------------FKLK--------------FI......CK-------------
Q55HL4_CRYNB/375-703---------------------------------------LRDI--------------LAG......G-------------
SPO75_YEAST/420-748---------------------------------------LFYY--------------KWK.....RS-------------
Q5KMP4_CRYNJ/407-736---------------------------------------VRII--------------LLG......G-------------
Q6FVT6_CANGA/437-765---------------------------------------VYYR--------------PRM......P-------------
Q6CTP0_KLULA/338-664---------------------------------------VLGR--------------VLD......K-------------
Q9C792_ARATH/233-550---------------------------------------IKRS--------------FEP......S-------------
Q5A2N5_CANAL/333-659---------------------------------------ILGR--------------ILD......G-------------
Q2TX45_ASPOR/301-610---------------------------------------LRRD--------------..........-------------
O15741_DICDI/138-463---------------------------------------IKLK--------------WLA......K-------------
Q4P7M9_USTMA/339-676---------------------------------------IQKV--------------FLG......R-------------
Q0CNN2_ASPTN/330-664---------------------------------------FSKT--------------FLS......P-------------
Q55X91_CRYNB/416-752---------------------------------------PQLL--------------MI.......K-------------
Q5ANH1_CANAL/429-746---------------------------------------LVNS--------------LFR.....CK-------------
Q6FQA3_CANGA/332-658---------------------------------------FMGR--------------ILD......T-------------
Q0UR74_PHANO/337-666---------------------------------------LLGR--------------ILP.....GK-------------
A1C5G9_ASPCL/369-694---------------------------------------FMST--------------FFD......R-------------
Q7SA72_NEUCR/715-1042---------------------------------------IMAR--------------ILD......N-------------
Q16T32_AEDAE/332-653---------------------------------------WKLA--------------TSK......S-------------
Q6CNN9_KLULA/328-653---------------------------------------VLGM--------------FLD......S-------------
PHM7_YEAST/330-656---------------------------------------VLGR--------------VLD......S-------------
Q9FVQ5_ARATH/322-645---------------------------------------LKNM--------------FIV......K-------------
Q29VG6_PICAN/391-712---------------------------------------FIRA--------------..N.....CK-------------
Q2QN15_ORYSJ/290-606---------------------------------------WG..--------------.........S-------------
YA7D_SCHPO/319-647---------------------------------------VLG