Sequence alignment for CL0419

PF16789

Q1D9L0_MYXXD/1-162MPPYRLQALQDMRARAKEEAEQAFSS---AIKALEKEKAELQRLIDDLEQR-KRERKAKVAAYLKEVMFKGAGINGMNMM
F8L3M0_SIMNZ/3-161QPQYPLEQLVRIKKRRLEEAEKVLKQ---KKEELEQEKKKQEELEEARNET-FRHKQDKMTQ.LRDEMDRGTTSDKIKIA
H8N239_CORCM/1-162MPPYRLQSLLDMREKAKEEAEQAFSD---SVKALAKEEQEQARLEAELERR-RKERKAKVQEYFQQIMAKGAGINGMNMM
D6YSB7_WADCW/3-163IPEYPLEKVMDIKKKRVDEAEKVVAA---KKRELEAEREKLRKCEEERDKA-VQHKIDKLNQ.LRDELDRGTTTDKIQQM
F8KX50_PARAV/3-163KVVYPLQQVLQVKQRRVEDAERVVAD---KKLALEREKETLAKRKAERDKV-LEHLKAKMDQ.MRYEMDHGTTSPKILQM
O84677_CHLTR/1-161MVRYPLEPVLSIKKDRVDRAEKVVKE---KRRLLELEQEKLRERESERDKV-KNHYMQKIRQ.LREQLDDGTTSDAILKM

PF02050

Q18CZ7_PEPD6/21-139-----------------EEIKMEFAK...IQQKKIDIETNLENLESNYSKY.SISKNNDS..-------....IQNQKIT
D1B4C1_SULD5/17-134-----------------DTIERELIK...HQHKERLIRHKISSLYDEITQT.QLPKEGLV..-------.....SAFLMV
A7ZFJ5_CAMC1/17-134-----------------DKVEAKLVV...ARLNVRSAEEKIALLRAKLNEF.RLPKSGNI..-------.....GELREN
Q6AJT7_DESPS/21-144-----------------DATVTRLTT...AEKNRTIIAEKLAEKEEGYRNF.LQEIENIQ.L-------QGVNIERLIMY
Q7NTQ9_CHRVO/20-138-----------------ERLETELAA...KRRLQERYRRNIERLDQLSAAS.GPSAAAGH..-------....PALALNC
A1WUB9_HALHL/20-141-----------------EQAASQLAR...AEGELRQGEARLEEILEMRQEY.RRQLNQDG..-------.AIEAARLRDY
Q7N5K4_PHOLL/19-142-----------------EKAATHLAQ...VCQNYQQMEQQLATLMGYQDEY.RERLNDTLSH-------.GMPCTTWQNY
A5N7B8_CLOK5/20-138-----------------EECKIEFQR...AQNESFRTKEKLMEMKENYRKY..NNFSGSS..-------...SVIEQKIR
A6W0W8_MARMS/19-139-----------------DSAAQQLAR...DKAKVQYDKQKLDELREYADQY.ESERNLLG..-------..LSAYLTTNY
Q085M6_SHEFN/19-142-----------------DQAALQLKS...AQFEKQKRQGQLDALNNYRLDY.MKQMEGHTGT-------.TLRANQYHQF
Q3SJV4_THIDA/18-141-----------------ETLARTVKL...AHGVWLRARGHQVRLLALRDAH.IGELASEL.R-------AGVSAAQLQQT
A4XW60_PSEMY/21-144-----------------REAARQLGH...CQGLVGQAEAKLGELERFRGDY.QQQWISEGSK-------.GVSGQWLMNY
A3DCM8_CLOTH/23-146-----------------NSLKNELGK...AVRELERQKDILNRLNREMNEC.IENINGKF.G-------EGISVGELRKY
A7MJK2_CROS8/24-147-----------------DDAALRLGE...MRRGCQQAEEQLSMLMNYQQEY.RNNLNQTM.T-------QGIASNRWVNY
A5D0F2_PELTS/20-140-----------------EAAEQALAQ...ARR...EYNRRLALLEDTRQRL..EAASFAAAR-------ENMDVFEEMHL
Q893Y4_CLOTE/20-138-----------------EQCKIQFQN...AQKLKIDIENKLMSLKDSYRKY.SSEITEE...-------...SIIGRKIR
Q82T42_NITEU/19-142-----------------DDAAINLGK...LNLKQQEAEKTLQLLVEYRENY.QSQFMESAGS-------.GISPVEWRNF
Q21IN5_SACD2/19-141-----------------DAAAEKLAT...IQKQLNNEISRLRDLEEYYGQY.EQSQQMLR..-------TGVNAQDLARI
Q1LCK2_RALME/19-142-----------------DKAARELGR...LQGLRTQAEQQLNALTQYRQEY.RIRMQAIAAE-------.GMSSSRWHDF
Q2RKE6_MOOTA/20-138-----------------KQLKLQLAE...SRRRQAEAEASLERYRSLRAGA.PAIEGAVA..-------....VEELIQK
Q7CHZ3_YERPE/19-142-----------------EQASTQLGH...VRQSYQNAEQQLTMLLTYQDEY.RERLNDTLCN-------.GMASSSWQNY
Q2Y9B9_NITMU/19-142-----------------DDAARRLGF...LNAQGLDMEAKLVLLTQYSDEY.QSRFRASMQQ-------.GLTAAGWRNY
Q3ADE0_CARHZ/20-135-----------------EQQKRVVQE...KIQAVRRQEEKINRIGESIAAE.LKIDSLLF..-------.......REHQ
Q88ET8_PSEPK/22-145-----------------RKAAQRLGH...FQQQLATAQAKLAELERFREDY.QLQWINRGGQ-------.GVNGSWLVNY
C1DHL1_AZOVD/19-142-----------------EAAGRTLAD...QRRTQRQAQEQMNTLEHYRQEY.RQRLQQAMQQ-------.GIAPASLHNY
Q8R9Z2_THETN/20-143-----------------KIEKENLAK...IMKEIEREREKLENLKKHLQEV.TKRAKEEV.E-------EGTLMYKLAET
Q8XSS3_RALSO/22-145-----------------EKATQEVGR...LMNTRELAAQKLAMLSDYRNNY.RQQMQVNA.E-------GGIDAARLHNY
Q4KG65_PSEF5/21-144-----------------RTAAQRLEY...FHGQVRVAESKLGDLERFRGDY.QEQWVERGKL-------.GVSGHWLMNY
A2SD92_METPP/19-142-----------------DAALGVHRN...ALNAVAAAQAQATQLAEYRQEY.AQRFGTQFQR-------.AGAIELLQCY
Q1GZU6_METFK/21-144-----------------DVAVNRLGE...ASRQLAEAENSLNLLLQYRADY.VSQRDHAMAN-------.GMTAEIYQNY
Q30UH4_SULDN/2-119-----------------QSSERFLQR...ANNNLNSAISALELSYNSLKDL.GSPQKGAM..-------.....REMLAT
A1WCD5_ACISJ/19-142-----------------DAARQALKN...VQDARHAAQAQLEQLTGYAAET.QGRWGMKADS-------.AMQPEVMYHH
A3QCP1_SHELP/19-142-----------------EAAATQLRG...VQLTLNKCRQQLDALQQYRLDY.MKQMEAQQGQ-------.VIAASSYHQF
Q9KQ72_VIBCH/34-157-----------------DKAVLALSK...ARSELDSYYHQLRQIEQYRLEY.CQQLVERGKS-------.GLTASQYGHL
C5ZV80_9HELI/17-134-----------------DEAELMLQK...NAQQIQAKQAEIDALVREFATL.EEPKSGVY..-------.....QAFLTF
A0RMZ0_CAMFF/17-134-----------------NKIELSLAK...CRALDKELKKSMGAIIDELNLH.RFPRGGSS..-------.....ADIKIN
Q12PL2_SHEDO/18-141-----------------EKAALQLKS...TQSDRQKYQAQLDVLNNYRLDY.MKQMSQHQGQ-------.TLSANHYSQF
A1U255_MARAV/19-142-----------------QEALERLGE...ARKQVEAHREQVENLERYQQEY.RDQIRASQQG-------.VVPVARLQAW
Q0P8C0_CAMJE/17-135-----------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESLGVLPKSGSI..-------.....AELRSN
D3UG45_HELM1/17-134-----------------EKQEIVIAK...IAQKISQKFEQISLLQAEMHAF.LAPSTGTI..-------.....QDFKIL
Q1IR50_KORVE/20-143-----------------HAEENALAALFGQRTHLLSLVVRVQMQCDELSRR.....MYESEV-------GGAPAAQLQFV
A6M194_CLOB8/21-139-----------------EESKRLFTE...SQREKKRIEERLQELKVSYQKY.SGISPNED..-------....VVYQKLK
Q2SBV7_HAHCH/22-145-----------------EDERKKMGE...IRRRVEQAEGKLEQLVAYHRDY.QDELRGTQNG-------.VRSVRHIQTY
Q5L0M2_GEOKA/19-142-----------------EKALGEYEE...AVRRFEQAAETLYRLLKEKEEC.AAARDEQL.Q-------AGLSVGDIRLR
Q2NX01_SODGM/19-143-----------------EEALLQLGA...CRSAHASAVAQLNQLMSYEQEY.RKQLEDNMTG-------TGLNVDKWINY
Q31FP3_THICR/21-142-----------------DKAQETFIA...VRQQLESSQEQLDSLQDYHTNH.LSKIHNEK..-------.EVTTAQLQTT
A8GG12_SERP5/19-142-----------------EQATQQLGQ...VRKAQQAAEQQLSMLLNYQDEY.RQKLNNQL.S-------GGMESSNWQNY
A1S7Z2_SHEAM/19-142-----------------EQAALQLRS...AQLELGRLKQQLDALNQYRLDY.MRQLSGQEGK-------.NISASYYQQF
A1K931_AZOSB/19-142-----------------DEAARRLGE...LIASERDGQKKLEMLQGYRDEY.HGRFMEAVRN-------.GIGPDAWRNF
Q5QTV9_IDILO/19-142-----------------DKAAQDFSQ...VQQQVQEQQMRLDGMSKYRLDY.LNQLQHRGQS-------.GIASIQVGQY
C5D8W8_GEOSW/19-142-----------------HQAAGEYNE...AVRRFEEVAEKLYHFLKQKEQY.EEIHKQKL.Q-------SGLSIQEIRHF
Q13T20_BURXL/19-142-----------------DAAAQRLGR...AQRERNDVQSQLDALVQYRDEY.HARFTASAQT-------.GMPAGNMRNF
Q7MQS1_WOLSU/17-134-----------------NEAERAILV...VNREIEQMQEEIASILREIASI.AIPSSGAY..-------.....ADFLKI
Q97H55_CLOAB/20-138-----------------EESKIEFKK...SQDVKKEIEKNLLSMTENYHEYSLKRLSGTV..-------.....IEQKIT
B6ITC9_RHOCS/16-133-----------------DERRRALAE...RQAVEERLCGERARLEQELAHE.QKVAAGSL..-------.....QAAATY
Q15RD9_PSEA6/19-142-----------------QKMATDYQL...AQQNVVDNQNKLSGLEQYRVNY.LKEGIRKGQL-------.GLAAKNYGQH
Q3J8N3_NITOC/19-142-----------------QQAAKVLGE...TQHLFQQQQHQLGEMSDYREEY.AQRCQSVGRN-------.GISAQQLQQL
A8AKI6_CITK8/20-137-----------------EDLSTKLAS...QNQLCQRFEKNIDTLTSLAAGL.VSQSANSA..-------.....AMMINQ
A9KNF7_CLOPH/20-143-----------------EQEKNNYGI...AKAKLMEEEHKLMELVERKDSY.EFQIKEAM.S-------STLNIANIRRL
Q3SIH1_THIDA/19-142-----------------DEAAKRLAA...ALRAGEEASEKLALLTQYRDDY.SMRCQADLAG-------.GLSTTQLHNY
B8I3Q0_CLOCE/20-143-----------------DNAKNNMAL...ASRELEKQKEFLTGLQTTRESSISELNSKV..D-------QGISISQIRAY
O25037_HELPY/17-134-----------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF.KNPELGGM..-------.....SLFLQT
Q2L188_BORA1/19-142-----------------DDAARELGR...LSAQRANAEQQLNMLYEYRHDY.LKRLQDAM.V-------AGMPAADCHNY
Q0AAS0_ALKEH/19-141-----------------DEAGQRLAE...ARQDLDSQRQQLRQLLTFRQEY.AEQLQGQS..-------GGINAARLRDY
A4VMN5_PSEU5/21-144-----------------RDAARLLGQ...AQTQLTQAEGKLAELEQYFRDY.QQQWMQQGSQ-------.GVSGQWLMNY
Q1QW47_CHRSD/19-142-----------------DQAAQSLGH...SRRKLQEAQQRLDQLLTYRHEY.RQRLENSMQQ-------.GIEPANWHNY
Q6D6G3_PECAS/19-142-----------------EKAAGQLGQ...VRQAHQQAEQQLNMLLNYQDDY.RQKLNSTMSS-------.GMANNSWQNY
Q47I06_DECAR/19-142-----------------DEATRQLGQ...LIAEEQNQRSRLQMLEQYRDEY.AQRLREAT.L-------QGVTRMILRNY
Q485L7_COLP3/18-141-----------------QRCADQLKI...AENEYQQNLSRLQGVADYRLEY.MKRLSERA.T-------NGLDSATYSHY
Q5FQB1_GLUOX/18-138-----------------DLVERSFAE...AVARETAAEEKLTAAQAEILNE.QRIASSPT..-------..ADDGAVEAF
Q7VHL3_HELHP/17-134-----------------QVCELAMMQ...NESKIANKQIQIENLQKDFLQL.KIPQAGTF..-------.....YAFKAF
B9L6S3_NAUPA/17-134-----------------DAIERNLQK...INVSIQNLNTKIEELTKTLLSF.TFPKEGNF..-------.....ALLNQI
A5I592_CLOBH/20-138-----------------EESKMKFKQ...AQMEKNHTEEKLFKLKNNYSKY.SNINLNDS..-------....ILEKKIR
B1HQW1_LYSSC/21-142-----------------.ETEMAYKE...SVRSFEEVATKLYDLLKKKEDL.IAFQQDRL.T-------VGSSIDEIHHY
B2FQS7_STRMK/19-137-----------------DAVARDLAE...RQRVLDTHLSRLDELRRYAEEY.ANAQMAAT..-------...SPAQLLNR
B4E812_BURCJ/19-140-----------------DSAAKQLGA...AQRDRTAAAEQLDALLRYRDEY.HARFAQSA.Q-------SGMPAGNWRNF
D0IYH2_COMT2/19-142-----------------DAARTTMQE...RQRAQQAAQAQMDQLQGYVLEM.QARWGPQEGL-------.AVQPEVMHHQ
G7ZH95_AZOL4/15-130-----------------DEKRRVLAE...LHTLADRLRNEIEKVKQEIVHE.QDTVRDDF..-------.....SVSFTY
M1F748_9ALTE/20-142-----------------.QALERMGE...ARTLMAQREQQIQELQSYHQEY.RQQIRDGQ.Q-------GVVAVSRLQAW
FLIJ_ECOLI/19-141-----------------EDAARLLGE...MRRGCQQAEEQLKMLIDYQNEY.RNNLNSDMSA-------.GITSNRWINY
Q5ZUN7_LEGPH/21-143-----------------.QAYIELVK...AREQFNQNKARHEQLVGYRQDY.LQQLEVLGQQ-------.GSYVGPLRNR
Q6LTN7_PHOPR/18-141-----------------HQASLALNQ...ARIERQNYLQQLQQIEQYRLDY.CKQLSTRG.Q-------EGLTASSYGHL
Q7VYE9_BORPE/19-141-----------------DEAARELGR...LSAERNNAEQQLNMLQDYRQDY.LQRMQTAM.Q-------SGMSAADCHNY
Q884X4_PSESM/22-143-----------------.TAAQRLGH...FQGQVNLANNKLQELDQFRQDY.QQQWLQRGSA-------.GVSGQWLLGY
Q8ECB9_SHEON/19-142-----------------EQAALLLKS...AQLECQKRQNQLDALNNYRLDY.MKQMQSQQGQ-------.AISASHYHQF
Q8P9E3_XANCP/19-137-----------------DKVARDLAE...RQRALDTHQSRLEELRRYAEEY.ASSQMSGT..-------...SAVALSNR
Q9I4N0_PSEAE/21-142-----------------.DAATQLGR...CQQQLLAAQQKLAELERYRNDY.QQQWISQGQK-------.GVSGQWLMNY
U5L7Q2_9BACI/19-142-----------------DEALDSYNQ...SVRRFEEAAGKLYELLKKKEDL.EEFQFSKLAS-------.GLPVQEIRHY

PF09486

E5AVH8_BURRH/6-162RRITALRRAVIRRKRIEDELREMLAQ---QRDEQATLLHSCEDKGTQIERERDVVRANEERIAQMMTGSSCFSIAEMQAS
Q63JT6_BURPS/4-160RQQRAFETLLARRAQRGERLRAEQRV---LRAERDAAAAELAQGEAHAHAKRDAANRYAERVDAMAAGRAPFTIGDYAAC
Q8XRH6_RALSO/5-160RRSSVWRALIEAKTRERRRVEADIEA---AQAALAEAQTAVEARQDALRQAEQRLDDHLRSMDDLTTGPS.LTAQAYLQY
C5ALL3_BURGB/11-167RRAIALNRASERRRKQNDALRAQLVA---QRAALAQREADLAVAHEQVERDLAAVQSINDQLDAMTTGAAPFVLDDFSAC
Q8PB86_XANCP/3-159ERVSTWRTLQQLKTRRYQRMQDHLSD---CRRALEQCDGERASCSQQADACTTRLAAFDAALADTAGAGEPIGIEAILQH
A1TJC3_ACIAC/8-157R......TLVRLKARRTEQAEAALQE---SIQALKGEEEALAQAQAEESHARDAERARRERLASATSAGSCFLANDAITL
H7C765_BURPS/5-161RRAMAFARALERRRRLDAVLREELAE---RRTRLQSLDRVLKEKVSQVELKADDVHRHAARIDTLMTGTASFSLDELTAC
G0AFR7_COLFT/6-158..AKIWRAIVAAQMRRQQRAKDELEA---ARQDMLAAEAAHAAAAAETAQACERSRIHEDGLKELLAAS..LSAALYLSH

PF07321

Q79GR0_BORPE/3-151-----LESLLAIKHFRADQAQLALKR---QQQACAVAAAAQRQAQGRLDDCRLWAGQLENRLYAELCRRI-VKTRDIDEV
B8DMT7_DESVM/7-155-----LQPLLNVRHFRENGARNALMT---AEGVLRDAMQAAEDRRAELERYRAWRPGEEERRYDAIMGTS-MAVEDLDRF
Q87P49_VIBPA/2-150-----IERLLEIKKIRADRADKAVQR---QEYRVANVAAELQKAERSVADYHVWRQEEEERRFAKAKQQT-VLLKELETL
Q9I331_PSEAE/3-151-----LALLLRVRRLRLDRAERAQGR---QLLRVRAAAQEHTERQAAQRDYRDWRLAEEQRLFLACQAAM-LDRRRLEAW
Q4CP84_TRYCC/1222-1363-----PRNFLKVESAEKREEEKVQKR---.........PAHRSTSSSSAPIRALLADADANIIVKPQIAA-MLQREIEKA
W8WUC9_CASDE/4-152-----FRELIAIKRFREGQAELAMMR---QRQVLAEAERLRLQAVEHLDEYRRWSEQRELDMYRDLCSRL-VRASEIEDV
Q7N0W1_PHOLL/2-150-----ISRLQRIKALRVERAEKHFSL---QQMKLQTARQHHQQALQTLQDYCQWRIEEEQRLFALCQGQP-IDRKGLERW
O30878_YERPE/2-150-----IRRLHRVKVLRVERAEKAIKT---QQACLQAAHRRHQEAVQTSQDYHLWRIDEEQRLFDQRKNTT-LNCKDLEKW
Q2SH49_HAHCH/2-150-----IASIAEIKQHRTNRQARQVKS---LEIALSDLRERRSQSAHAFTDFQQWRRRESDRLFAELAGKP-ASLQEVDDY
Q1MQY4_LAWIP/6-154-----LAPLLSVREHKEELAQQAVLR---AENALVEARKDLQKAEEDCKNYEEWCQQEINRYYSEIIGSL-VLFKELELL
G8PMJ9_PSEUV/5-149-----IKKLHLVKTLKEQKAQRELNA---ELEKVRRAKEQLEQKRKTAADERATLPAKQDALYEEIIKKV-ISTDDLDKV
F8JFD0_HYPSM/6-153-----IRQVQRVKVLQADRAEQEERA---RRAGLEAAAAAVETARANLERWREEMPRREAAIYDAIIGKL-VDLEALDAC
Q2SC35_HAHCH/2-150-----LSALADIKKLRERNAQAEALR---KRQLLTQSREKVEEAQRDLQQFEIWRVQEEHRLYDSIMGSE-VGLKAIDKV

PF16789

Q1D9L0_MYXXD/1-162N----RFEERLKDEEAQVALEVERQREAVKVAERLVEQRRREMAEAAKELKAIEKHRENWQKQVKYERQQREELNQEEIG
F8L3M0_SIMNZ/3-161R----EYIKVVDEELKQKEKKVQDQIKKVEEARQKVEEARKDLVKKQQDIEKLNMHRKEWDKEMKALEEHQMAIETDEIG
H8N239_CORCM/1-162G----RFEERLKDDEAQVALQIEHQKEVVRTAARLVEQRRMLMAEAAKELKAIEKNKEKFVKQVKKERQDREELQQEEIG
D6YSB7_WADCW/3-163K----NYLKVVEERILVEEKKVQEQEEQVNIAKRNLEIAQEELKMRRQEVDKLQNHKKDWIKQMKRELELAEEREMDEIG
F8KX50_PARAV/3-163K----VYIKIVQERLKVEEKKVADQKEQVTVAEKNLEIAKEELKRKRQEVDKLMTHRKDWLQELKKEEEIIEGREQDELG
O84677_CHLTR/1-161K----AYIKVVAIQLSEEEEKVNKQKENVLAASKELERAEVELTKRRKEEEKTRLHKEEWMKEALKEEARQEEKEQDEMG

PF02050

Q18CZ7_PEPD6/21-139I----NYLLALNN-------SIMDLSEELDKSTNELEKARKQLISKQIERKSLEKLKEKKYGQYYKEENLKEQNTNDEFA
D1B4C1_SULD5/17-134S----EQKSILNR-------EKKRHEEELIALLQVIKKLQVEYQKAHVEYEKIKYLEEQELQVMMAKIKREEQLYLDEIS
A7ZFJ5_CAMC1/17-134L----ELINIARA-------ELSACKESLEIAKKEVLHYEHKYKNANLEYEKMKYLEKEEFKKEIKRIQKAEALALDEFA
Q6AJT7_DESPS/21-144E----GRADYIKH-------EIAEIKKTLLNKEKIVHQERKNLSHCAREHKIMCQLKEKQNLAWRQFINKKEAAVLDEIA
Q7NTQ9_CHRVO/20-138A----GYKRHLLD-------LRQSQQQDLQLAQADAEVSQSRLQDARRREEQVKLLREEKLLEWRTAQSRAEQKRTDEAA
A1WUB9_HALHL/20-141N----AFLTRLDE-------AIVQQRQQIAQLQRRVTQLHKEWLRRWGEHRTIEKVVERRAEAEQAEAERRERQKSDEVA
Q7N5K4_PHOLL/19-142Q----QFMKTLEK-------AIEQHKLQLNQWQQRLDTALSQWREKQQRLNAFDTLQQRADNNRRLHQNRTEQKQMDEYA
A5N7B8_CLOK5/20-138H----IYINNLSY-------NIGETVEELNQKEKVVESKREELKQRQIDRKTVEVLKDKYIDDFRREQNRIEQNLNDEFA
A6W0W8_MARMS/19-139Q----HFVNRVQQ-------AIVQQEAAVGRSEQQADMSMRRWLQARSKTKSMDWLKEKNHKAELVVEAKQEQRQSDEFA
Q085M6_SHEFN/19-142H----QFIRQVDS-------AITQQVAAVKDAEKQVGYRQIHWQEKQQKRKAVEMLLSQKATKAMVIEAKREQKMSDEFA
Q3SJV4_THIDA/18-141S----RLQRAQAA-------KMAAAQASIDNAHRAWQARLAEWMEVEQKVKALRLLEARHRAHAAVQQRRIEQRQHDELV
A4XW60_PSEMY/21-144Q----RFLSQLET-------AIGQQHQNLEWHRANLEKIRAIWQQRYARLEGLRKLVQRYIDEARLAEDKREQKLLDELA
A3DCM8_CLOTH/23-146N----TYISYLSD-------RVKLQKENIKKAQLVVDKYRDKLIKAMQERKVLEKLREKKYEEYVREQLKEEQKLNDEIV
A7MJK2_CROS8/24-147Q----QFIQTLEK-------AIEQHRLQLTQWNTKVDQALSFWKEKKQRLQAWQTLQDRHASAALLAENRLDQKRMDEFA
A5D0F2_PELTS/20-140H----FYRMSLKG-------RMAVQEKSVKTAGHTVEKRRSEVIKARQERQVMEKLKERQLQNFNHEMAVKEQKEMDELA
Q893Y4_CLOTE/20-138H----QYLINVSH-------NIELTTEELKKREEEVEKVRISLKQKQIERKTVETLREKDKSAFIKEQNLLEQKANDEFA
Q82T42_NITEU/19-142K----AFICKLDT-------AIQSQQRLVTMTQQHTEAGSTQYHAHRQKLKSYDTLSQRAELHHQARLQKQEQRQLDEHT
Q21IN5_SACD2/19-141R----NFLQQLAM-------AKQAQMLQIQRVEGVQRQAREAWQACHLKHKLMKDMIARYKTEEQAVLDKNEQKMLDEWF
Q1LCK2_RALME/19-142S----RFLDSLDH-------AIRQQTNALAKAEADLLAGRANWQQQKRRQNSFDTLITRAETREQQVSARREQRANDEYA
Q2RKE6_MOOTA/20-138A----AYLEALDG-------RIACQQEEVARASRVVTEGREKVQAAMQERKVLDRLRERQFQDYKYNLAREEQKQVDEAA
Q7CHZ3_YERPE/19-142Q----QFIQTLEQ-------AIDQHRKQLAQWSIKVEQAVKYWQEKQQRLNAFETLQERAETTQRQQENRLDQKLMDEFA
Q2Y9B9_NITMU/19-142H----EFIDKLDA-------AISQQQEALALMRQRVAASEAAWQSERRVLNSYGTLAQRHRQIQLAHQARREQRETDEWA
Q3ADE0_CARHZ/20-135L----ERIEYLAT-------EKWRLEKELERLINERERAKEEYLAKKIEQKKMEVLKEKAKASYREELERENQSFLDEIS
Q88ET8_PSEPK/22-145Q----RFLGQLET-------AMTQQRQSLVWHQNNLNNARGTWQQAYARVEGLRKLVQRYQDEARRAEDKREQRLLDELS
C1DHL1_AZOVD/19-142R----AFLGSLDD-------AIQRAVQTLDAQRRQVDHSQRHWQEQRRKLNSYDTLVERRARLGQLRENRAEQRRSDETS
Q8R9Z2_THETN/20-143E----AYIMKIRE-------MIEKQANYILKLEKEAEKIREGLLKVSKEKKALENLKERQFSEYLYLLNLEQSRVIDEHV
Q8XSS3_RALSO/22-145A----AFIDRLGS-------AVDHQRGTISALEAQLQRSRDNWLEKQRREQSFDILRQRHVEEQRQDQERRAQRENDEHA
Q4KG65_PSEF5/21-144Q----YFLSQLDT-------AVGQQRQSLAWHQNNLDRAREAWQQAYARVEGLRKLVQRYIDEARALEDKREQKLLDELS
A2SD92_METPP/19-142Q----GFMVRLDE-------AVSQQQRLLAQAIERGETAKAALLSAELRVASVRKLIERRIAEAVRTQDRSDQKATDELA
Q1GZU6_METFK/21-144Q----SFLGKLSQ-------AITSQTENVERLRQVHHLRKQEWQECQKKKMSYDVLIDRADKRENAIELKRDQKMMDEHA
Q30UH4_SULDN/2-119R----ALLDSQRE-------IINHNKEWIAFAKNQVTQAKEQLKIDMIEYEKFKYLELQEIKAELKKMNAKEAKDLDEIA
A1WCD5_ACISJ/19-142Y----QFMGRLDH-------AIGLQTGVVSGQDVRVDKARQALLEAELRLASLRKVLERRRAEVALQQQRREQKQTDERA
A3QCP1_SHELP/19-142H----QFIRQIDE-------AIEKQVFAVSETDKQRQKAQQYWQGKQQKRKAVELLLAHKAEAKQKFEAKQEQKMIDEFA
Q9KQ72_VIBCH/34-157N----RFLTQLDE-------TLAKQKSAEQHFRLQVENCEQHWMNMRQKRKSYQWLMEKKQTERQLLQEKREQKQMDEFS
C5ZV80_9HELI/17-134V----HHKNEYRQ-------TIDSKMGELALLKRQKQELQDYFKAQNIEYEKAKYLDGLEIKKNLEKAKKQESKDLDEIS
A0RMZ0_CAMFF/17-134L----EEQKLLRE-------QKERIKEKIILNQKEIVHYEFQHKKAYIELEKMKYLEKEETAKEIAKIKKQEAKDLDEIA
Q12PL2_SHEDO/18-141H----QFIKQVDN-------AITQQVNAVKDAETQVLYRQHNWQEKQQKRKAVEMLLEQKALKRAHIENVREQKMSDEFA
A1U255_MARAV/19-142Q----AFIAQLDQ-------VIAQQQRQLQQAEQVFEARRREWQQAWERRRGMEKYIESCRQQEQREQDLRDQKLADEAA
Q0P8C0_CAMJE/17-135L----SMAQVGRE-------ALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQKQKELAKAEEKFLDEIA
D3UG45_HELM1/17-134Q----EGRGSFLF-------QIDSLHQEISLLKSQKKEAQRVYQHLYREVEKIQYIHSNILKKMITKIKKNEEKNLDEIA
Q1IR50_KORVE/20-143E----SQRIALRR-------AAAEIQSTIEDLNRAISLQQEKYMSARRESEKLERLRATELAAWHKQLERRDQAAVDELF
A6M194_CLOB8/21-139R----YYIQGVQS-------GIRSTEKDLAVKNQEIENRRKDLTAKQMERKTVQTLKEKKYSEYVKEQDRVEQINIDELA
Q2SBV7_HAHCH/22-145H----VFISRLGS-------AIEQQQQQLLLLKQQLSQQTDVWRAAYQKKNNMQDFIDRCKKEEAYYEDKKQQRNLDDAV
Q5L0M2_GEOKA/19-142L----QYMANLER-------MIDHYQLVVMQAREQMQRRQQRLMELNIEVKKYEKMRERIKRWAEQLEREAERRLLDEMA
Q2NX01_SODGM/19-143Q----SFIASLYK-------IVAHHSQQVSVFQSRVDLAVAQWHQKKQRLNAFEILKTRSETARQLRENRRSQKQMDEFA
Q31FP3_THICR/21-142Q----AFIDNVNK-------AILSQKDQITQLTHVLEKAQETWIEKRARHQSLKNIHLKLKRDERVKLDKQEQKMLDELA
A8GG12_SERP5/19-142Q----QFIGTLEQ-------AITQHRQQLTQWGEKVESAVKHWQDKQQRLNAFETLHTRAQSAQLQLENKRDQKLMDEFA
A1S7Z2_SHEAM/19-142H----RFIKQIDQ-------AIGQQVQSVTGAETQLEHRRRHWLEKQQKRKAVELLLKHKADKREAKEARLEQKLLDEFA
A1K931_AZOSB/19-142S----AFIGKLDD-------AIATQRKIVEQSRDRTAQGQEIWLAQRNRVKAFDTLSQRHQAGVARQEAKREQKLSDEHT
Q5QTV9_IDILO/19-142H----AFVGKLDE-------GVEQLHHDIIKLQQVLQQRKDRWLAQRRKRESIDFLIKEKRKREQIAEARKEQNNLDDFS
C5D8W8_GEOSW/19-142Q----QFISNLER-------TIHHYQLLVMQAREQMHRKQMKLTELNIEVKKYEKMKEKYIQAAFDVERTAENKWMDEIS
Q13T20_BURXL/19-142Q----AFIDTLDA-------AIEQQRNLLATATARVEAAKPDWQRQKQKLGSYEVLQARGEAAEARTTARRDQRDADEHA
Q7MQS1_WOLSU/17-134Q----AIKKAHID-------ELEFKKLDLAHLREKRQRMQEQLKLLSLEHEKAKYLDKLEIQKMLALQKRQEELQMDEVS
Q97H55_CLOAB/20-138Q----NYLNALNV-------LIDEASDNLEKQKKVVEDKRNVLIKKQVERKTVEVLKDKQKLEFEKNENLKEQRVNDELA
B6ITC9_RHOCS/16-133G----DFARHVIH-------RRERLDDAIARARAEVARAEESVAEAFQELKRYELAQEERQRQRQEALRRADTQRLDEIA
Q15RD9_PSEA6/19-142Q----SFVGKIDA-------ACEQQTKQVSNALVVAEQRKAQWLAQQRKRKAVEMLLDKQALKIQQKQDRAEQQMLDELA
Q3J8N3_NITOC/19-142Q----SFLARLDQ-------AIYQQKQQVERSSQLLEQKRKGWFAVRSQVKALEKLQDRYQREERNLAAYHEQAEMDDRN
A8AKI6_CITK8/20-137S----KYKHNIQR-------IIDWQKQEQALAHLEAQKIQGNLLAEAKREKSIELVLDAKRADRQAEINRREQKMTDSLS
A9KNF7_CLOPH/20-143E----DAIESMKQ-------FIKQQSKAVVKAEQAVELAMQRLKDAMIERKTHDKLRENAFEGYIKEYVGEEMKEIDELV
Q3SIH1_THIDA/19-142Q----VFMQKLDY-------AISGQQKVVDAVQAQIAAARTAWQACEQKKMSFVTLAGRAKKEETRRELWRDQKQNDEHA
B8I3Q0_CLOCE/20-143N----NYLSFLKQ-------KITVQKENVNIARIQVDIRRESLVKAVQERKILDKLREKKYDEFLKEQSKAEQLLIDELN
O25037_HELPY/17-134Q----QLKSALRM-------EIEYYQQESENLNKDLKILEKDYLLANQELEKAKIILEKEKQKEQKILEKKEQALLDENA
Q2L188_BORA1/19-142Q----RFIGTLDD-------AISQQANVLHSADMQLMQGRLHWQQQKRKLNSFDTLAQRDARSRALIETRREQRANDEIS
Q0AAS0_ALKEH/19-141N----AFISRIDQ-------AIQQQHQVVAQAKRRVNAQRQDWLEAYSHSRAVGRVVDRFRDEERREQERREQLQLDELA
A4VMN5_PSEU5/21-144Q----RFLSQLES-------AIGQQQRSVNWYRDNLLKVRQQWHQRHARVEGLSKLIESYQREARIAADKREQKLLDEFA
Q1QW47_CHRSD/19-142Q----QFLASLDQ-------AIAGQRQAVNDQQRHLDRQQQAWQGERRKLNTYDTLITRRDNAEQQRAARREQQLFDEMS
Q6D6G3_PECAS/19-142Q----QFIRTLDG-------AIEQHRQQLSQWTSRLDLAMKTWQEKQQRLNAFEKLQDREVTRQLAKENKIEQKQMDEFA
Q47I06_DECAR/19-142Q----DFLARIDE-------AVKQQKIAVENSERSTKTGKENWQAQNKQLKAIDTLSQRHDARERYRENKHDQKLQDEFS
Q485L7_COLP3/18-141H----AFIAKLDT-------ASKQVEIATRQAKALVDQSKSLWLKQRQKVKAVELLRDKRLKKIAVAADRAEQKMFDEIA
Q5FQB1_GLUOX/18-138S----RWLPGGRQ-------AVLEARQRCREAAMDREAVRSALIAARAAMEAVRTLREEQKEEERQADLRKEQNALDELA
Q7VHL3_HELHP/17-134E----ETKNMLLT-------HISLARNELEALFAHRKVLQEQYKKCNIEYEKVHFLDKKEHNEMIKNAKYKEKLEVDEIA
B9L6S3_NAUPA/17-134K----HQQHIIRD-------EIQNLKNQIMVLESRKKELLEELKKANIDYEKMKYLQAEEIKKMIKEKKLKESRDLDEIA
A5I592_CLOBH/20-138H----SYLNSLNF-------CINETANELQQKLKIVEERREELKTKQVERKTVEILKEKDKLAFEKEQNMIEQRNNDEFA
B1HQW1_LYSSC/21-142A----RFIDSLEK-------TIADVQQKVIQARAKMNWHEDKLLEKNLEVRKFEKMKEKDFKLFQQEQDRIESLFLDEIS
B2FQS7_STRMK/19-137R----AFLDRLDS-------AVEQQQATVNGNREKVEAERARLILASRDKAVLEQLAASYRAQEKVVTDRRDQREMDDIG
B4E812_BURCJ/19-140Q----AFIDTLDA-------AIAQQRSVLAAAEVRIDEARPNWQQKKRTVGSYEILQARGVAQEAQRDARREQRDADEHA
D0IYH2_COMT2/19-142Y----QFMERLQH-------AIGLQTRVVADQDIRLETARQALLAAELRVTSLQKVVQARRRDVALAQMRREQKDTDERA
G7ZH95_AZOL4/15-130S----NFAQAALE-------RGRKLGESLAQVEAQIEIATDEMAEAFQELKRYELAEEERQKRERDKQKRKDAAMLDETA
M1F748_9ALTE/20-142Q----AFMGQLDQ-------LIGQQQVQLEQANQVFEVRRNEWLKAWEKRRGMENFITTCRQQEQREQDSREQKQADEAA
FLIJ_ECOLI/19-141Q----QFIQTLEK-------AITQHRQQLNQWTQKVDIALNSWREKKQRLQAWQTLQERQSTAALLAENRLDQKKMDEFA
Q5ZUN7_LEGPH/21-143I----NFINHLDT-------ALVQLNSYLSQLAKNRMKADLNYKQAKTSEEGISKLIERVKRAELKQLQRIEQKETDEYA
Q6LTN7_PHOPR/18-141Q----KFLTQLDE-------TLAKQKEAGHQFEFQIEQCSEHWNEVRKKRRSIEWLLEKKQTERQKMLDRQEQKMMDEFS
Q7VYE9_BORPE/19-141Q----RFIATLDD-------AIGQQRHVLHRAEAHLNDGRLNWQQQKRKLNSFDTLAQRESRTQALLEARREQRVNDEYS
Q884X4_PSESM/22-143Q----RFLSQLDV-------AVAQQYKSLEWHKANLDRARSAWQDCYARVEGLRKLVQRYMDEARRLEDKREQKLLDELS
Q8ECB9_SHEON/19-142H----RFIRQIDE-------AIAQQQRVVADGEKQKNYRQHYWLEKQKKRKAVELLLDNKEKKRQAIELKKEQKMTDEFA
Q8P9E3_XANCP/19-137R----AFLDRLDS-------AVLQQAQTVESNRAKVEAERTRLLLASREKQVLEQLAASYRAQENKVIERRDQREMDDLG
Q9I4N0_PSEAE/21-142Q----RFLSQLET-------AVAQQANSVTWHREAVDKARLNWQERYARLEGLRKLVERYLEEARQAEDKREQKQLDELA
U5L7Q2_9BACI/19-142Q----HFIHSLEK-------TIEHYQQVVFNARNQMNYYQDKLTEKNIEVKKYEKMKEKDIVRFAESMKLEENRQMDDIS

PF09486

E5AVH8_BURRH/6-162M----RYMDLVTDRIRVLQRELAALEQQYREKTDEISRTAQAIASNRGRIDVCERRIGVLRRKLDELASDIADEEAEEAA
Q63JT6_BURPS/4-160R----RYRDALLDEHALASAQCARLRAALQAKVDRLAATARRIARNDAQIDVVRERIRRLARAAEAAAEDAHDEEIEEGV
Q8XRH6_RALSO/5-160D----AYRTQLEGGVGQAEQAVAAAQGVVAEREAALQAQRRKLARLDAMLERCRETADRLDRKEDAERELATEEEAVEAI
C5ALL3_BURGB/11-167R----IVLGIASERLHASEAQLEAARQAVDDAAAAIAGTNRTIARNLGSVDACQQRIAAMRRGYQRAEDDAADDEAEDGV
Q8PB86_XANCP/3-159Q----RFRAVLEERCGAAEQALVAATQALQRAHDEVATVQQTVSRLEAQAQVYAEKAARARRAWQAQREAAEEEDAIEAL
A1TJC3_ACIAC/8-157Q----MLVSEAQGQSTEAERHTAQARDRVDAAREQVRLRDAAVRRAQRQLEATRERLEQALAAAERAQEDAQDEEAEETA
H7C765_BURPS/5-161R----AYLDVAVAHLRALESEEARLRAEFDALAAAIEEKKLEIGRNLSRIDACDARIEQIRRHGERAADEALDEEMEEAA
G0AFR7_COLFT/6-158D----AWRGHLRGEVQVMQARERQAHDTLEKQERKVAIVRTKLVRMDAALDKCRLKLKRIEDDTRRRREENADEEAIESL

PF07321

Q79GR0_BORPE/3-151L....QRVGHARDRQASLALQLDDAVRRHEHEIQLLAQQREQHRECFQAQQRIAELVRLQQVEAAALRESQEDREIQEAI
B8DMT7_DESVM/7-155K....AGLAALAQAELQREQAVADADRRVEECRKAVADARAAVAKARREVAKIAAHKDIWSEEMRRETERLADIEMEEFK
Q87P49_VIBPA/2-150R....QEIALLREREAELKQRVAEVKVTLEQERTLLKQKQQEALQAHKTKEKFVQLQQQEIAEQSRQQQYQEELEQEEFR
Q9I331_PSEAE/3-151Q....QQVGLLREKEAGLEQDCAEAAQRLEGERERLRQCRRELLERQRQLEKFAELERHVDAERQGLRERSEEGELEEFT
Q4CP84_TRYCC/1222-1363QRNNMHEISSLRANVRRLESDLEEARQQLRGERDNSRSLRVMVQNARRELEE..KELALVRTSASRQQRAKEHQHVQANF
W8WUC9_CASDE/4-152L....ENVAGLREGEQDRETRVEEAENQAHREAETLTQCREAHREASRMVEKFVQLASLHAAEELRELERKEDLEMEEAA
Q7N0W1_PHOLL/2-150Q....QQVALLRENEAQLEKQVAEMTEKVELELRQLKECQRVLHHTRQQQEKFNELGRQQQEAIRAQGEYQEELEQEEFH
O30878_YERPE/2-150Q....RQIASLREKEANYELECAKLLERLANERERLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFL
Q2SH49_HAHCH/2-150N....SRVTYFKVQSNDLASQLKQIQAQETAAEQKLQAALDQLKAAQRAQEKFAILAEDFQGALQQNRIRLEEQQAEEMA
Q1MQY4_LAWIP/6-154K....VKTGILLDNVKEKYKLVDKAKDYVEACIEAKERAIKNLTELKKQTAKLAEHKKLWEAEEKILAQQREEVELEDFK
G8PMJ9_PSEUV/5-149K....EQAQILENAVKKLEDAAERAAYVYDRALKNADAARLEYQKALRIKDKYGKVADDLRSEANALMEAAEEQEIEE..
F8JFD0_HYPSM/6-153K....ARVVELREHEALLAKRLQDAEGAATAAREALEFASQKLAHARRAVSKFDELVATLRAAELLDAEAKEDAELEEAA
Q2SC35_HAHCH/2-150K....HQIGMLRLKEVSLAEQVEKARQEQKQAEAALRQAEQALAEAGKAVEKCQMLIEQVSADAIAEAQRLEELELEEAS

PF16789

Q1D9L0_MYXXD/1-162NALFLARQRK
F8L3M0_SIMNZ/3-161SAMH..NIRK
H8N239_CORCM/1-162SALFLARQRK
D6YSB7_WADCW/3-163QVLYLRNMRD
F8KX50_PARAV/3-163SVMYMIHQRK
O84677_CHLTR/1-161QLLHQLHKQK

PF02050

Q18CZ7_PEPD6/21-139SMSY------
D1B4C1_SULD5/17-134TMLF------
A7ZFJ5_CAMC1/17-134VMKF------
Q6AJT7_DESPS/21-144IMRH------
Q7NTQ9_CHRVO/20-138GQAW------
A1WUB9_HALHL/20-141RMLY------
Q7N5K4_PHOLL/19-142QRSV------
A5N7B8_CLOK5/20-138LYGF------
A6W0W8_MARMS/19-139MRRF------
Q085M6_SHEFN/19-142MQQY------
Q3SJV4_THIDA/18-141ELIH------
A4XW60_PSEMY/21-144QRLI------
A3DCM8_CLOTH/23-146SFNI------
A7MJK2_CROS8/24-147QRAS------
A5D0F2_PELTS/20-140GNAY------
Q893Y4_CLOTE/20-138LYGF------
Q82T42_NITEU/19-142AHNF------
Q21IN5_SACD2/19-141NSQN------
Q1LCK2_RALME/19-142ARIA------
Q2RKE6_MOOTA/20-138GSRF------
Q7CHZ3_YERPE/19-142QRAS------
Q2Y9B9_NITMU/19-142NSAA------
Q3ADE0_CARHZ/20-135LFGY------
Q88ET8_PSEPK/22-145QRLP------
C1DHL1_AZOVD/19-142AQLR------
Q8R9Z2_THETN/20-143SYKV------
Q8XSS3_RALSO/22-145AKLI------
Q4KG65_PSEF5/21-144QRLP------
A2SD92_METPP/19-142SRAA------
Q1GZU6_METFK/21-144MRVS------
Q30UH4_SULDN/2-119LMTY------
A1WCD5_ACISJ/19-142ALRA------
A3QCP1_SHELP/19-142SQQF------
Q9KQ72_VIBCH/34-157TLMF------
C5ZV80_9HELI/17-134VMLY------
A0RMZ0_CAMFF/17-134VQRY------
Q12PL2_SHEDO/18-141MQQF------
A1U255_MARAV/19-142GRAF------
Q0P8C0_CAMJE/17-135ISRF------
D3UG45_HELM1/17-134AILF------
Q1IR50_KORVE/20-143LMRL------
A6M194_CLOB8/21-139LYAY------
Q2SBV7_HAHCH/22-145GRRA------
Q5L0M2_GEOKA/19-142VQRF------
Q2NX01_SODGM/19-143LRAS------
Q31FP3_THICR/21-142SQQF------
A8GG12_SERP5/19-142QRSA------
A1S7Z2_SHEAM/19-142MQQF------
A1K931_AZOSB/19-142ARRY------
Q5QTV9_IDILO/19-142SQRF------
C5D8W8_GEOSW/19-142IQRF------
Q13T20_BURXL/19-142ARIL------
Q7MQS1_WOLSU/17-134LLLY------
Q97H55_CLOAB/20-138LYSF------
B6ITC9_RHOCS/16-133SIRF------
Q15RD9_PSEA6/19-142LQKF------
Q3J8N3_NITOC/19-142QHNF------
A8AKI6_CITK8/20-137AQCW------
A9KNF7_CLOPH/20-143SFQY------
Q3SIH1_THIDA/19-142ARRA------
B8I3Q0_CLOCE/20-143SFKF------
O25037_HELPY/17-134MILH------
Q2L188_BORA1/19-142ARLA------
Q0AAS0_ALKEH/19-141RRTY------
A4VMN5_PSEU5/21-144QRLA------
Q1QW47_CHRSD/19-142ARMT------
Q6D6G3_PECAS/19-142QRAS------
Q47I06_DECAR/19-142TRKF------
Q485L7_COLP3/18-141TQQY------
Q5FQB1_GLUOX/18-138VRQF------
Q7VHL3_HELHP/17-134VMLY------
B9L6S3_NAUPA/17-134ILLR------
A5I592_CLOBH/20-138LYAF------
B1HQW1_LYSSC/21-142LLT.------
B2FQS7_STRMK/19-137ARR.------
B4E812_BURCJ/19-140AK..------
D0IYH2_COMT2/19-142TMAF------
G7ZH95_AZOL4/15-130LV..------
M1F748_9ALTE/20-142GRAF------
FLIJ_ECOLI/19-141QRA.------
Q5ZUN7_LEGPH/21-143QKQW------
Q6LTN7_PHOPR/18-141TLQF------
Q7VYE9_BORPE/19-141ARL.------
Q884X4_PSESM/22-143QRL.------
Q8ECB9_SHEON/19-142SQQF------
Q8P9E3_XANCP/19-137ARR.------
Q9I4N0_PSEAE/21-142QRT.------
U5L7Q2_9BACI/19-142IQLY------

PF09486

E5AVH8_BURRH/6-162LARA------
Q63JT6_BURPS/4-160LARR------
Q8XRH6_RALSO/5-160LARA------
C5ALL3_BURGB/11-167LARR------
Q8PB86_XANCP/3-159IGLR------
A1TJC3_ACIAC/8-157VAR.------
H7C765_BURPS/5-161LGAR------
G0AFR7_COLFT/6-158LARR------

PF07321

Q79GR0_BORPE/3-151EL--------
B8DMT7_DESVM/7-155AV--------
Q87P49_VIBPA/2-150TV--------
Q9I331_PSEAE/3-151RH--------
Q4CP84_TRYCC/1222-1363VT--------
W8WUC9_CASDE/4-152SV--------
Q7N0W1_PHOLL/2-150RQ--------
O30878_YERPE/2-150QH--------
Q2SH49_HAHCH/2-150AD--------
Q1MQY4_LAWIP/6-154MP--------
G8PMJ9_PSEUV/5-149..--------
F8JFD0_HYPSM/6-153E.--------
Q2SC35_HAHCH/2-150ET--------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window