Sequence alignment for CL0419

PF02050

Q18CZ7_CLOD6/21-139------------------------EEIKMEFAK...IQQKKIDIETNLENLESNYSKY..SISKNNDS.-.....IQNQK
Q17W86_HELAH/17-134------------------------EKIEQKLQN...KRLELQQNEQQILSKQMDLSAF..KNPNFGGM.-......SLFL
D1B4C1_SULD5/17-134------------------------DTIERELIK...HQHKERLIRHKISSLYDEITQT..QLPKEGLV.-......SAFL
A7ZFJ5_CAMC1/17-134------------------------DKVEAKLVV...ARLNVRSAEEKIALLRAKLNEF..RLPKSGNI.-......GELR
E3IA18_GEOS0/19-142------------------------KQAVGEYNE...AVQRFQEVAEKLYHFLKQKEQY..EEIHKQKL.-QAGLPIQEIR
B9R5V1_9RHOB/16-133------------------------DEKRRQLAQ.......IESMISEFNRMADELDDQ..IRTEQERT.-..GITDVSHF
Q1N2X0_9GAMM/21-144------------------------QEALTYLGS...LKQRIEEEKKKGETLKQYQLEY..QQSFSSQGA-Q.GVTGSQIQ
Q2T245_BURTA/19-142------------------------DTATKQLGH...AQRERTDAQAQLDALVRYRDEY..RERFAASAQ-S.GMPAGNWR
D0JYF7_HELP5/17-134------------------------EKIEQKLES...KRLEWRQNEREILDKQAQLSAF..KNPELGGM.-......SLFL
Q6AJT7_DESPS/21-144------------------------DATVTRLTT...AEKNRTIIAEKLAEKEEGYRNF..LQEIENIQ.-LQGVNIERLI
A6SXY0_JANMA/19-142------------------------DEAAKRLGK...CMKTAEECEQKLALLEQYRDDY..AARFQQNLS-T.GLSALGYQ
Q7NTQ9_CHRVO/20-138------------------------ERLETELAA...KRRLQERYRRNIERLDQLSAAS..GPSAAAGH.-.....PALAL
A1WUB9_HALHL/20-141------------------------EQAASQLAR...AEGELRQGEARLEEILEMRQEY..RRQLNQDG.-..AIEAARLR
B7WXY7_COMTE/19-142------------------------DAARTALQE...RQRAQQAAQAQMDQLQGYVLEM..QTRWGAQEG-L.AVQPEVMH
B4SI03_STRM5/19-138------------------------DAVARDLAE...RQTVLDTHLSRLDELRRYAEEY..ANAQMAAT.-....SPAQLL
Q7N5K4_PHOLL/19-142------------------------EKAATHLAQ...VCQNYQQMEQQLATLMGYQDEY..RERLNDTLS-H.GMPCTTWQ
A3YS99_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
A6CQ92_9BACI/19-142------------------------EEIRESYRD...SVEKFEKIAEKLYELLKKKEDL..QSYQSERM.-LNGLSVQEIR
A7H0A7_CAMC5/17-134------------------------DKIEVRLVA...ARLNVRRLEASLKAVRGKLDEF..DLPKSGNA.-......NDLK
Q7WA80_BORPA/19-138------------------------DEAARELGR...LSAERNNAEQQFNMLQDYRQDY..LQRMQSGM.-....SAADCH
D0IRC5_HELP1/17-134------------------------EKIEQKLES...KRLEWRQNEREILDKQAQLSAF..KNPKLGGM.-......SLFL
C3XLA9_9HELI/17-134------------------------DEAELMLQK...NAQQILAKQGEIDALVAEFATL..KEPQSGIY.-......QAFL
A5N7B8_CLOK5/20-138------------------------EECKIEFQR...AQNESFRTKEKLMEMKENYRKY...NNFSGSS.-....SVIEQK
A4C6D0_9GAMM/18-141------------------------EARRAEYLK...AQQYLLESQTKLTGLSDFRLDY..MKQLHERG.-KQGLGSDKFN
B6BHN5_9PROT/2-119------------------------DKSERIVQK...ANADLNSAAMALEIAYQSIQDI..TPPQSGNM.-......KEFI
Q4HPN7_CAMUP/17-135------------------------DKAQTNLNA...ALQRQKENERFLGLAREELLNL...STLKGQ..-...ISSEELR
A6W0W8_MARMS/19-139------------------------DSAAQQLAR...DKAKVQYDKQKLDELREYADQY..ESERNLLG.-...LSAYLTT
Q085M6_SHEFN/19-142------------------------DQAALQLKS...AQFEKQKRQGQLDALNNYRLDY..MKQMEGHTG-T.TLRANQYH
Q3SJV4_THIDA/18-141------------------------ETLARTVKL...AHGVWLRARGHQVRLLALRDAH..IGELASEL.-RAGVSAAQLQ
A0YC97_9GAMM/21-144------------------------RQAAFRLAE...SARNAELNAQQGQQLQQYKDEY..REQFKSLAH-T.QAHAADLE
A4XW60_PSEMY/21-144------------------------REAARQLGH...CQGLVGQAEAKLGELERFRGDY..QQQWISEGS-K.GVSGQWLM
A1HN38_9FIRM/20-143------------------------ERAQMKLAE...AMKHSFNEQEKLRRLTDQFAEN..MNIIQSRQ.-LAKPTIDQLK
Q9ZMI0_HELPJ/17-134------------------------EKIERKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
A3DCM8_CLOTH/23-146------------------------NSLKNELGK...AVRELERQKDILNRLNREMNEC..IENINGKF.-GEGISVGELR
A7MJK2_CROS8/24-147------------------------DDAALRLGE...MRRGCQQAEEQLSMLMNYQQEY..RNNLNQTM.-TQGIASNRWV
A5D0F2_PELTS/20-140------------------------EAAEQALAQ...ARR...EYNRRLALLEDTRQRL...EAASFAAA-RENMDVFEEM
Q893Y4_CLOTE/20-138------------------------EQCKIQFQN...AQKLKIDIENKLMSLKDSYRKY..SSEITEE..-....SIIGRK
B9KF92_CAMLR/17-134------------------------DKAEANLTK...TRQKLLQCEEEFKEASKTCESL..TLANKGSI.-......ALLR
A4Y8L0_SHEPC/19-142------------------------EQASLLLKS...AQLECQKRQHQLNALNNYRLDY..MKQMQSQQG-Q.AISASHYH
Q82T42_NITEU/19-142------------------------DDAAINLGK...LNLKQQEAEKTLQLLVEYRENY..QSQFMESAG-S.GISPVEWR
FLIJ_BUCAP/20-143------------------------EKDIINIKN...LYLQKEKYVTQLSLLKDYQNEY..LIKLKSKIE-L.GICLYQWR
Q21IN5_SACD2/19-141------------------------DAAAEKLAT...IQKQLNNEISRLRDLEEYYGQY..EQSQQMLR.-.TGVNAQDLA
A4BUE0_9GAMM/19-142------------------------TELAQAYAA...QRELLDQEGERMAQLRGFRREY..EQKLTVSG.-GQGIDAYRLR
D2MWE8_CAMJU/17-135------------------------DKAESNLNQ...AKQRQIENEKAYELSRQEYENL.GVLPRSGSI.-......AELR
Q1LCK2_RALME/19-142------------------------DKAARELGR...LQGLRTQAEQQLNALTQYRQEY..RIRMQAIAA-E.GMSSSRWH
C5EYR8_9HELI/17-134------------------------DEAELMLQK...NAQKIIDKQAEIDALIREFATL..EEPKNGVY.-......QAFL
A8H2A5_SHEPA/19-142------------------------EQASLQLRS...AQLELQRRQNQLDALQNYRLDY..MKQMEQQQG-Q.SISASHYH
Q2RKE6_MOOTA/20-138------------------------KQLKLQLAE...SRRRQAEAEASLERYRSLRAGA..PAIEGAVA.-.....VEELI
Q7CHZ3_YERPE/19-142------------------------EQASTQLGH...VRQSYQNAEQQLTMLLTYQDEY..RERLNDTLC-N.GMASSSWQ
Q2Y9B9_NITMU/19-142------------------------DDAARRLGF...LNAQGLDMEAKLVLLTQYSDEY..QSRFRASMQ-Q.GLTAAGWR
A3J9N7_9ALTE/19-142------------------------KQALERMGE...ARTLMAQREQQIQELQRYHQEY..RQQIRDGQQ-G.VIAVSRLQ
Q3ADE0_CARHZ/20-135------------------------EQQKRVVQE...KIQAVRRQEEKINRIGESIAAE..LKIDSLLF.-........RE
Q88ET8_PSEPK/22-145------------------------RKAAQRLGH...FQQQLATAQAKLAELERFREDY..QLQWINRGG-Q.GVNGSWLV
C1DHL1_AZOVD/19-142------------------------EAAGRTLAD...QRRTQRQAQEQMNTLEHYRQEY..RQRLQQAMQ-Q.GIAPASLH
D3FNY0_CAMJI/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......VELR
Q8R9Z2_THETN/20-143------------------------KIEKENLAK...IMKEIEREREKLENLKKHLQEV..TKRAKEEV.-EEGTLMYKLA
Q8XSS3_RALSO/22-145------------------------EKATQEVGR...LMNTRELAAQKLAMLSDYRNNY..RQQMQVNA.-EGGIDAARLH
C6RHH5_9PROT/17-134------------------------DKIELNLAR...TRNEAAMIEGFIAQAAEQISKF..EMPSSGSA.-......ADLR
Q4KG65_PSEF5/21-144------------------------RTAAQRLEY...FHGQVRVAESKLGDLERFRGDY..QEQWVERGK-L.GVSGHWLM
Q1CUP7_HELPH/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
Q5WVU1_LEGPL/20-143------------------------QQAYIELVK...AREQFNQNKARHEQLVGYRQDY..LQQLEVLGQ-Q.GSYVGPLR
A6GTY4_9BURK/19-142------------------------DNLARAMAS...TQQKLVQGQDKLNMLQTYRDEC..EGGMHNKAS-T.GMTGQQLR
A2SD92_METPP/19-142------------------------DAALGVHRN...ALNAVAAAQAQATQLAEYRQEY..AQRFGTQFQ-R.AGAIELLQ
A7FWT5_CLOB1/20-138------------------------EESKMKFKQ...AQMEKNHTEEKLFKLKNNYSKY..SNINLNDS.-.....ILEKK
Q1GZU6_METFK/21-144------------------------DVAVNRLGE...ASRQLAEAENSLNLLLQYRADY..VSQRDHAMA-N.GMTAEIYQ
Q30UH4_SULDN/2-119------------------------QSSERFLQR...ANNNLNSAISALELSYNSLKDL..GSPQKGAM.-......REML
A1WCD5_ACISJ/19-142------------------------DAARQALKN...VQDARHAAQAQLEQLTGYAAET..QGRWGMKAD-S.AMQPEVMY
A3QCP1_SHELP/19-142------------------------EAAATQLRG...VQLTLNKCRQQLDALQQYRLDY..MKQMEAQQG-Q.VIAASSYH
Q9KQ72_VIBCH/34-157------------------------DKAVLALSK...ARSELDSYYHQLRQIEQYRLEY..CQQLVERGK-S.GLTASQYG
C5ZV80_9HELI/17-134------------------------DEAELMLQK...NAQQIQAKQAEIDALVREFATL..EEPKSGVY.-......QAFL
A6DE14_9PROT/17-134------------------------DKIERNIQK...INSSIKMLQMKIEELRKSFNSL..SLPSSGNF.-......ATLQ
A0RMZ0_CAMFF/17-134------------------------NKIELSLAK...CRALDKELKKSMGAIIDELNLH..RFPRGGSS.-......ADIK
Q12PL2_SHEDO/18-141------------------------EKAALQLKS...TQSDRQKYQAQLDVLNNYRLDY..MKQMSQHQG-Q.TLSANHYS
A1U255_MARAV/19-142------------------------QEALERLGE...ARKQVEAHREQVENLERYQQEY..RDQIRASQQ-G.VVPVARLQ
Q0P8C0_CAMJE/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
B2UJR0_RALPJ/22-145------------------------EKATQEVGR...LMNTREAATQKLALLSDYRNNY..HQQMLSSAE-G.GMDVTRLR
C3XE83_9HELI/26-143------------------------DMQEKNLLR...NQTLITRKYADIDSINTQIASI..PMPSSGSF.-......SAYQ
A8FXU3_SHESH/19-142------------------------EQAALQLQS...AQLALQKCQSQLGALRNYRLDY..MKQMETNHG-K.TISASYYH
D3UG45_HELM1/17-134------------------------EKQEIVIAK...IAQKISQKFEQISLLQAEMHAF..LAPSTGTI.-......QDFK
D3P642_AZOS1/18-135------------------------DEKRRVLAE...LHTLADRLRNEIEKVKQEITHE..QETVREDF.-......SVSF
B2US88_HELPS/17-134------------------------EKIEQKLES...KRLEWQQNEREILDKQAQLSAF..KNPELGGM.-......SLFL
Q1IR50_KORVE/20-143------------------------HAEENALAALFGQRTHLLSLVVRVQMQCDELSRR......MYESE-VGGAPAAQLQ
A6M194_CLOB8/21-139------------------------EESKRLFTE...SQREKKRIEERLQELKVSYQKY..SGISPNED.-.....VVYQK
Q2SBV7_HAHCH/22-145------------------------EDERKKMGE...IRRRVEQAEGKLEQLVAYHRDY..QDELRGTQN-G.VRSVRHIQ
B5QIH2_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQEYGSLGVLPKSGSI..-......AELR
Q48GE6_PSE14/21-144------------------------RTAAQRLGH...FQGQVNLANNKLQELDQFRQDY..QQQWLQRGS-A.GVSGQWLL
Q5L0M2_GEOKA/19-142------------------------EKALGEYEE...AVRRFEQAAETLYRLLKEKEEC..AAARDEQL.-QAGLSVGDIR
Q2NX01_SODGM/19-143------------------------EEALLQLGA...CRSAHASAVAQLNQLMSYEQEY..RKQLEDNMT-GTGLNVDKWI
Q31FP3_THICR/21-142------------------------DKAQETFIA...VRQQLESSQEQLDSLQDYHTNH..LSKIHNEK.-..EVTTAQLQ
Q1Z7A8_PHOPR/18-141------------------------HQASLALNQ...ARIERQNYLQQLQQIEQYRLDY..CKQLSTRG.-QEGLTASSYG
A3YJJ2_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
A8GG12_SERP5/19-142------------------------EQATQQLGQ...VRKAQQAAEQQLSMLLNYQDEY..RQKLNNQL.-SGGMESSNWQ
D2MUN1_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......ADLR
A3ZGG1_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
A1S7Z2_SHEAM/19-142------------------------EQAALQLRS...AQLELGRLKQQLDALNQYRLDY..MRQLSGQEG-K.NISASYYQ
A1K931_AZOSB/19-142------------------------DEAARRLGE...LIASERDGQKKLEMLQGYRDEY..HGRFMEAVR-N.GIGPDAWR
A7ZN65_ECO24/19-142------------------------EDAARLLGE...MRRGCQQAEEQLKMLIDYQNEY..RNNLNSDMS-A.GMTSNRWI
Q1Q6R7_9BACT/32-155------------------------EEISKELKT...AQKKLHE.EKKMELLLKSLLET..RQIEMTEML-QTFADASTFV
Q4HEB4_CAMCO/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
B9XXM4_HELPX/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
Q1ZIU2_9GAMM/18-141------------------------SSALQAYQQ...AQTMLFTQRQQLQNLQQYRRQY..SDQLSVKG.-AAGLTVPELR
Q5QTV9_IDILO/19-142------------------------DKAAQDFSQ...VQQQVQEQQMRLDGMSKYRLDY..LNQLQHRGQ-S.GIASIQVG
A3ZCK4_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
C5D8W8_GEOSW/19-142------------------------HQAAGEYNE...AVRRFEEVAEKLYHFLKQKEQY..EEIHKQKL.-QSGLSIQEIR
Q13T20_BURXL/19-142------------------------DAAAQRLGR...AQRERNDVQSQLDALVQYRDEY..HARFTASAQ-T.GMPAGNMR
Q7MQS1_WOLSU/17-134------------------------NEAERAILV...VNREIEQMQEEIASILREIASI..AIPSSGAY.-......ADFL
Q3KG23_PSEPF/21-144------------------------KTAVQRLGY...FQGQVKVAESKLADLNAFRLDY..SQQWIVRGS-T.GVTGQWLL
A3WJT3_9GAMM/19-142------------------------DKLAQHFGE...AKQRLVSEQQRLDGLVQYRLDY..LNQLQARGA-G.GIRSIQFG
A8FNG3_CAMJ8/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
Q97H55_CLOAB/20-138------------------------EESKIEFKK...SQDVKKEIEKNLLSMTENYHEY.SLKRLSGTV.-......IEQK
B6ITC9_RHOCS/16-133------------------------DERRRALAE...RQAVEERLCGERARLEQELAHE..QKVAAGSL.-......QAAA
Q15RD9_PSEA6/19-142------------------------QKMATDYQL...AQQNVVDNQNKLSGLEQYRVNY..LKEGIRKGQ-L.GLAAKNYG
Q3J8N3_NITOC/19-142------------------------QQAAKVLGE...TQHLFQQQQHQLGEMSDYREEY..AQRCQSVGR-N.GISAQQLQ
B9CZR9_WOLRE/17-134------------------------DKIELNLAR...TRNEAAMIEGFIAQAAEQISKF..EMPSSGSA.-......IDLR
A8AKI6_CITK8/20-137------------------------EDLSTKLAS...QNQLCQRFEKNIDTLTSLAAGL..VSQSANSA.-......AMMI
A9KNF7_CLOPH/20-143------------------------EQEKNNYGI...AKAKLMEEEHKLMELVERKDSY..EFQIKEAM.-SSTLNIANIR
Q3SIH1_THIDA/19-142------------------------DEAAKRLAA...ALRAGEEASEKLALLTQYRDDY..SMRCQADLA-G.GLSTTQLH
B8I3Q0_CLOCE/20-143------------------------DNAKNNMAL...ASRELEKQKEFLTGLQTTRESS.ISELNSKV..-DQGISISQIR
A6F8U6_9GAMM/18-141------------------------KNAARAYAL...IQQDAERYHSQMQQLSDYRKQY..LQQFTERG.-EAGISGSSYA
A6F4J3_9ALTE/19-142------------------------KAALEKMAE...AQQHHEAQRQQIENLERYQQEY..REQIRSSQK-G.VVSVARLQ
A3Y9C9_9GAMM/19-139------------------------DNVARLLAR...QKQKVEQEKQKLEQLQEYASQY..ESERNLL..-..GLSPYLVT
O25037_HELPY/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
A0Y173_9GAMM/18-141------------------------ESLRMSYLQ...ANQNLQANQQKLQGLNDFRLEY..SQQLHLKG.-QSGLSSAGFG
B6JKI5_HELP2/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLNAF..KNPELGGM.-......SLFL
Q2L188_BORA1/19-142------------------------DDAARELGR...LSAQRANAEQQLNMLYEYRHDY..LKRLQDAM.-VAGMPAADCH
A3IF26_9BACI/20-143------------------------NETEMAYKE...SVRSFEEVATKLYDLLKKKEDL..IAFQQDRL.-TVGSSIDEIH
Q0BB04_BURCM/19-142------------------------DTATKQLGT...AQRDRTAAAEQLDALLRYRDEY..HARFSQSAQ-H.GMPAGNWR
Q0AAS0_ALHEH/19-141------------------------DEAGQRLAE...ARQDLDSQRQQLRQLLTFRQEY..AEQLQGQS.-.GGINAARLR
A4VMN5_PSEU5/21-144------------------------RDAARLLGQ...AQTQLTQAEGKLAELEQYFRDY..QQQWMQQGS-Q.GVSGQWLM
B5ZA22_HELPG/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
Q2B7F7_9BACI/19-142------------------------DEALDSYNQ...SVRRFEEAAGKLYELLKKKEDL..EEFQFSKL.-ASGLPVQEIR
O30718_HELPX/17-134------------------------EKIEQKLES...KRLELQQNEREVLDKQAQLSAF..KNPELGGM.-......SLFL
Q1QW47_CHRSD/19-142------------------------DQAAQSLGH...SRRKLQEAQQRLDQLLTYRHEY..RQRLENSMQ-Q.GIEPANWH
Q6D6G3_ERWCT/19-142------------------------EKAAGQLGQ...VRQAHQQAEQQLNMLLNYQDDY..RQKLNSTMS-S.GMANNSWQ
Q46QY5_CUPPJ/19-142------------------------DAAARELGR...LQGLRTQAENQLNQLTQYRHEY..RERMQAVAA-E.GMTSGRWH
Q3BU38_XANC5/19-138------------------------DKVARDLAE...RQRVLETHQSRLEELRRYAEEY..ANSQMAGT.-....SAVALS
A5KEJ0_CAMJU/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQERESL.GVLPKSGSI.-......AELR
Q47I06_DECAR/19-142------------------------DEATRQLGQ...LIAEEQNQRSRLQMLEQYRDEY..AQRLREAT.-LQGVTRMILR
Q485L7_COLP3/18-141------------------------QRCADQLKI...AENEYQQNLSRLQGVADYRLEY..MKRLSERA.-TNGLDSATYS
C7BY70_HELPB/17-134------------------------EKIEQKLES...KRLELQQKEREVLDKQAQLSAF..KNPELGGM.-......SLFL
A3KR50_PSEAI/20-143------------------------RDAATQLGR...CQQQLLAAQQKLAELERYRNDY..QQQWISQGQ-K.GVSGQWLM
Q5FQB1_GLUOX/18-138------------------------DLVERSFAE...AVARETAAEEKLTAAQAEILNE..QRIASSPT.-...ADDGAVE
B9XTS2_HELPX/17-134------------------------EKIEQKLES...KRLEWRQNEREILDKQAQLSAF..KNPELGGM.-......SLFL
Q5HST4_CAMJR/17-135------------------------DKAESNLNQ...AKQRQLEHEKAYELSRQECESL.GVLPKSGSI.-......AELR
Q7VHL3_HELHP/17-134------------------------QVCELAMMQ...NESKIANKQIQIENLQKDFLQL..KIPQAGTF.-......YAFK
A4BIN5_9GAMM/19-142------------------------EQAAQALAQ...VRAQIETEEKRLEELVSYRQEY..LSYLDEQGT-K.GISMQQWH
B9L6S3_NAUPA/17-134------------------------DAIERNLQK...INVSIQNLNTKIEELTKTLLSF..TFPKEGNF.-......ALLN

PF09486

Q52496_RALSL/5-161RRSSVWRALIEAKTRERRRVEADIEAAQAALAE---AQTAVEARQDALRQAEQRLDDH--LRSMDDLTT.GPCLTAQAYL
Q4USC0_XANC8/3-160ERVSTWRTLQQLKTRRYQRMQDHLSDCRRALEQ---CDGERASCSQQADACTTRLAAF--DAALADTAGAGEPIGIEAIL
Q83XF5_9XANT/3-160EPAHTWSVLHQLKARRCERMQERLSDCRRALEH---CDRELARCRQEAEACTTRLASC--DAALMDKAGVGGSIDIDTIL
Q3JLH3_BURP1/12-169RRAMAFARALERRRRLDAVLREELAERRTRLQS---LDRVLKEKVSQVELKADDVHRH--AARIDTLMTGTASFSLDELT
Q0B377_BURCM/4-156RRVAAFERVLSRRRQLDRNLNAALGALRGELQA---LAGVLEECRAAVRAHAAELAAH--DGKIDTMLG.GASFRADAYL
Q63JT6_BURPS/4-161RQQRAFETLLARRAQRGERLRAEQRVLRAERDA---AAAELAQGEAHAHAKRDAANRY--AERVDAMAAGRAPFTIGDYA

PF02050

Q18CZ7_CLOD6/21-139ITINYLLALNNSIMDLSEELDKSTNELEKARKQLISKQIERKSLEKLKEKKYGQ--------YYKEENLKEQNTNDEFAS
Q17W86_HELAH/17-134QTQQLKSALRIEIEHYQQECEILHESLKILEKDYLLANQELEKAKIILEKEKQK--------EKEIMEKKEQALLDENAM
D1B4C1_SULD5/17-134MVSEQKSILNREKKRHEEELIALLQVIKKLQVEYQKAHVEYEKIKYLEEQELQV--------MMAKIKREEQLYLDEIST
A7ZFJ5_CAMC1/17-134ENLELINIARAELSACKESLEIAKKEVLHYEHKYKNANLEYEKMKYLEKEEFKK--------EIKRIQKAEALALDEFAV
E3IA18_GEOS0/19-142HFQQFISNLERTIHHYQLLVMQAREQMQHKQIKLTELNIEVKKFEKMKEKYMQA--------VVDAEKITENKWMDEISI
B9R5V1_9RHOB/16-133AYPTFAKAAADRRDNLRNSAHELDDQLQRAQDELSEAIEDLKKFEQLEERDQQR--------ERTAQEAAEQEQLDEVAA
Q1N2X0_9GAMM/21-144QHQAFIAQIDQVLADQKFQISELQQQYDKAHEIYLSLNRKLKTYEKLETRLTSQ--------AEAQENSQLQKFLDEMSA
Q2T245_BURTA/19-142NFQAFLDTLDAAIEQQRRVLAAAQTRIDAARPEWQAKKRTLGSYEILQARGARQ--------DAQRAAKREQRDADEHAA
D0JYF7_HELP5/17-134QTQQLKSALRMEIEYYQQESENLIKDLKILEKEYFLANQELEKAKIILENEKRK--------EKEILEKKEQAFLDENAM
Q6AJT7_DESPS/21-144MYEGRADYIKHEIAEIKKTLLNKEKIVHQERKNLSHCAREHKIMCQLKEKQNLA--------WRQFINKKEAAVLDEIAI
A6SXY0_JANMA/19-142NYQQFLGKLEQAISSQQSVVRDAHMRVERERSAWQASERKRMSYGTLANRALKA--------KQLQENKRDQKQTDEHAA
Q7NTQ9_CHRVO/20-138NCAGYKRHLLDLRQSQQQDLQLAQADAEVSQSRLQDARRREEQVKLLREEKLLE--------WRTAQSRAEQKRTDEAAG
A1WUB9_HALHL/20-141DYNAFLTRLDEAIVQQRQQIAQLQRRVTQLHKEWLRRWGEHRTIEKVVERRAEA--------EQAEAERRERQKSDEVAR
B7WXY7_COMTE/19-142HQYQFMERLQHAIGLQTRVVADQDIRLETARQALLAAELRVTSLQKVVQARRRD--------VALAQMRREQKDTDERAT
B4SI03_STRM5/19-138NRRAFLDRLDSAVEQQQATVNGNREKVEAERARLILASRDKAVLEQLAASYRAQ--------EKVVTDRRDQREMDDIGA
Q7N5K4_PHOLL/19-142NYQQFMKTLEKAIEQHKLQLNQWQQRLDTALSQWREKQQRLNAFDTLQQRADNN--------RRLHQNRTEQKQMDEYAQ
A3YS99_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
A6CQ92_9BACI/19-142HNQHFIANIEKTIDYYQGLVIQARNRMNWYEEKLSEMNIEVKKYEKIRENDFNK--------YKELMHSSENKILDEMAV
A7H0A7_CAMC5/17-134GNLELLKIMRDELASYKEQLELAKKEVAHFEHQYKNANLEYEKMKYLEKEDFKR--------EIKRIERAESLALDEFAV
Q7WA80_BORPA/19-138NYQRFIATLDDAIGQQRHVLHRAEAHLNDGRLNWQQQKRKLNSFDTLAQRESRT--------QALLEARREQRVNDEYSA
D0IRC5_HELP1/17-134QTQQLKSALRMEIEYYQQESENLIKDLKILEKDYFLANQELEKAKIILENEKRK--------EKEILEKKEQALLDENAM
C3XLA9_9HELI/17-134TFAHHKEEYRSSIDFKMQELAILRQQKRELQEHFKLHNIEYEKAKYLDGLEVKK--------LLEKARIKESKDLDEISV
A5N7B8_CLOK5/20-138IRHIYINNLSYNIGETVEELNQKEKVVESKREELKQRQIDRKTVEVLKDKYIDD--------FRREQNRIEQNLNDEFAL
A4C6D0_9GAMM/18-141QFQLFIAKIESAMVQQNQVINTAKQVVEQRKSLWLAQQTKTSAIAKLIEKQDVK--------IQQKLQKDEQKMLDEYST
B6BHN5_9PROT/2-119ANRTLLSSGRGMIDHNKEWVGFAKNQVNQAKEKLKLDMIEHEKFKHLELQEIEK--------EIKKIKLKEMKDLDEVAL
Q4HPN7_CAMUP/17-135ANVFMEGVAREALARAKEKVELSHKEVNHYQFLYKKAHLDYEKIKYLQSEELKA--------MQKAIQKAEEKFLDELAI
A6W0W8_MARMS/19-139NYQHFVNRVQQAIVQQEAAVGRSEQQADMSMRRWLQARSKTKSMDWLKEKNHKA--------ELVVEAKQEQRQSDEFAM
Q085M6_SHEFN/19-142QFHQFIRQVDSAITQQVAAVKDAEKQVGYRQIHWQEKQQKRKAVEMLLSQKATK--------AMVIEAKREQKMSDEFAM
Q3SJV4_THIDA/18-141QTSRLQRAQAAKMAAAQASIDNAHRAWQARLAEWMEVEQKVKALRLLEARHRAH--------AAVQQRRIEQRQHDELVE
A0YC97_9GAMM/21-144NYQRFYGNLQDAGDTQQERVVLAASQQEQARLKWQQQYARQKNMQSLVARKEKL--------EHREADNKLQREQDDSRR
A4XW60_PSEMY/21-144NYQRFLSQLETAIGQQHQNLEWHRANLEKIRAIWQQRYARLEGLRKLVQRYIDE--------ARLAEDKREQKLLDELAQ
A1HN38_9FIRM/20-143IAYNYLDKLKEEIAQQKTKVSLAEHRCRQCQLALEQAVQARKVVEKLYEKRRRE--------YLGKLCREEQKLLDEMGT
Q9ZMI0_HELPJ/17-134QTQQLKSALRMEIEYYQQEGENLTKDLKILEKDYLLANQELEKAKIILEKEKQK--------EKEILEKKEQALLDENAM
A3DCM8_CLOTH/23-146KYNTYISYLSDRVKLQKENIKKAQLVVDKYRDKLIKAMQERKVLEKLREKKYEE--------YVREQLKEEQKLNDEIVS
A7MJK2_CROS8/24-147NYQQFIQTLEKAIEQHRLQLTQWNTKVDQALSFWKEKKQRLQAWQTLQDRHASA--------ALLAENRLDQKRMDEFAQ
A5D0F2_PELTS/20-140HLHFYRMSLKGRMAVQEKSVKTAGHTVEKRRSEVIKARQERQVMEKLKERQLQN--------FNHEMAVKEQKEMDELAG
Q893Y4_CLOTE/20-138IRHQYLINVSHNIELTTEELKKREEEVEKVRISLKQKQIERKTVETLREKDKSA--------FIKEQNLLEQKANDEFAL
B9KF92_CAMLR/17-134SSLKLQEIAREGKQRVKQKLDLTKKELAHHQHLYKKAHLEFEKIKVLENEELKK--------IQKALQKEEEKFIDELAI
A4Y8L0_SHEPC/19-142QFHRFIRQIDDAIAQQNRVVADGEKQKEYRQHHWLEKQKKRKAVELLLANKAKK--------RDALELKREQKMTDEFAS
Q82T42_NITEU/19-142NFKAFICKLDTAIQSQQRLVTMTQQHTEAGSTQYHAHRQKLKSYDTLSQRAELH--------HQARLQKQEQRQLDEHTA
FLIJ_BUCAP/20-143NYNNFIFILYFLIKDNEQKIKKNQKILEKSLKQYSKNQIKLKTWNYLYKKYKKK--------EIKKILLVEEMISDEFSQ
Q21IN5_SACD2/19-141RIRNFLQQLAMAKQAQMLQIQRVEGVQRQAREAWQACHLKHKLMKDMIARYKTE--------EQAVLDKNEQKMLDEWFN
A4BUE0_9GAMM/19-142DYNAFLARIDQAIGHQQQSLTHLAAEVEELRRTWLDQWGNARALEQLVARYRRT--------EQRADAVREQRLNDALAQ
D2MWE8_CAMJU/17-135SNLSMAQVGREALARVKEKVELSKKEINHYQFLYQKAHLDYEKIKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
Q1LCK2_RALME/19-142DFSRFLDSLDHAIRQQTNALAKAEADLLAGRANWQQQKRRQNSFDTLITRAETR--------EQQVSARREQRANDEYAA
C5EYR8_9HELI/17-134TFVHHKNEYRETIDFKMGELALLKKQKQELQEYFKMQNVEYEKAKYLDGLEVKK--------ILDKIRRQESKDLDEISV
A8H2A5_SHEPA/19-142QFHQFVRQIDTAIIQQVNTVQDADNQRQHRQVYWQEKQQKRKAVELLLANKAEK--------AQLAELRAEQKMVDEFAS
Q2RKE6_MOOTA/20-138QKAAYLEALDGRIACQQEEVARASRVVTEGREKVQAAMQERKVLDRLRERQFQD--------YKYNLAREEQKQVDEAAG
Q7CHZ3_YERPE/19-142NYQQFIQTLEQAIDQHRKQLAQWSIKVEQAVKYWQEKQQRLNAFETLQERAETT--------QRQQENRLDQKLMDEFAQ
Q2Y9B9_NITMU/19-142NYHEFIDKLDAAISQQQEALALMRQRVAASEAAWQSERRVLNSYGTLAQRHRQI--------QLAHQARREQRETDEWAN
A3J9N7_9ALTE/19-142AWQAFMGQLDQLIGQQQVQLEQANQVFEVRRNEWLKAWEKRRGMENFITTCRQQ--------EQREQDSREQKQADEAAG
Q3ADE0_CARHZ/20-135HQLERIEYLATEKWRLEKELERLINERERAKEEYLAKKIEQKKMEVLKEKAKAS--------YREELERENQSFLDEISL
Q88ET8_PSEPK/22-145NYQRFLGQLETAMTQQRQSLVWHQNNLNNARGTWQQAYARVEGLRKLVQRYQDE--------ARRAEDKREQRLLDELSQ
C1DHL1_AZOVD/19-142NYRAFLGSLDDAIQRAVQTLDAQRRQVDHSQRHWQEQRRKLNSYDTLVERRARL--------GQLRENRAEQRRSDETSA
D3FNY0_CAMJI/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
Q8R9Z2_THETN/20-143ETEAYIMKIREMIEKQANYILKLEKEAEKIREGLLKVSKEKKALENLKERQFSE--------YLYLLNLEQSRVIDEHVS
Q8XSS3_RALSO/22-145NYAAFIDRLGSAVDHQRGTISALEAQLQRSRDNWLEKQRREQSFDILRQRHVEE--------QRQDQERRAQRENDEHAA
C6RHH5_9PROT/17-134GSLELLGAMRREKSLLTERLELMKKNIAHLERQYKAANLEYEKMKYLQTQDFSA--------QIEKIKKAEATALDEFAT
Q4KG65_PSEF5/21-144NYQYFLSQLDTAVGQQRQSLAWHQNNLDRAREAWQQAYARVEGLRKLVQRYIDE--------ARALEDKREQKLLDELSQ
Q1CUP7_HELPH/17-134QTQQLKSALRMEIEYYQQESENLIKDLKILEKECLLANQELEKAKIILEKEKQK--------EKEILEKKEQALLDENAM
Q5WVU1_LEGPL/20-143NRINFINHLDTALVQLNSYLSQLAKNRMKADLNYKQAKTSEEGISKLIERVKRA--------ELKQLQRIEQKETDEYAQ
A6GTY4_9BURK/19-142NQLAFVGKITQAIEQQSREIEFLNTTLAHQRTQWQEALAEQRKFEALVEREKLK--------QAKLENKRDQKMNDEFAA
A2SD92_METPP/19-142CYQGFMVRLDEAVSQQQRLLAQAIERGETAKAALLSAELRVASVRKLIERRIAE--------AVRTQDRSDQKATDELAS
A7FWT5_CLOB1/20-138IRHSYLNSLNFCINETANELQQKLKIVEERREELKTKQVERKTVEILKEKDKLA--------FEKEQNMIEQRNNDEFAL
Q1GZU6_METFK/21-144NYQSFLGKLSQAITSQTENVERLRQVHHLRKQEWQECQKKKMSYDVLIDRADKR--------ENAIELKRDQKMMDEHAM
Q30UH4_SULDN/2-119ATRALLDSQREIINHNKEWIAFAKNQVTQAKEQLKIDMIEYEKFKYLELQEIKA--------ELKKMNAKEAKDLDEIAL
A1WCD5_ACISJ/19-142HHYQFMGRLDHAIGLQTGVVSGQDVRVDKARQALLEAELRLASLRKVLERRRAE--------VALQQQRREQKQTDERAA
A3QCP1_SHELP/19-142QFHQFIRQIDEAIEKQVFAVSETDKQRQKAQQYWQGKQQKRKAVELLLAHKAEA--------KQKFEAKQEQKMIDEFAS
Q9KQ72_VIBCH/34-157HLNRFLTQLDETLAKQKSAEQHFRLQVENCEQHWMNMRQKRKSYQWLMEKKQTE--------RQLLQEKREQKQMDEFST
C5ZV80_9HELI/17-134TFVHHKNEYRQTIDSKMGELALLKRQKQELQDYFKAQNIEYEKAKYLDGLEIKK--------NLEKAKKQESKDLDEISV
A6DE14_9PROT/17-134QISLQKNTFLSEIKSYENQIKILENRKSELIKELKKANIEYEKMKYLQNEEIKK--------KIKNIRLKESKEMDEIAI
A0RMZ0_CAMFF/17-134INLEEQKLLREQKERIKEKIILNQKEIVHYEFQHKKAYIELEKMKYLEKEETAK--------EIAKIKKQEAKDLDEIAV
Q12PL2_SHEDO/18-141QFHQFIKQVDNAITQQVNAVKDAETQVLYRQHNWQEKQQKRKAVEMLLEQKALK--------RAHIENVREQKMSDEFAM
A1U255_MARAV/19-142AWQAFIAQLDQVIAQQQRQLQQAEQVFEARRREWQQAWERRRGMEKYIESCRQQ--------EQREQDLRDQKLADEAAG
Q0P8C0_CAMJE/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
B2UJR0_RALPJ/22-145NYAAFIDRLGNAVHQQKGTINALEQQLAMSRANWLEKQRREQSFDILRQRHIEE--------QRLDQERRAQRENDEHAA
C3XE83_9HELI/26-143SQKDSIQAYLYEIREIQRQIGILKEEQEYIKQQIRIAHLEHEKTLYLYNKAKDA--------QTLENNKQETKQLDEVTI
A8FXU3_SHESH/19-142QFHQFVRQIDDAIVKQIASVTEADTQRLHRQQYWQEKQQKRKAVELLLAHKAEK--------AQQAELRREQKLTDEFAS
D3UG45_HELM1/17-134ILQEGRGSFLFQIDSLHQEISLLKSQKKEAQRVYQHLYREVEKIQYIHSNILKK--------MITKIKKNEEKNLDEIAA
D3P642_AZOS1/18-135TYSNFAQAAMERGRKLGESLAQVEAQISIATDEMAEAFQELKRYELAEEERLKR--------ERDKLKRKEAAMLDETAL
B2US88_HELPS/17-134QTQQLKSAIRMEIEYYQQESENLIKDLKILEKEYLLANQELEKAKIILENEKRK--------EKEILEKKEQALLDENAM
Q1IR50_KORVE/20-143FVESQRIALRRAAAEIQSTIEDLNRAISLQQEKYMSARRESEKLERLRATELAA--------WHKQLERRDQAAVDELFL
A6M194_CLOB8/21-139LKRYYIQGVQSGIRSTEKDLAVKNQEIENRRKDLTAKQMERKTVQTLKEKKYSE--------YVKEQDRVEQINIDELAL
Q2SBV7_HAHCH/22-145TYHVFISRLGSAIEQQQQQLLLLKQQLSQQTDVWRAAYQKKNNMQDFIDRCKKE--------EAYYEDKKQQRNLDDAVG
B5QIH2_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
Q48GE6_PSE14/21-144GYQRFLSQLDVAVAQQYKSLEWHKANLDRARSAWQDCYARVEGLRKLVQRYMDE--------ARRLEDKREQKLLDELSQ
Q5L0M2_GEOKA/19-142LRLQYMANLERMIDHYQLVVMQAREQMQRRQQRLMELNIEVKKYEKMRERIKRW--------AEQLEREAERRLLDEMAV
Q2NX01_SODGM/19-143NYQSFIASLYKIVAHHSQQVSVFQSRVDLAVAQWHQKKQRLNAFEILKTRSETA--------RQLRENRRSQKQMDEFAL
Q31FP3_THICR/21-142TTQAFIDNVNKAILSQKDQITQLTHVLEKAQETWIEKRARHQSLKNIHLKLKRD--------ERVKLDKQEQKMLDELAS
Q1Z7A8_PHOPR/18-141HLQKFLTQLDETLAKQKEAGHQFEFQIEQCSEHWNEVRKKRRSIEWLLEKKQTE--------RQKMLDRQEQKMMDEFST
A3YJJ2_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
A8GG12_SERP5/19-142NYQQFIGTLEQAITQHRQQLTQWGEKVESAVKHWQDKQQRLNAFETLHTRAQSA--------QLQLENKRDQKLMDEFAQ
D2MUN1_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKTHLDYEKMKALETEEIKQ--------KQKELAKAEEKFLDEIAI
A3ZGG1_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
A1S7Z2_SHEAM/19-142QFHRFIKQIDQAIGQQVQSVTGAETQLEHRRRHWLEKQQKRKAVELLLKHKADK--------REAKEARLEQKLLDEFAM
A1K931_AZOSB/19-142NFSAFIGKLDDAIATQRKIVEQSRDRTAQGQEIWLAQRNRVKAFDTLSQRHQAG--------VARQEAKREQKLSDEHTA
A7ZN65_ECO24/19-142NYQQFIQTLEKAITQHRQQLNQWTQKVDIALNSWREKKQRLQAWQTLQERQSTA--------ALLAENRLDQKKMDEFAQ
Q1Q6R7_9BACT/32-155LFESYFASLNRDIIVQQSKIKKISEEIDHVRQKLLHVFKKRKLLEKLRERHKKE--------FDDQEKRLEIKKLDEIAT
Q4HEB4_CAMCO/17-135SNLSMAQVGREALARAREKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
B9XXM4_HELPX/17-134QTQQLKSALRMEIEYYQQEGENLNKDLKILEKDYLLANQELEKAKIILEKEKQK--------EQKILGKKRAGSFRRKRH
Q1ZIU2_9GAMM/18-141KYQQFIVQIDQGLSTQQQGLVKFEYDVHTQKKLWLDSQISCKAIAMLLKKKALK--------EEQIANKIEQKLLDEFSI
Q5QTV9_IDILO/19-142QYHAFVGKLDEGVEQLHHDIIKLQQVLQQRKDRWLAQRRKRESIDFLIKEKRKR--------EQIAEARKEQNNLDDFSS
A3ZCK4_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
C5D8W8_GEOSW/19-142HFQQFISNLERTIHHYQLLVMQAREQMHRKQMKLTELNIEVKKYEKMKEKYIQA--------AFDVERTAENKWMDEISI
Q13T20_BURXL/19-142NFQAFIDTLDAAIEQQRNLLATATARVEAAKPDWQRQKQKLGSYEVLQARGEAA--------EARTTARRDQRDADEHAA
Q7MQS1_WOLSU/17-134KIQAIKKAHIDELEFKKLDLAHLREKRQRMQEQLKLLSLEHEKAKYLDKLEIQK--------MLALQKRQEELQMDEVSL
Q3KG23_PSEPF/21-144GFQGFLAQLDTAVDQQRQSLQWHQNNLDKARDAWQQAFARVEGLRKLVQRYRDE--------AQRAEDKREQKLLDELSQ
A3WJT3_9GAMM/19-142QYHAFVGKLDEGIEQMHNVLQQLNQVVEQRKQQWLAQRQKAESIELLIENKKRA--------AARLQARKEQKNLDDFST
A8FNG3_CAMJ8/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKALETEEIKQ--------KQKEFAKAEEKFLDEIAI
Q97H55_CLOAB/20-138ITQNYLNALNVLIDEASDNLEKQKKVVEDKRNVLIKKQVERKTVEVLKDKQKLE--------FEKNENLKEQRVNDELAL
B6ITC9_RHOCS/16-133TYGDFARHVIHRRERLDDAIARARAEVARAEESVAEAFQELKRYELAQEERQRQ--------RQEALRRADTQRLDEIAS
Q15RD9_PSEA6/19-142QHQSFVGKIDAACEQQTKQVSNALVVAEQRKAQWLAQQRKRKAVEMLLDKQALK--------IQQKQDRAEQQMLDELAL
Q3J8N3_NITOC/19-142QLQSFLARLDQAIYQQKQQVERSSQLLEQKRKGWFAVRSQVKALEKLQDRYQRE--------ERNLAAYHEQAEMDDRNQ
B9CZR9_WOLRE/17-134GSLELLGAMRREKNLLTERLELMKKNIAHLERQHKAANLEYEKIKYLQTQDFSA--------QIEKIKKAEAAALDEFAT
A8AKI6_CITK8/20-137NQSKYKHNIQRIIDWQKQEQALAHLEAQKIQGNLLAEAKREKSIELVLDAKRAD--------RQAEINRREQKMTDSLSA
A9KNF7_CLOPH/20-143RLEDAIESMKQFIKQQSKAVVKAEQAVELAMQRLKDAMIERKTHDKLRENAFEG--------YIKEYVGEEMKEIDELVS
Q3SIH1_THIDA/19-142NYQVFMQKLDYAISGQQKVVDAVQAQIAAARTAWQACEQKKMSFVTLAGRAKKE--------ETRRELWRDQKQNDEHAA
B8I3Q0_CLOCE/20-143AYNNYLSFLKQKITVQKENVNIARIQVDIRRESLVKAVQERKILDKLREKKYDE--------FLKEQSKAEQLLIDELNS
A6F8U6_9GAMM/18-141HYHNFMKKLELAEFEQKQALDNIQQTVNNKHADWMEIRKKRDALGLLLDKRKVA--------AQLVEQRREQKDLDEFSN
A6F4J3_9ALTE/19-142GWQAFIAQLDQVIVQQQKLLTQAEERLQACREEWQRAWERRRGMEKYIETCRQH--------EQREQDVRDQKQMDEAAG
A3Y9C9_9GAMM/19-139NYQHFVSRLEQAVQQQKGAISQSEHQADQAQLQWLQARAKTKSMDLVKGKHAEQ--------ERRLEEKQEQKQFDEFAM
O25037_HELPY/17-134QTQQLKSALRMEIEYYQQESENLNKDLKILEKDYLLANQELEKAKIILEKEKQK--------EQKILEKKEQALLDENAM
A0Y173_9GAMM/18-141QYHAFIAKIEEAIRQQASTVNTAKQVVSQRKTLWLKQQIKAKAVAKLIENQKIK--------AAAVVAKNEQKMLDEFTS
B6JKI5_HELP2/17-134QTQQLKSALRMEIEYYQQESKNLNKDLKVLEKDYILANQELEKAKIILENEKQK--------EKEIVEKKEQALLDENAM
Q2L188_BORA1/19-142NYQRFIGTLDDAISQQANVLHSADMQLMQGRLHWQQQKRKLNSFDTLAQRDARS--------RALIETRREQRANDEISA
A3IF26_9BACI/20-143HYARFIDSLEKTIADVQQKVIQARAKMNWHEDKLLEKNLEVRKFEKMREKDFKL--------FQQEQDRIESLFLDEISL
Q0BB04_BURCM/19-142NFQAFIDTLDAAIAQQRTVLAAAELRIDEARPNWQQKKRTVGSYETLQARGVAQ--------ETQRAAKREQRDADEHAA
Q0AAS0_ALHEH/19-141DYNAFISRIDQAIQQQHQVVAQAKRRVNAQRQDWLEAYSHSRAVGRVVDRFRDE--------ERREQERREQLQLDELAR
A4VMN5_PSEU5/21-144NYQRFLSQLESAIGQQQRSVNWYRDNLLKVRQQWHQRHARVEGLSKLIESYQRE--------ARIAADKREQKLLDEFAQ
B5ZA22_HELPG/17-134QIQQLKSALRMEIEYYQQEGENLTKDLKVLEKDYILANQELEKAKIILENEKQK--------EKEILEKKEQALLDENAM
Q2B7F7_9BACI/19-142HYQHFIHSLEKTIEHYQQVVFNARNQMNYYQDKLTEKNIEVKKYEKMKEKDIVR--------FAESMKLEENRQMDDISI
O30718_HELPX/17-134QTQQLKSTLRMEIEYYQQESENLTKDLKILERDYLLANQELEKAKIILEKEKQK--------EQEILGKKEQALLDENAM
Q1QW47_CHRSD/19-142NYQQFLASLDQAIAGQRQAVNDQQRHLDRQQQAWQGERRKLNTYDTLITRRDNA--------EQQRAARREQQLFDEMSA
Q6D6G3_ERWCT/19-142NYQQFIRTLDGAIEQHRQQLSQWTSRLDLAMKTWQEKQQRLNAFEKLQDREVTR--------QLAKENKIEQKQMDEFAQ
Q46QY5_CUPPJ/19-142DFSRFLDSLDHAIRQQTTALEKAEADLLAGRSRWQNNKRRVNSFDTLIARADAR--------EEKVAARREQRANDEYAA
Q3BU38_XANC5/19-138NRRAFLDRLDSAVLQQAQTVQSNIAKVEAERTRLLLASREKQVLEQLAASYRAQ--------ENKVIERRDQREMDDLGA
A5KEJ0_CAMJU/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
Q47I06_DECAR/19-142NYQDFLARIDEAVKQQKIAVENSERSTKTGKENWQAQNKQLKAIDTLSQRHDAR--------ERYRENKHDQKLQDEFST
Q485L7_COLP3/18-141HYHAFIAKLDTASKQVEIATRQAKALVDQSKSLWLKQRQKVKAVELLRDKRLKK--------IAVAADRAEQKMFDEIAT
C7BY70_HELPB/17-134QTQQLKSALRMEIEYYQQQSENLTKDLKILEKDYFLANQELEKAKIILEKEKQK--------EKEILEKKEQALLDENAM
A3KR50_PSEAI/20-143NYQRFLSQLETAVAQQANSVTWHREAVDKARLNWQERYARLEGLRKLVERYLEE--------ARQAEDKREQKQLDELAQ
Q5FQB1_GLUOX/18-138AFSRWLPGGRQAVLEARQRCREAAMDREAVRSALIAARAAMEAVRTLREEQKEE--------ERQADLRKEQNALDELAV
B9XTS2_HELPX/17-134QTQQLKSALRMEIEYYQQESENLIKDLKILEKEYLLANQELEKAKIILENEKRK--------EKEILEKKEQALLDENAM
Q5HST4_CAMJR/17-135SNLSMAQVGREALARAKEKVELSKKEMNHYQFLYQKAHLDYEKMKVLEAEEIKQ--------KQKELAKAEEKFLDEIAI
Q7VHL3_HELHP/17-134AFEETKNMLLTHISLARNELEALFAHRKVLQEQYKKCNIEYEKVHFLDKKEHNE--------MIKNAKYKEKLEVDEIAV
A4BIN5_9GAMM/19-142RTQSFIDQLATLSGRQQQTIEGWRSREQQILEKWRELYQRRKNIGRFIDKISTE--------EAIAADKQEQKLIDELVN
B9L6S3_NAUPA/17-134QIKHQQHIIRDEIQNLKNQIMVLESRKKELLEELKKANIDYEKMKYLQAEEIKK--------MIKEKKLKESRDLDEIAI

PF09486

Q52496_RALSL/5-161QYDAYRTQLEGGVGQAEQAVAAAQGVVAERVAALQAQRRKLARLDAMLERCRETADRLDRKEDAERELATEEEAVEAILA
Q4USC0_XANC8/3-160QHQRFRAVLEERCGAAEQALVAATQALQRAHDEVATVQQTVSRLEAQAQVYAEKAARARRAWQAQREAAEEEDAIEALIG
Q83XF5_9XANT/3-160QHERFRTVLVEACRAAEQAQTAASQSLQSARDELGSVQQALSKLQAQAQVYADKAASARRARQAQREAAEEEDAIEALVA
Q3JLH3_BURP1/12-169ACRAYLDVAVAHLRALESEEARLRAEFDALAAAIEEKKLEIGRNLSRIDACDARIEQIRRHGERAADEALDEEMEEAALG
Q0B377_BURCM/4-156KLREFRSHAAEQHAMLEAQADQAGQALAAKHAQIGAMRTDILRNRARIDIYGKRRDALVKAIELAIEDAQDEETSEN...
Q63JT6_BURPS/4-161ACRRYRDALLDEHALASAQCARLRAALQAKVDRLAATARRIARNDAQIDVVRERIRRLARAAEAAAEDAHDEEIEEGVLA

PF02050

Q18CZ7_CLOD6/21-139MSY
Q17W86_HELAH/17-134ILH
D1B4C1_SULD5/17-134MLF
A7ZFJ5_CAMC1/17-134MKF
E3IA18_GEOS0/19-142QRF
B9R5V1_9RHOB/16-133RGR
Q1N2X0_9GAMM/21-144QIH
Q2T245_BURTA/19-142KVL
D0JYF7_HELP5/17-134ILH
Q6AJT7_DESPS/21-144MRH
A6SXY0_JANMA/19-142RAL
Q7NTQ9_CHRVO/20-138QAW
A1WUB9_HALHL/20-141MLY
B7WXY7_COMTE/19-142MAF
B4SI03_STRM5/19-138RRA
Q7N5K4_PHOLL/19-142RSV
A3YS99_CAMJU/17-135SRF
A6CQ92_9BACI/19-142MQY
A7H0A7_CAMC5/17-134IKF
Q7WA80_BORPA/19-138RLV
D0IRC5_HELP1/17-134ILH
C3XLA9_9HELI/17-134MLH
A5N7B8_CLOK5/20-138YGF
A4C6D0_9GAMM/18-141NAF
B6BHN5_9PROT/2-119MTH
Q4HPN7_CAMUP/17-135SRF
A6W0W8_MARMS/19-139RRF
Q085M6_SHEFN/19-142QQY
Q3SJV4_THIDA/18-141LIH
A0YC97_9GAMM/21-144SQR
A4XW60_PSEMY/21-144RLI
A1HN38_9FIRM/20-143LLV
Q9ZMI0_HELPJ/17-134ILH
A3DCM8_CLOTH/23-146FNI
A7MJK2_CROS8/24-147RAS
A5D0F2_PELTS/20-140NAY
Q893Y4_CLOTE/20-138YGF
B9KF92_CAMLR/17-134TRH
A4Y8L0_SHEPC/19-142QQF
Q82T42_NITEU/19-142HNF
FLIJ_BUCAP/20-143LKN
Q21IN5_SACD2/19-141SQN
A4BUE0_9GAMM/19-142RRS
D2MWE8_CAMJU/17-135SRF
Q1LCK2_RALME/19-142RIA
C5EYR8_9HELI/17-134MLY
A8H2A5_SHEPA/19-142QQF
Q2RKE6_MOOTA/20-138SRF
Q7CHZ3_YERPE/19-142RAS
Q2Y9B9_NITMU/19-142SAA
A3J9N7_9ALTE/19-142RAF
Q3ADE0_CARHZ/20-135FGY
Q88ET8_PSEPK/22-145RLP
C1DHL1_AZOVD/19-142QLR
D3FNY0_CAMJI/17-135SRF
Q8R9Z2_THETN/20-143YKV
Q8XSS3_RALSO/22-145KLI
C6RHH5_9PROT/17-134MNF
Q4KG65_PSEF5/21-144RLP
Q1CUP7_HELPH/17-134ILH
Q5WVU1_LEGPL/20-143KQW
A6GTY4_9BURK/19-142RIY
A2SD92_METPP/19-142RAA
A7FWT5_CLOB1/20-138YAF
Q1GZU6_METFK/21-144RVS
Q30UH4_SULDN/2-119MTY
A1WCD5_ACISJ/19-142LRA
A3QCP1_SHELP/19-142QQF
Q9KQ72_VIBCH/34-157LMF
C5ZV80_9HELI/17-134MLY
A6DE14_9PROT/17-134ILR
A0RMZ0_CAMFF/17-134QRY
Q12PL2_SHEDO/18-141QQF
A1U255_MARAV/19-142RAF
Q0P8C0_CAMJE/17-135SRF
B2UJR0_RALPJ/22-145KLI
C3XE83_9HELI/26-143MLH
A8FXU3_SHESH/19-142QQF
D3UG45_HELM1/17-134ILF
D3P642_AZOS1/18-135VGF
B2US88_HELPS/17-134ILH
Q1IR50_KORVE/20-143MRL
A6M194_CLOB8/21-139YAY
Q2SBV7_HAHCH/22-145RRA
B5QIH2_CAMJU/17-135SRF
Q48GE6_PSE14/21-144RLP
Q5L0M2_GEOKA/19-142QRF
Q2NX01_SODGM/19-143RAS
Q31FP3_THICR/21-142QQF
Q1Z7A8_PHOPR/18-141LQF
A3YJJ2_CAMJU/17-135SRF
A8GG12_SERP5/19-142RSA
D2MUN1_CAMJU/17-135SRF
A3ZGG1_CAMJU/17-135SRF
A1S7Z2_SHEAM/19-142QQF
A1K931_AZOSB/19-142RRY
A7ZN65_ECO24/19-142RAA
Q1Q6R7_9BACT/32-155SRF
Q4HEB4_CAMCO/17-135SRF
B9XXM4_HELPX/17-134DFT
Q1ZIU2_9GAMM/18-141FQY
Q5QTV9_IDILO/19-142QRF
A3ZCK4_CAMJU/17-135SRF
C5D8W8_GEOSW/19-142QRF
Q13T20_BURXL/19-142RIL
Q7MQS1_WOLSU/17-134LLY
Q3KG23_PSEPF/21-144RLP
A3WJT3_9GAMM/19-142QRF
A8FNG3_CAMJ8/17-135SRF
Q97H55_CLOAB/20-138YSF
B6ITC9_RHOCS/16-133IRF
Q15RD9_PSEA6/19-142QKF
Q3J8N3_NITOC/19-142HNF
B9CZR9_WOLRE/17-134MNF
A8AKI6_CITK8/20-137QCW
A9KNF7_CLOPH/20-143FQY
Q3SIH1_THIDA/19-142RRA
B8I3Q0_CLOCE/20-143FKF
A6F8U6_9GAMM/18-141FQY
A6F4J3_9ALTE/19-142RIL
A3Y9C9_9GAMM/19-139LKY
O25037_HELPY/17-134ILH
A0Y173_9GAMM/18-141NQF
B6JKI5_HELP2/17-134ILH
Q2L188_BORA1/19-142RLA
A3IF26_9BACI/20-143LTY
Q0BB04_BURCM/19-142KIL
Q0AAS0_ALHEH/19-141RTY
A4VMN5_PSEU5/21-144RLA
B5ZA22_HELPG/17-134ILH
Q2B7F7_9BACI/19-142QLY
O30718_HELPX/17-134ILH
Q1QW47_CHRSD/19-142RMT
Q6D6G3_ERWCT/19-142RAS
Q46QY5_CUPPJ/19-142RLA
Q3BU38_XANC5/19-138RRS
A5KEJ0_CAMJU/17-135SRF
Q47I06_DECAR/19-142RKF
Q485L7_COLP3/18-141QQY
C7BY70_HELPB/17-134ILH
A3KR50_PSEAI/20-143RTR
Q5FQB1_GLUOX/18-138RQF
B9XTS2_HELPX/17-134ILH
Q5HST4_CAMJR/17-135SRF
Q7VHL3_HELHP/17-134MLY
A4BIN5_9GAMM/19-142QRY
B9L6S3_NAUPA/17-134LLR

PF09486

Q52496_RALSL/5-161RAR
Q4USC0_XANC8/3-160LRL
Q83XF5_9XANT/3-160LRS
Q3JLH3_BURP1/12-169ARM
Q0B377_BURCM/4-156.RR
Q63JT6_BURPS/4-161RRL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window