Sequence alignment for CL0420

PF11345

Q5HS29_STAEQ/4-112AIIKFSVGGLAVLISYIVSVVLPWKEFGGIFATFPAVFLVSMCITGMQFGNEV....AMHVSRGAVFGMIGVL--CSILA
Q8TP71_METAC/9-119LFLRFLFGGSAVLASTLIARTFGGK.LGGIFAAFPAVYLAAVVGLGLEYKGSELLSVTEQLSRGALVGMAADI--CCALA
Q5HS30_STAEQ/9-119AILHFVIGGFAVALASIMADKVGGK.LGGIIATMPAVYLAAIIALAIDHKGQQLIQMSIHLSTGAIVGIVSCI--VTVFF
A4J8P6_DESRM/12-122LLLRFVLGGLAVVLSTLTARWIGGK.AGGIFAAFPAVYLAALLGVILLVPAQQAVSAVRSVSAGALVGMTSDI--ICAIA
A4J8P5_DESRM/8-116LMLRFVLGGLAVALCYILLILIPWKSVAGIFAAFPAVMVSALIITGMEKGSKE....ATNIAYGAVAGNIGGL--VCVMT
Q2FUQ6_STAA8/7-116AILHFVIGGIAVALASIIADKVGGK.LGGIIATMPAVFLAAIIALALDHRGTQLVEMSMNLSTGAIVGILSCI--LTVFL
Q2FUQ7_STAA8/5-111.LMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKV....AVHVSRGAVFGMTGVL--VCILV

PF06942

A6T8N2_KLEP7/5-111--IKGLLGALVVVLIGVLAKTKNYA-IAGLVPLFPTFALIAHYIVASERG-------IEALRATIVFGMWSILPYFIYLL
Q6DAZ4_PECAS/41-147--IKSVIGALIVLLISVLAKSRNYY-IAGLVPLFPTFALIAHYIVGTERG-------LDALRTTILFGIWSVIPYLAYLI
Q7MCE8_VIBVY/24-130--LKSLLGAAAVVIIALLSKSKNFY-IAGLVPLFPTFALIAHFIVGSERS-------MEDLRQTALFGLWSLLPYAAYLA
Q6F760_ACIAD/7-113--LKCTLGAAVVLLISILSKSKTFY-IAGLVPLFPTFALIAHVIVFGQQG-------AEALRKTALFGLWSLIPYAVYLG
A7MLC8_CROS8/5-111--IKALLGAAVVVLIGMLSKTKNYY-IAGLIPLFPTFALIAHYIVVTGRG-------VEALRTTVIFGMWAIIPYFVYLA
Q6AQN8_DESPS/6-112--FKCSIGAFAVLTIALLSRSKSFF-IAGLVPLFPTFALIAHYIVGSERS-------PMELRTTALFGLYSIMPYAAYLF
B7VMS3_VIBSL/3-108--FKCLLGAAAVLLIALLSKSKSFY-IAGLVPLFPTFALIAHYIVGTEQT-------MVELRTTALFGLFSLVPYAAYLG
GLPM_PSEAE/2-108--FKALIGAAVVVLLAVLSKTRNYY-IAGLVPLFPTFALIAHYIVGKGRS-------LDDLKTTIVFGMWSIIPYFVYLA
Q0WFT1_YERPE/5-111--LKVLIGTGMVLMIALLSKTRHYY-IAGLIPLFPTFALITHYIVGTERS-------IDALRITIKFGLWAIIPYFIYLI
Q8ZPL2_SALTY/5-111--IKAALGALVVVLIGLLSKTKNYY-IAGLIPLFPTFALIAHYIVASERG-------IDAMRTTIAFSMWSIIPYFIYLA
Q9KLV8_VIBCH/6-112--FKCLLGALAVLIIALLSKTKSFF-ISGLVPLFPTFALIAHYIVGTERT-------MEDLRTTALFGLYSLIPYAAYLL

PF11345

Q5HS29_STAEQ/4-112TWGLLQATHMWLLSIIGGFVAWFVSALIIFEIVEF--
Q8TP71_METAC/9-119ASYFILR.YGWKRGLAYALSLWALLAPLIYFTWFG--
Q5HS30_STAEQ/9-119TSIFIGK.KNYRSGTVFAILCWFVISVAIFLVRHI--
A4J8P6_DESRM/12-122AIYFIPK.KGWAKGLFMALIVWAVAVVVLYTISFT--
A4J8P5_DESRM/8-116VLLGLALWQNVTLAISIGLIAWFVASAVSFSIYTA--
Q2FUQ6_STAA8/7-116TSLYIKH.KGYRKGAIFTVVCWFVISLAIFSIRH.--
Q2FUQ7_STAA8/5-111TWMMLHMTHMWLISIVVGFLSWFISAVCIFEAVE.--

PF06942

A6T8N2_KLEP7/5-111SLWYFTGIMRLPLALAGAVGCWGLCAWLLILGWSRFH
Q6DAZ4_PECAS/41-147SLYYFTGWMKLPQALLAAVVCWSVSAALLIKIWTWYQ
Q7MCE8_VIBVY/24-130AVYYFSYRFSLVTTLSAATVIWLMAASLLIGAWTKVM
Q6F760_ACIAD/7-113MVYYFANRLPIGLCLTVATLTWVIVAAGLIYGWNSYF
A7MLC8_CROS8/5-111SLWVLSGMVKVPLALGGAVACWCLSAWLLIALWSRFH
Q6AQN8_DESPS/6-112AVYYFSIRFNLVTNLLLSTAIWIIFAAVLLVTWVKLH
B7VMS3_VIBSL/3-108AVYVFSYRYNLVSTLSLATIVWVLCASMLLLGWTRL.
GLPM_PSEAE/2-108ALYLLVERFRLETSLALAALAWLVAASVLVGLWVRLH
Q0WFT1_YERPE/5-111SLYFFIEHMRLSLALISAVLCWVIAAWILISIWSQWH
Q8ZPL2_SALTY/5-111TLWYFSGVMRLPVALGGAVVCWGLSAWLLIFCWIKWH
Q9KLV8_VIBCH/6-112AVYYFSYRLSLTGTLVCATLVWLVFAALLLVGWTRLH

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window