Sequence alignment for CL0420

PF06942

A6T8N2_KLEP7/5-111--IKGLLGALVVVLIGVLAKTKNYA-IAGLVPLFPTFALIAHYIVASERGIEA----LRATIVFGMWSILPYFIYLLSLW
Q5PIB2_SALPA/18-124--IKAALGALVVVLIGLLSKTKNYY-IAGLIPLFPTFALIAHYIVASERGIDA----MRTTIVFSMWSIIPYFIYLATLW
Q6DAZ4_ERWCT/41-147--IKSVIGALIVLLISVLAKSRNYY-IAGLVPLFPTFALIAHYIVGTERGLDA----LRTTILFGIWSVIPYLAYLISLY
F2ISS6_VIBCL/6-112--FKCLLGALAVLIIALLSKTKSFF-ISGLVPLFPTFALIAHYIVGTERTMED----LRTTALFGLYSLIPYAAYLLAVY
Q1CHE1_YERPN/6-112--LKVLIGTGMVLMIALLSKTRHYY-IAGLIPLFPTFALITHYIVGTERSIDA----LRITIKFGLWAIIPYFIYLISLY
Q02R57_PSEAB/2-108--FKALIGAAVVVLLAVLSKTRNYY-IAGLVPLFPTFALIAHYIVGKGRSLDD----LKTTIVFGMWSIIPYFVYLAALY
Q7MCE8_VIBVY/24-130--LKSLLGAAAVVIIALLSKSKNFY-IAGLVPLFPTFALIAHFIVGSERSMED----LRQTALFGLWSLLPYAAYLAAVY
Q6F760_ACIAD/7-113--LKCTLGAAVVLLISILSKSKTFY-IAGLVPLFPTFALIAHVIVFGQQGAEA----LRKTALFGLWSLIPYAVYLGMVY
A5L621_9GAMM/6-112--FKCLLGAAAVLLIALLSKSKSFY-ISGLVPLFPTFALIAHYIVGTEQTMVE----LRTTALFGLFSLVPYAAYLGAVY
A7MLC8_CROS8/5-111--IKALLGAAVVVLIGMLSKTKNYY-IAGLIPLFPTFALIAHYIVVTGRGVEA----LRTTVIFGMWAIIPYFVYLASLW
A6CZR0_9VIBR/6-112--IKCLIGSLAVLLIAILSKSKSFY-IAGLVPLFPSFALIAHYIVGTERNMEA----LRMTALFGIYSLLPYAAYLLAVY
A6ALH5_VIBHA/6-112--LKSLLGAGAVLIIAMLSKSKSFY-IAGLVPLFPTFALIAHFIVGSERDMEA----LRQTALFGIYSLIPYAAYLISVF
Q6AQN8_DESPS/6-112--FKCSIGAFAVLTIALLSRSKSFF-IAGLVPLFPTFALIAHYIVGSERSPME----LRTTALFGLYSIMPYAAYLFAVY
Q1QC57_PSYCK/17-123--LKMLIGALMVLAIQLFAQTRFFY-LAALAPLFPTFTLISHFIVGTERSPAD----LRVALIFSMLGVIPHLIYTFVVF

PF11345

Q4L2Z7_STAHJ/4-112ALIKFLVGGLAVTLSYIISVILPWKELGGVFATLPAVFLVSLFITGMQHGDVI....AKHVSRGAVFGMTGVLISILATW
Q8NUG0_STAAW/4-112TLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKV....AVHVSRGAVFGMTGVLVCILVTW
Q5HS29_STAEQ/4-112AIIKFSVGGLAVLISYIVSVVLPWKEFGGIFATFPAVFLVSMCITGMQFGNEV....AMHVSRGAVFGMIGVLCSILATW
Q8TP71_METAC/9-119LFLRFLFGGSAVLASTLIARTFGGK.LGGIFAAFPAVYLAAVVGLGLEYKGSELLSVTEQLSRGALVGMAADICCALAAS
Q46AH9_METBF/8-116LTLRFVFGGTAVAACYVMLQIIPSKSFAGVFAAFPAVMVAAVIMAGHFGTSRQ....ASDIALGASAGMIGCTICVLTAA
A6U591_STAA2/7-117AILHFVIGGIAVALASIIADKVGGK.LGGIIATMPAVFLAAIIALALDHRGTQLVEMSMNLSTGAIVGILSCILTVFLTS
Q5HS30_STAEQ/9-119AILHFVIGGFAVALASIMADKVGGK.LGGIIATMPAVYLAAIIALAIDHKGQQLIQMSIHLSTGAIVGIVSCIVTVFFTS
Q8PS90_METMA/8-116LGIRFVFGGTAVAACYILLQHLPSKSFAGVFAAFPAVMAAAVIMAGHFGSSEQ....ASDIALGASAGMIGCAVCVLTAT
A4J8P6_DESRM/12-122LLLRFVLGGLAVVLSTLTARWIGGK.AGGIFAAFPAVYLAALLGVILLVPAQQAVSAVRSVSAGALVGMTSDIICAIAAI
Q46AI2_METBF/9-119ILLRFLFGGSAVVISTIVAKKFGGR.LGGVFAAFPAVYLAAILGLSIDYNGSELLLISEQLSKGALVGMLADICCALAAS
A4J8P5_DESRM/8-116LMLRFVLGGLAVALCYILLILIPWKSVAGIFAAFPAVMVSALIITGMEKGSKE....ATNIAYGAVAGNIGGLVCVMTVL

PF06942

A6T8N2_KLEP7/5-111YFTGI-MRLPLALAGAVGCWGLCAWLLILGWSRFH
Q5PIB2_SALPA/18-124YFSGV-MRLPVALGGAVVCWGLSAWLLIFCWIKWH
Q6DAZ4_ERWCT/41-147YFTGW-MKLPQALLAAVVCWSVSAALLIKIWTWYQ
F2ISS6_VIBCL/6-112YFSYR-LSLTGTLVCATLVWLVFAALLLVGWTRLH
Q1CHE1_YERPN/6-112FFIEH-MRLSLALISAVLCWVIAAWILISIWSQWH
Q02R57_PSEAB/2-108LLVER-FRLETSLALAALAWLVAASVLVGLWVRLH
Q7MCE8_VIBVY/24-130YFSYR-FSLVTTLSAATVIWLMAASLLIGAWTKVM
Q6F760_ACIAD/7-113YFANR-LPIGLCLTVATLTWVIVAAGLIYGWNSYF
A5L621_9GAMM/6-112VFSYR-YSLVSTLSLATVVWVLCACMLLIGWTRVV
A7MLC8_CROS8/5-111VLSGM-VKVPLALGGAVACWCLSAWLLIALWSRFH
A6CZR0_9VIBR/6-112YFSYF-LTLSGTLVSAVMVWVLFATILLGVWNRTM
A6ALH5_VIBHA/6-112YFSYR-LSLVGTLTAATLVWVMFASMLLAFWTRWM
Q6AQN8_DESPS/6-112YFSIR-FNLVTNLLLSTAIWIIFAAVLLVTWVKLH
Q1QC57_PSYCK/17-123FSISY-ISLYKALLLGVVAWTIAAAILVLTWQYIQ

PF11345

Q4L2Z7_STAHJ/4-112AMLYFTNHWLLSIVTGFIAWFVSAVIIFEAVEF--
Q8NUG0_STAAW/4-112MMLHMTHMWLISIVVGFLSWFISAVCIFEAVEF--
Q5HS29_STAEQ/4-112GLLQATHMWLLSIIGGFVAWFVSALIIFEIVEF--
Q8TP71_METAC/9-119YFILR.YGWKRGLAYALSLWALLAPLIYFTWFG--
Q46AH9_METBF/8-116FCMEYLNRWSLSIIIALLIWFFSSCLSTRLIQG--
A6U591_STAA2/7-117LYIKH.KGYRKGAIFTVVCWFVISLAIFSIRHL--
Q5HS30_STAEQ/9-119IFIGK.KNYRSGTVFAILCWFVISVAIFLVRHI--
Q8PS90_METMA/8-116FCMEHLNLWGLSLEIALIAWFFSSYAAITLMQV--
A4J8P6_DESRM/12-122YFIPK.KGWAKGLFMALIVWAVAVVVLYTISFT--
Q46AI2_METBF/9-119YFILR.SGWKKGLVYSLLLWAVLAPAIYFVWFR--
A4J8P5_DESRM/8-116LGLALWQNVTLAISIGLIAWFVASAVSFSIYTA--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window