Sequence alignment for CL0421

PF06474

Q88FF2_PSEPK/1-34MSSR....----------------.SRRTSHS---------------------------------------VALTRLAQI
Q87YS7_PSESM/1-34MSSS....----------------.ISKPSHS---------------------------------------DALTRLAQA
Q9I2T2_PSEAE/1-34MPPQ....----------------.TRKTPDL---------------------------------------DALARAVRV
G3XDB7_PSESM/1-34MPAV....----------------.AFPVSSP---------------------------------------RLLARAVQI
Q7MII3_VIBVY/1-39MSPDQGGK----------------YYQQPKVK---------------------------------------QAGTMRFKF

PF08139

BAMC_YERPE/1-27M............................AIS---------------------------------------LQKSTVVKV
A1S8P9_SHEAM/1-37MANKSGI................LMRLLSRFG---------------------------------------SKMKKSLAV
Q12R62_SHEDO/1-42MVKTGKMVN...........FWYSDATIFDSV---------------------------------------ELMKSITSL
Q65VU1_MANSM/1-26M.............................IM---------------------------------------KLSNKFSLA
Q7N956_PHOLL/1-35MQKRKN..................RRGIIYPL---------------------------------------LLVRQGLMT
A1STV5_PSYIN/1-26M.............................IH---------------------------------------TWSKKIRFF
A6TGQ8_KLEP7/1-35MAVNSF.................IEGAIKPLL---------------------------------------SVWRRPLAL
Y162_HAEIN/1-27M............................ALV---------------------------------------NKIKTLSSV
Q6DAL4_PECAS/1-35MPVKSL..................SRGAFSPL---------------------------------------LLLRRLCGA
Q32AH4_SHIDS/1-33MNSFN...................EGVVSPLL---------------------------------------SFWRRSLML
Q32JI9_SHIDS/2-54MNLHALPTSPRRWQCYDGGNFYQTRLRVSESP---------------------------------------NMFKKILFP
Q7CKT3_YERPE/12-35.............................KPL---------------------------------------LFMQRVLIT
Q9KV82_VIBCH/1-35MLYTTP..................RLNISAFL---------------------------------------FMKQQLSFL
Q9L9I1_SALTY/1-33MNSFI...................EGAHQPLL---------------------------------------SVWRRAFLF

PF06291

BORD_ECOLI/1-97MKKMLLATALALLITGCAQQTFTVQNKQTAVAPKETITHHFFVSGIGQKKTVDAAKICGGAENVVKTETQQTFVNGLLGF

PF06474

Q88FF2_PSEPK/1-34SALALAATLVG---CQS
Q87YS7_PSESM/1-34MAVTASALLAG---CQS
Q9I2T2_PSEAE/1-34SILLIAGALAG---CQG
G3XDB7_PSESM/1-34AVLAMGALCVG---CQS
Q7MII3_VIBVY/1-39SWVFALLLLSG---CQS

PF08139

BAMC_YERPE/1-27VGVSLVMLLAA---CST
A1S8P9_SHEAM/1-37LTAILT..LSG---CAG
Q12R62_SHEDO/1-42FIALFL..LSG---CAS
Q65VU1_MANSM/1-26ALTVASVLLAA---CQA
Q7N956_PHOLL/1-35LGFVFA..LSA---CTN
A1STV5_PSYIN/1-26TLVSAAFFLFS---CSN
A6TGQ8_KLEP7/1-35AGILL...LTA---CSH
Y162_HAEIN/1-27GILAATLFLAG---CQA
Q6DAL4_PECAS/1-35GLVLIA..VVA---CSS
Q32AH4_SHIDS/1-33AGALF...LTA---CSH
Q32JI9_SHIDS/2-54LVALFM..LAG---CAK
Q7CKT3_YERPE/12-35FGLTLG..LSA---CSS
Q9KV82_VIBCH/1-35FLLSGL..LAG---CSS
Q9L9I1_SALTY/1-33SGALL...LTA---CSH

PF06291

BORD_ECOLI/1-97ITLGIYTPLEARVYCSK

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window