Sequence alignment for CL0421

PF08085

Q2K7B2_RHIEC/22-42----------------------------------NTIRGMGKDTANAVNATQDAG-------------------------
Q65RN8_MANSM/24-44----------------------------------ETTKGVGKDIQNAGQKMEQVF-------------------------
Q2Y7Q6_NITMU/20-40----------------------------------HTIQGVGKDVQSGGEALEKSA-------------------------
A6TH67_KLEP7/38-58----------------------------------NTTRGVGEDISDGGNAISGAA-------------------------
A4G7Q8_HERAR/21-41----------------------------------NTFKGFGKDVERGGEKVQDAA-------------------------
Q1BPK0_BURCA/20-40----------------------------------NTVAGVGQDISKGGQAISDSA-------------------------
Q2NCM0_ERYLH/22-42----------------------------------NTVKGLGRDIQSVGEAGEEVI-------------------------
A7HP47_PARL1/47-67----------------------------------NTVEGAGQDIQRGGAAIEDTA-------------------------
Q83F63_COXBU/23-43----------------------------------HTIRGFGQDLQAGGKAISHAA-------------------------
B2UDW6_RALPJ/19-39----------------------------------NTMAGAGKDIQTGGQKLENSA-------------------------
B0SXX7_CAUSK/20-40----------------------------------NTVAGVGQDVSAAGRAVTNTA-------------------------
A3NM76_BURP6/28-48----------------------------------NTVAGVGEDLNAAGRAIKRAA-------------------------
Q166S3_ROSDO/18-38----------------------------------ETTKGVGQDIQNAGEELDQAI-------------------------
A8F2N0_RICM5/33-53----------------------------------NTMQGTGQDMQATGKKLEDSA-------------------------
Q1QBK3_PSYCK/19-39----------------------------------NTFKGLGQDVSSAGSAVSGTA-------------------------
A4W5P2_ENT38/23-43----------------------------------NTARGVGEDIKSLGHAISHAA-------------------------
Q1LKH5_RALME/21-41----------------------------------NTMAGLGKDTQAAGRSLESAA-------------------------
Q1GU10_SPHAL/78-98----------------------------------NTVKGVGRDIESVGEAGDRAI-------------------------
A8LQR4_DINSH/21-41----------------------------------ATVEGAGQDISTAGDAIAEEA-------------------------
Q1GX64_SPHAL/29-49----------------------------------DTAASAGEDVEAAGEAMAEGA-------------------------
A0AZ61_BURCH/27-47----------------------------------NTVRGFGEDVNAAGSALKRAA-------------------------
Q57CI2_BRUAB/60-80----------------------------------NTVRGVGRDVKSTAHAVQETV-------------------------
Q6D110_ERWCT/22-42----------------------------------NTTRGFGQDVQKLGSKISHAA-------------------------
A8G8T2_SERP5/22-42----------------------------------NTTQGVGEDIQAGGKAIQRSA-------------------------
Q4UPH1_XANC8/22-42----------------------------------NTVAGAGKDVQGAGEKVEDAA-------------------------
A4EDM2_9RHOB/17-37----------------------------------ETMQGVGRDISNAGAAIDRSL-------------------------
Q13WP0_BURXL/38-58----------------------------------NTMAGAGQDISKGGNAITNSA-------------------------
Q7WQ81_BORBR/22-42----------------------------------NTMSGAGKDIERGGEKIQEKA-------------------------
E0TFG2_PARBH/21-41----------------------------------NTVEGVGQDVEEVGEEIEDAS-------------------------
A3UCY2_9RHOB/16-36----------------------------------NTIAGAGRDIEEAGDAIEDTA-------------------------
A6E6C7_9RHOB/21-41----------------------------------ETVEGAGRDIEDAGQAVTGAS-------------------------
F2GAC0_ALTMD/29-49----------------------------------ATIEGAGEDIQSAGEAVEEGA-------------------------
Q0C6M9_PELCD/18-38----------------------------------NTLSGMGKDIEQAGEAIQRKA-------------------------
Q1GF40_SILST/49-69----------------------------------ETTKGAGRDLQKAGQAISNTA-------------------------
A3W9Q1_9SPHN/22-42----------------------------------NTVRGAGEDLQSAANAVDEET-------------------------
Q1N8S6_9SPHN/21-41----------------------------------NTVEGAGRDVQSAGKAVEDAA-------------------------
A3W9Q0_9SPHN/22-42----------------------------------NTVRGMGDDLKSVADAVDDET-------------------------
A7MMA9_CROS8/22-42----------------------------------NTARGFGEDIQHLGGAIERAV-------------------------
B0T262_CAUSK/20-40----------------------------------NTVEGAGKDVSSVGGAVSDTA-------------------------
Q7VVV5_BORPE/21-41----------------------------------NTVAGMGKDMSDAGSAITHAA-------------------------
A8G8T1_SERP5/21-41----------------------------------NTFRGFGEDVQHLGGAISRTA-------------------------
Q3J4P1_RHOS4/20-40----------------------------------ETVEGAGQDLSAAGSAISQES-------------------------
Q6FE13_ACIAD/20-40----------------------------------NTFKGVGKDVSRAGDAVTNTA-------------------------
A4ELQ2_9RHOB/20-40----------------------------------ETVQGAGQDISNAGDALSAES-------------------------
Q2KYD4_BORA1/21-41----------------------------------NTIAGAGKDIERGGEAIQGAA-------------------------
A1B0I4_PARDP/22-42----------------------------------QTVQGAGHDLQSAGQAISRES-------------------------
A3V1K6_9RHOB/19-39----------------------------------NTVQGVGRDITSAGQAVENAF-------------------------
Q1NFI4_9SPHN/29-49----------------------------------NTVNGAGKDLRSAGGAVSDAS-------------------------
Q1GXZ3_METFK/20-40----------------------------------NTMKGAGQDIQRGGEKLENAA-------------------------
A3WM50_9GAMM/18-38----------------------------------STIEGMGQDVEDAGEAIEESA-------------------------
A5EVY0_DICNV/20-40----------------------------------NTVGGFGKDVQKAGQGVSHAA-------------------------
A1B0I2_PARDP/83-103----------------------------------ETMQGAGRDMQTAGQLLSDQA-------------------------
A1WAS8_ACISJ/19-39----------------------------------NTVKGMGQDVQRAGSAIERAA-------------------------
Q16B99_ROSDO/18-38----------------------------------ETTKGLGRDVQNAGEALDEAI-------------------------
A1JIP7_YERE8/22-42----------------------------------NTTKGVGKDVQSAGSAIERSA-------------------------
Q0G0E1_9RHIZ/23-43----------------------------------NTVRGVGADVGNTVDAGEAAA-------------------------
Q82WI8_NITEU/21-41----------------------------------NTIQGFGKDVQRGGEAIEKTA-------------------------
A6GNW1_9BURK/20-40----------------------------------NTIEGMGKDIKAGGAAIERTA-------------------------
Q5QW42_IDILO/19-39----------------------------------ETMEGAGEDIENAGEAIQDEA-------------------------
A4SQR1_AERS4/326-346----------------------------------NTVSGVGRDIEKAGEVIQRSA-------------------------
A6UAD3_SINMW/21-41----------------------------------NTAHGFREDSAQTGHAVDRAT-------------------------
A5WE31_PSYWF/19-39----------------------------------NTFKGLGQDVSKAGEGVTNTA-------------------------
Q1QTB6_CHRSD/22-42----------------------------------NTFEGAGEDIEQGGEEVQEAA-------------------------
Q83P40_SHIFL/20-40----------------------------------NTACGFGEDIKHLGNSISRAA-------------------------

PF06474

Q9JP38_PSEUB/1-34M-----------------PAV.....AFPVSSPRLLARAVQIAVLAMGALCVGCQS------------------------
Q8DBD9_VIBVU/1-39M-----------------SPDQGGKYYQQPKVKQAGTMRFKFSWVFALLLLSGCQS------------------------
Q9KPX5_VIBCH/1-18M-----------------R....................VKFSWVLA.LLLVGCQS------------------------
Q88FF2_PSEPK/1-34M-----------------SSR.....SRRTSHSVALTRLAQISALALAATLVGCQS------------------------
Q87MF9_VIBPA/1-18M-----------------R....................LKYSWALV.LLLSGCQL------------------------
Q8EE26_SHEON/1-20M-----------------R...................VSLYVVVGGFALLTGCQT------------------------
Q8GF74_PHOLU/1-18M-----------------K.....................TKAILFASVLLVGCQS------------------------
Q8XZ88_RALSO/1-18M-----------------R.....................LLAASVFSLLLAACAT------------------------
Q8EA91_SHEON/1-28M-----------------RKT.....FRQPH......ALAAMVIAMLMAQLSGCAT------------------------
Q87YS7_PSESM/1-34M-----------------SSS.....ISKPSHSDALTRLAQAMAVTASALLAGCQS------------------------
Q9I2T2_PSEAE/1-34M-----------------PPQ.....TRKTPDLDALARAVRVSILLIAGALAGCQG------------------------

PF08139

Q6FYI4_BARQU/1-19M...................................RSIIFTILIASL..LSACTL------------------------
BAMC_YERPE/1-27M.............................AISLQKSTVVKVVGVSLVMLLAACST------------------------
A0KHC3_AERHH/1-18M...................................KKSLLLLAALM...LGGCAT------------------------
Q91UX0_9ZZZZ/1-18M...................................KQAFVVLLVVA...LAGCAT------------------------
A3QH07_SHELP/1-19M...................................KRFIPIIACAGL..LFGCAS------------------------
Q1ZPP5_PHOAS/1-18M...................................KKYIVIAAALL...LSACAS------------------------
A8H789_SHEPA/1-32MLRH......................LNFLLINIIMKSLLLVVAAAVS..MVGCAS------------------------
Q1RFA5_ECOUT/1-54MMNLHALPTSPRRRQCYDGGNFYQTRLRVSESPNMFKKILFPLVALFM..LAGCAK------------------------
Q6D830_ERWCT/1-20M..................................LKKLFFPLLAIIL..LAGCAA------------------------
Q0VUW4_9ZZZZ/1-19M...................................RKIIIAALFALT..LAGCAT------------------------
Q3RC93_XYLFA/1-19M...................................RKFMMSVVVLAA..LTSCAT------------------------
Q8DBA9_VIBVU/1-22M................................KFSRQLVLSSLAVFV..LSACSG------------------------
A1S8P9_SHEAM/1-37MANKSG.................ILMRLLSRFGSKMKKSLAVLTAILT..LSGCAG------------------------
Q12R62_SHEDO/1-42MVKTGKMVN............FWYSDATIFDSVELMKSITSLFIALFL..LSGCAS------------------------
Q87MI3_VIBPA/1-22M................................KLSSQLVLSSLAVFV..LTACSG------------------------
A6UMA2_SINMW/1-17M....................................KYCSLILFLA...LAACKT------------------------
A6BXD9_YERPE/1-35MSVKI...................ISRGGIKPLLFMQRVLITFGLTLG..LSACSS------------------------
VIRB7_BRUAB/1-19M...................................KKVILAFVATAF..LAGCTT------------------------
A5L7N5_9GAMM/1-20M...................................KKAFLLVSLLST.FLIGCSS------------------------
A6VLX4_ACTSZ/1-23M.................................KIIKTLSLAAVISSFFLAACSA------------------------
VIRB7_AGRT5/1-17M....................................KYCLLCLALA...LGGCQT------------------------
BAMC_PASMU/1-19M...................................KKWLFPFAFVAT..LAGCSV------------------------
Q7D2Q0_AGRT5/14-32I...................................RSPAAACALALF..LSGCQS------------------------
Q7MIC3_VIBVY/1-18M...................................KKLVLAASIAL...LSACSA------------------------
Q08KZ5_BORPT/1-21M...................................RKIVSLALLALALGLGGCAT------------------------
Q65VU1_MANSM/1-26M..............................IMKLSNKFSLAALTVASVLLAACQA------------------------
Q6LLX3_PHOPR/1-22M...............................FSFMKLLVPLFSFLL...LTGCVA------------------------
Q7N956_PHOLL/1-35MQKRK...................NRRGIIYPLLLVRQGLMTLGFVFA..LSACTN------------------------
B1KD68_SHEWM/1-19M...................................KSLFLSLIALVV..LSGCAS------------------------
Q7N0L0_PHOLL/1-20M..................................LKRILFPFITLFL..LAGCAA------------------------
A6A5T2_VIBCL/1-35MLYTT...................PRLNISAFLFMKQQLSFLFLLSGL..LAGCSS------------------------
A4Y3L9_SHEPC/1-19M...................................KRLLLTLTFPLL..FVGCAS------------------------
Q8DD08_VIBVU/1-19M...................................KKRLLSLTALLI..LAGCSS------------------------
A1STV5_PSYIN/1-26M..............................IHTWSKKIRFFTLVSAAFFLFSCSN------------------------
A5IH57_LEGPC/1-18M...................................KELSVLLFALL...LSSCAS------------------------
YP57_BRUA2/1-18M...................................RTLVMVACAVS...LAACSS------------------------
A5I9X5_LEGPC/1-18M...................................KKLSILLLTVL...LSSCAS------------------------
Q6LB41_OLICO/4-22L...................................RRLIGIATLGLQ..VAACTA------------------------
Q5E255_VIBF1/1-19M...................................KRILSTLLLSTF..LFGCSS------------------------
A6D4I5_9VIBR/1-19M...................................KKTLLVSLLVAT..LAGCSS------------------------
Q46702_ECOLX/1-17M....................................RSLLLMGVLL...ISACSS------------------------
BAMC_SHIFL/1-27M.............................AYSVQKSRLAKVAGVSLVLLLAACSS------------------------
Q5E6X9_VIBF1/1-18M...................................KKVIIALSALF...LAACSA------------------------
Q7VKS9_HAEDU/1-24M................................KLSKKAFILLALLSSAILIGCQS------------------------
Q1V3W0_VIBAL/1-21M...................................KKHLLTSLLLSSLTLFGCSS------------------------
Q91UR3_9ZZZZ/1-19M...................................KRALVLLMLATA..LAGCAT------------------------
O50334_ECOLX/1-19M...................................KTIIFAILMTGL..LSACAS------------------------
Q8KJL9_RHILI/1-17M....................................KYYLLLSILA...LAACKT------------------------
Q1QF62_NITHX/7-25T...................................RRAILLCIVALS..LAGCAS------------------------
Q8Z330_SALTI/1-33MNSFI....................EGACQPLLSVWRRAFLFSGALL...LTACSH------------------------
Q1ZKK2_PHOAS/1-30MN..........................YSSGGFFMFKISFLFSFLLPFVLSGCVA------------------------
A6TGQ8_KLEP7/1-35MAVNSF..................IEGAIKPLLSVWRRPLALAGILL...LTACSH------------------------
Q91US3_9ZZZZ/1-18M...................................HKLAILSCAVL...LAACSS------------------------
Q7WRN6_9RHIZ/1-19M...................................KSVVFIILIANL..LSACAL------------------------
Q1Z7L8_PHOPR/1-18M...................................KKFFLAASVFA...LTACSA------------------------
Q1H9U7_9ZZZZ/1-18M...................................HKIVTLALLAT...LAGCAS------------------------
Q4AC48_9SPHN/1-19M...................................RKITIAALLVLA..LSGCAT------------------------
Q5NWM0_AROAE/3-21M...................................KRFALVALVAFA..LGGCAT------------------------
A7FC39_YERP3/1-19M...................................RKILVLTLLVFS..IAGCIS------------------------
Q91UW2_9ZZZZ/1-18M...................................HKLVVLSSILA...LAACSS------------------------
Y162_HAEIN/1-27M.............................ALVNKIKTLSSVGILAATLFLAGCQA------------------------
Q0AD28_NITEC/3-20L....................................RIFMLLIISLV..ITACAT------------------------
A0XXM5_9GAMM/1-21M...................................TIINRIFGCAAFCILAGCAN------------------------
BAMC_VIBCH/1-22M................................KFSRQLVLGSLAVLV..LSACSS------------------------
Q1ZBP2_9GAMM/1-30NN..........................QPSTHKVQRRFKNLLSATSVFILSACSS------------------------
Q6DAL4_ERWCT/1-35MPVKS...................LSRGAFSPLLLLRRLCGAGLVLIA..VVACSS------------------------
A4W5C4_ENT38/1-35MAVNSF..................NKGAVSPLLSVWRSTLALAGVLL...LSACSH------------------------
Q03542_9ZZZZ/1-19M...................................RKILTVIALAAT..LAGCAT------------------------
Q2NV82_SODGM/1-20M..................................LKKYLMPFVAILL..LSGCAA------------------------
Q8VT96_RHIRD/1-17M....................................KYFLLFVIFG...LASCQT------------------------
Q32AH4_SHIDS/1-33MNSFN....................EGVVSPLLSFWRRSLMLAGALF...LTACSH------------------------

PF06291

ISS_ECOLX/6-102M-----------------------------------KKMLFSAALAML--ITGCAQQTFTVGNKPTAVTPKETITHHFFV
Q9KXD0_BPVT2/1-97M-----------------------------------KKMLLATALALL--ITGCAQQTFTVQNKQTAVAPKETITHHFFV

PF08085

Q2K7B2_RHIEC/22-42------------------------------------------------------
Q65RN8_MANSM/24-44------------------------------------------------------
Q2Y7Q6_NITMU/20-40------------------------------------------------------
A6TH67_KLEP7/38-58------------------------------------------------------
A4G7Q8_HERAR/21-41------------------------------------------------------
Q1BPK0_BURCA/20-40------------------------------------------------------
Q2NCM0_ERYLH/22-42------------------------------------------------------
A7HP47_PARL1/47-67------------------------------------------------------
Q83F63_COXBU/23-43------------------------------------------------------
B2UDW6_RALPJ/19-39------------------------------------------------------
B0SXX7_CAUSK/20-40------------------------------------------------------
A3NM76_BURP6/28-48------------------------------------------------------
Q166S3_ROSDO/18-38------------------------------------------------------
A8F2N0_RICM5/33-53------------------------------------------------------
Q1QBK3_PSYCK/19-39------------------------------------------------------
A4W5P2_ENT38/23-43------------------------------------------------------
Q1LKH5_RALME/21-41------------------------------------------------------
Q1GU10_SPHAL/78-98------------------------------------------------------
A8LQR4_DINSH/21-41------------------------------------------------------
Q1GX64_SPHAL/29-49------------------------------------------------------
A0AZ61_BURCH/27-47------------------------------------------------------
Q57CI2_BRUAB/60-80------------------------------------------------------
Q6D110_ERWCT/22-42------------------------------------------------------
A8G8T2_SERP5/22-42------------------------------------------------------
Q4UPH1_XANC8/22-42------------------------------------------------------
A4EDM2_9RHOB/17-37------------------------------------------------------
Q13WP0_BURXL/38-58------------------------------------------------------
Q7WQ81_BORBR/22-42------------------------------------------------------
E0TFG2_PARBH/21-41------------------------------------------------------
A3UCY2_9RHOB/16-36------------------------------------------------------
A6E6C7_9RHOB/21-41------------------------------------------------------
F2GAC0_ALTMD/29-49------------------------------------------------------
Q0C6M9_PELCD/18-38------------------------------------------------------
Q1GF40_SILST/49-69------------------------------------------------------
A3W9Q1_9SPHN/22-42------------------------------------------------------
Q1N8S6_9SPHN/21-41------------------------------------------------------
A3W9Q0_9SPHN/22-42------------------------------------------------------
A7MMA9_CROS8/22-42------------------------------------------------------
B0T262_CAUSK/20-40------------------------------------------------------
Q7VVV5_BORPE/21-41------------------------------------------------------
A8G8T1_SERP5/21-41------------------------------------------------------
Q3J4P1_RHOS4/20-40------------------------------------------------------
Q6FE13_ACIAD/20-40------------------------------------------------------
A4ELQ2_9RHOB/20-40------------------------------------------------------
Q2KYD4_BORA1/21-41------------------------------------------------------
A1B0I4_PARDP/22-42------------------------------------------------------
A3V1K6_9RHOB/19-39------------------------------------------------------
Q1NFI4_9SPHN/29-49------------------------------------------------------
Q1GXZ3_METFK/20-40------------------------------------------------------
A3WM50_9GAMM/18-38------------------------------------------------------
A5EVY0_DICNV/20-40------------------------------------------------------
A1B0I2_PARDP/83-103------------------------------------------------------
A1WAS8_ACISJ/19-39------------------------------------------------------
Q16B99_ROSDO/18-38------------------------------------------------------
A1JIP7_YERE8/22-42------------------------------------------------------
Q0G0E1_9RHIZ/23-43------------------------------------------------------
Q82WI8_NITEU/21-41------------------------------------------------------
A6GNW1_9BURK/20-40------------------------------------------------------
Q5QW42_IDILO/19-39------------------------------------------------------
A4SQR1_AERS4/326-346------------------------------------------------------
A6UAD3_SINMW/21-41------------------------------------------------------
A5WE31_PSYWF/19-39------------------------------------------------------
Q1QTB6_CHRSD/22-42------------------------------------------------------
Q83P40_SHIFL/20-40------------------------------------------------------

PF06474

Q9JP38_PSEUB/1-34------------------------------------------------------
Q8DBD9_VIBVU/1-39------------------------------------------------------
Q9KPX5_VIBCH/1-18------------------------------------------------------
Q88FF2_PSEPK/1-34------------------------------------------------------
Q87MF9_VIBPA/1-18------------------------------------------------------
Q8EE26_SHEON/1-20------------------------------------------------------
Q8GF74_PHOLU/1-18------------------------------------------------------
Q8XZ88_RALSO/1-18------------------------------------------------------
Q8EA91_SHEON/1-28------------------------------------------------------
Q87YS7_PSESM/1-34------------------------------------------------------
Q9I2T2_PSEAE/1-34------------------------------------------------------

PF08139

Q6FYI4_BARQU/1-19------------------------------------------------------
BAMC_YERPE/1-27------------------------------------------------------
A0KHC3_AERHH/1-18------------------------------------------------------
Q91UX0_9ZZZZ/1-18------------------------------------------------------
A3QH07_SHELP/1-19------------------------------------------------------
Q1ZPP5_PHOAS/1-18------------------------------------------------------
A8H789_SHEPA/1-32------------------------------------------------------
Q1RFA5_ECOUT/1-54------------------------------------------------------
Q6D830_ERWCT/1-20------------------------------------------------------
Q0VUW4_9ZZZZ/1-19------------------------------------------------------
Q3RC93_XYLFA/1-19------------------------------------------------------
Q8DBA9_VIBVU/1-22------------------------------------------------------
A1S8P9_SHEAM/1-37------------------------------------------------------
Q12R62_SHEDO/1-42------------------------------------------------------
Q87MI3_VIBPA/1-22------------------------------------------------------
A6UMA2_SINMW/1-17------------------------------------------------------
A6BXD9_YERPE/1-35------------------------------------------------------
VIRB7_BRUAB/1-19------------------------------------------------------
A5L7N5_9GAMM/1-20------------------------------------------------------
A6VLX4_ACTSZ/1-23------------------------------------------------------
VIRB7_AGRT5/1-17------------------------------------------------------
BAMC_PASMU/1-19------------------------------------------------------
Q7D2Q0_AGRT5/14-32------------------------------------------------------
Q7MIC3_VIBVY/1-18------------------------------------------------------
Q08KZ5_BORPT/1-21------------------------------------------------------
Q65VU1_MANSM/1-26------------------------------------------------------
Q6LLX3_PHOPR/1-22------------------------------------------------------
Q7N956_PHOLL/1-35------------------------------------------------------
B1KD68_SHEWM/1-19------------------------------------------------------
Q7N0L0_PHOLL/1-20------------------------------------------------------
A6A5T2_VIBCL/1-35------------------------------------------------------
A4Y3L9_SHEPC/1-19------------------------------------------------------
Q8DD08_VIBVU/1-19------------------------------------------------------
A1STV5_PSYIN/1-26------------------------------------------------------
A5IH57_LEGPC/1-18------------------------------------------------------
YP57_BRUA2/1-18------------------------------------------------------
A5I9X5_LEGPC/1-18------------------------------------------------------
Q6LB41_OLICO/4-22------------------------------------------------------
Q5E255_VIBF1/1-19------------------------------------------------------
A6D4I5_9VIBR/1-19------------------------------------------------------
Q46702_ECOLX/1-17------------------------------------------------------
BAMC_SHIFL/1-27------------------------------------------------------
Q5E6X9_VIBF1/1-18------------------------------------------------------
Q7VKS9_HAEDU/1-24------------------------------------------------------
Q1V3W0_VIBAL/1-21------------------------------------------------------
Q91UR3_9ZZZZ/1-19------------------------------------------------------
O50334_ECOLX/1-19------------------------------------------------------
Q8KJL9_RHILI/1-17------------------------------------------------------
Q1QF62_NITHX/7-25------------------------------------------------------
Q8Z330_SALTI/1-33------------------------------------------------------
Q1ZKK2_PHOAS/1-30------------------------------------------------------
A6TGQ8_KLEP7/1-35------------------------------------------------------
Q91US3_9ZZZZ/1-18------------------------------------------------------
Q7WRN6_9RHIZ/1-19------------------------------------------------------
Q1Z7L8_PHOPR/1-18------------------------------------------------------
Q1H9U7_9ZZZZ/1-18------------------------------------------------------
Q4AC48_9SPHN/1-19------------------------------------------------------
Q5NWM0_AROAE/3-21------------------------------------------------------
A7FC39_YERP3/1-19------------------------------------------------------
Q91UW2_9ZZZZ/1-18------------------------------------------------------
Y162_HAEIN/1-27------------------------------------------------------
Q0AD28_NITEC/3-20------------------------------------------------------
A0XXM5_9GAMM/1-21------------------------------------------------------
BAMC_VIBCH/1-22------------------------------------------------------
Q1ZBP2_9GAMM/1-30------------------------------------------------------
Q6DAL4_ERWCT/1-35------------------------------------------------------
A4W5C4_ENT38/1-35------------------------------------------------------
Q03542_9ZZZZ/1-19------------------------------------------------------
Q2NV82_SODGM/1-20------------------------------------------------------
Q8VT96_RHIRD/1-17------------------------------------------------------
Q32AH4_SHIDS/1-33------------------------------------------------------

PF06291

ISS_ECOLX/6-102SPIGQRKLLMQPKFVGGAENVVKTETQQTFVNALPGFITFGIYTPRETRVYCSQ
Q9KXD0_BPVT2/1-97SGIGQKKTVDAAKICGGTENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSQ

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window