Sequence alignment for CL0422

PF00147

TENA_HUMAN/1980-2189-----------FPKDCSQAMLN..GDTTS...GLYTIYLNGDKAE--ALEVFCDMTSDGG-GWIVFLRRKNGRENFYQNW
TENX_HUMAN/4071-4280-----------FPRDCGEEMQN..GAGAS...RTSTIFLNGNRER--PLNVFCDMETDGG-GWLVFQRRMDGQTDFWRDW
FIBB_CHICK/211-460-----------SGRECEDIYRK..GGETS...EMYIIQPDPFT.T--PYRVYCDMETDNG-GWTLIQNRQDGSVNFGRAW
FIBB_HUMAN/237-487-----------SGKECEEIIRK..GGETS...EMYLIQPDSSV.K--PYRVYCDMNTENG-GWTVIQNRQDGSVDFGRKW
TENA_CHICK/1587-1796-----------YPKDCSQALLN..GEVTS...GLYTIYLNGDRTQ--PLQVFCDMAEDGG-GWIVFLRRQNGKEDFYRNW
FIBA2_PETMA/400-635-----------EYIDCLDVLQRRPGGKAS...GLYEVRPRGAK.R--ALTVHCEQDTDGG-GWTLVQQREDGSLNFNRSF
FIBG_BOVIN/173-414-----------TGRDCQDVANK..GAKES...GLYFIRPLKA..K--QFLVYCEIDGSGN-GWTVFQKRLDGSLDFKKNW
FIBB_RAT/225-475-----------SGKECEEIIRK..GGETS...EMYLIQPDTSS.K--PYRVYCDMKTENG-GWTVIQNRQDGSVDFGRKW
FGL2_MOUSE/202-428-----------IYKDCSDHYVL..GRRSS...GAYRVTPDHRN.S--SFEVYCDMETMGG-GWTVLQARLDGSTNFTREW
FIBB_BOVIN/214-464-----------SGKECEKIIRN..EGETS...EMYLIQPEDSS.K--PYRVYCDMKTEKG-GWTVIQNRQDGSVDFGRKW
FIBA_PARPA/66-280-----------YPRDCYDILQS..CSGQSPPSGQYYIQPDGGN..--LIKVYCDMETDEG-GWTVFQRRIDGTINFYRSW

PF01410

A7S046_NEMVE/1196-1399IRKPTG.MKNNPAKTCKDLRMDHPD....YVSGYYWIDPNEGSKK.DAIRVYC..DFSN..DFSCISPTK..AKLLNLRV
Q149N0_HUMAN/1477-1688MKFPMG.TQTNPARTCKDLQLSHPD....FPDGEYWIDPNQGCSG.DSFKVYC..NFTSG.GETCIYPDKKSEGVRISSW
Q8BKY2_MOUSE/1246-1463LISPDG.SRKNPARNCRDLKFCHPE....LKSGEYWVDPNQGCKM.DAIKVFC..NMET..GETCINASP..MTVPRKHW
Q9NDD6_RIFPA/292-500IKNPTG.TKDMPARTCKDLAXAHPE....FENGMYWIDPNQGNPV.DSIEVYC..DIKA..HETCVIAKP..NEAFKGRW
Q5PR22_HUMAN/922-1138MRSPDG.SKKHPARTCDDLKLCHSA....KQSGEYWIDPNQGSVE.DAIKVYC..NMET..GETCISANP..SSVPRKTW
Q8AW17_DANRE/1118-1347MRFPLG.TKESPARTCQDLHLSQPE....LKDGEYWIDPNQGCAR.DSFKVYC..NFTAG.GETCLYPSKAVENVKMNSW
Q4AE65_9CHON/362-580MRSPDG.SRKNPARTCQDLLFCHPA....KKSGKYWIDPNQGCVE.DAIKVFC..NMDT..GDTCIHADP..SEIPHKSW
Q4SDF0_TETNG/1437-1655LRSPDG.SRMDPAKTCQDLRHSHPD....KKSGEYWIDPDGGSAK.DAIRVFC..NMEA..GETCISASP..ANIPRKSW
Q561Q0_DANRE/40-257IRSPDG.SRKNPARSCRDLKLCHPE....WKSGDYWVDPNLGSAA.DAIKVFC..NMET..GETCVKPST..PKIPRKNW
Q4SK65_TETNG/166-381MKSPDG.SRKHPARTCDDLKRCYPM....KKSGEYWVDPNQGSVE.DAIQVHC..NMDT..GETCISANP..PSIPRKVW
Q5ZGV8_PARLI/188-394IKKPNG.TKDNPARTCKDLLMCHPK....TQDGYYWIDPNEGCPEVDAFYAFC..NMTAG.SDTCLAPDSTTAHTETKGY
P90679_AREMA/477-683FKNPTG.THAAPARTCKDLAMAHPE....FEDGMYWVDPNQGSPV.DAIEVFC..DIQA..HQTCVMAKP..GQIFKGVW
Q59GD4_HUMAN/1443-1656LRRPPG.TAERPGLVCHELHRNHPH....LPDGEYWIDPNQGCAR.DSFRVFC..NFTAG.GETCLYPDKKFEIVKLASW
Q589R0_ORYLA/1640-1825IRFPLG.TQDSPARTCQDLHLSQPD....LKDGEYWIDPNQGCSR.DSFKVFC..NFTK..GETCLYPSKGIDS......
Q95ND8_BOVIN/68-286IRSPEG.SRKNPARTCRDLKMCHSD....WKSGEYWIDPNQGCNL.DAIKVFC..NMET..GETCVYPTQ..PSVAQKNW
O97406_HALDI/1224-1438LRDPTG.TKDAPGRTCHDLFKNNPE....ITDGWYFVDPNGGGIS.DSFEAEC..LFNGKRTETCIHPIQ..TGYERQQW
Q26055_PARLI/840-1050LLEPLG.SRDQPIRSCKDLFKCFQR....PKMATTGSDSNEGSIK.DRFLAHCVKRGESGSPETCITPRV..DEIAPARW
Q5DG16_SCHJA/254-456LEMPNG.TRSFPARSCSYLSRTHPG....FPDGEYWIDPNGGSNK.DAVKVFC..RLNS..GETCFSPSISSYQQQNNRN
Q3TX57_MOUSE/1155-1371LLTPEG.SRKNPARTCRDLRLSHPE....WNSDYYWIDPNQGCTM.DAIKVYC..DFST..GETCIQAQP..VNTPAKNS
Q26634_STRPU/1217-1413IKAPQGKAKTNPARSCKDVFLNNVE....AESGYYWVDPNLGCQK.DAIQVYC..EAET..GATCVPSTN..NVVSNMTW
Q90YI9_DANRE/222-440IRSPEG.TQANPARMCRDLRMCHPE....WKSGSYWVDPNQGSPL.DAIKVFC..NMET..GETCVSPYH..SDIPRKNW
Q4S5M8_TETNG/1257-1474LLSPDG.SQKNPARTCRDLKLCHPN....WKSGNYWVDPNLGSTA.DAIKVFC..NMET..GETCVYPSI..AKAPKKNW
Q53UC1_CIOIN/621-843IKAPRGVSKKTAARSCMDIYLAEQQQNIVAKNGIRWIDPNGGCTA.DGIEVYC..NFDT..METCVYPTN..RHIENGTH
CO5A1_HUMAN/1625-1836MKRPLG.TQQNPARTCKDLQLCHPD....FPDGEYWVDPNQGCSR.DSFKVYC..NFTAG.GSTCVFPDKKSEGARITSW
Q9I907_PAGMA/1607-1818MKFPMG.TQDNPARTCNDLHLSQPD....YPDGEYWIDPNQGCIG.DAIKVFC..NFTAG.GETCIFPDKKSTGVRISNW
Q70BL5_PARLI/2583-2794MYAPIG.SKEQPVRSCEDLFKCFPD....APDGDYWIDSNEGSIK.DAYLVQCVKHGEDGSAETCIRPRS..DTVSRAPW
CO1A2_LITCT/1136-1354ILTPEG.SRKNPARTCRDLRLSHPE....WTSGFYWIDPNQGCTS.DAIRVFC..DFSS..GETCIHANP..DEITQKNW
CAF1_EPHMU/359-546LKSPTG.TKDSPARSCHDLFLEDNS....TSDGYYWIDPNGGCIG.DAVKVFC..NFTGGVQQTCISATK..NAGDLKSW
CO1A2_ONCMY/1139-1355LLTPEG.SKKNPARTCRDIRLSHPD....WSSGFYWIDPNQGCIA.DAIKAYC..DFST..GHTCIHPHP..ESIARKNW
CO2A1_XENTR/1274-1491IRSPDG.TKKNPARTCRDLKLCHPE....WKSGDYWIDPNQGCTV.DAIKVFC..NMET..GETCVYPNP..SKIPKKNW
O77087_9ANNE/683-889FKNPTG.TRAAPARTCKDLALAHPE....MEDGVYWVDPNQGSPI.DAIEVYC..HIKT..HQTCVFAKP..SQVFKGSW
Q5ZGV7_PARLI/130-334IEEPRG.TEAQPAVSCKEILMAYPD....SVDGLYWLDPNGGAPN.DKFQASC..KFEQG.GLTCLNPTA.AASTDPESW
A7RGC7_NEMVE/22-225FKNPLG.THRHPARTCRDLKLCRPE....AESGQYWIDPNGGITE.DSILVYC..DFAL..NASCITPNQ......FMKW
A5D9L2_PIG/127-305MRRPTG.TQDSPARTCQDLKLCHPE....LPDGEYWVDPNQGCAR.DAFRVFC..NFTAG.GETCVTPRDDVTQ......
Q17A80_AEDAE/631-839IRKPVG.TRENPGRTCRDLHYGHPQ....FKDGWYWIDPNLGMAD.DAVYVFC..NMTAE.GETCVFPDLHSSQMPNIPW
Q26052_PARLI/533-729IKTPQGKSQNNPARSCKDIFLNDAN....AESGTYWVDPNLGCHQ.DAIQVHC..EQET..QATCVSPSM..SQIINSTW

PF00147

TENA_HUMAN/1980-2189KAYAAGFGDRR............EEFWLGLD---------------------NLNKITA----------QG..QYELRVD
TENX_HUMAN/4071-4280EDYAHGFGNIS............GEFWLGNE---------------------ALHSLTQ----------AG..DYSMRVD
FIBB_CHICK/211-460DEYKRGFGNIAKSGGKKY.CDTPGEYWLGND---------------------KISQLTK----------IG..PTKVLIE
FIBB_HUMAN/237-487DPYKQGFGNVATNTDGKNYCGLPGEYWLGND---------------------KISQLTR----------MG..PTELLIE
TENA_CHICK/1587-1796KNYVAGFGDPK............DEFWIGLE---------------------NLHKISS----------QG..QYELRVD
FIBA2_PETMA/400-635SAYREGFGTVDGSG........HGELWLGLE---------------------AMYLLAH----------ED...STMRVE
FIBG_BOVIN/173-414IQYKEGFGHLSPTGT......GNTEFWLGNE---------------------KIHLIST----------QSSIPYVLRIQ
FIBB_RAT/225-475DPYKKGFGNIATNEDTKKYCGLPGEYWLGND---------------------KISQLTR----------IG..PTELLIE
FGL2_MOUSE/202-428KDYKAGFGNLER............EFWLGND---------------------KIHLLTK----------SK..EMILRID
FIBB_BOVIN/214-464DPYKQGFGNIATNAEGKKYCGVPGEYWLGND---------------------RISQLTN----------MG..PTKLLIE
FIBA_PARPA/66-280SYYQTGFGNLN............TEFWLGND---------------------NIHYLTS----------QG..DYELRVE

PF01410

A7S046_NEMVE/1196-1399QANVN...K--------------KDKWLSEAFEEES................QIDYSAE..........QSQIAFLRVFS
Q149N0_HUMAN/1477-1688PKEKP....--------------.GSWFSEFKRGKL.................LSYLDVEGNSIN....MVQMTFLKLLT
Q8BKY2_MOUSE/1246-1463WTDSG.AEK--------------KYVWFGESMNGGF................QFSYGPPDLPEDVV...DVQLAFLRLLS
Q9NDD6_RIFPA/292-500ADEPV...S--------------EHTWFGEELEHGF................PFTYKAD..........KVQLTFLQLLS
Q5PR22_HUMAN/922-1138WASKS.PDN--------------KPVWYGLDMNRGS................QFAYGDH.QSPNTA...ITQMTFLRLLS
Q8AW17_DANRE/1118-1347TKEKP....--------------.GSLFSQFAKGNKCEVIHCESCTDVVFVVQFSYVDSVGEAVG....VVQLGFLRLLS
Q4AE65_9CHON/362-580WTKRNSDDD--------------KHLWFGESMNGGL................QFSYGDKKHSPNTV...MIQTTFLRLLS
Q4SDF0_TETNG/1437-1655WTKASPSSS--------------KPVWFGSDMNAGS................RFQYGHGDELGNTA...AVQLKLLQLLS
Q561Q0_DANRE/40-257WTSKS.KAQ--------------KHVWFGESMNGGF................HFSYADGSQTPSTT...TIQLNFLRLLS
Q4SK65_TETNG/166-381WNTSK...N--------------KPVWFGADINRGT................HFVYGNKDQLANTI...TVQMTFIRLLS
Q5ZGV8_PARLI/188-394RKATP....--------------.GEWFLENLRGKE.................FSYQGG..........IVQLTFLRLLS
P90679_AREMA/477-683YRGEP....--------------GHVWFADEMENGL................LVHLQGG..........NVQMTFLQLLS
Q59GD4_HUMAN/1443-1656SKEKP....--------------.GGWYSTFRRGKK.................FSYVDADGSPVN....VVQLNFLKLLS
Q589R0_ORYLA/1640-1825.........--------------..............................FSYVDASGEPVG....VVQLGFLRLLS
Q95ND8_BOVIN/68-286YISKNPKEK--------------RHVWYGESMTGGF................QFEYGGQGSDPADV...AIQLTFLRLMS
O97406_HALDI/1224-1438FTRKE.NPE--------------AHVWFAETFDENG................FFNYGVH..........QSQVKYLHQMS
Q26055_PARLI/840-1050YEGAS....--------------.GSRYDLRM.GLD................KFSYEAS..........EVQLTFLRLLS
Q5DG16_SCHJA/254-456FAKKK.YSN--------------QEIWFSQLYNEKP.................FTYNME..........MNQINFLQLLS
Q3TX57_MOUSE/1155-1371YSRAQ..AN--------------KHVWLGETINGGS................QFEYNVEGVSSKEM...ATQLAFMRLLA
Q26634_STRPU/1217-1413YVGKT....--------------KRAFF.SSMHGGD................KFAYIED..........STQMTFLRLLS
Q90YI9_DANRE/222-440YTSKNIREK--------------KHVWFGESMPNGF................QFQYGSDGSDPEDV...NIQLTFMRLMS
Q4S5M8_TETNG/1257-1474WSSKS.KDR--------------KHVWFGETMNGGF................HLDYAQDGPAGLVA...AVQLNFLRLLS
Q53UC1_CIOIN/621-843YTGES....--------------RHVYYGEEMATGS................TVRYDPSDEDRVPHADYTSQLTFLRLLS
CO5A1_HUMAN/1625-1836PKENP....--------------.GSWFSEFKRGKL.................LSYVDAEGNPVG....VVQMTFLRLLS
Q9I907_PAGMA/1607-1818PKEAP....--------------.GSWFSEFKRGKI.................LNYVDMGESTIN....TVQMTFLKLLS
Q70BL5_PARLI/2583-2794YQGNS....--------------.GHRYISEMNGLE................KFTYDAS..........EVQVTFLRLLS
CO1A2_LITCT/1136-1354YINTSNKDK--------------KHLWFGEILNGGT................QFEYHDEGLTAKDM...ATQLAFMRLLA
CAF1_EPHMU/359-546SGHSI....--------------...WFSDMLGGFK.................LTYDIS..........RSQLQFIRAAS
CO1A2_ONCMY/1139-1355YRSSE..NK--------------KHVWFGETINGGT................EFAYNDETLSPQSM...ATQLAFMRLLA
CO2A1_XENTR/1274-1491WSAKG.KEK--------------KHIWFGETINGGF................QFSYGDDSSAPNTA...NIQMTFLRLLS
O77087_9ANNE/683-889YSGPQ....--------------KYVWFGEDMDNGF................QFTYKAD..........RVQMTFLQLLS
Q5ZGV7_PARLI/130-334TRSPA....--------------.TDWFSGWNNGFE.................FEYEAN..........VVQLRFLHMKS
A7RGC7_NEMVE/22-225YSGRD....--------------GYKWFAQDLHGSQ................QFHYTSD..........PSQLLFLRLLS
A5D9L2_PIG/127-305.........--------------..............................FSYVDSEGSPVG....VVQLTFLRLLS
Q17A80_AEDAE/631-839RKEND....--------------KTDWYSNLRGGFR.................ISYETVG.........VVQMTFLRLLS
Q26052_PARLI/533-729YVGKV....--------------KRTYF.STMEGGD................KFSYIEE..........PTQMTFLRLLS

PF00147

TENA_HUMAN/1980-2189LRDH.GETAFAVYDKFSVGDAKTRYKLKVEGYSG...............TAGDSMAYHNGRSFSTFDKDTD.....SAIT
TENX_HUMAN/4071-4280LRAG.DEAVFAQYDSFHVDSAAEYYRLHLEGYHG...............TAGDSMSYHSGSVFSARDRDPN.....SLLI
FIBB_CHICK/211-460MEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKG.NAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRK
FIBB_HUMAN/237-487MEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRG.TAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRK
TENA_CHICK/1587-1796LRDR.GETAYAVYDKFSVGDAKTRYRLRVDGYSG...............TAGDSMTYHNGRSFSTFDKDND.....SAIT
FIBA2_PETMA/400-635LQGWDGAGAHAEYTVT.LRDDSKGYALQVSDYRG.TAGNALVSG....VADDPELTSHGGMTFSTYDRDTDKW..S..DG
FIBG_BOVIN/173-414LEDWNGRTSTADYASFKVTGENDKYRLTYAYFIGGDAGDAFDGYDFGDDSSDKFFTSHNGMQFSTWDSDND.....KYDG
FIBB_RAT/225-475MEDWKGDKVKAHYGGFTVQTEANKYQVSVNKYKG.TAGNALMEGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRK
FGL2_MOUSE/202-428LEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNG.TAGDALR........FSR.HYNHDLRFFTTPDRDNDR....YPSG
FIBB_BOVIN/214-464MEDWKGDKVTALYEGFTVQNEANKYQLSVSKYKG.TAGNALIEGASQLVGENRTMTIHNSMFFSTYDRDNDGWKTTDPRK
FIBA_PARPA/66-280LNNTLGNHYYAKYNKFRIGDSFSEYLLVLGAYSG...............TAGDSLAYHNTMRFSTYDNDND.....VYSI

PF01410

A7S046_NEMVE/1196-1399KRAYQNVTYNCQNYKAWTNR......KHSIKLRG---------------DNDLIFHAKSPKKFQPTVI.LN---------
Q149N0_HUMAN/1477-1688ASARQNFTYHCHQSAAWYDVSS.GSYDKALRFLG---------------SNDEEMSYD..NNPFIKTL.YD---------
Q8BKY2_MOUSE/1246-1463SRASQNITYHCKNSIAYMDQAS.GNVKKSLKLMG---------------SNEGEFKAEGNSKFTYTVL.ED---------
Q9NDD6_RIFPA/292-500STAYQNVTYHCRNSVAYYDKAE.RNYRKAVRFMA---------------SNDLELVARRPRKARYSVV.LD---------
Q5PR22_HUMAN/922-1138KEASQNITYICKNSVGYMDDQA.KNLKKAVVLKG---------------ANDLDIKAEGNIRFRYIVL.QD---------
Q8AW17_DANRE/1118-1347VQARQNLTYHCQRSVAWTDQTTDGGYKRALRLQG---------------ANDEEISYE..TSPYIKAL.ID---------
Q4AE65_9CHON/362-580KEASQNITYHCKNSVAYMDDQT.GTLRKALILKS---------------ANDIEIKAEGNNRFKYSVL.ED---------
Q4SDF0_TETNG/1437-1655TESHQNITFHCRNTVAYKEQTS.GQLKKALVLRG---------------ANGQELRAQGNARLRYTVT.KD---------
Q561Q0_DANRE/40-257TEATQTITYHCKNSVAYMDQAT.GNLKKAILLQG---------------SNDVEIRAEGNSRFTYGVL.ED---------
Q4SK65_TETNG/166-381KEASQTITYHCKNSVAYMDQKA.GNLKKAIILKG---------------ANDLELKAEGNSRFRYTVL.ED---------
Q5ZGV8_PARLI/188-394SKATQKFTYNCVNGVAWYDEAE.NSFDNAIRLLA---------------ANDEEFTFDGLNQP..KVI.KD---------
P90679_AREMA/477-683TEAVQNITYHCKNSVAYYDKAN.DNLDSAAMFMT---------------SNDLELNADK.PKFRYEVL.LD---------
Q59GD4_HUMAN/1443-1656ATARQNFTYSCQNAAAWLDEAT.GDYSHSARFLG---------------TNGEELSFNQTTAATVSVP.QD---------
Q589R0_ORYLA/1640-1825VQARQNFTYHCHRSVAWADRSAKNNHKRALHFRG---------------ANDEELSYE..TNPYIKAL.KD---------
Q95ND8_BOVIN/68-286TEASQNITYHCKNSVAYMDQQT.GNLKKALLLQG---------------SNEIEIRAEGNSRFTYSVT.YD---------
O97406_HALDI/1224-1438SRARQDIAFSCKNTVIIADQTP.GNIRKAIRLGS---------------FDEEIMGPVAKKPYRFRVK.SD---------
Q26055_PARLI/840-1050TKAHQNVTYHCKNSVAVHNSQT.GSTEQALRLMT---------------TSDVELSPDAPFLEQYEVIGED---------
Q5DG16_SCHJA/254-456SKANQQLTLLC.NDIQFNDNNL.......PRLFT---------------NNDKELSKNG.SILRYNLL.EN---------
Q3TX57_MOUSE/1155-1371NRASQNITYHCKNSIAYLDEET.GSLNKAVLLQG---------------SNDVELVAEGNSRFTYSVL.VD---------
Q26634_STRPU/1217-1413TSARQTVTYFCKNVQG............NPIFLS---------------SSDVELVDDQDSKFNYRTL.ED---------
Q90YI9_DANRE/222-440NQGSQNITYHCKNSIAYMDETS.GNLKKALLLQG---------------SNDIEIRAEGNSRFTYRVS.ED---------
Q4S5M8_TETNG/1257-1474TEASQNLTYHCKNSIAYMDQKT.GDLKKALLLQG---------------SNEVEIRAEGNSRFTYAVL.ED---------
Q53UC1_CIOIN/621-843RQVKQHVTFYCRNMVAYYDAAA.DNKAQALKLRG---------------FGDAEFTAEGDPSTTYRVL.HD---------
CO5A1_HUMAN/1625-1836ASAHQNVTYHCYQSVAWQDAAT.GSYDKALRFLG---------------SNDEEMSYD..NNPYIRAL.VD---------
Q9I907_PAGMA/1607-1818SSARQNFTYICHQSVAWYDAKA.DNYDKALRFLG---------------SNDEEMSYD..NNPFIKPL.MD---------
Q70BL5_PARLI/2583-2794NKAHQNVTYHCKNSVAVLDGQS.GTTEQALRLMT---------------TSDVELSPDAPSQRQYEVIGDD---------
CO1A2_LITCT/1136-1354NQASQNITYHCKNSIAYMDEET.GNLKKAVILQG---------------SNDVELRAEGNTRFTYSVL.ED---------
CAF1_EPHMU/359-546RHAVQSFTYKCRNSAA............AVIFRT---------------QDNKEIAAN.......KVT.YD---------
CO1A2_ONCMY/1139-1355NQATQNITYHCKNSVAYMDGEN.GNLKKAVLLQG---------------SNDVELRAEGNSRFTFNVL.ED---------
CO2A1_XENTR/1274-1491TDATQNITYHCKNSIAFMDEAS.GNLKKAVLLQG---------------SNDVEIRAEGNSRFTYNAL.ED---------
O77087_9ANNE/683-889TEAYQNITYHCQNSAPFYNMQT.QSTDNAAKFMT---------------SNDLELQANH.KKFTYSVK.LD---------
Q5ZGV7_PARLI/130-334NIATQLFTFNCLRTAAYYNEKT.SSYDGSIQFKG---------------YNDDIIQY...GMPGYVVP.KD---------
A7RGC7_NEMVE/22-225DRASQKITYHCRNSVAWYDSRS.RDFDKSIKLKS---------------GNGIELYAASSNKYKPTII.KD---------
A5D9L2_PIG/127-305VSAHQDVSYPCSSG.........EDQDGPLKLRG---------------ANEDELSPE..TSPYVKEF.RD---------
Q17A80_AEDAE/631-839EGAYQNFTYTCMNSVAWYSNLE.ENHDDAIRFLG---------------DNEIDIGYEN.SKLRPNVL.VD---------
Q26052_PARLI/533-729TSARQTVTYYCKNVAG............NPIFRS---------------SSEIELVDDETSKFNYNII.ED---------

PF00147

TENA_HUMAN/1980-2189NCALSYKGA...FWYRNCHRVNLMG..RYGDNNHSQ.........GVNWFHWKGH........EHSIQFAEMKLRPS
TENX_HUMAN/4071-4280SCAVSYRGA...WWYRNCHYANLNG..LYGSTVDHQ.........GVSWYHWKGF........EFSVPFTEMKLRPR
FIBB_CHICK/211-460QCSKEDGGG...WWYNRCHAANPNGRYYWGGTYSWD.MAKHGTDDGIVWMNWKGS........WYSMKKMSMKIKPY
FIBB_HUMAN/237-487QCSKEDGGG...WWYNRCHAANPNGRYYWGGQYTWD.MAKHGTDDGVVWMNWKGS........WYSMRKMSMKIRPF
TENA_CHICK/1587-1796NCALSYKGA...FWYKNCHRVNLMG..RYGDNNHSQ.........GVNWFHWKGH........EYSIQFAEMKLRPS
FIBA2_PETMA/400-635SCAEWYGGG...WWINACQAANLNGVYYQGGPYDPREKPPYEVENGVVWATYRGS........DYSLKRTAVRFRRV
FIBG_BOVIN/173-414NCAEQVGIG...WWMNKCHAGHLNGVYYQGGTYSKT.STPNGYDNGIIWATWKSR........WYSMKKTTMKIIPL
FIBB_RAT/225-475QCSKEDGGG...WWYNRCHAANPNGRYYWGGLYSWD.MSKHGTDDGVVWMNWKGS........WYSMRRMSMKIRPV
FGL2_MOUSE/202-428NCGLYYSSG...WWFDSCLSANLNGKYYHQKYKGVR........NGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPK
FIBB_BOVIN/214-464QCSKEDGGG...WWYNRCHAANPNGRYYWGGAYTWD.MAKHGTDDGVVWMNWQGS........WYSMKKMSMKIRPY
FIBA_PARPA/66-280NCASHSSYGRGAWWYKSCLLSNLNG.QYYDYSGAPS..........IYWSYLPGD........NDQIPFAEMKLRNR

PF01410

A7S046_NEMVE/1196-1399ECTTKDD-----QWHKTILAI..DTKQKHRLPIV-----------DMALFDFGKPHQ------KVTVEVGSVCF---
Q149N0_HUMAN/1477-1688GCASRKG-----Y.EKTVIEI..NTPKIDQVPIV-----------DVMINDFGDQNQ------KFGFEVGPVCF---
Q8BKY2_MOUSE/1246-1463GCTKHTG-----EWSKTVFEY..QTRKAMRLPII-----------DIAPYDIGGPDQ------EFGVDIGPVCF---
Q9NDD6_RIFPA/292-500ECKLSQD-----TWARTVFQF..KTEKTQRLPVV-----------DIAMVDIGADNQ------AFGLEIGPVCF---
Q5PR22_HUMAN/922-1138TCSKRNG-----NVGKTVFEY..RTQNVARLPII-----------DLAPVDVGGTDQ------EFGVEIGPVCF---
Q8AW17_DANRE/1118-1347GCSYRKG-----L.DRTVLEV..NTPQVEQLPLL-----------DIRISDFGEDHQ------KFGFEVGPVCF---
Q4AE65_9CHON/362-580GCTKHSG-----SWGKTVFEY..RTQNTARLPIV-----------DIAPLDIGGPDQ------EFGFDIGPVCF---
Q4SDF0_TETNG/1437-1655GCSKSDG-----LWGKTVIQY..RSQTAARLPVL-----------DLGLMDTGKAEQ------EFGLDIGPVCF---
Q561Q0_DANRE/40-257GCKKHTG-----QWAKTVIEY..KTQKTSRLPIM-----------DIAPMDIGGADQ------EFGVDIGAVCF---
Q4SK65_TETNG/166-381SCSEANG-----KWGKTVFEY..RTQKTPRLPIV-----------DIAPVDIGGPDQ------EFGIDLGPVCF---
Q5ZGV8_PARLI/188-394ECQNKPT-----S.GETILEV..NTSKLHQLPIA-----------DFAPLDFGRRNQ------KFGYTVGSACF---
P90679_AREMA/477-683ECQHKQS-----KWTKTVFEF..KTTKTRRLPIV-----------DIAPSDIGGEDQ------AFGLEIGPVCF---
Q59GD4_HUMAN/1443-1656GCRLRKG-----Q.TKTLFEF..SSSRAGFLPLW-----------DVAATDFGQTNQ------KFGFELGPVCF---
Q589R0_ORYLA/1640-1825GCS...G-----F.DRTILEI..NTPQLEHLPLL-----------DIKVSDFGESNQ------QFGFEVGPVCF---
Q95ND8_BOVIN/68-286GCTSHTG-----AWGKTVIEY..KTTKTSRLPII-----------DVAPLDVGAPDQ------EFGFDVGPACF---
O97406_HALDI/1224-1438TCMTSNG-----KFGETIVEVRGRGQRVERMPIM-----------DVGLYDVGGEDQ------EFGIQIGPACF---
Q26055_PARLI/840-1050GCQDRSA-----ELSQTVIKY..STRRNTRLPIV-----------DVAPSDIGGVDQ------EFGITLGPVCF---
Q5DG16_SCHJA/254-456SCQSTKS-----TFGKITIEV..DT.RPQRLPLR-----------DIILPNIINSKQ------ILGLELGRVCF---
Q3TX57_MOUSE/1155-1371GCSKKTN-----EWGKTIIEY..KTNKPSRLPFL-----------DIAPLDIGGADQ------EFRVEVGPVCF---
Q26634_STRPU/1217-1413GCSSSSS-----QWGKSVYEY..ETKKTTRLPIV-----------DFAPGEVGSESQ------MFGLEMGPVCF---
Q90YI9_DANRE/222-440GCTSHTG-----TWGKTVIDY..KTTKTSRLPII-----------DIAPMDIGAPDQ------EFGVEVGPVCF---
Q4S5M8_TETNG/1257-1474GCKKHTG-----RWGKTVFEY..KTQKTSRLPIV-----------DFAPMDIGGADQ------EFGVDVGAVCF---
Q53UC1_CIOIN/621-843GCTGRPS-----TWGKTDIEF..TTGFVGRMPIT-----------DIAPFDIGGADQ------QFGAEFGPACF---
CO5A1_HUMAN/1625-1836GCATKKG-----Y.QKTVLEI..DTPKVEQVPIV-----------DIMFNDFGEASQ------KFGFEVGPACF---
Q9I907_PAGMA/1607-1818GCSLKQG-----Y.SKTVMEI..NTPRIDQLPII-----------DVMLNDFGESNQ------RFGFEVGPVCF---
Q70BL5_PARLI/2583-2794ECRVRNG-----EWHQTVINY..STRRNTRLPIV-----------DVAPSDIGREDQ------EFGITLGPVCF---
CO1A2_LITCT/1136-1354GCTKHTG-----EWGKTVIEY..RTNKPSRLPIL-----------DIAPLDIGGHDQ------EIGFEIGPVCF---
CAF1_EPHMU/359-546GCKSRPS-----VPDAAFVAV..ETKRVEQLPIR-----------DFASSDIAGQHQ------EFGFEMGPACF---
CO1A2_ONCMY/1139-1355GCTRHTG-----QWSKTVIEY..RTNKPSRLPIL-----------DIAPLDIGEADQ------EFGLDIGPVCF---
CO2A1_XENTR/1274-1491GCKKHTG-----KWSKTVIEY..RTQKTSRLPIV-----------DIAPMDIGGADQ------EFGVDIGPVCF---
O77087_9ANNE/683-889ECQYKLK-----KWASTTFEF..RTTKTRRLPIL-----------DIAPYDIGGPDQ------AFGLEIGPVCF---
Q5ZGV7_PARLI/130-334GCKTIFK-----KVKKSIFTL..TAEDPSQLPIK-----------DFAPRGYKGRGQ------RFGFIVGPVCF---
A7RGC7_NEMVE/22-225DCGVKDG-----KWRKTVLEV..NTESTHRLPIV-----------DIAVFDIGDRDE------EFGLQIGSVCF---
A5D9L2_PIG/127-305GCQTQQ.-----..GRTVLEV..RTPVLEQLPVL-----------DASFSDLGAPPR------RGGVLLGPVCF---
Q17A80_AEDAE/631-839GCKSGKS-----K.SETIFEI..RTTKLQYLPII-----------DFYPVDYGQPQQ------AFGFQVGPVCF---
Q26052_PARLI/533-729GCSTATS-----QKGKSVYEY..ETKKTTRLPIV-----------DFAPGEVGLENQ------KFGLEMGPVCF---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window