Sequence alignment for CL0422

PF00147

TENA_HUMAN/1980-2189-----------------------------FPKDCSQAMLNGDT-----TSGLYTIYLN-GDKAEALEVFCDMTSDGGGWI
TENX_HUMAN/4071-4280-----------------------------FPRDCGEEMQNGAG-----ASRTSTIFLN-GNRERPLNVFCDMETDGGGWL
FIBB_CHICK/211-460-----------------------------SGRECEDIYRKGGE-----TSEMYIIQPD-PFT.TPYRVYCDMETDNGGWT
FIBG_BOVIN/173-414-----------------------------TGRDCQDVANKGAK-----ESGLYFIRPL-KA..KQFLVYCEIDGSGNGWT
FGL2_MOUSE/202-428-----------------------------IYKDCSDHYVLGRR-----SSGAYRVTPD-HRN.SSFEVYCDMETMGGGWT

PF01410

Q17A80_AEDAE/613-839KFLDMYSSIYSMRQELDRIRKPVG.TRENPGRTCRDLHYGHPQ....FKDGWYWIDPNLGMADDAVYVFCNMTA--EGET
CO2A1_XENTR/1256-1491RDVDVEATLKSLNNQIESIRSPDG.TKKNPARTCRDLKLCHPE....WKSGDYWIDPNQGCTVDAIKVFCNMET--.GET
CO5A1_HUMAN/1607-1836GMEEIFGSLNSLKLEIEQMKRPLG.TQQNPARTCKDLQLCHPD....FPDGEYWVDPNQGCSRDSFKVYCNFTA--GGST
A7S046_NEMVE/1178-1399PSVSFMTALEKMEIDVNTIRKPTG.MKNNPAKTCKDLRMDHPD....YVSGYYWIDPNEGSKKDAIRVYCDFSN--.DFS
COBA1_HUMAN/1575-1804GMEEIFGSLNSLKQDIEHMKFPMG.TQTNPARTCKDLQLSHPD....FPDGEYWIDPNQGCSGDSFKVYCNFTS--GGET
B3DLK0_DANRE/1185-1420HDVEVDATLKSINGQIEDIRSPDG.SRKNPARSCRDLKLCHPE....WKSGDYWVDPNLGSAADAIKVFCNMET--.GET
F1QBU0_DANRE/1463-1693GMEEIFGSLNSLRQEIESMRFPLG.TKESPGRTCQDLHLSQPD....LKDGEYWIDPNQGCARDSFKVYCNFTA--GGET
F1QDL1_DANRE/1212-1448RDSEVDTSLKSLSQKIENIRSPEG.TQANPARMCRDLRMCHPE....WKSGSYWVDPNQGSPLDAIKVFCNMET--.GET
F6SZ48_CIOIN/603-843RDEEMMVVLKELTNSVENIKAPRGVSKKTAARSCMDIYLAEQQQNIVAKNGIRWIDPNGGCTADGIEVYCNFDT--.MET
F7F6Q4_CALJA/1131-1364.DPGVHATLKSLSSQIETMRSPDG.SKKHPARTCDDLKLCHSA....KQSGEYWIDPNQGSVEDAIKVYCNMET--.GET
G3PWU7_GASAC/1588-1817GMEDVFGSLNNLKQDIERMKFPMG.TQDNPARTCNDLHLSQPD....YPDGEYWIDPNQGCIGDSIKVFCNFTA--GGET
H2QFA6_PANTR/1396-1625..EEVLASLTSLSLELEQLRRPPG.TAERPGLVCHELHRNHPH....LPDGEYWIDPNQGCARDSFRVFCNFTA--GGET
H3C2Q8_TETNG/1256-1491.DAGVHATLKTLRRRLSDLRSPDG.SRMDPAKTCQDLRHSHPD....KKSGEYWIDPDGGSAKDAIRVFCNMEA--.GET
H3C754_TETNG/1178-1413HDVEVDSTLKSLNKQIENLLSPDG.SQKNPARTCRDLKLCHPN....WKSGNYWVDPNLGSTADAIKVFCNMET--.GET
H3CTY6_TETNG/1094-1325..PGILATLKALSSQISNMKSPDG.SRKHPARTCDDLKRCYPM....KKSGEYWVDPNQGSVEDAIQVHCNMDT--.GET
CO1A1_BOVIN/1226-1462RDLEVDTTLKSLSQQIENIRSPEG.SRKNPARTCRDLKMCHSD....WKSGEYWIDPNQGCNLDAIKVFCNMET--.GET
CO3A1_MOUSE/1229-1463.TEEIMSSLKSVNGQIESLISPDG.SRKNPARNCRDLKFCHPE....LKSGEYWVDPNQGCKMDAIKVFCNMET--.GET
CO1A2_MOUSE/1137-1371KDYEVDATLKSLNNQIETLLTPEG.SRKNPARTCRDLRLSHPE....WNSDYYWIDPNQGCTMDAIKVYCDFST--.GET
W4Y054_STRPU/1634-1866.MEVLFSSLDQLQTDVEGIKKPNG.TKDNPARTCKDLLMCHPK....TQDGYYWIDPNEGCPDDAFYAFCNMTA--GGDT
W4ZCX1_STRPU/3533-3747QDTELLGAISALGQQIELIKAPQGKAKTNPARSCKDVFLNNVE....AESGYYWVDPNLGCQKDAIQVYCEAET--.GAT
W5LPK3_ASTMX/967-1201KDYEVDATIKSLNTQIDNLLSPEG.SKKNPARTCRDIRLSHPD....WTSGFYWIDPNQGCTMDAIKAFCDFST--.GQT

PF00147

TENA_HUMAN/1980-2189VFLRRKNGRENFYQNWKAYAAGFGDRR...........EEFWLGLDNLNKITAQG..QY-ELRVDLRDH.GETAFAVYDK
TENX_HUMAN/4071-4280VFQRRMDGQTDFWRDWEDYAHGFGNIS...........GEFWLGNEALHSLTQAG..DY-SMRVDLRAG.DEAVFAQYDS
FIBB_CHICK/211-460LIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIG..PT-KVLIEMEDWNGDKVSALYGG
FIBG_BOVIN/173-414VFQKRLDGSLDFKKNWIQYKEGFGHLSPTGT.....GNTEFWLGNEKIHLISTQSSIPY-VLRIQLEDWNGRTSTADYAS
FGL2_MOUSE/202-428VLQARLDGSTNFTREWKDYKAGFGNLER...........EFWLGNDKIHLLTKSK..EM-ILRIDLEDFNGLTLYALYDQ

PF01410

Q17A80_AEDAE/613-839CVFPDLHSSQMPNIPWRKEN..........D-------KTDWYSNL----RGGFR.ISY.........ETVGVVQMTFLR
CO2A1_XENTR/1256-1491CVYPNPSKIP.KKNWWSAKGK........EK-------KHIWFGET----INGGFQFSY...GDDSSAPNTANIQMTFLR
CO5A1_HUMAN/1607-1836CVFPDKKSEGARITSWPKEN...........-------PGSWFSEF----KRGKL.LSY....VDAEGNPVGVVQMTFLR
A7S046_NEMVE/1178-1399CISPTKAKLLNLRVQANVNK...........-------KDKWLSEA----FEEESQIDY..........SAEQSQIAFLR
COBA1_HUMAN/1575-1804CIYPDKKSEGVRISSWPKEK...........-------PGSWFSEF----KRGKL.LSY....LDVEGNSINMVQMTFLK
B3DLK0_DANRE/1185-1420CVKPSTPKIP.RKNWWTSKSK........AQ-------KHVWFGES----MNGGFHFSY...ADGSQTPSTTTIQLNFLR
F1QBU0_DANRE/1463-1693CLYPSKAVENVKMNSWIKEK...........-------PGSLFSQF----AKGNK.FSY....VDSVGEAVGVVQLGFLR
F1QDL1_DANRE/1212-1448CVSPYHSDIP.RKNWYTSKNIR.......EK-------KHVWFGES----MPNGFQFQY...GSDGSDPEDVNIQLTFMR
F6SZ48_CIOIN/603-843CVYPTNRHIE.NGTHYTGES...........-------RHVYYGEE----MATGSTVRYDPSDEDRVPHADYTSQLTFLR
F7F6Q4_CALJA/1131-1364CISANPSSVP.RKTWWASKSP........DH-------KPVWYGLD----MNRGSQFVY....GDHQSPNTAITQMTFLR
G3PWU7_GASAC/1588-1817CIHPDKKSAGVRISNWPKEL...........-------PGSWFSEF----KRGKI.LNY....VDMAENTINTVQMTFLK
H2QFA6_PANTR/1396-1625CLYPDKKFEIVKLASWSKEK...........-------PGGWYSTF----RRGKK.FSY....VDADGSPVNVVQLNFLK
H3C2Q8_TETNG/1256-1491CISASPANIP.RKSWWTKASPS.......SS-------KPVWFGSD----MNAGSRFQY...GHGDELGNTAAVQLKLLQ
H3C754_TETNG/1178-1413CVYPSIAKAP.KKNWWSSKSK........DR-------KHVWFGET----MNGGFHLDY...AQDGPAGLVAAVQLNFLR
H3CTY6_TETNG/1094-1325CISANPPSIP.RKVWWNTSK..........N-------KPVWFGAD----INRGTHFVY...GNKDQLANTITVQMTFIR
CO1A1_BOVIN/1226-1462CVYPTQPSVA.QKNWYISKNPK.......EK-------RHVWYGES----MTGGFQFEY...GGQGSDPADVAIQLTFLR
CO3A1_MOUSE/1229-1463CINASPMTVP.RKHWWTDSGA........EK-------KHVWFGES----MNGGFQFSY...GPPDLPEDVVDVQLAFLR
CO1A2_MOUSE/1137-1371CIQAQPVNTP.AKNSYSRAQA.........N-------KHVWLGET----INGGSQFEY...NVEGVSSKEMATQLAFMR
W4Y054_STRPU/1634-1866CLAPDNTTGH.HFYNYTEENSTETKGYRKAV-------PGEWFLEN----LRGKE.FSY..........QGGIVQLTFLR
W4ZCX1_STRPU/3533-3747CVPSTNNVVS.NMTWYVGKT...........-------KRAFFSSM----HGGDK.FAY..........IEDSTQMTFLR
W5LPK3_ASTMX/967-1201CIHAHPESIP.RKNWYRSSQE.........K-------KHIWFGET----INGGTEFGY...NDETLSPQSMATQLAFMR

PF00147

TENA_HUMAN/1980-2189FSVGDAKTRYKLKVEGYSG...............TAGDSMAYHNGRSFSTFDKDTD.....SAITNCALSYKGAFWYRNC
TENX_HUMAN/4071-4280FHVDSAAEYYRLHLEGYHG...............TAGDSMSYHSGSVFSARDRDPN.....SLLISCAVSYRGAWWYRNC
FIBB_CHICK/211-460FTIHNEGNKYQLSVSNYKG.NAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRC
FIBG_BOVIN/173-414FKVTGENDKYRLTYAYFIGGDAGDAFDGYDFGDDSSDKFFTSHNGMQFSTWDSDND.....KYDGNCAEQVGIGWWMNKC
FGL2_MOUSE/202-428FYVANEFLKYRLHIGNYNG.TAGDALR........FSR.HYNHDLRFFTTPDRDNDR....YPSGNCGLYYSSGWWFDSC

PF01410

Q17A80_AEDAE/613-839LLSEGAYQNFTYTCMNSVA------------WYSNLE.ENHDDAIRFLGDNEIDI------GYEN.SKLRPNV--LVDGC
CO2A1_XENTR/1256-1491LLSTDATQNITYHCKNSIA------------FMDEAS.GNLKKAVLLQGSNDVEI------RAEGNSRFTYNA--LEDGC
CO5A1_HUMAN/1607-1836LLSASAHQNVTYHCYQSVA------------WQDAAT.GSYDKALRFLGSNDEEM------SYD..NNPYIRA--LVDGC
A7S046_NEMVE/1178-1399VFSKRAYQNVTYNCQNYKA------------W......TNRKHSIKLRGDNDLIF------HAKSPKKFQPTV--ILNEC
COBA1_HUMAN/1575-1804LLTASARQNFTYHCHQSAA------------WYDVSS.GSYDKALRFLGSNDEEM------SYD..NNPFIKT--LYDGC
B3DLK0_DANRE/1185-1420LLSTEATQTITYHCKNSVA------------YMDQAT.GNLKKAILLQGSNDVEI------RAEGNSRFTYGV--LEDGC
F1QBU0_DANRE/1463-1693LLSVQARQNLTYHCQRSVA------------WTDQTTDGGYKRALRLQGANDEEI------SYE..TSPYIKA--LIDGC
F1QDL1_DANRE/1212-1448LMSNQGSQNITYHCKNSIA------------YMDETS.GNLKKALLLQGSNDIEI------RAEGNSRFTYRV--SEDGC
F6SZ48_CIOIN/603-843LLSRQVKQHVTFYCRNMVA------------YYDAAA.DNKAQALKLRGFGDAEF------TAEGDPSTTYRV--LHDGC
F7F6Q4_CALJA/1131-1364LLSKEASQNITYVCKNSVG------------YMDDQA.KNLKKAVVLKGANDLDI------KAEGNIRFRYIV--LQDTC
G3PWU7_GASAC/1588-1817LLSSSARQNFTYICHQSVA------------WYDAKA.DNYDKALRFLGSNDEEI------SYD..NNLFIKP--LVDGC
H2QFA6_PANTR/1396-1625LLSATARQNFTYSCQNAAA------------WLDEAT.GDYSHSARFLGTNGEEL------SFNQTTAATVSV--PQDGC
H3C2Q8_TETNG/1256-1491LLSTESHQNITFHCRNTVA------------YKEQTS.GQLKKALVLRGANGQEL------RAQGNARLRYTV--TKDGC
H3C754_TETNG/1178-1413LLSTEASQNLTYHCKNSIA------------YMDQKT.GDLKKALLLQGSNEVEI------RAEGNSRFTYAV--LEDGC
H3CTY6_TETNG/1094-1325LLSKEASQTITYHCKNSVA------------YMDQKA.GNLKKAIILKGANDLEL------KAEGNSRFRYTV--LEDSC
CO1A1_BOVIN/1226-1462LMSTEASQNITYHCKNSVA------------YMDQQT.GNLKKALLLQGSNEIEI------RAEGNSRFTYSV--TYDGC
CO3A1_MOUSE/1229-1463LLSSRASQNITYHCKNSIA------------YMDQAS.GNVKKSLKLMGSNEGEF------KAEGNSKFTYTV--LEDGC
CO1A2_MOUSE/1137-1371LLANRASQNITYHCKNSIA------------YLDEET.GSLNKAVLLQGSNDVEL------VAEGNSRFTYSV--LVDGC
W4Y054_STRPU/1634-1866LLSSKATQKFTYSCVNGVA------------WYDEAE.DSFDNAIRLLASNDEEF------TFDGL..NQPKV--IKDEC
W4ZCX1_STRPU/3533-3747LLSTSARQTVTYFCKN...------------.........VQGNPIFLSSSDVEL------VDDQDSKFNYRT--LEDGC
W5LPK3_ASTMX/967-1201LLANQAVQNVTYHCKNSIA------------YMDAEN.GNLKKAVLLQGSNDVEL------RAEGNSRFTFSV--LEDGC

PF00147

TENA_HUMAN/1980-2189HRVNLMG..RYGDNNHSQ........GVNWFHWKGH........EHSIQFAEMKLRPS--
TENX_HUMAN/4071-4280HYANLNG..LYGSTVDHQ........GVSWYHWKGF........EFSVPFTEMKLRPR--
FIBB_CHICK/211-460HAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGS........WYSMKKMSMKIKPY--
FIBG_BOVIN/173-414HAGHLNGVYYQGGTYSKTSTPNGYDNGIIWATWKSR........WYSMKKTTMKIIPL--
FGL2_MOUSE/202-428LSANLNGKYYHQKYKGVR.......NGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPK--

PF01410

Q17A80_AEDAE/613-839KSGKS----K.SETIFEIRTTKLQYLPIIDFYPVDY--------GQPQQAFGFQVGPVCF
CO2A1_XENTR/1256-1491KKHTG----KWSKTVIEYRTQKTSRLPIVDIAPMDI--------GGADQEFGVDIGPVCF
CO5A1_HUMAN/1607-1836ATKKG----Y.QKTVLEIDTPKVEQVPIVDIMFNDF--------GEASQKFGFEVGPACF
A7S046_NEMVE/1178-1399TTKDD----QWHKTILAIDTKQKHRLPIVDMALFDF--------GKPHQKVTVEVGSVCF
COBA1_HUMAN/1575-1804ASRKG----Y.EKTVIEINTPKIDQVPIVDVMINDF--------GDQNQKFGFEVGPVCF
B3DLK0_DANRE/1185-1420KKHTG----QWAKTVIEYKTQKTSRLPIMDIAPMDI--------GGADQEFGVDIGAVCF
F1QBU0_DANRE/1463-1693SYRKG----L.DRTVLEVNTPQVEQLPLLDIRISDF--------GEDNQKFGFEVGPVCF
F1QDL1_DANRE/1212-1448TSHTG----TWGKTVIDYKTTKTSRLPIIDIAPMDI--------GAPDQEFGVEVGPVCF
F6SZ48_CIOIN/603-843TGRPS----TWGKTDIEFTTGFVGRMPITDIAPFDI--------GGADQQFGAEFGPACF
F7F6Q4_CALJA/1131-1364SKRNG----NVGKTVFEYRTQNVARLPIIDLAPVDV--------GGTDQEFGVEIGPVCF
G3PWU7_GASAC/1588-1817SLKQG----Y.SKTVMEINTPRIDQLPIIDVMLNDF--------GESNQRFGFELGPVCF
H2QFA6_PANTR/1396-1625RLRKG----Q.TKTLFEFSSSRAGFLPLWDVAATDF--------GQTNQKFGFELGPVCF
H3C2Q8_TETNG/1256-1491SKSDG----LWGKTVIQYRSQTAARLPVLDLGLMDT--------GKAEQEFGLDIGPVCF
H3C754_TETNG/1178-1413KKHTG----RWGKTVFEYKTQKTSRLPIVDFAPMDI--------GGADQEFGVDVGAVCF
H3CTY6_TETNG/1094-1325SEANG----KWGKTVFEYRTQKTPRLPIVDIAPVDI--------GGPDQEFGIDLGPVCF
CO1A1_BOVIN/1226-1462TSHTG----AWGKTVIEYKTTKTSRLPIIDVAPLDV--------GAPDQEFGFDVGPACF
CO3A1_MOUSE/1229-1463TKHTG----EWSKTVFEYQTRKAMRLPIIDIAPYDI--------GGPDQEFGVDIGPVCF
CO1A2_MOUSE/1137-1371SKKTN----EWGKTIIEYKTNKPSRLPFLDIAPLDI--------GGADQEFRVEVGPVCF
W4Y054_STRPU/1634-1866KNKPS----L.GETILEVNTSKLHQLPISDFAPLDF--------GRRNQKFGYTVGSACF
W4ZCX1_STRPU/3533-3747SSSSS----QWGKSVYEYETKKTTRLPIVDFAPGEV--------GSESQMFGLEMGPVCF
W5LPK3_ASTMX/967-1201TRHTG----QWSKTVIEYRTNKPSRLPILDIAPLDI--------GGADQEFGLDIGPVCF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window