Sequence alignment for CL0423

PF04636

H9GH47_ANOCA/62-498GPSSFIPVEEIL..QEGAERA...QRHLFIEAFLSSGR.....VDNITMVMGL.....HPEYLTSFWKTQYLLLR--MDG
W5LN19_ASTMX/16-447GPSAFIPAQVIL..DEGP......RQEVMTDTLLSVSH.....ADHIATIMGL.....HPAYLGCFLRTQNALLQ--PDG
H3BCQ9_LATCH/18-462GPSQFIPEKEIL..QIGKE.DAH.IHALFEEAFAALGR.....LDNITLLMVF.....HPQYLHSFLKTQHYLLQ--MDG
F1R1P4_DANRE/28-465GPSSFIPENEII..GAMPL.SDS.TVMLLDEEF..SGR.....MDNLTQVMGL.....HPHYLQAFLRCHYYLLR--MDG
A0F081_DANRE/15-443GPSAFIPTEEIL..EEGS......THEVMSDVLLSEGR.....ADHINMVMGL.....HPTYLACFQRTQDALLQ--LDG
B4NMK7_DROWI/5-489.IDYYAGMGQIA..QDC.......SSTDTDIVDMDPDD.....LDQVTQVIGY.....HPRYKDHFLHTQNFIMK--GDG
Q28ZG4_DROPS/4-508AVDYFADMGQIS..QDV...STQNPTFIYPHTRMYT.......YIAVRLVIGY.....HPHFHDHFLRTQNFIMK--GDG
F7HTF1_CALJA/47-491GPSRFIPEKEIL..QVGSE.DAQ.MHALFADSFAALGR.....LDNITLVMVF.....HPQYLESFLKTQHYLLQ--MDG
A7SCG7_NEMVE/102-542GPSSFIPSKELP..SMDTD.DEQ.THSLLVDSFLFNGR.....VPNVTCIIGV.....HPQYLDWNARTEYFLMR--GEG
F7HY37_CALJA/43-479GPSAFIPVEEVL..REGTE.SL..EQHLGLEALMSSGR.....VDNLAVVMGL.....HPDYFTSFWRLHYLLLH--TDG
W5MLE5_LEPOC/40-480GPSAFIPENEIL..EATPA.DTH.TNLLLVEEYSTSGR.....IDHLTQLMGL.....HPQYLESFLRSQFYMLR--MDG
E9C869_CAPO3/294-722APSRFIPTPKLM..PMNEEPGAEASYQVMVDSFLHDCR.....VSHFVRALSY.....HPTYLAAFLHTHHFILR--GDG
Q7PTB1_ANOGA/4-440MVEYYSDMGQIG..QDYGSKNSPTDSSN...............LDHVTKVIAY.....HPRYLDHFLNTQKFVMQ--CDG
G1U329_RABIT/39-491GPSAFIPEKEVV..QANTV.DER.TN.FLVEEYSTSGR.....LDNITQVMSL.....HTQYLESFLRSQFYMLR--MDG
C3XTE9_BRAFL/48-481GPSSFIPEHEVL..QESVF.SFRATRQLFVDAFLQNNR.....LENITSVMGF.....HPQYLESFLRLQHYLLR--MDG
I1FVV2_AMPQE/119-585GPSSFMSVKDVAGYHESSKPVTHELQQLYENAFLRDAR.....LSNIVQCLSD.....HPQYLDLFIQTMDFIMN--GDG
I3J1U7_ORENI/91-527GPSAFIPAKEIL..KGGP......NQDVLIESFLSLGR.....VDHISMVMAM.....HPAYLCCFLKTQHALLE--MDG
W5KLV4_ASTMX/20-439.......QNQVM..KVNSE.KER.ASPLCMKALASRGR.....LDTVSQQMAS.....HPQYLESFLRTQHYILY--MDG
B4MDV6_DROVI/4-484AVDYYAEMGQIS..QDC.......SSTDFDMDDL..DE.....CDQVTQVIGY.....HPLYRDHFLRTQNFIMK--GDG
A8WVR0_CAEBR/66-543DTDLWQVVYSLC..VCSAIRGEETTK...TNPFVFLGRWSFGFVSQFTENLLFRFTCKHPALHVHMTGSYGHMFV--DIS
K1Q3S5_CRAGI/175-609GPSKYIPESEIV..PVSTS.EDQ.TQMLFVDAFLQNNR.....LDHVTQLMGY.....HPNYLEMFLRTQQYLLR--GDG
U3K820_FICAL/39-467GPSAFIPLGEIP..QERGD.S...SLHQLLKAFVSAGR.....VDHVAMVMGL.....HPQYLSSFWKTQYLLLR--MDG
F7ARK8_MONDO/41-477GPSAFIPVEEIL..QQGPE.TIE.EQQLSLEV.SASGR.....PDNVMLVMGL.....HPDYLSSFWKMQGLLLR--VDG
W5NCK4_LEPOC/20-441.......QNQVV..KMSSE.KER.SQLLCVKALASRGR.....LDSITQQMGY.....HPQYLESFLRTQHYILH--MDG
F4Q7E9_DICFS/150-592KTTSFINETQLP..PLNS..NDQLTKRLFQEAFLQSGR.....VNHIIRLLGW.....HPQYLERFLASYNKVMR--DQG
B4QAY3_DROSI/4-496AVDYYADMGQIS..QDCFA.ATQTGASDFDMDEL..DD.....LDQVTQVIGY.....HPQFHDHFLATQNFIMK--GDG
H2ZKE8_CIOSA/218-659..SRFIPTDQIH..PVDTD.DEQ.AHSLYSESFVQNCR.....LEHMVMVMGL.....HPQYLQQFLETNDHLLR--SSG
H3BCK5_LATCH/13-462GPSSFIPVQEIL..QEGAK.NN..DRQIFIEAFVSTGR.....VDHLLVVMGL.....HPEYLTSFWKTQYYLLQ--MDG
H2RRP9_TAKRU/38-481GPSRFIPEKEIL..KVSKV.ADR.TQSIFEDAFSTLGR.....LDNISVVMGF.....HPHYLESFLRTQHYLLQ--MDG
W5MCN8_LEPOC/98-536GPSFFIPATEIA..EEGVQ.Q...GEQVLIEAFVSLGR.....VDHVTMVMGL.....HPEYLSSFLRAQHYLLQ--LDG
H3ALF1_LATCH/44-502.VTFVSSKRLVA..KMSLE.KDR.PQLLFVKALASRGR.....LDPVTQQMGY.....HPQYLDSFLKTQHYLLH--MDG
G3PXZ5_GASAC/8-439..QRQRAHKQVM...VNGE.NER.VSLLFMKAVVSRGS.....VDAVSQQMAS.....HPQYLESFLRTQHYILH--MDG
SESN_DICDI/138-598RTTVFTSESQLP..PLNT..DDELTRKLFQDVFLQHGR.....VNHLTRILGW.....HPQYLEKFLLAYNTIMR--DPG

PF02627

Q930A6_RHIME/29-113-----------------------------------------------------------PALEQYTQQRLYGDVW..QRP
Q930A6_RHIME/156-240-----------------------------------------------------------PGLVQYTTDYLFRDLW..LRP
Q8KL33_RHIEC/44-128-----------------------------------------------------------WPMQTLVTEYCWDAIW.NRPG
DC4C_ACIAD/35-119-----------------------------------------------------------QDFQNFISRFAWGEVW.SRPG
Q7D077_AGRT5/19-101-----------------------------------------------------------PAHKAAWFQAIQGLGA...AS
Q7D1C9_AGRT5/12-94-----------------------------------------------------------PEAFKAVMALENYVQS...SG
O06218_MYCTU/45-127-----------------------------------------------------------GLLTAGWATLRETLL....VG
O06800_MYCTU/26-109-----------------------------------------------------------PQVYQRFVALGDAALT...DG
Q88GS9_PSEPK/72-155-----------------------------------------------------------ANAPAALETYVTVSAL.NGKS
O26169_METTH/26-109-----------------------------------------------------------PEILEAYYDKMEKILS...ND
O26336_METTH/31-115-----------------------------------------------------------PDLARFVAEFAYGDVY.SR.G
O26787_METTH/36-120-----------------------------------------------------------PDIYEAVVKLNEAAYT...GK
O27018_METTH/13-96-----------------------------------------------------------PEVAESFKNFREAVRS...EG
O29899_ARCFU/36-119-----------------------------------------------------------PEWLERQMDERQFVMS...LE
Q8DUG8_STRMU/42-124-----------------------------------------------------------PTALETYRTVGEINRR...NS
O30263_ARCFU/32-115-----------------------------------------------------------PETLLRFIEFRDSIMA...EG
YURZ_BACSU/32-115-----------------------------------------------------------PLMGRKFNEFTEQCFA...GN
Q88K69_PSEPK/28-111-----------------------------------------------------------PDTVAGYMTASGAGAK...TN
O53749_MYCTU/49-133-----------------------------------------------------------QYLFWTFAIYTGRLL....HG
O53905_MYCTU/40-123-----------------------------------------------------------PRLARTFNDLLATMLW...HG
Q89PM8_BRADU/34-118-----------------------------------------------------------PAFLDAYGKYAGYAVE...NG
Q88N35_PSEPK/35-119-----------------------------------------------------------GEFQEMITRHAWGDIW.TRPG
O69814_STRCO/47-126-----------------------------------------------------------ALVAPAWALMRESLLA...GP
Q8DKG6_THEEB/35-118-----------------------------------------------------------PDAMKAFYSLSRASSI...PG
O86608_STRCO/355-439-----------------------------------------------------------GDFQEFLTRYAWGEIW.DRPG
Y4147_CUPNH/24-107-----------------------------------------------------------PAAMSAFQGVMKAATQ...DG
Q89PR3_BRADU/12-94-----------------------------------------------------------PAGVKALGGVRGYVM....QS
Q81CE2_BACCR/28-111-----------------------------------------------------------PEIAETYNAFTQACFQ...EG
Q89CI6_BRADU/13-94-----------------------------------------------------------PEAMNVLQSLGNLT.....KQ
YJ81_YEAST/199-283-----------------------------------------------------------DLWYYTLVHVYGPLFA..FDE
P73604_SYNY3/23-107-----------------------------------------------------------PKFGDFCTRVAGEAWG...LP
Q81RU7_BACAN/19-103-----------------------------------------------------------PAFAHYSEKILFEEVW..RDD
Q89CP9_BRADU/40-125-----------------------------------------------------------AGHGRAWDKFRAGGLL..DPG
YDFG_BACSU/12-94-----------------------------------------------------------PEGMKIMMDMEKYTK....QS
Q828B2_STRAW/38-123-----------------------------------------------------------PELGHQIVSWAFGDIY.DRPG
Q89RQ0_BRADU/34-116-----------------------------------------------------------PEMARAFNGIGGYIRF...KS
Q82A02_STRAW/34-115-----------------------------------------------------------PKVFRALIGFDAAAR....EG
Q89D50_BRADU/12-94-----------------------------------------------------------PDTLKALIAVDDQIKA...SG
Q82HT0_STRAW/32-114-----------------------------------------------------------PDVYKAMIRLDTAA.....QR
Y1053_HAEIN/24-107-----------------------------------------------------------PKMLQAYQALGAAAAE...GN
Q8E1D2_STRA5/17-102-----------------------------------------------------------PEFARYNDDILFGEVW.AKED
Y742_METJA/19-103-----------------------------------------------------------PDLYDIIVKLNDTVFT...GK
AHPD_STRAW/94-177-----------------------------------------------------------PEYGTLRAGLRMNVIG...NP
Y1511_METJA/18-101-----------------------------------------------------------PEFYEAVANLQKEVFS...GK
Q7MJJ5_VIBVY/55-138-----------------------------------------------------------PTVLNSILAFGDSLG....KG
Q89SZ5_BRADU/50-134-----------------------------------------------------------EANMIPAMRLGNSILH...KQ
Q7NI16_GLOVI/40-125-----------------------------------------------------------PQVMRAVMNLYGAIHT.HSDT
Q82MF4_STRAW/285-369-----------------------------------------------------------ARFQDFISRYAWGEIW..TDS
Q7NMU5_GLOVI/47-129-----------------------------------------------------------PAAYRALLGLGSYVES...SG
Q89F01_BRADU/58-143-----------------------------------------------------------PEVLEARTKTDKDIFY.NVAD
Q7NSY1_CHRVO/13-97-----------------------------------------------------------PKLDQLTREALFGDVW.QR.A
Q82MM5_STRAW/103-186-----------------------------------------------------------PRVLWADLRFEQSVAK...WN
Q7NX57_CHRVO/41-125-----------------------------------------------------------PAALEGYLALNGALG....KG
Q7NXV7_CHRVO/15-94-----------------------------------------------------------YQAQAGLERYIRGC......G
Q82PT4_STRAW/14-96-----------------------------------------------------------AKFLRYINS.AGKAVS...DS
Q7P0I8_CHRVO/10-92-----------------------------------------------------------PKAYQGLLACKNALA....ES
Q89I69_BRADU/24-107-----------------------------------------------------------PDTMKGFAALAQAATR...DG
Q7P1X7_CHRVO/26-109-----------------------------------------------------------PEVMQGFNDMARAATR...DG
Q82QS6_STRAW/57-140-----------------------------------------------------------PDLYEQFMPFGGQLLR...RG
Q89UN1_BRADU/34-118-----------------------------------------------------------RPFQEMLNEYCWGTVW.GREE
AHPD_COXBU/96-175-----------------------------------------------------------SEYQRLPANLRMNIIA...NP
Q89IH0_BRADU/35-120-----------------------------------------------------------TDFQDLITRYAWGEIW.TR.P
Q89IL8_BRADU/43-126-----------------------------------------------------------PKTLRRTWESIKEVMA...PG
Q7ULD6_RHOBA/54-137-----------------------------------------------------------PAVLDAYLKFSGALA....VG
Q7UPD1_RHOBA/39-122-----------------------------------------------------------PEYMRAYEDLGKAARE...SG
Q89XS3_BRADU/55-139-----------------------------------------------------------PESLAVRSPLFNLIMY..GKD
Q7USN7_RHOBA/41-121-----------------------------------------------------------PDVLGGMTQINDGL.....QN
Q89LE4_BRADU/50-134-----------------------------------------------------------PALEAYTQNRLLGDVW.KRPG
Q7UTX7_RHOBA/162-245-----------------------------------------------------------AESPALLEAYRTIAGIFDTKT
Q7VG56_HELHP/77-162-----------------------------------------------------------PDLGRFIIEFAFGDIY.TR.G
Q89LE4_BRADU/177-261-----------------------------------------------------------PGVVQYTTDVLFRDLW.LRPD
Q7VG63_HELHP/82-166-----------------------------------------------------------PEFFSNYVNFAFDEVP..SES
Q7VG63_HELHP/216-301-----------------------------------------------------------QHIRTFLSANCFGDYY.TR.G
Q87FG9_VIBPA/24-106-----------------------------------------------------------VLTMTTISAVMPAFAT...DK
Q87FG9_VIBPA/158-243-----------------------------------------------------------PQIDQYLKAHLFGDIF.AR.D
Q7VTI6_BORPE/91-170-----------------------------------------------------------AQLKSLPAQLRMNAYA..THG
Q8A7Y1_BACTN/178-261-----------------------------------------------------------PELDAIFGNFTKEVQQ...YG
Q7VW83_BORPE/12-94-----------------------------------------------------------PELFKKFVAFSLALK....QS
Q87H24_VIBPA/33-118-----------------------------------------------------------PDLAKFTIEYPFGDIY.TREG
Q7W0B6_BORPE/40-124-----------------------------------------------------------ASLQKLVTEYCWGEVW.TRPG
Q87WR5_PSESM/34-118-----------------------------------------------------------QPLQDFVNEHAWGSVW.SRDG
Q8A7Y1_BACTN/311-396-----------------------------------------------------------KHIQRYLSANCFGDYQ.TR.G
Q87XC8_PSESM/23-106-----------------------------------------------------------PETMKGMAALGAAGSK...TN
Q89M11_BRADU/16-98-----------------------------------------------------------PDAYDLVLALGQVAAK...AG
Q881M4_PSESM/43-127-----------------------------------------------------------PVMAHNTDTLLFDEVW.KR.S
Q881M4_PSESM/170-254-----------------------------------------------------------PGLVQYTTSALFNDLW.LRPG
Q8DV36_STRMU/17-102-----------------------------------------------------------PEFAHFNDDMLFGENW..NNQ
Q89N13_BRADU/21-105-----------------------------------------------------------PVEANAFLAFNHAV..ERKDG
Q881R7_PSESM/57-141-----------------------------------------------------------PDILRQRSQAFNAIMY..APG
Q89NA9_BRADU/36-119-----------------------------------------------------------PSYFEQYCRLGGAIRH...KG
Q88GS0_PSEPK/34-118-----------------------------------------------------------KPLQELVTEYCWGHVW.GREG
Q8A8P6_BACTN/142-227-----------------------------------------------------------PALDQFLKAHLFGDIF.SRDN
Q8EKK9_SHEON/33-118-----------------------------------------------------------PDLGKYIIEYPFGDIY.QREG
Q8EMR2_OCEIH/26-109-----------------------------------------------------------PEVFHSFFAFNNKALE...EG
Q8EMR2_OCEIH/135-218-----------------------------------------------------------EDAFKAFLTFDGATLE...EG
Q8EWL7_MYCPE/18-103-----------------------------------------------------------PEFAALNDDVLFGQVW.SRES
Q8FN18_COREF/270-361-----------------------------------------------------------PQALKARTLTDLDIFYNTDGE
Q8FN50_COREF/40-124-----------------------------------------------------------RPFQDFITRTAWGDVW.EREG
Q8FN71_COREF/14-100-----------------------------------------------------------PEPYKQLVEVSKTLKKIYPEV
Q8FQN1_COREF/33-119-----------------------------------------------------------PGSSDWVVGAVFGGTY.QREG
Q8KL13_RHIEC/51-135-----------------------------------------------------------WPMQELVTEYCWDNIW.NRPG
Q8NLN6_CORGL/20-105-----------------------------------------------------------PDAFKAFVHFDEAALR.GPNK
Q8NMX8_CORGL/269-355-----------------------------------------------------------PAALKARTLTDLDIFFNTDGE
Q8NN44_CORGL/15-100-----------------------------------------------------------EPYKNMLELTKTLRKI.YPDV
Q8NRJ9_CORGL/17-103-----------------------------------------------------------PKSAELNDDVLFGQVW.SRES
Q8PBZ0_XANCP/31-114-----------------------------------------------------------NQVVRRFFALDTQTYQ...AG
Q8PDG7_XANCP/35-119-----------------------------------------------------------GEFQDMITRHAWGTIW.TRDG
Q8RCV6_THETN/21-104-----------------------------------------------------------PEVMRAFNQLHHAATK...NG
Q8TN24_METAC/40-121-----------------------------------------------------------EDLFTSWLALGEMLLV...RG
Q8TNJ6_METAC/14-97-----------------------------------------------------------PELFSLLENMRELSFA...EG
Q8TP59_METAC/27-113-----------------------------------------------------------EDFGEGLASFYQAIWA.ERED
Q8TTM1_METAC/27-111-----------------------------------------------------------PELIEVFDNFAFDEVI..SYG
Q8TXW6_METKA/29-113-----------------------------------------------------------DEYAEVVEELHRIIWK...ES
A9CKY5_AGRT5/48-130-----------------------------------------------------------PDTARRFTGHFEHLFA.ATGR
A9CKY7_AGRT5/64-149-----------------------------------------------------------PGTALRIMAFYEHLFD.QSNS
A9CIC5_AGRT5/44-127-----------------------------------------------------------DLLEKTWAEVKAVMAT...PS
A9CLJ3_AGRT5/34-118-----------------------------------------------------------RPFQDILNEYCWGMAW..TDD
Q8XQ14_RALSO/17-101-----------------------------------------------------------PALADYTDNVLFGDVW.QRPG
Q8XX67_RALSO/35-119-----------------------------------------------------------APFQDLITRYAWGEIW.TRPG
Q8XYW1_RALSO/93-173-----------------------------------------------------------ADLAQQPAELRMNAYA..GSG
Q8Y1Q8_RALSO/21-105-----------------------------------------------------------PVLVPYTRHRIVEELW.HRPG
Q8Y1Q8_RALSO/150-234-----------------------------------------------------------QALLHFTDALLNHEVW.LRPG
Q8Y972_LISMO/15-97-----------------------------------------------------------PEVHSAWMETVHKLDA...AS
Q8YLD1_NOSS1/42-125-----------------------------------------------------------PTLKRTWETIKEVMAS...PG
Q8ZSI6_NOSS1/44-126-----------------------------------------------------------AESPATLRGGMALWDL.FETT
Q92S80_RHIME/12-94-----------------------------------------------------------PDAYKAVAALDSYVK....GS
Q92XD0_RHIME/12-93-----------------------------------------------------------PSLMKSWFSISTAV.....AS
Q930M4_RHIME/49-134-----------------------------------------------------------EDLARFTIQYPYGDVL.SRDG
Q930M4_RHIME/170-255-----------------------------------------------------------PDFVNWREHTLGEEIF..GAV
Q930M4_RHIME/308-395-----------------------------------------------------------PGLGRLIVAHCYGDIF.CRPA
Q97UW0_SULSO/43-128-----------------------------------------------------------RELQEMVTIFAWGLIW.TRDD
Q984R0_RHILO/14-98-----------------------------------------------------------AGLPGAWAEVKAIELS..DKT
Q987X0_RHILO/12-95-----------------------------------------------------------PSLMKKWQR.SSIELS..AAA
Q98BX3_RHILO/57-141-----------------------------------------------------------VAIAGAWAEIKGVQLN..PKT
Q98JY9_RHILO/46-129-----------------------------------------------------------VSLKRVWEQLKAVMLA...DS
Q98K47_RHILO/12-94-----------------------------------------------------------PEIMKAVSALNKAVD....EC
Q98L97_RHILO/13-95-----------------------------------------------------------PGALQALLALDKSTEA...AD
AHPD_CAUCR/95-178-----------------------------------------------------------AAYQALPCRLRLNRLA...HA
Q9A3V6_CAUCR/52-136-----------------------------------------------------------PDILRHAAQ..GFALYRDPVR
Q9A5N6_CAUCR/302-387-----------------------------------------------------------ADYQAMITRYAWNEIW.GRPG
AHPD_BRADU/95-178-----------------------------------------------------------PEYKTMPPRLRMDVIG...NP
Q9CB37_MYCLE/51-135-----------------------------------------------------------QLLFWAWLIYGGRLL....RG
Q9CE69_LACLA/31-116-----------------------------------------------------------PDLNNLMLKFAFGTIY.ER.G
Q9CFE3_LACLA/16-101-----------------------------------------------------------PKFAELNDDILFGEVW.SREK
Q9FC57_STRCO/14-95-----------------------------------------------------------GKVMKHLNSAGAAV.....QA
Q9HLI4_THEAC/22-105-----------------------------------------------------------PELTDRFLSFMESTLG...KG
Q9I1E7_PSEAE/38-118-----------------------------------------------------------ANAPAALETYLTVSGL.NAKA
Q9I5X1_PSEAE/24-106-----------------------------------------------------------PKMLAAYGALEEASA....EG
Q9I6M1_PSEAE/12-94-----------------------------------------------------------PDAYAAMLGLEKALAK...AG
Q9K796_BACHD/28-111-----------------------------------------------------------PEIAEKYNAFTEACFA...KG
Q9KXX7_STRCO/38-123-----------------------------------------------------------YDFTRIATEHAFNDAW.TRSE
Q9KZB1_STRCO/28-109-----------------------------------------------------------PEVYKAMIRLETVA.....KR
Q9KZB2_STRCO/10-92-----------------------------------------------------------REVGKALSALSAAAK....KG
Q9PCL2_XYLFA/167-252-----------------------------------------------------------PAANEYLRSHLFGDIF.KRDN
Q9RDI4_STRCO/14-96-----------------------------------------------------------GRFAKRFAGVGMLVH....QS
Q9RJG5_STRCO/31-117-----------------------------------------------------------PEAYAALRATAEAVRGVAEAA
Q9RTJ7_DEIRA/77-160-----------------------------------------------------------EQFLAWWNYFNLLVNK...EG
Q9RV26_DEIRA/68-152-----------------------------------------------------------ADFQRFMTEYAWGAVW.GR.G
Q9RVP9_DEIRA/30-114-----------------------------------------------------------PDLMAYIRDFAYDTVY.ERPG
Q9WYF2_THEMA/12-95-----------------------------------------------------------PEVSGAVVRMRNKAFS...DG
Q9X1V5_THEMA/22-105-----------------------------------------------------------TLNTKRFFNLDSAVYR...PG
A1B484_PARDP/43-125-----------------------------------------------------------...PADMLEMWFGKTF.NREG
A1B485_PARDP/37-120-----------------------------------------------------------..VAETVVGHGMGEVY.AREG
A1B6G6_PARDP/25-103-----------------------------------------------------------...DDAFLALSKVVFA...DG
A9WCB6_CHLAA/49-136-----------------------------------------------------------PDEFRAFFAYHDALME..RPS
D5ATI8_RHOCB/41-126-----------------------------------------------------------.TLPADMLEMWFGKTF.NRDG
F3Z5J5_9ACTO/59-139-----------------------------------------------------------PVVLETYAAITGAVAE...HG
Q0SH24_RHOSR/298-378-----------------------------------------------------------.PFQDFITRTAWGDIW.SRPG
Q0WB04_YERPE/37-118-----------------------------------------------------------..VQKLITEYCWGEVW..GDP
Q1LKT1_RALME/24-106-----------------------------------------------------------PQVMKSFGEMGKAAIA...DG
Q2YKQ5_BRUA2/43-126-----------------------------------------------------------.PFQALITEAAWGTVW.ARPG
Q32CQ3_SHIDS/13-94-----------------------------------------------------------PAVYNALVQAKTAL.E...NS
Q74U89_YERPE/50-134-----------------------------------------------------------PKMAQLTDDVLYADIW.ERPQ
Q79ZI9_STRAW/42-127-----------------------------------------------------------PKAYHALVETSEAVRAVAADA
Q7CV78_AGRT5/40-122-----------------------------------------------------------.PFQQLITEGAWGTVW..SGN
Q7VSA2_BORPE/23-105-----------------------------------------------------------PETVKGYQQLSAAGKQ...TN
Q7VYW3_BORPE/12-94-----------------------------------------------------------PRTMQALMALQSYVN....DC
Q8TL87_METAC/31-112-----------------------------------------------------------.EFLHKYKRCDHKLLS...DG
S5V223_STRCU/22-98-----------------------------------------------------------...FAAWRAFQDAVDR..EDG
V9VWJ7_9RHOB/37-119-----------------------------------------------------------..FQELITEAAWGTVW.ASDR

PF04636

H9GH47_ANOCA/62-498PLPYHKRHYIAIMAAARHQ-CSYLV---GFHMGE--FL-HMGGDPEWLRGLQFAPQKLRNLNEINKILAHRPWLITKEHI
W5LN19_ASTMX/16-447PLPLPWRHYIIIMASARHQ-CSYLV---KLHSSA--FQ-LAGGDESWLRGLHCAPPKIQRLQTLNKLLAHRPWLITQEHI
H3BCQ9_LATCH/18-462PLPLYFRHYIGIMAAARHQ-CSYLV---NLHVDD--FL-QVGGDRKWLSGLEFAPQKLQNLGELNKILAHRPWLLTKDHI
F1R1P4_DANRE/28-465PLPLHYRHYIAIMAAARHQ-CSTLV---CHHVQE--FE-QIGVCSDWLRGLEFCPQRLRNLNEINKILAHRPWLITKQHI
A0F081_DANRE/15-443PLPLSWRHYIVILAAARHQ-CSYLV---QHHSSA--FL-LAGGDESWLRGVHCAPPKIQHLQTLNKLLAHRPWIITQEHI
B4NMK7_DROWI/5-489PLPYHYRYYLAIIAAARHQ-CPYLV---KRYEKE--FI-NQGGSSDWLNGLEYIPPKLRAIYDINKILAHRPWLLRKEHI
Q28ZG4_DROPS/4-508PLPNDYRYYLAIIAAARHQ-CPYLV---KRYEKE--FI-NQGGSSEWLRGLDHIPDKLRAIYDINKILAHRPWLLRKEHI
F7HTF1_CALJA/47-491PLPLHYRHYIGIMAAARHQ-CSYLV---NLHVND--FL-HVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHI
A7SCG7_NEMVE/102-542PLPYDWRHYIAIMAASRHQ-CSYLV---SIYERE--FL-RYHGDKQWLKGIQHIPKKLHALLDMNKYLAHQPWLVSTQLI
F7HY37_CALJA/43-479PLASSWRHYIAIMAAARHQ-CSYLV---GSHMAE--FL-QTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHI
W5MLE5_LEPOC/40-480PLPLHYRHYIAIMAAARHQ-CSFLV---NMHVQE--FY-QIGVCLEWLKGLEYIPQRLRNLNEINKILAHRPWLITKEHI
E9C869_CAPO3/294-722PLPAHWRNYIAIMAAARCG-VKYVV---SVQQST--FL-VNGGDTTWLKGLEFAPVKLQNLDELNMLLAYQPWRVTAEHI
Q7PTB1_ANOGA/4-440PLPYDYRNYIAIMAAARHK-CTYLV---NLYEEI--FL-ANGGDPNWLNGLEHIPPKLRAISDINKILAHRPWLLNKEHV
G1U329_RABIT/39-491PLPLPYRHYIAIMAAARHQ-CSYLI---NMHVDE--FL-KTGGIAEWLNGLEYVPQRLRNLNEINKLLAHRPWLITKEHI
C3XTE9_BRAFL/48-481PLPQDYRHYIGVMSAARHQ-CSYLV---DLQESE--FL-MQDGDPDWLKGLDYIPQKLKNLCELNKILAHRPWLITKQHI
I1FVV2_AMPQE/119-585PLNQDVRCYIAILASSRHR-CSYLV---TYLEME--FR-AKGGNVLWLKGISHIPTKISNLLILNKMLCHQPWYISQTHF
I3J1U7_ORENI/91-527PLPRHWRHYIAVMAAARHH-CSYLV---QQHSAG--FL-EAGGEESWLSGLEHAPAKLRSLQTLNKLLAHRPWLITQQHI
W5KLV4_ASTMX/20-439PLPHHYRHYIAIMAAARHH-CSYLV---SLHSAQ--FL-RVGGDPLWLQGLEAAPPRLQQLDHINKVLAHQPWLTAHSHI
B4MDV6_DROVI/4-484PLPYAYRYYLAIIAAARHQ-CPYLV---KRYEKE--FI-NQGGNSEWLNGLDYIPAKLRAIYDINKILAHRPWLLRKEHI
A8WVR0_CAEBR/66-543DLPAPSRHYLAVMGASRHR-CLSLI---DHHRRK--FL-EKGGNPYWLLGVDWAHMKYRKLDYLNRMICHRPWMIHWKNF
K1Q3S5_CRAGI/175-609PLPFHYRHYIAIMAASRHQ-CAYLI---HLHEQE--FI-LQGGDQDWLKGPAFIPTKLRKLHEVNKILAHRPWLFNKSHI
U3K820_FICAL/39-467PLPYHRRHYIAIMAAARHR-CSYLV---GLHMGE--FL-QVGGNPAWLRGLHCAPQKLRNLNEINKLLAHRPWLVTKEHI
F7ARK8_MONDO/41-477PLPCPWRHYIAIMASARHQ-CSYLI---SFHMAE--FL-QVGGDPEWLLGIHRVPQKLRNLNEINKLLAHRPWLVTKEHI
W5NCK4_LEPOC/20-441PLPLHYRHYIAIMAAARHH-CRYLV---SLHSAH--FL-RVGGDPLWLQGLDSAPPRLRSLDQLNKVLAHRPWLTARQHI
F4Q7E9_DICFS/150-592PLPLPWRNYIGILASARYN-CGYLV---ALLEHE--YL-HSGGDPKWLQGVDHIPQKLKNLLKIVEMMAHQPWLLPNVDI
B4QAY3_DROSI/4-496PLPNDYRYYLAIIAAARHQ-CPYLV---KRYEKE--FI-NQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHI
H2ZKE8_CIOSA/218-659ALPYEYRSYIAIMAAARHQ-CTYLV---HLMEVQ--FL-LQGGDREWLRGLDHVPAKLRALSELNKLLAHRPWLVTAQHF
H3BCK5_LATCH/13-462PLPYPYRHYIAIMASARHR-CSYLV---NLHIMD--FL-QAGGNREWLNGLNFAPQKLRNLNEINKLLAHRPWLITKEHI
H2RRP9_TAKRU/38-481PLSLHYRHYIGIMAAARHQ-CSYLV---NLHVND--FL-QVGGDPKWLNGLDEAPRKLQPLGELNKILAHRPWLLTKEHI
W5MCN8_LEPOC/98-536PLPYAWRHYIAIMAAARHQ-CSYLV---QLHASR--FL-QVGGDPQWLGGLSCVPWKLRSLNELNKLLAHRPWLVTKEHI
H3ALF1_LATCH/44-502PLPFPCRHYIAVMAAARHG-CRYLV---NLHVSQ--FL-RVGGDPQWLQGLEFIPQRLRNLNQINKILAHRPWLIRKEHI
G3PXZ5_GASAC/8-439PLPLPYRHYIAIMAAARHH-CNYLV---YLHSAQ--FL-RVGGDPQWLQGLEAAPPRLRLLDHINKVLAHQPWLTACSHF
SESN_DICDI/138-598PLPLHWRNYIGILAAARYK-CSYII---ALQEHE--FL-MNNGDARWLQGIDHIPAKLKNLLKVIELLAHQPWLLPKLDI

PF02627

Q930A6_RHIME/29-113GLNRRDRSLVTIAALIARG.EAPAL...TYYADQ..AL.ENGVKP-----------------------------------
Q930A6_RHIME/156-240DLAPRDRSLVTIAALISVG.QVEQI...TFHLNK..AL.DNGLSE-----------------------------------
Q8KL33_RHIEC/44-128.LERKQRSILNLGMISALN.RPH..E.LKLHVRG..AI.NNGLTK-----------------------------------
DC4C_ACIAD/35-119.LPRHTRSLVTIAVLLALG.RED..E.LRMHLRA..CF.NNGVTK-----------------------------------
Q7D077_AGRT5/19-101TLDVKTQSLIYIGILAALR.LESGI...GFHVME..AK.ARGASR-----------------------------------
Q7D1C9_AGRT5/12-94.LEHRFIHLIKLRASIING.CAFCV...DMHVKE..SR.HDGLSE-----------------------------------
O06218_MYCTU/45-127QVPRGRKEAVAAAVAASLR.CPWCV...DAHTTM..LY.AAGQTD-----------------------------------
O06800_MYCTU/26-109ALSRKVKELVALAIAVVQG.CDGCV...ASHAQA..AV.RAGATA-----------------------------------
Q88GS9_PSEPK/72-155ELGLAEREVVQLIAATQHG.CDFCV...AGHTAV..AL.NKAKLP-----------------------------------
O26169_METTH/26-109ALPLVTKELIGVGAAAALG.SEHCL...KTHIKA..AK.RLDAGG-----------------------------------
O26336_METTH/31-115VLDLKTRELLTLAALTVLR.ADD..Q.LKSHVRG..AL.NAGCSK-----------------------------------
O26787_METTH/36-120VLDYRTQKLIALGITAANS.DDRAV...KKQIQS..AINEFGVTR-----------------------------------
O27018_METTH/13-96KLTEREKLLISVACSVAVR.CDACT...RRHAEE..AL.EAGITE-----------------------------------
O29899_ARCFU/36-119SIPEKYKHLIMIAVAAAVG.SKMCT...EVFTKI..AK.RRGVSE-----------------------------------
Q8DUG8_STRMU/42-124.LTPTEREVVQITAAVTNG.CAFCV...AGHTAF..SI.KQIQMA-----------------------------------
O30263_ARCFU/32-115KLNPILKEKIALAVSKVNY.CNPCL...ISHSRK..LE.MMGESI-----------------------------------
YURZ_BACSU/32-115SLTEREKQLIALGIAINAQ.DEYCM...IYHTKG..CL.DQGASE-----------------------------------
Q88K69_PSEPK/28-111HLDAKTRELISLAVAVTTR.CDGCI...AVHSQQ..AV.KAGASR-----------------------------------
O53749_MYCTU/49-133RLPGVDTELVILRVAHLRS.CEY..E.LQHHRRM..AR.RRGLDA-----------------------------------
O53905_MYCTU/40-123TLDSRLRELVIMRIGWLTD.CDYEW...TQHWRV..AS.GLGVSA-----------------------------------
Q89PM8_BRADU/34-118PLSPKMRELIYVALDGSAT.HLFRSG.LALHLRL..AL.QEGASA-----------------------------------
Q88N35_PSEPK/35-119.LPRHTRSLITIAMLIGMN.RND..E.LKLHLRA..AA.NNGVTR-----------------------------------
O69814_STRCO/47-126.GDRTGKEVAAFGVSQANK.CRFCV...DAHTMLLHAT.GDHALA-----------------------------------
Q8DKG6_THEEB/35-118ALDTKTKELIALAIGVAKH.CDGCI...AFHTRA..AL.QAGATP-----------------------------------
O86608_STRCO/355-439.LDRRSRSCVTLTALVAGG.HLD..E.LAPHLRA..AL.RNGLTP-----------------------------------
Y4147_CUPNH/24-107SLPAAVKELIAVALAVQKG.CDDCV...LFHTSQ..AL.RHRATR-----------------------------------
Q89PR3_BRADU/12-94GLSPTLVELVYLRISQINN.CAYCL...DTHTRD..LL.KKGVKI-----------------------------------
Q81CE2_BACCR/28-111ALTKREKQLIALGISLATQ.DEYCT...IYHTKG..CL.DQGCSD-----------------------------------
Q89CI6_BRADU/13-94GLPEKLLELVHLRASQING.CSVCV...DMHPKI..AR.KAGETD-----------------------------------
YJ81_YEAST/199-283ILSAQETSLVIIASLVPQD.VNP..Q.LRGHLKG..AL.NIGCDK-----------------------------------
P73604_SYNY3/23-107LIDQKTKALIVIAVDVANQ.TLS..GPFQAHVDM..AL.KQGATK-----------------------------------
Q81RU7_BACAN/19-103TLTLRERSLCTVSVLISLG.NTE..Q.LPFHLRL..AK.QNGIKE-----------------------------------
Q89CP9_BRADU/40-125PLSLRQREIVIDRTCALSK.CEYEW...GVHVAV..FAGPARLTE-----------------------------------
YDFG_BACSU/12-94SINRTTRELIKIRVSQMNG.CAFCI...DMHTSD..AR.KMGETE-----------------------------------
Q828B2_STRAW/38-123.LAPRDRQLVTLGMLTALGGCEV..Q.LEVHVNA..AL.NVGLSP-----------------------------------
Q89RQ0_BRADU/34-116KLDPRLRELAILQVGWMER.SEY..E.FTHHVKI..GK.EFGVTD-----------------------------------
Q82A02_STRAW/34-115.IDPALVELIQIRASHLNH.CAYCL...HMHTND..AR.KAGESE-----------------------------------
Q89D50_BRADU/12-94.LEQSLIELVKTRASQING.CAFCI...NMHTED..AR.KRGETE-----------------------------------
Q82HT0_STRAW/32-114GLDPKLRELVKIRASQLNH.CAFCL...DMHTKD..AL.AAGESV-----------------------------------
Y1053_HAEIN/24-107VLDAKTRELIALAVAVTTR.CESCI...SAHAEE..AV.KAGASE-----------------------------------
Q8E1D2_STRA5/17-102HLTDKTRSIITISALISGG.NLE..Q.LEHHLQF..AK.QNGVTK-----------------------------------
Y742_METJA/19-103TLDYKTQKLIAIGIVASRC.DEVAI...EKQMKS..AMKELGITK-----------------------------------
AHPD_STRAW/94-177GVEKVDFELWSLAVSAVNG.CGQCL...DSHEQV..LR.KAGVDR-----------------------------------
Y1511_METJA/18-101KLDEKMQRLVLLAVVATLG.DEKAV...KRQTKK..LM.EMGATI-----------------------------------
Q7MJJ5_VIBVY/55-138KLTARQRELVALAVGQANA.CQYCL...SAHTLI..AS.STGLTK-----------------------------------
Q89SZ5_BRADU/50-134KLSAVNRELLILQAAQLEG.GAYEW...RQHVPI..AL.GVGCTQ-----------------------------------
Q7NI16_GLOVI/40-125.ISDELKELISLRVAQINSCRDYCV...PMHTYM..LH.KQGTVE-----------------------------------
Q82MF4_STRAW/285-369TLTRRERSMITLTALVAHG.HYD..E.LALHVRA..AR.RNGLTP-----------------------------------
Q7NMU5_GLOVI/47-129.LDPKVLDLIKIRASQLNG.CAFCL...DMHTTE..AR.KAGEAE-----------------------------------
Q89F01_BRADU/58-143GLPRAERELAAAATSRYNG.CIYCA...SVHARF..AS.TYSKRR-----------------------------------
Q7NSY1_CHRVO/13-97ALSPRERSLITIAALLGQS.RPHAL...AFHLRR..GR.DNGLAA-----------------------------------
Q82MM5_STRAW/103-186RLDPDLKALAEMTAAATIG.CAWCM...DFGYWV..SR.ERGMAR-----------------------------------
Q7NX57_CHRVO/41-125KLSAGLRERIALAVAEFNG.CDYCL...SAHSYL..AKHVAKLGD-----------------------------------
Q7NXV7_CHRVO/15-94.LDHALLELVKTRVSQLNG.CAFCI...DMHTKD..AR.AAGETE-----------------------------------
Q82PT4_STRAW/14-96TLPAATQELVKIRASQING.CGFCT...DMHTKD..AT.HAGETS-----------------------------------
Q7P0I8_CHRVO/10-92GLGLPLIELAYLRVAQLNG.CAFCL...KLHSQA..LR.RRGESQ-----------------------------------
Q89I69_BRADU/24-107ALDKKTKELMALALGVAAH.CDGCI...GFHTEA..LV.KLGATR-----------------------------------
Q7P1X7_CHRVO/26-109ALDKKTKELIALALGVAAR.CDGCL...GFHAQA..LV.KLGASK-----------------------------------
Q82QS6_STRAW/57-140RLPARLRELLILRTSCNTG.TRYEW...GRHLTL..AK.AAGVTD-----------------------------------
Q89UN1_BRADU/34-118.LPRKTRSMLNIAMIAILN.RQH..E.FRAHLKG..AL.TNGVTR-----------------------------------
AHPD_COXBU/96-175GIDKKDFELYSLAVSAING.CGLCI...DAHANT..LI.KAGFSK-----------------------------------
Q89IH0_BRADU/35-120HFDERTRRVLVIGTMVALG.QWD..E.FRLHVRA..ALAEGGFTP-----------------------------------
Q89IL8_BRADU/43-126ALDPKVKEMLYAAVSVAHG.CSYCI...HSHTAG..AR.AKGMTE-----------------------------------
Q7ULD6_RHOBA/54-137ALTAKQRERIALAVGQANS.CDYCL...SAHTAL..GK.MSGLTA-----------------------------------
Q7UPD1_RHOBA/39-122PLNDREVALVKLAISLGAG.LEGAA...HSHCRK..AL.EAGCTP-----------------------------------
Q89XS3_BRADU/55-139GLSPAERELGALSASVVNR.CIYCA...AVHASR..FI.SYSGRN-----------------------------------
Q7USN7_RHOBA/41-121DLPAKYRELAYYKASQLNS.CDYCS...HYHRQA..AK.KAGLSD-----------------------------------
Q89LE4_BRADU/50-134.LAPRDRSIVTLAALIARN...QTIE.MPYHFNL..AL.DNGVKP-----------------------------------
Q7UTX7_RHOBA/162-245NLNATERQIIAMTNNRLNG.CEYCM...AAHTSI...M.QSLKVP-----------------------------------
Q7VG56_HELHP/77-162ELNLQEREMITLSSLLTAGGCEA..Q.LEVHINA..AL.NVGISK-----------------------------------
Q89LE4_BRADU/177-261.LAPRDRSLVTVSALIANG.QMA..Q.LTPHLNR..AM.DNGLTQ-----------------------------------
Q7VG63_HELHP/82-166KLELKEGLMITLASLVAIP.ALS..E.FKAILNA..AL.KNGVEP-----------------------------------
Q7VG63_HELHP/216-301GLPLKFRELLTFVYILSMG.GAD..SQVRAHIAG..NI.RVGNDR-----------------------------------
Q87FG9_VIBPA/24-106.LSNKERAIVPIAAFTASG.DVE..K.LKISLND..GL.ESGLTI-----------------------------------
Q87FG9_VIBPA/158-243LLTWKQREIATIAALANIK.GVN..SQLAAHYNI..SM.NNGVSA-----------------------------------
Q7VTI6_BORPE/91-170GVDKKRFELFALAASIIGK.CHFCV...QSHYEN..LK.KDGLTV-----------------------------------
Q8A7Y1_BACTN/178-261NLDTKTRLMVTLASNIASQ.AQT..E.YRMMLES..AL.NAGITP-----------------------------------
Q7VW83_BORPE/12-94SIETSIRDLVDIRASQING.CTFCL...DMHVKE..AT.MHGERP-----------------------------------
Q87H24_VIBPA/33-118.LDLKSREIATVSALTAMG...NCTPQLKVHLHA..AL.NVGCTE-----------------------------------
Q7W0B6_BORPE/40-124.LERKTRSFLNLAMLIALN.RPN..E.LRLHLRG..AI.NNGVTK-----------------------------------
Q87WR5_PSESM/34-118.LPLKTRSLITLAALTALK.CPQ..E.LKGHVRG..AL.NNGCTV-----------------------------------
Q8A7Y1_BACTN/311-396GLDVKTRELLTFSILVSLGGCESQV...KGHIQG..NV.NVGNNK-----------------------------------
Q87XC8_PSESM/23-106HLDAKTRELISLAVAVTTR.CDGCI...AFHAAE..AK.KLGVTS-----------------------------------
Q89M11_BRADU/16-98.LDKQLLELVKLRASQING.CAFCV...QHHILL..SE.RIGVPV-----------------------------------
Q881M4_PSESM/43-127ELSPRDRSLATVAVLVARG.QSA..E.LAAHADL..AL.KNGVTP-----------------------------------
Q881M4_PSESM/170-254.LAPRDRSLITVTTLVANG.QVA..Q.IGYHLNR..AM.DNGLTQ-----------------------------------
Q8DV36_STRMU/17-102DIDLKMRCIITVVALMSSG.VTD..SSLVYHLQN..AK.NNGVSK-----------------------------------
Q89N13_BRADU/21-105LIPPKYRELISLAVALTTQ.CAYCL...DVHTAQ..AA.KAGATR-----------------------------------
Q881R7_PSESM/57-141GLSRAERELASTVVSRINR.CVYCA...SVHAQR..FE.QLAKRN-----------------------------------
Q89NA9_BRADU/36-119ELDPVVRELAITRTGILCE.APYEI...VAHKRI..GK.NVGVTD-----------------------------------
Q88GS0_PSEPK/34-118.LSLKERSMINLAMISALN.RPH..E.LKLHIRG..AL.RNGLSR-----------------------------------
Q8A8P6_BACTN/142-227.LDWRTRELSTVAALSVLD.GVK..NELNTHIAH..AK.HNGVTQ-----------------------------------
Q8EKK9_SHEON/33-118.LDLKTRELVTVAALTALGHCQP..Q.LNVHING..AL.NVGCTP-----------------------------------
Q8EMR2_OCEIH/26-109KLSVKQKELIAVAVAHITG.CPYCI...ELHVGN..VK.KQGADK-----------------------------------
Q8EMR2_OCEIH/135-218KLTVKEKELIAVASAHTTG.CAYCI...DLHTKN..AK.KAGASK-----------------------------------
Q8EWL7_MYCPE/18-103QLSLKNRSMITIASLMSQG.LFP..Q.LKSHFII..GK.ENGITK-----------------------------------
Q8FN18_COREF/270-361GVGRAEREIAATVTSRFNG.CVYCA...SVHAGR..SVEEAPERL-----------------------------------
Q8FN50_COREF/40-124.LDHTQRRLLTIAILTAVG.NHG..E.LDMHIRA..AL.RAGVDS-----------------------------------
Q8FN71_COREF/14-100DLPESLIELVSVRVSQING.CGTCL...SIHVPA..AR.RAGVPE-----------------------------------
Q8FQN1_COREF/33-119.LELRDRQMLNMAALAAMG.GVE..PQLTGHIKT..AVDVAGMSR-----------------------------------
Q8KL13_RHIEC/51-135.LDRRARSILNLGMIAVLN.RPH..E.LRGHIRG..AI.NNGVTK-----------------------------------
Q8NLN6_CORGL/20-105KIPRNYTEMIALAVAFTTQ.CAYCI...DIHTAA..AK.KEGVTT-----------------------------------
Q8NMX8_CORGL/269-355GLGRAERELGATVTSRYNG.CVYCA...SVHAGR..AQ.EESGRA-----------------------------------
Q8NN44_CORGL/15-100DLPTSLIELVNVRVSQING.CGTCL...SLHVPA..AR.RAGVPE-----------------------------------
Q8NRJ9_CORGL/17-103ELSPRDRSIVIVTMLMASG.VLD..SAFESHVQR..AK.DNGVTA-----------------------------------
Q8PBZ0_XANCP/31-114ALDVKTKELLGLVASMVLR.CDDCI...SYHVAQ..CK.EAGVTR-----------------------------------
Q8PDG7_XANCP/35-119.LPAHTRSLLTLAMMVALG.CDE..E.FKLHVRA..AR.NNGVTA-----------------------------------
Q8RCV6_THETN/21-104ALSAKEKELIALGIAVAIR.CSYCI...LAHVNS..AL.QAGATK-----------------------------------
Q8TN24_METAC/40-121RLSPRDRELAILRVALRTE.CEYEW...ANHSLG..AL.GAGVTG-----------------------------------
Q8TNJ6_METAC/14-97GIPLKYKFLIAMALDAANG.AVDGVKVLAIQ.....AM.EAGATK-----------------------------------
Q8TP59_METAC/27-113GLSMKQKHLMVFAIACSNN.NIESA...VKILER..LK.KFEATR-----------------------------------
Q8TTM1_METAC/27-111NLDTKTRMMVILGSLIASQ.TLS..E.YKVMLGG..AL.NVGVTP-----------------------------------
Q8TXW6_METKA/29-113PLDDKTKHLIALALAAAAG.DERRV...GLIAET..AKNVAEVTD-----------------------------------
A9CKY5_AGRT5/48-130RLPLQDRELIAVVVSATNG.CGVCE...IHHTRA......FGDLL-----------------------------------
A9CKY7_AGRT5/64-149HLSASERELIAVVTSVATG.CSYCVFNHRPALAA..AL.GDRVLA-----------------------------------
A9CIC5_AGRT5/44-127ALDPLVKEMLYIAVSVTNG.CSYCA...HSHTAA..AK.AKGMTN-----------------------------------
A9CLJ3_AGRT5/34-118ALDLKQRSLLNLGMLAALG.RMH..E.FRIHFRG..AL.RNGLTE-----------------------------------
Q8XQ14_RALSO/17-101.LSPRDRSLITVASLIALY.RTN..E.LPFHLKK..AL.DNGLRR-----------------------------------
Q8XX67_RALSO/35-119.LPRHTRSLLTIAMMVALN.RDG..E.LRLHLRA..AA.NNGVTR-----------------------------------
Q8XYW1_RALSO/93-173GVDKRRFEMYALAASIVGK.CHFCI...QSHYAQ..LKRHQDMTT-----------------------------------
Q8Y1Q8_RALSO/21-105.LQPRDRAIVTLSVLVSRN.ASN..A.YDHYLNK..AL.DSGLKP-----------------------------------
Q8Y1Q8_RALSO/150-234.LATRDRALATIASLAAQG.QAD..V.LPTYLER..AL.ASGVTK-----------------------------------
Q8Y972_LISMO/15-97KLDKKTEELAYIAVMAATR.LESGL...PFHVKM..AK.SNGATR-----------------------------------
Q8YLD1_NOSS1/42-125ELDPLVRELIYIAVSVTNG.CDYCI...SSHSAA..AR.GKGMNE-----------------------------------
Q8ZSI6_NOSS1/44-126SFTPIEQQVIYLTANYEHD.CRYCM...AAHSGL..AK.MIGMTP-----------------------------------
Q92S80_RHIME/12-94GIEPRLIHLIKLRASQING.CAYCV...DMHTKE..AR.HSGLSQ-----------------------------------
Q92XD0_RHIME/12-93SLESSLIELVKIRASQING.CANCI...NMHTAE..AR.AKGESE-----------------------------------
Q930M4_RHIME/49-134.LDLRTRQILTAATLLAHG.SAQ..SQLSFHLYG..LL.NAGGTR-----------------------------------
Q930M4_RHIME/170-255HLEPRLAHLASAAMLAARG.KVG..ASFDAHIVS..AL.AAGATD-----------------------------------
Q930M4_RHIME/308-395.LDPKVRELGAISALAAQG.TVAAEKPLGVHIDA..AL.NLGATP-----------------------------------
Q97UW0_SULSO/43-128VIPKKIRSLINIGILSCLN.RQN..E.LKLHVKG..AI.RNGCTE-----------------------------------
Q984R0_RHILO/14-98ALPPKVKSLISLAVAAQIP.CNYCV...WSDTQD..AK.RAGATD-----------------------------------
Q987X0_RHILO/12-95SLEHSLTELVKLRGSQING.CANCI...NLHASE..AR.ENGETE-----------------------------------
Q98BX3_RHILO/57-141ALDGKTKELMGLAVASQIP.CQYCI...YFHTEA..AK.LNGASD-----------------------------------
Q98JY9_RHILO/46-129AIDPLTKEMIYIAVSTANG.CSYCV...HSHTAA..AR.AKGMTD-----------------------------------
Q98K47_RHILO/12-94GLEISLLHLIKLRASQING.CSFCV...EMHSRE..AR.RDGETE-----------------------------------
Q98L97_RHILO/13-95.IPYVTRKLIHLRASQINA.CSLCV...DMHARE..LK.KAGEKD-----------------------------------
AHPD_CAUCR/95-178GARGVTYDLSCVAVSAING.CGACL...DSHEAD..LR.GRGVEP-----------------------------------
Q9A3V6_CAUCR/52-136KLDPVLRELAQTRAGWARG.SQF..V.FSQHCKS..LR.GLGVSE-----------------------------------
Q9A5N6_CAUCR/302-387.LDHRTRRLLVLAICASLA.RWE..E.FRLHVRA..GLEQGGFTQ-----------------------------------
AHPD_BRADU/95-178GVDKSDFELWSLAVSSING.CGICI...DAHERT..LR.AAGVNS-----------------------------------
Q9CB37_MYCLE/51-135KLPRVDTELVILRVAHLRT.CEY..E.LQHHRRM..ARKRGLDTK-----------------------------------
Q9CE69_LACLA/31-116VLNFKDRELITITSLLTQGGCEN..Q.LRVHIQA..SL.NVGLTQ-----------------------------------
Q9CFE3_LACLA/16-101ELSAHERSVITITALIAGG.NFE..Q.LNFHMAK..GK.ENGISQ-----------------------------------
Q9FC57_STRCO/14-95ALPVATQELVKIRASQING.CGFCT...DMHTKD..AA.AAGEDQ-----------------------------------
Q9HLI4_THEAC/22-105SLDVKTKELIALSLSLALQ.CEWCI...PYHTAK..CL.EAGCSE-----------------------------------
Q9I1E7_PSEAE/38-118SLGLPEREVVQLVAATTHG.CDFCV...AGHTAV..AR.NKARLP-----------------------------------
Q9I5X1_PSEAE/24-106ALDAKTRELISIAVAITTR.CDGCI...GVHTEA..AL.KAGASE-----------------------------------
Q9I6M1_PSEAE/12-94.LERPLIELVYLRTSQING.CAYCV...NMHAND..AR.KAGETE-----------------------------------
Q9K796_BACHD/28-111ELSQKQKQLIALGVSVFAQ.DEYCI...IYHTKG..CM.DQDCSE-----------------------------------
Q9KXX7_STRCO/38-123HLDLRTRALISVTITASLG....ILEPLRGQLRI..AL.HNGVTK-----------------------------------
Q9KZB1_STRCO/28-109GLDPALYELVKIRASQINH.CAFCL...DMHTKD..AL.AAGESV-----------------------------------
Q9KZB2_STRCO/10-92LGDPVLAELVMIRASQLNH.CAFCL...DMHLAL..AR.KNGEGE-----------------------------------
Q9PCL2_XYLFA/167-252.LDWQSRELATVGMLSALPGAES..Q.LQAHMRI..SM.NVGLTA-----------------------------------
Q9RDI4_STRCO/14-96ALPQSTQELVSLRASQING.CGHCI...DMHVKE..AA.AAGESA-----------------------------------
Q9RJG5_STRCO/31-117GLDRILVELVNIRVSQLNA.CAYCL...NAHTRA..AL.RGGETT-----------------------------------
Q9RTJ7_DEIRA/77-160GLSNAERELLAVVVSGLNR.CVYCA...VSHGAA..LR.EFSGDA-----------------------------------
Q9RV26_DEIRA/68-152GLTDRERHMVTIGILAALG.REK..E.LAGHLRA..TA.NTGVSE-----------------------------------
Q9RVP9_DEIRA/30-114.LDLKTKELLASVLLVSLG.SPD..E.LKTHLRG..AL.RAGATE-----------------------------------
Q9WYF2_THEMA/12-95SIPAKYKVLAALAIAVVEK.CKPCA...QGYYQK..AI.EMGATK-----------------------------------
Q9X1V5_THEMA/22-105KLDVKTKELMGLVASTVLR.CDDCI...RYHLVR..CV.QEGASD-----------------------------------
A1B484_PARDP/43-125.LDAKTRLLLTIGAITVQG.ALAEPQ.LRMTVRQ..AL.AAGATK-----------------------------------
A1B485_PARDP/37-120.LDLKTRLLVTVGALAAMG.GQTRPQ.LKVNVAS..AL.RAGASA-----------------------------------
A1B6G6_PARDP/25-103ALDKRTKQLIAVAVAHVTQ.CPWCI...EGHVKG..AR.REGATN-----------------------------------
A9WCB6_CHLAA/49-136NLSKAEKEMIVVATSAAND.CLYCV...IAHGAI..LR.IRSKNP-----------------------------------
D5ATI8_RHOCB/41-126.LDARTRLLVTLAGQVTLG.AQAEAP.IRLTIRH..AL.EAGATE-----------------------------------
F3Z5J5_9ACTO/59-139TFDARTREAIALAVGAVDA.CAYCQ...AAHTVS..AK.AAGFTP-----------------------------------
Q0SH24_RHOSR/298-378.LDHELRRLLTIAVLTAVG.NEHEL...DMHIRA..AL.RAGVDA-----------------------------------
Q0WB04_YERPE/37-118ALTFKTRSMLNIGILTAMG.QHHEL...SLHVKG..AL.RNGVTR-----------------------------------
Q1LKT1_RALME/24-106ALDAKTKELIALAIGVAAR.CDGCI...GFHAKA..LV.KLGATA-----------------------------------
Q2YKQ5_BRUA2/43-126.WSKRERSIVTIALLAALG.QDDEV...AMHIRA..TR.NTGATK-----------------------------------
Q32CQ3_SHIDS/13-94TLDTTLMELIYLRVSQING.CAFCL...EMHSKA..LR.KSGVPQ-----------------------------------
Q74U89_YERPE/50-134.LSKRDRSLVTVSALVAMD.RPDQL...RSHLRL..AR.QNGVTE-----------------------------------
Q79ZI9_STRAW/42-127GLDRVLVELINLRVSQING.CAYCL...SLHTKA..AL.RVGETT-----------------------------------
Q7CV78_AGRT5/40-122HFTKRERSIVTIALLAALG.QDEEL...AMHVRA..TV.NTGATE-----------------------------------
Q7VSA2_BORPE/23-105QLDAKTRELIALAVAVTTR.CDGCI...AVHAKA..AT.DNGATK-----------------------------------
Q7VYW3_BORPE/12-94GLEHSLLELVKMRASQING.CAFCL...NLHYTE..AR.RQGESE-----------------------------------
Q8TL87_METAC/31-112ALPAKVKIMIALAVVASKQ.CERCT...VVQMQS..AL.KNGATK-----------------------------------
S5V223_STRCU/22-98AVPRRYRELISVAVALVTQ.CAYCL...DVHTAA..AR.RHGVTA-----------------------------------
V9VWJ7_9RHOB/37-119.ISLRERSMLTLALLAATG.NFDEI...PMHIRA..TA.RTGASQ-----------------------------------

PF04636

H9GH47_ANOCA/62-498KALLKTG.ENS....WSLAELIQALVL-LTHYH----SLASFV--FGCGVNLESDPEAPHAGQ....APSPL........
W5LN19_ASTMX/16-447QELVCPGADPR....WSLAELIQAVVL-MSHAH----SLASFI--WGCGIHPEPDSTAEQHPP....SASPA........
H3BCQ9_LATCH/18-462ERLLKAE.EHS....WSLAELIHAVVL-LTHYH----SLASFA--FGCGISPEIHTEGGHTFR....PPSVS........
F1R1P4_DANRE/28-465QALVKTG.EHS....WSLAELVHAVVL-LAHFH----ALASFV--FGSGVNPDPEVTEVNGVTGDLCPPVMK........
A0F081_DANRE/15-443QELVCPGAEAR....WSLAELIQAVVL-MTHAH----SLASFV--WGCGIHPEPEQTEDQTLQ....PCSPT........
B4NMK7_DROWI/5-489ERLTKG..KNS....WSLSEVVHAMVL-LSHFH----SLSSFV--FSCGLTQKLDGLSSPKLK....SAPAEIAPNGNGV
Q28ZG4_DROPS/4-508ELLTKG..INS....WSLSEVVHAMVL-LSHFH----SLSSFV--FSCGLTQKLDGLSSPKLK....SAPATLG......
F7HTF1_CALJA/47-491EGLLKAE.EHS....WSLAELVHAVVL-LTHYH----SLASFT--FGCGISPEIHCDGGHTFR....PPSVS........
A7SCG7_NEMVE/102-542EKLLKG..EDN....WSLSELVHAIVI-MAHIH----ALSSFV--YGCGVVPEIDSENGHTFK....PPTLT........
F7HY37_CALJA/43-479QALLKTG.EHT....WSLAELIQALVL-LTHCH----SLSSFV--FGCGILPEADADGSPATQ....APTPP........
W5MLE5_LEPOC/40-480QKLVKTG.ENS....WSLAELVHAVVL-LAHFH----ALASFV--FGSGINPEVD...SDNFQ....RTTVN........
E9C869_CAPO3/294-722RTLLRG..QDS....WSLAELVQAIVV-LTHFH----SVSAIA--AGAGLTPEVDLEGGHLFA....TESER........
Q7PTB1_ANOGA/4-440ERLTKG..QNS....WSLSEVVHAIVL-LAHYH----SLSSFV--FSCGLTQELDGASHKIEN....NNVLTQK......
G1U329_RABIT/39-491QKLVKTG.ENN....WSLPELVHAVVL-LAHYH----ALASFV--FGSGINPERDPEISNGFR....LISVN........
C3XTE9_BRAFL/48-481EQLLRG..NDS....WSLSELVHAIVL-LAHFH----SLASFV--FGTGINLEIDHECGHTLQ....PASLS........
I1FVV2_AMPQE/119-585QELLVG..PDS....WSVAELVHAVVI-MAFFH----ALAGFC--LGCGLNPEIDTELGHTVS....DQSEIVPSHF...
I3J1U7_ORENI/91-527QELVCPGAEPR....WSLAELIHAVVL-MAHAH----SLCSFV--WGCGLNPEPDHIGGYTFQ....PPSLS........
W5KLV4_ASTMX/20-439QALLKPG.EQC....WSLAELVQAVVL-LAHCH----SLCSFI--FGSA..AETDTAPSQRVP....HGTPP........
B4MDV6_DROVI/4-484ERLTKG..RSS....WSLSEVVHAMVL-LSHFH----SLSSFV--FSCGLTQKLDGLSSPKLK....GAPVSMPPQ....
A8WVR0_CAEBR/66-543AVLITRRSPDGGPAFFSICSLHHAIGI-MSMTH----AMCTVV--CCIGLERRVDLTQE.....................
K1Q3S5_CRAGI/175-609EGLR....KEA....WSVSELVQAIVI-MAHFH----ALSSFV--FGCGIKNEPDHHGGFTYR....PHSPT........
U3K820_FICAL/39-467EALLRPG.EDS....WSLAELVQALVL-LTHYH----SLASFV--FGCGIKPEEEQDG.........APSPH........
F7ARK8_MONDO/41-477EALLTTG.EHS....WSLAELIQAVVL-LTHYH----SLASFV--FGCGILPEGDPEGNPSLQ....VPSPS........
W5NCK4_LEPOC/20-441EALLKIA.EQC....WSLAELVQAVVL-LAHCH----ALASFV--FGAGLEQDTPEPPGLA...................
F4Q7E9_DICFS/150-592EYLVKG..QDA....WSIAELVHAMIL-ICTFL----SLAGFV--FSCGILPEYGLASTTTLD....ERTSF........
B4QAY3_DROSI/4-496ERLTKG..KNS....WSLSEVVHAMVL-LSHFH----SLSSFV--FSCGLTQKLDGLSSPKLK....SPPAAVG......
H2ZKE8_CIOSA/218-659KNLTEGEPSTR....WQHSHLVQVVVL-LCHFH----SIAIFC--HGAGVNLELDHPRAHAFH....TTTST........
H3BCK5_LATCH/13-462EALLTTG.ENS....WSLAELIHAVVL-LTHYH----SLSSFV--FGCGINPELDHEGGHSFR....PPSPR........
H2RRP9_TAKRU/38-481EQLVKAE.EHS....WSLAELIHAVVL-LTHYH----SLASFT--FGCGIMPEIHSDGGHTFR....PPSLS........
W5MCN8_LEPOC/98-536EALVRPG.GEG....WCLAELIHAVVL-LTHYH----SLSSFV--FGCGINPEPDHEGGHAFR....SPSPH........
H3ALF1_LATCH/44-502ESLLKIE.EQC....WSLAELVHAVVL-LAHYH----ALASFV--FGSGCDQEDRPDSRNLFK....IPLVPLG......
G3PXZ5_GASAC/8-439QALLKSG.EQC....WSLAELVQAVVI-LAHCH----SLCSFV--FGCDTDTDADFVPSSKSP....NGVPP........
SESN_DICDI/138-598EYLVKG..TDA....WSIAELVHAMVL-ICTFL----SLSGFV--FCCGISPECGLSESNNLS....SSF..........

PF02627

Q930A6_RHIME/29-113---------------...SEISETITH.LAYYS....GWGKAM..ATVGPVSE---------------------------
Q930A6_RHIME/156-240---------------...EQAAEVITH.LAFYA....GWPNAM..SALPVAKA---------------------------
Q8KL33_RHIEC/44-128---------------...EEIREVFLQ.VSIYC....GVPAAI..DSFRVAAE---------------------------
DC4C_ACIAD/35-119---------------...DELKELILH.CSLYA....GLPASN..AAMHMAEE---------------------------
Q7D077_AGRT5/19-101---------------...EDIISAVLT.GLPAA....G.NAVI..GALGPALD---------------------------
Q7D1C9_AGRT5/12-94---------------...QWINLMSVW.RESPV....YTEQER..ALLGWVDA---------------------------
O06218_MYCTU/45-127---------------...TAAA.ILAG.TAPAA....GDPNAP.YVAWAAGTG---------------------------
O06800_MYCTU/26-109---------------...QEAAEAIGV.TILMH....GGPATI..HGARAYAA---------------------------
Q88GS9_PSEPK/72-155---------------...QEVVDALRA.RGEL.......PNAR.YETLAAFAR---------------------------
O26169_METTH/26-109---------------...DEILLAILI.GASMA....ESTALS..RSLRVFKE---------------------------
O26336_METTH/31-115---------------...DEIIEVMIQ.MAVYA....GFPAAI..NAVLAAKE---------------------------
O26787_METTH/36-120---------------...DEIVDVLRV.VLLTS....GNPPFV..KAMRILYE---------------------------
O27018_METTH/13-96---------------...GELAEAAAV.AALIR....AGSAMN..TASAIFRD---------------------------
O29899_ARCFU/36-119---------------...REIGEAILV.ARFAL....ASTIFA..TVTPALEW---------------------------
Q8DUG8_STRMU/42-124---------------...PDLLEALRN.ATPID....DDPKLD..TLAKFTIA---------------------------
O30263_ARCFU/32-115---------------...EPLNEREKA.ALSFA....AKIAIT..KGKLEDEE---------------------------
YURZ_BACSU/32-115---------------...ENILEAVSV.AAAFG....GGAAFS..QGVTVVQQ---------------------------
Q88K69_PSEPK/28-111---------------...EEIAEALGV.AVAMN....AGAALV..YSARAMDA---------------------------
O53749_MYCTU/49-133---------------...NTQATIFAWPDVPDG....DGPRKV.LSARQQALL---------------------------
O53905_MYCTU/40-123---------------...DDLLGVRDW.QGYNG....FGPAEQ..AVLAATDD---------------------------
Q89PM8_BRADU/34-118---------------...REIIDVFRL.ATVQ.....GLDGCN..LGIGILAE---------------------------
Q88N35_PSEPK/35-119---------------...DEIKEVLMQ.SAIYC....GIPAAN..ATFHLAES---------------------------
O69814_STRCO/47-126---------------...ERLAGGLEP.ADERH....A.......RVLDWARR---------------------------
Q8DKG6_THEEB/35-118---------------...EEIMETLMV.TVAMD....GGPALM..YATHVLEA---------------------------
O86608_STRCO/355-439---------------...GEIKEVLLQ.AAVYC....GVPAAN..GAFRVAQQ---------------------------
Y4147_CUPNH/24-107---------------...EQLAEVLAI.NIEMG....GGPGAM..YASKALAY---------------------------
Q89PR3_BRADU/12-94---------------...EKIALVQAW.KEAGA....LFDERE..RAALAWAE---------------------------
Q81CE2_BACCR/28-111---------------...KEILEACGV.SAAFA....GGAAMS..QAVTLVQE---------------------------
Q89CI6_BRADU/13-94---------------...ERLFAVSAW.RDAPY....FSEAER..AALALTEA---------------------------
YJ81_YEAST/199-283---------------...ETVEAVRGL.AILIS....QWCGVS..WKSGVVKL---------------------------
P73604_SYNY3/23-107---------------...EEIEEVLSF.MCVYG....GFNKAA..GAFAALKE---------------------------
Q81RU7_BACAN/19-103---------------...NEMIALITH.MAFYV....GWPKAV..SAFLSLFM---------------------------
Q89CP9_BRADU/40-125---------------...EEVRATVEG.DATSA....CWSLDE..QALIAAVD---------------------------
YDFG_BACSU/12-94---------------...QRIYCLHAW.NECDF....YSPEEK..AALELSEH---------------------------
Q828B2_STRAW/38-123---------------...DEIVEALLH.SAVYC....GIPKAM..NASLVAKK---------------------------
Q89RQ0_BRADU/34-116---------------...EDIA...GL.MAETE....GKPSKLEPLARAVLKG---------------------------
Q82A02_STRAW/34-115---------------...DRLHMVAVW.REARH....FFTPKE..QAALALTE---------------------------
Q89D50_BRADU/12-94---------------...QRLYLLNAW.RESPL....YTDRER..AALAWTEA---------------------------
Q82HT0_STRAW/32-114---------------...ERVVQLSAW.DESRH....FYTEKE.LAALELTEA---------------------------
Y1053_HAEIN/24-107---------------...AEVAAALAT.AIALN....AGAAYT..YSLRALEA---------------------------
Q8E1D2_STRA5/17-102---------------...EEIADIITH.LAFYV....GWPKAW..SAFNKAKE---------------------------
Y742_METJA/19-103---------------...EEIADVLRV.VLLTS....GMPAFT..KAMKILEK---------------------------
AHPD_STRAW/94-177---------------...DTIQEAFKI.AAVIQ....AVGTTL..DAEAVLAE---------------------------
Y1511_METJA/18-101---------------...EEIQDVMKV.VYIGA....GMPRFI..KAVEAILE---------------------------
Q7MJJ5_VIBVY/55-138---------------...GEIVAARKV.EADNS....VDQAIV.EFAALAVTQ---------------------------
Q89SZ5_BRADU/50-134---------------...AQIDAVERS.DYDAA....GLSEAE.RALLKFGRE---------------------------
Q7NI16_GLOVI/40-125---------------...EKIRALPRS.ATSDL....YSEAEK..VALEYAER---------------------------
Q82MF4_STRAW/285-369---------------...EEIGAVLLQ.TAVYC....GVPAAN..SAFAVAQR---------------------------
Q7NMU5_GLOVI/47-129---------------...QRLHALAAW.REAPF....FSPTER..AALAFGEA---------------------------
Q89F01_BRADU/58-143---------------...DDVQRLLDE.GVEAD....LGERWN..AVVKASVA---------------------------
Q7NSY1_CHRVO/13-97---------------...DELAEVVTH.LAFYV....GWPSAT..AALEQLDA---------------------------
Q82MM5_STRAW/103-186---------------...EKLLDVPSW.RDSAA....YTPLER..DVMEYAEA---------------------------
Q7NX57_CHRVO/41-125---------------...DEIAAARDF.ASADA....RQAAAL.RFARQVAEQ---------------------------
Q7NXV7_CHRVO/15-94---------------...QRLYLLSAW.REAPC....YTERER..AALAWAEA---------------------------
Q82PT4_STRAW/14-96---------------...TRLNLIAAW.REATV....FTDAER..AALELTEQ---------------------------
Q7P0I8_CHRVO/10-92---------------...EKLDQLAGW.DAADA....LSPREA..AAIAWTEA---------------------------
Q89I69_BRADU/24-107---------------...EEIEETLGM.AVYMG....GGPSLM..YAADAIAA---------------------------
Q7P1X7_CHRVO/26-109---------------...TEVEEALAM.AVYMG....GGPSLM..YSAHALAA---------------------------
Q82QS6_STRAW/57-140---------------...GDINRITEG.PEAPG....WTDLER..HLIRAADE---------------------------
Q89UN1_BRADU/34-118---------------...DEIREILMQ.VAIYG....GMPAAV..DSFRIARE---------------------------
AHPD_COXBU/96-175---------------...HSIQHVIRI.AAVLN....GLAQV......SIIEN---------------------------
Q89IH0_BRADU/35-120---------------...DDIKEILLQ.QAIYC....GVPAAN..HAVKEASA---------------------------
Q89IL8_BRADU/43-126---------------...AEYGELLAI.VGMAA....ETNRLV..TALGVPVD---------------------------
Q7ULD6_RHOBA/54-137---------------...SEILDARRG.KADDA....KAGAIL.AFANQVVAK---------------------------
Q7UPD1_RHOBA/39-122---------------...DDLRHVAML.SAPTI....GFPTMM..RAKSWVED---------------------------
Q89XS3_BRADU/55-139---------------...DIVEEIFAD.ERDAT....LEARQQ..ALFNFATK---------------------------
Q7USN7_RHOBA/41-121---------------...QQLD.SMNV.SSGDL....FDEKEQ..AVLKYAEQ---------------------------
Q89LE4_BRADU/50-134---------------...REISEIITH.LAFYA....GWANAM..SAVAVAED---------------------------
Q7UTX7_RHOBA/162-245---------------...DDVIESLRS.GTPIA....D.PKL...EALRVFAE---------------------------
Q7VG56_HELHP/77-162---------------...EKIIECLMQ.CIPYT....GFPKVL..NAVFVAKK---------------------------
Q89LE4_BRADU/177-261---------------...TEASEAITQ.LAFYV....GWPNVF..SAMPVAKD---------------------------
Q7VG63_HELHP/82-166---------------...VAIKEILYQ.ATPYV....GMGKVL..DFINATNE---------------------------
Q7VG63_HELHP/216-301---------------...GKLISVITA.LVPYI....GYPRSL..NALSALDE---------------------------
Q87FG9_VIBPA/24-106---------------...NEIKEVLAQ.LYAYA....GFPRSL..NGLAAFMD---------------------------
Q87FG9_VIBPA/158-243---------------...EELNDFILV.LKQCC....DESIAS..NAQSVLDS---------------------------
Q7VTI6_BORPE/91-170---------------...EQLRDAGRI.AAVVN....A.......AALALAAQ---------------------------
Q8A7Y1_BACTN/178-261---------------...IEIKEILYQ.AVAYA....GMAKVM..DFVGITNE---------------------------
Q7VW83_BORPE/12-94---------------...LRLHHIAAW.RESTL....FSPRER..AALAWTEV---------------------------
Q87H24_VIBPA/33-118---------------...EEIKEVIIQ.MSVYA....GFPAAL..NGMFAFKE---------------------------
Q7W0B6_BORPE/40-124---------------...DEIVEVVLQ.AAIYC....GVPAAL..DAMKAVRE---------------------------
Q87WR5_PSESM/34-118---------------...EEIREALLH.CAVYA....GVPAAI..DAFRAAQE---------------------------
Q8A7Y1_BACTN/311-396---------------...DTLLAVVTQ.LLPYI....GYPRTL..NAIACLNE---------------------------
Q87XC8_PSESM/23-106---------------...EEVAEALGV.AINMN....AGAALV..YSTHVLDA---------------------------
Q89M11_BRADU/16-98---------------...DKLNLVAVW.REAPI....YSARER..AALAWTEA---------------------------
Q881M4_PSESM/43-127---------------...LELSELINH.LAFYS....GWGNAT..QAAPIVKE---------------------------
Q881M4_PSESM/170-254---------------...TEASELLSH.LAFYA....GWPNAF..SAVPVFSD---------------------------
Q8DV36_STRMU/17-102---------------...KEIAAIITH.AAFYV....GWPKAW..AVFILAKD---------------------------
Q89N13_BRADU/21-105---------------...EEVAEAALI.AAAVR....AGGTLG..HALLAQRL---------------------------
Q881R7_PSESM/57-141---------------...DVIAQVFAD.PATAG....TTAREK..AIVQFAID---------------------------
Q89NA9_BRADU/36-119---------------...EQNEALENW.QAASC....FNEVQR..AALAFTDE---------------------------
Q88GS0_PSEPK/34-118---------------...EQIREILLQ.VGIYC....GVPAAV..DSFRLARE---------------------------
Q8A8P6_BACTN/142-227---------------...AQIDEVLIM.AARCR....NGMVLS..ESDEPAKT---------------------------
Q8EKK9_SHEON/33-118---------------...KEIVEVILQ.MSVYA....GFPAAL..NGMFVAKT---------------------------
Q8EMR2_OCEIH/26-109---------------...EEVTEAIFV.ATALK....AGSSLA..HGVNGLNA---------------------------
Q8EMR2_OCEIH/135-218---------------...DELSEAIFV.AVALK....AGSALA..HSVNALNA---------------------------
Q8EWL7_MYCPE/18-103---------------...QEAIEIVTQ.LAFYS....GWPKAW..SAFSLIKE---------------------------
Q8FN18_COREF/270-361---------------...DDVNALIDN.GVDADLGSDQWNVIR..DAARALTA---------------------------
Q8FN50_COREF/40-124---------------...ETIGETLLH.TAIYA....GVPNSN..HGFKLLND---------------------------
Q8FN71_COREF/14-100---------------...KKLDALPAW.RMVDE....YTAEEK..AALQLAES---------------------------
Q8FQN1_COREF/33-119---------------...EEVAECFVH.LMPYI....GVPKTL..AAMRCMKA---------------------------
Q8KL13_RHIEC/51-135---------------...QEIQEIFLQ.VAIYV....GVPAGI..DSFRHAQE---------------------------
Q8NLN6_CORGL/20-105---------------...EELAEVALI.AAALR....AGGAMT..HGALAMKL---------------------------
Q8NMX8_CORGL/269-355---------------...DDVNALLAS.IDSDL....GSDQWN..VIRDAARA---------------------------
Q8NN44_CORGL/15-100---------------...KKLDALAAW.QMVDE....FTVEEK..AALQLAES---------------------------
Q8NRJ9_CORGL/17-103---------------...EEIAEIITH.VAFYA....GWPKAW..AAFRIAKD---------------------------
Q8PBZ0_XANCP/31-114---------------...EEFFETFSV.GLVVG....GSIVIP..HLRRAVDF---------------------------
Q8PDG7_XANCP/35-119---------------...AQIKEVLLQ.AAIYC....GVPAAN..HAFALAQP---------------------------
Q8RCV6_THETN/21-104---------------...EEIMETLGV.AVLMS....GGPGVA..YATEAIKV---------------------------
Q8TN24_METAC/40-121---------------...TEIDALSSE.SASWS....DADAA....LLRAVDE---------------------------
Q8TNJ6_METAC/14-97---------------...DEVMETIRI.AQYIF....GVGSVY..TAAKALTD---------------------------
Q8TP59_METAC/27-113---------------...AEISDAMMI.AAWTG....GIQNFT.DFSVAVLKE---------------------------
Q8TTM1_METAC/27-111---------------...IEVKEIVYQ.SVPYV....GIAKIF..DFIHATNE---------------------------
Q8TXW6_METKA/29-113---------------...EEIAATLAL.VAWVE....GVSKVT..RTWGVLRQ---------------------------
A9CKY5_AGRT5/48-130---------------...NDPGFARRV.ALDYH....LADLSK..RQRALADL---------------------------
A9CKY7_AGRT5/64-149---------------...DRIA..RNH.NDVTL....A.PRER..ALADLAQK---------------------------
A9CIC5_AGRT5/44-127---------------...EQHADLMRV.IALAA....KTNQLA..VALQVPVD---------------------------
A9CLJ3_AGRT5/34-118---------------...AELRAALTQ.IAVYC....GIPAGV..EAFRAAQE---------------------------
Q8XQ14_RALSO/17-101---------------...DELIEAITH.LAFYS....GWPTAS..TALPIAQR---------------------------
Q8XX67_RALSO/35-119---------------...EEIQEVLLQ.TAIYC....GVPAAN..HAFHLAQA---------------------------
Q8XYW1_RALSO/93-173---------------...QQLRDVGRI.AAVIH....A.......AALVIAAE---------------------------
Q8Y1Q8_RALSO/21-105---------------...SELSELLTH.LAFYA....SFAYSF..GAVAVLKG---------------------------
Q8Y1Q8_RALSO/150-234---------------...EAIGELLAH.VAFYG....GWGNAI..QAASAVSR---------------------------
Q8Y972_LISMO/15-97---------------...DEIISAILV.GLPAV....GNTVI...SALPIALD---------------------------
Q8YLD1_NOSS1/42-125---------------...AMFGELLAI.IATAN....TTNRLA..NGYQIPVD---------------------------
Q8ZSI6_NOSS1/44-126---------------...EDIE.ALRH.GQPLA....D..QKL..QALRLFTK---------------------------
Q92S80_RHIME/12-94---------------...QWINLVCVW.RESPH....FDERER..AVLGWTEA---------------------------
Q92XD0_RHIME/12-93---------------...QRIYLLSAW.REAPC....YTDRER..AALAWTET---------------------------
Q930M4_RHIME/49-134---------------...ADVVDLLFI.SAGLL....GFPTAI..NAVPIVRD---------------------------
Q930M4_RHIME/170-255---------------...SDIVEMVIQ.LSVYS....GFPAAL..NAAGRARN---------------------------
Q930M4_RHIME/308-395---------------...EEIVETLFN.IIPYA....GYPLIE..KALLIAHD---------------------------
Q97UW0_SULSO/43-128---------------...EEIKEVLLQ.VGAYC....GLPAAM..DSFRIAQE---------------------------
Q984R0_RHILO/14-98---------------...EEIQEAVAM.AALTR....HWSTIF..NGMQVDFD---------------------------
Q987X0_RHILO/12-95---------------...QRIYLLPAW.REAPC....YSDRER..AALGWTEA---------------------------
Q98BX3_RHILO/57-141---------------...EEIKETIAM.AAIVR....HWSTML..NGSQVDLA---------------------------
Q98JY9_RHILO/46-129---------------...AQHGELVSI.IGLAG....QTNHLV..TAMQIPVD---------------------------
Q98K47_RHILO/12-94---------------...QRLYLVAAW.KESPL....FSERER..AAFAWTEA---------------------------
Q98L97_RHILO/13-95---------------...ERIFALAAW.RETPY....FTDAER..AALALAEA---------------------------
AHPD_CAUCR/95-178---------------...TQIQAALRI.AAVVS....AVARTL..AAEAALHP---------------------------
Q9A3V6_CAUCR/52-136---------------...DKIAAVPHW.SVSTA....FDAHER..AVLAYADG---------------------------
Q9A5N6_CAUCR/302-387---------------...DELKEVLMQ.IAIYA....GVPAAN..TAFTEAAD---------------------------
AHPD_BRADU/95-178---------------...ETIQTAVRF.AAITQ....SVAIAL..EAAGPASP---------------------------
Q9CB37_MYCLE/51-135---------------...IQAMIFAWP.DVPTG....AGLSVR.QQALLAATD---------------------------
Q9CE69_LACLA/31-116---------------...EEIIETFIH.YAPYV....GFPRVL..NAIFVAKE---------------------------
Q9CFE3_LACLA/16-101---------------...EEISEIITH.LSFYV....GWPKAW..SAFNIAKK---------------------------
Q9FC57_STRCO/14-95---------------...QRLNLVAVW.REATV....FSDAER..AALAVTEE---------------------------
Q9HLI4_THEAC/22-105---------------...DEMIEASYI.AAIMA....GTPALM..NVKIMADT---------------------------
Q9I1E7_PSEAE/38-118---------------...EPVIEALRA.RGELP....D.......ARYEALAD---------------------------
Q9I5X1_PSEAE/24-106---------------...AEIAQTLAT.AISLN....AGAAYV..YSLRALEA---------------------------
Q9I6M1_PSEAE/12-94---------------...QRLQALCVW.QETPY....FTPRER..AALAWTEQ---------------------------
Q9K796_BACHD/28-111---------------...EEILEAIGV.TAAFG....GGAAMS..QAVTLVQE---------------------------
Q9KXX7_STRCO/38-123---------------...EEIVEAFIQ.MAVYA....GVARAF..DSYAVARE---------------------------
Q9KZB1_STRCO/28-109---------------...ERIVQLAAW.EESRH....FYTEKE..LAAIELTE---------------------------
Q9KZB2_STRCO/10-92---------------...ERLGLLAAW.EEAAD....LYDGRE..RAALALTE---------------------------
Q9PCL2_XYLFA/167-252---------------...GQLRQLTQV.LAARV....DADMAR..RASTALEQ---------------------------
Q9RDI4_STRCO/14-96---------------...VRLHLVAAW.RESTV....FTEAER..AALALAEE---------------------------
Q9RJG5_STRCO/31-117---------------...QRLGVLPAW.RDTEL....FSPRER..AALALAEA---------------------------
Q9RTJ7_DEIRA/77-160---------------...VKADAVAVN.WRQAE....LSEREQ..AMCAYAEK---------------------------
Q9RV26_DEIRA/68-152---------------...RDLSDVLHQ.VAIYA....GVPAAL..SAVNATKE---------------------------
Q9RVP9_DEIRA/30-114---------------...QEVREALLL.CVPYL....GFPRTV..AAFSQLQS---------------------------
Q9WYF2_THEMA/12-95---------------...DEIKEILEV.AVTMG....ACIAET..WAREVWQY---------------------------
Q9X1V5_THEMA/22-105---------------...EEIFEALDI.ALVVG....GSIVIP..HLRRAVGF---------------------------
A1B484_PARDP/43-125---------------...REIAETIFQ.MSMFG....GLPAMQ..KALEIAQ.---------------------------
A1B485_PARDP/37-120---------------...REICEAIFQ.MHLYG....GMPAAI..NALNAAI.---------------------------
A1B6G6_PARDP/25-103---------------...EQIMEAIWV.AAEMR....AGAAYA..HANKAL..---------------------------
A9WCB6_CHLAA/49-136---------------RLAEQVATNYRR.AEITP....RQCAIL.DYALKVAL.---------------------------
D5ATI8_RHOCB/41-126---------------...REIAEVIFQ.MSMFG....GVPAMT..KALELARE---------------------------
F3Z5J5_9ACTO/59-139---------------...EETVAIR...RGVPG....DDARLE..ALVQVAR.---------------------------
Q0SH24_RHOSR/298-378---------------...DTIGEVLLH.TSVYA....GVPNSN..LGFAL...---------------------------
Q0WB04_YERPE/37-118---------------...EEIRAVLLQ.TVVYC....GAPVAL..AAFRIAS.---------------------------
Q1LKT1_RALME/24-106---------------...AEVHEALGV.AIYMG....GGPSAM..YASNAVA.---------------------------
Q2YKQ5_BRUA2/43-126---------------...EDICEALMH.VAIYA....GVPASN..HAFKIAKQ---------------------------
Q32CQ3_SHIDS/13-94---------------...HKLDALAGW.RVSHH....FDERER..AALAWAE.---------------------------
Q74U89_YERPE/50-134---------------...EELVEAITQ.LAFYS....GWPTAV..TAISIAKE---------------------------
Q79ZI9_STRAW/42-127---------------...QRLGVLAAW.RDTEL....FTSRER..AALALAE.---------------------------
Q7CV78_AGRT5/40-122---------------...ADIREALLH.VAIYA....GVPAAN..HAFKIAK.---------------------------
Q7VSA2_BORPE/23-105---------------...GEIAEALGV.AVALN....AGAALV..YSARVMD.---------------------------
Q7VYW3_BORPE/12-94---------------...LRLQLLNAW.RESPL....YTARER..AALAWTEA---------------------------
Q8TL87_METAC/31-112---------------...EEIMEVMDV.IFITS....GAPAVA..ACRDALK.---------------------------
S5V223_STRCU/22-98---------------...EELAETAFV.TAAVR....AGGTLA..HAL.....---------------------------
V9VWJ7_9RHOB/37-119---------------...EDVIEVFQH.AAIYA....GVPRAN..RALKLAKE---------------------------

PF04636

H9GH47_ANOCA/62-498...................................................GCDSSSPGSDEGVHAPG............
W5LN19_ASTMX/16-447..................................................ERLAQPPPPQREDPNRQE............
H3BCQ9_LATCH/18-462....NYCACDI.................................AN..................GNSG............
F1R1P4_DANRE/28-465....GLCTCHL.................................TNSNQANGNPNT........................
A0F081_DANRE/15-443.....................................................DSCCSVRGKARNQQE............
B4NMK7_DROWI/5-489ADGSRQTTTSPIHQQQLQLQQQQQQKTVLGEISLNGSSAN.......................PIDNS............
Q28ZG4_DROPS/4-508APATATAAAAPSLPPQPQ.PQPLLSKTVLGEISLNTGGAGG...TKPDYNTQNAASNNGSGGAPGDGA............
F7HTF1_CALJA/47-491....NYCICDI.................................TN.....GNHTVDEMQVNSTENVS............
A7SCG7_NEMVE/102-542..................................................ETNQASFDSGNATTGSES............
F7HY37_CALJA/43-479....................................................SEQSSPPSRDPLNNSG............
W5MLE5_LEPOC/40-480....NFCICDL.................................AN.......DNSLEDSILDCANPE............
E9C869_CAPO3/294-722.......................................................AELAEQLNSSQDA............
Q7PTB1_ANOGA/4-440............................................TAFNRLNDLYNSQHPENLPNGDDA............
G1U329_RABIT/39-491....NFCVCDL.................................AN.......DNNIENASLTGSNFG............
C3XTE9_BRAFL/48-481..................................................EGANDVEAHHSNSVASSS............
I1FVV2_AMPQE/119-585............................................TNPALGVGGTGSDSEPSSEAMSPA............
I3J1U7_ORENI/91-527..................................................HSPHSPAHSPAHEDGRHE............
W5KLV4_ASTMX/20-439....GYCLCDA.................................AN.......GNTALPPTERTPRRR............
B4MDV6_DROVI/4-484.........SPPLPPQQQ.QQ...QKNVLGEISLNSSSAGGGNNTKQDYNN............TMDNN............
A8WVR0_CAEBR/66-543............................................EIDFLNIDDIDYWEARLSELFRKV............
K1Q3S5_CRAGI/175-609...................................................ENSNDSDYTSDSFNKSH............
U3K820_FICAL/39-467.....................................................SDSSPASEDSMWGSG............
F7ARK8_MONDO/41-477....................................................SGQSSPPNGDPLGSSG............
W5NCK4_LEPOC/20-441....SYCFCDA.................................AN......GNAAAPPEGLRSARRR............
F4Q7E9_DICFS/150-592.......................................................SLNESDCEVEDLT............
B4QAY3_DROSI/4-496ALA.PTILITPTSPTEAQ.K....GKPVLAEISLNN........ANPDYNSQTAASSN..GGAPPDSA............
H2ZKE8_CIOSA/218-659.............................................SPRSNTSSGAATPKVDAKSGRKS............
H3BCK5_LATCH/13-462..................................................ACDSDSCLRVEDYVNGHGLDNQGIDIADSI
H2RRP9_TAKRU/38-481....QYCVCDI.................................AN......GNGHANHHDDPLGNQF............
W5MCN8_LEPOC/98-536.....................................................PTDSPATEEGASRPG.....VGTAGGR
H3ALF1_LATCH/44-502....NQCFCDA.................................AN.......GNYCSQELLRINRRR............
G3PXZ5_GASAC/8-439....TFCPFDA.................................AN.....GNANITIISVNWLLRRQ............
SESN_DICDI/138-598.......................................................SLNDSDCEIEDTA............

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRADU/34-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRADU/12-94--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
Q89CI6_BRADU/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRADU/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q89RQ0_BRADU/34-116--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q89D50_BRADU/12-94--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRADU/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRADU/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRADU/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRADU/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRADU/35-120--------------------------------------------------------------------------------
Q89IL8_BRADU/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRADU/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRADU/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRADU/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRADU/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRADU/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRADU/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRADU/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
A1B484_PARDP/43-125--------------------------------------------------------------------------------
A1B485_PARDP/37-120--------------------------------------------------------------------------------
A1B6G6_PARDP/25-103--------------------------------------------------------------------------------
A9WCB6_CHLAA/49-136--------------------------------------------------------------------------------
D5ATI8_RHOCB/41-126--------------------------------------------------------------------------------
F3Z5J5_9ACTO/59-139--------------------------------------------------------------------------------
Q0SH24_RHOSR/298-378--------------------------------------------------------------------------------
Q0WB04_YERPE/37-118--------------------------------------------------------------------------------
Q1LKT1_RALME/24-106--------------------------------------------------------------------------------
Q2YKQ5_BRUA2/43-126--------------------------------------------------------------------------------
Q32CQ3_SHIDS/13-94--------------------------------------------------------------------------------
Q74U89_YERPE/50-134--------------------------------------------------------------------------------
Q79ZI9_STRAW/42-127--------------------------------------------------------------------------------
Q7CV78_AGRT5/40-122--------------------------------------------------------------------------------
Q7VSA2_BORPE/23-105--------------------------------------------------------------------------------
Q7VYW3_BORPE/12-94--------------------------------------------------------------------------------
Q8TL87_METAC/31-112--------------------------------------------------------------------------------
S5V223_STRCU/22-98--------------------------------------------------------------------------------
V9VWJ7_9RHOB/37-119--------------------------------------------------------------------------------

PF04636

H9GH47_ANOCA/62-498.GTDA...........................MEEV.....................EVLMERMKLLQECQLDEEE...V
W5LN19_ASTMX/16-447.WTEA...........................VNEV.....................QLLMEKMMLVQQQEEE......F
H3BCQ9_LATCH/18-462.LEEV........................SVLTAEK.....................SLLSFSEKVIKQPKKKTRQSRLY
F1R1P4_DANRE/28-465................................GSEL.....................EALMERMKRLLEEREDDD....A
A0F081_DANRE/15-443.WSEA...........................VNEV.....................KLLMERMMMVQQQGEE......F
B4NMK7_DROWI/5-489.GVGA....TEAAALNG..YLATAQQQPQ.QHGICV.....................EALMERMKVLSQKQDE......C
Q28ZG4_DROPS/4-508.GGAAGGGGAGAAALNG..YLATAQQLPQ.QHGISV.....................EALMERMKVLSQNQDE......C
F7HTF1_CALJA/47-491.VSDS...........................FFEV.....................EALMEKMRQLQECRDEEE....A
A7SCG7_NEMVE/102-542.VRSS...........................TMTR.....................DELMARMREVRAEQDTLME...A
F7HY37_CALJA/43-479.GFEA...........................ARDV.....................EALMERMRQLQESLLRDEG...A
W5MLE5_LEPOC/40-480.TKDS...........................VSEL.....................EALMERMKRLQEEREEEE....A
E9C869_CAPO3/294-722.VGDA.........................TDSSWT.....................AAMLQRLNAVAGEAD.......V
Q7PTB1_ANOGA/4-440.NIRP...........................EVTV.....................DALMQRMKRLSEKNDE......C
G1U329_RABIT/39-491.IVDS...........................LSEL.....................EALMERMKRLQEEREDEE....A
C3XTE9_BRAFL/48-481................................EPGV.....................EMLMHRMKKIQEAADLQE....I
I1FVV2_AMPQE/119-585.CSPP...........................NEQVSKYLVEHYIETSKLTDTRKLDDTIKEKLAAVSQEEDETEE...I
I3J1U7_ORENI/91-527.LADG...........................AVEV.....................EVLMKRMVELQQQQEEEE....C
W5KLV4_ASTMX/20-439.SLDS...........................SCEL.....................ACLRERIQKSQEEKERKGDPVLQ
B4MDV6_DROVI/4-484.NSRS....TGANNNFGQHYLATAELQPQHQCAISV.....................EALMERMKVLSQNQDE......C
A8WVR0_CAEBR/66-543.ADRP...........................ETNV.....................EYMISEMKKTEKGMKRPAAKLCA
K1Q3S5_CRAGI/175-609.IENS...........................EPEVGI...................EILMERMKKLKESQEEE.....P
U3K820_FICAL/39-467.GTDA...........................MLEV.....................EMLMERMKLLQENQLEEEG...V
F7ARK8_MONDO/41-477.GFDA...........................VREV.....................EALMERMKVLQECQLQEEA...A
W5NCK4_LEPOC/20-441.SLDS...........................SCEG.....................GCLQERIQWVQEEKERRGERRIN
F4Q7E9_DICFS/150-592.ASEN...........................TIKV.....................MELLKKKKEEQEEDDFEDG...G
B4QAY3_DROSI/4-496.NAAA..DGPDATALNG..YLATAQQLPQ.QHGISV.....................ETLMERMKVLSQKQDE......C
H2ZKE8_CIOSA/218-659.PASP...........................IAEIGDV..................EVLMERMRKLQEEEED......V
H3BCK5_LATCH/13-462IAGDA...........................MQEV.....................EALMARMKLLQECRLDEE....A
H2RRP9_TAKRU/38-481.PKEM...........................CGEV.....................EVLMERMKQLQECRDDEE....A
W5MCN8_LEPOC/98-536GAGEA...........................LQEV.....................EALMRKMRLLQEQEEE......A
H3ALF1_LATCH/44-502.SLDS...........................CVEL.....................ETLRDRMQRIHIENENREEKTCE
G3PXZ5_GASAC/8-439.SLDS...........................SCDM.....................VCLKERIQKSQEEREKREERLLQ
SESN_DICDI/138-598.ATEN...........................TAKV.....................MELLKNRRSQQQDDDDDDQ....

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRADU/34-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRADU/12-94--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
Q89CI6_BRADU/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRADU/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q89RQ0_BRADU/34-116--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q89D50_BRADU/12-94--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRADU/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRADU/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRADU/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRADU/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRADU/35-120--------------------------------------------------------------------------------
Q89IL8_BRADU/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRADU/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRADU/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRADU/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRADU/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRADU/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRADU/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRADU/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
A1B484_PARDP/43-125--------------------------------------------------------------------------------
A1B485_PARDP/37-120--------------------------------------------------------------------------------
A1B6G6_PARDP/25-103--------------------------------------------------------------------------------
A9WCB6_CHLAA/49-136--------------------------------------------------------------------------------
D5ATI8_RHOCB/41-126--------------------------------------------------------------------------------
F3Z5J5_9ACTO/59-139--------------------------------------------------------------------------------
Q0SH24_RHOSR/298-378--------------------------------------------------------------------------------
Q0WB04_YERPE/37-118--------------------------------------------------------------------------------
Q1LKT1_RALME/24-106--------------------------------------------------------------------------------
Q2YKQ5_BRUA2/43-126--------------------------------------------------------------------------------
Q32CQ3_SHIDS/13-94--------------------------------------------------------------------------------
Q74U89_YERPE/50-134--------------------------------------------------------------------------------
Q79ZI9_STRAW/42-127--------------------------------------------------------------------------------
Q7CV78_AGRT5/40-122--------------------------------------------------------------------------------
Q7VSA2_BORPE/23-105--------------------------------------------------------------------------------
Q7VYW3_BORPE/12-94--------------------------------------------------------------------------------
Q8TL87_METAC/31-112--------------------------------------------------------------------------------
S5V223_STRCU/22-98--------------------------------------------------------------------------------
V9VWJ7_9RHOB/37-119--------------------------------------------------------------------------------

PF04636

H9GH47_ANOCA/62-498TPEEMETCF......EREKR........ESLLVTPA..........DIAEHSLP.................PNILCFVED
W5LN19_ASTMX/16-447TPEEMVTRF......ERERT........ESILEPAE...........VVRAALP.................DSISRFVQD
H3BCQ9_LATCH/18-462ENTENVARFRNRSFKSIKKK........KCFFLIAT..........GDEDSLPN.................RDVSRHFED
F1R1P4_DANRE/28-465SEEEMFTRF......EKEKK........ESLLVVSA.........GFDEEVVPP.................SPVARFVDD
A0F081_DANRE/15-443TQEEMVTRF......ERERT........ESLLEPAD...........VQRSVLP.................DCVSRFVVD
B4NMK7_DROWI/5-489SEAELSNRF......KNVEM........QTAELPAV...........TPEAAVVL...............PPIISQYVDD
Q28ZG4_DROPS/4-508SEAELSSRF......KNVEM........QTAELAAV...........TPGPAVAL...............PPNISHYVDD
F7HTF1_CALJA/47-491SQEEMASRF......EIEKR........ESMFVFSS..........DDEEVTPA.................RDVSRHFED
A7SCG7_NEMVE/102-542SQEELFQHF......EKLESGELAHFKDEAASTPTESLT................................TDLARYLED
F7HY37_CALJA/43-479SQEEMESRF......ELEKS........ESLLVTPS.........ADILEPSPH.................PDMLCFVED
W5MLE5_LEPOC/40-480SQEEMATRF......EKEKK........ESLLVGSG..........VFEEVVLT.................SRVSRFVED
E9C869_CAPO3/294-722TEEENVKNF......EKSET........E.............FNTGHIHHAASA.................SDINRFIRR
Q7PTB1_ANOGA/4-440SETELSNRF......KHVEQ........QAAELPPV...........VREAPADV...............PQQLGRYVDD
G1U329_RABIT/39-491SQEEMTTRF......EKEKK........ESLFVVSGDNFHSFPHSDFEDDMIVT.................SDVSRYIED
C3XTE9_BRAFL/48-481SQEEMKQRF......EKVEK........QSLECQSA...........CSECLAV.................SDYAKYRDD
I1FVV2_AMPQE/119-585DNDRQFAESVSSFGLEKIHS........RSVPTP.....................................VNLLRYITD
I3J1U7_ORENI/91-527TQEEMVTRF......ERERS........ESIPTVFF........CLAVVRGAPP.................DLVLRLVEE
W5KLV4_ASTMX/20-439SHTLLHIDA......EEEEE........EMMFL......................................TDPSRFVTD
B4MDV6_DROVI/4-484SEAELSNRF......KSVEL........QTAELAAA...........SPEVAVAL...............PPIISHYVDD
A8WVR0_CAEBR/66-543MTTETIESLINAPPATYSSN........RKSYSPVLLLANIDENGDDILEKEPP.................CEYPIYSHH
K1Q3S5_CRAGI/175-609TEEERRKRF......EKVEF........QSAELTKP...........GKKPSPK.................AEIIKYVQD
U3K820_FICAL/39-467TQEEMATRF......ELEKT........ESLLVPSS..........DPLDPSLQ.................SNIRCFLED
F7ARK8_MONDO/41-477SQEEMENRF......ELEKS........ESLLVAPT.........SDILELTPS.................PDVLCFVED
W5NCK4_LEPOC/20-441AQPLLYTEL.....EEEEEA........PCC........................................ADPSRFVSD
F4Q7E9_DICFS/150-592PEIDRQQEFHNAGNIDADNS........SSSSSGSS.........SLATTSSSTYGG.............IVDMSRYNCN
B4QAY3_DROSI/4-496SEAELSSRF......QKVEQ........QTAELAAV...........TPEAAVGV...............PTNLSHYVDD
H2ZKE8_CIOSA/218-659TTEERSRRF....EIEKEEA........SHGLLPGVSGPVGGA............................AYFARYVQE
H3BCK5_LATCH/13-462SQEEMATRF......EKEKR........ESLLVAPS.........ADEREFAL..................PNVSRFVED
H2RRP9_TAKRU/38-481SQEEMATRF......EREKT........ESMLVVTA..........EDEESAPS.................RDISRHFED
W5MCN8_LEPOC/98-536SQEEMATRF......EREKS........ESLLVAPS.........DDSTRPTP..................ATVSCFVED
H3ALF1_LATCH/44-502RTRALPG........EQEEG........KIWLRPARGGNFYSHLQSNCEDEVVSP................PDLSRYVED
G3PXZ5_GASAC/8-439THTLQQSPLFFLDAEEEDET........MCF........................................TDPTRFITD
SESN_DICDI/138-598.LHDRQQDFHNAGDDSQSSN........NNTTTTTTTTTTTTTTTNTNTTSNSAGGGDSSSSTLSQSSDRMSDFSRYIGN

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRADU/34-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRADU/12-94--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
Q89CI6_BRADU/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRADU/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q89RQ0_BRADU/34-116--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q89D50_BRADU/12-94--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRADU/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRADU/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRADU/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRADU/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRADU/35-120--------------------------------------------------------------------------------
Q89IL8_BRADU/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRADU/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRADU/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRADU/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRADU/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRADU/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRADU/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRADU/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
A1B484_PARDP/43-125--------------------------------------------------------------------------------
A1B485_PARDP/37-120--------------------------------------------------------------------------------
A1B6G6_PARDP/25-103--------------------------------------------------------------------------------
A9WCB6_CHLAA/49-136--------------------------------------------------------------------------------
D5ATI8_RHOCB/41-126--------------------------------------------------------------------------------
F3Z5J5_9ACTO/59-139--------------------------------------------------------------------------------
Q0SH24_RHOSR/298-378--------------------------------------------------------------------------------
Q0WB04_YERPE/37-118--------------------------------------------------------------------------------
Q1LKT1_RALME/24-106--------------------------------------------------------------------------------
Q2YKQ5_BRUA2/43-126--------------------------------------------------------------------------------
Q32CQ3_SHIDS/13-94--------------------------------------------------------------------------------
Q74U89_YERPE/50-134--------------------------------------------------------------------------------
Q79ZI9_STRAW/42-127--------------------------------------------------------------------------------
Q7CV78_AGRT5/40-122--------------------------------------------------------------------------------
Q7VSA2_BORPE/23-105--------------------------------------------------------------------------------
Q7VYW3_BORPE/12-94--------------------------------------------------------------------------------
Q8TL87_METAC/31-112--------------------------------------------------------------------------------
S5V223_STRCU/22-98--------------------------------------------------------------------------------
V9VWJ7_9RHOB/37-119--------------------------------------------------------------------------------

PF04636

H9GH47_ANOCA/62-498PEFGYKDFTRRGEQ.TPPTFRA..QDYTWEDHGYSLINRLYPDVGQLLDEKFQVVYNLTYH...........TIAMHSGV
W5LN19_ASTMX/16-447PDFIYQDFSPRGEQ.SPPTMRA..QDYSWEDHGFSLMNRLYGEMAQLLDEKFQVVCALTYH...........TMAMHTHV
H3BCQ9_LATCH/18-462TSYGYKDFSRRGEH..VPTLRA..QDYNWEDHGFSLVNRLYPDVGQWLDDKFQIAYNLTYN...........TMAMHKDV
F1R1P4_DANRE/28-465PSFGYQDFARHGED.NPPTFKA..QDYSWEDHGFSLVNRLYSDIGHLLDDKFRTACDLTYY...........NMASHEGV
A0F081_DANRE/15-443ADFTYQDFSPRGAQ.APPTMRA..QDYSWEDHGFSLMNRLYGEMAQLLDEKFQVACALTYH...........TMAMHSHV
B4NMK7_DROWI/5-489PNFTYQDFARRGAE.NINTFRI..QDYSWEDHGYSLVDGLYNEVGTFLDEKFRAAYNLTYF...........TMGGIKNV
Q28ZG4_DROPS/4-508ANFIYQDFARRGAE.NVNTFRI..QDYSWEDHGYSLVDGLYNDVGTYLDEKFRSAYNLTYC...........TMGGIKNV
F7HTF1_CALJA/47-491PSYGYKDFSRHGMH..VPTFRV..QDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYN...........TMAMHKDV
A7SCG7_NEMVE/102-542PNFRYQDFASRPQQ.DISTFRI..QDCSWEEHGFSLFNRLYPDIGTLLDEKFSSTLGLTYF...........TLGDRTNV
F7HY37_CALJA/43-479PTFGYEDFTRRGAQ.APPTFRA..QDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYN...........TIAMHSGV
W5MLE5_LEPOC/40-480PTFGYQDFARHGED.NLPTFRA..QDYSWEDHGFSLINRLYSDIGHLLDDKFRTVYNLTYY...........NMASHEDV
E9C869_CAPO3/294-722PDFAHEDFDIKSRE..YSVFRY..QDYSWEDHGFSLVDRFYESCAQLLDQQFSIAKTMTYA...........TMGGQGGI
Q7PTB1_ANOGA/4-440PGFTYQDFARRGAENIPQTFRI..QDYSWDDHGYSLVNRLYNDVGFYLDDKFRAAYNLTYY...........TIAGRTNV
G1U329_RABIT/39-491PGFGYEDFARRGEE.HLPTFRA..QDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYN...........TMATHEGV
C3XTE9_BRAFL/48-481PNFHYEDFAKRGEERTIPTFRA..QDYSWEDQGFSLVNRLYSDIGQLLDDKFRMAYNLTYY...........TMGPQKDV
I1FVV2_AMPQE/119-585PSYEHEDFTLASAC....TLRA..REYSWEDHGFSFLNSLYPLLSELLDEKFKVASEMTYR...........HVGATKDI
I3J1U7_ORENI/91-527PEFRYEDFAPRGEQ.SPPTMRA..QDYSWEDHGFSLLNRLLPDMGQLLDEKFQIVCNLTYH...........RMAMHEGV
W5KLV4_ASTMX/20-439PDFGYQEFARQEED.HFQVFRV..QDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVASLPSP................HDP
B4MDV6_DROVI/4-484ASFTYQDFARRGAE.NINTFRI..QDYSWEDHGYSLVDGLYNDVGTFLDEKFRAAYNLTYF...........TMGGIKNV
A8WVR0_CAEBR/66-543RTFGYIDFRKRPEK.DIPPFRV..EEFGW.DHVYNTMNEYTDTLTSRLDHMFDHIRTLTGNMSSASNSSGEGSPADQNEI
K1Q3S5_CRAGI/175-609EEFCYIDFTKRGCTEEAPTFRA..NEYSWDDHGFSIANRLYSEIGNLLDEKFSMAYNLTYY...........TMGEVIDV
U3K820_FICAL/39-467PEFGYKDFTRRGEQ.APPTFRA..QDYTWEDHGYSLMNRLYPDVGQLLDEKFQVVYNLTYN...........TIAMHCGV
F7ARK8_MONDO/41-477PTFGYEDFTRRGTQ.APPTFRA..QDYTWEDHGYSLIQRLYPEGGQLLDEKFQVVYTLTYN...........TIAMHSGV
W5NCK4_LEPOC/20-441PEFGYQDFDRREED.HFQVFRVQQQDYSWEDHGFSLVNRLYSDIGHLLDDRFRTVTSLPNS...........VLSGGQGS
F4Q7E9_DICFS/150-592NQLTHTDFDVSSKD..YTIFSV..QDYSWKEHGYELVSRIFPDAAPLLDEEFSFVYTMTYY...........RFNNSTDI
B4QAY3_DROSI/4-496ANFIYQDFARRGTE.SINTFRI..QDYSWEDHGYSLVDGLYNDVGIFLDAKFRAAYNLTYC...........TMGGIKNV
H2ZKE8_CIOSA/218-659PDFSYQDFAKRDAHAEIPTYRA..QDYSW.DHAFTVMSSYYNGVAELLDEKYQTAYNLTYK...........TLATRDNV
H3BCK5_LATCH/13-462PEFGYVDFTRRGEQ.TPPTLRA..QDYSWEDHGYSLINRLYSEVGQLLDEKFQIVYNLTYH...........TMAMHCGV
H2RRP9_TAKRU/38-481PSYGYKEFSRRGEQ..VPTLRV..QDYSWEDHGFSLVNRLYPDVGQMLDEKFQLAYNLTYN...........TMATHKDV
W5MCN8_LEPOC/98-536PDFGYEDFTRRGEQ.APPTFRA..QDYSWEDHGYSLINRLYPDVGQHLDEKFQVVSNLTYN...........TMAMHSGV
H3ALF1_LATCH/44-502PEFGYQDFARREEE.QLQIFRV..QDYSWEDHGFSLVNRLYSDIGHLLDEKFRTVYALQNG...........TMAKRQGC
G3PXZ5_GASAC/8-439PDLCYQEFARREED.HFQVFRV..QDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVTTLPTM................HSP
SESN_DICDI/138-598NTMTHTDFDVSSKL..YNIFSA..QEYSWREHGYELVSRYFPDAAPLLDEEFSFVYTMTYY...........KFNNNTDI

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRADU/34-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRADU/12-94--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
Q89CI6_BRADU/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRADU/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q89RQ0_BRADU/34-116--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q89D50_BRADU/12-94--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRADU/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRADU/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRADU/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRADU/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRADU/35-120--------------------------------------------------------------------------------
Q89IL8_BRADU/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRADU/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRADU/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRADU/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRADU/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRADU/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRADU/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRADU/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
A1B484_PARDP/43-125--------------------------------------------------------------------------------
A1B485_PARDP/37-120--------------------------------------------------------------------------------
A1B6G6_PARDP/25-103--------------------------------------------------------------------------------
A9WCB6_CHLAA/49-136--------------------------------------------------------------------------------
D5ATI8_RHOCB/41-126--------------------------------------------------------------------------------
F3Z5J5_9ACTO/59-139--------------------------------------------------------------------------------
Q0SH24_RHOSR/298-378--------------------------------------------------------------------------------
Q0WB04_YERPE/37-118--------------------------------------------------------------------------------
Q1LKT1_RALME/24-106--------------------------------------------------------------------------------
Q2YKQ5_BRUA2/43-126--------------------------------------------------------------------------------
Q32CQ3_SHIDS/13-94--------------------------------------------------------------------------------
Q74U89_YERPE/50-134--------------------------------------------------------------------------------
Q79ZI9_STRAW/42-127--------------------------------------------------------------------------------
Q7CV78_AGRT5/40-122--------------------------------------------------------------------------------
Q7VSA2_BORPE/23-105--------------------------------------------------------------------------------
Q7VYW3_BORPE/12-94--------------------------------------------------------------------------------
Q8TL87_METAC/31-112--------------------------------------------------------------------------------
S5V223_STRCU/22-98--------------------------------------------------------------------------------
V9VWJ7_9RHOB/37-119--------------------------------------------------------------------------------

PF04636

H9GH47_ANOCA/62-498DTSMLRRAIWNYVHCVFGI.RYDDYDYREVNQLLERSLKIYIKTVACYPEKTTKRMYTHFWRHFKHSEKVHINLLLLEAR
W5LN19_ASTMX/16-447DTSTLRKALWNYIHCIYGI.RHDDYDYGEVNQLLERSLKVFVKTAACHPEKTTLRMYSSFWRQFLHSEKVHVNLLLMEAR
H3BCQ9_LATCH/18-462DTSMLRRAVWNYIHCMFGI.RYDDYDYIEINQLLDHGFKVYIKTVVCSPEKTTKKMYDSFWRQFKHSEKVHVNLLLMEAR
F1R1P4_DANRE/28-465DTSMLRRALFNYVHCMYGI.RYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTCRMYESYWHQFRHSEKVHVNLLLMEAR
A0F081_DANRE/15-443DTSTLRKAIWNYIQCIYGI.RYDDYDYGEVNQLLERSLKVYVKTVACHPEKTTARMYFSFWRQFRHSEKVHVNLLLMEAR
B4NMK7_DROWI/5-489DTSKFRRAIWNYIQCIYGI.RHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEAR
Q28ZG4_DROPS/4-508DTSKFRRAIWNYIQCIYGI.RHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEAR
F7HTF1_CALJA/47-491DTSMLRRAIWNYIHCMFGI.RYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEAR
A7SCG7_NEMVE/102-542DTTVFRMATWNYIHLIFGI.YHDDYLYTEVNKLMERSYKRYIKKVACVPEKATQEDYLEFMPELTHSEKVHINLLLLEAR
F7HY37_CALJA/43-479DTSVLRRAIWNYIHCVFGI.RYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEAR
W5MLE5_LEPOC/40-480DTTMLRRALFNYVHCMFGI.RYDDYDYGEVNQLLERTLKVYIKTVTCYPERTTRRMYDSYWRQFRHSEKVHVNLLLMEAR
E9C869_CAPO3/294-722DTQKLRYAVWYYITRVNGI.LHDDFNYGTVNELLEREVKLYIKRLACSPAEITQAEYVAASRGLLPSEKIHIAILATEAN
Q7PTB1_ANOGA/4-440DTSKFRRAIWNYIQCIYGI.RHDDYDYGEVNQLLDRSLKMFIKTACCFPERITKLDYDSVLVELQHSEKVHINLMILEAR
G1U329_RABIT/39-491DTTMLRRALFNYVHCMFGI.RYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEAR
C3XTE9_BRAFL/48-481DTSMLRAAIWNYIHCMFGI.FHDDYDYGEVNQLLDIRLKSFIKTVTCYPERTTRKDYDNFWKEFKHSEKVQVNLMVLEAR
I1FVV2_AMPQE/119-585DTKPFREATWYYIQSIKGI.RHDDYNYGKVNKVLSIEYKTYIRMVACFPEKVSLYDFRECMDGLQFSEKVHVNVLVMEAR
I3J1U7_ORENI/91-527DTHSLRKALWNYIHCLYGI.RYDDYDYGSVNVLLERSLKVFVKTMACHPEQTTARIYHSFWRHFRHSEKVHANLIVMEAR
W5KLV4_ASTMX/20-439D...LKRAIWNYIHCIYGI.RYDDYDYGEVNHLLERGLKLYIKAVACYPDSTKNPLCPHPLSPLKASEKVHVNLLVMEAR
B4MDV6_DROVI/4-484DTSKFRRAIWNYIQCIFGI.RHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEAR
A8WVR0_CAEBR/66-543DTTAFREAVWNYTQGLYGV.RVDDYDYSKINRVLDKGTKTFIKLAACYPHKLTTE.FTKALPGFKDSEKIHVVMMIAMAR
K1Q3S5_CRAGI/175-609DTSAFRRAIWYYIHCLYGI.MHDDYDYGQVNQLLERNLKQYIKTVTCYPERLTKKDYDNVMKEFKHSEKVHVNLMLLEAR
U3K820_FICAL/39-467DTSVLRRAIWNYVHCVFGI.RYDDYDYGEVNQLLERNLKIYIKTVACYPEKTTKQIYTQFWRHFKHSEKVHVNLLLLEAR
F7ARK8_MONDO/41-477DTSMLRRAIWNYIHCVFGI.RYDDYDYGEVNQLLERSLKVYIKTVACYPEKTTKRMYNHFWRHFRHSEKVHVNLLLLEAR
W5NCK4_LEPOC/20-441E...VKRAIWNYIHWMFGI.RYDDYDYGEVNHLLERNLKLYIKTVTCYPDKTKSQLFPRPWKPLKPAEKVHVNLLIMEAR
F4Q7E9_DICFS/150-592DTLPFRRAVWYYVQRVKGM.CHDDYNYQEVNMFLSRNLKYYVKKAVCFPDNISKIDYSKLGYDLKPDEKCHLALLAVCSH
B4QAY3_DROSI/4-496DTSKFRRAIWNYIQCIYGI.RHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEAR
H2ZKE8_CIOSA/218-659DTTSLRRAIWMYVHCMYGI.MYDDYNYSEVNQLLERPLKLYIKTVSCFPEQTTRAVYDGFWKQFRHSEKVHVNIMLLEAR
H3BCK5_LATCH/13-462NTSMLRRAIWNYIHCIFGI.RYDDYDYGDVNQLLERSLKIYMKTVACYPERTTTRMYNGFWRHFKHSEKVHVNLLIQESK
H2RRP9_TAKRU/38-481DTSMLRRAIWNYIHCMFGI.RYDDYDYGEINQLLDRGFKIYIKTMVCSPEKTTRRMYESFWRQFQHSEKVHVNLLLMEAR
W5MCN8_LEPOC/98-536DTYMLRKAVWNYIHCVFGI.RYDDYDYGDVNHLLERSLKVYIKTVACYPEKTTRKMYNGFWRHFRHSEKVHVNLILLEAR
H3ALF1_LATCH/44-502DNAVFKRGIWNYIHCMFGISRYDDYDYGEVNHWLERSLKVYIKTVTCHPEKTCSQMFERFWKQFKHSEKVHVNLLILEAR
G3PXZ5_GASAC/8-439D...LKRAIWNYIHCVLGI.RYDDYDYGEVNQLLERDFKLYIKAVACFPDATKTLVCPLSLAPLKTSERIHVNLLIMEAR
SESN_DICDI/138-598DTLPFRRAVWYYVQRVKGM.LHDDYNYQEVNMFLSRSLKNFVKKAVCFPETIKRDDYSKLGYSLKPDEKCHLSLLAVCSH

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRADU/34-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRADU/12-94--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
Q89CI6_BRADU/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRADU/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q89RQ0_BRADU/34-116--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q89D50_BRADU/12-94--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRADU/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRADU/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRADU/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRADU/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRADU/35-120--------------------------------------------------------------------------------
Q89IL8_BRADU/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRADU/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRADU/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRADU/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRADU/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRADU/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRADU/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRADU/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
A1B484_PARDP/43-125--------------------------------------------------------------------------------
A1B485_PARDP/37-120--------------------------------------------------------------------------------
A1B6G6_PARDP/25-103--------------------------------------------------------------------------------
A9WCB6_CHLAA/49-136--------------------------------------------------------------------------------
D5ATI8_RHOCB/41-126--------------------------------------------------------------------------------
F3Z5J5_9ACTO/59-139--------------------------------------------------------------------------------
Q0SH24_RHOSR/298-378--------------------------------------------------------------------------------
Q0WB04_YERPE/37-118--------------------------------------------------------------------------------
Q1LKT1_RALME/24-106--------------------------------------------------------------------------------
Q2YKQ5_BRUA2/43-126--------------------------------------------------------------------------------
Q32CQ3_SHIDS/13-94--------------------------------------------------------------------------------
Q74U89_YERPE/50-134--------------------------------------------------------------------------------
Q79ZI9_STRAW/42-127--------------------------------------------------------------------------------
Q7CV78_AGRT5/40-122--------------------------------------------------------------------------------
Q7VSA2_BORPE/23-105--------------------------------------------------------------------------------
Q7VYW3_BORPE/12-94--------------------------------------------------------------------------------
Q8TL87_METAC/31-112--------------------------------------------------------------------------------
S5V223_STRCU/22-98--------------------------------------------------------------------------------
V9VWJ7_9RHOB/37-119--------------------------------------------------------------------------------

PF04636

H9GH47_ANOCA/62-498MQAALLYALRAITRYM
W5LN19_ASTMX/16-447LQAALLYALRAITRYM
H3BCQ9_LATCH/18-462MQAELLYALRAITRYM
F1R1P4_DANRE/28-465MQAELLYALRAITHYM
A0F081_DANRE/15-443MQAALLYALRAITRYM
B4NMK7_DROWI/5-489NQAELLYALREIMRYM
Q28ZG4_DROPS/4-508NQAELLYALREIMRYM
F7HTF1_CALJA/47-491MQAELLYALRAITRYM
A7SCG7_NEMVE/102-542LQAELLYATRAIMKYM
F7HY37_CALJA/43-479MQAALLYALRAITRYM
W5MLE5_LEPOC/40-480MQAELLYALRAITRYM
E9C869_CAPO3/294-722KQAGLMYALHAVMKYM
Q7PTB1_ANOGA/4-440NQAELLYALREVMRYM
G1U329_RABIT/39-491MQAELLYALRAITRHL
C3XTE9_BRAFL/48-481MQAELLYALRAIMRYM
I1FVV2_AMPQE/119-585LQAELIYSLKALMSHM
I3J1U7_ORENI/91-527LQAALLYILRAITHYM
W5KLV4_ASTMX/20-439LQAELLYALRAITQYM
B4MDV6_DROVI/4-484NQAELLYALREIMRYM
A8WVR0_CAEBR/66-543FQASMFHYTRAVCNYN
K1Q3S5_CRAGI/175-609LQGELLYALRGVMHYM
U3K820_FICAL/39-467LQAALLYALRAVTRYM
F7ARK8_MONDO/41-477MQAALLYALRAITRYM
W5NCK4_LEPOC/20-441LQAELLYALRAITQYM
F4Q7E9_DICFS/150-592KQAALLYGLYTVMSYQ
B4QAY3_DROSI/4-496NQAELLYALREIMRYM
H2ZKE8_CIOSA/218-659MQVGLLYGLRALTQ..
H3BCK5_LATCH/13-462MQAALLYVLRAITRYM
H2RRP9_TAKRU/38-481MQAELLYALRAITRYM
W5MCN8_LEPOC/98-536MQAALLYSLRAITRYM
H3ALF1_LATCH/44-502IQVELLYALRAITQHM
G3PXZ5_GASAC/8-439LQAELLYALRAITQYM
SESN_DICDI/138-598KQASLLYGLYSVMNYQ

PF02627

Q930A6_RHIME/29-113----------------
Q930A6_RHIME/156-240----------------
Q8KL33_RHIEC/44-128----------------
DC4C_ACIAD/35-119----------------
Q7D077_AGRT5/19-101----------------
Q7D1C9_AGRT5/12-94----------------
O06218_MYCTU/45-127----------------
O06800_MYCTU/26-109----------------
Q88GS9_PSEPK/72-155----------------
O26169_METTH/26-109----------------
O26336_METTH/31-115----------------
O26787_METTH/36-120----------------
O27018_METTH/13-96----------------
O29899_ARCFU/36-119----------------
Q8DUG8_STRMU/42-124----------------
O30263_ARCFU/32-115----------------
YURZ_BACSU/32-115----------------
Q88K69_PSEPK/28-111----------------
O53749_MYCTU/49-133----------------
O53905_MYCTU/40-123----------------
Q89PM8_BRADU/34-118----------------
Q88N35_PSEPK/35-119----------------
O69814_STRCO/47-126----------------
Q8DKG6_THEEB/35-118----------------
O86608_STRCO/355-439----------------
Y4147_CUPNH/24-107----------------
Q89PR3_BRADU/12-94----------------
Q81CE2_BACCR/28-111----------------
Q89CI6_BRADU/13-94----------------
YJ81_YEAST/199-283----------------
P73604_SYNY3/23-107----------------
Q81RU7_BACAN/19-103----------------
Q89CP9_BRADU/40-125----------------
YDFG_BACSU/12-94----------------
Q828B2_STRAW/38-123----------------
Q89RQ0_BRADU/34-116----------------
Q82A02_STRAW/34-115----------------
Q89D50_BRADU/12-94----------------
Q82HT0_STRAW/32-114----------------
Y1053_HAEIN/24-107----------------
Q8E1D2_STRA5/17-102----------------
Y742_METJA/19-103----------------
AHPD_STRAW/94-177----------------
Y1511_METJA/18-101----------------
Q7MJJ5_VIBVY/55-138----------------
Q89SZ5_BRADU/50-134----------------
Q7NI16_GLOVI/40-125----------------
Q82MF4_STRAW/285-369----------------
Q7NMU5_GLOVI/47-129----------------
Q89F01_BRADU/58-143----------------
Q7NSY1_CHRVO/13-97----------------
Q82MM5_STRAW/103-186----------------
Q7NX57_CHRVO/41-125----------------
Q7NXV7_CHRVO/15-94----------------
Q82PT4_STRAW/14-96----------------
Q7P0I8_CHRVO/10-92----------------
Q89I69_BRADU/24-107----------------
Q7P1X7_CHRVO/26-109----------------
Q82QS6_STRAW/57-140----------------
Q89UN1_BRADU/34-118----------------
AHPD_COXBU/96-175----------------
Q89IH0_BRADU/35-120----------------
Q89IL8_BRADU/43-126----------------
Q7ULD6_RHOBA/54-137----------------
Q7UPD1_RHOBA/39-122----------------
Q89XS3_BRADU/55-139----------------
Q7USN7_RHOBA/41-121----------------
Q89LE4_BRADU/50-134----------------
Q7UTX7_RHOBA/162-245----------------
Q7VG56_HELHP/77-162----------------
Q89LE4_BRADU/177-261----------------
Q7VG63_HELHP/82-166----------------
Q7VG63_HELHP/216-301----------------
Q87FG9_VIBPA/24-106----------------
Q87FG9_VIBPA/158-243----------------
Q7VTI6_BORPE/91-170----------------
Q8A7Y1_BACTN/178-261----------------
Q7VW83_BORPE/12-94----------------
Q87H24_VIBPA/33-118----------------
Q7W0B6_BORPE/40-124----------------
Q87WR5_PSESM/34-118----------------
Q8A7Y1_BACTN/311-396----------------
Q87XC8_PSESM/23-106----------------
Q89M11_BRADU/16-98----------------
Q881M4_PSESM/43-127----------------
Q881M4_PSESM/170-254----------------
Q8DV36_STRMU/17-102----------------
Q89N13_BRADU/21-105----------------
Q881R7_PSESM/57-141----------------
Q89NA9_BRADU/36-119----------------
Q88GS0_PSEPK/34-118----------------
Q8A8P6_BACTN/142-227----------------
Q8EKK9_SHEON/33-118----------------
Q8EMR2_OCEIH/26-109----------------
Q8EMR2_OCEIH/135-218----------------
Q8EWL7_MYCPE/18-103----------------
Q8FN18_COREF/270-361----------------
Q8FN50_COREF/40-124----------------
Q8FN71_COREF/14-100----------------
Q8FQN1_COREF/33-119----------------
Q8KL13_RHIEC/51-135----------------
Q8NLN6_CORGL/20-105----------------
Q8NMX8_CORGL/269-355----------------
Q8NN44_CORGL/15-100----------------
Q8NRJ9_CORGL/17-103----------------
Q8PBZ0_XANCP/31-114----------------
Q8PDG7_XANCP/35-119----------------
Q8RCV6_THETN/21-104----------------
Q8TN24_METAC/40-121----------------
Q8TNJ6_METAC/14-97----------------
Q8TP59_METAC/27-113----------------
Q8TTM1_METAC/27-111----------------
Q8TXW6_METKA/29-113----------------
A9CKY5_AGRT5/48-130----------------
A9CKY7_AGRT5/64-149----------------
A9CIC5_AGRT5/44-127----------------
A9CLJ3_AGRT5/34-118----------------
Q8XQ14_RALSO/17-101----------------
Q8XX67_RALSO/35-119----------------
Q8XYW1_RALSO/93-173----------------
Q8Y1Q8_RALSO/21-105----------------
Q8Y1Q8_RALSO/150-234----------------
Q8Y972_LISMO/15-97----------------
Q8YLD1_NOSS1/42-125----------------
Q8ZSI6_NOSS1/44-126----------------
Q92S80_RHIME/12-94----------------
Q92XD0_RHIME/12-93----------------
Q930M4_RHIME/49-134----------------
Q930M4_RHIME/170-255----------------
Q930M4_RHIME/308-395----------------
Q97UW0_SULSO/43-128----------------
Q984R0_RHILO/14-98----------------
Q987X0_RHILO/12-95----------------
Q98BX3_RHILO/57-141----------------
Q98JY9_RHILO/46-129----------------
Q98K47_RHILO/12-94----------------
Q98L97_RHILO/13-95----------------
AHPD_CAUCR/95-178----------------
Q9A3V6_CAUCR/52-136----------------
Q9A5N6_CAUCR/302-387----------------
AHPD_BRADU/95-178----------------
Q9CB37_MYCLE/51-135----------------
Q9CE69_LACLA/31-116----------------
Q9CFE3_LACLA/16-101----------------
Q9FC57_STRCO/14-95----------------
Q9HLI4_THEAC/22-105----------------
Q9I1E7_PSEAE/38-118----------------
Q9I5X1_PSEAE/24-106----------------
Q9I6M1_PSEAE/12-94----------------
Q9K796_BACHD/28-111----------------
Q9KXX7_STRCO/38-123----------------
Q9KZB1_STRCO/28-109----------------
Q9KZB2_STRCO/10-92----------------
Q9PCL2_XYLFA/167-252----------------
Q9RDI4_STRCO/14-96----------------
Q9RJG5_STRCO/31-117----------------
Q9RTJ7_DEIRA/77-160----------------
Q9RV26_DEIRA/68-152----------------
Q9RVP9_DEIRA/30-114----------------
Q9WYF2_THEMA/12-95----------------
Q9X1V5_THEMA/22-105----------------
A1B484_PARDP/43-125----------------
A1B485_PARDP/37-120----------------
A1B6G6_PARDP/25-103----------------
A9WCB6_CHLAA/49-136----------------
D5ATI8_RHOCB/41-126----------------
F3Z5J5_9ACTO/59-139----------------
Q0SH24_RHOSR/298-378----------------
Q0WB04_YERPE/37-118----------------
Q1LKT1_RALME/24-106----------------
Q2YKQ5_BRUA2/43-126----------------
Q32CQ3_SHIDS/13-94----------------
Q74U89_YERPE/50-134----------------
Q79ZI9_STRAW/42-127----------------
Q7CV78_AGRT5/40-122----------------
Q7VSA2_BORPE/23-105----------------
Q7VYW3_BORPE/12-94----------------
Q8TL87_METAC/31-112----------------
S5V223_STRCU/22-98----------------
V9VWJ7_9RHOB/37-119----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window