Sequence alignment for CL0423

PF04636

A6QQS4_BOVIN/45-492GHGPSRFIPEKEILQVGSEDAQMHTLFTDSFAALGRL..........DNITLVMVFHPQYLESFLKTQHYLLQ--MDGPL
SESN1_CAEEL/1-461MHTTTKRRKAMDWLNFDPIPEV.........................DRLFRFTCKHPTLHVHMTGSYGHMFV--DISDL
A0F081_DANRE/13-444PSGPSAFIPTEEILEEGS....THEVMSDVLLSEGRA..........DHINMVMGLHPTYLACFQRTQDALLQ--LDGPL
SESN_DROME/1-497MYYAVDYYADMGQISQDCFAATQTGASDFDMDELDDL..........DQVTQVIGYHPQFHDHFLATQNFIMK--GDGPL
Q4S6X1_TETNG/118-531GNGPSRFIPEKEILKVSKVADRTQAIFEDAFSMLGRL..........DNVSVVMGFHPHYLESFLRTQHYLLQ--MDGPL
Q7PTB1_ANOGA/1-441MYSMVEYYSDMGQIGQDYGSKNSPTDSSNL.................DHVTKVIAYHPRYLDHFLNTQKFVMQ--CDGPL
A7SCG7_NEMVE/100-543FKGPSSFIPSKELPSMDTDDEQTHSLLVDSFLFNGRV..........PNVTCIIGVHPQYLDWNARTEYFLMR--GEGPL
A8WVR0_CAEBR/63-544ERMDTDLWQVVYSLCVCSAIRGEETTKTNPFVFLGRWSFGFVSQFTENLLFRFTCKHPALHVHMTGSYGHMFV--DISDL
SESN_DICDI/136-599KQRTTVFTSESQLPPLNTDDELTRKLFQDVFLQHGRV..........NHLTRILGWHPQYLEKFLLAYNTIMR--DPGPL
A2ALF5_MOUSE/41-480SRGPSAFIPVEEILREGAESLEQHLGL.EALMSSGRV..........DNLAVVMGLHPDYLSSFWRLHYLLLH--TDGPL
A2RSF4_MOUSE/37-492TRGPSAFIPEKEVVQANTADERTNFLV.EEYSTSGRL..........DNITQVMSLHTQYLESFLRSQFYMLR--MDGPL
Q6GNB9_XENLA/65-472TRGPSAYIPVSQITGPYVG............................DNIAAVMGLHPDYLHVFWKTQHQLLR--MDGAL
Q7ZVJ7_DANRE/26-470STGPSSFIPENEIIEAMPLSDSTVMLLDEEFS..GRM..........DNLTQVMGLHPHYLQAFLRCHYYLLR--MDGPL

PF02627

Q930A6_RHIME/29-113---------------------------------------------------------PALEQYTQQRLYGDVW..QRPGL
Q930A6_RHIME/156-240---------------------------------------------------------PGLVQYTTDYLFRDLW..LRPDL
Q8KL33_RHIEC/44-128---------------------------------------------------------WPMQTLVTEYCWDAIWN.RPG.L
DC4C_ACIAD/35-119---------------------------------------------------------QDFQNFISRFAWGEVWS.RPG.L
Q7D077_AGRT5/19-101---------------------------------------------------------PAHKAAWFQAIQGLGA...ASTL
Q7D1C9_AGRT5/12-94---------------------------------------------------------PEAFKAVMALENYVQS...SG.L
O06218_MYCTU/45-127---------------------------------------------------------GLLTAGWATLRETLL....VGQV
Q7WHA8_BORBR/12-94---------------------------------------------------------PRTMQALMALQSYVN....DCGL
O06800_MYCTU/26-109---------------------------------------------------------PQVYQRFVALGDAALT...DGAL
Q88GS9_PSEPK/72-155---------------------------------------------------------ANAPAALETYVTVSALN.GKSEL
O26169_METTH/26-109---------------------------------------------------------PEILEAYYDKMEKILS...NDAL
Q7WJL9_BORBR/42-124---------------------------------------------------------AALKSMWEA..FGALG...GGVI
O26336_METTH/31-115---------------------------------------------------------PDLARFVAEFAYGDVYS.R.GVL
O26787_METTH/36-120---------------------------------------------------------PDIYEAVVKLNEAAYT...GKVL
Q88IP0_PSEPK/41-115---------------------------------------------------------PVALNGYLGLAQALG....KSSL
O27018_METTH/13-96---------------------------------------------------------PEVAESFKNFREAVRS...EGKL
Q7WN29_BORBR/12-94---------------------------------------------------------PGAAAALAGVYGYVM....KSGL
O29899_ARCFU/36-119---------------------------------------------------------PEWLERQMDERQFVMS...LESI
Q8DUG8_STRMU/42-124---------------------------------------------------------PTALETYRTVGEINRR...NS.L
O30263_ARCFU/32-115---------------------------------------------------------PETLLRFIEFRDSIMA...EGKL
Q7WNG4_BORBR/34-118---------------------------------------------------------MAFQDITTQWCWGYAWT.RPG.L
YURZ_BACSU/32-115---------------------------------------------------------PLMGRKFNEFTEQCFA...GNSL
Q88K69_PSEPK/28-111---------------------------------------------------------PDTVAGYMTASGAGAK...TNHL
O53749_MYCTU/49-133---------------------------------------------------------QYLFWTFAIYTGRLL....HGRL
Q7WNI3_BORBR/39-122---------------------------------------------------------PPIAEGWLNYLTAVRQ...KASL
O53905_MYCTU/40-123---------------------------------------------------------PRLARTFNDLLATMLW...HGTL
Q89PM8_BRAJA/34-118---------------------------------------------------------PAFLDAYGKYAGYAVE...NGPL
O67982_RHOOP/297-381---------------------------------------------------------APFQDFITRTAWGDIWS.RPG.L
Q7WNR4_BORBR/34-118---------------------------------------------------------GSLRRLTDEYCFGEVWG.DET.L
O68251_DEHMU/42-118---------------------------------------------------------DVYFATDTMVSKFLLK...ETLL
Q88N35_PSEPK/35-119---------------------------------------------------------GEFQEMITRHAWGDIWT.RPG.L
O69814_STRCO/47-126---------------------------------------------------------ALVAPAWALMRESLLA...GP.G
Q7WPN1_BORBR/34-118---------------------------------------------------------APFQALATEYCWGRVWG.RDE.L
YBE3_SCHPO/128-205---------------------------------------------------------LDLANIALDYAYGKVLS.FNEVV
Q8DKG6_THEEB/35-118---------------------------------------------------------PDAMKAFYSLSRASSI...PGAL
O86608_STRCO/355-439---------------------------------------------------------GDFQEFLTRYAWGEIWD.RPG.L
Q7WPY0_BORBR/32-117---------------------------------------------------------PALAQMTDDVLFGGLWE.RPQ.L
YCO4_PARDE/21-104---------------------------------------------------------ASIDDAFLALSKVVFA...DGAL
Q7WQ74_BORBR/23-106---------------------------------------------------------PETVKGYQQLSAAGKQ..TNQ.L
Y4147_CUPNH/24-107---------------------------------------------------------PAAMSAFQGVMKAATQ...DGSL
Q89PR3_BRAJA/12-94---------------------------------------------------------PAGVKALGGVRGYVM....QSGL
YNQ5_PARDE/35-121---------------------------------------------------------DAVAETVVGHGMGEVYA.REG.L
Q81CE2_BACCR/28-111---------------------------------------------------------PEIAETYNAFTQACFQ...EGAL
YNQ6_PARDE/40-126---------------------------------------------------------PTIPADMLEMWFGKTFN.REG.L
Q89CI6_BRAJA/13-94---------------------------------------------------------PEAMNVLQSLGNLT.....KQGL
YJ81_YEAST/199-283---------------------------------------------------------DLWYYTLVHVYGPLFA..FDEIL
P71826_MYCTU/26-111---------------------------------------------------------GEFFALTVDHLFGRIWT.RPG.L
Q8CL33_YERPE/30-114---------------------------------------------------------PKMAQLTDDVLYADIWE.RPQ.L
P73604_SYNY3/23-107---------------------------------------------------------PKFGDFCTRVAGEAWG...LPLI
Q81RU7_BACAN/19-103---------------------------------------------------------PAFAHYSEKILFEEVW..RDDTL
Q89CP9_BRAJA/40-125---------------------------------------------------------AGHGRAWDKFRAGGLL..DPGPL
YDFG_BACSU/12-94---------------------------------------------------------PEGMKIMMDMEKYTK....QSSI
Q828B2_STRAW/38-123---------------------------------------------------------PELGHQIVSWAFGDIYD.RPG.L
Q52659_RHOCA/40-126---------------------------------------------------------PTLPADMLEMWFGKTFN.RDG.L
Q89RQ0_BRAJA/34-116---------------------------------------------------------PEMARAFNGIGGYIRF...KSKL
Q53427_LEGPN/38-123---------------------------------------------------------ANSPAALEAYIGIMTSL.SKGAL
Q82A02_STRAW/34-115---------------------------------------------------------PKVFRALIGFDAAAR....EG.I
Q54401_STRLA/19-103---------------------------------------------------------APEFAAWLAFQNAVDR..QDGAV
Q89D50_BRAJA/12-94---------------------------------------------------------PDTLKALIAVDDQIKA...SG.L
AHPD_MYCTU/93-176---------------------------------------------------------GRYDDLRPGLRMNIIA...NPGI
Q82HT0_STRAW/32-114---------------------------------------------------------PDVYKAMIRLDTAA.....QRGL
Y1053_HAEIN/24-107---------------------------------------------------------PKMLQAYQALGAAAAE...GNVL
Q8E1D2_STRA5/17-102---------------------------------------------------------PEFARYNDDILFGEVWA.KEDHL
Y742_METJA/19-103---------------------------------------------------------PDLYDIIVKLNDTVFT...GKTL
AHPD_STRAW/94-177---------------------------------------------------------PEYGTLRAGLRMNVIG...NPGV
Y1511_METJA/18-101---------------------------------------------------------PEFYEAVANLQKEVFS...GKKL
Q7MJJ5_VIBVY/55-138---------------------------------------------------------PTVLNSILAFGDSLG....KGKL
Q89SZ5_BRAJA/50-134---------------------------------------------------------EANMIPAMRLGNSILH...KQKL
Q7NI16_GLOVI/40-125---------------------------------------------------------PQVMRAVMNLYGAIHTH.SDT.I
Q82MF4_STRAW/285-369---------------------------------------------------------ARFQDFISRYAWGEIW..TDSTL
Q7NMU5_GLOVI/47-129---------------------------------------------------------PAAYRALLGLGSYVES...SG.L
Q89F01_BRAJA/58-143---------------------------------------------------------PEVLEARTKTDKDIFYN.VADGL
Q7NSY1_CHRVO/13-97---------------------------------------------------------PKLDQLTREALFGDVWQ.R.AAL
Q82MM5_STRAW/103-186---------------------------------------------------------PRVLWADLRFEQSVAK...WNRL
Q7NX57_CHRVO/41-125---------------------------------------------------------PAALEGYLALNGALG....KGKL
Q8D1N8_YERPE/49-133---------------------------------------------------------RPVQKLITEYCWGEVW..GDPAL
Q7NXV7_CHRVO/15-94---------------------------------------------------------YQAQAGLERYIRGC......G.L
Q82PT4_STRAW/14-96---------------------------------------------------------AKFLRYINS.AGKAVS...DSTL
Q7P0I8_CHRVO/10-92---------------------------------------------------------PKAYQGLLACKNALA....ESGL
Q89I69_BRAJA/24-107---------------------------------------------------------PDTMKGFAALAQAATR...DGAL
Q7P1X7_CHRVO/26-109---------------------------------------------------------PEVMQGFNDMARAATR...DGAL
Q82QS6_STRAW/57-140---------------------------------------------------------PDLYEQFMPFGGQLLR...RGRL
Q89UN1_BRAJA/34-118---------------------------------------------------------RPFQEMLNEYCWGTVWG.REE.L
AHPD_COXBU/96-175---------------------------------------------------------SEYQRLPANLRMNIIA...NPGI
Q89IH0_BRAJA/35-120---------------------------------------------------------TDFQDLITRYAWGEIWT.R.PHF
Q840R0_9GAMM/10-95---------------------------------------------------------LVSPNGIRSLRDLETYL.HGSNL
Q89IL8_BRAJA/43-126---------------------------------------------------------PKTLRRTWESIKEVMA...PGAL
Q7ULD6_RHOBA/54-137---------------------------------------------------------PAVLDAYLKFSGALA....VGAL
Q84H85_9MICC/39-123---------------------------------------------------------SELGDYIVSFAFGDIYS.RDS.L
Q7UPD1_RHOBA/39-122---------------------------------------------------------PEYMRAYEDLGKAARE...SGPL
Q89XS3_BRAJA/55-139---------------------------------------------------------PESLAVRSPLFNLIMY..GKDGL
Q7USN7_RHOBA/41-121---------------------------------------------------------PDVLGGMTQINDGL.....QNDL
Q89LE4_BRAJA/50-134---------------------------------------------------------PALEAYTQNRLLGDVWK.RPG.L
Q7UTX7_RHOBA/162-245---------------------------------------------------------AESPALLEAYRTIAGIFDTKTNL
Q872E4_NEUCS/44-109---------------------------------------------------------PPVADGWNSFLGAIRT...QTLL
Q7VG56_HELHP/77-162---------------------------------------------------------PDLGRFIIEFAFGDIYT.R.GEL
Q89LE4_BRAJA/177-261---------------------------------------------------------PGVVQYTTDVLFRDLWL.RPD.L
Q7VG63_HELHP/82-166---------------------------------------------------------PEFFSNYVNFAFDEVP..SESKL
Q7VG63_HELHP/216-301---------------------------------------------------------QHIRTFLSANCFGDYYT.R.GGL
Q87FG9_VIBPA/24-106---------------------------------------------------------VLTMTTISAVMPAFAT...DK.L
Q87FG9_VIBPA/158-243---------------------------------------------------------PQIDQYLKAHLFGDIFA.R.DLL
Q8D7H9_VIBVU/12-94---------------------------------------------------------PQALTAMLGIENYLA....DTAL
Q7VTI6_BORPE/91-170---------------------------------------------------------AQLKSLPAQLRMNAYA..THGGV
Q8A7Y1_BACTN/178-261---------------------------------------------------------PELDAIFGNFTKEVQQ...YGNL
Q7VW83_BORPE/12-94---------------------------------------------------------PELFKKFVAFSLALK....QSSI
Q87H24_VIBPA/33-118---------------------------------------------------------PDLAKFTIEYPFGDIYT.REG.L
Q7W0B6_BORPE/40-124---------------------------------------------------------ASLQKLVTEYCWGEVWT.RPG.L
Q87WR5_PSESM/34-118---------------------------------------------------------QPLQDFVNEHAWGSVWS.RDG.L
Q8A7Y1_BACTN/311-396---------------------------------------------------------KHIQRYLSANCFGDYQT.R.GGL
Q87XC8_PSESM/23-106---------------------------------------------------------PETMKGMAALGAAGSK...TNHL
Q89M11_BRAJA/16-98---------------------------------------------------------PDAYDLVLALGQVAAK...AG.L
Q881M4_PSESM/43-127---------------------------------------------------------PVMAHNTDTLLFDEVWK.R.SEL
Q881M4_PSESM/170-254---------------------------------------------------------PGLVQYTTSALFNDLWL.RPG.L
Q8DV36_STRMU/17-102---------------------------------------------------------PEFAHFNDDMLFGENW..NNQDI
Q89N13_BRAJA/21-105---------------------------------------------------------PVEANAFLAFNHAV..ERKDGLI
Q881R7_PSESM/57-141---------------------------------------------------------PDILRQRSQAFNAIMY..APGGL
Q89NA9_BRAJA/36-119---------------------------------------------------------PSYFEQYCRLGGAIRH...KGEL
Q88GS0_PSEPK/34-118---------------------------------------------------------KPLQELVTEYCWGHVWG.REG.L
Q8A8P6_BACTN/142-227---------------------------------------------------------PALDQFLKAHLFGDIFS.RDN.L
Q8EKK9_SHEON/33-118---------------------------------------------------------PDLGKYIIEYPFGDIYQ.REG.L
Q8EMR2_OCEIH/26-109---------------------------------------------------------PEVFHSFFAFNNKALE...EGKL
Q8EMR2_OCEIH/135-218---------------------------------------------------------EDAFKAFLTFDGATLE...EGKL
Q8EWL7_MYCPE/18-103---------------------------------------------------------PEFAALNDDVLFGQVWS.RESQL
Q8FER3_ECOL6/13-95---------------------------------------------------------PAVYNALVQ.AKTALE...NSTL
Q8FN18_COREF/270-361---------------------------------------------------------PQALKARTLTDLDIFYNTDGEGV
Q8FN50_COREF/40-124---------------------------------------------------------RPFQDFITRTAWGDVWE.REG.L
Q8FN71_COREF/14-100---------------------------------------------------------PEPYKQLVEVSKTLKKIYPEVDL
Q8FQN1_COREF/33-119---------------------------------------------------------PGSSDWVVGAVFGGTYQ.REG.L
AHPD_BRUSU/94-170---------------------------------------------------------KDYRTMPARLRMNVIS...NPGV
Q8FW21_BRUSU/42-126---------------------------------------------------------APFQALITEAAWGTVWA.RPG.W
Q8GMC9_STRGL/56-141---------------------------------------------------------PDAAAPLNHLANVLLR..APASL
Q8GMI8_STRGL/41-122---------------------------------------------------------PVVLETYAAITGAVAE...HGTF
Q8GQ78_PSEAI/24-107---------------------------------------------------------PQVMKSFGEMGKAAIA...DGAL
Q8KL13_RHIEC/51-135---------------------------------------------------------WPMQELVTEYCWDNIWN.RPG.L
Q8NLN6_CORGL/20-105---------------------------------------------------------PDAFKAFVHFDEAALRG.PNKKI
Q8NMX8_CORGL/269-355---------------------------------------------------------PAALKARTLTDLDIFFNTDGEGL
Q8NN44_CORGL/15-100---------------------------------------------------------EPYKNMLELTKTLRKIY.PDVDL
Q8NRJ9_CORGL/17-103---------------------------------------------------------PKSAELNDDVLFGQVWS.RESEL
Q8NUW4_STAAW/10-92---------------------------------------------------------GELMSVMSQGEKFIH....QSPV
Q8PBZ0_XANCP/31-114---------------------------------------------------------NQVVRRFFALDTQTYQ...AGAL
Q8PDG7_XANCP/35-119---------------------------------------------------------GEFQDMITRHAWGTIWT.RDG.L
Q8PSC4_METMA/27-113---------------------------------------------------------EDFGEGLAGFYKSVWAE.REGGL
Q8PT04_METMA/24-107---------------------------------------------------------PEFFKLLESTRGLAFS...EDGM
Q8PUU3_METMA/18-101---------------------------------------------------------PETAEAFGQMRNSIFK...DAFL
Q8PYE4_METMA/43-127---------------------------------------------------------PEIFIPKTLYDNSIMR..EVKNL
Q8PYL6_METMA/19-102---------------------------------------------------------PGVMKALMGLHSEVVK...DGAL
Q8PYV8_METMA/9-92---------------------------------------------------------PETAEAFGKLRSSIFE...GGEL
Q8PZ63_METMA/30-113---------------------------------------------------------PEFLGKYRRCDGKLLS...DGAL
Q8PZJ3_METMA/27-110---------------------------------------------------------CSTYNSFLELEKKAFE...AGSL
Q8PZX1_METMA/20-103---------------------------------------------------------SDSLKKYNRCNKKLLS...DGAL
Q8Q0J3_METMA/14-97---------------------------------------------------------PEVAARFNDLIEAQKA...LKGL
Q8RCV6_THETN/21-104---------------------------------------------------------PEVMRAFNQLHHAATK...NGAL
Q8RN34_CAMJU/39-124---------------------------------------------------------AFINDFLSANCFGDYYT.R.MGL
Q8RR45_STRSU/50-134---------------------------------------------------------ANSPTALETYQTVSGIN.RRSSL
Q8TN24_METAC/40-121---------------------------------------------------------EDLFTSWLALGEMLLV...RGRL
Q8TNJ6_METAC/14-97---------------------------------------------------------PELFSLLENMRELSFA...EGGI
Q8TP59_METAC/27-113---------------------------------------------------------EDFGEGLASFYQAIWAE.REDGL
Q8TTM1_METAC/27-111---------------------------------------------------------PELIEVFDNFAFDEVI..SYGNL
Q8TXW6_METKA/29-113---------------------------------------------------------DEYAEVVEELHRIIWK...ESPL
A9CKY5_AGRT5/48-130---------------------------------------------------------PDTARRFTGHFEHLFAA.TGRRL
A9CKY7_AGRT5/64-149---------------------------------------------------------PGTALRIMAFYEHLFDQ.SNSHL
A9CIC5_AGRT5/44-127---------------------------------------------------------DLLEKTWAEVKAVMAT...PSAL
A9CL79_AGRT5/55-127---------------------------------------------------------AEALNERTPLFNDIMY..SDGGL
A9CLJ3_AGRT5/34-118---------------------------------------------------------RPFQDILNEYCWGMAW..TDDAL
Q8XQ14_RALSO/17-101---------------------------------------------------------PALADYTDNVLFGDVWQ.RPG.L
Q8XX67_RALSO/35-119---------------------------------------------------------APFQDLITRYAWGEIWT.RPG.L
Q8XYW1_RALSO/93-173---------------------------------------------------------ADLAQQPAELRMNAYA..GSGGV
Q8Y1Q8_RALSO/21-105---------------------------------------------------------PVLVPYTRHRIVEELWH.RPG.L
Q8Y1Q8_RALSO/150-234---------------------------------------------------------QALLHFTDALLNHEVWL.RPG.L
Q8Y972_LISMO/15-97---------------------------------------------------------PEVHSAWMETVHKLDA...ASKL
Q8YLD1_NOSS1/42-125---------------------------------------------------------PTLKRTWETIKEVMAS...PGEL
Q8ZSI6_NOSS1/44-126---------------------------------------------------------AESPATLRGGMALWDLF.ETTSF
Q92S80_RHIME/12-94---------------------------------------------------------PDAYKAVAALDSYVK....GSGI
Q92XD0_RHIME/12-93---------------------------------------------------------PSLMKSWFSISTAV.....ASSL
Q930M4_RHIME/49-134---------------------------------------------------------EDLARFTIQYPYGDVLS.RDG.L
Q930M4_RHIME/170-255---------------------------------------------------------PDFVNWREHTLGEEIF..GAVHL
Q930M4_RHIME/308-395---------------------------------------------------------PGLGRLIVAHCYGDIFC.RPA.L
Q93HH4_STRAW/42-128---------------------------------------------------------PKAYHALVETSEAVRAVAADAGL
Q978P3_THEVO/22-105---------------------------------------------------------PDLTESFLSFMEKTLG...KGEL
Q97UW0_SULSO/43-128---------------------------------------------------------RELQEMVTIFAWGLIWT.RDDVI
Q984R0_RHILO/14-98---------------------------------------------------------AGLPGAWAEVKAIELS..DKTAL
Q987X0_RHILO/12-95---------------------------------------------------------PSLMKKWQR.SSIELS..AAASL
Q98BX3_RHILO/57-141---------------------------------------------------------VAIAGAWAEIKGVQLN..PKTAL
Q98JY9_RHILO/46-129---------------------------------------------------------VSLKRVWEQLKAVMLA...DSAI
Q98K47_RHILO/12-94---------------------------------------------------------PEIMKAVSALNKAVD....ECGL
Q98L97_RHILO/13-95---------------------------------------------------------PGALQALLALDKSTEA...AD.I
AHPD_CAUCR/95-178---------------------------------------------------------AAYQALPCRLRLNRLA...HAGA
Q9A3V6_CAUCR/52-136---------------------------------------------------------PDILRHAAQ..GFALYRDPVRKL
Q9A5N6_CAUCR/302-387---------------------------------------------------------ADYQAMITRYAWNEIWG.RPG.L
AHPD_BRAJA/95-178---------------------------------------------------------PEYKTMPPRLRMDVIG...NPGV
Q9CB37_MYCLE/51-135---------------------------------------------------------QLLFWAWLIYGGRLL....RGKL
Q9CE69_LACLA/31-116---------------------------------------------------------PDLNNLMLKFAFGTIYE.R.GVL
Q9CFE3_LACLA/16-101---------------------------------------------------------PKFAELNDDILFGEVWS.REKEL
Q9FC57_STRCO/14-95---------------------------------------------------------GKVMKHLNSAGAAV.....QAAL
Q9HLI4_THEAC/22-105---------------------------------------------------------PELTDRFLSFMESTLG...KGSL
Q9I1E7_PSEAE/38-118---------------------------------------------------------ANAPAALETYLTVSGLN.AKASL
Q9I5X1_PSEAE/24-106---------------------------------------------------------PKMLAAYGALEEASA....EGAL
Q9I6M1_PSEAE/12-94---------------------------------------------------------PDAYAAMLGLEKALAK...AG.L
Q9K796_BACHD/28-111---------------------------------------------------------PEIAEKYNAFTEACFA...KGEL
Q9KX42_RHIRD/39-123---------------------------------------------------------QPFQQLITEGAWGTVW..SGNHF
Q9KXX7_STRCO/38-123---------------------------------------------------------YDFTRIATEHAFNDAWT.RSEHL
Q9KZB1_STRCO/28-109---------------------------------------------------------PEVYKAMIRLETVA.....KRGL
Q9KZB2_STRCO/10-92---------------------------------------------------------REVGKALSALSAAAK....KGLG
Q9L5A7_9PROT/34-118---------------------------------------------------------QPFQELITEAAWGTVWA.SDR.I
Q9L5B1_9RHOB/33-117---------------------------------------------------------TPFQEMIAETAWGNVWA.SDR.I
Q9LBE9_PSEHY/66-154---------------------------------------------------------PEEFRAFFAYHDALME..RPSNL
Q9PCL2_XYLFA/167-252---------------------------------------------------------PAANEYLRSHLFGDIFK.RDN.L
Q9RDI4_STRCO/14-96---------------------------------------------------------GRFAKRFAGVGMLVH....QSAL
Q9RJG5_STRCO/31-117---------------------------------------------------------PEAYAALRATAEAVRGVAEAAGL
Q9RTJ7_DEIRA/77-160---------------------------------------------------------EQFLAWWNYFNLLVNK...EGGL
Q9RV26_DEIRA/68-152---------------------------------------------------------ADFQRFMTEYAWGAVWG.R.GGL
Q9RVP9_DEIRA/30-114---------------------------------------------------------PDLMAYIRDFAYDTVYE.RPG.L
Q9WYF2_THEMA/12-95---------------------------------------------------------PEVSGAVVRMRNKAFS...DGSI
Q9X1V5_THEMA/22-105---------------------------------------------------------TLNTKRFFNLDSAVYR...PGKL
AHPD_STRVD/94-172---------------------------------------------------------HEYGNLRAGLRMNVIG...NPGV

PF04636

A6QQS4_BOVIN/45-492PLHYRHYIGIMAAARHQ-CSYLV---NLHVND--FLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGL
SESN1_CAEEL/1-461PASARHYLALMAASRHR-CLSLM---DHHRRK--FLEKGGQQMWLLGIDWSYMKFRKLDYLNRMLCHRPWMIHWKNLAVL
A0F081_DANRE/13-444PLSWRHYIVILAAARHQ-CSYLV---QHHSSA--FLLAGGDESWLRGVHCAPPKIQHLQTLNKLLAHRPWIITQEHIQEL
SESN_DROME/1-497PNDYRYYLAIIAAARHQ-CPYLV---KRYEKE--FINQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHIERL
Q4S6X1_TETNG/118-531SLHYRHYIGIMAAARHQ-CSYLV---NLHVND--FLQVGGDPKWLNGLDQAPPKLQQLGELNKVLAHRPWLLTKEHIEE.
Q7PTB1_ANOGA/1-441PYDYRNYIAIMAAARHK-CTYLV---NLYEEI--FLANGGDPNWLNGLEHIPPKLRAISDINKILAHRPWLLNKEHVERL
A7SCG7_NEMVE/100-543PYDWRHYIAIMAASRHQ-CSYLV---SIYERE--FLRYHGDKQWLKGIQHIPKKLHALLDMNKYLAHQPWLVSTQLIEKL
A8WVR0_CAEBR/63-544PAPSRHYLAVMGASRHR-CLSLI---DHHRRK--FLEKGGNPYWLLGVDWAHMKYRKLDYLNRMICHRPWMIHWKNFAVL
SESN_DICDI/136-599PLHWRNYIGILAAARYK-CSYII---ALQEHE--FLMNNGDARWLQGIDHIPAKLKNLLKVIELLAHQPWLLPKLDIEYL
A2ALF5_MOUSE/41-480ASSWRHYIAIMAAARHQ-CSYLV---GSHMTE--FLQTGGDPEWLLGLHRAPEKLRKLSEVNKLLAHRPWLITKEHIQAL
A2RSF4_MOUSE/37-492PLPDRHYIAIMAAARHQ-CSYLI---NMHVDE--FLKTGGIAEWLNGLEYVPQRLRNLNEINKLLAHRPWLITKEHIQKL
Q6GNB9_XENLA/65-472SLPERHYVAIMASARHQ-CTYLV---SLHSSC--FLQVGGDPRWLEGFDAAPLKLRKLNDLNKILAHRPWLINKEHIEIL
Q7ZVJ7_DANRE/26-470PLHYRHYIAIMAAARHQ-CSTLV---CHHVQE--FEQIGVCSDWLRGLEFCPQRLRNLNEINKILAHRPWLITKQHIQAL

PF02627

Q930A6_RHIME/29-113NRRDRSLVTIAALIARG.EAPAL...TYYADQ..AL.ENGVKP...----------------------------------
Q930A6_RHIME/156-240APRDRSLVTIAALISVG.QVEQI...TFHLNK..AL.DNGLSE...----------------------------------
Q8KL33_RHIEC/44-128ERKQRSILNLGMISALN.RPH..E.LKLHVRG..AI.NNGLTK...----------------------------------
DC4C_ACIAD/35-119PRHTRSLVTIAVLLALG.RED..E.LRMHLRA..CF.NNGVTK...----------------------------------
Q7D077_AGRT5/19-101DVKTQSLIYIGILAALR.LESGI...GFHVME..AK.ARGASR...----------------------------------
Q7D1C9_AGRT5/12-94EHRFIHLIKLRASIING.CAFCV...DMHVKE..SR.HDGLSE...----------------------------------
O06218_MYCTU/45-127PRGRKEAVAAAVAASLR.CPWCV...DAHTTM..LY.AAGQTD...----------------------------------
Q7WHA8_BORBR/12-94EHSLLELVKMRASQING.CAFCL...NLHYTE..AR.RQGESE...----------------------------------
O06800_MYCTU/26-109SRKVKELVALAIAVVQG.CDGCV...ASHAQA..AV.RAGATA...----------------------------------
Q88GS9_PSEPK/72-155GLAEREVVQLIAATQHG.CDFCV...AGHTAV..AL.NKAKLP...----------------------------------
O26169_METTH/26-109PLVTKELIGVGAAAALG.SEHCL...KTHIKA..AK.RLDAGG...----------------------------------
Q7WJL9_BORBR/42-124AARLGEQIAVAVANRNR.CEYCL...AAHTAL..GR.KAGASA...----------------------------------
O26336_METTH/31-115DLKTRELLTLAALTVLR.ADD..Q.LKSHVRG..AL.NAGCSK...----------------------------------
O26787_METTH/36-120DYRTQKLIALGITAANS.DDRAV...KKQIQS..AINEFGVTR...----------------------------------
Q88IP0_PSEPK/41-115SAAEREVVALATSEING.CDYCL...AAHTFF..GG.KAGLSD...----------------------------------
O27018_METTH/13-96TEREKLLISVACSVAVR.CDACT...RRHAEE..AL.EAGITE...----------------------------------
Q7WN29_BORBR/12-94APALVELVYLRVSQINN.CAYCL...DMHTRD..LL.KQGVAV...----------------------------------
O29899_ARCFU/36-119PEKYKHLIMIAVAAAVG.SKMCT...EVFTKI..AK.RRGVSE...----------------------------------
Q8DUG8_STRMU/42-124TPTEREVVQITAAVTNG.CAFCV...AGHTAF..SI.KQIQMA...----------------------------------
O30263_ARCFU/32-115NPILKEKIALAVSKVNY.CNPCL...ISHSRK..LE.MMGESI...----------------------------------
Q7WNG4_BORBR/34-118ERKTRSIINLAMLTALN.RPGEI...KLHVKG..AL.TNGVTP...----------------------------------
YURZ_BACSU/32-115TEREKQLIALGIAINAQ.DEYCM...IYHTKG..CL.DQGASE...----------------------------------
Q88K69_PSEPK/28-111DAKTRELISLAVAVTTR.CDGCI...AVHSQQ..AV.KAGASR...----------------------------------
O53749_MYCTU/49-133PGVDTELVILRVAHLRS.CEY..E.LQHHRRM..AR.RRGLDA...----------------------------------
Q7WNI3_BORBR/39-122SGALRELVIVRVAQING.APYEA...DQHIPI..AL.KEGVSQ...----------------------------------
O53905_MYCTU/40-123DSRLRELVIMRIGWLTD.CDYEW...TQHWRV..AS.GLGVSA...----------------------------------
Q89PM8_BRAJA/34-118SPKMRELIYVALDGSAT.HLFRSG.LALHLRL..AL.QEGASA...----------------------------------
O67982_RHOOP/297-381DHELRRLLTIAVLTAVG.NEH..E.LDMHIRA..AL.RAGVDA...----------------------------------
Q7WNR4_BORBR/34-118TPKQRSMLVIALLACMG.RVQ..E.LKTHVGG..AV.NNGCNV...----------------------------------
O68251_DEHMU/42-118PYVTKQRIAILVSLDNG.CKMCA...GVHKQL..AR.ALGVSE...----------------------------------
Q88N35_PSEPK/35-119PRHTRSLITIAMLIGMN.RND..E.LKLHLRA..AA.NNGVTR...----------------------------------
O69814_STRCO/47-126DRTGKEVAAFGVSQANK.CRFCV...DAHTMLLHAT.GDHALA...----------------------------------
Q7WPN1_BORBR/34-118DRRTRSIANIAMMIALN.RAP..E.LRIHIKG..AL.TNGVPR...----------------------------------
YBE3_SCHPO/128-205SPLETSLMIIAALVPQD.VNP..Q.LRGHLKG..AL.NHGATK...----------------------------------
Q8DKG6_THEEB/35-118DTKTKELIALAIGVAKH.CDGCI...AFHTRA..AL.QAGATP...----------------------------------
O86608_STRCO/355-439DRRSRSCVTLTALVAGG.HLD..E.LAPHLRA..AL.RNGLTP...----------------------------------
Q7WPY0_BORBR/32-117SKRDRSLITCTALVALG.ATE..Q.MATHFPR..AL.ENGVTR...----------------------------------
YCO4_PARDE/21-104DKRTKQLIAVAVAHVTQ.CPWCI...EGHVKG..AR.REGATN...----------------------------------
Q7WQ74_BORBR/23-106DAKTRELIALAVAVTTR.CDGCI...AVHAKA..AT.DNGATK...----------------------------------
Y4147_CUPNH/24-107PAAVKELIAVALAVQKG.CDDCV...LFHTSQ..AL.RHRATR...----------------------------------
Q89PR3_BRAJA/12-94SPTLVELVYLRISQINN.CAYCL...DTHTRD..LL.KKGVKI...----------------------------------
YNQ5_PARDE/35-121DLKTRLLVTVGALAAMG.GQTRPQ.LKVNVAS..AL.RAGASA...----------------------------------
Q81CE2_BACCR/28-111TKREKQLIALGISLATQ.DEYCT...IYHTKG..CL.DQGCSD...----------------------------------
YNQ6_PARDE/40-126DAKTRLLLTIGAITVQG.ALAEPQ.LRMTVRQ..AL.AAGATK...----------------------------------
Q89CI6_BRAJA/13-94PEKLLELVHLRASQING.CSVCV...DMHPKI..AR.KAGETD...----------------------------------
YJ81_YEAST/199-283SAQETSLVIIASLVPQD.VNP..Q.LRGHLKG..AL.NIGCDK...----------------------------------
P71826_MYCTU/26-111SMRDRRMAVIAVLTAQG.QSD..L.LEVQVNA..VLHNDELTI...----------------------------------
Q8CL33_YERPE/30-114SKRDRSLVTVSALVAMD.RPD..Q.LRSHLRL..AR.QNGVTE...----------------------------------
P73604_SYNY3/23-107DQKTKALIVIAVDVANQ.TLS..GPFQAHVDM..AL.KQGATK...----------------------------------
Q81RU7_BACAN/19-103TLRERSLCTVSVLISLG.NTE..Q.LPFHLRL..AK.QNGIKE...----------------------------------
Q89CP9_BRAJA/40-125SLRQREIVIDRTCALSK.CEYEW...GVHVAV..FAGPARLTE...----------------------------------
YDFG_BACSU/12-94NRTTRELIKIRVSQMNG.CAFCI...DMHTSD..AR.KMGETE...----------------------------------
Q828B2_STRAW/38-123APRDRQLVTLGMLTALGGCEV..Q.LEVHVNA..AL.NVGLSP...----------------------------------
Q52659_RHOCA/40-126DARTRLLVTLAGQVTLG.AQAEAP.IRLTIRH..AL.EAGATE...----------------------------------
Q89RQ0_BRAJA/34-116DPRLRELAILQVGWMER.SEY..E.FTHHVKI..GK.EFGVTD...----------------------------------
Q53427_LEGPN/38-123NPKLREQIALVSAGYNG.CNYCA...SAHTYL..GE.KAGINK...----------------------------------
Q82A02_STRAW/34-115DPALVELIQIRASHLNH.CAYCL...HMHTND..AR.KAGESE...----------------------------------
Q54401_STRLA/19-103PRRYRELISVAVALVTQ.CAYCL...DVHTEA..AR.RHGVTA...----------------------------------
Q89D50_BRAJA/12-94EQSLIELVKTRASQING.CAFCI...NMHTED..AR.KRGETE...----------------------------------
AHPD_MYCTU/93-176PKANFELWSFAVSAING.CSHCL...VAHEHT..LR.TVGVDR...----------------------------------
Q82HT0_STRAW/32-114DPKLRELVKIRASQLNH.CAFCL...DMHTKD..AL.AAGESV...----------------------------------
Y1053_HAEIN/24-107DAKTRELIALAVAVTTR.CESCI...SAHAEE..AV.KAGASE...----------------------------------
Q8E1D2_STRA5/17-102TDKTRSIITISALISGG.NLE..Q.LEHHLQF..AK.QNGVTK...----------------------------------
Y742_METJA/19-103DYKTQKLIAIGIVASRC.DEVAI...EKQMKS..AMKELGITK...----------------------------------
AHPD_STRAW/94-177EKVDFELWSLAVSAVNG.CGQCL...DSHEQV..LR.KAGVDR...----------------------------------
Y1511_METJA/18-101DEKMQRLVLLAVVATLG.DEKAV...KRQTKK..LM.EMGATI...----------------------------------
Q7MJJ5_VIBVY/55-138TARQRELVALAVGQANA.CQYCL...SAHTLI..AS.STGLTK...----------------------------------
Q89SZ5_BRAJA/50-134SAVNRELLILQAAQLEG.GAYEW...RQHVPI..AL.GVGCTQ...----------------------------------
Q7NI16_GLOVI/40-125SDELKELISLRVAQINSCRDYCV...PMHTYM..LH.KQGTVE...----------------------------------
Q82MF4_STRAW/285-369TRRERSMITLTALVAHG.HYD..E.LALHVRA..AR.RNGLTP...----------------------------------
Q7NMU5_GLOVI/47-129DPKVLDLIKIRASQLNG.CAFCL...DMHTTE..AR.KAGEAE...----------------------------------
Q89F01_BRAJA/58-143PRAERELAAAATSRYNG.CIYCA...SVHARF..AS.TYSKRR...----------------------------------
Q7NSY1_CHRVO/13-97SPRERSLITIAALLGQS.RPHAL...AFHLRR..GR.DNGLAA...----------------------------------
Q82MM5_STRAW/103-186DPDLKALAEMTAAATIG.CAWCM...DFGYWV..SR.ERGMAR...----------------------------------
Q7NX57_CHRVO/41-125SAGLRERIALAVAEFNG.CDYCL...SAHSYL..AKHVAKLGD...----------------------------------
Q8D1N8_YERPE/49-133TFKTRSMLNIGILTAMG.QHH..E.LSLHVKG..AL.RNGVTR...----------------------------------
Q7NXV7_CHRVO/15-94DHALLELVKTRVSQLNG.CAFCI...DMHTKD..AR.AAGETE...----------------------------------
Q82PT4_STRAW/14-96PAATQELVKIRASQING.CGFCT...DMHTKD..AT.HAGETS...----------------------------------
Q7P0I8_CHRVO/10-92GLPLIELAYLRVAQLNG.CAFCL...KLHSQA..LR.RRGESQ...----------------------------------
Q89I69_BRAJA/24-107DKKTKELMALALGVAAH.CDGCI...GFHTEA..LV.KLGATR...----------------------------------
Q7P1X7_CHRVO/26-109DKKTKELIALALGVAAR.CDGCL...GFHAQA..LV.KLGASK...----------------------------------
Q82QS6_STRAW/57-140PARLRELLILRTSCNTG.TRYEW...GRHLTL..AK.AAGVTD...----------------------------------
Q89UN1_BRAJA/34-118PRKTRSMLNIAMIAILN.RQH..E.FRAHLKG..AL.TNGVTR...----------------------------------
AHPD_COXBU/96-175DKKDFELYSLAVSAING.CGLCI...DAHANT..LI.KAGFSK...----------------------------------
Q89IH0_BRAJA/35-120DERTRRVLVIGTMVALG.QWD..E.FRLHVRA..ALAEGGFTP...----------------------------------
Q840R0_9GAMM/10-95EPALLELVKLRASILNG.CAFCI...DMHSKE..AR.ARGEME...----------------------------------
Q89IL8_BRAJA/43-126DPKVKEMLYAAVSVAHG.CSYCI...HSHTAG..AR.AKGMTE...----------------------------------
Q7ULD6_RHOBA/54-137TAKQRERIALAVGQANS.CDYCL...SAHTAL..GK.MSGLTA...----------------------------------
Q84H85_9MICC/39-123TQQEQTMVTISTLAALG.TEV..Q.LKLHINV..GF.NVGLTK...----------------------------------
Q7UPD1_RHOBA/39-122NDREVALVKLAISLGAG.LEGAA...HSHCRK..AL.EAGCTP...----------------------------------
Q89XS3_BRAJA/55-139SPAERELGALSASVVNR.CIYCA...AVHASR..FI.SYSGRN...----------------------------------
Q7USN7_RHOBA/41-121PAKYRELAYYKASQLNS.CDYCS...HYHRQA..AK.KAGLSD...----------------------------------
Q89LE4_BRAJA/50-134APRDRSIVTLAALIARN...QTIE.MPYHFNL..AL.DNGVKP...----------------------------------
Q7UTX7_RHOBA/162-245NATERQIIAMTNNRLNG.CEYCM...AAHTSI...M.QSLKVP...----------------------------------
Q872E4_NEUCS/44-109PADERELAISRVAVCNG.AWYEW...HHHAPL..AV.QAGVSE...----------------------------------
Q7VG56_HELHP/77-162NLQEREMITLSSLLTAGGCEA..Q.LEVHINA..AL.NVGISK...----------------------------------
Q89LE4_BRAJA/177-261APRDRSLVTVSALIANG.QMA..Q.LTPHLNR..AM.DNGLTQ...----------------------------------
Q7VG63_HELHP/82-166ELKEGLMITLASLVAIP.ALS..E.FKAILNA..AL.KNGVEP...----------------------------------
Q7VG63_HELHP/216-301PLKFRELLTFVYILSMG.GAD..SQVRAHIAG..NI.RVGNDR...----------------------------------
Q87FG9_VIBPA/24-106SNKERAIVPIAAFTASG.DVE..K.LKISLND..GL.ESGLTI...----------------------------------
Q87FG9_VIBPA/158-243TWKQREIATIAALANIK.GVN..SQLAAHYNI..SM.NNGVSA...----------------------------------
Q8D7H9_VIBVU/12-94STELKELIKIRASMING.CAYCI...QMHTTE..AL.KNGIAQ...----------------------------------
Q7VTI6_BORPE/91-170DKKRFELFALAASIIGK.CHFCV...QSHYEN..LK.KDGLTV...----------------------------------
Q8A7Y1_BACTN/178-261DTKTRLMVTLASNIASQ.AQT..E.YRMMLES..AL.NAGITP...----------------------------------
Q7VW83_BORPE/12-94ETSIRDLVDIRASQING.CTFCL...DMHVKE..AT.MHGERP...----------------------------------
Q87H24_VIBPA/33-118DLKSREIATVSALTAMG...NCTPQLKVHLHA..AL.NVGCTE...----------------------------------
Q7W0B6_BORPE/40-124ERKTRSFLNLAMLIALN.RPN..E.LRLHLRG..AI.NNGVTK...----------------------------------
Q87WR5_PSESM/34-118PLKTRSLITLAALTALK.CPQ..E.LKGHVRG..AL.NNGCTV...----------------------------------
Q8A7Y1_BACTN/311-396DVKTRELLTFSILVSLGGCESQV...KGHIQG..NV.NVGNNK...----------------------------------
Q87XC8_PSESM/23-106DAKTRELISLAVAVTTR.CDGCI...AFHAAE..AK.KLGVTS...----------------------------------
Q89M11_BRAJA/16-98DKQLLELVKLRASQING.CAFCV...QHHILL..SE.RIGVPV...----------------------------------
Q881M4_PSESM/43-127SPRDRSLATVAVLVARG.QSA..E.LAAHADL..AL.KNGVTP...----------------------------------
Q881M4_PSESM/170-254APRDRSLITVTTLVANG.QVA..Q.IGYHLNR..AM.DNGLTQ...----------------------------------
Q8DV36_STRMU/17-102DLKMRCIITVVALMSSG.VTD..SSLVYHLQN..AK.NNGVSK...----------------------------------
Q89N13_BRAJA/21-105PPKYRELISLAVALTTQ.CAYCL...DVHTAQ..AA.KAGATR...----------------------------------
Q881R7_PSESM/57-141SRAERELASTVVSRINR.CVYCA...SVHAQR..FE.QLAKRN...----------------------------------
Q89NA9_BRAJA/36-119DPVVRELAITRTGILCE.APYEI...VAHKRI..GK.NVGVTD...----------------------------------
Q88GS0_PSEPK/34-118SLKERSMINLAMISALN.RPH..E.LKLHIRG..AL.RNGLSR...----------------------------------
Q8A8P6_BACTN/142-227DWRTRELSTVAALSVLD.GVK..NELNTHIAH..AK.HNGVTQ...----------------------------------
Q8EKK9_SHEON/33-118DLKTRELVTVAALTALGHCQP..Q.LNVHING..AL.NVGCTP...----------------------------------
Q8EMR2_OCEIH/26-109SVKQKELIAVAVAHITG.CPYCI...ELHVGN..VK.KQGADK...----------------------------------
Q8EMR2_OCEIH/135-218TVKEKELIAVASAHTTG.CAYCI...DLHTKN..AK.KAGASK...----------------------------------
Q8EWL7_MYCPE/18-103SLKNRSMITIASLMSQG.LFP..Q.LKSHFII..GK.ENGITK...----------------------------------
Q8FER3_ECOL6/13-95DTTLMELVYLRVSQING.CAFCL...EMHSKA..LR.KSGVPQ...----------------------------------
Q8FN18_COREF/270-361GRAEREIAATVTSRFNG.CVYCA...SVHAGR..SVEEAPERL...----------------------------------
Q8FN50_COREF/40-124DHTQRRLLTIAILTAVG.NHG..E.LDMHIRA..AL.RAGVDS...----------------------------------
Q8FN71_COREF/14-100PESLIELVSVRVSQING.CGTCL...SIHVPA..AR.RAGVPE...----------------------------------
Q8FQN1_COREF/33-119ELRDRQMLNMAALAAMG.GVE..PQLTGHIKT..AVDVAGMSR...----------------------------------
AHPD_BRUSU/94-170DKVDFELWSLAVSAING.CGMCI...DAHEDV..LR.KANVTA...----------------------------------
Q8FW21_BRUSU/42-126SKRERSIVTIALLAALG.QDDEV...AMHIRA..TR.NTGATK...----------------------------------
Q8GMC9_STRGL/56-141SRGERELIAAYVSHLND.TPFCA...GTHGAA..AAAQLDGGH...----------------------------------
Q8GMI8_STRGL/41-122DARTREAIALAVGAVDA.CAYCQ...AAHTVS..AK.VAGFT....----------------------------------
Q8GQ78_PSEAI/24-107DAKTKELIALAIGVAAR.CDGCI...GFHAKA..LV.KLGATA...----------------------------------
Q8KL13_RHIEC/51-135DRRARSILNLGMIAVLN.RPH..E.LRGHIRG..AI.NNGVTK...----------------------------------
Q8NLN6_CORGL/20-105PRNYTEMIALAVAFTTQ.CAYCI...DIHTAA..AK.KEGVTT...----------------------------------
Q8NMX8_CORGL/269-355GRAERELGATVTSRYNG.CVYCA...SVHAGR..AQ.EESGRA...----------------------------------
Q8NN44_CORGL/15-100PTSLIELVNVRVSQING.CGTCL...SLHVPA..AR.RAGVPE...----------------------------------
Q8NRJ9_CORGL/17-103SPRDRSIVIVTMLMASG.VLD..SAFESHVQR..AK.DNGVTA...----------------------------------
Q8NUW4_STAAW/10-92NDELSALIKLLISKING.CHYCV...DIHKKE..LK.ELGVTQ...----------------------------------
Q8PBZ0_XANCP/31-114DVKTKELLGLVASMVLR.CDDCI...SYHVAQ..CK.EAGVTR...----------------------------------
Q8PDG7_XANCP/35-119PAHTRSLLTLAMMVALG.CDE..E.FKLHVRA..AR.NNGVTA...----------------------------------
Q8PSC4_METMA/27-113SMKNKHLMVFAVACSNN....NVE.SAVKIME..RLHKFGATR...----------------------------------
Q8PT04_METMA/24-107PMKYKLLIAMSLDAANG.AVDGVKVLAIQ.....AM.QAGATK...----------------------------------
Q8PUU3_METMA/18-101DLKTKELIAVASSVLMR.CQFCV...DTHSQR..AI.VAGATK...----------------------------------
Q8PYE4_METMA/43-127DQDTVELISIGVASALR.CEHCL...KMHVRI..AK.RRGISK...----------------------------------
Q8PYL6_METMA/19-102SAKTKELMMVGIAVAIR.CEYCL...WKHVPE..AV.KMGATR...----------------------------------
Q8PYV8_METMA/9-92DRKTKELIAVASSVLMR.CQYCV...DVHSQR..AV.ANGASK...----------------------------------
Q8PZ63_METMA/30-113PAKTKILMALAVVASKQ.CESCT...VAQMKS..AL.NHGVTK...----------------------------------
Q8PZJ3_METMA/27-110SRKHKELMALSISIVTK.CEPCI...EWHVQQ..AC.LTGASD...----------------------------------
Q8PZX1_METMA/20-103PAKVKILIALAVVASKQ.CERCT...VVQMQS..AL.KNGATK...----------------------------------
Q8Q0J3_METMA/14-97DAKSKQLINIAIQTANR.NPRGV...QMHAMM..AK.NEGATR...----------------------------------
Q8RCV6_THETN/21-104SAKEKELIALGIAVAIR.CSYCI...LAHVNS..AL.QAGATK...----------------------------------
Q8RN34_CAMJU/39-124DLKTRELLTLVYLISLG.GLD..NQVKAHIQG..NL.NMGQSR...----------------------------------
Q8RR45_STRSU/50-134NPTEREVVQITAAVANG.CGFCV...AGHTAI..SI.KQVKMP...----------------------------------
Q8TN24_METAC/40-121SPRDRELAILRVALRTE.CEYEW...ANHSLG..AL.GAGVTG...----------------------------------
Q8TNJ6_METAC/14-97PLKYKFLIAMALDAANG.AVDGVKVLAIQ.....AM.EAGATK...----------------------------------
Q8TP59_METAC/27-113SMKQKHLMVFAIACSNN.NIESA...VKILER..LK.KFEATR...----------------------------------
Q8TTM1_METAC/27-111DTKTRMMVILGSLIASQ.TLS..E.YKVMLGG..AL.NVGVTP...----------------------------------
Q8TXW6_METKA/29-113DDKTKHLIALALAAAAG.DERRV...GLIAET..AKNVAEVTD...----------------------------------
A9CKY5_AGRT5/48-130PLQDRELIAVVVSATNG.CGVCE...IHHTRA......FGDLL...----------------------------------
A9CKY7_AGRT5/64-149SASERELIAVVTSVATG.CSYCVFNHRPALAA..AL.GDRVLA...----------------------------------
A9CIC5_AGRT5/44-127DPLVKEMLYIAVSVTNG.CSYCA...HSHTAA..AK.AKGMTN...----------------------------------
A9CL79_AGRT5/55-127SRGGREIGALAASFVNH.CIYCA...AVHANR..YI.QLEKRP...----------------------------------
A9CLJ3_AGRT5/34-118DLKQRSLLNLGMLAALG.RMH..E.FRIHFRG..AL.RNGLTE...----------------------------------
Q8XQ14_RALSO/17-101SPRDRSLITVASLIALY.RTN..E.LPFHLKK..AL.DNGLRR...----------------------------------
Q8XX67_RALSO/35-119PRHTRSLLTIAMMVALN.RDG..E.LRLHLRA..AA.NNGVTR...----------------------------------
Q8XYW1_RALSO/93-173DKRRFEMYALAASIVGK.CHFCI...QSHYAQ..LKRHQDMTT...----------------------------------
Q8Y1Q8_RALSO/21-105QPRDRAIVTLSVLVSRN.ASN..A.YDHYLNK..AL.DSGLKP...----------------------------------
Q8Y1Q8_RALSO/150-234ATRDRALATIASLAAQG.QAD..V.LPTYLER..AL.ASGVTK...----------------------------------
Q8Y972_LISMO/15-97DKKTEELAYIAVMAATR.LESGL...PFHVKM..AK.SNGATR...----------------------------------
Q8YLD1_NOSS1/42-125DPLVRELIYIAVSVTNG.CDYCI...SSHSAA..AR.GKGMNE...----------------------------------
Q8ZSI6_NOSS1/44-126TPIEQQVIYLTANYEHD.CRYCM...AAHSGL..AK.MIGMTP...----------------------------------
Q92S80_RHIME/12-94EPRLIHLIKLRASQING.CAYCV...DMHTKE..AR.HSGLSQ...----------------------------------
Q92XD0_RHIME/12-93ESSLIELVKIRASQING.CANCI...NMHTAE..AR.AKGESE...----------------------------------
Q930M4_RHIME/49-134DLRTRQILTAATLLAHG.SAQ..SQLSFHLYG..LL.NAGGTR...----------------------------------
Q930M4_RHIME/170-255EPRLAHLASAAMLAARG.KVG..ASFDAHIVS..AL.AAGATD...----------------------------------
Q930M4_RHIME/308-395DPKVRELGAISALAAQG.TVAAEKPLGVHIDA..AL.NLGATP...----------------------------------
Q93HH4_STRAW/42-128DRVLVELINLRVSQING.CAYCL...SLHTKA..AL.RVGETT...----------------------------------
Q978P3_THEVO/22-105DVKTKSLVALALSLGLQ.CEWCI...TYHTKK..CL.EAGCTE...----------------------------------
Q97UW0_SULSO/43-128PKKIRSLINIGILSCLN.RQN..E.LKLHVKG..AI.RNGCTE...----------------------------------
Q984R0_RHILO/14-98PPKVKSLISLAVAAQIP.CNYCV...WSDTQD..AK.RAGATD...----------------------------------
Q987X0_RHILO/12-95EHSLTELVKLRGSQING.CANCI...NLHASE..AR.ENGETE...----------------------------------
Q98BX3_RHILO/57-141DGKTKELMGLAVASQIP.CQYCI...YFHTEA..AK.LNGASD...----------------------------------
Q98JY9_RHILO/46-129DPLTKEMIYIAVSTANG.CSYCV...HSHTAA..AR.AKGMTD...----------------------------------
Q98K47_RHILO/12-94EISLLHLIKLRASQING.CSFCV...EMHSRE..AR.RDGETE...----------------------------------
Q98L97_RHILO/13-95PYVTRKLIHLRASQINA.CSLCV...DMHARE..LK.KAGEKD...----------------------------------
AHPD_CAUCR/95-178RGVTYDLSCVAVSAING.CGACL...DSHEAD..LR.GRGVEP...----------------------------------
Q9A3V6_CAUCR/52-136DPVLRELAQTRAGWARG.SQF..V.FSQHCKS..LR.GLGVSE...----------------------------------
Q9A5N6_CAUCR/302-387DHRTRRLLVLAICASLA.RWE..E.FRLHVRA..GLEQGGFTQ...----------------------------------
AHPD_BRAJA/95-178DKSDFELWSLAVSSING.CGICI...DAHERT..LR.AAGVNS...----------------------------------
Q9CB37_MYCLE/51-135PRVDTELVILRVAHLRT.CEY..E.LQHHRRM..ARKRGLDTK...----------------------------------
Q9CE69_LACLA/31-116NFKDRELITITSLLTQGGCEN..Q.LRVHIQA..SL.NVGLTQ...----------------------------------
Q9CFE3_LACLA/16-101SAHERSVITITALIAGG.NFE..Q.LNFHMAK..GK.ENGISQ...----------------------------------
Q9FC57_STRCO/14-95PVATQELVKIRASQING.CGFCT...DMHTKD..AA.AAGEDQ...----------------------------------
Q9HLI4_THEAC/22-105DVKTKELIALSLSLALQ.CEWCI...PYHTAK..CL.EAGCSE...----------------------------------
Q9I1E7_PSEAE/38-118GLPEREVVQLVAATTHG.CDFCV...AGHTAV..AR.NKARLP...----------------------------------
Q9I5X1_PSEAE/24-106DAKTRELISIAVAITTR.CDGCI...GVHTEA..AL.KAGASE...----------------------------------
Q9I6M1_PSEAE/12-94ERPLIELVYLRTSQING.CAYCV...NMHAND..AR.KAGETE...----------------------------------
Q9K796_BACHD/28-111SQKQKQLIALGVSVFAQ.DEYCI...IYHTKG..CM.DQDCSE...----------------------------------
Q9KX42_RHIRD/39-123TKRERSIVTIALLAALG.QDE..E.LAMHVRA..TV.NTGATE...----------------------------------
Q9KXX7_STRCO/38-123DLRTRALISVTITASLG....ILEPLRGQLRI..AL.HNGVTK...----------------------------------
Q9KZB1_STRCO/28-109DPALYELVKIRASQINH.CAFCL...DMHTKD..AL.AAGESV...----------------------------------
Q9KZB2_STRCO/10-92DPVLAELVMIRASQLNH.CAFCL...DMHLAL..AR.KNGEGE...----------------------------------
Q9L5A7_9PROT/34-118SLRERSMLTLALLAATG.NFAEI...PMHIRA..TA.RTGASQ...----------------------------------
Q9L5B1_9RHOB/33-117TDRERSMLTLAVLAATG.SFDEI...PMHIRA..TA.RTGASK...----------------------------------
Q9LBE9_PSEHY/66-154SKAEKEMIVVATSAAND.CLYCV...VAHGAI..LR.VRSKNPRLS----------------------------------
Q9PCL2_XYLFA/167-252DWQSRELATVGMLSALPGAES..Q.LQAHMRI..SM.NVGLTA...----------------------------------
Q9RDI4_STRCO/14-96PQSTQELVSLRASQING.CGHCI...DMHVKE..AA.AAGESA...----------------------------------
Q9RJG5_STRCO/31-117DRILVELVNIRVSQLNA.CAYCL...NAHTRA..AL.RGGETT...----------------------------------
Q9RTJ7_DEIRA/77-160SNAERELLAVVVSGLNR.CVYCA...VSHGAA..LR.EFSGDA...----------------------------------
Q9RV26_DEIRA/68-152TDRERHMVTIGILAALG.REK..E.LAGHLRA..TA.NTGVSE...----------------------------------
Q9RVP9_DEIRA/30-114DLKTKELLASVLLVSLG.SPD..E.LKTHLRG..AL.RAGATE...----------------------------------
Q9WYF2_THEMA/12-95PAKYKVLAALAIAVVEK.CKPCA...QGYYQK..AI.EMGATK...----------------------------------
Q9X1V5_THEMA/22-105DVKTKELMGLVASTVLR.CDDCI...RYHLVR..CV.QEGASD...----------------------------------
AHPD_STRVD/94-172DKVDFEFWSFAVSAING.CGMCL...DSTKQV..LR.KAGVER...----------------------------------

PF04636

A6QQS4_BOVIN/45-492LK....A.EEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIH.C...DGGHTFRP.........PSVSNYCIC....
SESN1_CAEEL/1-461FARRTPDGGPAFFSVCSLHHAVGIMSMTHAMCTVICCIGLERRVD.L........................TQDEI....
A0F081_DANRE/13-444VC....PGAEARWSLAELIQAVVLMTHAHSLASFVWGCGIHPEPE.Q...TEDQTLQP.........CSPTDSCCS....
SESN_DROME/1-497TK......GKNSWSLSEVVHAMVLLSHFHSLSSFVFSCGLTQKLD.G...LSSPKLKSPPAAVAALAPTILITPTSPTEP
Q4S6X1_TETNG/118-531.....................M...............CG.........................................
Q7PTB1_ANOGA/1-441TK......GQNSWSLSEVVHAIVLLAHYHSLSSFVFSCGLTQELD.G....ASHKIEN.........NNVLTQKTA....
A7SCG7_NEMVE/100-543LK......GEDNWSLSELVHAIVIMAHIHALSSFVYGCGVVPEID.S...ENGHTFKP.........PTLTETNQA....
A8WVR0_CAEBR/63-544ITRRSPDGGPAFFSICSLHHAIGIMSMTHAMCTVVCCIGLERRVD.L........................TQEEI....
SESN_DICDI/136-599VK......GTDAWSIAELVHAMVLICTFLSLSGFVFCCGISPECG.L...SESNNLSS.........SFSLNDSDC....
A2ALF5_MOUSE/41-480LK....T.GEHSWSLAELIQALVLLTHCHSLASFVFGCGILPEGD.AEGSPASQAPSP.........PSEQGTPPS....
A2RSF4_MOUSE/37-492VK....T.GENNWSLPELVHAVVLLAHYHALASFVFGSGINPERD.P...GIANGFRL.........ISVSSFCVC....
Q6GNB9_XENLA/65-472LS....SQGGHSWSLAELIHALLLLTHFHALSSFILGCGIYLSED......NNAVPRP.........PSP..........
Q7ZVJ7_DANRE/26-470VK....T.GEHSWSLAELVHAVVLLAHFHALASFVFGSGVNPDPEVTEVNGVTGDLCP.........PVMKGLCTC....

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
Q7WHA8_BORBR/12-94--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
Q7WJL9_BORBR/42-124--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
Q88IP0_PSEPK/41-115--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
Q7WN29_BORBR/12-94--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
Q7WNG4_BORBR/34-118--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
Q7WNI3_BORBR/39-122--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRAJA/34-118--------------------------------------------------------------------------------
O67982_RHOOP/297-381--------------------------------------------------------------------------------
Q7WNR4_BORBR/34-118--------------------------------------------------------------------------------
O68251_DEHMU/42-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q7WPN1_BORBR/34-118--------------------------------------------------------------------------------
YBE3_SCHPO/128-205--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Q7WPY0_BORBR/32-117--------------------------------------------------------------------------------
YCO4_PARDE/21-104--------------------------------------------------------------------------------
Q7WQ74_BORBR/23-106--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRAJA/12-94--------------------------------------------------------------------------------
YNQ5_PARDE/35-121--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
YNQ6_PARDE/40-126--------------------------------------------------------------------------------
Q89CI6_BRAJA/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P71826_MYCTU/26-111--------------------------------------------------------------------------------
Q8CL33_YERPE/30-114--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRAJA/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q52659_RHOCA/40-126--------------------------------------------------------------------------------
Q89RQ0_BRAJA/34-116--------------------------------------------------------------------------------
Q53427_LEGPN/38-123--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q54401_STRLA/19-103--------------------------------------------------------------------------------
Q89D50_BRAJA/12-94--------------------------------------------------------------------------------
AHPD_MYCTU/93-176--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRAJA/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRAJA/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q8D1N8_YERPE/49-133--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRAJA/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRAJA/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRAJA/35-120--------------------------------------------------------------------------------
Q840R0_9GAMM/10-95--------------------------------------------------------------------------------
Q89IL8_BRAJA/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q84H85_9MICC/39-123--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRAJA/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRAJA/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q872E4_NEUCS/44-109--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRAJA/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q8D7H9_VIBVU/12-94--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRAJA/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRAJA/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRAJA/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FER3_ECOL6/13-95--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
AHPD_BRUSU/94-170--------------------------------------------------------------------------------
Q8FW21_BRUSU/42-126--------------------------------------------------------------------------------
Q8GMC9_STRGL/56-141--------------------------------------------------------------------------------
Q8GMI8_STRGL/41-122--------------------------------------------------------------------------------
Q8GQ78_PSEAI/24-107--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8NUW4_STAAW/10-92--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8PSC4_METMA/27-113--------------------------------------------------------------------------------
Q8PT04_METMA/24-107--------------------------------------------------------------------------------
Q8PUU3_METMA/18-101--------------------------------------------------------------------------------
Q8PYE4_METMA/43-127--------------------------------------------------------------------------------
Q8PYL6_METMA/19-102--------------------------------------------------------------------------------
Q8PYV8_METMA/9-92--------------------------------------------------------------------------------
Q8PZ63_METMA/30-113--------------------------------------------------------------------------------
Q8PZJ3_METMA/27-110--------------------------------------------------------------------------------
Q8PZX1_METMA/20-103--------------------------------------------------------------------------------
Q8Q0J3_METMA/14-97--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8RN34_CAMJU/39-124--------------------------------------------------------------------------------
Q8RR45_STRSU/50-134--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CL79_AGRT5/55-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q93HH4_STRAW/42-128--------------------------------------------------------------------------------
Q978P3_THEVO/22-105--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRAJA/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KX42_RHIRD/39-123--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9L5A7_9PROT/34-118--------------------------------------------------------------------------------
Q9L5B1_9RHOB/33-117--------------------------------------------------------------------------------
Q9LBE9_PSEHY/66-154--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
AHPD_STRVD/94-172--------------------------------------------------------------------------------

PF04636

A6QQS4_BOVIN/45-492..........DITNGNHSVDEMQVNSAGNVSVSDSF...........................FEVEALMEK-MKQLQEC
SESN1_CAEEL/1-461..........DFLNIDDLDYWEARMSAYFRKVPDRRP..........................TEVEYLISE-LKKTEKG
A0F081_DANRE/13-444............VRGKARNQQEWSEAV....................................NEVKLLMER-MMMVQQQ
SESN_DROME/1-497QKGKPVLAEISLNNANPDYDSQTAASSNGGAPPDSANAVADGPDATTLNGYLATAQQLPQQHGISVETLMER-MKVLSQK
Q4S6X1_TETNG/118-531................................................................EVEVLMER-MKQLQEC
Q7PTB1_ANOGA/1-441...........FNRLNDLYNSQHPENLPNGDDANIRPE.........................VTVDALMQR-MKRLSEK
A7SCG7_NEMVE/100-543..........SFDSGNATTGSESVRSST...................................MTRDELMAR-MREVRAE
A8WVR0_CAEBR/63-544..........DFLNIDDIDYWEARLSELFRKVADRPE..........................TNVEYMISE-MKKTEKG
SESN_DICDI/136-599..........EIEDTAATENTAKVMELLKNRRSQQQDD.........................DDDDQLHDR-QQDFHNA
A2ALF5_MOUSE/41-480..............GDPLNNSGGFEAA....................................RDVEALMER-MRQLQES
A2RSF4_MOUSE/37-492..........DLANDNSIENTSLAGSNFGIVDSL.............................GELEALMER-MKRLQED
Q6GNB9_XENLA/65-472................DIPLNEGCSKL....................................KEAERVLAE-IKKLDEE
Q7ZVJ7_DANRE/26-470..........HLTNSNQANGNPPCNSNTG..................................SELEALMER-MKRLLEE

PF02627

Q930A6_RHIME/29-113---------------------------------------------------------------SEISETITH.LAYYS..
Q930A6_RHIME/156-240---------------------------------------------------------------EQAAEVITH.LAFYA..
Q8KL33_RHIEC/44-128---------------------------------------------------------------EEIREVFLQ.VSIYC..
DC4C_ACIAD/35-119---------------------------------------------------------------DELKELILH.CSLYA..
Q7D077_AGRT5/19-101---------------------------------------------------------------EDIISAVLT.GLPAA..
Q7D1C9_AGRT5/12-94---------------------------------------------------------------QWINLMSVW.RESPV..
O06218_MYCTU/45-127---------------------------------------------------------------TAAA.ILAG.TAPAA..
Q7WHA8_BORBR/12-94---------------------------------------------------------------LRLQLLNAW.RESPL..
O06800_MYCTU/26-109---------------------------------------------------------------QEAAEAIGV.TILMH..
Q88GS9_PSEPK/72-155---------------------------------------------------------------QEVVDALRA.RGEL...
O26169_METTH/26-109---------------------------------------------------------------DEILLAILI.GASMA..
Q7WJL9_BORBR/42-124---------------------------------------------------------------GDMAAAQDG.RSADP..
O26336_METTH/31-115---------------------------------------------------------------DEIIEVMIQ.MAVYA..
O26787_METTH/36-120---------------------------------------------------------------DEIVDVLRV.VLLTS..
Q88IP0_PSEPK/41-115---------------------------------------------------------------EAVSQARAG.TLSAV..
O27018_METTH/13-96---------------------------------------------------------------GELAEAAAV.AALIR..
Q7WN29_BORBR/12-94---------------------------------------------------------------EKLALLQAW.REAGG..
O29899_ARCFU/36-119---------------------------------------------------------------REIGEAILV.ARFAL..
Q8DUG8_STRMU/42-124---------------------------------------------------------------PDLLEALRN.ATPID..
O30263_ARCFU/32-115---------------------------------------------------------------EPLNEREKA.ALSFA..
Q7WNG4_BORBR/34-118---------------------------------------------------------------DEIKEVLLQ.ATVYC..
YURZ_BACSU/32-115---------------------------------------------------------------ENILEAVSV.AAAFG..
Q88K69_PSEPK/28-111---------------------------------------------------------------EEIAEALGV.AVAMN..
O53749_MYCTU/49-133---------------------------------------------------------------NTQATIFAWPDVPDG..
Q7WNI3_BORBR/39-122---------------------------------------------------------------AQIDDLADW.EASSR..
O53905_MYCTU/40-123---------------------------------------------------------------DDLLGVRDW.QGYNG..
Q89PM8_BRAJA/34-118---------------------------------------------------------------REIIDVFRL.ATVQ...
O67982_RHOOP/297-381---------------------------------------------------------------DTIGEVLLH.TAVYA..
Q7WNR4_BORBR/34-118---------------------------------------------------------------EEIRAVMMQ.VAIYC..
O68251_DEHMU/42-118---------------------------------------------------------------VEIEEIALG.IDAL...
Q88N35_PSEPK/35-119---------------------------------------------------------------DEIKEVLMQ.SAIYC..
O69814_STRCO/47-126---------------------------------------------------------------ERLAGGLEP.ADERH..
Q7WPN1_BORBR/34-118---------------------------------------------------------------KEIAEVILQ.SAVYC..
YBE3_SCHPO/128-205---------------------------------------------------------------EQVMSARNI.ALEIS..
Q8DKG6_THEEB/35-118---------------------------------------------------------------EEIMETLMV.TVAMD..
O86608_STRCO/355-439---------------------------------------------------------------GEIKEVLLQ.AAVYC..
Q7WPY0_BORBR/32-117---------------------------------------------------------------EELVEMITH.MAYYS..
YCO4_PARDE/21-104---------------------------------------------------------------EQIMEAIWV.AAEMR..
Q7WQ74_BORBR/23-106---------------------------------------------------------------GEIAEALGV.AVALN..
Y4147_CUPNH/24-107---------------------------------------------------------------EQLAEVLAI.NIEMG..
Q89PR3_BRAJA/12-94---------------------------------------------------------------EKIALVQAW.KEAGA..
YNQ5_PARDE/35-121---------------------------------------------------------------REICEAIFQ.MHLYG..
Q81CE2_BACCR/28-111---------------------------------------------------------------KEILEACGV.SAAFA..
YNQ6_PARDE/40-126---------------------------------------------------------------REIAETIFQ.MSMFG..
Q89CI6_BRAJA/13-94---------------------------------------------------------------ERLFAVSAW.RDAPY..
YJ81_YEAST/199-283---------------------------------------------------------------ETVEAVRGL.AILIS..
P71826_MYCTU/26-111---------------------------------------------------------------DELRELAVF.ITHYV..
Q8CL33_YERPE/30-114---------------------------------------------------------------EELVEAITQ.LAFYS..
P73604_SYNY3/23-107---------------------------------------------------------------EEIEEVLSF.MCVYG..
Q81RU7_BACAN/19-103---------------------------------------------------------------NEMIALITH.MAFYV..
Q89CP9_BRAJA/40-125---------------------------------------------------------------EEVRATVEG.DATSA..
YDFG_BACSU/12-94---------------------------------------------------------------QRIYCLHAW.NECDF..
Q828B2_STRAW/38-123---------------------------------------------------------------DEIVEALLH.SAVYC..
Q52659_RHOCA/40-126---------------------------------------------------------------REIAEVIFQ.MSMFG..
Q89RQ0_BRAJA/34-116---------------------------------------------------------------EDIA...GL.MAETE..
Q53427_LEGPN/38-123---------------------------------------------------------------DELKENLSG.KSSDK..
Q82A02_STRAW/34-115---------------------------------------------------------------DRLHMVAVW.REARH..
Q54401_STRLA/19-103---------------------------------------------------------------EELAETAFV.TASVR..
Q89D50_BRAJA/12-94---------------------------------------------------------------QRLYLLNAW.RESPL..
AHPD_MYCTU/93-176---------------------------------------------------------------EAIFEALKA.AAIVS..
Q82HT0_STRAW/32-114---------------------------------------------------------------ERVVQLSAW.DESRH..
Y1053_HAEIN/24-107---------------------------------------------------------------AEVAAALAT.AIALN..
Q8E1D2_STRA5/17-102---------------------------------------------------------------EEIADIITH.LAFYV..
Y742_METJA/19-103---------------------------------------------------------------EEIADVLRV.VLLTS..
AHPD_STRAW/94-177---------------------------------------------------------------DTIQEAFKI.AAVIQ..
Y1511_METJA/18-101---------------------------------------------------------------EEIQDVMKV.VYIGA..
Q7MJJ5_VIBVY/55-138---------------------------------------------------------------GEIVAARKV.EADNS..
Q89SZ5_BRAJA/50-134---------------------------------------------------------------AQIDAVERS.DYDAA..
Q7NI16_GLOVI/40-125---------------------------------------------------------------EKIRALPRS.ATSDL..
Q82MF4_STRAW/285-369---------------------------------------------------------------EEIGAVLLQ.TAVYC..
Q7NMU5_GLOVI/47-129---------------------------------------------------------------QRLHALAAW.REAPF..
Q89F01_BRAJA/58-143---------------------------------------------------------------DDVQRLLDE.GVEAD..
Q7NSY1_CHRVO/13-97---------------------------------------------------------------DELAEVVTH.LAFYV..
Q82MM5_STRAW/103-186---------------------------------------------------------------EKLLDVPSW.RDSAA..
Q7NX57_CHRVO/41-125---------------------------------------------------------------DEIAAARDF.ASADA..
Q8D1N8_YERPE/49-133---------------------------------------------------------------EEIRAVLLQ.TVVYC..
Q7NXV7_CHRVO/15-94---------------------------------------------------------------QRLYLLSAW.REAPC..
Q82PT4_STRAW/14-96---------------------------------------------------------------TRLNLIAAW.REATV..
Q7P0I8_CHRVO/10-92---------------------------------------------------------------EKLDQLAGW.DAADA..
Q89I69_BRAJA/24-107---------------------------------------------------------------EEIEETLGM.AVYMG..
Q7P1X7_CHRVO/26-109---------------------------------------------------------------TEVEEALAM.AVYMG..
Q82QS6_STRAW/57-140---------------------------------------------------------------GDINRITEG.PEAPG..
Q89UN1_BRAJA/34-118---------------------------------------------------------------DEIREILMQ.VAIYG..
AHPD_COXBU/96-175---------------------------------------------------------------HSIQHVIRI.AAVLN..
Q89IH0_BRAJA/35-120---------------------------------------------------------------DDIKEILLQ.QAIYC..
Q840R0_9GAMM/10-95---------------------------------------------------------------QRLYALAAW.REAPF..
Q89IL8_BRAJA/43-126---------------------------------------------------------------AEYGELLAI.VGMAA..
Q7ULD6_RHOBA/54-137---------------------------------------------------------------SEILDARRG.KADDA..
Q84H85_9MICC/39-123---------------------------------------------------------------EKIVGALIQ.CIPYI..
Q7UPD1_RHOBA/39-122---------------------------------------------------------------DDLRHVAML.SAPTI..
Q89XS3_BRAJA/55-139---------------------------------------------------------------DIVEEIFAD.ERDAT..
Q7USN7_RHOBA/41-121---------------------------------------------------------------QQLD.SMNV.SSGDL..
Q89LE4_BRAJA/50-134---------------------------------------------------------------REISEIITH.LAFYA..
Q7UTX7_RHOBA/162-245---------------------------------------------------------------DDVIESLRS.GTPIA..
Q872E4_NEUCS/44-109---------------------------------------------------------------GE...............
Q7VG56_HELHP/77-162---------------------------------------------------------------EKIIECLMQ.CIPYT..
Q89LE4_BRAJA/177-261---------------------------------------------------------------TEASEAITQ.LAFYV..
Q7VG63_HELHP/82-166---------------------------------------------------------------VAIKEILYQ.ATPYV..
Q7VG63_HELHP/216-301---------------------------------------------------------------GKLISVITA.LVPYI..
Q87FG9_VIBPA/24-106---------------------------------------------------------------NEIKEVLAQ.LYAYA..
Q87FG9_VIBPA/158-243---------------------------------------------------------------EELNDFILV.LKQCC..
Q8D7H9_VIBVU/12-94---------------------------------------------------------------QKLFALSAW.KESPL..
Q7VTI6_BORPE/91-170---------------------------------------------------------------EQLRDAGRI.AAVVN..
Q8A7Y1_BACTN/178-261---------------------------------------------------------------IEIKEILYQ.AVAYA..
Q7VW83_BORPE/12-94---------------------------------------------------------------LRLHHIAAW.RESTL..
Q87H24_VIBPA/33-118---------------------------------------------------------------EEIKEVIIQ.MSVYA..
Q7W0B6_BORPE/40-124---------------------------------------------------------------DEIVEVVLQ.AAIYC..
Q87WR5_PSESM/34-118---------------------------------------------------------------EEIREALLH.CAVYA..
Q8A7Y1_BACTN/311-396---------------------------------------------------------------DTLLAVVTQ.LLPYI..
Q87XC8_PSESM/23-106---------------------------------------------------------------EEVAEALGV.AINMN..
Q89M11_BRAJA/16-98---------------------------------------------------------------DKLNLVAVW.REAPI..
Q881M4_PSESM/43-127---------------------------------------------------------------LELSELINH.LAFYS..
Q881M4_PSESM/170-254---------------------------------------------------------------TEASELLSH.LAFYA..
Q8DV36_STRMU/17-102---------------------------------------------------------------KEIAAIITH.AAFYV..
Q89N13_BRAJA/21-105---------------------------------------------------------------EEVAEAALI.AAAVR..
Q881R7_PSESM/57-141---------------------------------------------------------------DVIAQVFAD.PATAG..
Q89NA9_BRAJA/36-119---------------------------------------------------------------EQNEALENW.QAASC..
Q88GS0_PSEPK/34-118---------------------------------------------------------------EQIREILLQ.VGIYC..
Q8A8P6_BACTN/142-227---------------------------------------------------------------AQIDEVLIM.AARCR..
Q8EKK9_SHEON/33-118---------------------------------------------------------------KEIVEVILQ.MSVYA..
Q8EMR2_OCEIH/26-109---------------------------------------------------------------EEVTEAIFV.ATALK..
Q8EMR2_OCEIH/135-218---------------------------------------------------------------DELSEAIFV.AVALK..
Q8EWL7_MYCPE/18-103---------------------------------------------------------------QEAIEIVTQ.LAFYS..
Q8FER3_ECOL6/13-95---------------------------------------------------------------HKLDALAGW.RVSHH..
Q8FN18_COREF/270-361---------------------------------------------------------------DDVNALIDN.GVDADLG
Q8FN50_COREF/40-124---------------------------------------------------------------ETIGETLLH.TAIYA..
Q8FN71_COREF/14-100---------------------------------------------------------------KKLDALPAW.RMVDE..
Q8FQN1_COREF/33-119---------------------------------------------------------------EEVAECFVH.LMPYI..
AHPD_BRUSU/94-170---------------------------------------------------------------EAIQAAVRF.ASII...
Q8FW21_BRUSU/42-126---------------------------------------------------------------EDICEALMH.VAIYA..
Q8GMC9_STRGL/56-141---------------------------------------------------------------EAVTAVFAA.PQDAP..
Q8GMI8_STRGL/41-122---------------------------------------------------------------..LEETVAI.RRGTP..
Q8GQ78_PSEAI/24-107---------------------------------------------------------------AEVHEALGV.AIYMG..
Q8KL13_RHIEC/51-135---------------------------------------------------------------QEIQEIFLQ.VAIYV..
Q8NLN6_CORGL/20-105---------------------------------------------------------------EELAEVALI.AAALR..
Q8NMX8_CORGL/269-355---------------------------------------------------------------DDVNALLAS.IDSDL..
Q8NN44_CORGL/15-100---------------------------------------------------------------KKLDALAAW.QMVDE..
Q8NRJ9_CORGL/17-103---------------------------------------------------------------EEIAEIITH.VAFYA..
Q8NUW4_STAAW/10-92---------------------------------------------------------------MKIDEVLSF.RHLDL..
Q8PBZ0_XANCP/31-114---------------------------------------------------------------EEFFETFSV.GLVVG..
Q8PDG7_XANCP/35-119---------------------------------------------------------------AQIKEVLLQ.AAIYC..
Q8PSC4_METMA/27-113---------------------------------------------------------------AEIVDTMMI.AAWTG..
Q8PT04_METMA/24-107---------------------------------------------------------------EEVLEALRI.TQYIF..
Q8PUU3_METMA/18-101---------------------------------------------------------------EEIAEAISV.AMFVA..
Q8PYE4_METMA/43-127---------------------------------------------------------------EKIFSAIMI.GASLS..
Q8PYL6_METMA/19-102---------------------------------------------------------------EEILEAVST.AIMMS..
Q8PYV8_METMA/9-92---------------------------------------------------------------KEVAEAIAV.AMFIA..
Q8PZ63_METMA/30-113---------------------------------------------------------------EEIMETMEV.IFITS..
Q8PZJ3_METMA/27-110---------------------------------------------------------------KEIYETIDV.ALEMG..
Q8PZX1_METMA/20-103---------------------------------------------------------------EEIMEVMDV.IFITS..
Q8Q0J3_METMA/14-97---------------------------------------------------------------DEIVGAVVL.NLHHS..
Q8RCV6_THETN/21-104---------------------------------------------------------------EEIMETLGV.AVLMS..
Q8RN34_CAMJU/39-124---------------------------------------------------------------KDLLNIIAA.LIPYI..
Q8RR45_STRSU/50-134---------------------------------------------------------------DVILQALRQ.GTPIE..
Q8TN24_METAC/40-121---------------------------------------------------------------TEIDALSSE.SASWS..
Q8TNJ6_METAC/14-97---------------------------------------------------------------DEVMETIRI.AQYIF..
Q8TP59_METAC/27-113---------------------------------------------------------------AEISDAMMI.AAWTG..
Q8TTM1_METAC/27-111---------------------------------------------------------------IEVKEIVYQ.SVPYV..
Q8TXW6_METKA/29-113---------------------------------------------------------------EEIAATLAL.VAWVE..
A9CKY5_AGRT5/48-130---------------------------------------------------------------NDPGFARRV.ALDYH..
A9CKY7_AGRT5/64-149---------------------------------------------------------------DRIA..RNH.NDVTL..
A9CIC5_AGRT5/44-127---------------------------------------------------------------EQHADLMRV.IALAA..
A9CL79_AGRT5/55-127---------------------------------------------------------------EVVD.......AIY...
A9CLJ3_AGRT5/34-118---------------------------------------------------------------AELRAALTQ.IAVYC..
Q8XQ14_RALSO/17-101---------------------------------------------------------------DELIEAITH.LAFYS..
Q8XX67_RALSO/35-119---------------------------------------------------------------EEIQEVLLQ.TAIYC..
Q8XYW1_RALSO/93-173---------------------------------------------------------------QQLRDVGRI.AAVIH..
Q8Y1Q8_RALSO/21-105---------------------------------------------------------------SELSELLTH.LAFYA..
Q8Y1Q8_RALSO/150-234---------------------------------------------------------------EAIGELLAH.VAFYG..
Q8Y972_LISMO/15-97---------------------------------------------------------------DEIISAILV.GLPAV..
Q8YLD1_NOSS1/42-125---------------------------------------------------------------AMFGELLAI.IATAN..
Q8ZSI6_NOSS1/44-126---------------------------------------------------------------EDIE.ALRH.GQPLA..
Q92S80_RHIME/12-94---------------------------------------------------------------QWINLVCVW.RESPH..
Q92XD0_RHIME/12-93---------------------------------------------------------------QRIYLLSAW.REAPC..
Q930M4_RHIME/49-134---------------------------------------------------------------ADVVDLLFI.SAGLL..
Q930M4_RHIME/170-255---------------------------------------------------------------SDIVEMVIQ.LSVYS..
Q930M4_RHIME/308-395---------------------------------------------------------------EEIVETLFN.IIPYA..
Q93HH4_STRAW/42-128---------------------------------------------------------------QRLGVLAAW.RDTEL..
Q978P3_THEVO/22-105---------------------------------------------------------------SEMMETAYI.AAIMA..
Q97UW0_SULSO/43-128---------------------------------------------------------------EEIKEVLLQ.VGAYC..
Q984R0_RHILO/14-98---------------------------------------------------------------EEIQEAVAM.AALTR..
Q987X0_RHILO/12-95---------------------------------------------------------------QRIYLLPAW.REAPC..
Q98BX3_RHILO/57-141---------------------------------------------------------------EEIKETIAM.AAIVR..
Q98JY9_RHILO/46-129---------------------------------------------------------------AQHGELVSI.IGLAG..
Q98K47_RHILO/12-94---------------------------------------------------------------QRLYLVAAW.KESPL..
Q98L97_RHILO/13-95---------------------------------------------------------------ERIFALAAW.RETPY..
AHPD_CAUCR/95-178---------------------------------------------------------------TQIQAALRI.AAVVS..
Q9A3V6_CAUCR/52-136---------------------------------------------------------------DKIAAVPHW.SVSTA..
Q9A5N6_CAUCR/302-387---------------------------------------------------------------DELKEVLMQ.IAIYA..
AHPD_BRAJA/95-178---------------------------------------------------------------ETIQTAVRF.AAITQ..
Q9CB37_MYCLE/51-135---------------------------------------------------------------IQAMIFAWP.DVPTG..
Q9CE69_LACLA/31-116---------------------------------------------------------------EEIIETFIH.YAPYV..
Q9CFE3_LACLA/16-101---------------------------------------------------------------EEISEIITH.LSFYV..
Q9FC57_STRCO/14-95---------------------------------------------------------------QRLNLVAVW.REATV..
Q9HLI4_THEAC/22-105---------------------------------------------------------------DEMIEASYI.AAIMA..
Q9I1E7_PSEAE/38-118---------------------------------------------------------------EPVIEALRA.RGELP..
Q9I5X1_PSEAE/24-106---------------------------------------------------------------AEIAQTLAT.AISLN..
Q9I6M1_PSEAE/12-94---------------------------------------------------------------QRLQALCVW.QETPY..
Q9K796_BACHD/28-111---------------------------------------------------------------EEILEAIGV.TAAFG..
Q9KX42_RHIRD/39-123---------------------------------------------------------------ADIREALLH.VAIYA..
Q9KXX7_STRCO/38-123---------------------------------------------------------------EEIVEAFIQ.MAVYA..
Q9KZB1_STRCO/28-109---------------------------------------------------------------ERIVQLAAW.EESRH..
Q9KZB2_STRCO/10-92---------------------------------------------------------------ERLGLLAAW.EEAAD..
Q9L5A7_9PROT/34-118---------------------------------------------------------------ADVQEAFQH.VAVYA..
Q9L5B1_9RHOB/33-117---------------------------------------------------------------EDVAEAFQH.VAIYA..
Q9LBE9_PSEHY/66-154---------------------------------------------------------------EQIATNYRR.AEITP..
Q9PCL2_XYLFA/167-252---------------------------------------------------------------GQLRQLTQV.LAARV..
Q9RDI4_STRCO/14-96---------------------------------------------------------------VRLHLVAAW.RESTV..
Q9RJG5_STRCO/31-117---------------------------------------------------------------QRLGVLPAW.RDTEL..
Q9RTJ7_DEIRA/77-160---------------------------------------------------------------VKADAVAVN.WRQAE..
Q9RV26_DEIRA/68-152---------------------------------------------------------------RDLSDVLHQ.VAIYA..
Q9RVP9_DEIRA/30-114---------------------------------------------------------------QEVREALLL.CVPYL..
Q9WYF2_THEMA/12-95---------------------------------------------------------------DEIKEILEV.AVTMG..
Q9X1V5_THEMA/22-105---------------------------------------------------------------EEIFEALDI.ALVVG..
AHPD_STRVD/94-172---------------------------------------------------------------RSSR......RRSDC..

PF04636

A6QQS4_BOVIN/45-492.REEEEASQEEMAS............RFEIEKRESMFVF..........SSDDDEVTPARDVSRHFEDTSYGYKDFSRHG
SESN1_CAEEL/1-461.QTRPPAKMCAMTTETIESLISAPAATYSSNRKNYSPVLLLANID..ENGEDIMEKEPPCNYPIYSHHRTFGYIDFRKRP
A0F081_DANRE/13-444...GEEFTQEEMVT............RFERERTESLL...........EPADVQRSVLPDCVSRFVVDADFTYQDFSPRG
SESN_DROME/1-497...QDECSEAELSS............RFQKVEQQTAEL.........AAVTPEAAVGVPTNLSHYVDDANFIYQDFARRG
Q4S6X1_TETNG/118-531.RDDEEASQEEMAT............RFEREKTESMLVV..........TAEDEDSAPSRDVSRHFEDPSYGYTEFSRRG
Q7PTB1_ANOGA/1-441...NDECSETELSN............RFKHVEQQAAEL.........PPVVREAPADVPQQLGRYVDDPGFTYQDFARRG
A7SCG7_NEMVE/100-543QDTLMEASQEELFQ............HFEKLESGELAHF.......KDEAASTPTESLTTDLARYLEDPNFRYQDFASRP
A8WVR0_CAEBR/63-544.MKRPAAKLCAMTTETIESLINAPPATYSSNRKSYSPVLLLANID..ENGDDILEKEPPCEYPIYSHHRTFGYIDFRKRP
SESN_DICDI/136-599.GDDSQSSNNNTTTTTTTT.......TTTTTTTNTNTTSNSAGGGDSSSSTLSQSSDRMSDFSRYIGNNTMTHTDFDVSS
A2ALF5_MOUSE/41-480LLRDEGASQEEMEN............RFELEKSESLLVT.........PSADILEPSPHPDILCFVEDPAFGYEDFTRRG
A2RSF4_MOUSE/37-492.REDDETTREEMTT............RFEKEKKESLFVVPGETLHAFPHSDFEDDVIVTADVSRYIEDPSFGYEDFARRG
Q6GNB9_XENLA/65-472...GEETSQEEMET............RFEREKRECAMVP.........TNGDNSKAVCFPGILHFLEDPGFGYIDFTRRG
Q7ZVJ7_DANRE/26-470.REDDDASEEEMFT............RFEKEKKESLLVV.........SAGFDEEVVPPSPVARFVDDPSFGYQDFARHG

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------------------------
Q7WHA8_BORBR/12-94--------------------------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------------------------
Q7WJL9_BORBR/42-124--------------------------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------------------------
Q88IP0_PSEPK/41-115--------------------------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------------------------
Q7WN29_BORBR/12-94--------------------------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------------------------
Q7WNG4_BORBR/34-118--------------------------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------------------------
Q7WNI3_BORBR/39-122--------------------------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------------------------
Q89PM8_BRAJA/34-118--------------------------------------------------------------------------------
O67982_RHOOP/297-381--------------------------------------------------------------------------------
Q7WNR4_BORBR/34-118--------------------------------------------------------------------------------
O68251_DEHMU/42-118--------------------------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------------------------
Q7WPN1_BORBR/34-118--------------------------------------------------------------------------------
YBE3_SCHPO/128-205--------------------------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------------------------
Q7WPY0_BORBR/32-117--------------------------------------------------------------------------------
YCO4_PARDE/21-104--------------------------------------------------------------------------------
Q7WQ74_BORBR/23-106--------------------------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------------------------
Q89PR3_BRAJA/12-94--------------------------------------------------------------------------------
YNQ5_PARDE/35-121--------------------------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------------------------
YNQ6_PARDE/40-126--------------------------------------------------------------------------------
Q89CI6_BRAJA/13-94--------------------------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------------------------
P71826_MYCTU/26-111--------------------------------------------------------------------------------
Q8CL33_YERPE/30-114--------------------------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------------------------
Q89CP9_BRAJA/40-125--------------------------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------------------------
Q52659_RHOCA/40-126--------------------------------------------------------------------------------
Q89RQ0_BRAJA/34-116--------------------------------------------------------------------------------
Q53427_LEGPN/38-123--------------------------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------------------------
Q54401_STRLA/19-103--------------------------------------------------------------------------------
Q89D50_BRAJA/12-94--------------------------------------------------------------------------------
AHPD_MYCTU/93-176--------------------------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------------------------
Q89SZ5_BRAJA/50-134--------------------------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------------------------
Q89F01_BRAJA/58-143--------------------------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------------------------
Q8D1N8_YERPE/49-133--------------------------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------------------------
Q89I69_BRAJA/24-107--------------------------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------------------------
Q89UN1_BRAJA/34-118--------------------------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------------------------
Q89IH0_BRAJA/35-120--------------------------------------------------------------------------------
Q840R0_9GAMM/10-95--------------------------------------------------------------------------------
Q89IL8_BRAJA/43-126--------------------------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------------------------
Q84H85_9MICC/39-123--------------------------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------------------------
Q89XS3_BRAJA/55-139--------------------------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------------------------
Q89LE4_BRAJA/50-134--------------------------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------------------------
Q872E4_NEUCS/44-109--------------------------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------------------------
Q89LE4_BRAJA/177-261--------------------------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------------------------
Q8D7H9_VIBVU/12-94--------------------------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------------------------
Q89M11_BRAJA/16-98--------------------------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------------------------
Q89N13_BRAJA/21-105--------------------------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------------------------
Q89NA9_BRAJA/36-119--------------------------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------------------------
Q8FER3_ECOL6/13-95--------------------------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------------------------
AHPD_BRUSU/94-170--------------------------------------------------------------------------------
Q8FW21_BRUSU/42-126--------------------------------------------------------------------------------
Q8GMC9_STRGL/56-141--------------------------------------------------------------------------------
Q8GMI8_STRGL/41-122--------------------------------------------------------------------------------
Q8GQ78_PSEAI/24-107--------------------------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------------------------
Q8NUW4_STAAW/10-92--------------------------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------------------------
Q8PSC4_METMA/27-113--------------------------------------------------------------------------------
Q8PT04_METMA/24-107--------------------------------------------------------------------------------
Q8PUU3_METMA/18-101--------------------------------------------------------------------------------
Q8PYE4_METMA/43-127--------------------------------------------------------------------------------
Q8PYL6_METMA/19-102--------------------------------------------------------------------------------
Q8PYV8_METMA/9-92--------------------------------------------------------------------------------
Q8PZ63_METMA/30-113--------------------------------------------------------------------------------
Q8PZJ3_METMA/27-110--------------------------------------------------------------------------------
Q8PZX1_METMA/20-103--------------------------------------------------------------------------------
Q8Q0J3_METMA/14-97--------------------------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------------------------
Q8RN34_CAMJU/39-124--------------------------------------------------------------------------------
Q8RR45_STRSU/50-134--------------------------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------------------------
A9CL79_AGRT5/55-127--------------------------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------------------------
Q93HH4_STRAW/42-128--------------------------------------------------------------------------------
Q978P3_THEVO/22-105--------------------------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------------------------
AHPD_BRAJA/95-178--------------------------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------------------------
Q9KX42_RHIRD/39-123--------------------------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------------------------
Q9L5A7_9PROT/34-118--------------------------------------------------------------------------------
Q9L5B1_9RHOB/33-117--------------------------------------------------------------------------------
Q9LBE9_PSEHY/66-154--------------------------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------------------------
AHPD_STRVD/94-172--------------------------------------------------------------------------------

PF04636

A6QQS4_BOVIN/45-492.MHVP.TFRVQ.....DYCW.....................................EDHGYSLVNRLYPDV.....GQL
SESN1_CAEEL/1-461EKDIP.PFRVE.....EFGW......................................DHVYNTMNEYTDTL.....TSR
A0F081_DANRE/13-444AQAPP.TMRAQ.....DYSW.....................................EDHGFSLMNRLYGEM.....AQL
SESN_DROME/1-497TESIN.TFRIQ.....DYSW.....................................EDHGYSLVDGLYNDV.....GIF
Q4S6X1_TETNG/118-531EQ.VP.TFRAQVRMRHSRSWVSGAPPRSLTLLFLNRAGLQLGGPRVLPGQPAVPRRGTDAGREVPAGLQPHLQHHGHAQG
Q7PTB1_ANOGA/1-441AENIPQTFRIQ.....DYSW.....................................DDHGYSLVNRLYNDV.....GFY
A7SCG7_NEMVE/100-543QQDIS.TFRIQ.....DCSW.....................................EEHGFSLFNRLYPDI.....GTL
A8WVR0_CAEBR/63-544EKDIP.PFRVE.....EFGW......................................DHVYNTMNEYTDTL.....TSR
SESN_DICDI/136-599KLY.N.IFSAQ.....EYSW.....................................REHGYELVSRYFPDA.....APL
A2ALF5_MOUSE/41-480TQAPP.TFRAQ.....DYTW.....................................EDHGYSLIQRLYPEG.....GQL
A2RSF4_MOUSE/37-492EEHLP.TFRAQ.....DYTW.....................................ENHGFSLVNRLYSDI.....GHL
Q6GNB9_XENLA/65-472EQAPP.TFRAH.....DYTW.....................................EDHGYSLLQRLNPEV.....GQL
Q7ZVJ7_DANRE/26-470EDNPP.TFKAQ.....DYSW.....................................EDHGFSLVNRLYSDI.....GHL

PF02627

Q930A6_RHIME/29-113----------------..GW------------------------------------------------------------
Q930A6_RHIME/156-240----------------..GW------------------------------------------------------------
Q8KL33_RHIEC/44-128----------------..GV------------------------------------------------------------
DC4C_ACIAD/35-119----------------..GL------------------------------------------------------------
Q7D077_AGRT5/19-101----------------..G.------------------------------------------------------------
Q7D1C9_AGRT5/12-94----------------..YT------------------------------------------------------------
O06218_MYCTU/45-127----------------..GD------------------------------------------------------------
Q7WHA8_BORBR/12-94----------------..YT------------------------------------------------------------
O06800_MYCTU/26-109----------------..GG------------------------------------------------------------
Q88GS9_PSEPK/72-155----------------....------------------------------------------------------------
O26169_METTH/26-109----------------..ES------------------------------------------------------------
Q7WJL9_BORBR/42-124----------------..RT------------------------------------------------------------
O26336_METTH/31-115----------------..GF------------------------------------------------------------
O26787_METTH/36-120----------------..GN------------------------------------------------------------
Q88IP0_PSEPK/41-115----------------..A.------------------------------------------------------------
O27018_METTH/13-96----------------..AG------------------------------------------------------------
Q7WN29_BORBR/12-94----------------..LF------------------------------------------------------------
O29899_ARCFU/36-119----------------..AS------------------------------------------------------------
Q8DUG8_STRMU/42-124----------------..DD------------------------------------------------------------
O30263_ARCFU/32-115----------------..AK------------------------------------------------------------
Q7WNG4_BORBR/34-118----------------..GI------------------------------------------------------------
YURZ_BACSU/32-115----------------..GG------------------------------------------------------------
Q88K69_PSEPK/28-111----------------..AG------------------------------------------------------------
O53749_MYCTU/49-133----------------..DG------------------------------------------------------------
Q7WNI3_BORBR/39-122----------------..FS------------------------------------------------------------
O53905_MYCTU/40-123----------------..FG------------------------------------------------------------
Q89PM8_BRAJA/34-118----------------..GL------------------------------------------------------------
O67982_RHOOP/297-381----------------..GV------------------------------------------------------------
Q7WNR4_BORBR/34-118----------------..GI------------------------------------------------------------
O68251_DEHMU/42-118----------------....------------------------------------------------------------
Q88N35_PSEPK/35-119----------------..GI------------------------------------------------------------
O69814_STRCO/47-126----------------..A.------------------------------------------------------------
Q7WPN1_BORBR/34-118----------------..GI------------------------------------------------------------
YBE3_SCHPO/128-205----------------..K.------------------------------------------------------------
Q8DKG6_THEEB/35-118----------------..GG------------------------------------------------------------
O86608_STRCO/355-439----------------..GV------------------------------------------------------------
Q7WPY0_BORBR/32-117----------------..GW------------------------------------------------------------
YCO4_PARDE/21-104----------------..AG------------------------------------------------------------
Q7WQ74_BORBR/23-106----------------..AG------------------------------------------------------------
Y4147_CUPNH/24-107----------------..GG------------------------------------------------------------
Q89PR3_BRAJA/12-94----------------..LF------------------------------------------------------------
YNQ5_PARDE/35-121----------------..GM------------------------------------------------------------
Q81CE2_BACCR/28-111----------------..GG------------------------------------------------------------
YNQ6_PARDE/40-126----------------..GL------------------------------------------------------------
Q89CI6_BRAJA/13-94----------------..FS------------------------------------------------------------
YJ81_YEAST/199-283----------------..QW------------------------------------------------------------
P71826_MYCTU/26-111----------------..GF------------------------------------------------------------
Q8CL33_YERPE/30-114----------------..GW------------------------------------------------------------
P73604_SYNY3/23-107----------------..GF------------------------------------------------------------
Q81RU7_BACAN/19-103----------------..GW------------------------------------------------------------
Q89CP9_BRAJA/40-125----------------..CW------------------------------------------------------------
YDFG_BACSU/12-94----------------..YS------------------------------------------------------------
Q828B2_STRAW/38-123----------------..GI------------------------------------------------------------
Q52659_RHOCA/40-126----------------..GV------------------------------------------------------------
Q89RQ0_BRAJA/34-116----------------..GK------------------------------------------------------------
Q53427_LEGPN/38-123----------------..KT------------------------------------------------------------
Q82A02_STRAW/34-115----------------..FF------------------------------------------------------------
Q54401_STRLA/19-103----------------..AG------------------------------------------------------------
Q89D50_BRAJA/12-94----------------..YT------------------------------------------------------------
AHPD_MYCTU/93-176----------------..GV------------------------------------------------------------
Q82HT0_STRAW/32-114----------------..FY------------------------------------------------------------
Y1053_HAEIN/24-107----------------..AG------------------------------------------------------------
Q8E1D2_STRA5/17-102----------------..GW------------------------------------------------------------
Y742_METJA/19-103----------------..GM------------------------------------------------------------
AHPD_STRAW/94-177----------------..AV------------------------------------------------------------
Y1511_METJA/18-101----------------..GM------------------------------------------------------------
Q7MJJ5_VIBVY/55-138----------------..VD------------------------------------------------------------
Q89SZ5_BRAJA/50-134----------------..GL------------------------------------------------------------
Q7NI16_GLOVI/40-125----------------..YS------------------------------------------------------------
Q82MF4_STRAW/285-369----------------..GV------------------------------------------------------------
Q7NMU5_GLOVI/47-129----------------..FS------------------------------------------------------------
Q89F01_BRAJA/58-143----------------..LG------------------------------------------------------------
Q7NSY1_CHRVO/13-97----------------..GW------------------------------------------------------------
Q82MM5_STRAW/103-186----------------..YT------------------------------------------------------------
Q7NX57_CHRVO/41-125----------------..RQ------------------------------------------------------------
Q8D1N8_YERPE/49-133----------------..GA------------------------------------------------------------
Q7NXV7_CHRVO/15-94----------------..YT------------------------------------------------------------
Q82PT4_STRAW/14-96----------------..FT------------------------------------------------------------
Q7P0I8_CHRVO/10-92----------------..LS------------------------------------------------------------
Q89I69_BRAJA/24-107----------------..GG------------------------------------------------------------
Q7P1X7_CHRVO/26-109----------------..GG------------------------------------------------------------
Q82QS6_STRAW/57-140----------------..WT------------------------------------------------------------
Q89UN1_BRAJA/34-118----------------..GM------------------------------------------------------------
AHPD_COXBU/96-175----------------..GL------------------------------------------------------------
Q89IH0_BRAJA/35-120----------------..GV------------------------------------------------------------
Q840R0_9GAMM/10-95----------------..FS------------------------------------------------------------
Q89IL8_BRAJA/43-126----------------..ET------------------------------------------------------------
Q7ULD6_RHOBA/54-137----------------..KA------------------------------------------------------------
Q84H85_9MICC/39-123----------------..GF------------------------------------------------------------
Q7UPD1_RHOBA/39-122----------------..GF------------------------------------------------------------
Q89XS3_BRAJA/55-139----------------..LE------------------------------------------------------------
Q7USN7_RHOBA/41-121----------------..FD------------------------------------------------------------
Q89LE4_BRAJA/50-134----------------..GW------------------------------------------------------------
Q7UTX7_RHOBA/162-245----------------..D.------------------------------------------------------------
Q872E4_NEUCS/44-109----------------....------------------------------------------------------------
Q7VG56_HELHP/77-162----------------..GF------------------------------------------------------------
Q89LE4_BRAJA/177-261----------------..GW------------------------------------------------------------
Q7VG63_HELHP/82-166----------------..GM------------------------------------------------------------
Q7VG63_HELHP/216-301----------------..GY------------------------------------------------------------
Q87FG9_VIBPA/24-106----------------..GF------------------------------------------------------------
Q87FG9_VIBPA/158-243----------------..DE------------------------------------------------------------
Q8D7H9_VIBVU/12-94----------------..FD------------------------------------------------------------
Q7VTI6_BORPE/91-170----------------..A.------------------------------------------------------------
Q8A7Y1_BACTN/178-261----------------..GM------------------------------------------------------------
Q7VW83_BORPE/12-94----------------..FS------------------------------------------------------------
Q87H24_VIBPA/33-118----------------..GF------------------------------------------------------------
Q7W0B6_BORPE/40-124----------------..GV------------------------------------------------------------
Q87WR5_PSESM/34-118----------------..GV------------------------------------------------------------
Q8A7Y1_BACTN/311-396----------------..GY------------------------------------------------------------
Q87XC8_PSESM/23-106----------------..AG------------------------------------------------------------
Q89M11_BRAJA/16-98----------------..YS------------------------------------------------------------
Q881M4_PSESM/43-127----------------..GW------------------------------------------------------------
Q881M4_PSESM/170-254----------------..GW------------------------------------------------------------
Q8DV36_STRMU/17-102----------------..GW------------------------------------------------------------
Q89N13_BRAJA/21-105----------------..AG------------------------------------------------------------
Q881R7_PSESM/57-141----------------..TT------------------------------------------------------------
Q89NA9_BRAJA/36-119----------------..FN------------------------------------------------------------
Q88GS0_PSEPK/34-118----------------..GV------------------------------------------------------------
Q8A8P6_BACTN/142-227----------------..NG------------------------------------------------------------
Q8EKK9_SHEON/33-118----------------..GF------------------------------------------------------------
Q8EMR2_OCEIH/26-109----------------..AG------------------------------------------------------------
Q8EMR2_OCEIH/135-218----------------..AG------------------------------------------------------------
Q8EWL7_MYCPE/18-103----------------..GW------------------------------------------------------------
Q8FER3_ECOL6/13-95----------------..FD------------------------------------------------------------
Q8FN18_COREF/270-361----------------SDQW------------------------------------------------------------
Q8FN50_COREF/40-124----------------..GV------------------------------------------------------------
Q8FN71_COREF/14-100----------------..YT------------------------------------------------------------
Q8FQN1_COREF/33-119----------------..GV------------------------------------------------------------
AHPD_BRUSU/94-170----------------....------------------------------------------------------------
Q8FW21_BRUSU/42-126----------------..GV------------------------------------------------------------
Q8GMC9_STRGL/56-141----------------..VS------------------------------------------------------------
Q8GMI8_STRGL/41-122----------------..GD------------------------------------------------------------
Q8GQ78_PSEAI/24-107----------------..GG------------------------------------------------------------
Q8KL13_RHIEC/51-135----------------..GV------------------------------------------------------------
Q8NLN6_CORGL/20-105----------------..AG------------------------------------------------------------
Q8NMX8_CORGL/269-355----------------..GS------------------------------------------------------------
Q8NN44_CORGL/15-100----------------..FT------------------------------------------------------------
Q8NRJ9_CORGL/17-103----------------..GW------------------------------------------------------------
Q8NUW4_STAAW/10-92----------------..FT------------------------------------------------------------
Q8PBZ0_XANCP/31-114----------------..GS------------------------------------------------------------
Q8PDG7_XANCP/35-119----------------..GV------------------------------------------------------------
Q8PSC4_METMA/27-113----------------..GI------------------------------------------------------------
Q8PT04_METMA/24-107----------------..GV------------------------------------------------------------
Q8PUU3_METMA/18-101----------------..AG------------------------------------------------------------
Q8PYE4_METMA/43-127----------------..NA------------------------------------------------------------
Q8PYL6_METMA/19-102----------------..GG------------------------------------------------------------
Q8PYV8_METMA/9-92----------------..GG------------------------------------------------------------
Q8PZ63_METMA/30-113----------------..GA------------------------------------------------------------
Q8PZJ3_METMA/27-110----------------..GG------------------------------------------------------------
Q8PZX1_METMA/20-103----------------..GA------------------------------------------------------------
Q8Q0J3_METMA/14-97----------------..GF------------------------------------------------------------
Q8RCV6_THETN/21-104----------------..GG------------------------------------------------------------
Q8RN34_CAMJU/39-124----------------..GY------------------------------------------------------------
Q8RR45_STRSU/50-134----------------..TD------------------------------------------------------------
Q8TN24_METAC/40-121----------------..DA------------------------------------------------------------
Q8TNJ6_METAC/14-97----------------..GV------------------------------------------------------------
Q8TP59_METAC/27-113----------------..GI------------------------------------------------------------
Q8TTM1_METAC/27-111----------------..GI------------------------------------------------------------
Q8TXW6_METKA/29-113----------------..GV------------------------------------------------------------
A9CKY5_AGRT5/48-130----------------..LA------------------------------------------------------------
A9CKY7_AGRT5/64-149----------------..A.------------------------------------------------------------
A9CIC5_AGRT5/44-127----------------..KT------------------------------------------------------------
A9CL79_AGRT5/55-127----------------....------------------------------------------------------------
A9CLJ3_AGRT5/34-118----------------..GI------------------------------------------------------------
Q8XQ14_RALSO/17-101----------------..GW------------------------------------------------------------
Q8XX67_RALSO/35-119----------------..GV------------------------------------------------------------
Q8XYW1_RALSO/93-173----------------..A.------------------------------------------------------------
Q8Y1Q8_RALSO/21-105----------------..SF------------------------------------------------------------
Q8Y1Q8_RALSO/150-234----------------..GW------------------------------------------------------------
Q8Y972_LISMO/15-97----------------..GN------------------------------------------------------------
Q8YLD1_NOSS1/42-125----------------..TT------------------------------------------------------------
Q8ZSI6_NOSS1/44-126----------------..D.------------------------------------------------------------
Q92S80_RHIME/12-94----------------..FD------------------------------------------------------------
Q92XD0_RHIME/12-93----------------..YT------------------------------------------------------------
Q930M4_RHIME/49-134----------------..GF------------------------------------------------------------
Q930M4_RHIME/170-255----------------..GF------------------------------------------------------------
Q930M4_RHIME/308-395----------------..GY------------------------------------------------------------
Q93HH4_STRAW/42-128----------------..FT------------------------------------------------------------
Q978P3_THEVO/22-105----------------..GT------------------------------------------------------------
Q97UW0_SULSO/43-128----------------..GL------------------------------------------------------------
Q984R0_RHILO/14-98----------------..HW------------------------------------------------------------
Q987X0_RHILO/12-95----------------..YS------------------------------------------------------------
Q98BX3_RHILO/57-141----------------..HW------------------------------------------------------------
Q98JY9_RHILO/46-129----------------..QT------------------------------------------------------------
Q98K47_RHILO/12-94----------------..FS------------------------------------------------------------
Q98L97_RHILO/13-95----------------..FT------------------------------------------------------------
AHPD_CAUCR/95-178----------------..AV------------------------------------------------------------
Q9A3V6_CAUCR/52-136----------------..FD------------------------------------------------------------
Q9A5N6_CAUCR/302-387----------------..GV------------------------------------------------------------
AHPD_BRAJA/95-178----------------..SV------------------------------------------------------------
Q9CB37_MYCLE/51-135----------------..AG------------------------------------------------------------
Q9CE69_LACLA/31-116----------------..GF------------------------------------------------------------
Q9CFE3_LACLA/16-101----------------..GW------------------------------------------------------------
Q9FC57_STRCO/14-95----------------..FS------------------------------------------------------------
Q9HLI4_THEAC/22-105----------------..GT------------------------------------------------------------
Q9I1E7_PSEAE/38-118----------------..D.------------------------------------------------------------
Q9I5X1_PSEAE/24-106----------------..AG------------------------------------------------------------
Q9I6M1_PSEAE/12-94----------------..FT------------------------------------------------------------
Q9K796_BACHD/28-111----------------..GG------------------------------------------------------------
Q9KX42_RHIRD/39-123----------------..GV------------------------------------------------------------
Q9KXX7_STRCO/38-123----------------..GV------------------------------------------------------------
Q9KZB1_STRCO/28-109----------------..FY------------------------------------------------------------
Q9KZB2_STRCO/10-92----------------..LY------------------------------------------------------------
Q9L5A7_9PROT/34-118----------------..GV------------------------------------------------------------
Q9L5B1_9RHOB/33-117----------------..GV------------------------------------------------------------
Q9LBE9_PSEHY/66-154----------------..RQ------------------------------------------------------------
Q9PCL2_XYLFA/167-252----------------..DA------------------------------------------------------------
Q9RDI4_STRCO/14-96----------------..FT------------------------------------------------------------
Q9RJG5_STRCO/31-117----------------..FS------------------------------------------------------------
Q9RTJ7_DEIRA/77-160----------------..LS------------------------------------------------------------
Q9RV26_DEIRA/68-152----------------..GV------------------------------------------------------------
Q9RVP9_DEIRA/30-114----------------..GF------------------------------------------------------------
Q9WYF2_THEMA/12-95----------------..AC------------------------------------------------------------
Q9X1V5_THEMA/22-105----------------..GS------------------------------------------------------------
AHPD_STRVD/94-172----------------..RG------------------------------------------------------------

PF04636

A6QQS4_BOVIN/45-492IDEKFHIAYNLTYNT...............MAMH--KDVDTSML.......RRAIWNYIHCMFGIRYDDYDYGEINQLLD
SESN1_CAEEL/1-461LDRMFDHIRTLTGNMPSGSSHASGDGEPPAAVNQ--NEIDTAAF.......REAIWNYTQGLYGVRVDDYDYSKINRVLD
A0F081_DANRE/13-444LDEKFQVACALTYHT...............MAMH--SHVDTSTL.......RKAIWNYIQCIYGIRYDDYDYGEVNQLLE
SESN_DROME/1-497LDAKFRAAYNLTYCT...............MGGI--KNVDTSKF.......RRAIWNYIQCIYGIRHDDYDYGEVNQLLV
Q4S6X1_TETNG/118-531RGHQHAAPGHLELHP...............LHVR--HQVGSRSALRPQAHGRRRVCLTSPLLASIRYDDYDYGEINQLLD
Q7PTB1_ANOGA/1-441LDDKFRAAYNLTYYT...............IAGR--TNVDTSKF.......RRAIWNYIQCIYGIRHDDYDYGEVNQLLD
A7SCG7_NEMVE/100-543LDEKFSSTLGLTYFT...............LGDR--TNVDTTVF.......RMATWNYIHLIFGIYHDDYLYTEVNKLME
A8WVR0_CAEBR/63-544LDHMFDHIRTLTGNM.SSASNSSGEGSP...ADQ--NEIDTTAF.......REAVWNYTQGLYGVRVDDYDYSKINRVLD
SESN_DICDI/136-599LDEEFSFVYTMTYYK...............FNNN--TDIDTLPF.......RRAVWYYVQRVKGMLHDDYNYQEVNMFLS
A2ALF5_MOUSE/41-480LDEKFQVACSLTYNT...............IAMH--SGVDTSML.......RRAIWNYIHCVFGIRYDDYDYGEVNQLLE
A2RSF4_MOUSE/37-492LDEKFRMVYNLTYNT...............MATH--EDVDTTTL.......RRALFNYVHCMFGIRYDDYDYGEVNQLLE
Q6GNB9_XENLA/65-472LDDKFQVAFNLTYHT...............CATH--SGVDTSKL.......RRAIWNYIQCIYGIRYDDYDYGEVNQLLE
Q7ZVJ7_DANRE/26-470LDDKFRTACDLTYYN...............MASH--EGVDTSML.......RRALFNYVHCMYGIRYDDYDYGEVNQLLE

PF02627

Q930A6_RHIME/29-113------------------------------GKAM..ATVGPVSE------------------------------------
Q930A6_RHIME/156-240------------------------------PNAM..SALPVAKA------------------------------------
Q8KL33_RHIEC/44-128------------------------------PAAI..DSFRVAAE------------------------------------
DC4C_ACIAD/35-119------------------------------PASN..AAMHMAEE------------------------------------
Q7D077_AGRT5/19-101------------------------------NAVI..GALGPALD------------------------------------
Q7D1C9_AGRT5/12-94------------------------------EQER..ALLGWVDA------------------------------------
O06218_MYCTU/45-127------------------------------PNAP.YVAWAAGTG------------------------------------
Q7WHA8_BORBR/12-94------------------------------ARER..AALAWTEA------------------------------------
O06800_MYCTU/26-109------------------------------PATI..HGARAYAA------------------------------------
Q88GS9_PSEPK/72-155------------------------------PNAR.YETLAAFAR------------------------------------
O26169_METTH/26-109------------------------------TALS..RSLRVFKE------------------------------------
Q7WJL9_BORBR/42-124------------------------------AAAL.RFALQLVEA------------------------------------
O26336_METTH/31-115------------------------------PAAI..NAVLAAKE------------------------------------
O26787_METTH/36-120------------------------------PPFV..KAMRILYE------------------------------------
Q88IP0_PSEPK/41-115------------------------------.........ALAQQ------------------------------------
O27018_METTH/13-96------------------------------SAMN..TASAIFRD------------------------------------
Q7WN29_BORBR/12-94------------------------------DARE..RAALAWAE------------------------------------
O29899_ARCFU/36-119------------------------------TIFA..TVTPALEW------------------------------------
Q8DUG8_STRMU/42-124------------------------------PKLD..TLAKFTIA------------------------------------
O30263_ARCFU/32-115------------------------------IAIT..KGKLEDEE------------------------------------
Q7WNG4_BORBR/34-118------------------------------PAGL..DAFKIANQ------------------------------------
YURZ_BACSU/32-115------------------------------AAFS..QGVTVVQQ------------------------------------
Q88K69_PSEPK/28-111------------------------------AALV..YSARAMDA------------------------------------
O53749_MYCTU/49-133------------------------------PRKV.LSARQQALL------------------------------------
Q7WNI3_BORBR/39-122------------------------------DKER..RVLALTEQ------------------------------------
O53905_MYCTU/40-123------------------------------PAEQ..AVLAATDD------------------------------------
Q89PM8_BRAJA/34-118------------------------------DGCN..LGIGILAE------------------------------------
O67982_RHOOP/297-381------------------------------PNSN..LGFALGKQ------------------------------------
Q7WNR4_BORBR/34-118------------------------------PAGV..EGTRTAEG------------------------------------
O68251_DEHMU/42-118------------------------------......SCSEAEKR------------------------------------
Q88N35_PSEPK/35-119------------------------------PAAN..ATFHLAES------------------------------------
O69814_STRCO/47-126------------------------------......RVLDWARR------------------------------------
Q7WPN1_BORBR/34-118------------------------------PAAG..DAFRQMQS------------------------------------
YBE3_SCHPO/128-205------------------------------.........ECGIQ------------------------------------
Q8DKG6_THEEB/35-118------------------------------PALM..YATHVLEA------------------------------------
O86608_STRCO/355-439------------------------------PAAN..GAFRVAQQ------------------------------------
Q7WPY0_BORBR/32-117------------------------------PSAV.SAAMRAWEI------------------------------------
YCO4_PARDE/21-104------------------------------AAYA..HANKALAV------------------------------------
Q7WQ74_BORBR/23-106------------------------------AALV..YSARVMDA------------------------------------
Y4147_CUPNH/24-107------------------------------PGAM..YASKALAY------------------------------------
Q89PR3_BRAJA/12-94------------------------------DERE..RAALAWAE------------------------------------
YNQ5_PARDE/35-121------------------------------PAAI..NALNAAIE------------------------------------
Q81CE2_BACCR/28-111------------------------------AAMS..QAVTLVQE------------------------------------
YNQ6_PARDE/40-126------------------------------PAMQ..KALEIAQS------------------------------------
Q89CI6_BRAJA/13-94------------------------------EAER..AALALTEA------------------------------------
YJ81_YEAST/199-283------------------------------CGVS..WKSGVVKL------------------------------------
P71826_MYCTU/26-111------------------------------PLGS..RLNSAIER------------------------------------
Q8CL33_YERPE/30-114------------------------------PTAV..TAISIAKE------------------------------------
P73604_SYNY3/23-107------------------------------NKAA..GAFAALKE------------------------------------
Q81RU7_BACAN/19-103------------------------------PKAV..SAFLSLFM------------------------------------
Q89CP9_BRAJA/40-125------------------------------SLDE..QALIAAVD------------------------------------
YDFG_BACSU/12-94------------------------------PEEK..AALELSEH------------------------------------
Q828B2_STRAW/38-123------------------------------PKAM..NASLVAKK------------------------------------
Q52659_RHOCA/40-126------------------------------PAMT..KALELARE------------------------------------
Q89RQ0_BRAJA/34-116------------------------------PSKLEPLARAVLKG------------------------------------
Q53427_LEGPN/38-123------------------------------QVAL..NFATQLIE------------------------------------
Q82A02_STRAW/34-115------------------------------TPKE..QAALALTE------------------------------------
Q54401_STRLA/19-103------------------------------GTLA..HALLADRL------------------------------------
Q89D50_BRAJA/12-94------------------------------DRER..AALAWTEA------------------------------------
AHPD_MYCTU/93-176------------------------------AQAL..ATIEALSP------------------------------------
Q82HT0_STRAW/32-114------------------------------TEKE.LAALELTEA------------------------------------
Y1053_HAEIN/24-107------------------------------AAYT..YSLRALEA------------------------------------
Q8E1D2_STRA5/17-102------------------------------PKAW..SAFNKAKE------------------------------------
Y742_METJA/19-103------------------------------PAFT..KAMKILEK------------------------------------
AHPD_STRAW/94-177------------------------------GTTL..DAEAVLAE------------------------------------
Y1511_METJA/18-101------------------------------PRFI..KAVEAILE------------------------------------
Q7MJJ5_VIBVY/55-138------------------------------QAIV.EFAALAVTQ------------------------------------
Q89SZ5_BRAJA/50-134------------------------------SEAE.RALLKFGRE------------------------------------
Q7NI16_GLOVI/40-125------------------------------EAEK..VALEYAER------------------------------------
Q82MF4_STRAW/285-369------------------------------PAAN..SAFAVAQR------------------------------------
Q7NMU5_GLOVI/47-129------------------------------PTER..AALAFGEA------------------------------------
Q89F01_BRAJA/58-143------------------------------ERWN..AVVKASVA------------------------------------
Q7NSY1_CHRVO/13-97------------------------------PSAT..AALEQLDA------------------------------------
Q82MM5_STRAW/103-186------------------------------PLER..DVMEYAEA------------------------------------
Q7NX57_CHRVO/41-125------------------------------AAAL.RFARQVAEQ------------------------------------
Q8D1N8_YERPE/49-133------------------------------PVAL..AAFRIASA------------------------------------
Q7NXV7_CHRVO/15-94------------------------------ERER..AALAWAEA------------------------------------
Q82PT4_STRAW/14-96------------------------------DAER..AALELTEQ------------------------------------
Q7P0I8_CHRVO/10-92------------------------------PREA..AAIAWTEA------------------------------------
Q89I69_BRAJA/24-107------------------------------PSLM..YAADAIAA------------------------------------
Q7P1X7_CHRVO/26-109------------------------------PSLM..YSAHALAA------------------------------------
Q82QS6_STRAW/57-140------------------------------DLER..HLIRAADE------------------------------------
Q89UN1_BRAJA/34-118------------------------------PAAV..DSFRIARE------------------------------------
AHPD_COXBU/96-175------------------------------AQV......SIIEN------------------------------------
Q89IH0_BRAJA/35-120------------------------------PAAN..HAVKEASA------------------------------------
Q840R0_9GAMM/10-95------------------------------ERES..AALAWTDA------------------------------------
Q89IL8_BRAJA/43-126------------------------------NRLV..TALGVPVD------------------------------------
Q7ULD6_RHOBA/54-137------------------------------GAIL.AFANQVVAK------------------------------------
Q84H85_9MICC/39-123------------------------------PRVL..NGLTLVKD------------------------------------
Q7UPD1_RHOBA/39-122------------------------------PTMM..RAKSWVED------------------------------------
Q89XS3_BRAJA/55-139------------------------------ARQQ..ALFNFATK------------------------------------
Q7USN7_RHOBA/41-121------------------------------EKEQ..AVLKYAEQ------------------------------------
Q89LE4_BRAJA/50-134------------------------------ANAM..SAVAVAED------------------------------------
Q7UTX7_RHOBA/162-245------------------------------PKL...EALRVFAE------------------------------------
Q872E4_NEUCS/44-109------------------------------......DGLGVVKR------------------------------------
Q7VG56_HELHP/77-162------------------------------PKVL..NAVFVAKK------------------------------------
Q89LE4_BRAJA/177-261------------------------------PNVF..SAMPVAKD------------------------------------
Q7VG63_HELHP/82-166------------------------------GKVL..DFINATNE------------------------------------
Q7VG63_HELHP/216-301------------------------------PRSL..NALSALDE------------------------------------
Q87FG9_VIBPA/24-106------------------------------PRSL..NGLAAFMD------------------------------------
Q87FG9_VIBPA/158-243------------------------------SIAS..NAQSVLDS------------------------------------
Q8D7H9_VIBVU/12-94------------------------------EAER..AVLHLTDD------------------------------------
Q7VTI6_BORPE/91-170------------------------------......AALALAAQ------------------------------------
Q8A7Y1_BACTN/178-261------------------------------AKVM..DFVGITNE------------------------------------
Q7VW83_BORPE/12-94------------------------------PRER..AALAWTEV------------------------------------
Q87H24_VIBPA/33-118------------------------------PAAL..NGMFAFKE------------------------------------
Q7W0B6_BORPE/40-124------------------------------PAAL..DAMKAVRE------------------------------------
Q87WR5_PSESM/34-118------------------------------PAAI..DAFRAAQE------------------------------------
Q8A7Y1_BACTN/311-396------------------------------PRTL..NAIACLNE------------------------------------
Q87XC8_PSESM/23-106------------------------------AALV..YSTHVLDA------------------------------------
Q89M11_BRAJA/16-98------------------------------ARER..AALAWTEA------------------------------------
Q881M4_PSESM/43-127------------------------------GNAT..QAAPIVKE------------------------------------
Q881M4_PSESM/170-254------------------------------PNAF..SAVPVFSD------------------------------------
Q8DV36_STRMU/17-102------------------------------PKAW..AVFILAKD------------------------------------
Q89N13_BRAJA/21-105------------------------------GTLG..HALLAQRL------------------------------------
Q881R7_PSESM/57-141------------------------------AREK..AIVQFAID------------------------------------
Q89NA9_BRAJA/36-119------------------------------EVQR..AALAFTDE------------------------------------
Q88GS0_PSEPK/34-118------------------------------PAAV..DSFRLARE------------------------------------
Q8A8P6_BACTN/142-227------------------------------MVLS..ESDEPAKT------------------------------------
Q8EKK9_SHEON/33-118------------------------------PAAL..NGMFVAKT------------------------------------
Q8EMR2_OCEIH/26-109------------------------------SSLA..HGVNGLNA------------------------------------
Q8EMR2_OCEIH/135-218------------------------------SALA..HSVNALNA------------------------------------
Q8EWL7_MYCPE/18-103------------------------------PKAW..SAFSLIKE------------------------------------
Q8FER3_ECOL6/13-95------------------------------ERER..AALAWAES------------------------------------
Q8FN18_COREF/270-361------------------------------NVIR..DAARALTA------------------------------------
Q8FN50_COREF/40-124------------------------------PNSN..HGFKLLND------------------------------------
Q8FN71_COREF/14-100------------------------------AEEK..AALQLAES------------------------------------
Q8FQN1_COREF/33-119------------------------------PKTL..AAMRCMKA------------------------------------
AHPD_BRUSU/94-170------------------------------......QSAAIALE------------------------------------
Q8FW21_BRUSU/42-126------------------------------PASN..HAFKIAKQ------------------------------------
Q8GMC9_STRGL/56-141------------------------------PRMR..ALLAVAAE------------------------------------
Q8GMI8_STRGL/41-122------------------------------DVKL.EALVQVARE------------------------------------
Q8GQ78_PSEAI/24-107------------------------------PSAM..YASNAVAA------------------------------------
Q8KL13_RHIEC/51-135------------------------------PAGI..DSFRHAQE------------------------------------
Q8NLN6_CORGL/20-105------------------------------GAMT..HGALAMKL------------------------------------
Q8NMX8_CORGL/269-355------------------------------DQWN..VIRDAARA------------------------------------
Q8NN44_CORGL/15-100------------------------------VEEK..AALQLAES------------------------------------
Q8NRJ9_CORGL/17-103------------------------------PKAW..AAFRIAKD------------------------------------
Q8NUW4_STAAW/10-92------------------------------DQEK..VTLEFAEM------------------------------------
Q8PBZ0_XANCP/31-114------------------------------IVIP..HLRRAVDF------------------------------------
Q8PDG7_XANCP/35-119------------------------------PAAN..HAFALAQP------------------------------------
Q8PSC4_METMA/27-113------------------------------QNFT.DFSAAILKE------------------------------------
Q8PT04_METMA/24-107------------------------------GSVY..TAARALND------------------------------------
Q8PUU3_METMA/18-101------------------------------SQIG..WTNVYEEN------------------------------------
Q8PYE4_METMA/43-127------------------------------AVLA..ESTRALAS------------------------------------
Q8PYL6_METMA/19-102------------------------------PGVA..YGSVVVLK------------------------------------
Q8PYV8_METMA/9-92------------------------------SQLN..WANNYGEN------------------------------------
Q8PZ63_METMA/30-113------------------------------PAVA..ACREALKL------------------------------------
Q8PZJ3_METMA/27-110------------------------------PAAY..SRFALNAL------------------------------------
Q8PZX1_METMA/20-103------------------------------PAVA..ACRDALKL------------------------------------
Q8Q0J3_METMA/14-97------------------------------ASVL..DCLPAAIK------------------------------------
Q8RCV6_THETN/21-104------------------------------PGVA..YATEAIKV------------------------------------
Q8RN34_CAMJU/39-124------------------------------PKAL..NALNLLDD------------------------------------
Q8RR45_STRSU/50-134------------------------------AKL...DALARFTL------------------------------------
Q8TN24_METAC/40-121------------------------------DAA....LLRAVDE------------------------------------
Q8TNJ6_METAC/14-97------------------------------GSVY..TAAKALTD------------------------------------
Q8TP59_METAC/27-113------------------------------QNFT.DFSVAVLKE------------------------------------
Q8TTM1_METAC/27-111------------------------------AKIF..DFIHATNE------------------------------------
Q8TXW6_METKA/29-113------------------------------SKVT..RTWGVLRQ------------------------------------
A9CKY5_AGRT5/48-130------------------------------DLSK..RQRALADL------------------------------------
A9CKY7_AGRT5/64-149------------------------------PRER..ALADLAQK------------------------------------
A9CIC5_AGRT5/44-127------------------------------NQLA..VALQVPVD------------------------------------
A9CL79_AGRT5/55-127------------------------------...K..NGLDADLP------------------------------------
A9CLJ3_AGRT5/34-118------------------------------PAGV..EAFRAAQE------------------------------------
Q8XQ14_RALSO/17-101------------------------------PTAS..TALPIAQR------------------------------------
Q8XX67_RALSO/35-119------------------------------PAAN..HAFHLAQA------------------------------------
Q8XYW1_RALSO/93-173------------------------------......AALVIAAE------------------------------------
Q8Y1Q8_RALSO/21-105------------------------------AYSF..GAVAVLKG------------------------------------
Q8Y1Q8_RALSO/150-234------------------------------GNAI..QAASAVSR------------------------------------
Q8Y972_LISMO/15-97------------------------------TVI...SALPIALD------------------------------------
Q8YLD1_NOSS1/42-125------------------------------NRLA..NGYQIPVD------------------------------------
Q8ZSI6_NOSS1/44-126------------------------------.QKL..QALRLFTK------------------------------------
Q92S80_RHIME/12-94------------------------------ERER..AVLGWTEA------------------------------------
Q92XD0_RHIME/12-93------------------------------DRER..AALAWTET------------------------------------
Q930M4_RHIME/49-134------------------------------PTAI..NAVPIVRD------------------------------------
Q930M4_RHIME/170-255------------------------------PAAL..NAAGRARN------------------------------------
Q930M4_RHIME/308-395------------------------------PLIE..KALLIAHD------------------------------------
Q93HH4_STRAW/42-128------------------------------SRER..AALALAEV------------------------------------
Q978P3_THEVO/22-105------------------------------PALM..NVNIMEEA------------------------------------
Q97UW0_SULSO/43-128------------------------------PAAM..DSFRIAQE------------------------------------
Q984R0_RHILO/14-98------------------------------STIF..NGMQVDFD------------------------------------
Q987X0_RHILO/12-95------------------------------DRER..AALGWTEA------------------------------------
Q98BX3_RHILO/57-141------------------------------STML..NGSQVDLA------------------------------------
Q98JY9_RHILO/46-129------------------------------NHLV..TAMQIPVD------------------------------------
Q98K47_RHILO/12-94------------------------------ERER..AAFAWTEA------------------------------------
Q98L97_RHILO/13-95------------------------------DAER..AALALAEA------------------------------------
AHPD_CAUCR/95-178------------------------------ARTL..AAEAALHP------------------------------------
Q9A3V6_CAUCR/52-136------------------------------AHER..AVLAYADG------------------------------------
Q9A5N6_CAUCR/302-387------------------------------PAAN..TAFTEAAD------------------------------------
AHPD_BRAJA/95-178------------------------------AIAL..EAAGPASP------------------------------------
Q9CB37_MYCLE/51-135------------------------------LSVR.QQALLAATD------------------------------------
Q9CE69_LACLA/31-116------------------------------PRVL..NAIFVAKE------------------------------------
Q9CFE3_LACLA/16-101------------------------------PKAW..SAFNIAKK------------------------------------
Q9FC57_STRCO/14-95------------------------------DAER..AALAVTEE------------------------------------
Q9HLI4_THEAC/22-105------------------------------PALM..NVKIMADT------------------------------------
Q9I1E7_PSEAE/38-118------------------------------......ARYEALAD------------------------------------
Q9I5X1_PSEAE/24-106------------------------------AAYV..YSLRALEA------------------------------------
Q9I6M1_PSEAE/12-94------------------------------PRER..AALAWTEQ------------------------------------
Q9K796_BACHD/28-111------------------------------AAMS..QAVTLVQE------------------------------------
Q9KX42_RHIRD/39-123------------------------------PAAN..HAFKIAKL------------------------------------
Q9KXX7_STRCO/38-123------------------------------ARAF..DSYAVARE------------------------------------
Q9KZB1_STRCO/28-109------------------------------TEKE..LAAIELTE------------------------------------
Q9KZB2_STRCO/10-92------------------------------DGRE..RAALALTE------------------------------------
Q9L5A7_9PROT/34-118------------------------------PRAN..QALKLAKE------------------------------------
Q9L5B1_9RHOB/33-117------------------------------PKAN..HALKLAKQ------------------------------------
Q9LBE9_PSEHY/66-154------------------------------RAML.DYAMKVALD------------------------------------
Q9PCL2_XYLFA/167-252------------------------------DMAR..RASTALEQ------------------------------------
Q9RDI4_STRCO/14-96------------------------------EAER..AALALAEE------------------------------------
Q9RJG5_STRCO/31-117------------------------------PRER..AALALAEA------------------------------------
Q9RTJ7_DEIRA/77-160------------------------------EREQ..AMCAYAEK------------------------------------
Q9RV26_DEIRA/68-152------------------------------PAAL..SAVNATKE------------------------------------
Q9RVP9_DEIRA/30-114------------------------------PRTV..AAFSQLQS------------------------------------
Q9WYF2_THEMA/12-95------------------------------IAET..WAREVWQY------------------------------------
Q9X1V5_THEMA/22-105------------------------------IVIP..HLRRAVGF------------------------------------
AHPD_STRVD/94-172------------------------------TQAV..AATLDAEA------------------------------------

PF04636

A6QQS4_BOVIN/45-492RSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT
SESN1_CAEEL/1-461KGTKTFIKLAACYPHKLTTE.FTRALPGFKDSEKIHVVMMVAMARFQASMFHYTRAVCNYNA
A0F081_DANRE/13-444RSLKVYVKTVACHPEKTTARMYFSFWRQFRHSEKVHVNLLLMEARMQAALLYALRAITRYMT
SESN_DROME/1-497RPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEARNQAELLYALREIMRYMT
Q4S6X1_TETNG/118-531RSFKIYIKTMVCSPEKTTKRMYESFWRQFQHSEKVRPSLLL...RPMASA..PAPSLTRLFS
Q7PTB1_ANOGA/1-441RSLKMFIKTACCFPERITKLDYDSVLVELQHSEKVHINLMILEARNQAELLYALREVMRYMT
A7SCG7_NEMVE/100-543RSYKRYIKKVACVPEKATQEDYLEFMPELTHSEKVHINLLLLEARLQAELLYATRAIMKYMT
A8WVR0_CAEBR/63-544KGTKTFIKLAACYPHKLTTE.FTKALPGFKDSEKIHVVMMIAMARFQASMFHYTRAVCNYNA
SESN_DICDI/136-599RSLKNFVKKAVCFPETIKRDDYSKLGYSLKPDEKCHLSLLAVCSHKQASLLYGLYSVMNYQN
A2ALF5_MOUSE/41-480RNLKIYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
A2RSF4_MOUSE/37-492RSLKVYIKTVTCYPERTTKRMYDSYWRQFTHSEKVHVNLLLMEARMQAELLYALRAITRHLT
Q6GNB9_XENLA/65-472RSLKVYMKTVTCHPERVTRLLYNDFWRQFKHSEKVHLNFLLLEARLQAALLYCLRAITRFMT
Q7ZVJ7_DANRE/26-470RSLKVYIKTVTCYPERTTCRMYESYWHQFRHSEKVHVNLLLMEARMQAELLYALRAITHYMT

PF02627

Q930A6_RHIME/29-113--------------------------------------------------------------
Q930A6_RHIME/156-240--------------------------------------------------------------
Q8KL33_RHIEC/44-128--------------------------------------------------------------
DC4C_ACIAD/35-119--------------------------------------------------------------
Q7D077_AGRT5/19-101--------------------------------------------------------------
Q7D1C9_AGRT5/12-94--------------------------------------------------------------
O06218_MYCTU/45-127--------------------------------------------------------------
Q7WHA8_BORBR/12-94--------------------------------------------------------------
O06800_MYCTU/26-109--------------------------------------------------------------
Q88GS9_PSEPK/72-155--------------------------------------------------------------
O26169_METTH/26-109--------------------------------------------------------------
Q7WJL9_BORBR/42-124--------------------------------------------------------------
O26336_METTH/31-115--------------------------------------------------------------
O26787_METTH/36-120--------------------------------------------------------------
Q88IP0_PSEPK/41-115--------------------------------------------------------------
O27018_METTH/13-96--------------------------------------------------------------
Q7WN29_BORBR/12-94--------------------------------------------------------------
O29899_ARCFU/36-119--------------------------------------------------------------
Q8DUG8_STRMU/42-124--------------------------------------------------------------
O30263_ARCFU/32-115--------------------------------------------------------------
Q7WNG4_BORBR/34-118--------------------------------------------------------------
YURZ_BACSU/32-115--------------------------------------------------------------
Q88K69_PSEPK/28-111--------------------------------------------------------------
O53749_MYCTU/49-133--------------------------------------------------------------
Q7WNI3_BORBR/39-122--------------------------------------------------------------
O53905_MYCTU/40-123--------------------------------------------------------------
Q89PM8_BRAJA/34-118--------------------------------------------------------------
O67982_RHOOP/297-381--------------------------------------------------------------
Q7WNR4_BORBR/34-118--------------------------------------------------------------
O68251_DEHMU/42-118--------------------------------------------------------------
Q88N35_PSEPK/35-119--------------------------------------------------------------
O69814_STRCO/47-126--------------------------------------------------------------
Q7WPN1_BORBR/34-118--------------------------------------------------------------
YBE3_SCHPO/128-205--------------------------------------------------------------
Q8DKG6_THEEB/35-118--------------------------------------------------------------
O86608_STRCO/355-439--------------------------------------------------------------
Q7WPY0_BORBR/32-117--------------------------------------------------------------
YCO4_PARDE/21-104--------------------------------------------------------------
Q7WQ74_BORBR/23-106--------------------------------------------------------------
Y4147_CUPNH/24-107--------------------------------------------------------------
Q89PR3_BRAJA/12-94--------------------------------------------------------------
YNQ5_PARDE/35-121--------------------------------------------------------------
Q81CE2_BACCR/28-111--------------------------------------------------------------
YNQ6_PARDE/40-126--------------------------------------------------------------
Q89CI6_BRAJA/13-94--------------------------------------------------------------
YJ81_YEAST/199-283--------------------------------------------------------------
P71826_MYCTU/26-111--------------------------------------------------------------
Q8CL33_YERPE/30-114--------------------------------------------------------------
P73604_SYNY3/23-107--------------------------------------------------------------
Q81RU7_BACAN/19-103--------------------------------------------------------------
Q89CP9_BRAJA/40-125--------------------------------------------------------------
YDFG_BACSU/12-94--------------------------------------------------------------
Q828B2_STRAW/38-123--------------------------------------------------------------
Q52659_RHOCA/40-126--------------------------------------------------------------
Q89RQ0_BRAJA/34-116--------------------------------------------------------------
Q53427_LEGPN/38-123--------------------------------------------------------------
Q82A02_STRAW/34-115--------------------------------------------------------------
Q54401_STRLA/19-103--------------------------------------------------------------
Q89D50_BRAJA/12-94--------------------------------------------------------------
AHPD_MYCTU/93-176--------------------------------------------------------------
Q82HT0_STRAW/32-114--------------------------------------------------------------
Y1053_HAEIN/24-107--------------------------------------------------------------
Q8E1D2_STRA5/17-102--------------------------------------------------------------
Y742_METJA/19-103--------------------------------------------------------------
AHPD_STRAW/94-177--------------------------------------------------------------
Y1511_METJA/18-101--------------------------------------------------------------
Q7MJJ5_VIBVY/55-138--------------------------------------------------------------
Q89SZ5_BRAJA/50-134--------------------------------------------------------------
Q7NI16_GLOVI/40-125--------------------------------------------------------------
Q82MF4_STRAW/285-369--------------------------------------------------------------
Q7NMU5_GLOVI/47-129--------------------------------------------------------------
Q89F01_BRAJA/58-143--------------------------------------------------------------
Q7NSY1_CHRVO/13-97--------------------------------------------------------------
Q82MM5_STRAW/103-186--------------------------------------------------------------
Q7NX57_CHRVO/41-125--------------------------------------------------------------
Q8D1N8_YERPE/49-133--------------------------------------------------------------
Q7NXV7_CHRVO/15-94--------------------------------------------------------------
Q82PT4_STRAW/14-96--------------------------------------------------------------
Q7P0I8_CHRVO/10-92--------------------------------------------------------------
Q89I69_BRAJA/24-107--------------------------------------------------------------
Q7P1X7_CHRVO/26-109--------------------------------------------------------------
Q82QS6_STRAW/57-140--------------------------------------------------------------
Q89UN1_BRAJA/34-118--------------------------------------------------------------
AHPD_COXBU/96-175--------------------------------------------------------------
Q89IH0_BRAJA/35-120--------------------------------------------------------------
Q840R0_9GAMM/10-95--------------------------------------------------------------
Q89IL8_BRAJA/43-126--------------------------------------------------------------
Q7ULD6_RHOBA/54-137--------------------------------------------------------------
Q84H85_9MICC/39-123--------------------------------------------------------------
Q7UPD1_RHOBA/39-122--------------------------------------------------------------
Q89XS3_BRAJA/55-139--------------------------------------------------------------
Q7USN7_RHOBA/41-121--------------------------------------------------------------
Q89LE4_BRAJA/50-134--------------------------------------------------------------
Q7UTX7_RHOBA/162-245--------------------------------------------------------------
Q872E4_NEUCS/44-109--------------------------------------------------------------
Q7VG56_HELHP/77-162--------------------------------------------------------------
Q89LE4_BRAJA/177-261--------------------------------------------------------------
Q7VG63_HELHP/82-166--------------------------------------------------------------
Q7VG63_HELHP/216-301--------------------------------------------------------------
Q87FG9_VIBPA/24-106--------------------------------------------------------------
Q87FG9_VIBPA/158-243--------------------------------------------------------------
Q8D7H9_VIBVU/12-94--------------------------------------------------------------
Q7VTI6_BORPE/91-170--------------------------------------------------------------
Q8A7Y1_BACTN/178-261--------------------------------------------------------------
Q7VW83_BORPE/12-94--------------------------------------------------------------
Q87H24_VIBPA/33-118--------------------------------------------------------------
Q7W0B6_BORPE/40-124--------------------------------------------------------------
Q87WR5_PSESM/34-118--------------------------------------------------------------
Q8A7Y1_BACTN/311-396--------------------------------------------------------------
Q87XC8_PSESM/23-106--------------------------------------------------------------
Q89M11_BRAJA/16-98--------------------------------------------------------------
Q881M4_PSESM/43-127--------------------------------------------------------------
Q881M4_PSESM/170-254--------------------------------------------------------------
Q8DV36_STRMU/17-102--------------------------------------------------------------
Q89N13_BRAJA/21-105--------------------------------------------------------------
Q881R7_PSESM/57-141--------------------------------------------------------------
Q89NA9_BRAJA/36-119--------------------------------------------------------------
Q88GS0_PSEPK/34-118--------------------------------------------------------------
Q8A8P6_BACTN/142-227--------------------------------------------------------------
Q8EKK9_SHEON/33-118--------------------------------------------------------------
Q8EMR2_OCEIH/26-109--------------------------------------------------------------
Q8EMR2_OCEIH/135-218--------------------------------------------------------------
Q8EWL7_MYCPE/18-103--------------------------------------------------------------
Q8FER3_ECOL6/13-95--------------------------------------------------------------
Q8FN18_COREF/270-361--------------------------------------------------------------
Q8FN50_COREF/40-124--------------------------------------------------------------
Q8FN71_COREF/14-100--------------------------------------------------------------
Q8FQN1_COREF/33-119--------------------------------------------------------------
AHPD_BRUSU/94-170--------------------------------------------------------------
Q8FW21_BRUSU/42-126--------------------------------------------------------------
Q8GMC9_STRGL/56-141--------------------------------------------------------------
Q8GMI8_STRGL/41-122--------------------------------------------------------------
Q8GQ78_PSEAI/24-107--------------------------------------------------------------
Q8KL13_RHIEC/51-135--------------------------------------------------------------
Q8NLN6_CORGL/20-105--------------------------------------------------------------
Q8NMX8_CORGL/269-355--------------------------------------------------------------
Q8NN44_CORGL/15-100--------------------------------------------------------------
Q8NRJ9_CORGL/17-103--------------------------------------------------------------
Q8NUW4_STAAW/10-92--------------------------------------------------------------
Q8PBZ0_XANCP/31-114--------------------------------------------------------------
Q8PDG7_XANCP/35-119--------------------------------------------------------------
Q8PSC4_METMA/27-113--------------------------------------------------------------
Q8PT04_METMA/24-107--------------------------------------------------------------
Q8PUU3_METMA/18-101--------------------------------------------------------------
Q8PYE4_METMA/43-127--------------------------------------------------------------
Q8PYL6_METMA/19-102--------------------------------------------------------------
Q8PYV8_METMA/9-92--------------------------------------------------------------
Q8PZ63_METMA/30-113--------------------------------------------------------------
Q8PZJ3_METMA/27-110--------------------------------------------------------------
Q8PZX1_METMA/20-103--------------------------------------------------------------
Q8Q0J3_METMA/14-97--------------------------------------------------------------
Q8RCV6_THETN/21-104--------------------------------------------------------------
Q8RN34_CAMJU/39-124--------------------------------------------------------------
Q8RR45_STRSU/50-134--------------------------------------------------------------
Q8TN24_METAC/40-121--------------------------------------------------------------
Q8TNJ6_METAC/14-97--------------------------------------------------------------
Q8TP59_METAC/27-113--------------------------------------------------------------
Q8TTM1_METAC/27-111--------------------------------------------------------------
Q8TXW6_METKA/29-113--------------------------------------------------------------
A9CKY5_AGRT5/48-130--------------------------------------------------------------
A9CKY7_AGRT5/64-149--------------------------------------------------------------
A9CIC5_AGRT5/44-127--------------------------------------------------------------
A9CL79_AGRT5/55-127--------------------------------------------------------------
A9CLJ3_AGRT5/34-118--------------------------------------------------------------
Q8XQ14_RALSO/17-101--------------------------------------------------------------
Q8XX67_RALSO/35-119--------------------------------------------------------------
Q8XYW1_RALSO/93-173--------------------------------------------------------------
Q8Y1Q8_RALSO/21-105--------------------------------------------------------------
Q8Y1Q8_RALSO/150-234--------------------------------------------------------------
Q8Y972_LISMO/15-97--------------------------------------------------------------
Q8YLD1_NOSS1/42-125--------------------------------------------------------------
Q8ZSI6_NOSS1/44-126--------------------------------------------------------------
Q92S80_RHIME/12-94--------------------------------------------------------------
Q92XD0_RHIME/12-93--------------------------------------------------------------
Q930M4_RHIME/49-134--------------------------------------------------------------
Q930M4_RHIME/170-255--------------------------------------------------------------
Q930M4_RHIME/308-395--------------------------------------------------------------
Q93HH4_STRAW/42-128--------------------------------------------------------------
Q978P3_THEVO/22-105--------------------------------------------------------------
Q97UW0_SULSO/43-128--------------------------------------------------------------
Q984R0_RHILO/14-98--------------------------------------------------------------
Q987X0_RHILO/12-95--------------------------------------------------------------
Q98BX3_RHILO/57-141--------------------------------------------------------------
Q98JY9_RHILO/46-129--------------------------------------------------------------
Q98K47_RHILO/12-94--------------------------------------------------------------
Q98L97_RHILO/13-95--------------------------------------------------------------
AHPD_CAUCR/95-178--------------------------------------------------------------
Q9A3V6_CAUCR/52-136--------------------------------------------------------------
Q9A5N6_CAUCR/302-387--------------------------------------------------------------
AHPD_BRAJA/95-178--------------------------------------------------------------
Q9CB37_MYCLE/51-135--------------------------------------------------------------
Q9CE69_LACLA/31-116--------------------------------------------------------------
Q9CFE3_LACLA/16-101--------------------------------------------------------------
Q9FC57_STRCO/14-95--------------------------------------------------------------
Q9HLI4_THEAC/22-105--------------------------------------------------------------
Q9I1E7_PSEAE/38-118--------------------------------------------------------------
Q9I5X1_PSEAE/24-106--------------------------------------------------------------
Q9I6M1_PSEAE/12-94--------------------------------------------------------------
Q9K796_BACHD/28-111--------------------------------------------------------------
Q9KX42_RHIRD/39-123--------------------------------------------------------------
Q9KXX7_STRCO/38-123--------------------------------------------------------------
Q9KZB1_STRCO/28-109--------------------------------------------------------------
Q9KZB2_STRCO/10-92--------------------------------------------------------------
Q9L5A7_9PROT/34-118--------------------------------------------------------------
Q9L5B1_9RHOB/33-117--------------------------------------------------------------
Q9LBE9_PSEHY/66-154--------------------------------------------------------------
Q9PCL2_XYLFA/167-252--------------------------------------------------------------
Q9RDI4_STRCO/14-96--------------------------------------------------------------
Q9RJG5_STRCO/31-117--------------------------------------------------------------
Q9RTJ7_DEIRA/77-160--------------------------------------------------------------
Q9RV26_DEIRA/68-152--------------------------------------------------------------
Q9RVP9_DEIRA/30-114--------------------------------------------------------------
Q9WYF2_THEMA/12-95--------------------------------------------------------------
Q9X1V5_THEMA/22-105--------------------------------------------------------------
AHPD_STRVD/94-172--------------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window