Sequence alignment for CL0429

PF10890

Q9LDS7_ORYSJ/1-72---MGKTPVRMKAVVYALSPFQQKVMPGLWKDITTKIHH-KVSENWISATLLLA.PIVGTYEYAMYYKEQEKLSHRY---
QCR8_SOLTU/1-72---MGKQPVKLKAVVYAISPFQQKIMPGLWKDLPGKIHH-KVSENWISATLLLG.PLVGTYSYVQHFLEKEKLEHRY---
A4S5I8_OSTLU/1-73---MAKVPARLRSVTYSLSPMRTGVMHGLFKDWASGMAT-RVKENAVDAGVFCALPLGATVWYALNYKENEKLEHRY---
Q1EMP3_PLAMJ/1-72---MGKQHIPLKAVTYALSPYNQKVMPGLWKDLPGKIAH-KFSDHWLGAVCIFG.PVFGTMQFAEWYTEREKMHHRS---

PF02939

QCR8_BOVIN/2-81GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLR.RTRACIL----RVAPPFVAFYLVYTWGTQEFEKSKRKNPA
QCR8_KLULA/12-91WWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNAVFNTFR.RVKSQIL----YMALPAALYWAWWVNCRDYNAYLYTKAGR
QCR8_SCHPO/13-92WWGHLGGPKQKGIITYSLSPFQQRPMAGFFKTSTQNMFR.RVMTEGL----YVAIPFGIAYYIYCWGKERNEFLNSKHGR
QCR8_YEAST/12-91WWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR.RFKSQFL----YVLIPAGIYWYWWKNGNEYNEFLYSKAGR
O45525_CAEEL/9-89GKHFGNLGKMYGEHRFALAPNEQKAYKGFFDQAFVKTFKTYVWDQWY----YYIPQTIGAYLLYDWAKKTNVAANRKNPA
Q9VVH5_DROME/9-88GQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVR.RFRSNVF----IVTPPFIVGYLIYDLTERKHTALLRKNPA
QCR8_NEUCR/25-104GWGNFGGMKQRGIISYGISPNRQNPLAGTAHDAVFNTFR.RVSSQFL----YWAPSLVAGYYIMNWAIERNHYLNSKAGR

PF10890

Q9LDS7_ORYSJ/1-72-----
QCR8_SOLTU/1-72-----
A4S5I8_OSTLU/1-73-----
Q1EMP3_PLAMJ/1-72-----

PF02939

QCR8_BOVIN/2-81AYEND
QCR8_KLULA/12-91EELER
QCR8_SCHPO/13-92HLVEE
QCR8_YEAST/12-91EELER
O45525_CAEEL/9-89DFAND
Q9VVH5_DROME/9-88DYAND
QCR8_NEUCR/25-104AEFAG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window