Sequence alignment for CL0433

PF13421

A1B688_PARDP/26-236VYRYPTVGKAIKYGAKLTVRE------------------GQAAVF---IH--EGQLAD----------------------
A3V3G3_9RHOB/26-236VWRFERHGHEIKYGAKLTVRE------------------GQAAVF---VH--EGQLAD----------------------
A4CIK3_ROBBH/30-240VHRFERYQNEIKNGARLIVRE------------------GQKAVF---VN--EGQLAD----------------------
A4WUR1_RHOS5/26-236VWRFERQGHAIKYGAKLTVRE------------------GQAAVF---IH--EGQLAD----------------------
A5G3T6_GEOUR/26-236VWRFPRFENEIKYGAQLTVRQ------------------SQVAVF---VN--MGQIAD----------------------
A6C8B2_9PLAN/27-238TWRFPRYQNEIKNGAQLIVRP------------------GQMALF---VH--RGQVAD----------------------
A6DY99_9RHOB/26-236VWRFEREGHEIKYGAKLTVRE------------------GQAAVF---VH--EGQLAD----------------------
B3E867_GEOLS/26-236IYRFPRYNNEIKNGAKLVVRE------------------GQAAVF---IN--EGQIAD----------------------
B6B0M0_9RHOB/26-236VWRFEREGHEIKYGAKLTVRE------------------GQAAVF---VH--EGQMAD----------------------
B8FFG4_DESAA/26-236VFRFERYGNEIKYGAKLVVRE------------------GQQAVF---IN--EGQIAD----------------------
B9M753_GEOSF/26-236VWRFPRYENEIKYGAQLVVRQ------------------AQAAVF---VD--RGEIAD----------------------
D5UR64_TSUPD/26-236AWRFPRYNNEIKNGAQLIVRE------------------GQEALF---VY--RGQLAD----------------------
C2G525_9SPHI/26-236VWKFPRYQNEIKMGAQLTVRE------------------GQAAVF---MN--EGRIAD----------------------
C5JBH5_9BACT/26-236VYRFERHGNEIKYGAQLVVRE------------------GQHALF---VN--EGQLAD----------------------
C7D9P0_9RHOB/26-236VWRFEREGHEIKYGAKLTVRT------------------GQAAVF---VH--EGQLAD----------------------
C9KTK6_9BACE/35-258MWKYP..ANDIMRGAVIKVHQ------------------NQRALL---YS--SGQRID----------------------
C9L2Z9_9BACE/38-254VWKFP.YDN.LSIGTQLIVNH------------------SQEAIF---LR--GGAVCD----------------------
D1N0K4_9BACT/26-236VHRFERFNNEIKYGAKLIVRP------------------GQAAVF---VN--EGKIAD----------------------
E8RWI6_MICSL/26-236VWRFPRYQNEIKMGAKLVVRE------------------SQTAVF---VN--EGKIAD----------------------
D3IJU6_9BACT/26-237IWRFPRYQSEIKNGAQLNVRE------------------SQVAVL---VN--EGQFAD----------------------
Q0FM78_9RHOB/26-236VWRFEREGHEIKYGAKLTVRE------------------GQSAVF---VH--EGQLAD----------------------
Q26GM4_FLABB/30-240AHRFERYQNEIKNGAKLIVRE------------------GQTAVF---IN--EGQLAD----------------------
Q47L21_THEFY/21-231AWRFPRHDNEIKMGAKLIVRE------------------GQLAVF---VN--EGRIAD----------------------
Q7UUL6_RHOBA/56-267VWRFPRHDNEIKNGAQLIVRP------------------GQTAVF---VY--KGEIAD----------------------

PF01145

A5DBX9_PICGU/79-250----------------KKVDQ..................GEVGLV...QT..FGALSR......................
Q54X13_DICDI/30-222----------------LILKE..................REIIIL...ER..FGQYHN......................
Q8NL82_CORGL/38-205----------------PVARV..................GHAVLR...QR..AGEISR......................
Q9RQU5_CLODI/24-196----------------RVIKQ..................SKVGII...MR..LGKFQK......................
Q3YQY0_EHRCJ/26-202----------------FIVDE..................AHQSIV...LQ..FGRVVK......................
Q01QT0_SOLUE/4-251----------------YTVDQ..................NERAVK...TR..FGRAVRVSGDKTTLDDPIAEALRPEEKS
A6DJY3_9BACT/29-214----------------RQVSE..................NEYLII...TR..FGKVNR......................
Q7BTU1_YERPE/7-194----------------DRVEP..................GYVGIK...VN.KLGEDKGI.....................
FLOT1_ARATH/3-185----------------KVARA..................SQYLAI.......TGAGIE......................
Q87KY0_VIBPA/44-297----------------LMTDA..................GYSYVH...QNNITGELDV......................
Q7WQ89_BORBR/28-208----------------FQVDQ..................GERGVV...LR..NGKLVR......................
A6EM35_9BACT/36-219----------------KRCPS..................DRILVV.......YGKVGTGN....................
A1RSJ3_PYRIL/47-245----------------YTLPA..................GVVAVV...VDPVSGTISK......................
A7JFZ5_FRANO/22-195----------------SIVAT..................QSVNII...ER..FGKFVR......................
Q28CP1_XENTR/61-241----------------KMVPD..................YQRIVI...FR..LGRVQA......................
A9AV86_HERA2/27-198----------------SIIYE..................HERGLL...YK..HGKFQR......................
A9AH04_BURM1/23-201----------------LTVDP..................RHIAVL.......SGRGGAE.....................
Q8D667_VIBVU/25-231----------------YTVNE..................VQQVVI...TQ..FGKPIGT.....................
Q9XAJ5_STRCO/27-227----------------KVAGP..................SEAFIV.......TGRRGKRSTDPETGR............V
A5UQB3_ROSS1/147-329----------------IMVPD..................GCQALI...TR..FGKLEE......................
Q8PBR9_XANCP/66-240----------------QLIGE..................QQRGVV...LR..FGQFSR......................
A6DTT2_9BACT/42-238----------------RTIEK..................NEKAVV...LQ..FGKLKS......................
A1VS28_POLNA/25-221----------------TRIET..................GEVGLR...IN..FDKTTDP.....................
A6V731_PSEA7/10-287----------------KFVAAPIGVLALGFGLFNGVFFYNEAGFMT.HVRTIFGDEKI......................
D1N1N5_9BACT/30-214----------------YQLNQ..................TESAVV...TT..FGRPAE......................
A7GXM3_CAMC5/29-235----------------RVVET..................NEVHIV...QS..ARKTMSY.....................
A6GGG7_9DELT/52-236----------------IIVNP..................DEVALV...IE..DGRASG......................
Q1HR13_AEDAE/28-207----------------YNVDG..................GHRAVI...FDRFTGVKQQ......................
A1RAB0_ARTAT/20-208----------------YVVHL..................QKGMVR...................................
Q47MY9_THEFY/102-281----------------VEIEQ..................GTTGVL...TK..FGAIVA......................
Q8F4L3_LEPIN/16-199----------------IVVNP..................NEKALL...YV..NSKLEK......................
Q72UG5_LEPIC/48-230----------------STVKA..................GEIGLFWKPFG..LSDIGLH.....................
Q65J46_BACLD/36-220----------------EKIPN..................GYVGVV...YSPNGGVKSE......................
Q76Z22_9CAUD/26-209----------------TIVDA..................GTTKVG...TL..MGEVQD......................
A1KN88_MYCBP/55-245----------------TIVGT..................RQFAIM...TT..FGRPTG......................
A4NZC0_HAEIF/24-210----------------FSVDE..................GEIGLV...TR..YGEIQE......................
A6DTT0_9BACT/309-521----------------TYIAP..................GYKAIL.......SGSGTS......................
A1RZ05_THEPD/30-234----------------LIVHE..................YEVAVF...FR..DGKAYD......................
Q82CW6_STRAW/178-350----------------ARGCT..................GRAWVL...GL..FGRYRG......................
A6G7G5_9DELT/54-276----------------ITVPA..................GHHAVMYRYFE..AGTVTD......................
A3ZSS7_9PLAN/140-314----------------CEVQR..................FHRGVL...FY..DGKYVE......................
A9B3W6_HERA2/115-349----------------QHVEE..................GEVLLI.......QRRMDHQ.....................
Q8ETQ3_OCEIH/33-230----------------KTVPS..................NVALII...TGPKLGDPEKERNIFQD...............
Q2JUY0_SYNJA/34-221----------------RLVGN..................GENMVV...FT..WGGGVSP.....................
A5CSU8_CLAM3/32-222----------------RRVPP..................NQALVI.......VGRNAEKSEGGA................
A3CLK3_STRSV/29-214----------------VNARP..................NEVVVI.......TGLRKQ......................
A7VQ64_9CLOT/74-274----------------KVINP..................KEALVL...TL..FGKYCG......................
Q8V6S4_9VIRU/31-228----------------EPVDE..................GNVAVV...TE..WGDATG......................
Q3AHV3_SYNSC/32-214----------------FVVPA..................GEVGVV...TT..LGKVSK......................
Q119N4_TRIEI/61-249----------------QICKP..................NEILIL.......SGRKRRLKGGQ.................
Q1BPT6_BURCA/42-247----------------LTVRE..................TQVAIF...VN..EGKVAD......................
Q8YY85_NOSS1/318-534----------------TEIPI..................GYVGVVISFVGKAQEDVSGAAFTHGNLV...........NP
A7B9F0_9ACTO/13-202----------------YQGGA..................GDHVVQ...IR..AGRTIR......................
A7A735_BIFAD/49-245----------------YSVDV..................GEVAVI....RNMGGSLAG......................
Q2RZL8_SALRD/80-256----------------VDVPE..................GYEGVL...CR..FGEPYEN.....................
Q54K65_DICDI/28-191----------------KILNQ..................YERGVV...FN..FGKFHT......................
Q3IR56_NATPD/37-229----------------ATVDE..................GDRGVK...KV..QGSVTG......................
A7BKU8_9GAMM/106-302----------------IIVPP..................NVYVVH...TR..IGRDEP......................
A6DTT1_9BACT/27-205----------------YTVGQ..................SQAVVL...TS..LGKQSV......................
Y1021_SYNY3/86-292----------------VIAPN..................NEALVR...TGGVFKKEQM......................
Q6WHG5_BPKV4/25-219----------------AEIPT..................GFVGKI...................................
Q114A2_TRIEI/361-607----------------TRIEQ..................EEVGVVISFVGKEYDKNYDQQPIFYGAEKSLY....QLVPK
Q67KD6_SYMTH/26-206----------------RKVPP..................NRALIV...YG..FGGPRV......................
ERLN1_PONAB/24-211----------------HKIEE..................GHLAVY...YR..GGALLT......................
A3X541_9RHOB/26-218----------------AKATL..................DTALVR...TG..FGGRRV......................
Q6U9K4_9CAUD/33-217----------------AVVDD..................GSVATT...TF..LGKVSP......................
A9B5U5_HERA2/35-232----------------KTIPP..................GYVGIA...FNKANNNVTT......................
Q2SE90_HAHCH/5-203----------------IKTEP..................TTYIMQ...FN..KGKLKR......................
Q9ZMI7_HELPJ/62-262----------------EVISS..................GEIGIK...IT..AGKYEP......................
A6DJY2_9BACT/306-539----------------VEIKP..................GYAGVR...EN..FGKISRDAG...................
A7N4W8_VIBHB/30-242----------------KVRGE..................GDALIV.......NGLHAT......................
Q22WG5_TETTS/26-207----------------SSLQV..................NEYGLD.......YSSISKTI....................
Q7UMK7_RHOBA/174-391----------------VEIPT..................GYVGVVTLQTNNEQAGLQKGV....................
Q878M8_STRPQ/39-222----------------TRIPA..................NTVGVK...VSATSGVQKQ......................
D1N1N6_9BACT/53-297----------------FAVEP..................QRAVIV...VK..FGKIQE......................
A4HYE6_LEIIN/5-177----------------PSISQ..................SEVGIV...ET..CGRFSY......................
A0XWY7_9GAMM/53-213----------------TMIGP...........................................................
A5V005_ROSS1/55-242----------------VQVDE..................GQRGII...VT..SGAVEG......................
HFLC_BUCBP/21-239----------------FIIKE..................GQRGII...LR..FGKISYDDN...................
B9LBU8_CHLSY/36-219----------------TIVQE..................GTCHVY...TL..FGSVVG......................
A6V538_PSEA7/332-551----------------REIGM..................DARGVY...ER..FGKPVA......................
Q8PPV1_XANAC/20-207----------------VSPDP..................GQQAVLV.DKPLFFGKGGIRL....................
Q11VD7_CYTH3/21-198----------------VTVKQ..................GYVAII...TV..FGKYRR......................
Q1IQW9_KORVE/72-276----------------AVVSS..................GEAGVR...VSETSGTLSG......................
Q3M8Q8_ANAVT/9-189----------------IIINP..................GQAGVL...SI..LGKARD......................
Q090V7_STIAD/69-267----------------QVIEP..................AQVGIR...VNLLTGTSSE......................
D1N1N4_9BACT/326-563----------------HEVGP..................SEVGVK...ER..LGKVVE......................
Q1PZW5_9BACT/32-225----------------IKVGA..................DQVGVRTRVWGVSRGIVQK......................
A6DJY4_9BACT/65-290----------------FTVES..................GQQVITFKFKEIMLHDGEG......................
Q1D2G7_MYXXD/109-312----------------VTARP..................SEFLVH...MR..RGRVRE......................
Q54F95_DICDI/43-215----------------TKIEQ..................NELGVR...YT..FGKIGK......................
A4FVJ0_DANRE/138-311----------------KIVRE..................HERAVK...FR..LGHLLKK.....................
A1AN40_PELPD/42-249----------------LVVRE..................GQMAVL...IS..EGKLAD......................
Q233H7_TETTS/39-215----------------VQSNP..................NQWLLV...IQ..NGKLVK......................
A1ZL05_9BACT/23-202----------------TVVRQ..................DMVGVK...TK..FGKVKP......................
A7UY12_BACUN/32-219----------------ERIDS..................GQTGIIVNLAGSERGVDDA......................
Q043D7_LACGA/23-194----------------HIVPQ..................NYEGLV...ET..LGKYSR......................
A5TW95_FUSNP/28-213----------------YTVDT..................GEVAII...ST..FGKITK......................
A7BTW2_9GAMM/55-247----------------YINEE..................SQRAVE...MR..FGKLIK......................
A1TM35_ACIAC/23-205----------------FVVDQ..................RQFGVV...YQ..LGQIKE......................
A8LGX8_FRASN/173-419----------------IDVQV..................GTAGVVIVRVGQMYDDSNAAVAPRVPGHRSFQYPWAFLENG
Q1MDA7_RHIL3/28-223----------------TRSSR..................DEAYVR...TG..LGGQKV......................
Q48BK3_PSE14/61-251----------------VQVRS..................GEATVV...TR..FGNPSR......................
A4YEZ5_METS5/41-236----------------FIVQP..................TENCVV...II..QGQVQA......................
Q9A5B4_CAUCR/49-247----------------STVEP..................GNVGVK...IR.TLGASAG......................
Q87TY4_PSESM/47-268----------------RQIDP..................QNRAVV...MR..FGALER......................
Q0RL11_FRAAA/10-261----------------ASTSG..................GQIAVVRNGGPFDNHRIRQ......................
A4YLJ4_BRASO/276-496----------------TIIPV..................GNVGVVIFYTGPHMADVSGETY...................
A3JKR6_9ALTE/29-215----------------VLVEP..................RQARMI...YSWAGGEVLR......................
A3RPR4_RALSL/36-235----------------QIIPP..................GYTGIK.......INRLVDRGI...................
Q7UMK6_RHOBA/205-421----------------IVIPA..................GFKGVVTLLSAPPAEDPNQLLVEEG................
A3EPC8_9BACT/42-222----------------VSINP..................GQAGVF...WDISHGTDTS......................
Q67MY2_SYMTH/40-231----------------IFVRE..................DEYLVI....RSWTGVVQR......................
A5FZF5_ACICJ/44-216----------------RTANE..................WERAVV...LR..LGRFAG......................
A0ZCT5_NODSP/20-192----------------KLINQ..................GNEALV...ER..LGRYHR......................
Q2JMY3_SYNJB/34-233----------------YVTLP..................GHATVV...FNTFSGLQKG......................
Q1PZW6_9BACT/41-239----------------KELAP..................DEVAVI...VNNLTGSIKQ......................
Q0SNV9_BORAP/33-247----------------FIVGP..................SEEAIV...LR..LGKLNR......................
Q7PAR4_RICSI/68-263----------------YEIKE..................GEEAAV...IR..FGRFVR......................
A8FZG0_SHESH/35-214----------------FIVIE..................GHVGVV...KR..FGEAKG......................

PF11978

MVP_MOUSE/519-647---------------------------------------GPDFFT-----------------------------------
Q38C44_TRYB2/534-652---------------------------------------GPDFMA-----------------------------------
Q4D3P0_TRYCC/529-647---------------------------------------GPDFMA-----------------------------------
Q4QCJ5_LEIMA/614-738---------------------------------------GPDYMA-----------------------------------
MVP_STRPU/521-639---------------------------------------GPDFCT-----------------------------------
MVP_DANRE/533-651---------------------------------------GPDFCT-----------------------------------
MVP_DISOM/519-637---------------------------------------GPDFFT-----------------------------------
MVP_CHICK/520-636---------------------------------------GPDFCA-----------------------------------
MVPA_DICDI/504-621---------------------------------------GPDFMT-----------------------------------
MVPB_DICDI/520-633---------------------------------------GPDFMT-----------------------------------
MVP_TRYCC/511-626---------------------------------------GPRFSS-----------------------------------
MVP_LEIIN/511-626---------------------------------------GPRFSS-----------------------------------
A7RH80_NEMVE/598-715---------------------------------------GPDYIT-----------------------------------
A1ZGE7_9BACT/529-640---------------------------------------LHNKIS-----------------------------------
A6FXE2_9DELT/535-646---------------------------------------LYNKVS-----------------------------------
A4HP51_LEIBR/553-671---------------------------------------GPSNMT-----------------------------------
Q4DYQ9_TRYCC/535-653---------------------------------------GPSNMT-----------------------------------
Q38AX5_TRYB2/537-655---------------------------------------GPSNVT-----------------------------------
A0CI16_PARTE/525-641---------------------------------------GPDFMT-----------------------------------
A0EGV2_PARTE/516-633---------------------------------------GPEFST-----------------------------------

PF13421

A1B688_PARDP/26-236-------.VFAPG-LYMLETNNLPILTRLQHWDHGF-RSP--------------------FKSEIY---FVNTTRFNDLK
A3V3G3_9RHOB/26-236-------.VFTPG-LYMLETNNMPVMTSLQHWDHGF-KSP--------------------FKSEIY---FVNTTRFSNLK
A4CIK3_ROBBH/30-240-------.VFGPG-TYELTTSNLPILTTLKGWKYGF-DSP--------------------FKAEVY---FVNTRLFTDEK
A4WUR1_RHOS5/26-236-------.VFGPG-LYMLETNNLPILTTLQHWDHGF-RSP--------------------FKSEVY---FVNTTRFNNQK
A5G3T6_GEOUR/26-236-------.VFTSG-QHRLTTKNLPVLTTLLGWKYGF-QSP--------------------FKAEVY---FINTRNFTNLK
A6C8B2_9PLAN/27-238-------.VFEPG-HYELKTDNLPILATLQGWKHGF-NSP--------------------FRSEVY---FVNTTQITDLK
A6DY99_9RHOB/26-236-------.VFTPG-LYMLETNNMPVMTSLQHWDHGF-KSP--------------------FKSEIY---FISTTRFNNLK
B3E867_GEOLS/26-236-------.VFKPG-TYDLTTQNLPILATLKGWKYGF-ESP--------------------FKAEVY---FVSTRQFTNLK
B6B0M0_9RHOB/26-236-------.VFTPG-LYLLETNNMPILTTLNHWDHGF-QSP--------------------FKSEVY---YVNTTRFNDLK
B8FFG4_DESAA/26-236-------.VFTPG-TYTLETRNLPILSTLKGWKHGF-ESP--------------------FKAEVY---FCSTRQFTDIK
B9M753_GEOSF/26-236-------.VFTPG-QYRLETQNLPVLSTLRGWKYGF-QSP--------------------FKAEVY---FVNVRSFTNLK
D5UR64_TSUPD/26-236-------.RYGPG-GYTLVSENMPVMSTLQGWPHGF-SSP--------------------FRSEVY---FVNRRPITDLR
C2G525_9SPHI/26-236-------.VYYSG-RYELSTQNMPIMTTLQGWKYGF-NSP--------------------FKADVF---FVSLRQFVNQK
C5JBH5_9BACT/26-236-------.GFTPG-TYTLETQNIPVLSTLRGWKHGF-ASP--------------------FKAEVY---FVSLRGFTNLK
C7D9P0_9RHOB/26-236-------.VFTPG-LYMLETNNLPIMTTLKYWDHGF-KSP--------------------FKSEIY---YVNTTRFSDLK
C9KTK6_9BACE/35-258-------NIGPGR-EIVVDSANIPGLKRLLNKATGG-ETS--------------------YPFEVW---FANMSCEHNIN
C9L2Z9_9BACE/38-254-------.IFGEG-THTLSTNNIPVLQKLINLPFGG-RTP--------------------FTAEVY---FVSKTVRRNLK
D1N0K4_9BACT/26-236-------.KFGPG-TYTLETKNLPILTTLLSLPYNF-NSP--------------------FKAEVY---FIRTTEQLDRK
E8RWI6_MICSL/26-236-------.VFEPG-TYTLETRNLPILSTLKGWKYGF-NSP--------------------FKAEVY---FVNTRQFTDMK
D3IJU6_9BACT/26-237-------.IYQPG-RHVLNTNNMPILSTIMGWKYGF-NSP--------------------FKVDVY---FVNTKQFLNVK
Q0FM78_9RHOB/26-236-------.VFTPG-LYMLETNNMPIMTSLQHWDHGF-RSP--------------------FKSEIY---FVNTTRFNGLK
Q26GM4_FLABB/30-240-------.VFTPG-TYDLTTQNLPILSTLKGWKYGF-NSP--------------------FKAEVY---FVNTHLFTDEK
Q47L21_THEFY/21-231-------.VFAPG-TYTLTTQNLPVLSTLQGWKYGF-NSP--------------------FKAEVY---FFNTRQFTDLK
Q7UUL6_RHOBA/56-267-------.IYPPG-HYQLTTDNMPVMTTLQGWKYGF-DSP--------------------FKAEVY---FVSTRQLTDLK

PF01145

A5DBX9_PICGU/79-250........TVEPG....................LSY.VNT....................WSESLV...RVNVK.VNIRE
Q54X13_DICDI/30-222........ILHAG....................VHW.TIPWVDRPKTFYYSYYVDTPSGKELREGLNLTRISTQ.NEVLD
Q8NL82_CORGL/38-205..........MQG....................REF.SRP.....................GDQFR...QVDLR.RRLIQ
Q9RQU5_CLODI/24-196........VAETG....................VHF.LIP....................FLDKMA..YVIDLR.EIVID
Q3YQY0_EHRCJ/26-202.......QIHNSG....................LYF.KLP....................FIQKVV...YVDKR.IIDIS
Q01QT0_SOLUE/4-251RYVYPQVRVIQPG....................GPYFRMP....................WEKVHK....VSIA.TMTVN
A6DJY3_9BACT/29-214........IAEPG....................LTF.KLP...................YPIENSI...SLEKR.LNTYE
Q7BTU1_YERPE/7-194......GEVVGVG....................RQW.TGL....................NTELYT...FPTFK.QMKTY
FLOT1_ARATH/3-185.......DIKLSK....................KSW.VFP.....................WQSCT...VFDVS.PVNYT
Q87KY0_VIBPA/44-297........FTEPG....................IHF.RMP....................FLSKIT...KYDQVITVSFG
Q7WQ89_BORBR/28-208........VSEPG....................LDF.KTP....................FIDSVS...TVSVR.DHTFI
A6EM35_9BACT/36-219.....SAKCIHGG....................AAF.IWP....................VIQDYE...FLDLT.PISIE
A1RSJ3_PYRIL/47-245.......PVAGPA....................IGF.KAP....................WAYIIEDTYAIEVIEFVQRE
A7JFZ5_FRANO/22-195........IQRAG....................LNF.RIP....................FIERIA..GRVSLR.VQQLD
Q28CP1_XENTR/61-241........ARGPG....................LVL.LFP....................LIDQFQ...RVDMR.TKAFS
A9AV86_HERA2/27-198........VLEPG........................KYR....................FLRNAYQISKIDVR.PSSLS
A9AH04_BURM1/23-201......PELAGPG....................VHFKLLP....................PLQTAT...LVDTR.LQSLE
Q8D667_VIBVU/25-231.......PIVNAG....................LKI.KIP....................YIQEIN...MIDKR.VLEWD
Q9XAJ5_STRCO/27-227FTDNSGQKVVVGG....................GVF.VVP....................FVQQRF...TLDLS.SRHIP
A5UQB3_ROSS1/147-329........IAPAG....................RKVLLDP....................WKRVSY...IVNVT.REYPY
Q8PBR9_XANCP/66-240........ILQPG....................PSF.KLP...................WPIESVR...KVNATEIKTFS
A6DTT2_9BACT/42-238........TFDSNS..................RFVF.AWPY..................PFDSVISIKTSSSRS.LKSLR
A1VS28_POLNA/25-221.......TERLPG...............................................SFNQTLIGDIVTFK.IQDVA
A6V731_PSEA7/10-287........VDDVGY..................ATKW........................FGRATTWKKAISVQSVLITD
D1N1N5_9BACT/30-214........VNEPG....................LHF.RWP...................FPFQKIH...RFDHR.IRCFE
A7GXM3_CAMC5/29-235......GKDTGNG....................NSYYEFPSW...............MPIFGVTKI...VLPVS.VFSIK
A6GGG7_9DELT/52-236........DLQPG....................SYM........................FEKTRV...TGSLD.VIWMK
Q1HR13_AEDAE/28-207........VSGEG....................THF.FVP....................WVQRPI...IFDIR.SQPRN
A1RAB0_ARTAT/20-208........HQGVG....................QAFWFRP....................ANSVLS...EVPVD.DQELP
Q47MY9_THEFY/102-281........ELGPG....................RHYLWHP....................WTRVDF...VVDTSTEIPYN
Q8F4L3_LEPIN/16-199........VYDPG....................VYR.ISG....................FLKKIL...VFKHP.TIEFL
Q72UG5_LEPIC/48-230......KEPVLSG....................FYW.LYP.....................WNDIY...TYSTQ.WNAYK
Q65J46_BACLD/36-220........TLDQG....................WHL....V..................GLFDKVT...RYPVR.MQTVN
Q76Z22_9CAUD/26-209.......RPLEEG....................LHF.VNP....................FMGFDT...F.DTR.NNKFV
A1KN88_MYCBP/55-245.......VSLNNG....................FHG.KWP....................WQMTHPMDGAVQID.KYVKE
A4NZC0_HAEIF/24-210........TKSAG....................LHWRS......................WLEDDV...VFSTR.EQKVT
A6DTT0_9BACT/309-521.......STLEPG....................LHI.TPP...................YPFSQIT...RVETSRLRQIN
A1RZ05_THEPD/30-234........VLGPGRHTLTTQNLPLLTRVLSAIAGYP.TTP....................FKATVI...FVSTK.QFRGL
Q82CW6_STRAW/178-350.......TIRRTG....................LMW.VNP....................LLLRRR...V.DVR.LRHWR
A6G7G5_9DELT/54-276.......RIWGEG......................FHVIP....................PWDTLT...VYESR.LQQKT
A3ZSS7_9PLAN/140-314........TLEPG...................VYAFWKET....................VDARVV...EIDLR.EQTLD
A9B3W6_HERA2/115-349......HIIRPPG....................LHSPIVP...................ALEVGVA...VMPTY.NIQTD
Q8ETQ3_OCEIH/33-230.DEGRYMKVIRGG....................GH..RLR....................MFQTST...PVPLT.AFQLQ
Q2JUY0_SYNJA/34-221.......MALQPG....................LHW.VPP....................FVSRTV...IFDVK.TQALT
A5CSU8_CLAM3/32-222.GFSSPQKVIIGG....................RTF.IWP....................IFQEGF...TLSLE.QYQTS
A3CLK3_STRSV/29-214.......RHLRGK....................AGF.MIP....................FVEQRS...YLDIE.QFSTD
A7VQ64_9CLOT/74-274.......TLKKDG....................FYW.VNPFCTA...........VNPTAATGRTTGPNSVIVSESKKVS
Q8V6S4_9VIRU/31-228.......EVLQPG....................ANW.ITP....................VKHNTV...ELSTR.QQAYT
Q3AHV3_SYNSC/32-214.......TPREPG....................LNL.KLP....................FIQATH...NFSVR.TQVIP
Q119N4_TRIEI/61-249...TVGYRVIFGG....................RAI.PIP....................ILETTK...TMDLR.TMPVP
Q1BPT6_BURCA/42-247........VFQPGLYTLETRTL.PVLTNLKNWDKFF.QSP....................FKSDVY...FFSTR.LQLGR
Q8YY85_NOSS1/318-534GHKGVWVEPLYPG........................KHP....................LNTRIMKVELVPTT.NIVLN
A7B9F0_9ACTO/13-202.........SGVG....................QSFWLRA....................GRCALA...EVPTA.NRAHS
A7A735_BIFAD/49-245.......HSEDAG....................FHL.KTP.....................WQSVI...KYDTR.NNLIN
Q2RZL8_SALRD/80-256.......KETRNG....................RNW.LFR....................FSDYIP..YLVSKR.DQVVD
Q54K65_DICDI/28-191........VKEAG....................FHI.VIP....................FIQKCD...IVDIR.TFTYT
Q3IR56_NATPD/37-229.......DVLEPG....................WHFPLVP....................FYHSVE...YIEIR.PQTYT
A7BKU8_9GAMM/106-302.......VTLGLG....................KSFRYNP....................YKDAYL...VVPAA.MQTIG
A6DTT1_9BACT/27-205........ELRPG....................LHF.KLP...................WPISKAE...KINTK.RQIFN
Y1021_SYNY3/86-292........VILHG....................GCI.VIP....................GFHEIT...RVSLR.EISID
Q6WHG5_BPKV4/25-219........QTKDG....................FDLTQEPRQPSKF.......RLDWAWRYPDRLV...LLDVS.DSFYE
Q114A2_TRIEI/361-607GYKGVQKEPLTAG........................QYA....................INTRVKTVKLVPTT.QIILN
Q67KD6_SYMTH/26-206........TKGGG......................LVVWP....................LIQSAQ...ELSLE.LMSFD
ERLN1_PONAB/24-211.......SPSGPG....................YHI.MLP....................FITTFR...SVQTT.LQTDE
A3X541_9RHOB/26-218........VTDGG......................CLALP....................ILHQMQ...KVSMG.ALNFE
Q6U9K4_9CAUD/33-217.......NIMQPG....................LNV.INP.....................LASVD...TYSTR.DLKME
A9B5U5_HERA2/35-232........AIDPG....................WTL.INP....................FTTAIQ...QYPVT.IQTYI
Q2SE90_HAHCH/5-203.........EGAG....................LGFFYFA....................PTTSLV...SIPIG.SADLP
Q9ZMI7_HELPJ/62-262.......TPLQPG....................IHF.FVP....................IIQDIL...IVDTR.IRNIN
A6DJY2_9BACT/306-539....GEVVQLQPG....................LNF.KLP...................WPMGKIS...IYNVDKLSTFT
A7N4W8_VIBHB/30-242.......RASLTG.....................TF.VWP....................VINKFE...FMDIT.RKKIS
Q22WG5_TETTS/26-207.....SQTPFEAG....................VHF.LG.....................IGHHFL...VFPKT.VINIE
Q7UMK7_RHOBA/174-391.....QSKVLQPG....................LYP.VNP....................NEQQID...IINVG.YNESS
Q878M8_STRPQ/39-222........TLSTG....................YHL.KVP....................FIDKIY...KMPTS.VQQKK
D1N1N6_9BACT/53-297........TYTTG....................GHW.FLP...................YPVNQFI...RIQTN.QQSMD
A4HYE6_LEIIN/5-177........TADPG....................IHC........................LWCGSILVRRITLR.LQEYE
A0XWY7_9GAMM/53-213.........ANYG....................MSL........................LRNEVV...NIDMR.PNTYT
A5V005_ROSS1/55-242........IQEPG....................IFFRPFA....................PFTRVE...IVNVR.RQTVT
HFLC_BUCBP/21-239....HHVLVYKPG....................LHI.KLP....................FIESVK...IFNSK.IQTID
B9LBU8_CHLSY/36-219.......VLREPG......................LVILPFHLGV.........NAFLISFFGRRY...VIDMRLDQRYL
A6V538_PSEA7/332-551........VLGPG....................LHL.GLPW..................PLGRVLA...VENGV.VHELA
Q8PPV1_XANAC/20-207......DDVRDPG....................RTY.TWL....................TTSATY...V.DVT.PQTVQ
Q11VD7_CYTH3/21-198........VIEPG....................LSF.RIP....................FIETVY..KRISIQ.NRSVE
Q1IQW9_KORVE/72-276........TLYPG....................VHF.VTP....................VLEHVE...TFDTR.DKLFT
Q3M8Q8_ANAVT/9-189.......GALLEG....................IHL.KPP....................LISAID...VYDLT.VQKFE
Q090V7_STIAD/69-267.........VREG....................WVL.MLP....................HVHRLY...LYSLK.DQVYR
D1N1N4_9BACT/326-563.......TDLEPG....................IYW.TLPW..................PFGEIRQ...FSCTD.IHQVV
Q1PZW5_9BACT/32-225........DYGPG....................WHR........................AISTIDQWDLYDIT.VQTLE
A6DJY4_9BACT/65-290.......FIKDEG....................SVHLILPK..................PFGEVLK...FSSAHTPQLVS
Q1D2G7_MYXXD/109-312........VSGQG....................ASCFKLP.....................GDSVA...IVPTS.IQRLQ
Q54F95_DICDI/43-215.......KILGPG....................LRL.MVP....................LIHDIE...LFDTR.SSTQH
A4FVJ0_DANRE/138-311.......RPRGPG....................LMF.YLP....................FLDVCH...IVDIR.LQILK
A1AN40_PELPD/42-249........VFQPGTYRLETRNM.PLLATLKGWKYGF.SSP....................FKTEVY...FCSTR.QFTNL
Q233H7_TETTS/39-215.........AGVG....................LKCFVLP.....................NQTYV...TFPSK.IEKVS
A1ZL05_9BACT/23-202.......RTLEPG....................LYS.INP....................FTTKML...TLPAR.SINME
A7UY12_BACUN/32-219........KVETG....................WVV.YNR....................FAKQLF...EYPAF.AQIVD
Q043D7_LACGA/23-194........TVKAG....................FVM.IFP....................GVQRIR...KVSLA.LQPLE
A5TW95_FUSNP/28-213........VENEG....................LHV.KIP....................FVQGKT...FMETR.EKTYI
A7BTW2_9GAMM/55-247........ITGPG....................LHF.KLP....................FIESYH...QYQLS.LQRIL
A1TM35_ACIAC/23-205.......VITEPG....................LNFKLPP....................PFQNVR...YIDKR.LLTLD
A8LGX8_FRASN/173-419GCQGVQEETLPGG....................GSYQINP....................WFARVV...LIPTR.VLVLE
Q1MDA7_RHIL3/28-223........VLDGG.....................SV.VLP....................IFHSTA...RVNLK.TLRLE
Q48BK3_PSE14/61-251.......VLLDPG....................LNW.RWP...................APFEATI...PVDLR.LRTTS
A4YEZ5_METS5/41-236........VLPSGTHNIQSPQ...NPLSSFMAKFRYNQLP....................FDTIAL...FISMT.RHEVR
Q9A5B4_CAUCR/49-247.........VDPE........................PLPARW.............YLRGIGERII...QYPVI.QRTYG
Q87TY4_PSESM/47-268........VQNAG....................LLT.AWPQ..................PFEHVVL...LPSADRVIERR
Q0RL11_FRAAA/10-261........IVNPA....................SSRTYVG....................LYSSMH...NYPAQ.QRYYT
A4YLJ4_BRASO/276-496....RHGELVRNGGRGVWKDPLLPGKYAFNTYAGKIEIIP....................TVNFILKWVRGEVG.AMKLD
A3JKR6_9ALTE/29-215.......TITEPG....................LYF.KLPF..................PLQSTSD...RVSLA.ERIIK
A3RPR4_RALSL/36-235.....TRENVVTG....................FVF.YNP....................VQTALI...QYPTY.VQRVI
Q7UMK6_RHOBA/205-421.KRGVQEKTLDPG....................VYY.INP....................YVQRVN...LVDCR.SQRFN
A3EPC8_9BACT/42-222.......QVYREG....................VQI.IAP....................WNRMY....IYDLR.TQEAR
Q67MY2_SYMTH/40-231.......VVTEAG....................PTF.KIP....................LLQSAQ...TLPKHRVVHDS
A5FZF5_ACICJ/44-216........IRGPG....................VFF.IIP....................VIETVY..VLVDTR.KQSTI
A0ZCT5_NODSP/20-192........KLGSG....................LNF.IVP....................LVDQIV..MEDTIR.EQFLD
Q2JMY3_SYNJB/34-233.......RVELPG....................VIF.RIP....................GIETPI...TYTVL.TRVWE
Q1PZW6_9BACT/41-239........INRAG....................AIV.YYP....................FIQDIY...ILDKR.ELVLK
Q0SNV9_BORAP/33-247........TLDSG....................IHL.KIP....................LIEEKF...IVPVKIVQEIK
Q7PAR4_RICSI/68-263........KGYPG....................LNY.HLPA..................PFEKIIVE.KVKQSR.RIEIG
A8FZG0_SHESH/35-214........QENPG....................LHF.KIP....................FIETVE...MIEVR.TRKNA

PF11978

MVP_MOUSE/519-647---------------------------------DVI------------------------TIETAD---HARLQLQLAYN
Q38C44_TRYB2/534-652---------------------------------DKI------------------------VVETLE---HARLQLEIAYN
Q4D3P0_TRYCC/529-647---------------------------------DVI------------------------EVETLD---HARLMLHLAYN
Q4QCJ5_LEIMA/614-738---------------------------------DII------------------------EVETRD---HARLRLHLAYN
MVP_STRPU/521-639---------------------------------DII------------------------TIETAD---HARLQLQLSYN
MVP_DANRE/533-651---------------------------------DII------------------------TIETAD---HARLQLQLSYN
MVP_DISOM/519-637---------------------------------DVI------------------------VIETAD---HARLQLQLAYN
MVP_CHICK/520-636---------------------------------DIV------------------------TIETAD---HARLQLQLAYN
MVPA_DICDI/504-621---------------------------------DVV------------------------IVETSD---HARLSLKLSYN
MVPB_DICDI/520-633---------------------------------DLI------------------------TVETAD---HARLSLKLSYN
MVP_TRYCC/511-626---------------------------------DRI------------------------VVETSD---HARLELDLSYN
MVP_LEIIN/511-626---------------------------------DTI------------------------VVETSD---HARLRLRLSYN
A7RH80_NEMVE/598-715---------------------------------DLL------------------------EVETTD---HARLLIKIAMN
A1ZGE7_9BACT/529-640---------------------------------DIV------------------------KAESSD---FTQVSITLSYR
A6FXE2_9DELT/535-646---------------------------------DVV------------------------EAETRD---LVSVRIRLSYR
A4HP51_LEIBR/553-671---------------------------------DVV------------------------HVETRD---HAQLALQLCYD
Q4DYQ9_TRYCC/535-653---------------------------------DIV------------------------HVETRD---HAQLALQLCYA
Q38AX5_TRYB2/537-655---------------------------------DIV------------------------HVETRD---HAQLALQLCYA
A0CI16_PARTE/525-641---------------------------------DQL------------------------IVETSD---HAKLKLTLSYN
A0EGV2_PARTE/516-633---------------------------------DEI------------------------TVETSD---HAVLKLLLAYN

PF13421

A1B688_PARDP/26-236..........WGTKN----------------------------------------------PVIARDP--------EFG.
A3V3G3_9RHOB/26-236..........WGTKN----------------------------------------------PIMLRDP--------EFG.
A4CIK3_ROBBH/30-240..........WGTKN----------------------------------------------PVMLSDE--------RFG.
A4WUR1_RHOS5/26-236..........WGTKN----------------------------------------------PIICRDP--------EFG.
A5G3T6_GEOUR/26-236..........WGTKN----------------------------------------------PVILRDP--------EFG.
A6C8B2_9PLAN/27-238..........WGTPN----------------------------------------------PIMLRDP--------EFG.
A6DY99_9RHOB/26-236..........WGTKN----------------------------------------------PIMLRDP--------EFG.
B3E867_GEOLS/26-236..........WGTPG----------------------------------------------PCTMRDP--------EFG.
B6B0M0_9RHOB/26-236..........WGTKN----------------------------------------------PIIARDP--------EFG.
B8FFG4_DESAA/26-236..........WGTPG----------------------------------------------PVTMRDK--------EFG.
B9M753_GEOSF/26-236..........WGTKN----------------------------------------------PVMLRDP--------EFG.
D5UR64_TSUPD/26-236..........WGTPN----------------------------------------------PVTIRDP--------DFG.
C2G525_9SPHI/26-236..........WGTNN----------------------------------------------PIMLRDA--------EFG.
C5JBH5_9BACT/26-236..........WGTKQ----------------------------------------------PIIVRDP--------EFG.
C7D9P0_9RHOB/26-236..........WGTKN----------------------------------------------PIMIRDP--------EFG.
C9KTK6_9BACE/35-258IGITANDGILFPVLN----------------------------------------------KATGREM--------DFP.
C9L2Z9_9BACE/38-254..........FGTIN----------------------------------------------AVPVRDP--------LYSI
D1N0K4_9BACT/26-236..........WGTAT----------------------------------------------PVMMRDA--------DFG.
E8RWI6_MICSL/26-236..........WGTQN----------------------------------------------PVILRDA--------EFG.
D3IJU6_9BACT/26-237..........WGTAN----------------------------------------------PIMLRDP--------EFG.
Q0FM78_9RHOB/26-236..........WGTKN----------------------------------------------PIICRDP--------EFG.
Q26GM4_FLABB/30-240..........WGTKN----------------------------------------------PITLNDD--------RFG.
Q47L21_THEFY/21-231..........WGTQN----------------------------------------------PIIVRDP--------EFG.
Q7UUL6_RHOBA/56-267..........WGTPN----------------------------------------------PIMLRDP--------EFG.

PF01145

A5DBX9_PICGU/79-250----------IPA..............................................Q.SCFTRDN...........V
Q54X13_DICDI/30-222----------LPK..............................................Q.TVITRDC...........A
Q8NL82_CORGL/38-205----------VHP..............................................Q.SIPTADA...........M
Q9RQU5_CLODI/24-196----------FPP..............................................Q.PVITKDN...........V
Q3YQY0_EHRCJ/26-202----------SDS..............................................R.EVIAADQ...........K
Q01QT0_SOLUE/4-251----------MALDLENPT.................................ANENGTRL.DAVTKDQ...........L
A6DJY3_9BACT/29-214----------RPL..............................................T.QTSLKNA...........R
Q7BTU1_YERPE/7-194----------DEP..............................................F.TFQMSDG...........T
FLOT1_ARATH/3-185----------FKV................................................QAMSAEK...........L
Q87KY0_VIBPA/44-297----------NSKGEDFY....................................QRLDSV.QVRFADT...........Y
Q7WQ89_BORBR/28-208----------FEN..............................................L.EAYSYDQ...........Q
A6EM35_9BACT/36-219----------VNL..............................................V.NALSKQN...........I
A1RSJ3_PYRIL/47-245----------KAAGRW.......................................TFTAP.EVLTKDG...........V
A7JFZ5_FRANO/22-195----------IVA................................................ETKTRDN...........V
Q28CP1_XENTR/61-241----------VPP..............................................S.KVKSRDG...........V
A9AV86_HERA2/27-198----------LSG..............................................Q.EMFSADL...........I
A9AH04_BURM1/23-201----------SPD.............................................PL.QLATEDK...........H
Q8D667_VIBVU/25-231----------GRP..............................................S.DMPTKDK...........L
Q9XAJ5_STRCO/27-227----------VAV..............................................R.GAVTLRG...........V
A5UQB3_ROSS1/147-329----------NAP.............................................IR.EAPTASR...........V
Q8PBR9_XANCP/66-240----------NQV................................................PVLTRDE...........N
A6DTT2_9BACT/42-238----------FTPKENP......................................GDKII.KTVANTSLIPGEDGYLITA
A1VS28_POLNA/25-221----------VAVD...........................................NMT.PLASDNS...........T
A6V731_PSEA7/10-287----------DND................................................TNPDNDG...........L
D1N1N5_9BACT/30-214----------GGAG...........................................KLE.ETMTADG...........Q
A7GXM3_CAMC5/29-235----------IED..............................................Y.EAYDLGR...........L
A6GGG7_9DELT/52-236----------TGQRQL.......................................KWGLG.NVCTRDG...........I
Q1HR13_AEDAE/28-207----------VPV................................................VTGSKDL...........Q
A1RAB0_ARTAT/20-208----------TLF................................................HAITRDH...........Q
Q47MY9_THEFY/102-281----------APV..............................................L.ACPTKEN...........V
Q8F4L3_LEPIN/16-199----------ITVT............................................NQ.ELLTKDN...........V
Q72UG5_LEPIC/48-230----------EKV................................................DVLTNDD...........L
Q65J46_BACLD/36-220----------NQD..............................................I.QVATSDG...........K
Q76Z22_9CAUD/26-209----------KEN..............................................L.LIPTKDR...........F
A1KN88_MYCBP/55-245----------GNTD...........................................QRI.TVRLGNQ...........S
A4NZC0_HAEIF/24-210----------IGKFDDVG....................................DITSGI.SAYTRDT...........Q
A6DTT0_9BACT/309-521----------FTMGKDIRTEQEKEKRPFLD............TKSWINTDYQSSLFLTGT.GTGSRNA...........E
A1RZ05_THEPD/30-234----------FGG................................................RSQTTEL...........A
Q82CW6_STRAW/178-350----------SEP..............................................M.PAVDANG...........V
A6G7G5_9DELT/54-276----------LRF................................................SVLSDEG...........L
A3ZSS7_9PLAN/140-314----------VAG..............................................Q.DIMTADK...........V
A9B3W6_HERA2/115-349----------VEVEM.........................................VDTA.SLHTVDK...........I
Q8ETQ3_OCEIH/33-230----------ITS..............................................P.TVHTLKG...........V
Q2JUY0_SYNJA/34-221----------WKDNDPT.....................................AYAPRL.VALSQDG...........Q
A5CSU8_CLAM3/32-222----------VTA................................................EARDANF...........I
A3CLK3_STRSV/29-214----------VRT.............................................SE.AVPTLDF...........I
A7VQ64_9CLOT/74-274----------LKAITL.......................................NNEKQ.TVNDERG...........N
Q8V6S4_9VIRU/31-228----------MTSNPGEGA..................................KDYADPI.VVKTADG...........V
Q3AHV3_SYNSC/32-214----------EKF................................................STLTKDL...........Q
Q119N4_TRIEI/61-249----------VEV..............................................R.NAYSKGG...........T
Q1BPT6_BURCA/42-247----------RWGT............................................AQ.PVTIRDR...........E
Q8YY85_NOSS1/318-534----------WSGRTERHK.................................YDANLEAL.TVRSKDG...........F
A7B9F0_9ACTO/13-202----------FLV................................................QATTADQ...........Q
A7A735_BIFAD/49-245----------FYKDTDYKYD...............................GGSAVGKQV.TVNDRSG...........A
Q2RZL8_SALRD/80-256----------MHN................................................ANFTADY...........A
Q54K65_DICDI/28-191----------LDK..............................................Q.KIISKDN...........I
Q3IR56_NATPD/37-229----------MSGDVFEGD..................................VAEEDAV.DFRSADQ...........Q
A7BKU8_9GAMM/106-302----------IVA................................................RSITKEK...........Q
A6DTT1_9BACT/27-205----------GSA..............................................R.DIPTSDN...........I
Y1021_SYNY3/86-292----------VVRA...........................................GNL.AVRTQDY...........M
Q6WHG5_BPKV4/25-219----------MKF..............................................D.TFMPKDE...........L
Q114A2_TRIEI/361-607----------WSDQKKHPLN................................YDYELKQM.KLISRDH...........F
Q67KD6_SYMTH/26-206----------VVP.............................................QQ.DFYTVQG...........V
ERLN1_PONAB/24-211----------VKN..............................................V.PCGTSGG...........V
A3X541_9RHOB/26-218----------IARQ...........................................GRE.AVLTRDK...........M
Q6U9K4_9CAUD/33-217----------FTN..............................................V.QVPSQDK...........L
A9B5U5_HERA2/35-232----------MVQSDNEGQ..................................TAGDDSI.KIQSSEA...........Q
Q2SE90_HAHCH/5-203----------FIF................................................KESTSDF...........Q
Q9ZMI7_HELPJ/62-262----------FSRTEDMGVAGK............................NQGIFRNDAI.NVMDSRG...........L
A6DJY2_9BACT/306-539----------VGQVKSATSALGEPPMEEDEYKISNEEKVNVWGRKSHGAHEEGYEDFNYLASDAASEK...........S
A7N4W8_VIBHB/30-242----------VVRSGRKD...................................QEGEEYE.GLHCRDN...........I
Q22WG5_TETTS/26-207----------FSNERGA......................................SAGMI.MGRTQDG...........L
Q7UMK7_RHOBA/174-391----------IEVQKQVDAQGNPMH.....................DEHGEPLATLDTGI.NFPSNDG...........F
Q878M8_STRPQ/39-222----------IKK..............................................I.TTQTEDA...........Q
D1N1N6_9BACT/53-297----------VNFVAAEMPDGSG..........................SGQSLEPGRDS.YLLTGDA...........N
A4HYE6_LEIIN/5-177----------LKV................................................ESKTKDN...........V
A0XWY7_9GAMM/53-213----------ETF................................................RILANDD...........L
A5V005_ROSS1/55-242----------LSQ................................................NVASSDK...........Q
HFLC_BUCBP/21-239----------NRL..............................................D.SVLTKDN...........K
B9LBU8_CHLSY/36-219----------RSQ................................................PVNSEEG...........A
A6V538_PSEA7/332-551----------TSVATGNGEAEPLAP.....................AEGPAPDSANRLWD.ASHVSEKSQVIASLADHRQ
Q8PPV1_XANAC/20-207----------VAF..............................................D.DFSSSDN...........I
Q11VD7_CYTH3/21-198----------IEF................................................QAVTQDQ...........A
Q1IQW9_KORVE/72-276----------TGVAEDAKAA................................SGHGKGAL.TVQAKEG...........L
Q3M8Q8_ANAVT/9-189----------VPA................................................ESSTKDL...........Q
Q090V7_STIAD/69-267----------TERSLR.......................................ADGPA.PFQAAEG...........L
D1N1N4_9BACT/326-563----------IGELHDEKEEEAPEDDGHGHGPAPKAKKTALSPVVLWTAAHGGEDNNFIV.AVPPIGKESSGRNSEASIS
Q1PZW5_9BACT/32-225----------MAKENSGLG..................................HDERKHV.AIRTADD...........Y
A6DJY4_9BACT/65-290----------SSSFWPSGVGQALGASA..................QAGDSTADLMMGDDG.YVLTGDQ...........Y
Q1D2G7_MYXXD/109-312----------FTA................................................DQVTHEK...........V
Q54F95_DICDI/43-215----------LPK..............................................Q.TLVTLDG...........V
A4FVJ0_DANRE/138-311----------IPP..............................................H.MVVTKDL...........V
A1AN40_PELPD/42-249----------KWGT............................................PG.PVTMRDP...........E
Q233H7_TETTS/39-215----------FNA................................................NNVTKEM...........Q
A1ZL05_9BACT/23-202----------LKI................................................DLPSKEG...........L
A7UY12_BACUN/32-219----------YEP..............................................F.DIQDKKG...........T
Q043D7_LACGA/23-194----------ISK..............................................Y.RIITKDN...........A
A5TW95_FUSNP/28-213----------FGRTDE.......................................MDTTM.EVSTKDM...........Q
A7BTW2_9GAMM/55-247----------PKDIVPNDEI................................QTSQEGIV.NTASLDN...........Y
A1TM35_ACIAC/23-205----------STD.............................................TE.SMLTAEK...........Q
A8LGX8_FRASN/173-419----------WSRKRQEES.................................RFDSALDQ.IVVNVGG...........F
Q1MDA7_RHIL3/28-223----------VRRG...........................................EGD.ALITKDR...........M
Q48BK3_PSE14/61-251----------SGL..............................................Q.DVGTRDG...........L
A4YEZ5_METS5/41-236----------IQG................................................KSQTDDL...........V
Q9A5B4_CAUCR/49-247----------YTREADE.....................................RGNENE.EIAFSDNT.........GL
Q87TY4_PSESM/47-268----------VETLLRSPAALKADEI...................VTLSAPMSDALAGSG.FLLTGDA...........G
Q0RL11_FRAAA/10-261----------ITSVAGEGD..................................RGKVDVV.TTPSKDG...........V
A4YLJ4_BRASO/276-496----------ENLS............................................EI.SLITKDA...........F
A3JKR6_9ALTE/29-215----------VTN................................................RARSKEE...........A
A3RPR4_RALSL/36-235----------WTQDINEG...................................HSLNEEL.TFNTKDA...........V
Q7UMK6_RHOBA/205-421----------LSNG...........................................GEM.GFPSRDG...........F
A3EPC8_9BACT/42-222----------IRL................................................HVLSING...........L
Q67MY2_SYMTH/40-231----------NPA................................................ELLTADQ...........K
A5FZF5_ACICJ/44-216----------ISA..............................................E.NTLTLDG...........V
A0ZCT5_NODSP/20-192----------IKP..............................................Q.NVITRDN...........I
Q2JMY3_SYNJB/34-233----------FTNDPASA...................................NAISNAI.TVNTADG...........Q
Q1PZW6_9BACT/41-239----------MTAAEINEK..................................QPQGNPL.IIKTIDG...........G
Q0SNV9_BORAP/33-247----------FGFIISPNDIR..............................ENNNTSDES.MIITGDL...........N
Q7PAR4_RICSI/68-263----------YRTNSSLRSGG.............................DNTKNIAGES.IMLTGDE...........N
A8FZG0_SHESH/35-214----------EKM................................................ASSTKEQ...........M

PF11978

MVP_MOUSE/519-647----------WHF------------------------------------------------ELKNRND-----------P
Q38C44_TRYB2/534-652----------WEF------------------------------------------------DTTDVEH-----------I
Q4D3P0_TRYCC/529-647----------WEF------------------------------------------------DTTDMER-----------I
Q4QCJ5_LEIMA/614-738----------WEF------------------------------------------------GSVASNG-----------K
MVP_STRPU/521-639----------WHF------------------------------------------------DVPDKTD-----------V
MVP_DANRE/533-651----------WHF------------------------------------------------DLKQPAD-----------A
MVP_DISOM/519-637----------WHF------------------------------------------------EVKDRSD-----------P
MVP_CHICK/520-636----------WHF------------------------------------------------EV..PED-----------P
MVPA_DICDI/504-621----------WEF------------------------------------------------KV.DRSK-----------I
MVPB_DICDI/520-633----------WHF------------------------------------------------KV.EQDN-----------P
MVP_TRYCC/511-626----------WYF------------------------------------------------DV.NREE-----------P
MVP_LEIIN/511-626----------WYF------------------------------------------------DI.DRAN-----------P
A7RH80_NEMVE/598-715----------NYF------------------------------------------------DV.DPSD-----------P
A1ZGE7_9BACT/529-640----------VNF------------------------------------------------TG.....-----------.
A6FXE2_9DELT/535-646----------VNF------------------------------------------------EG.....-----------.
A4HP51_LEIBR/553-671----------WYF------------------------------------------------DVTPGDT-----------E
Q4DYQ9_TRYCC/535-653----------WYF------------------------------------------------DVTPGDE-----------L
Q38AX5_TRYB2/537-655----------WHF------------------------------------------------DVAHGDE-----------A
A0CI16_PARTE/525-641----------WHF------------------------------------------------KV.NKDD-----------P
A0EGV2_PARTE/516-633----------WRF------------------------------------------------KV.DENN-----------I

PF13421

A1B688_PARDP/26-236PVRI---RAFG-TYSMRV-------------------------.TDPGRFMTEI-------VGTDGEFTRDE-------I
A3V3G3_9RHOB/26-236PTRL---RAFG-TYTVRV-------------------------.ADPALFLREI-------VGTDGEFTMDE-------I
A4CIK3_ROBBH/30-240LTEI---RAFG-TYSFRI-------------------------.EDPGKFVVDV-------VGTDGNFTNYE-------V
A4WUR1_RHOS5/26-236PVRL---RAFG-TYSMRV-------------------------.TDPGRFMTEI-------VGTDGEFTADE-------I
A5G3T6_GEOUR/26-236PVRL---RSFG-TYVVRV-------------------------.SEPAKFIKEI-------VGTGGHFTLND-------V
A6C8B2_9PLAN/27-238PIRL---RAFG-NYSLKA-------------------------.NDPRILVKEL-------VGTNAEFHSEE-------I
A6DY99_9RHOB/26-236PTRI---RAFG-TYTVRV-------------------------.ADAAKFLSEI-------VGTDGEFTMDE-------I
B3E867_GEOLS/26-236AVRV---TAFG-IYSIKI-------------------------.KDPAVFIREI-------AGTDGEFNTDE-------I
B6B0M0_9RHOB/26-236PVRL---RAFG-TYSVKV-------------------------.SDPARFLTEI-------VGTDGEFTMDE-------I
B8FFG4_DESAA/26-236AVRV---TAYG-IFSMRI-------------------------.KDPATFIREI-------VGTDGNFSTSE-------I
B9M753_GEOSF/26-236PVRL---RAYG-TYVVRA-------------------------.SDPAKFIREI-------VGTSGHFTLND-------V
D5UR64_TSUPD/26-236MVQV---RANG-LCVVRV-------------------------.IDSPTFLRQV-------IGTDSNVDSDE-------I
C2G525_9SPHI/26-236PVRL---RAFG-NYAFSV-------------------------.KDPGLFIKTI-------SATNPTFTVDD-------I
C5JBH5_9BACT/26-236PVRL---RGFG-SYTIRV-------------------------.VDPRKLLTEI-------VGTDGHFTVDE-------I
C7D9P0_9RHOB/26-236PTRL---RAYG-TYTVKV-------------------------.TDPAKFLTEI-------VGTDGEFTMDE-------I
C9KTK6_9BACE/35-258...I---TAFG-SYRFKL-------------------------.YNPEVYCDKL-------VGTTELSSTGN-------V
C9L2Z9_9BACE/38-254PIPV---RAFG-EYGIRV-------------------------.VDASMLLGEL-------VGTLHTFDTES-------I
D1N0K4_9BACT/26-236IVRL---RARG-NYAYKV-------------------------.SLRDELLTRF-------VGAQADFTGDA-------I
E8RWI6_MICSL/26-236VVRV---RAFG-AFAARV-------------------------.VDASRLLREL-------VGTDPQFRTEE-------V
D3IJU6_9BACT/26-237PIRM---RAFG-SYCFRV-------------------------NADPRKFITNV-------AGTNGNFTTEG-------I
Q0FM78_9RHOB/26-236PVRL---RAFG-TYSVRV-------------------------.TDPARFLSEI-------VGTDGEFTSDE-------I
Q26GM4_FLABB/30-240LVEI---RAFG-TYAFKI-------------------------.ADPGKFIVDI-------VGTDNNFTNFE-------I
Q47L21_THEFY/21-231MVRL---RAFG-GFALRV-------------------------.VDPPLLLQEL-------VGTDPQFRTEE-------V
Q7UUL6_RHOBA/56-267PIRI---RAFG-TYALRA-------------------------.VDPKALLLEI-------VGTNGEFGADD-------V

PF01145

A5DBX9_PICGU/79-250SVIV...TSVV.YY..NI..........................IDPQKAIFSI................SN.......I
Q54X13_DICDI/30-222SVDL...DAVL.SY..KI..........................TNPKQMIYSC................VN.......L
Q8NL82_CORGL/38-205AVTI...TMALTAA..TI...........................DPVKFVADS................QN.......P
Q9RQU5_CLODI/24-196TMQI...DTVV.YY..KV..........................TDPVRYVFEI................AN.......P
Q3YQY0_EHRCJ/26-202RFIV...DSYA.KY..RI..........................VDPVKFYQTV.............RTEIG.......L
Q01QT0_SOLUE/4-251NTGL...TGQI.RY..RVSEANLY..............AFVFGIKKPFVHVLAYFVSVLRQRIASFEAKEEP.......L
A6DJY3_9BACT/29-214SLMV...SMYC.IW..KI..........................ADAEVFLRTV............NTNAEA.......Q
Q7BTU1_YERPE/7-194AIGH...KIGV.AY..LV.........................NRNKVTTVFQTYRK......GVDD....I.......T
FLOT1_ARATH/3-185PFVL...PAVF.TIGPRVD........................DDDALILYARLIS........PHDKDSNH.......V
Q87KY0_VIBPA/44-297IGQI...PVTF.RF..KL..........................SNDPEALKKM............HREFRN.......N
Q7WQ89_BORBR/28-208PATL...RVSV.TY..RVP........................AEHVAELYAEY............GTISNL.......Q
A6EM35_9BACT/36-219RVNV...PSRF.TI..GV..........................STEPGVMQNAAER.......LLGLGQQE.......I
A1RSJ3_PYRIL/47-245TVTV...EMVV.RY..RIR........................PERFDELVKKF.............PQVDY.......D
A7JFZ5_FRANO/22-195FVHM...KVSV.QF..LVE........................ESKAVDAFYKL................TN.......A
Q28CP1_XENTR/61-241LVSM...GADI.QF..CI..........................CDPVLSVLSV................QD.......L
A9AV86_HERA2/27-198SVKL...NLLA.NF..QI..........................DQPDRWTHSH................IS.......A
A9AH04_BURM1/23-201DLLV...SYAA.KY..RI..........................SDPMKYFTAT............GGDPAA.......A
Q8D667_VIBVU/25-231YISV...DLFA.RW..RI..........................IDPLQYFLRL.............KDERS.......A
Q9XAJ5_STRCO/27-227KANL...EGVA.IV..KVGG......................TEDAIRAAAQRF............LMQQDG.......I
A5UQB3_ROSS1/147-329NASV...DLFL.QF..KI..........................EDPAAFIFTL.............GGAKG.......F
Q8PBR9_XANCP/66-240IVNV...SLNV.QY..QI..........................SDPRKYLFGS................RN.......A
A6DTT2_9BACT/42-238DLNLLHCESTL.RY..TI..........................ADLPKYLFDS................QD.......F
A1VS28_POLNA/25-221VKDF...DMTV.VY..NVN........................PTAVSELWTTKNRT......FHGISEKGG.......D
A6V731_PSEA7/10-287GATI...EAFPIVFLGNV...........................DAKVESSARFRLPGGEPFLKMAQEYRN.......P
D1N1N5_9BACT/30-214NILV...GIYV.NY..RI..........................SNAEQFFVRL.............ENITK.......A
A7GXM3_CAMC5/29-235PFVV...DITA.FF..RI..........................SDSNLAAQRV.............NNFDD.......L
A6GGG7_9DELT/52-236EVSA...NGVA.HL..RL..........................GDPLIFNRELLQG.......AARLSEVD.......L
Q1HR13_AEDAE/28-207NVNI...TLRI.LF..RPI........................PDQLPKIYTIL..............GQDY.......D
A1RAB0_ARTAT/20-208DVSV...QANV.TY..RF..........................IDPVAVSMRLDFGLQT.AGKAPATGREQ.......V
Q47MY9_THEFY/102-281PLKS..IEFFL.KF..RI..........................TNATAFVRTI..............GASN.......F
Q8F4L3_LEPIN/16-199ALRL...SFSY.NY..KI..........................VDSIRFSENFSMS......DHPTFVLGG.......L
Q72UG5_LEPIC/48-230KIDV...QAIV.IM..RPI........................RDEVYQLHIEV..............GPEY.......Y
Q65J46_BACLD/36-220NISM...DIAY.NY..VVQ........................PDKVVELFNKF..............GAVD.......I
Q76Z22_9CAUD/26-209NSTA...NVTV.LY..RV..........................DNSKTPFIKKNYG......TMEMFVDKA.......M
A1KN88_MYCBP/55-245TALA...DVSI.RW..QLK........................QAAAPELFQQY............KTFDNV.......R
A4NZC0_HAEIF/24-210TVTT...ALTI.TF..KL..........................TDPVAVYKNY................RN.......T
A6DTT0_9BACT/309-521ITVF...NAQI.NY..QV.........................KSDEIALWAAH................EN.......P
A1RZ05_THEPD/30-234PLMF...RGSY.WF..RV..........................GDPKLFVTEVVGG.......QGKYTSAE.......V
Q82CW6_STRAW/178-350PLRV...VVLV.TW..RV..........................KDTARALLGI..............D..D.......H
A6G7G5_9DELT/54-276DLEV...VVSV.RY..RPH........................RNQLGLLHQDI..............GPNY.......F
A3ZSS7_9PLAN/140-314TLRL...NLVA.TY..RV..........................VDPLKAAAAT................ID.......V
A9B3W6_HERA2/115-349VVDT...QSRI.IQ..RFPDDGSSMPVEMRYEGFLKLPYNYPNRDHIFKEIADRRNMDVMQVRMSADFWIEA.......I
Q8ETQ3_OCEIH/33-230PIEA...EAVA.ML..KV..........................ADSLEGIARYAEQ.......FLGKDQDE.......I
Q2JUY0_SYNJA/34-221QIAA...EATL.QF..RI..........................VDAPKVYTQL...............GEN.......Y
A5CSU8_CLAM3/32-222NTAV...VATV.NF..KVTG......................TEDGVRRAVQRY............LLQQDA.......L
A3CLK3_STRSV/29-214NVRA...DAAV.KL..KI..........................GTTDEMIARAAEN.......FLNWNTTD.......I
A7VQ64_9CLOT/74-274PVII...GTIV.IW..RV..........................VNTAKAVFNV................NN.......Y
Q8V6S4_9VIRU/31-228EATF...DVTV.RY..QL.........................PNDPEAVTDFY.............TDYRT.......L
Q3AHV3_SYNSC/32-214VIEA...TATV.KY..AVK........................PGEAPRIYSTIA...........TDDSAI.......Y
Q119N4_TRIEI/61-249PLNI...QAIA.NI..KV..........................SSDPKIVGNAIER.......FLERDRSE.......I
Q1BPT6_BURCA/42-247FGFVQLRAFGIYSY..RI..........................VDAAAFHREVSGT.......RAAYTVDD.......L
Q8YY85_NOSS1/318-534AFDL...EVSQ.II..HVG........................ALDAPKVISRV................GS.......M
A7B9F0_9ACTO/13-202NINA...QVAI.TY..HI..........................EDAEAAAAHYDFGLYPREAGADAQGLWQ.......I
A7A735_BIFAD/49-245SADI...DVQV.NY..SLD........................PSAAEYLYSEY................GK.......Q
Q2RZL8_SALRD/80-256SIGI...SSQI.VF..QV..........................VDAKKFIANTTPA.......GIMKSLNL.......Y
Q54K65_DICDI/28-191NLTV...DALV.VF..RI..........................HDPKLAVTKA................ND.......C
Q3IR56_NATPD/37-229RVGA...DITV.RY..RVN........................EDGADEFHREW............NTIDQY.......E
A7BKU8_9GAMM/106-302GLNV...LAYL.QW..QI..........................SDFSIAYKKL..............DFSDSRDPLGIV
A6DTT1_9BACT/27-205LLSS...QISA.SW..RI..........................TDPLKFRNSL.............GTLTD.......A
Y1021_SYNY3/86-292RANM...RVTF.YV..CITP......................NRNEILTAAARLSK........KGQISEAD.......I
Q6WHG5_BPKV4/25-219MLKY...DVEM.TM..AVD........................PAKYNFVFAKV............PFKSQTDQLGVISQ
Q114A2_TRIEI/361-607EIFV...QFTQ.II..RIA........................AENAPKMICMVGYYTGE.DKIYVTDDSGQVVKKYAVI
Q67KD6_SYMTH/26-206AVTV...EAVA.QI..KV.........................KSDTESILTAAEQ........FLSKTTKE.......Q
ERLN1_PONAB/24-211MIYI...DRIE.VV..NM..........................LAPYAVFDIVR...........NYTADY.......D
A3X541_9RHOB/26-218RADV...IFGF.EL..RVSP......................APEGIAVAAQALGH........RIARGGDS.......V
Q6U9K4_9CAUD/33-217KTSV...DITL.ML..RFD........................GDKAQAVRING............GTERQA.......I
A9B5U5_HERA2/35-232QLNL...DVAV.QY..RVK........................KEEAAVLYTDW..............GGQS.......L
Q2SE90_HAHCH/5-203EVTV...QGQL.VY..RV..........................KSPKILAATMNFTLADDGKSYVSDAPKK.......L
Q9ZMI7_HELPJ/62-262TVSI...ELTV.QY..RLN........................PQTTPQTIATY..............GLSW.......E
A6DJY2_9BACT/306-539NMNMLTIKVPV.HY..KV..........................KDIYEYLYNY................KE.......P
A7N4W8_VIBHB/30-242RADL...KVDF.YI..GVNH......................EEEDIVRVAKLFTA........HDASNLER.......L
Q22WG5_TETTS/26-207QVNL...EISF.QY..KLL........................VKDLYNLYTRF...............GLK.......Y
Q7UMK7_RHOBA/174-391DIQL...DFSA.IW..GVM........................PENAAQIVRVF............G....N.......L
Q878M8_STRPQ/39-222WLDT...TLDV.KY..RVS........................EKNAMNVFKDY................QS.......M
D1N1N6_9BACT/53-297IIHT...MWTI.NY..QV..........................TNPAKYYETLTMPAKPVDNDRVMPDVVETDANGFTG
A4HYE6_LEIIN/5-177FVTL...SLVI.QY..QVA........................PDKLAEVYYAC................DS.......S
A0XWY7_9GAMM/53-213NIKF...DFHA.VI..AIQ........................SGSVQTVVEQY.............GAENW.......Y
A5V005_ROSS1/55-242LYDI...DIQV.DY..SR.........................KTDPALLRQMYAR.........IGTSDDL.......L
HFLC_BUCBP/21-239NLVL...NTYI.NW..KI..........................NDFCRYYLSTG...........EDNIYY.......A
B9LBU8_CHLSY/36-219PMGI...GVWY.EM..SI..........................SDPVAYLFKN................AD.......P
A6V538_PSEA7/332-551SFQIVNMDVRI.VY..RIG........................LDDAAALAATY..............RSGD.......L
Q8PPV1_XANAC/20-207LLDF...STQI.QY..RI..........................TAPALLLSRF.............GQD.W.......F
Q11VD7_CYTH3/21-198NVYF...KAMM.LY..AV.........................INQSESTIKNVAF.........KFVDESS.......F
Q1IQW9_KORVE/72-276SLGL...AITV.RY..RL...........................DPKRLDYIQS...........HLPQPV.......E
Q3M8Q8_ANAVT/9-189NLSA...RFAI.NF..RL...........................DPIQVVDVRRKQ.......GTLEN..I.......V
Q090V7_STIAD/69-267SIGI...EVTL.RY..ALD........................PVRIPDLAQRL..............PGDV.......G
D1N1N4_9BACT/326-563FIRM...VIPI.DY..QI..........................RRDGVMNYGY..............KNLD.......P
Q1PZW5_9BACT/32-225DVEV...DLVI.KY..QIK........................RGSAWKLRQDL.............GVGER.......Y
A6DJY4_9BACT/65-290LYHV...KGHL.TY..RV..........................VNPVRYYKSFYS.........TKLDEEE.......G
Q1D2G7_MYXXD/109-312GVQV...TGLA.VY..RI..........................SDPLVAFRMLNFS.......FPERAQEK.......L
Q54F95_DICDI/43-215VLSI...DSII.QY..KV..........................VDPLKLVQDL................KD.......H
A4FVJ0_DANRE/138-311CTEV...TAVC.YY..RI..........................ENVSVCYSSF................AS.......I
A1AN40_PELPD/42-249LGAVRVTAYGLYAI..KL..........................KDPALFIREIVGT.......SGVFSTAS.......I
Q233H7_TETTS/39-215GLEV...SGFA.IW..SVNR......................ESDGPFKCYKYT..............QGSN.......A
A1ZL05_9BACT/23-202TISS...DISI.LY..RIK........................KEDAAEILKNV..............GYGY.......E
A7UY12_BACUN/32-219IFKT...DPTI.EY..FIE........................REDAKVVFLRYR...........KTTEEL.......E
Q043D7_LACGA/23-194EITT...SLTL.NY..LV..........................TDSYKYFYNN................TD.......S
A5TW95_FUSNP/28-213SIKL...EFTV.QA..SI..........................TDPEKLYRAF..............NNKH.......E
A7BTW2_9GAMM/55-247ALNA...NIAL.LY..RLP........................EEQVEYIHRNM................PD.......F
A1TM35_ACIAC/23-205RVVI...DWYV.RW..RI..........................SDPSEYIRNV............GLDENA.......G
A8LGX8_FRASN/173-419PIRF...DMQQ.TI..QIP........................ARAAPRLVSQFGEQ......EKHPVEPDDDVTRPAPV
Q1MDA7_RHIL3/28-223RVDI...GAEF.YV..RVK........................PDASSIALAAQTLG.......NRTNDAEA.......L
Q48BK3_PSE14/61-251RIIV...QAYV.AW..QVQG......................DADNVQRFMRAV............QNQPDE.......A
A4YEZ5_METS5/41-236PLDY...EVAV.YY..RV..........................TDAAKLTVNVQFA.......GAFFKDGD.......L
Q9A5B4_CAUCR/49-247PMTA...DISV.TL..QVN........................PASAPNLYQTY...............RLS.......F
Q87TY4_PSESM/47-268VVQL...DVTV.FY..KV..........................TDPNAFVLQG................DH.......V
Q0RL11_FRAAA/10-261SMGI...EGTF.YF..TLNLDHDV.............LRRFDDKFGTRKFPLASKGGKLYYAWSGDDGWSAF.......L
A4YLJ4_BRASO/276-496EPTL...PLSV.VM..HID........................YKKAPMIIQRF................GD.......V
A3JKR6_9ALTE/29-215FFDL...EVKA.VM..QIR........................SSSVMEATFNL................EN.......P
A3RPR4_RALSL/36-235PVNV...DVAV.SY..QLD........................RNKVPEFYTNF..............RADR.......I
Q7UMK6_RHOBA/205-421WVRL...DGRI.EF..RVD........................PERAAEVFVTY............NDSGNDDGYDARVE
A3EPC8_9BACT/42-222PIGM...DSSV.IY..RVN........................PGTLPTLQETV..............GPDY.......Y
Q67MY2_SYMTH/40-231PIIV...DHYT.VW..QI..........................TDPRLFVQNT.............QTVAR.......A
A5FZF5_ACICJ/44-216SVAV...DSVL.FW..KV..........................EDVRRVATEL................TD.......Y
A0ZCT5_NODSP/20-192YLEV...DAVL.FW..RI..........................RDMVKSFYEI................DD.......L
Q2JMY3_SYNJB/34-233AFAI...DVAI.AL..KPN........................LATLDELHASI..............GENY.......L
Q1PZW6_9BACT/41-239EVVL...DLQI.QY..ILN........................PEYASHIIQNT................GI.......G
Q0SNV9_BORAP/33-247IINI...EWLV.QY..KI..........................RDPYSFKFKV................ED.......P
Q7PAR4_RICSI/68-263IIAL...NCDV.MW..HI..........................NNLEDFIFNV................QR.......P
A8FZG0_SHESH/35-214PVTV...EVSV.NW..TVN........................KEAALDLFKRY............GGLTQF.......E

PF11978

MVP_MOUSE/519-647E...---ETAK-LF--SV--------------------------PDFVGDACKA-------------------------I
Q38C44_TRYB2/534-652K...---..RI-AF--SV--------------------------PDFVGMACKT-------------------------L
Q4D3P0_TRYCC/529-647K...---..KI-AF--EL--------------------------PDFVGKACNT-------------------------L
Q4QCJ5_LEIMA/614-738AGRV---DPEL-AF--TI--------------------------PDFIGEACKA-------------------------L
MVP_STRPU/521-639A...---ASAK-LF--SV--------------------------PDFIGDACKA-------------------------I
MVP_DANRE/533-651A...---QAAA-LF--SV--------------------------PDFVGDACKA-------------------------I
MVP_DISOM/519-637M...---ESAK-VF--SV--------------------------LDFVGDACKA-------------------------I
MVP_CHICK/520-636K...---ALGR-LF--SV--------------------------PDFVGDACKA-------------------------L
MVPA_DICDI/504-621E...---DAQK-IF--QV--------------------------PDFVGDSCKA-------------------------I
MVPB_DICDI/520-633....---..SK-LF--AT--------------------------SDFTGDLCKA-------------------------T
MVP_TRYCC/511-626D...---..AK-IF--SV--------------------------PDFIGDCCKT-------------------------I
MVP_LEIIN/511-626S...---..RR-TF--SV--------------------------PDFIGDCCKT-------------------------I
A7RH80_NEMVE/598-715E...---AVKD-MF--SV--------------------------PDFIGFVCKN-------------------------I
A1ZGE7_9BACT/529-640....---DSEK-WF--NV--------------------------QNYVKFLTDH-------------------------M
A6FXE2_9DELT/535-646....---DPQA-WF--NV--------------------------ENYVKFLTEH-------------------------L
A4HP51_LEIBR/553-671V...---.AKE-CF--SV--------------------------NDFVGDACSY-------------------------I
Q4DYQ9_TRYCC/535-653A...---.AGK-CF--SV--------------------------GDFVADTCSF-------------------------I
Q38AX5_TRYB2/537-655A...---.ARK-CF--GV--------------------------DDFIADACSL-------------------------I
A0CI16_PARTE/525-641N...---DAQK-LF--GV--------------------------KDFVGDACKS-------------------------I
A0EGV2_PARTE/516-633E...---SASK-IF--AV--------------------------KDFIGDLCNQ-------------------------M

PF13421

A1B688_PARDP/26-236SFQLRNIIVQE....FSRMIAG--SGIPV---LDMA---------AN---------------------T-GDL-------
A3V3G3_9RHOB/26-236SYQIRNVIVQE....FSRALAA--SGIPA---LDMA---------AN---------------------T-ADL-------
A4CIK3_ROBBH/30-240NEHLKSLIVTR....FTDTVGE--ANLPL---ELYA---------AN---------------------T-SEL-------
A4WUR1_RHOS5/26-236SFQIRNVIVQE....MGRALAA--STIPV---LDMA---------AN---------------------T-ADL-------
A5G3T6_GEOUR/26-236SEQLKNLIVTR....FSDMLGE--SKIPV---LDLA---------AN---------------------Y-NEL-------
A6C8B2_9PLAN/27-238NELLRSIINSS....FADLIGE--SKYAA---LDLA---------SK---------------------Y-TEI-------
A6DY99_9RHOB/26-236SFQIRNIIVQA....FSRIIAG--SGIPV---LDMA---------AN---------------------T-ADL-------
B3E867_GEOLS/26-236QDNLKGKIGMR....IKEVMPE--LQIPV---IDLE---------SK---------------------V-FTM-------
B6B0M0_9RHOB/26-236SFQIRNIIVQE....FSRTIAR--AGIPV---LDMA---------AN---------------------T-REL-------
B8FFG4_DESAA/26-236SSNLRGKIGMR....IKEVMPE--TGIPI---LDLE---------GK---------------------V-MML-------
B9M753_GEOSF/26-236SDQLRNLIVTR....FSDMLGE--HRIPV---LDLA---------AR---------------------Y-NEL-------
D5UR64_TSUPD/26-236AELLRRTIATA....FSDMLME--TGVGA---IELQ---------GR---------------------Q-REL-------
C2G525_9SPHI/26-236NEQLRNIAVTR....GMDAVAE--SRIPV---LDLA---------SN---------------------Y-DEV-------
C5JBH5_9BACT/26-236SGQLRDLFVSR....FANLLAE--SRIPL---LDLS---------TR---------------------Y-DAL-------
C7D9P0_9RHOB/26-236SYQLRNIIVQE....FSRVIAQ--SGIPV---LDMA---------AN---------------------T-ADL-------
C9KTK6_9BACE/35-258NDFFADQIKVLMIEVVQDLIKQ--NTFTI---TQLM---------GA---------------------S-RNL-------
C9L2Z9_9BACE/38-254IEQFKSVVLQQLNASFGQFVKQ--ERISV---VDLP---------AY---------------------S-PQM-------
D1N0K4_9BACT/26-236EGQMKTKVVSA....CSDALGE--LKIPA---LDLA---------AN---------------------Y-TEI-------
E8RWI6_MICSL/26-236QEYLRQLMVGR....LGGALAT--AGVPL---LDLA---------AH---------------------Q-DAI-------
D3IJU6_9BACT/26-237TQQLRNFVITK....FTDHLGE--SKIAA---LDLA---------GN---------------------L-NEF-------
Q0FM78_9RHOB/26-236SFQIRNIIVQE....FSRLIAG--SGIPV---LDMA---------AN---------------------T-QEL-------
Q26GM4_FLABB/30-240NEHLKSLIATR....FTDTVGE--ANLPI---ELYA---------AN---------------------T-TEL-------
Q47L21_THEFY/21-231AEHLRQRIVSH....LAPALAN--SGMSV---LDMA---------AN---------------------Q-QAL-------
Q7UUL6_RHOBA/56-267NVLLRSIIQSS....FADLIGS--SQIAA---LDLA---------SN---------------------Y-EQL-------

PF01145

A5DBX9_PICGU/79-250NEAIVERTQTT----LRDVI....GCRVL...QDVV.........EK.....................R.EEI-------
Q54X13_DICDI/30-222PNILSKLLQAQ----LRNLA....GTLEI...DQII.........EE.......................SHL-------
Q8NL82_CORGL/38-205DEEIYLAAQIA----LREMV....IAMPL...EDFI.........GV.......................RID-------
Q9RQU5_CLODI/24-196IAAIENLTATT----LRNII....GELDL...DETL.........TS.....................Q.RYN-------
Q3YQY0_EHRCJ/26-202KNRLSSIIESN----IREKI....GNVSL...INFL.........NE....................AR.SEV-------
Q01QT0_SOLUE/4-251APPITQATGAA----AAAVLP..GSEMTGISINDLR.........KN.....................L.RDL-------
A6DJY3_9BACT/29-214SNILPNIIGSA----SGSIF....SRYEM...NDVV.........TTDA................KAHKLAEI-------
Q7BTU1_YERPE/7-194DTDLRQKIADS----LNRLA....SRMTT...DTFI.........DG.....................GKASL-------
FLOT1_ARATH/3-185HELVEGVIEGE----TRVLA....ASMTM...EEIF.........KG.....................T.KEF-------
Q87KY0_VIBPA/44-297NNLIDALLVKN----ARNVTVITATQYIG...EEFF.........QG.....................GLNQF-------
Q7WQ89_BORBR/28-208MRVLERKTPDA----VKNVF....GRYTA...VRAI.........QE.....................R.QKL-------
A6EM35_9BACT/36-219QDLAMEIIFGQ----LRLVV....ASMDI...EEIN.........ND.....................R.DKF-------
A1RSJ3_PYRIL/47-245DKVLVPKARQL----IRDVI....SKVSL...DYLI.........EN.....................R.DVI-------
A7JFZ5_FRANO/22-195RAQMESYVFDV----IRSSL....PRMSL...DESF.........EN.....................K.DAI-------
Q28CP1_XENTR/61-241NFVTRNTAQNL----MTQSL....GRKYL...REIQ.........ND.....................R.ARI-------
A9AV86_HERA2/27-198QTVVYNELQVA----LREVI....AGYTL...DQLL.........AD.....................R.SMI-------
A9AH04_BURM1/23-201GERLAGALKGA----LGDAF....GKHAL...DDAL.........GA.....................Q.RAI-------
Q8D667_VIBVU/25-231QSRLDDILGSE----TRNAV....AKHEL...IEII.........RTNKN..............RKPLR.DPL-------
Q9XAJ5_STRCO/27-227VGFTQEVLSGA----LRAIV....GRMSV...EDVI.........RD.....................R.AAF-------
A5UQB3_ROSS1/147-329QEKLQNAVSEV----TRALI....YEQRAEAIYDLV..................................GES-------
Q8PBR9_XANCP/66-240DLVLEQAAQSA----VREQV....GRSDL...NTVL.........NN.....................R.GPL-------
A6DTT2_9BACT/42-238EKLLLQLVDSS----LLQSV....AERNI...DKAR.........NQ.......................KEI-------
A1VS28_POLNA/25-221ILLMQNYVALS----ARNAAYKVAREYES...LKMA.........DNRP.................LIE.QKI-------
A6V731_PSEA7/10-287DNFIRTALVPA----IKETLQATASLMSA...DDYY.........AG.....................ARSEF-------
D1N1N5_9BACT/30-214EDQLNSWMRGY----KNAAF....GQFRF...NQVV.........NTDPK...............LMKL.NEI-------
A7GXM3_CAMC5/29-235NNQLTNIIQGS----IRSIL....SSRVL...EDIL.........QI.....................R.SEL-------
A6GGG7_9DELT/52-236QRLLMPRFQAV----LRSVI....ATCPT...AELH.........AQ....................R..ELF-------
Q1HR13_AEDAE/28-207ERVLPSITTEV----LKAVV....AQFDA...GELI.........TQ.....................R.EMV-------
A1RAB0_ARTAT/20-208STIIGQLCQSH----AIDQI....ATTTL...AEAL.........ER....................GV.SQL-------
Q47MY9_THEFY/102-281DLVLSSAVQDA----IRQRS....RLVQT...ENAH.........DL.....................R.GSD-------
Q8F4L3_LEPIN/16-199VQQLTNLLKVE----IRERI....SNFTI...FELN.........EK.....................R.EKL-------
Q72UG5_LEPIC/48-230RSIVQPEFRAS----IRNVV....SHHQM...IQIS.........KN.....................S.AVL-------
Q65J46_BACLD/36-220ESIENSYLKTR----LWDAARKSISKYSV...IDTY.........GQ....................KS.SDA-------
Q76Z22_9CAUD/26-209SQFLTSIIKDE----GRKIA....DSRGL...ADSF.........NV.......................TAM-------
A1KN88_MYCBP/55-245VNLIERNLSVA----LNEVF....AGFNPLDPRNLD.........VS....................PL.PSL-------
A4NZC0_HAEIF/24-210DNMINQLLEPR----SRQALEIVFSRYSA...QLAL.........EN.....................R.AQL-------
A6DTT0_9BACT/309-521EQQLVALARNT----LTFEL....MRSNFTNLYQIP................................R.SEL-------
A1RZ05_THEPD/30-234NEFIRGFINEK----VIKHL....SGYSL...AEAF.........SS.....................L.EQV-------
Q82CW6_STRAW/178-350QTYLRECVESA----LARVLPQVPAEAPVV.KDTVS.........LR....................NV.DAV-------
A6G7G5_9DELT/54-276ERLIKPEVEAH----VRRTF....GNRPA...HEIY.........SSSKDVLQELRNIPMITRIDEDDADDAG-------
A3ZSS7_9PLAN/140-314QQALYRDAQLA----ARAVI....GAREL...DAFL.........TD.....................K.ENV-------
A9B3W6_HERA2/115-349QSQLRRDVEED----LRAII....HDNTFYNPEKRSYGKLAPADISA....................RR.AEI-------
Q8ETQ3_OCEIH/33-230DEEITEVLAAN----LRAIL....AKLTV...EDIN.........ND.....................R.ESF-------
Q2JUY0_SYNJA/34-221LDRIAPIVRSV----ILNET....SGFSA...QALY.........ST....................ER.PLL-------
A5CSU8_CLAM3/32-222PEIVRQSLEGA----IRGLI....GDRPV...DELV.........KS.....................F.SVV-------
A3CLK3_STRSV/29-214SNSVQDVLEGN----LREVI....GQMEL...RKMV.........ND.....................R.QEF-------
A7VQ64_9CLOT/74-274KVFLSTQCDSA----TRNVARLYPYDSEDSTGEKSL.........RG.....................SSQEV-------
Q8V6S4_9VIRU/31-228ENAEKRMIRTT----LAKQMLVTTGSMKT...SEVY.........TSA...................GQ.TEI-------
Q3AHV3_SYNSC/32-214ARVIQPSLLKS----LKSVF....SKYEL...DTIA.........TD.....................W.NNI-------
Q119N4_TRIEI/61-249TRVARETLEGN----LRGVV....ATLTP...EQLN.........ED.....................R.LQF-------
Q1BPT6_BURCA/42-247EQQLRNLVVTA----MSTTFG..SADVPF...VDMA.........AN.....................Q.SLL-------
Q8YY85_NOSS1/318-534QNLVDNVLEPS----IGNYFRNSAQDYTV...LDFL.........NA.....................R.SER-------
A7B9F0_9ACTO/13-202DETVTRIAFSA----LASAI....GEMTL...TDAI.........SG.....................SLERV-------
A7A735_BIFAD/49-245QTFTQNYISND----LRSVAREQSGRFDT...LTML.........TN.....................R.GEY-------
Q2RZL8_SALRD/80-256ASYIALRIITS----VEDARVKFSGRDSL...DNIV..................................AAL-------
Q54K65_DICDI/28-191ILLVNEMAQIK----VCEIL....SHNTL...DQVL.........HN.....................R.DKI-------
Q3IR56_NATPD/37-229QRLLRPETVDT----VAREA....SALNA...TEAN.........SDE...................GR.ELL-------
A7BKU8_9GAMM/106-302NAQLGEQADAA----IKDKI....ATMSV...EEVL.........TD.....................K.API-------
A6DTT1_9BACT/27-205QSNLKSIIETS----QETIL....RSKSR...DQLF.........STE...................GM.TTT-------
Y1021_SYNY3/86-292KDALEKRADDA----IRAAA....KKKKL...AELD.........SD.....................K.LGF-------
Q6WHG5_BPKV4/25-219QDVFVRYARAK----LNTIIPSIIAEYSI...SEVA.........SN.....................R.EKL-------
Q114A2_TRIEI/361-607RNLVSRVLTKV----VYSHFQQAATGKTA...IQFL.........NT.....................R.GDS-------
Q67KD6_SYMTH/26-206NEILKLVMEGH----LRGII....GQLTV...EQIV.........KE.....................P.EMV-------
ERLN1_PONAB/24-211KTLIFNKIHHE----LNQFC....SAHTL...QEVY.........IE....................LF.DQI-------
A3X541_9RHOB/26-218HEVLSGALVNA----IQNAA....AYRSL...EEIH.........LD.....................R.GGF-------
Q6U9K4_9CAUD/33-217DKYVAKKFEST----VRE......SGKNIKKAQDLF.........GDA..................TTQ.SML-------
A9B5U5_HERA2/35-232DVIELQVVRQQ----TRSILTTLAGRYSW...EDIS.........GE....................KR.AEL-------
Q2SE90_HAHCH/5-203PARILNLLQSI----TRNSI....QNLSL...KASL.........LA.....................S.ETL-------
Q9ZMI7_HELPJ/62-262QKIINPVVRDV----VRSVV....GRYPA...EDLP.........IK.....................R.NEI-------
A6DJY2_9BACT/306-539QLVLQSLAEQE----LVSYI....GQADY...SAFM.........GN.....................DRTQA-------
A7N4W8_VIBHB/30-242KEHFQPKFSEA----LKTAV....KQFEF...EELL.........TN.....................R.RAF-------
Q22WG5_TETTS/26-207EQVFVYQSIDI----LQEMA....TKYTA...SDFF.........TD.....................R.FNI-------
Q7UMK7_RHOBA/174-391DAVEQKVIEPQ----SESICRNNGSKMGA...IELLI.......GET.....................R.EQF-------
Q878M8_STRPQ/39-222ENVNKSLIKAA----VQRAVEQVTVNYDI...YEAL.........GS....................KR.NEL-------
D1N1N6_9BACT/53-297TRGPQTLVRNL----FRQAVIQVTAGRKV...DDIL.........YD.....................KQTEY-------
A4HYE6_LEIIN/5-177LECMRDYVLNS----IRAKI....PLYKL...EALY.........VE.....................R.GTI-------
A0XWY7_9GAMM/53-213KRFVRETFRTY----VRDTV....QKYDS...GELK.........TN.....................R.EKI-------
A5V005_ROSS1/55-242RTQLDGFIADA----LKSAS....TQFSL...DQAL.........SD.....................R.GGF-------
HFLC_BUCBP/21-239ETLIKQKFNNR----LRAQI....SHLNI...KEII.........FN....................VK.DQL-------
B9LBU8_CHLSY/36-219QGSLAANVSNA----VVRTL....SNMPL...AQML.........EN.....................R.HAM-------
A6V538_PSEA7/332-551PALVRSTASRV----LVHAF....ASRTL...DEVL.........GE....................QR.AGL-------
Q8PPV1_XANAC/20-207KNNVASQYASI----VRDQV....KRYDM...TKMM.........SDP...................DTARKI-------
Q11VD7_CYTH3/21-198MQALIRTIEGT----IRSFV....ATKKQ...AEIL.........SL.....................R.TEI-------
Q1IQW9_KORVE/72-276TELVPPVVASA----WREVA....PNYTV...REMF.........SA....................KR.EEV-------
Q3M8Q8_ANAVT/9-189SKIIAPQTQEA----FKIAA....ARRTV...EEAI.........TK.....................R.SEL-------
Q090V7_STIAD/69-267REIVEPSVDGV----LRRHF....AQHTV...REIF.........AT....................HR.AQI-------
D1N1N4_9BACT/326-563EKTLTRIGEQA----ATEYL....ASSSM...MEVM.........ST....................DR.LGA-------
Q1PZW5_9BACT/32-225KIIVENETRDV----ARSVF....GKMVE...RDLY.........NPE...................EK.RKR-------
A6DJY4_9BACT/65-290DKRAQDVLRNI----VDRTLTFQSSKWSV...DKAH.........YV.....................SQNEF-------
Q1D2G7_MYXXD/109-312AELLREMFVGA----ARRLV....ANMSV...EECL.........SK....................RK.EGI-------
Q54F95_DICDI/43-215DESIENLVQIK----LIEMV....PKKTL...AQLL.........YE.....................R.DGF-------
A4FVJ0_DANRE/138-311PDVMQALTQVS----VREIL....AHHAF...NDIL.........LD.....................R.KRI-------
A1AN40_PELPD/42-249EDNLRGKIASH----IKEALP..QAGIAV...IDLE.........GK.....................V.VLL-------
Q233H7_TETTS/39-215NENVKIMCESI----VRHQI....ANHAL...QEVL.........TN.....................R.NML-------
A1ZL05_9BACT/23-202KTLILPVFRSA----SADVC....ARFFA...KDMH.........SG....................ER.SVI-------
A7UY12_BACUN/32-219QSVILTEVKNA----YKDVA....GLYET...DSLI.........NN.....................R.PAF-------
Q043D7_LACGA/23-194VESMVQLIRGH----LRDII....GRMEL...NEAL.........GS.....................T.SQI-------
A5TW95_FUSNP/28-213QRFIRPRVKEI----IQATI....AKYTI...EEFV.........SK.....................R.AEI-------
A7BTW2_9GAMM/55-247KQLLEYMVINI----FKEEI....GLINM...IEVP.........KK.....................R.GDL-------
A1TM35_ACIAC/23-205ALQLNRVVRNA----FQEEV....NRRTV...RELL.........ST....................KR.DAL-------
A8LGX8_FRASN/173-419RRFVERVLGTT----AEGYFLSTASEYKV...LDFL.........NS.....................H.NEV-------
Q1MDA7_RHIL3/28-223RILIEAKFVDG----LRSVA....ATMNL...DALQ.........EQ.....................R.MDF-------
Q48BK3_PSE14/61-251ARQIRTFVGSA----LETTA....SSFDL...SSLV.........NTDAN...............KVNI.TAF-------
A4YEZ5_METS5/41-236AAYLAPIIDQE----VSSIL....NQVKL...VDVY.........KK.....................F.GDI-------
Q9A5B4_CAUCR/49-247DQLLDGPIRND----VRSAVAAEAEKVGV...ETLY.........SG....................GR.QMV-------
Q87TY4_PSESM/47-268LPALDRLVNRS----AVALT....AARDL...DTILVARPELIGADSQAAER...........RERLR..GDL-------
Q0RL11_FRAAA/10-261GAIIRPVIDND----LREQI....NNFTC...ADLVSSCALVQMGANQQAGAQTTLNAASSNGNIQAVQ.NAI-------
A4YLJ4_BRASO/276-496KKLVEQTLDPM----VSAFFKNVAQKMTL...IELL.........QN.....................R.AAI-------
A3JKR6_9ALTE/29-215EDQIKASISEA----VKAIV....PTLEL...SEVY.........SD.....................R.EKI-------
A3RPR4_RALSL/36-235DSFTHGYLRDT----ARNVIVALGSEYNF...DDVN.........GA....................RK.EEF-------
Q7UMK6_RHOBA/205-421EEIIEKIILPN----ARSFCRLRGSDNSG...RDFIL.......GEK.....................R.LAF-------
A3EPC8_9BACT/42-222HVLIAPYVRSE----ARKIV....GRYTP...SQIY.........SN....................QR.ELI-------
Q67MY2_SYMTH/40-231EQRIDAAVYST----VRGVL....GRLKF...GEII.........SEGE.................SAR.GNL-------
A5FZF5_ACICJ/44-216RAMIGQVAQTS----LREII....SGMGL...GEIL.........GN.....................R.EAM-------
A0ZCT5_NODSP/20-192QGSLTQIATTT----LREII....AQNTV...EQTN.........VS.....................R.AEM-------
Q2JMY3_SYNJB/34-233STVVVPVVRSK----IRDIS....ASFNS...EDFY.........RKS...................QR.AAI-------
Q1PZW6_9BACT/41-239DVYKQKWVYDY----ARTICYYCYGELGI...DEFP.........SAS...................KR.DAK-------
Q0SNV9_BORAP/33-247ETTIKDIAKSS----MNRLI....GDNTI...FEII.........ND.....................NRVGV-------
Q7PAR4_RICSI/68-263AETVKATVESA----VREVI....GNTPI...SWVL.........SD....................QK.QEI-------
A8FZG0_SHESH/35-214QRILDPRFRSA----TKDTI....PQFEA...EQLI.........QD.....................R.ASA-------

PF11978

MVP_MOUSE/519-647ASRVRGAVASV----TFDDFHKNSARIIR---MAVF---------GF-----------------------EMSEDAGPDG
Q38C44_TRYB2/534-652ANRIRAAIASE----PFDNFHRNSSSLIR---RAIF---------HS-----------------------HS........
Q4D3P0_TRYCC/529-647ANRIRAAIASE----SFEEFHRNSSSLIR---QAIF---------RS-----------------------YL........
Q4QCJ5_LEIMA/614-738ASRVRSAIAGQ----AFEFFHCNSSTLIR---QAIF---------TP-----------------------AED.......
MVP_STRPU/521-639ASRIRGAVAGV----QFDDFHKNSAKIIR---ASVF---------GF-----------------------DEK.......
MVP_DANRE/533-651ASRIRGAVASV----QFDDFHKNSNRIIC---SAVF---------GF-----------------------DEK.......
MVP_DISOM/519-637ASRIRGAVASV----QFDDFHKNSSRILR---AAVF---------GL-----------------------DPE.......
MVP_CHICK/520-636ASRVRGAVAAV----TFDDFHKNSNRLIC---SAVF---------GF-----------------------DEG.......
MVPA_DICDI/504-621ASRVRGAVAAV----SFDDFHKRSAEVIR---QSVF---------GL-----------------------DES.......
MVPB_DICDI/520-633GSLVRAAVAAS----TFDNFHKHSSDIIQ---QAVF---------GS-----------------------TD........
MVP_TRYCC/511-626ASRIRGAVAAE----DFDSFHRNSAKIIR---VAVF---------GR-----------------------GEN.......
MVP_LEIIN/511-626ASRVRGAVAAE----DFDSFHRNSAKIIR---TAVF---------GV-----------------------DEA.......
A7RH80_NEMVE/598-715ASRIRANVAQV----TFDEFHRYSAKIIR---RAVF---------GV-----------------------DEK.......
A1ZGE7_9BACT/529-640RSFIRNLVKKH----TIMDFYGNGIDILR---NGVL---------GA-----------------------SSK.......
A6FXE2_9DELT/535-646RSLLRGKIKGE----PIQRLHPRVVGFVR---DVVL---------GA-----------------------QGE.......
A4HP51_LEIBR/553-671ASHIRAAVASM----PFEEFHKNSARCLR---RAVF---------DV-----------------------NPA.......
Q4DYQ9_TRYCC/535-653AGRIRAAVASL----PFQQFHKNSAKILQ---EAVF---------GV-----------------------DPV.......
Q38AX5_TRYB2/537-655AGRIRAAVASL----PFQQFHKSSVKVLQ---QAVF---------GI-----------------------NPV.......
A0CI16_PARTE/525-641ASRVRGAVSSI----TFEDFHNNSSVKIR---EAVF---------GK-----------------------EG........
A0EGV2_PARTE/516-633ASKVRAAVASV----VFDKFHKTSAKLIR---TAIF---------GT-----------------------DEN.......

PF13421

A1B688_PARDP/26-236--GQMVA---KAIS----------------------------------------------------------PT------
A3V3G3_9RHOB/26-236--GKLVA---GAID----------------------------------------------------------PT------
A4CIK3_ROBBH/30-240--SETCR---EVME----------------------------------------------------------PE------
A4WUR1_RHOS5/26-236--GKLVA---QAIA----------------------------------------------------------PT------
A5G3T6_GEOUR/26-236--SAYLT---GKIA----------------------------------------------------------PE------
A6C8B2_9PLAN/27-238--STELK---KIVN----------------------------------------------------------ER------
A6DY99_9RHOB/26-236--GKLVA---GEIS----------------------------------------------------------AV------
B3E867_GEOLS/26-236--GEMLK---ERIA----------------------------------------------------------PA------
B6B0M0_9RHOB/26-236--GQLVA---REIE----------------------------------------------------------VQ------
B8FFG4_DESAA/26-236--GEMLV---DRIN----------------------------------------------------------PS------
B9M753_GEOSF/26-236--SLYLT---EKVA----------------------------------------------------------PE------
D5UR64_TSUPD/26-236--SEKLR---EYVQ----------------------------------------------------------TR------
C2G525_9SPHI/26-236--SGLIQ---QKIS----------------------------------------------------------PE------
C5JBH5_9BACT/26-236--GDLLE---QRLG----------------------------------------------------------PE------
C7D9P0_9RHOB/26-236--GKLVA---TAIA----------------------------------------------------------PT------
C9KTK6_9BACE/35-258--NENIR---NNAN----------------------------------------------------------KE------
C9L2Z9_9BACE/38-254--AQYLQ---NCLK----------------------------------------------------------SE------
D1N0K4_9BACT/26-236--GDRVR---ANLE----------------------------------------------------------PD------
E8RWI6_MICSL/26-236--GRRLA---AVLT----------------------------------------------------------EE------
D3IJU6_9BACT/26-237--SASLT---EALK----------------------------------------------------------PD------
Q0FM78_9RHOB/26-236--GKMLA---DGIS----------------------------------------------------------ST------
Q26GM4_FLABB/30-240--SETCQ---AVMQ----------------------------------------------------------PE------
Q47L21_THEFY/21-231--GDRLA---QALS----------------------------------------------------------AE------
Q7UUL6_RHOBA/56-267--AAQLR---ERVV----------------------------------------------------------EK------

PF01145

A5DBX9_PICGU/79-250--ADSIE---SIIA..........................................................KT......
Q54X13_DICDI/30-222--LNALT---GLMA..........................................................SE......
Q8NL82_CORGL/38-205--LEPVL---VAAQ..........................................................AA......
Q9RQU5_CLODI/24-196--KCKNE---NYPD..........................................................EA......
Q3YQY0_EHRCJ/26-202--MTIIQ---EGVS..........................................................KE......
Q01QT0_SOLUE/4-251--NEYMD---NECR..........................................................SA......
A6DJY3_9BACT/29-214--EQSIA---QEAK..........................................................KN......
Q7BTU1_YERPE/7-194--LDNAL---KDIQ..........................................................AE......
FLOT1_ARATH/3-185--KKEVF---DKVQ..........................................................LE......
Q87KY0_VIBPA/44-297--KSKLG---DQLREGIYLTERRQVEVEELD........................LAPVGANQANANQLQRTNQLVWKTV
Q7WQ89_BORBR/28-208--GVDVN---AAVL..........................................................SA......
A6EM35_9BACT/36-219--LTNIS---NSVE..........................................................SE......
A1RSJ3_PYRIL/47-245--AKQIE---QQYR..........................................................ES......
A7JFZ5_FRANO/22-195--ALDIK---KELS..........................................................EE......
Q28CP1_XENTR/61-241--AEHLK---EDLN..........................................................EQ......
A9AV86_HERA2/27-198--APQIL---ALVQ..........................................................PK......
A9AH04_BURM1/23-201--ADAAR---DAVR..........................................................AS......
Q8D667_VIBVU/25-231--LSEAE---RALKIGALVPIQKGR...................................QLVEQEIFLAAAEK......
Q9XAJ5_STRCO/27-227--AGQVA---EEAE..........................................................AS......
A5UQB3_ROSS1/147-329--TQNLL---NTLN..........................................................QQ......
Q8PBR9_XANCP/66-240--AIASK---DRLQ..........................................................AA......
A6DTT2_9BACT/42-238--TQATL---SRLN..........................................................KR......
A1VS28_POLNA/25-221--RENVI---KTLT..........................................................EE......
A6V731_PSEA7/10-287--AAEFE---NQLNDGLYLIKRKEVRGPRGAVPHQTAILQAGTEQGAFGDNNASQFVTEKVTDAKGIPVRKQQQ......
D1N1N5_9BACT/30-214--QDQIK---TRLA..........................................................ES......
A7GXM3_CAMC5/29-235--GDDFT---KAVK..........................................................TQ......
A6GGG7_9DELT/52-236--DARVS---QALG..........................................................DT......
Q1HR13_AEDAE/28-207--SQKVS---DDLT..........................................................ER......
A1RAB0_ARTAT/20-208--RLVLT---EALR..........................................................AD......
Q47MY9_THEFY/102-281--VADMQ---ELLN..........................................................RQ......
Q8F4L3_LEPIN/16-199--FEGIS---EKLN..........................................................VS......
Q72UG5_LEPIC/48-230--AKDIK---SAVI..........................................................ER......
Q65J46_BACLD/36-220--AAEIQ---KTFA..........................................................DD......
Q76Z22_9CAUD/26-209--QENTK---RRLQ..........................................................EA......
A1KN88_MYCBP/55-245--AKRAA---DILR..........................................................QD......
A4NZC0_HAEIF/24-210--TNDIT---AQIR..........................................................EA......
A6DTT0_9BACT/309-521--ENILL---KSLT..........................................................QA......
A1RZ05_THEPD/30-234--SFKTK---AFLL..........................................................EE......
Q82CW6_STRAW/178-350--GDTLT---RLVA..........................................................AD......
A6G7G5_9DELT/54-276--AGGVG---VEVR..........................................................EA......
A3ZSS7_9PLAN/140-314--ADEIA---AITR..........................................................RR......
A9B3W6_HERA2/115-349--AAQLK---NRVQ..........................................................EK......
Q8ETQ3_OCEIH/33-230--NQQVT---EIAQ..........................................................KQ......
Q2JUY0_SYNJA/34-221--QGQIR---ERVA..........................................................LL......
A5CSU8_CLAM3/32-222--AQEAV---NQTK..........................................................ND......
A3CLK3_STRSV/29-214--ASKVQ---DNVA..........................................................PD......
A7VQ64_9CLOT/74-274--ADMMK---QDLQ..........................................................AR......
Q8V6S4_9VIRU/31-228--TMDAR---SQLE..........................................................EK......
Q3AHV3_SYNSC/32-214--STLVQ---ESVS..........................................................NE......
Q119N4_TRIEI/61-249--AERIA---EDVS..........................................................RD......
Q1BPT6_BURCA/42-247--SQRVA---EALV..........................................................PV......
Q8YY85_NOSS1/318-534--QVEAS---EYIK..........................................................AA......
A7B9F0_9ACTO/13-202--GRVLT---QAFA..........................................................DDH.....
A7A735_BIFAD/49-245--TKAVQ---DALA..........................................................AK......
Q2RZL8_SALRD/80-256--NDHLS---DDFG..................................................................
Q54K65_DICDI/28-191--SNQIH---DELK..........................................................EA......
Q3IR56_NATPD/37-229--GDIIA---DELR..........................................................SQ......
A7BKU8_9GAMM/106-302--IEELT---TRLKTVTEGR..............................................SHEDGLTQ......
A6DTT1_9BACT/27-205--EKDLL---EDLN..........................................................DR......
Y1021_SYNY3/86-292--ADEVL---NLIQ..........................................................GD......
Q6WHG5_BPKV4/25-219--NQFVK---QRLN..........................................................QE......
Q114A2_TRIEI/361-607--QKEAE---NYIK..........................................................TL......
Q67KD6_SYMTH/26-206--ADRMR---ANVA..........................................................DD......
ERLN1_PONAB/24-211--DENLK---QALQ..........................................................KD......
A3X541_9RHOB/26-218--AQDVA---TAIE..........................................................VQ......
Q6U9K4_9CAUD/33-217--QELIK---SEVN..........................................................EY......
A9B5U5_HERA2/35-232--ADKVK---EQLT..........................................................TE......
Q2SE90_HAHCH/5-203--AGTLA---AALD..........................................................SAP.....
Q9ZMI7_HELPJ/62-262--AALIN---SGIN..........................................................KE......
A6DJY2_9BACT/306-539--ADQLK---KVLQ..........................................................EK......
A7N4W8_VIBHB/30-242--RDAVV---EVIG..........................................................SE......
Q22WG5_TETTS/26-207--GTEMQ---NKLN..........................................................EY......
Q7UMK7_RHOBA/174-391--QTDVS---EDFQ..........................................................SV......
Q878M8_STRPQ/39-222--YAEIE---KSLS..........................................................ER......
D1N1N6_9BACT/53-297--SDEVS---RLFS..........................................................KL......
A4HYE6_LEIIN/5-177--SQQLK---DEVD..........................................................AI......
A0XWY7_9GAMM/53-213--AQEVT---LRLQ..........................................................NY......
A5V005_ROSS1/55-242--AQRIR---ANLTTPP....................................................GPGQE......
HFLC_BUCBP/21-239--TSNIK---YSLNASSKINYKNVIFKKAIN........................GTSNQNINQENNLLQSISD......
B9LBU8_CHLSY/36-219--SQAVR---AEVS..........................................................PK......
A6V538_PSEA7/332-551--AGEVG---QAVQ..........................................................AE......
Q8PPV1_XANAC/20-207--DDSVT---QNVS..........................................................AL......
Q11VD7_CYTH3/21-198--IEEVK---MHLD..........................................................AT......
Q1IQW9_KORVE/72-276--RQRAA---GIIT..........................................................AK......
Q3M8Q8_ANAVT/9-189--KEDFD---NALG..........................................................DR......
Q090V7_STIAD/69-267--QKDIA---AEIT..........................................................PL......
D1N1N4_9BACT/326-563--EAAMK---KRIQ..........................................................EL......
Q1PZW5_9BACT/32-225--AEECR---TRLR..........................................................ER......
A6DJY4_9BACT/65-290--MQICL---DSIR..........................................................KE......
Q1D2G7_MYXXD/109-312--AAELV---REIA..........................................................PV......
Q54F95_DICDI/43-215--NKELV---DSVN..........................................................ET......
A4FVJ0_DANRE/138-311--AQEIQ---VTLD..........................................................SG......
A1AN40_PELPD/42-249--GETLR---DRIA..........................................................PA......
Q233H7_TETTS/39-215--RDSMK---VDLQ..........................................................KQ......
A1ZL05_9BACT/23-202--ENKIQ---ERMK..........................................................EL......
A7UY12_BACUN/32-219--EKEVE---ALLK..........................................................ER......
Q043D7_LACGA/23-194--NAQLA---EAIG..........................................................DL......
A5TW95_FUSNP/28-213--SRLIF---EDLK..........................................................DD......
A7BTW2_9GAMM/55-247--SKNVI---EKLK..........................................................RK......
A1TM35_ACIAC/23-205--MSDVK---KEVL..........................................................EVV.....
A8LGX8_FRASN/173-419--RLEVE---QKVR..........................................................QA......
Q1MDA7_RHIL3/28-223--VKAVQ---EAVG..........................................................AD......
Q48BK3_PSE14/61-251--ENQLR---QQID..........................................................QQ......
A4YEZ5_METS5/41-236--SMAVT---AALK..........................................................QF......
Q9A5B4_CAUCR/49-247--IQKAY---ARVA..........................................................GK......
Q87TY4_PSESM/47-268--VRGIN---QRLA..........................................................EL......
Q0RL11_FRAAA/10-261--NKSLA---TDLN..........................................................DN......
A4YLJ4_BRASO/276-496--QEESA---AEMK..........................................................VK......
A3JKR6_9ALTE/29-215--SKAVM---ETLN..........................................................KI......
A3RPR4_RALSL/36-235--VLRLT---KELD..........................................................AR......
Q7UMK6_RHOBA/205-421--QKDFQ---QTLG..........................................................ET......
A3EPC8_9BACT/42-222--EKEIL---KNLR..........................................................EK......
Q67MY2_SYMTH/40-231--NQEVT---RLVN..........................................................EQ......
A5FZF5_ACICJ/44-216--DAKIR---AAIA..........................................................AK......
A0ZCT5_NODSP/20-192--DTAIL---NQLN..........................................................QT......
Q2JMY3_SYNJB/34-233--EQRAL---DLIR..........................................................QE......
Q1PZW6_9BACT/41-239--ADKAR---LEIN..........................................................TF......
Q0SNV9_BORAP/33-247--TEGVK---SSMN..........................................................EI......
Q7PAR4_RICSI/68-263--TYKIE---KLAQ..........................................................KI......
A8FZG0_SHESH/35-214--IQGIE---RRLA..........................................................EE......

PF11978

MVP_MOUSE/519-647ALLPRAR...DRAV------------------------------------------------------------------
Q38C44_TRYB2/534-652...GTTELRGDSLY------------------------------------------------------------------
Q4D3P0_TRYCC/529-647...GTTEMREDGLY------------------------------------------------------------------
Q4QCJ5_LEIMA/614-738...GSIVSHGDSLC------------------------------------------------------------------
MVP_STRPU/521-639...NKVR...ERFL------------------------------------------------------------------
MVP_DANRE/533-651...LAVR...SSLR------------------------------------------------------------------
MVP_DISOM/519-637...LRVR...ERLL------------------------------------------------------------------
MVP_CHICK/520-636...GRLR...EHLR------------------------------------------------------------------
MVPA_DICDI/504-621...GEVR...KNFS------------------------------------------------------------------
MVPB_DICDI/520-633...GSSN...DCLY------------------------------------------------------------------
MVP_TRYCC/511-626...GEIN...TSLR------------------------------------------------------------------
MVP_LEIIN/511-626...GETK...KNLR------------------------------------------------------------------
A7RH80_NEMVE/598-715...GNVR...NRLR------------------------------------------------------------------
A1ZGE7_9BACT/529-640...TNKR...PGRL------------------------------------------------------------------
A6FXE2_9DELT/535-646...DGGR...PGRR------------------------------------------------------------------
A4HP51_LEIBR/553-671..TDEPN...GLLR------------------------------------------------------------------
Q4DYQ9_TRYCC/535-653..SGGTK...TELR------------------------------------------------------------------
Q38AX5_TRYB2/537-655..NGDPM...SELR------------------------------------------------------------------
A0CI16_PARTE/525-641...NEIR...TSYT------------------------------------------------------------------
A0EGV2_PARTE/516-633...GKIR...KEYL------------------------------------------------------------------

PF13421

A1B688_PARDP/26-236---------------V.AAYG----------------------LT-IP--EFY-IENISLPD...EVEKM---LDKRTSM
A3V3G3_9RHOB/26-236---------------L.KNYG----------------------LS-LP--ELY-IENISLPP...AVEKA---LDARTSR
A4CIK3_ROBBH/30-240---------------F.ARVG----------------------IE-LE--KFY-IENVSMPE...ELKKE---IFEYSRL
A4WUR1_RHOS5/26-236---------------V.AAYG----------------------LS-IP--ELY-IENISLPQ...EVEKA---LDKRTSM
A5G3T6_GEOUR/26-236---------------F.LEYG----------------------LE-MT--KLL-VENISLPQ...EVEEA---LDKKSSM
A6C8B2_9PLAN/27-238---------------IDDEYG----------------------LE-TP--QLL-IVNISLPE...TVEKA---LDTRTSM
A6DY99_9RHOB/26-236---------------V.AEYG----------------------LS-IP--EFY-IENISLPP...EVEAA---LDKRTSM
B3E867_GEOLS/26-236---------------F.EGLG----------------------IA-LT--EVQ-VQDVGLPE...EVERA---IDKAGAM
B6B0M0_9RHOB/26-236---------------L.AEYG----------------------LS-LP--ELY-IENISLPP...AVEAV---MDKRSSM
B8FFG4_DESAA/26-236---------------F.KEFG----------------------LQ-LT--EVQ-VQDLGLPE...EVERA---IDKGGAM
B9M753_GEOSF/26-236---------------F.NEYG----------------------LE-VT--KLL-VENISLPP...EVEEA---LDKKSSM
D5UR64_TSUPD/26-236---------------IQGPYG----------------------LA-CE--AIE-M.NISLPD...EITQA---MTRGVAR
C2G525_9SPHI/26-236---------------F.EEIG----------------------LL-LN--KFL-IENVSLPD...EVEKV---LDKRSSM
C5JBH5_9BACT/26-236---------------F.AEYG----------------------LA-LV--NPL-VENISLPE...EVEQA---LDKRSSI
C7D9P0_9RHOB/26-236---------------L.EEYG----------------------IS-VP--ELY-IENISLPP...AVEEA---LDTRTSR
C9KTK6_9BACE/35-258---------------LKQVYG----------------------IE-LT--SFN-L.RFNSPAYQKYTQEG---LEGAGLE
C9L2Z9_9BACE/38-254---------------F.ARYG----------------------IS-LE--NFN-LASINYDEGHPNVQKV---LEAQANA
D1N0K4_9BACT/26-236---------------F.AALG----------------------FE-LL--SFT-VESISLPD...EVNQA---MDKRSSL
E8RWI6_MICSL/26-236---------------L.AEVG----------------------IA-IP--KFV-IENVSVPP...EVEQA---LDKRTSM
D3IJU6_9BACT/26-237---------------F.EEYG----------------------LE-LT--NFL-VENISLPE...AVEKA---LDKRTSM
Q0FM78_9RHOB/26-236---------------I.AEYG----------------------LS-LP--ELY-IENISLPA...AVEAA---LDKRTSM
Q26GM4_FLABB/30-240---------------F.MGVG----------------------IS-LE--RFY-IENVSMPE...ELKKE---IFEYSRI
Q47L21_THEFY/21-231---------------F.ASIG----------------------VA-IP--RFI-IENISLPP...EVEAA---LDKRAQM
Q7UUL6_RHOBA/56-267---------------IDDEYG----------------------LD-CP--QLF-IVNISLPE...SVEKA---LDTRTSM

PF01145

A5DBX9_PICGU/79-250...............A-FDWG......................VN.IE..SIL.IKDLQLPP...KVQSS...LSMAAEA
Q54X13_DICDI/30-222...............A-NKWG......................VE.IV..FVK.VQRVE.AR...RLAEV...LAKKKNA
Q8NL82_CORGL/38-205...............A-KNVG......................VE.VS..SIL.LKDLNLPQ...EYSGA...LQESIVA
Q9RQU5_CLODI/24-196...............T-DKWG......................IK.VN..RVE.LKNIMPPQ...DIQVA...MEKQMRA
Q3YQY0_EHRCJ/26-202...............S-EKFG......................IE.MI..DVR.IKRADLPE...ENSTA...IFRRMQT
Q01QT0_SOLUE/4-251...............P-ARYG......................V..IL..DASLITGIDPPD...EVESA...LAAINTA
A6DJY3_9BACT/29-214...............A-EQYG......................IE.LV..SVG.VRHLGLPP..NKTQQS...LIERMRQ
Q7BTU1_YERPE/7-194...............M-SPVG......................IE.VI..SLSWVGKPDYPD...TVIES...INAKVTA
FLOT1_ARATH/3-185...............L-NQFG......................LV.IYNANVKQLVDV.PGH...EYFSY...LGQKTQM
Q87KY0_VIBPA/44-297PVVDKTGQPIRQDNPL-QQYG......................IQ.VT..QVT.IGDPQPEK...QLDQL...LADKKRL
Q7WQ89_BORBR/28-208...............M-DGAP......................VQ.IV..GVQ.VEEVGFSK...AYEHS...IEQRMLA
A6EM35_9BACT/36-219...............L-KKVG......................LK.LI..NVN.ITDIVDES...GYIEA...LGKEAAA
A1RSJ3_PYRIL/47-245...............I-EKDPAV.................AGLID.IL..DVN.VLNFILPQ...QITDA...INRKVAA
A7JFZ5_FRANO/22-195...............M-STYG......................YT.II..KSL.VVDINPEE...NVKRS...MNEINAA
Q28CP1_XENTR/61-241...............V-KPWG......................LC.VERVELA.LESIL......QTPENALIVPSVTPA
A9AV86_HERA2/27-198...............A-NELG......................AS.IQ..TIQ.IKDFSLPA...ELKRA...ALQQAKV
A9AH04_BURM1/23-201...............A-AALG......................IE.LV..DVQ.LTRVDLPA...AQTDA...VYQRMIG
Q8D667_VIBVU/25-231...............I-KIFG......................IE.LL..DIR.FKRINYNE...SVRPK...IYERMVS
Q9XAJ5_STRCO/27-227...............L-SGQG......................LV.LD..AFQ.IQDITTEG...SYLED...LGRPEAA
A5UQB3_ROSS1/147-329...............F-LPA.......................VR.FV..NAN.ITHAEPSSQEYRIDLA...KPEMIRV
Q8PBR9_XANCP/66-240...............L-NAYN......................TG.LSVTGVT.LPDARPPE...EVKPA...FDEVNGA
A6DTT2_9BACT/42-238...............I-TDLQ......................LG.IE......VLSIELKI...SFPAQ...IREETIA
A1VS28_POLNA/25-221...............K-LADK......................IT.VS..QIQ.VRAITPAD...VIVNS...ANELVRA
A6V731_PSEA7/10-287...............F-RKFG......................VE.VV..EAR.ITNVDPNP...QYKQR...MVKVQQA
D1N1N5_9BACT/30-214...............C-KNYG......................LE.IV..SVG.VNSINVPK...TISDK...VFDRMIS
A7GXM3_CAMC5/29-235...............L-ENWG......................IEPVKNIELMDIRDNRDSKVIFNIMEKKKSLIEKESR
A6GGG7_9DELT/52-236...............L-GDIG......................LL.LL..DLE.VVEINLPQ...EFKTA...MARGALS
Q1HR13_AEDAE/28-207...............A-AQFG......................VI.LD..DIS.ITHLTFGK...EFTQA...VEMKQVA
A1RAB0_ARTAT/20-208...............A-RLQST....................GIE.IL..GVQ.VLAVRPES...DVERA...LQTPVRE
Q47MY9_THEFY/102-281...............L-SRYG......................VQ.IM..GCN.IPDVQLPD...QYQQH...LSTRERV
Q8F4L3_LEPIN/16-199...............L-AKQG......................VI.LT..STS.PLDFSFPK...NVQEI...FAKLVES
Q72UG5_LEPIC/48-230...............T-KGKH......................IE.VF..DVI.LDDVEYSP...NMLHA...IETKLTK
Q65J46_BACLD/36-220...............M-KGLG......................FV.ID..DLT.LGVPKPDK...ATQEA...IDARVKS
Q76Z22_9CAUD/26-209...............L-TGTG......................IT.LQ..EVL.VQDVTFDP...RIQNQILQTQDRIQK
A1KN88_MYCBP/55-245...............V-GGQ.......................VD.IF..DVN.VPTIQYDQ...STEDKINQLNQQRAQ
A4NZC0_HAEIF/24-210...............V-KGYP......................IE.IT..AVQ..SVINFNK...EYEKR...VEESVQK
A6DTT0_9BACT/309-521...............L-EKYQL....................NIG.VKLESID.ILNFQPHP...AIAEA...WNEKLAA
A1RZ05_THEPD/30-234...............V-RRIG......................LE.LI..DLK.FEAIDTTP...EYRDRLFWIKQTGAA
Q82CW6_STRAW/178-350...............A-APVG......................LE.VF..SAQ.PTRIEYAP...EVAAR...MQRRR..
A6G7G5_9DELT/54-276...............M-QDLTGELPGELLGEPVSSTPELGYIDVQ.....EIK.LMDINLPE...IVKAA...IADKYRQ
A3ZSS7_9PLAN/140-314...............A-ETLG......................LE.LI..SVG.VRDAILPG...EMKDL...LNKVTQA
A9B3W6_HERA2/115-349...............V-QQWG......................IE.VL..DIG.ITQVVLNP...DRIKA...FYRAITA
Q8ETQ3_OCEIH/33-230...............L-DDMG......................FR.ITSLGLTDLRDVD.NS...DYLTN...LGRPETA
Q2JUY0_SYNJA/34-221...............L-KEYG......................IE.VL..DFL.LRDVDFDP...DFVAA...IEAKTIA
A5CSU8_CLAM3/32-222...............L-AELG......................LQ.IE..TLN.VREITTPG..SSYLDD...RARSNAA
A3CLK3_STRSV/29-214...............L-AKMG......................LE.VI..AFT.VQSFSDEG...GVIDN...LGIENVE
A7VQ64_9CLOT/74-274...............V-DVAG......................IE.IM..DVR.ITNLTYAP...EIAAA...MLQRQQA
Q8V6S4_9VIRU/31-228...............F-ADTG......................LV.LD..SVQ.ITKVNFPQ...SYEKS...ITEKEVA
Q3AHV3_SYNSC/32-214...............L-SKFD......................YVAVK..GLD.ITGLKIAE...EYRAA...IEQKQIA
Q119N4_TRIEI/61-249...............L-IKLG......................LQ.L...DILKIQSISDDV...DYLNS...IGRKQIA
Q1BPT6_BURCA/42-247...............F-TRYG......................LA.LD..AFA.VESVSLPA...KLQKA...LDLRIGA
Q8YY85_NOSS1/318-534...............L-RTYD......................VQ.AI..DTL.IGDIQPPA...SLMQT...QTDRKIA
A7B9F0_9ACTO/13-202..............QL-RATG......................VA.VV..DAR.LLSLRPDE...GVESS...LRAPLLE
A7A735_BIFAD/49-245...............W-RKIG......................LT.VE..QVS.VQDVRYGD...EIVKK...YNEAQAA
Q2RZL8_SALRD/80-256................-..........................IE.........VTNVSMPSADNQILED...LEEIRTL
Q54K65_DICDI/28-191...............L-NKYG......................VT.IE..YLK.LKDIHFDE...TIAKA...IAK....
Q3IR56_NATPD/37-229...............S-PRY.......................VD.IE..SVQ.VRDIHFDP...EFEQA...LEQVEIA
A7BKU8_9GAMM/106-302...............H-EGLG......................IK.IV..TVQ.IREALVSS..EKLWQD...LQAPFRH
A6DTT1_9BACT/27-205..............IQ-NSYG......................IS.FD..FVG.ITSFSVPA...ANSET...ILSRMKE
Y1021_SYNY3/86-292...............L-RKVG......................LT.LN..NIA.ISEIEESD...TYDENNFFDAQGVRL
Q6WHG5_BPKV4/25-219...............L-KDTP.........................FVLKVVG.VTDVVYPK...TITAA...QEASAER
Q114A2_TRIEI/361-607...............L-EMIG......................VEGCG..TFM.VDTVNLPL...VVDSY...LQEKQKQ
Q67KD6_SYMTH/26-206...............M-SKMG......................LE.VI..SFT.IKEIKDKN...DYINN...MGRPDTE
ERLN1_PONAB/24-211...............L-NLMAP....................GLT.IQ..AVR.VTKPKIPE...AIRRNFELMEAEKTK
A3X541_9RHOB/26-218...............A-KQLG......................LM.LV..SSA.LISVDQSDQ.SQLNENNAFNAQGLRR
Q6U9K4_9CAUD/33-217...............S-KPFG......................YE.VV..EVF.LQEITLPK...LIQDQ...VEQTKIR
A9B5U5_HERA2/35-232...............F-ERRH......................LI.LE..DFV.IREVHLPD...NLKQA...LENKITA
Q2SE90_HAHCH/5-203..............VL-EKLG......................VE.IL..DVS.ILAIKPNP...ETARA...LEATVRE
Q9ZMI7_HELPJ/62-262...............V-SKLP......................NTPVELSSIQ.LREIVLPA...KIKEQ...IEKVQIA
A6DJY2_9BACT/306-539...............A-DAID......................LG.VNVVFLE.IEASHPPV...DTVLS...HDRVMGA
A7N4W8_VIBHB/30-242...............M-DGFK......................IYDVVIDKVD.QTALDAHSPGNILDVEGIRKISAITA
Q22WG5_TETTS/26-207...............F-QKEF......................CS.IV..EFFQLRKVDLPD...KFEHS...IQETEVQ
Q7UMK7_RHOBA/174-391...............L-SEKE......................ISMLY..GL..VRHIYIPK...NVREP...IQKGYVS
Q878M8_STRPQ/39-222...............L-AKES......................IE.LV..SVT.LTDQDAGD...EIEKA...IKDESVK
D1N1N6_9BACT/53-297...............L-TDAD......................CG.MVVESVS.LNRVFPPQ...KTKAA...FDEVAAA
A4HYE6_LEIIN/5-177...............I-NTYG......................IE.IV..SAL.ISDIDPGA...EITKA...MNEVQKF
A0XWY7_9GAMM/53-213...............L-STTP......................FK.LA..NVV.VGNINYPD...IVANA...VEKKLAA
A5V005_ROSS1/55-242...............S-PADQ......................LF.VVIEAVK.VLDIKVSE...EYARL...LSEKANL
HFLC_BUCBP/21-239...............L-SEIG......................VQ.IL..DVR.IGKISVSE...DFFSL...ICSRINS
B9LBU8_CHLSY/36-219...............A-SEWG......................YR.LG..SVY.IRKVHFRD..QTMIRQ...IEAKVVN
A6V538_PSEA7/332-551...............L-DRLGS....................GVE.VL..GAA.IEAIHPPA...GAANA...YHAVQAA
Q8PPV1_XANAC/20-207...............V-KEQG......................LP.IQIQNIT.LGRARPNP...DVLQQ...MNLTAAQ
Q11VD7_CYTH3/21-198...............L-EEWG......................YH.MI..DIQ.LNDIMFDE...EIIKS...MAKVVAS
Q1IQW9_KORVE/72-276...............L-AKDG......................VI.VE..EVM.LRDIQLPP...EYAKG...LEDLLLK
Q3M8Q8_ANAVT/9-189...............L-DKYG......................II.VL..DTS.VVDLTFSP...EFARA...VEEKQIA
Q090V7_STIAD/69-267...............L-REDG......................IV.LR..SVT.LGNVDLPH...QYRAG...VEALLAE
D1N1N4_9BACT/326-563...............A-DMHEL....................GIR.IV..AVT.ILDAHPPV..EKVAPA...YQNVIGA
Q1PZW5_9BACT/32-225...............L-ESRY......................IE.II..DVL.ILEFRFDQ...QLDRK...IKNIKVA
A6DJY4_9BACT/65-290...............V-STLN......................LG.IECDRFD.IKPEDRKPI.AQLSGS...FAGVSRS
Q1D2G7_MYXXD/109-312...............L-SGRGRLEDQTDA......GWGVILDTIE.IQ..DVRVLSSTVFANMQARFRHEQERQAREAEL
Q54F95_DICDI/43-215...............F-ESWG......................IN.LE..SFT.LSDIIFTQ...DVSNA...MSKKVEA
A4FVJ0_DANRE/138-311...............T-CRWG......................IK.VE..KAE.IEEINLPP...ELQHN...FAVEAEA
A1AN40_PELPD/42-249...............M-QAFG......................LE.LI..EVQ.VQDIGLPA...EVEQA...IDKAGAM
Q233H7_TETTS/39-215...............L-SGWG......................IW.LE..TVE.ITDVKICS..KSLFED...LQAEFRQ
A1ZL05_9BACT/23-202...............L-DKRG......................FL.IE..AVL.LKSISLPA...RVSKA...IEQKLAA
A7UY12_BACUN/32-219...............L-STRG......................FT.FT..NIQ..SSVKPND...VLQAA...IDEKNTA
Q043D7_LACGA/23-194...............T-DIYG......................IR.VV..RVN.VDELLPSP...EIQKA...MDKQLTA
A5TW95_FUSNP/28-213...............F-SQYG......................LS.VS..NVS.IVNHDFSD...EYERA...IESKKVA
A7BTW2_9GAMM/55-247...............V-QDIN......................LK.IELYDFS.LPYYDWSE...EFLADTQRMETITTA
A1TM35_ACIAC/23-205.............KGT-KPWG......................VD.VV..DVR.ITRVDYVE...AITES...VYRRMEA
A8LGX8_FRASN/173-419...............L-DEWD......................IE.AV..RTT.LGEFEPPA...NLDE....IRRAIAS
Q1MDA7_RHIL3/28-223...............L-QSNG......................LE.LE..SVS.LTRLDQTDI.KHFNANNFFDAQGLAA
Q48BK3_PSE14/61-251..............LL-ATYG......................VR.VL..QVG.VERLTLPS...VTLNA...TVDRMRA
A4YEZ5_METS5/41-236...............L-AELG......................VE.LI..SVR.VTRLIPED..PELRRI...IQLRDLG
Q9A5B4_CAUCR/49-247...............W-ARHG......................VN.IS..QLDWIGSIRYPQ...AIIQQ...MQAKTQL
Q87TY4_PSESM/47-268..............NA-TGMG......................IG.VEVARVD.VQSS.LPK...AAVNA...FNAVLTA
Q0RL11_FRAAA/10-261...............L-GGPF.........................LENLRFT.LARVTLPE...NVQGA...VNSAQAA
A4YLJ4_BRASO/276-496...............F-EGYS......................LE.LQ..EVL.IGTPRAAPGDQTIENILIQLRMRQVA
A3JKR6_9ALTE/29-215...............Y-DIHG......................WE.CL..RVI.VEDPKLDASIEEASNKRIENRRRAEA
A3RPR4_RALSL/36-235...............L-TPLG......................VS.IK..QFGIVGSLRPPR...TLLDA...VSAKTKA
Q7UMK6_RHOBA/205-421...............C-RQQG......................IE.II..QAL.VTRISPPQ...QIASP...VRDRQIA
A3EPC8_9BACT/42-222...............L-RPYP......................ID.VS..GFL.IRNVRLPE...VIRVA...IERKLTE
Q67MY2_SYMTH/40-231...............L-ASYG......................IT.VH..DVR.LKRTDLPP...QNLES...VFNRMKS
A5FZF5_ACICJ/44-216...............S-QDWG......................IG.GI..AVE.IRDVRIPA...ELNDA...MSRNAQA
A0ZCT5_NODSP/20-192...............T-ENWG......................VE.MI..RLD.IQSITPPE...SVRKS...MEEERAA
Q2JMY3_SYNJB/34-233...............M-PTVNRDGQ..............TLPLVQ.VE..GLF.LGNPNFPQ...ALRDS...IERKQVA
Q1PZW6_9BACT/41-239...............L-EPHG......................FF.LT..SIN.LTDYRYYR...EYAEK...IQERRLA
Q0SNV9_BORAP/33-247...............I-DNYN......................LG.IDVVQVQ.IRNALPPK..GKVYEA...FEDVNIA
Q7PAR4_RICSI/68-263...............L-DSYNA....................GVM.IE..KVQ.LLKAEPPA...EVIDA...YRDVQTS
A8FZG0_SHESH/35-214...............M-EGFP......................VV.VD..NIQ.IENIILPQ...KYINS...IEIKQTE

PF11978

MVP_MOUSE/519-647---------------F-PQNG----------------------LV-VS--SVD-VQSVEPVD------------------
Q38C44_TRYB2/534-652---------------F-PVNG----------------------LV-IT--NVD-VRSVEPVE------------------
Q4D3P0_TRYCC/529-647---------------F-PVNG----------------------LL-IT--NVD-VQSVEPVE------------------
Q4QCJ5_LEIMA/614-738---------------F-TANG----------------------LY-IT--TVD-VQSVEPVN------------------
MVP_STRPU/521-639---------------F-PQNS----------------------LV-IT--SID-IQSVEPVD------------------
MVP_DANRE/533-651---------------F-GQNG----------------------LV-IS--SVD-IQSVEPVD------------------
MVP_DISOM/519-637---------------F-PQNS----------------------LC-VT--SVD-VHSVEPVD------------------
MVP_CHICK/520-636---------------F-VPNG----------------------LV-VT--SVD-IQSVEPVD------------------
MVPA_DICDI/504-621---------------F-NSNN----------------------LV-IT--NID-IQSVEPVD------------------
MVPB_DICDI/520-633---------------F-ETNG----------------------LV-IT--NID-VQSVEPVD------------------
MVP_TRYCC/511-626---------------F-SANN----------------------LV-VT--NID-IQSVEPTD------------------
MVP_LEIIN/511-626---------------F-TAND----------------------FV-VT--NID-VQSSEPTD------------------
A7RH80_NEMVE/598-715---------------F-DDNR----------------------LV-VT--NID-IQSIEPVD------------------
A1ZGE7_9BACT/529-640---------------F-EENN----------------------VH-IY--DLE-VLDIRLSD------------------
A6FXE2_9DELT/535-646---------------F-EENG----------------------MR-IY--DVE-VLGVEIGD------------------
A4HP51_LEIBR/553-671---------------F-PANH----------------------LV-VT--SVD-TQEMEVLD------------------
Q4DYQ9_TRYCC/535-653---------------F-EANN----------------------FV-VT--SVD-TQRMEVLD------------------
Q38AX5_TRYB2/537-655---------------F-DANN----------------------FV-VT--SVD-THTMEVLD------------------
A0CI16_PARTE/525-641---------------F-EANN----------------------LV-IT--SVD-IQGQEITD------------------
A0EGV2_PARTE/516-633---------------M-VKNN----------------------LV-IT--NVD-IKTVEPVD------------------

PF13421

A1B688_PARDP/26-236GI-----------------------------------
A3V3G3_9RHOB/26-236GI-----------------------------------
A4CIK3_ROBBH/30-240DK-----------------------------------
A4WUR1_RHOS5/26-236GI-----------------------------------
A5G3T6_GEOUR/26-236GI-----------------------------------
A6C8B2_9PLAN/27-238GV-----------------------------------
A6DY99_9RHOB/26-236GI-----------------------------------
B3E867_GEOLS/26-236RA-----------------------------------
B6B0M0_9RHOB/26-236GV-----------------------------------
B8FFG4_DESAA/26-236RA-----------------------------------
B9M753_GEOSF/26-236GI-----------------------------------
D5UR64_TSUPD/26-236GV-----------------------------------
C2G525_9SPHI/26-236GI-----------------------------------
C5JBH5_9BACT/26-236NI-----------------------------------
C7D9P0_9RHOB/26-236GI-----------------------------------
C9KTK6_9BACE/35-258NR-----------------------------------
C9L2Z9_9BACE/38-254AA-----------------------------------
D1N0K4_9BACT/26-236GA-----------------------------------
E8RWI6_MICSL/26-236GA-----------------------------------
D3IJU6_9BACT/26-237GV-----------------------------------
Q0FM78_9RHOB/26-236GV-----------------------------------
Q26GM4_FLABB/30-240DK-----------------------------------
Q47L21_THEFY/21-231GI-----------------------------------
Q7UUL6_RHOBA/56-267GV-----------------------------------

PF01145

A5DBX9_PICGU/79-250KRIG......................EGKIINAKAEV
Q54X13_DICDI/30-222DLKN......................KEIIITAKAHK
Q8NL82_CORGL/38-205KIQA......................ETDLERARNEV
Q9RQU5_CLODI/24-196ERER......................REAILQAEGNK
Q3YQY0_EHRCJ/26-202DREK......................EAKEIRAEGEE
Q01QT0_SOLUE/4-251HNQV......................SSDISLAQASA
A6DJY3_9BACT/29-214EREVE....................SQKYLIKGETEA
Q7BTU1_YERPE/7-194NQKTLQ...................RQQEVEQRKAEA
FLOT1_ARATH/3-185EAAN......................QARIDVSEAKM
Q87KY0_VIBPA/44-297VADRIRA.................IQEQETSKAQAET
Q7WQ89_BORBR/28-208QVQIET...................TRQQKETAMITA
A6EM35_9BACT/36-219HAIN......................AARKSVAEKTR
A1RSJ3_PYRIL/47-245QQDAIR...................AQFERQRVEELA
A7JFZ5_FRANO/22-195QRQL......................EATKAKAEAEK
Q28CP1_XENTR/61-241VPCGGIDQ...............LLMQFLALTRQSSG
A9AV86_HERA2/27-198QRET......................AAALEQARGEQ
A9AH04_BURM1/23-201ALHD......................QAAQVRADGAA
Q8D667_VIBVU/25-231ERRQ......................IAERFLSEGNG
Q9XAJ5_STRCO/27-227RAKQEAD.................IAEAVARRAAEQA
A5UQB3_ROSS1/147-329AKEAYT..................YEYQLALRKEQDE
Q8PBR9_XANCP/66-240QQVR......................ERLINEAQAYA
A6DTT2_9BACT/42-238VSQA......................SNEAARLQSEA
A1VS28_POLNA/25-221QNELKT...................KEVEVQTAKKEA
A6V731_PSEA7/10-287LAELA.....................VARQNRLKEEE
D1N1N5_9BACT/30-214ERQS......................VAADFLAEGER
A7GXM3_CAMC5/29-235IEVANNKKLAQ.........IAEIEAKQATEVKQQEA
A6GGG7_9DELT/52-236RLGG......................EAEIYEAQTRA
Q1HR13_AEDAE/28-207QQEAEK...................ARFMVEKAEQMK
A1RAB0_ARTAT/20-208QLQAEADR...............AVYERRAVAVERER
Q47MY9_THEFY/102-281AKEMVA...................YEQEWELIRKRR
Q8F4L3_LEPIN/16-199KVRA......................LADLENARTQV
Q72UG5_LEPIC/48-230QQELEQ...................QKYELEIAEKNI
Q65J46_BACLD/36-220SQELER...................TQTELKIAEAEA
Q76Z22_9CAUD/26-209EEAE......................KSQLRIATTAA
A1KN88_MYCBP/55-245TSIA......................LEAQRTAEAQA
A4NZC0_HAEIF/24-210NVAIQT...................EERNLIIQQKKA
A6DTT0_9BACT/309-521VEFS......................KLTLDKAGTYA
A1RZ05_THEPD/30-234GYVLQ....................MDTAKEVARELG
Q82CW6_STRAW/178-350..........................IAALDAQHRDT
A6G7G5_9DELT/54-276EQLKLE...................YIHRIAREEQEA
A3ZSS7_9PLAN/140-314KKAAE.....................ANLIFRREETA
A9B3W6_HERA2/115-349DLEI......................QTANRLSEQEI
Q8ETQ3_OCEIH/33-230QIRK......................HAEIAEATNRR
Q2JUY0_SYNJA/34-221ENQLAQ...................KQFEIEQARQDA
A5CSU8_CLAM3/32-222RARQ......................VAEVAEAENKR
A3CLK3_STRSV/29-214TIKKDAL.................IAKAKAERERKEV
A7VQ64_9CLOT/74-274EAVI......................AARQKIVEGAV
Q8V6S4_9VIRU/31-228QQRELK...................AEAEVEVAKQEA
Q3AHV3_SYNSC/32-214QQQLLR...................AKTEVQIAEQEA
Q119N4_TRIEI/61-249MVRR......................DAEIAESNAQA
Q1BPT6_BURCA/42-247GM........................AGDLARATQYQ
Q8YY85_NOSS1/318-534EEERK....................TYEVQQMAQTQR
A7B9F0_9ACTO/13-202QLQA......................EADRALYERRA
A7A735_BIFAD/49-245EIDKQK...................AMNEQEVAKTEA
Q2RZL8_SALRD/80-256LKEID....................AMKEKRQVRLES
Q54K65_DICDI/28-191..........................KVEAANLRDIK
Q3IR56_NATPD/37-229QQEA......................DAERTRAQGDA
A7BKU8_9GAMM/106-302QQGTT....................ARFSLLTMQNEV
A6DTT1_9BACT/27-205ERIK......................EASIIRSEAES
Y1021_SYNY3/86-292RTETIQRSIQQK.......REVELTTRVAIEQGELEA
Q6WHG5_BPKV4/25-219RQQE......................DTVKAQRKLDL
Q114A2_TRIEI/361-607EAREA.....................QAKAAPERLLE
Q67KD6_SYMTH/26-206RIKR......................AAEIAAAEALR
ERLN1_PONAB/24-211LLIAAQ..................KQKVVEKEAETER
A3X541_9RHOB/26-218LAELV....................ADQRKERVRIET
Q6U9K4_9CAUD/33-217EEAVNQ...................AQADLDKAEKVA
A9B5U5_HERA2/35-232QQAAER...................QKYELEQAQIKA
Q2SE90_HAHCH/5-203QMMKDADEA............AYTRRNAAIEQERKIK
Q9ZMI7_HELPJ/62-262RQESER...................VKYEVERSKQEA
A6DJY2_9BACT/306-539VFES......................DAKIFKAQTKA
A7N4W8_VIBHB/30-242QKNTETNAIR...........QDERTTIKKKNVEAEA
Q22WG5_TETTS/26-207..........................KQSISKAQAQK
Q7UMK7_RHOBA/174-391DELKLT...................RDEETKTARIEA
Q878M8_STRPQ/39-222QKQVDS...................AKQDKEKAKIEA
D1N1N6_9BACT/53-297NNTQSSLYSKAQEYQVQTANDALARQAEILAAAETYR
A4HYE6_LEIIN/5-177QRLR......................VASVDAAETEK
A0XWY7_9GAMM/53-213QQLLAE...................KETQKEIARKDA
A5V005_ROSS1/55-242EVKI......................ETEERRRQQIE
HFLC_BUCBP/21-239EYRA......................IAKHYRLMGDK
B9LBU8_CHLSY/36-219RLRQ......................VTSAILQDGAN
A6V538_PSEA7/332-551QITA......................RALIARERGQA
Q8PPV1_XANAC/20-207QQRVK....................TLVEATTAERQR
Q11VD7_CYTH3/21-198NN........................LKAAAENEGQA
Q1IQW9_KORVE/72-276EQQNDQLSVQ..........TEMQQKQVRISELEAEA
Q3M8Q8_ANAVT/9-189EQRAQR...................AVYVAREAEQEA
Q090V7_STIAD/69-267ELSAEKMRYTL........ELKSKQVQESELNAEAEK
D1N1N4_9BACT/326-563MEER......................ETMIWKAKAYA
Q1PZW5_9BACT/32-225EL........................DYVLNQSKALA
A6DJY4_9BACT/65-290ITSA......................NKAVSKAQEEK
Q1D2G7_MYXXD/109-312AKER......................FVHREETEAER
Q54F95_DICDI/43-215EFIK......................DSRLLLAQSEL
A4FVJ0_DANRE/138-311RRQA......................QVKVIAAEGEK
A1AN40_PELPD/42-249RVIG......................NMQEYTSYETA
Q233H7_TETTS/39-215EARL......................KAEAIRVETNN
A1ZL05_9BACT/23-202EQDAMR...................MQFVLQREQQEA
A7UY12_BACUN/32-219VQNALKV.................ENEKKAAIAEAEK
Q043D7_LACGA/23-194DREK......................TAAIARAEGEA
A5TW95_FUSNP/28-213EQEVEKA.................KAEQEKLKVEAEN
A7BTW2_9GAMM/55-247VRKA......................KSDKELAQEAA
A1TM35_ACIAC/23-205ERKR......................VANELRSTGAA
A8LGX8_FRASN/173-419EREHAR..................IHRHELENARIKA
Q1MDA7_RHIL3/28-223LTRITEG................RKKERNEIVRDTEV
Q48BK3_PSE14/61-251ERETI....................ATERTAVGMREA
A4YEZ5_METS5/41-236L.........................EVEMAVRMGLA
Q9A5B4_CAUCR/49-247EQEALA...................AKALEAKETALA
Q87TY4_PSESM/47-268SQQA......................DQAVANARTEA
Q0RL11_FRAAA/10-261FARITE...................AQARVAEAKAEA
A4YLJ4_BRASO/276-496REQ.......................VETFQEQEKAA
A3JKR6_9ALTE/29-215AEDFKR...................AIFLEQTGEAEA
A3RPR4_RALSL/36-235IQDAIR...................TENEVRSAQAEA
Q7UMK6_RHOBA/205-421TQQAQQY.................VKEIEQQTSEQQL
A3EPC8_9BACT/42-222EQNYQR...................MEYVLDVARKEA
Q67MY2_SYMTH/40-231ERSKIAQDYL...........SQGDEQAAIIRARTDK
A5FZF5_ACICJ/44-216EKEK......................QARVTLASSEV
A0ZCT5_NODSP/20-192EIKK......................RALAFEAEGER
Q2JMY3_SYNJB/34-233SITA......................QTAAVRAQIQE
Q1PZW6_9BACT/41-239DKEVEEQ.................KTRAKAAMENQRR
Q0SNV9_BORAP/33-247IQDKNKYINEGRKEFNQIVPKIKGEALKVIEEARGYK
Q7PAR4_RICSI/68-263KADK......................EKEINQAQAYN
A8FZG0_SHESH/35-214KNLAAA...................EEHKLERQRLEA

PF11978

MVP_MOUSE/519-647-------------------------------------
Q38C44_TRYB2/534-652-------------------------------------
Q4D3P0_TRYCC/529-647-------------------------------------
Q4QCJ5_LEIMA/614-738-------------------------------------
MVP_STRPU/521-639-------------------------------------
MVP_DANRE/533-651-------------------------------------
MVP_DISOM/519-637-------------------------------------
MVP_CHICK/520-636-------------------------------------
MVPA_DICDI/504-621-------------------------------------
MVPB_DICDI/520-633-------------------------------------
MVP_TRYCC/511-626-------------------------------------
MVP_LEIIN/511-626-------------------------------------
A7RH80_NEMVE/598-715-------------------------------------
A1ZGE7_9BACT/529-640-------------------------------------
A6FXE2_9DELT/535-646-------------------------------------
A4HP51_LEIBR/553-671-------------------------------------
Q4DYQ9_TRYCC/535-653-------------------------------------
Q38AX5_TRYB2/537-655-------------------------------------
A0CI16_PARTE/525-641-------------------------------------
A0EGV2_PARTE/516-633-------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window