Sequence alignment for CL0435

PF03666

Q5KFU1_CRYNJ/229-746------------------------------------------------------------------GWPLEVLADMLTPP
S8E9R2_FOMPI/133-565------------------------------------------------------------------GYSAEYLAGLLCPQ
C5FU53_ARTOC/155-599------------------------------------------------------------------GLKYDVWEKLLSPS
L8FQS0_PSED2/112-539------------------------------------------------------------------AFHTKDLASILTPA
H2AZX0_KAZAF/181-685------------------------------------------------------------------GFDSEFVAEFCCPD
R9P8J9_PSEHS/205-717------------------------------------------------------------------GYDIDILASILNPR
F8PYL6_SERL3/132-564------------------------------------------------------------------GYSSEFLASMLCPQ
N1J4X2_BLUG1/150-556------------------------------------------------------------------EFSTTDLESILTPS
E9EL47_METRA/99-518------------------------------------------------------------------GFPTRDLASILTPA
M9MFA0_PSEA3/199-702------------------------------------------------------------------GYDIEILASILNPR
NPR3_CANGA/243-797------------------------------------------------------------------EFDIDFLAELCCPS
H6BW23_EXODN/130-559------------------------------------------------------------------GLGEDGLANLLAPG
G8BZL7_TETPH/286-791------------------------------------------------------------------GFDSEFIAEVCSPD
G0WEJ7_NAUDC/230-810------------------------------------------------------------------GFDSDFVAEFCSPE
R8BC65_TOGMI/105-536------------------------------------------------------------------GFPTKDLESILTPG
V5ETE4_PSEBG/203-712------------------------------------------------------------------GYDIELLASILNPR
G8JWB1_ERECY/316-852------------------------------------------------------------------NFNSEFVAEICCPP
C4QYA8_PICPG/201-611------------------------------------------------------------------GFDINFLSEIVTPP
G8BGC4_CANPC/198-622------------------------------------------------------------------GMDPSYLCEMLAPP
G0VDK5_NAUCC/193-728------------------------------------------------------------------GFDSDFVAEFCSPE
S2K004_MUCC1/105-579------------------------------------------------------------------NIDVSFLADALAPK
NPR3_EMENI/170-616------------------------------------------------------------------GLPVDVWEKLLSPS
E7KD88_YEASA/399-966------------------------------------------------------------------EFDNDFVAEFCSPE
B8N792_ASPFN/172-617------------------------------------------------------------------GLQADVWEKLLSPS
U1GT46_ENDPU/116-550------------------------------------------------------------------GLDASALERLLMPS
D8PLZ6_SCHCM/127-556------------------------------------------------------------------GYNAEFLTNLLCPH
I2G095_USTH4/203-726------------------------------------------------------------------GYDIEILASILNPR
S6E8H4_ZYGB2/281-781------------------------------------------------------------------GFDPEFVAEFCSPE
NPR3_PHANO/150-598------------------------------------------------------------------GFKTDALEKMLSPG
U7Q027_SPOS1/110-529------------------------------------------------------------------GLPTKALEGILTPP
A0A0C4E2D4_MAGP6/120-591------------------------------------------------------------------GFPTKDLESILTPG
S8B047_PENO1/186-645------------------------------------------------------------------GLPGSVWEKLLSPS
C5DHQ6_LACTC/241-731------------------------------------------------------------------RFDKDFFAEISSPP
E9D3F7_COCPS/142-585------------------------------------------------------------------GLGTDVWEKLLCPS
U4LL48_PYROM/132-582------------------------------------------------------------------GFKTEFLADMLAPK
K2SR44_MACPH/175-626------------------------------------------------------------------GFKSEGLEKLLCPG
S8BNA5_DACHA/141-592------------------------------------------------------------------GFRHDVISGLLNVP
D6RLY8_COPC7/119-572------------------------------------------------------------------GYSGEFLASLLCPQ
U5HEM2_USTV1/112-634------------------------------------------------------------------GFPSTVLASLLSPS
G4MPF6_MAGO7/119-567------------------------------------------------------------------GFPTKDLESILTPS
A0A0D1CR33_USTMA/205-718------------------------------------------------------------------GYDIDILASILNPR
B6H909_PENRW/169-617------------------------------------------------------------------GVPGSVWEKLLSPS
NPR3_ASPFU/179-636------------------------------------------------------------------GLPADVWEKLLSPS
C5DQJ7_ZYGRC/281-783------------------------------------------------------------------GLDAEFVAEFCSPE
C4JQY3_UNCRE/143-587------------------------------------------------------------------GLATNTWEKLLCPS
E7A1P0_SPORE/203-720------------------------------------------------------------------GYDIEILASILNPR
G8ZWI0_TORDC/270-767------------------------------------------------------------------DFDPEFVAEFCSPE
C1GWB7_PARBA/152-590------------------------------------------------------------------GLPTSVWEKLLSPS
B2ALS2_PODAN/100-533------------------------------------------------------------------GYPTKDLENLLTPN
G0RDM3_HYPJQ/95-508------------------------------------------------------------------GFPARDLAYILTPA
B6QRZ0_TALMQ/155-594------------------------------------------------------------------GLPSEVWEKLLSPS
J8Q1I2_SACAR/396-963------------------------------------------------------------------EFDHDFVAEFCSPE
J7RBT2_KAZNA/205-696------------------------------------------------------------------GFDSEFVAEFCCPD
M1VZL7_CLAP2/99-560------------------------------------------------------------------GFPTRDLASILTPA
F4P7C7_BATDJ/218-654------------------------------------------------------------------GLDCEFLSDILSPK
NPR3_KLULA/205-723------------------------------------------------------------------NFNTEFVAELCSPR
A7TP53_VANPO/308-811------------------------------------------------------------------DFDAEFVAEFCSPE
NPR3_ASHGO/273-791------------------------------------------------------------------NFDAEFVAELCSPP
G2R1J8_THITE/107-555------------------------------------------------------------------GFPTKDLENILTPA
J5JA21_BEAB2/104-534------------------------------------------------------------------GFPTRDLASILTPA
V5FG66_BYSSN/161-604------------------------------------------------------------------GLTTDVWEKLLSPS
I2H4A8_TETBL/339-898------------------------------------------------------------------DFDSEFVAEFCSPE
G4U9V0_NEUT9/109-529------------------------------------------------------------------GFPTKDLENILTPA
A0A098D4P8_GIBZA/98-520------------------------------------------------------------------GFPARDLAGILTPA
R7YHW5_CONA1/139-554------------------------------------------------------------------GFNIESLEKLLSPP
W1QEY3_OGAPD/185-592------------------------------------------------------------------GFDVDFVSELVTPP
H1V255_COLHI/104-533------------------------------------------------------------------GFPTKDLASILTPG
T5A616_OPHSC/95-515------------------------------------------------------------------GFPTRDLAGILTPA
D5G9F0_TUBMM/127-587------------------------------------------------------------------GFKEEFLAGLLAPK
M7TWW8_EUTLA/45-472------------------------------------------------------------------GFPTKDLESLLTPA
G0SXZ9_RHOG2/78-582------------------------------------------------------------------GFPDPVLASLLTPS
C0NJI2_AJECG/153-591------------------------------------------------------------------GLPTNVWEKLLSPS
G1WZV0_ARTOA/142-590------------------------------------------------------------------GFRHNVLAGLLSVP
M7X5H8_RHOT1/78-583------------------------------------------------------------------GFPDPVLASLLTPS
NPR3_DEBHA/205-647------------------------------------------------------------------GFEADYLCEMLCPP
K0KSM9_WICCF/157-573------------------------------------------------------------------GFDAEFLGEFLSPP
S9VYA1_SCHCR/73-478------------------------------------------------------------------GYEKGFLANMLSPR
K1XTL5_MARBU/116-531------------------------------------------------------------------DFYTTDLESILTPS
G8YSZ2_PICSO/187-642------------------------------------------------------------------GYEPDYLSEMLCPP
V2XGE3_MONRO/83-522------------------------------------------------------------------GYSSEFLAGILCPH

PF06218

M3IIL9_CANMX/8-518IPIVAIFYSVFHPIEGTKIVHQFPENTISTGRKRK................DDTEEEDNEDNEDEGIFEFDTIRNYVIPK
M2UFV8_COCH5/4-472RAIKAIFYTRFHHEKGNRVLHQVPPGAIIPSTL..........................PSALTTPLFPFSSVTQYLIPT
Q6BQE8_DEBHA/7-469VPITAIFYAVFHPTEGTKVLNQVPEGSIGNSS...........................TSDSNGIIFNFDTIKNYIIPK
Q0U9Y5_PHANO/4-462RAIEAIFYTRFHHEKGSRVLHQVPPGSITPSPKPS........................KSDLAETLFPFSSVTSYLIPS
G3AQK3_SPAPN/8-551IPIVAVFYAVFHPTEGTKIIHQVPENSIVTTSHQRTKVVKNVSRLSMDSTNSDSRQRQEDEDEDDGLFNFDTVKNYVIPK
W6RQZ3_CAEEL/186-593..LLGILLAEFHNTLGAIIKHSVPK..................................ENNKVEATFHFT..KGLIIPK
A5DQL3_PICGU/6-475EPITAVFYSVFHPTEGTKIVHQVPDV.................................ISRDQPSLFDFDAVRNYVIPK
K1Y0B6_MARBU/2-405..IQGIFFARFLSEKGTKVVHQSPPGCIVAE............................PDVDKARLFDFEVLAEYIIPR

PF03666

Q5KFU1_CRYNJ/229-746.RSACNRRFELCV--GNVVFLGHPVCATPDG...KWEAPPDEDEL................EERAPSRGRRMRDQGGTMT
S8E9R2_FOMPI/133-565.DSMCHQKFELVV--DDLAFIGHPVCAEPDG...SWRFKPKV.......................INRGRGSRKGEAPKL
C5FU53_ARTOC/155-599.PAWHKRRFEVGV--NDLTFVGWPVFVRKDG...TWRKK...........................KKKKKEKEKEKGKT
L8FQS0_PSED2/112-539.RAFHKRCFELTL--DPLTFVTYPMHIREDG...RWKKK...........................KREK..........
H2AZX0_KAZAF/181-685.RELCNSRFEFTV--DDLCFLGLPIRRDASG...YWRKSKRKK.....................HTSKKSSSLSHAKVTR
R9P8J9_PSEHS/205-717.TALAHQKFELVV--DDLAFLGHPVAAHPER...GWDEEGNETLQSDRDS......QGETSTAQSQQRGRSGLRKEIRPF
F8PYL6_SERL3/132-564.RSLCHQKFELRI--DDLVFLGHPVGAESDG...SWRFKSEKL....................KSGSRGRGSRNRDATQQ
N1J4X2_BLUG1/150-556.RAYHKSRFEMIL--DPLCFLTYPVHIREDG...RWKKRMT.........................KKSQRTRRKV....
E9EL47_METRA/99-518.RSYHKKLFQLSL--DPVHCISYPIHVPENG...KWKRH...........................KKSN..........
M9MFA0_PSEA3/199-702.PELAHQKFELIV--DDLAFLGHPVAASKAG...TWGEPDNHDGHPGATDS.....DDAHAAAPSQRRGRSGLRKEIRPY
NPR3_CANGA/243-797.REMCNTRFELTV--DEYCFLGHPIHVDSSG...NWRKSRKRNNS.................LSKSKRSGSLTGSRKRSG
H6BW23_EXODN/130-559.RAWHKRKFELGI--NDFTFLGRPVYAREDG...LWRKP...........................KSKKSSRAEDDSVQ
G8BZL7_TETPH/286-791.REMCNTSFEFTV--DNLCFLGLPIHSDKDG...NWRTSKNKSN...................RKSAKTSST..HSKGSR
G0WEJ7_NAUDC/230-810.REMCNTRFEFTI--DELCFLGLPVHIDSDG...KWRKSRHSKRRQ...............GSVKSKKSSSGRSSSSNFK
R8BC65_TOGMI/105-536.RAYHKGLFQISL--DPLICVSYPIYAPENG...IWKKKSK........................KKKKK..........
V5ETE4_PSEBG/203-712.QELTHHKFELMI--DDLAFLGHPVSLDRSD...ILGGQDDEDADAE............GHDRSAGQRGRSGLRKEIRPY
G8JWB1_ERECY/316-852.KDMCNTRFEFTI--DESCFLGLPIHVDESG...RWRKRRNRKTP................LNTRSKRSESGGAVNTTDT
C4QYA8_PICPG/201-611.KKLCNTRFELTV--DEMVFLGLPIHPKSS....RYKKS...........................DRNSHSHHSHSHHS
G8BGC4_CANPC/198-622.AAMCNARFEMMI--EGKTFLGLPIHKSIDG...GWKTRAI.........................SNSKHATQGGTRSR
G0VDK5_NAUCC/193-728.REMCNNKFEFTV--DEFAFLGLPVHVDSNG...KWRRQRHKRHNAT.............TKSVKSKKSSSGGSLTSRQK
S2K004_MUCC1/105-579.SPLCDRKFQLSM--DDLTFVGHPVSLSSPQQQQQQQQQQQQQQQQQQQSMDAEDHDADFLTSPLSPNPTSQLNSPTTQS
NPR3_EMENI/170-616.RSWHKRRFELGI--NDLAFVGWPVFVREDG...NWRKQ...........................RRKKKKKQRAE...
E7KD88_YEASA/399-966.REMCNTRFEFTV--DNFCFLGLPIHVDSQG...RWRKSKHKNK...................TRSKRSSST..TTNISR
B8N792_ASPFN/172-617.RSWHKRRFEVGI--NDLAFVGWPVFVREDG...TWRKQ...........................RRKKKKTKPE....
U1GT46_ENDPU/116-550DRSWHKRKFEVGF--NDLVFVGWPIFIREDG...TWRKK...........................RRKERVNTVKAEDN
D8PLZ6_SCHCM/127-556.VSMCHQKFELIV--DELAFIGHPVCAYPDG...TWKFKPEVG....................KGLNRGRGSRNRQMSSA
I2G095_USTH4/203-726.PELAHQKFELIV--DDLAFLGHPVSAGKAG...TWGDPENNRDGNDKDAD....DDNDRSKAQTQQRGRSGLRKEVRPY
S6E8H4_ZYGB2/281-781.REMCNTRYEFTV--DTLCFLGLPIHVDQHG...NWRKSKRKKQ..................MTRSKRSSST..TTRISK
NPR3_PHANO/150-598.KEFNKRRFELGV--ESIVFVGAPMFVREDG...LWKKL...........................KRRKKKRSDKEKLD
U7Q027_SPOS1/110-529.RAFHKKRFQMSL--DSVTYISYPVHVPSNG...VWARR...........................RNAT..........
A0A0C4E2D4_MAGP6/120-591.RAYHKTLFQLSL--DPIYCVSYPIHVPESG...SWKKR...........................KKKK..KKNELK..
S8B047_PENO1/186-645.RSWHKKRFEVGI--NDLALIGWPVFVREDG...TWRKQ...........................RRKKKKKKSAPE..
C5DHQ6_LACTC/241-731.KEMCNTRFELTI--DELALVGLPIHRNADG...QWRKTKKRKS..................SSRSKRSNSSSRTRKVSR
E9D3F7_COCPS/142-585.SSWHKRRFEVGV--NDLTFVGWPVFVREDG...TWRKK...........................RKKKK..TRAGDSV
U4LL48_PYROM/132-582.AAAARGRFEMSV--DDIVYIGMPVHVRPDG...TWRRS...........................RKRKKKGDVEEDDD
K2SR44_MACPH/175-626.RGFNKRKFEVGM--EGLSFLGHPMFAKGNG...AWRKR...........................KKRANASQEDVRPN
S8BNA5_DACHA/141-592.RALSRTRFELSV--EQFVFLGYPCYNRPDG...TWQRR...........................RREKKPKPETPKTD
D6RLY8_COPC7/119-572.SNKCHQKFELIV--DDLAFLGHPVAANERG...EWEFRPEPT....................KGSVRGREGKEKKAKEG
U5HEM2_USTV1/112-634.RELCDQPFELVV--DHLAFVGHPVWLGDDEPSTGLNRGPAGGRAQHRGDLHGHGSDSDSEEDGGERRGRTRRRPPPPNQ
G4MPF6_MAGO7/119-567.KAYHKKLFQISL--DPIYCVSYPIHVPENG...IWKKK...........................KKKKDQEPK.....
A0A0D1CR33_USTMA/205-718.PELSHKKFELVI--DDLAFLGHPVTPNKNG...VWGDQDDESQDDRVEA......RDEKTAAHAQQRGRSGLRKEIRPY
B6H909_PENRW/169-617.RSWHKRRFEVGI--NDLALIGWPVFVREDG...SWRKQ...........................RRKKQKKPRAE...
NPR3_ASPFU/179-636.PAWHKRRFEVGI--NDLAFIGWPVFVREDG...TWRKQ...........................RRKKKKKRRAD...
C5DQJ7_ZYGRC/281-783.REMCNTRYEFTV--DTLCFLGLPVHVDQHG...NWRKSKRKKH..................TTRSKRSSST..TTRLSK
C4JQY3_UNCRE/143-587.SSWHKRRFEVGV--NDLAFVGWPVFVREDG...RWRKK...........................WKKKKKKTPAGYTV
E7A1P0_SPORE/203-720.PELAHQKFELVV--DDLAFLGHPVAATKGG...TWSDESDEGKDNDKDGH....GSNDKAAAQAQQRGRSGLRKEIRPY
G8ZWI0_TORDC/270-767.RELCNTRFEFTV--DEICFLGLPIRVDADG...QWRKSRRRKQ..................SNRSRRSNST..AGRNSK
C1GWB7_PARBA/152-590.PAWHKRKFEVGV--NDLVFVGWPVFVREDG...TWRKR...........................KRKKRTRKKE....
B2ALS2_PODAN/100-533.RAYHKRLFRVSL--DNIYCVSYPIYVPENG...MWQKK...........................KRKK..........
G0RDM3_HYPJQ/95-508.RPYHKKIFQLSL--DPLLCISYPIHVPENG...KWKKT...........................KKAN..........
B6QRZ0_TALMQ/155-594.RAWHKRRFEIGI--NDLAFVGWPVFVRDDG...HWRKKSR.........................RRKRKKTKSGGEGK
J8Q1I2_SACAR/396-963.REMCNTRFEFTV--DNFCFLGLPIHVDSQG...RWRKSKHKNK...................TRSKRSSST..TTNISR
J7RBT2_KAZNA/205-696.RELCNTKFEFTI--DQLAFLGLPIHCDSKG...KWRKSKHKR....................QFSRKLTNSTSHGNLSR
M1VZL7_CLAP2/99-560.RSYDKKLFQLSL--DPIHCISYPIHVPEDG...KWKRN...........................KKIH....KANKLN
F4P7C7_BATDJ/218-654.VALCDKQFHLTV--DNVDFVGHPTLLNADRPGTGLRFARM.........................VQKRKLIASATSYR
NPR3_KLULA/205-723.KEMCNTRFEFTV--DDLCFLGLPIHADHKG...RWKKSKKRK....................QASKRSARSSTARNSIS
A7TP53_VANPO/308-811.REMCNTNFEFTV--DNLSFLGFPIHIDADG...NWKKSKKKKS...................TRSKRSSSI..YTKDDR
NPR3_ASHGO/273-791.KEMCNTRFELTV--DDLCFLGLPIHVDESG...RWRKQKVKRQQ................TNTRSKRSSSGGKPDAGSR
G2R1J8_THITE/107-555.RAYHKRLFQVSL--DPVHCVSYPIYVPENG...VWRKK...........................KSKK..........
J5JA21_BEAB2/104-534.RPYHKKLFQLSL--DPLLCVSYPIHVPESG...KWKRV...........................KKSK..AG......
V5FG66_BYSSN/161-604.RTWHKRRFEVGI--NDLSFVGWPVFVRDDG...TWRKQ...........................KRKKKKPRAE....
I2H4A8_TETBL/339-898.REMCNTKFEFTI--DKFCFLGLPIHVDEEG...NWKKSKKKKH..................SSRSKRSSSI..GTKCSV
G4U9V0_NEUT9/109-529.RAYHKRLFQVSL--DSLYCVSYPIYVPENG...VWRKK...........................SKKQ..........
A0A098D4P8_GIBZA/98-520.RSYHKRLFQLSL--DPLYCVSYPIHVPENG...RWKKP...........................KKTS..RT......
R7YHW5_CONA1/139-554.RGFNKRRFEVGL--EGLVFLGAPMFVRADG...LWKKK...........................RRRHSERRDHQAAC
W1QEY3_OGAPD/185-592.KQLCNSRFEVSV--EDMAFLGLPIHVNEDG...NWRVSSHA......................KSRRKKTSRRKKVSSS
H1V255_COLHI/104-533.RAYHKKLFQLSL--DPLYCVSYPIHVPESG...TWKKK...........................KKKK..........
T5A616_OPHSC/95-515.RSYHKSLFQLSL--DPLLCISYPIHVPDNG...KWKRP...........................KRAD..........
D5G9F0_TUBMM/127-587.ERMCRAKFELSI--DDMVFLGYPLHVRPDG...TWRKQ...........................KKKRGRGRSGSGGG
M7TWW8_EUTLA/45-472.RSFHKKRFQVSL--DQLFFVSYPVFVPENG...IWRKT...........................KKKK..........
G0SXZ9_RHOG2/78-582.RELCDQPFELVV--DHLAFVGHPVWLGDDE...GPRERLDGAANEAGEQE....KRETETEDDEDERGRSRLSRKGSMA
C0NJI2_AJECG/153-591.PAWHKRRFEVGV--NDLVFVGWPVFVKDDG...TWRKR...........................KRKKKVRTQQ....
G1WZV0_ARTOA/142-590.RALAKSRFELSV--DHSVFLGYPCYSRIDG...TWQRK...........................KKERKIKSEGPKGE
M7X5H8_RHOT1/78-583.RELCDQPFELVV--DHLAFVGHPVWLGDDE...GPRERLDGAANETGEQE....KREADTEDDEDERGRSRLSRKGSMA
NPR3_DEBHA/205-647.KQMCNSRFEIMI--DDLVFLGLPIHSYDNG...SWKSKHS.........................HRPKSGKSSKGRSK
K0KSM9_WICCF/157-573.KRLCNSRFELTV--DDMAFLGLPIHKNDDG...LWRNHKS.........................KRDQKSKHSGNTSG
S9VYA1_SCHCR/73-478.PELCNQKFEMWV--DGLTFLGCPVHIGPSG...EWVKR...........................KNPPKNVEVSSLVD
K1XTL5_MARBU/116-531.RAYHKKRFELSL--DPLYFVSYPMHVYPNG...LWNKKL..........................KKSKKSKGVDTETK
G8YSZ2_PICSO/187-642.RQMCNSRFEIMI--DDLIFLGLPIHSFEDG...SWRQSDS.........................KRVASRISSKIKYK
V2XGE3_MONRO/83-522.ASMCHQKFELVV--DDLAFIGHPVCAEAGG...IWHFKQEKP....................KVSSRGRESHNRPTSRN

PF06218

M3IIL9_CANMX/8-518-PQLCNRLISLKI..DKYKVIGYPVNMENSY-------------------------------------------------
M2UFV8_COCH5/4-472-QQFCDRLLTFCV..NHHRVIGYPVCIREGK-------------------------------------------------
Q6BQE8_DEBHA/7-469-PKLCNKLISIKI..DRFKVLGYPVNIENEK-------------------------------------------------
Q0U9Y5_PHANO/4-462-QHFCDRLLTFVV..NHHRIIGYPVCIQGAK-------------------------------------------------
G3AQK3_SPAPN/8-551-PQLCNRLISFKI..NKYKVIGYPVNMENPR-------------------------------------------------
W6RQZ3_CAEEL/186-593-PSMFRNSFSLTIKSLRCKVLMFPVGIDHKS-------------------------------------------------
A5DQL3_PICGU/6-475-PQLCNKLVSFKI..GRYRVMGYPVNIENTD-------------------------------------------------
K1Y0B6_MARBU/2-405-QGFCNRFVTICCPENKYRILGHPVCIQDEK-------------------------------------------------

PF03666

Q5KFU1_CRYNJ/229-746NLDTVDEGIEAYTSAITKFASIESETKRSSQSNH..............................................
S8E9R2_FOMPI/133-565AETSLTPDRVERHKR.................................................................
C5FU53_ARTOC/155-599DRKKHGGNGSISGLGAAISAGEASMSVPLVSIPGDAHDDATNDDSDEL................................
L8FQS0_PSED2/112-539........................RSRRRKEEEERQENGSIADDTAISESPAERSGAEDE....................
H2AZX0_KAZAF/181-685SSSNRSESSKRTQSSNTAKAYPNSNSDVEQENNEESLD..........................................
R9P8J9_PSEHS/205-717DPPNGIDGSND........GTDISASTGAKSRHASRTRIEKPDD.A..................................
F8PYL6_SERL3/132-564DDGKSEISSIAEKG..................................................................
N1J4X2_BLUG1/150-556........................ASNRDIKNRQVVNNERGNEDNL..................................
E9EL47_METRA/99-518..................................KAKAPRLSEENLAPHETEPPTPSVVI....................
M9MFA0_PSEA3/199-702DVPDGQTPAKEPDADSAKKGKSEPKTSDTE...............A..................................
NPR3_CANGA/243-797SKSSNHDKSFSAETPNSPESSKIIEEVGSLHKSRTLSNPQN.......................................
H6BW23_EXODN/130-559Q.......................SSDTANGSDSDKDEEAPADDETHAVKDK............................
G8BZL7_TETPH/286-791RHSINSKESTSKTN.........................EDENIESSENHDDEDDK........................
G0WEJ7_NAUDC/230-810RSRKRSISLHRSKSRRSEDSDPEVADDEGIENNINQNNNNDIVDNGDDKTVED...........................
R8BC65_TOGMI/105-536........................SKTSRKGEEEVAPDIEPRDDAPAPTEEDHVEVRD......................
V5ETE4_PSEBG/203-712DVSDGGDASKDAACSLRQNGGKTEAAAPTKARNASQTRMEQTSD.S..................................
G8JWB1_ERECY/316-852SLGRAGSSGSKAHEELQQNEQQQQNIDSDLGEGLGIPVKSDQGGGGYEHEG.............................
C4QYA8_PICPG/201-611RATSLDEDEFEVKPLLDSLNDLHF........................................................
G8BGC4_CANPC/198-622SNSKPLDPKTKPSHNVPDGKIE..........................................................
G0VDK5_NAUCC/193-728R.RQKSTSLSNTNTI...........DEGYE.............TGDEKTDHMRAR........................
S2K004_MUCC1/105-579TPSTPSQQPLTSPASYNTSSNKRTLPNDDTNGDTSNDDDDDDENDDESA...............................
NPR3_EMENI/170-616........................WESGELGHNDATEDSQDDGNDAVAASTETLSPFSALHPI.................
E7KD88_YEASA/399-966KKSIASKISSLSENILKKVNSGEADTVY...........DSNIGHEASTDTQNLRI........................
B8N792_ASPFN/172-617........................WEGGELGHNEIPGDVRDDADEAIAASTETLSPHTMTASE.................
U1GT46_ENDPU/116-550RVDSSLEV................VHKGEYATEDELNHERHVDLENSPAT..............................
D8PLZ6_SCHCM/127-556TNDDADPSDAHPAEH.................................................................
I2G095_USTH4/203-726DLQDGEETSKDSTAPTSAKNDKAELQSSAKSRSISQSCMELTTDST..................................
S6E8H4_ZYGB2/281-781QR......SNVSQ...PEGSNNGTGLARIEGSPTRDHDEDSQSGDDHNSDN.............................
NPR3_PHANO/150-598DADFVKNLTISEEDEEADTVDEIPVKSKP................EPFVYPEGFEPGYGHGSIS................
U7Q027_SPOS1/110-529..................................DKNNSKAKDKAASTRGASTGRAGE......................
A0A0C4E2D4_MAGP6/120-591........................KKASVFSSGSLFSTIRDPDAHHDSDAARQLGESVRLAAKAGSDTVGLSPLAGDGSS
S8B047_PENO1/186-645........................WDGGELGHNENSEDGQGEDDLTATPDMGGSVATITELSLTAS..............
C5DHQ6_LACTC/241-731SHYEGTDVTG.............................DSEILEEQLSGSQLF..........................
E9D3F7_COCPS/142-585LDTAPTLGSEKGGYADG.......GEKLESERDPNVDGRSDNDEEPSRSLIES...........................
U4LL48_PYROM/132-582P.......................DEDGDEGENEGYAPEQEEEGQEGEEVEKGVEDLSIEDTGKVPE.............
K2SR44_MACPH/175-626NGHQDADGPY..............ESGAPADTEDEGVNVTGPEDGMPIDLPPGFEPGYGHG...................
S8BNA5_DACHA/141-592ETKDQE..................DDTADAVNDEGDITGNDADDEDPDALTLSRSKSPNP....................
D6RLY8_COPC7/119-572EGSGKSKSPNPASALAPENGKEGVASSTTTTTAAV.............................................
U5HEM2_USTV1/112-634GPFANLSGDFSRSSSEELGSGSGSLASNPATPPARPTPMMRNSSSTSTVHPLSS..........................
G4MPF6_MAGO7/119-567........................RKGSIISAGGIMVSATDEDGNELPPLNPDHIRPVIDTTRLSP..............
A0A0D1CR33_USTMA/205-718DPSDDRVASND........KIDKSAKTGAKSRNASLTRIEQTND.I..................................
B6H909_PENRW/169-617........................WDGGELGHNDSAEEGKKDEQLVTSPDLGASVASIAESLTS................
NPR3_ASPFU/179-636........................WEGGELGHNENAEDAPDDEDGDAGGNASGGGGLMAASTETLSPKQ...........
C5DQJ7_ZYGRC/281-783QR......SSLSQNGDGESGENDMDSSQLRSSSHNLQDDNGEINEDNDECE.............................
C4JQY3_UNCRE/143-587LDEA.SLGADYDGHTND.......GEDYEAEHSHNMPDQPDNDDEPSRSSMET...........................
E7A1P0_SPORE/203-720DLPDGSDNLDKAPAASDKQAANKDTTPSAKSRNVSQTRMEPTHDAL..................................
G8ZWI0_TORDC/270-767RG......SSVKNSEFNETN....DTADIESSVLNL...DESTGYDESEV..............................
C1GWB7_PARBA/152-590........................ASTEQDLRDGDERRYEKRDDGSSIQALQTDGKNDPI....................
B2ALS2_PODAN/100-533.........................KQEQEQHQAESGPGAKEDDALPTETDTGFKSGDRVA...................
G0RDM3_HYPJQ/95-508.......................................KEVDDNIAPDEPNPPPTSKT.....................
B6QRZ0_TALMQ/155-594QHGSGEAKIGQDDDDANLNSDNDVPDSTQSSRDEDNADKTDIEDNADS................................
J8Q1I2_SACAR/396-963KKSIASKISSLSENTLKKVNSGEAETDY...........DNNTGDENCTDTPNLKV........................
J7RBT2_KAZNA/205-696KGHSVGSRRSKNENDLERRMTRVDTLEPDDEMISSHIG..........................................
M1VZL7_CLAP2/99-560RANKTNKTSKANKAGKNSRTNKANKTSKTSKASKASKSSRHTADYQLAPHEAETPMPSIF....................
F4P7C7_BATDJ/218-654QSLGEIDSSSTFTAAVSDPSSSCVSEDKPSANAFSSKLPSPVDHH...................................
NPR3_KLULA/205-723RNSVGRNSIGRNRSKTESQGHINDVEEPADDENSDYEPSKSEMLNEMYCVP.............................
A7TP53_VANPO/308-811........KSITQSPMINNNN.........SSDVEEEDDDYKYKETEMSSRKSI..........................
NPR3_ASHGO/273-791TSVGLPHGTQERQPSTDQSGSGAPYLAQSSSESGQLRDPEQSDDV...................................
G2R1J8_THITE/107-555................PRNQPPQSQQHREPGVGPGTGAAKKDDDDALPTDAGASARSGGEKGAS................
J5JA21_BEAB2/104-534....................................RASSAVDDDAQVAWRAPLIAVSAPCAPSA...............
V5FG66_BYSSN/161-604........................WEGGDLGHEDQLDKSQPEEGDTAAESNAPAGSKSSTFT..................
I2H4A8_TETBL/339-898NNHSTTANTNTDITRRRENSDLTPFISDTTEKDLVTKLNDTISVESYD................................
G4U9V0_NEUT9/109-529....................................QKHRDHDDTAPTDTDGPARTSDK.....................
A0A098D4P8_GIBZA/98-520...................................EKRSTYNDEQLAPHEAGPATTGKATE...................
R7YHW5_CONA1/139-554DQDEAAQATDGR............PQTDGPSDEDEGVNMRGGEEP...................................
W1QEY3_OGAPD/185-592SESSGEDDESDHGEK.................................................................
H1V255_COLHI/104-533.............................KGKTERAKSVRTEESAVLVDFDPNEDNEDTPNG..................
T5A616_OPHSC/95-515..............................KARTSSAASKQPDDHVYPHETEVPPPTP......................
D5G9F0_TUBMM/127-587DDDGNVGVEGNPDVGGIIIGNGGHEDDADDEKDDEDGESSQGGNF...................................
M7TWW8_EUTLA/45-472........................QPQSQPSRPPENGDAVNRSDHSPAPQPDTLQTEVK.....................
G0SXZ9_RHOG2/78-582EGAA.EDDDDARRADRDQTVGPPASREASLPPHARALLIPERDDSPSPRRPDALAHTHSSA...................
C0NJI2_AJECG/153-591........................GENGEPGVEDKERGDLRNNDMSSKQASETEGDNCPV....................
G1WZV0_ARTOA/142-590EEK..E..................VHTSDVDNDDEDTKGNDADDEDPDAVALSRSKSPN.....................
M7X5H8_RHOT1/78-583EGAAEEEDDDARRVDRDQTVGPPASREASLPPHARALLIPERDDSPSPRRPGALAHSHSSA...................
NPR3_DEBHA/205-647NAADNASIDEGIDYETTS..............................................................
K0KSM9_WICCF/157-573NNTRSGSTKGESETEDATSGPEVENIQDEKSNFSKTEN..........................................
S9VYA1_SCHCR/73-478PFGIKEDSTSAASANLSELKIN..........................................................
K1XTL5_MARBU/116-531ASSK....................TRSVQSDGKDRSTSATSAENAS..................................
G8YSZ2_PICSO/187-642SQEDDKSKKSSNENNAQDNPP...........................................................
V2XGE3_MONRO/83-522DSAPRNDSSPSRSPSNEKSVAV..........................................................

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

Q5KFU1_CRYNJ/229-746.............................KDDDVPNLTMFHLVLIIDKPDPKPGTESHDEHHSQTM.GIYDEIYREIAFK
S8E9R2_FOMPI/133-565.............................PLPDPSWLQTFHLVLVLDRPDPS.......SSTSGTIWKYFDTIYEQIAFT
C5FU53_ARTOC/155-599.........................SEEEQLTIKDGMTMFNVVFVLN.PPTL.......EYNVR.....IREMYENVVKK
L8FQS0_PSED2/112-539..............ARNVRKPKGTSFASDDTND.GGMTMFNLVFIMN.PKTT.......EAPMR.....VSDMFEHVAKD
H2AZX0_KAZAF/181-685.............................KDDLERNMNMFHICFVLN.PPLT.......EYNKR.....ADDLYQYIVAR
R9P8J9_PSEHS/205-717............................PSSRAKAPLTQFHLVLVLDRPDPSTAL.PTMDLSSW.....LQLFYDNIVFK
F8PYL6_SERL3/132-564.............................PPAQSLWLQMFHFVIVLDLPDPS.......SSASGNVAKYFDVIYEQIAFT
N1J4X2_BLUG1/150-556............................SEDSDDGGMTMFNAVFILD.VSKY.......DLKEK.....ASEMYEHVVKT
E9EL47_METRA/99-518..............SSEPARDKDGKKDDVDEEKRSSMTMFNLVFILN.PKKS.......EDKEL.....VDALYHNVVKK
M9MFA0_PSEA3/199-702............................PASKAAAPLTQFHLVLVLDRPDPSTAM.SGMDLSSW.....LQLFYDNIVFK
NPR3_CANGA/243-797..............................DHFTKDMTMFHVCFIMD.PNLI.......EYNKR.....VDDMYQYVVAR
H6BW23_EXODN/130-559.....................AETKEHRTVEPPKSQLTMFHAVFVMD.PPPL.......EHTLR.....VKDMYDHVARK
G8BZL7_TETPH/286-791.................SYMNPIAMHDLNSPDYEKNMNMFHVCFVMN.PPIS.......EYNQR.....VDDMYHYIVMR
G0WEJ7_NAUDC/230-810....................SVEQVGECDKNNFDKNMNMFHVCFIMN.PPLT.......EYNKK.....TDDMYQYVVAK
R8BC65_TOGMI/105-536...............MAAPPPSKVPAAEEAEDKVSSMTMFNLVFILN.PQKH.......EAKEM.....VELMYSNIVRK
V5ETE4_PSEBG/203-712............................SVSRSYAPLTQFHLVLVLDRPDPSTAM.HGMDISSW.....LQLFYDNIIFK
G8JWB1_ERECY/316-852.......................KTQRDDNEEMQKAVNMFHVCFIMN.PQLV.......EYNER.....VDDMYHYVVTR
C4QYA8_PICPG/201-611.............................IESEKCPMHMFNLVFVMN.PPVV.......EYNHR.....VDEMFHYVISR
G8BGC4_CANPC/198-622.............................IEDSKSNLNMFHLVFVMN.PPTM.......ENNYR.....IDEMFHHVISK
G0VDK5_NAUCC/193-728..................MSDVEQSEMDDINDLDKNMNMFHVCFIMD.PPLT.......EYNKR.....VDDMYQYIVAK
S2K004_MUCC1/105-579.........................SDTFPSSTSIHMTLFHVVFVMT.PPDL.......ELNAQ.....VETIYKNVILR
NPR3_EMENI/170-616..........SQRPSVPNSRSSQMSSEPLDADDKDMMTMFNVVFVLD.PPLL.......EYSMR.....VREIYDNVIKK
E7KD88_YEASA/399-966.................NTDVSGNEFEREKEDLGKNMNMFHVCFVMN.PHLI.......EYNKR.....IDDMYQFVVTR
B8N792_ASPFN/172-617..........SQRASMGSIRSSRTLSEMLDGDDKDSMTMFNVVFVLD.PPLL.......EYSMR.....IREIYDNIIKK
U1GT46_ENDPU/116-550........................NPASSQADESREMTIFNVVFVLN.PPIL.......EYSLR.....VNEMYDHVVKK
D8PLZ6_SCHCM/127-556.............................LGTKSAWLQSFHVVLVLDLPDPS.......SSNSGNVWKYFDIIYERIAFN
I2G095_USTH4/203-726............................TSSKSHAPLSSFHLVLVLDRPDPSAAM.SGMDLSSW.....LQLFYDNIVFK
S6E8H4_ZYGB2/281-781.......................QIPELSKEDLEKNMNMFHVCFVMN.PLLV.......EYNQR.....IDDMFHYAVAR
NPR3_PHANO/150-598..........SGPSGAPSEAGSDARSNSTSQDNNPDMNMFNVVFVLN.PPAL.......EYQQR.....VKEMYDNVTRK
U7Q027_SPOS1/110-529...............TSAGGAASATQGKDKEEKVSSMTMFTLVFIMS.PKRH.......EANEL.....LDTMYTHVVRE
A0A0C4E2D4_MAGP6/120-591RQDEADGCGQEPRQDEEEENDKGKDQEKDKNDKVSSMTMLNLVFFLN.PKKH.......EVKEL.....VSSMYTHIIRQ
S8B047_PENO1/186-645.......PTDYKRTSTASSRLGKHAEDGIDTEDNDQMTMFNVVFVMD.PPLL.......EYSTR.....IKDIYENVIKK
C5DHQ6_LACTC/241-731....................EEETGKAEY.EALEKSVNMFHLCFLTN.PRLV.......EYNKR.....VDDIYHYVVSR
E9D3F7_COCPS/142-585.....................HPDEDGSVTDGTKDAMTMFNVVFVMN.PPIL.......EHNLR.....IKENYDNVIKK
U4LL48_PYROM/132-582.......DEATKAADEDADDEREGETPTEQTNTESSMNMFHIVFVLN.PPEL.......EYQAR.....TLQIYDYVVRR
K2SR44_MACPH/175-626.............ISDEASDAGSDAKSASTAGGDTEMTMFNVVFVLN.PPAL.......EYQLR.....TGEMYDNVIRK
S8BNA5_DACHA/141-592..............PPSLRKKFKREPRKPLEQVPSKLAMFHVVFVMS.PPQL.......EYHSR.....MNDMYD.VAKQ
D6RLY8_COPC7/119-572.............................KPKKPSWMQKFQLAFVLDLPDPS.......SSASGNVLKYFDIIYEQVVFT
U5HEM2_USTV1/112-634....................FASSDQSATGIHGTGRLLAFNFVCVIDTPPDS.......HLSSH.....LEGYYKDVIIP
G4MPF6_MAGO7/119-567........HAQDGSGLDTAKNGDKEEEEQQDDKVSSMTMFNLVFFLN.PKKS.......EVNEL.....IDTMHTHIIRK
A0A0D1CR33_USTMA/205-718............................PTSRSKAPLTQFHLVLILDRPDPSTAV.PGVDLSSW.....LQLFYDNIVFK
B6H909_PENRW/169-617.........PTDSKRGSGSGRPGKQDESLDPEDKDHMTMFNVVFVVD.PPLL.......EYSMR.....VKEIYENIIKK
NPR3_ASPFU/179-636.....VTLSEAKRGSGSSGKAARSLVDCLDGDDKDSMTMFNVVFVLD.PPLL.......EYSMR.....TKEVYDNIIKK
C5DQJ7_ZYGRC/281-783......................NSNNQNIKEDLEKNMNMFHVCFVMN.PSLV.......EYNER.....IDDMFHYAVAR
C4JQY3_UNCRE/143-587.....................NTEEDESVTDGNKESMTMFNVVFVMN.PPIL.......EHNSR.....IKENYDNVIKK
E7A1P0_SPORE/203-720............................PSSRSQAPLTQFHLVLVLDRPDPSSAM.AGMDLSSW.....LQLYYDNVVFK
G8ZWI0_TORDC/270-767.......................LESKKH.DDLDKSMDMFHVCFVMN.PSLV.......VYNEK.....VDDMFRYVVAR
C1GWB7_PARBA/152-590..............PGDKVNAEGDSLQRLQESDKGSMTMFNVVFVLN.PPLL.......EYGLR.....IREKYENVIKK
B2ALS2_PODAN/100-533............RDGEPLGAGDAEGKEKAEKEKKASMTMFNLVFFLR.PKKH.......EAKDL.....VDIMYTNIIKK
G0RDM3_HYPJQ/95-508..............DSNPEKTKDGKRDESDEDKRSSMTMFNLVFFLD.PKRH.......EAKEL.....VDSLFSNIVKK
B6QRZ0_TALMQ/155-594.........................QTGSPESDKDTMSMFNVVFVMA.PPVL.......EYSIH.....LKEMYEHVIKK
J8Q1I2_SACAR/396-963.................DTDFNRTEFEREKEDLGKNMNMFHVCFVMN.PHLI.......EYNKR.....VDDMYQFVVTR
J7RBT2_KAZNA/205-696.............................KDNLDKNMNMFHVCFVMN.PPLT.......EYNKR.....IDDMYQYVVAK
M1VZL7_CLAP2/99-560.............LSADAAKDKDPKKDGADDEKRSSMTMFNLVFILN.PRKS.......EGKAL.....VDALYPNVVKK
F4P7C7_BATDJ/218-654.................................HHQLTMFNLVFALQ.PDGRG....TSHHSKE.....VKNIYDHVVVK
NPR3_KLULA/205-723.......................DAENDEFESLQQSINMFQVCFIMN.PKII.......EYNER.....VDDMYHYVVTR
A7TP53_VANPO/308-811....................KVEANIPFS.PDDGKNLTMFHVCFVMN.PHLI.......EYNQR.....VNDMFRHIVSK
NPR3_ASHGO/273-791..............................EDLQKAVHMFHVCFIMN.PQLV.......EYNER.....IDDMYHYIVTR
G2R1J8_THITE/107-555.........DAEKIEARDMLKPPVKPADETEDKKSSMTMFNLVFFLH.PKKH.......EVKPL.....VDIMFTHIIKK
J5JA21_BEAB2/104-534........PADSDAAVEKEKEKDKEKKEEEEEKRSSMTMFNLVFILR.PRKE.......QTREL.....VEALYSNIAKK
V5FG66_BYSSN/161-604...........DGKNPTDAKRKSSKSDELPDSDKDSMTMFNVVFVLD.PPQL.......EYSIR.....IMENYENVIKK
I2H4A8_TETBL/339-898.........................ESGK.DDLQNNMTMFHVVFIMD.PSLI.......EYNQR.....VNDMFRNVAAR
G4U9V0_NEUT9/109-529..............GPSDVDQLAAKPAEEAEDKKSSMTMFNLVFILN.PRRH.......EVADL.....VDILYTHIIKK
A0A098D4P8_GIBZA/98-520.............QPAEEKEVKKEDGKDKDDEKRSSMTMFNLVFILN.PSSN.......EVKDV.....IESLYDHIIKK
R7YHW5_CONA1/139-554.............................FDPALNDMSMFNVVFVLN.PPAL.......EYQLR.....VKETYDNVVRK
W1QEY3_OGAPD/185-592.............................PTKNDCQMYMFHLVFVMN.PPVI.......EYNHR.....IDEMFHYIVSR
H1V255_COLHI/104-533...........ADASQIDSKEEETTQQDEADDKRASMTMFNLVFIMN.PKKH.......EAKEL.....IATLYLNIIKK
T5A616_OPHSC/95-515...............KPSDVKDAPKKEEADDEKRSSMTMFNLVFILN.PKKN.......EVKDL.....VDVLYGNIVKK
D5G9F0_TUBMM/127-587..................................GNMTMFHVVFVLN.PPEL.......EYHSR.....TQEMFDYVVKR
M7TWW8_EUTLA/45-472...............GIAEDSAYQNQADEAEEKKSGMTMFNLVFILN.PKRH.......EAREL.....VDTLYFHIIKK
G0SXZ9_RHOG2/78-582............STLHPGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS.......HLSSH.....LEGYYKDVVVP
C0NJI2_AJECG/153-591..............GELKKIVEDDVLPGSPEADKDSMTMFNVVFVLN.PPLL.......EYGLR.....VREKYENVIKK
G1WZV0_ARTOA/142-590..............PPPSERKKIKREPRKVEATPSKLAMFHIVFVMN.PPQL.......EYHSR.....MHDMYD.VAKQ
M7X5H8_RHOT1/78-583............STLHAGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS.......HLSSH.....LEGYYKDVVVP
NPR3_DEBHA/205-647.............................KSQSKNSMSMFHLVFIMN.PPII.......ECNYR.....IDEMFHYVISR
K0KSM9_WICCF/157-573.............................DDSDSNSMEMFHVVFVMN.PSLV.......EYNYR.....LDEMFHYVVSR
S9VYA1_SCHCR/73-478.............................QSKPTSSMSLFHVVFVLNVPTAS.......IYRPT.....INTMYESIVVK
K1XTL5_MARBU/116-531............................ENGEDHGGMTMFNVVFILN.VAKD.......EADER.....ILTIYEHVIKK
G8YSZ2_PICSO/187-642.............................AADSKNSLNMFHLVFIMN.PPII.......ESNYR.....IDEMFHYVISR
V2XGE3_MONRO/83-522.............................PSNKCAWLHTFHLVMVLDLPDPS.......SSAAGNVSKYFDVIYEQAAFI

PF06218

M3IIL9_CANMX/8-518--------------------------------YSRNSFNFNFCFVF-------------RYDMG-----NTSPYESAIKR
M2UFV8_COCH5/4-472--------------------------------YSRNEFIFNFAIVI-------------GENER-----DWACYGEVARK
Q6BQE8_DEBHA/7-469--------------------------------YSRNSFNFNFCFVF-------------PYN.S-----DTTPYESAIKR
Q0U9Y5_PHANO/4-462--------------------------------YSRNEFIFNFALVI-------------GESEV-----DWACYGEVVRK
G3AQK3_SPAPN/8-551--------------------------------YSRNSFSFNFCFVF-------------PYDKG-----DISPYEPAIKR
W6RQZ3_CAEEL/186-593--------------------------------YERGRFTFDMAFIV-------------DMTSS-----AETMYEPIVQK
A5DQL3_PICGU/6-475--------------------------------YARNSFTFNFCFVF-------------PYD.S-----DTTPYESAVRR
K1Y0B6_MARBU/2-405--------------------------------YARNEFMFNFCIVI-------------GVE.V-----DKTPYEAVVRR

PF03666

Q5KFU1_CRYNJ/229-746WTAAAYNLQCESNLVAREAW-------------------------------MIVKYKEKCLNEGI...........GITE
S8E9R2_FOMPI/133-565TTAVLYQEQVLHNFVEDECD-------------------------------VLGALRDEYSRRGE...........QFAD
C5FU53_ARTOC/155-599FGKALKSEQARANYVWKEAL-------------------------------NILRIKEKCREERC...........SLSA
L8FQS0_PSED2/112-539INKALRYAQNYSNYVWKESE-------------------------------RILNLKEKAREERR...........PMST
H2AZX0_KAZAF/181-685LSILLRYFQAKNNYVSKECS-------------------------------IILKERENVVKYSKSYESA.LTPAAKAKC
R9P8J9_PSEHS/205-717MTAALFAEQQRVDYVGRETE-------------------------------KLLALRERCMDDGQ...........AYSA
F8PYL6_SERL3/132-564VTAVLFQEQVLSNFVEAECD-------------------------------ILVSLKDEYIDKGE...........PYSE
N1J4X2_BLUG1/150-556FNRALLETQANSGYVWNESE-------------------------------LILAMKEKAREDRR...........PMSW
E9EL47_METRA/99-518VNKAYKYSQQHCEFVWKESK-------------------------------RILLAKDRAREDEK...........SMNV
M9MFA0_PSEA3/199-702MTAALFAEQSKSDYVGRETE-------------------------------KLLALRERCMDDGQ...........AYSA
NPR3_CANGA/243-797LSVLLRYLQSKNDYVSEQCE-------------------------------LILKEKEKVFKNSKHYKSL.SLPSEKGRY
H6BW23_EXODN/130-559MSKVLKWEQSHHDYVWEQSE-------------------------------LMHSIKASHFQQKS...........PTKA
G8BZL7_TETPH/286-791LAHTLKILQAKSFYVSKEVE-------------------------------ILLKEKEYVLKSSRVYKNL.KGAANKGQY
G0WEJ7_NAUDC/230-810LSLLLRYVQAKDSYVSKQCN-------------------------------LILKERERVLKFSQKYKSI.KGKHNKAKY
R8BC65_TOGMI/105-536VNKAYKYVQQRSDFVWKESK-------------------------------RILTLKDKAREDKR...........KMSL
V5ETE4_PSEBG/203-712MTSALFAEQRESDYIGRETE-------------------------------KLLALRERCMDDGQ...........AYAA
G8JWB1_ERECY/316-852LSLILRYLQDKTGYVVEECH-------------------------------KILKTRDRILKQLKQIKKVRGQQALQGRY
C4QYA8_PICPG/201-611LCLLLRYEQDKHNFVWKEAL-------------------------------NIMKLKEETAGL.............DIVS
G8BGC4_CANPC/198-622LSLILRRAQLKHDYIGSEVK-------------------------------RIISLREELHDE.................
G0VDK5_NAUCC/193-728LSLLLRYLQAKSSYVSQQCT-------------------------------MILRERERVLKYSNKYKSI.KEENLKAKY
S2K004_MUCC1/105-579YSSALRYEQLRCGYVQEEIE-------------------------------KVLGLKEEAFNKGI...........PYEQ
NPR3_EMENI/170-616FSKALKWEQSRTNYVWRECQ-------------------------------HILNIKEKAKEKRS...........SLNS
E7KD88_YEASA/399-966LSLLLRYVQSKTSYISSECH-------------------------------IILKEKERVLKHSKTYQSI.RGAGNKGKY
B8N792_ASPFN/172-617FAKALKWEQARTDYVWREAQ-------------------------------HISHIKEKAKETRT...........SVNT
U1GT46_ENDPU/116-550LGKALKWEQARANYVWQQSD-------------------------------LILKAKTQARHKRS...........SITA
D8PLZ6_SCHCM/127-556LTAVLFREQVLSNFVEMECE-------------------------------QLMSIRESCIAKGE...........HFST
I2G095_USTH4/203-726MTAALFAEQSKSDYVGCETE-------------------------------KLLSLRERCMDDGQ...........AYAA
S6E8H4_ZYGB2/281-781LSMLLRYAQAKSNYVSRECH-------------------------------IIMKEKERVLKHSKTYRSI.KGAHNRGKY
NPR3_PHANO/150-598YAKALKYEEARFQYVWKESK-------------------------------RIIDLKQRAKESNE...........SLTS
U7Q027_SPOS1/110-529VNKVYKYCQESGDFIWQECK-------------------------------KIIQLKDHAREDRV...........KMSV
A0A0C4E2D4_MAGP6/120-591VNKYYKYCQERNDFVWKESK-------------------------------KILALKEKAREERT...........KMTA
S8B047_PENO1/186-645FAKALKWEQARNDYVWRESQ-------------------------------HILQVRRRARENRT...........SVHN
C5DHQ6_LACTC/241-731LSLVLRYAQIKSGYVTRECY-------------------------------EIIKTQDRILKSSERYKSI.KGPANKARY
E9D3F7_COCPS/142-585FGKGLKSEQATANYVWKEAQ-------------------------------KILHIKEKGRENKS...........SLSS
U4LL48_PYROM/132-582FSRTLKYEQDKDGYVWKEAE-------------------------------KIARLKEQAAHEDI...........SYSE
K2SR44_MACPH/175-626FSKDLKYEQAKTNYVWRESK-------------------------------AILNLKNKAKENRE...........PMSM
S8BNA5_DACHA/141-592FTLALKTQQAEDDYVARETE-------------------------------RIIELRERGEKRGD...........SIHE
D6RLY8_COPC7/119-572FTAVLFQEQVLSNFVEAECD-------------------------------VLIPMKESFAEQGQ...........PYKE
U5HEM2_USTV1/112-634VTANVKALERQEQWLGKESF-------------------------------KLLKAIEKAHDQGI...........RNRE
G4MPF6_MAGO7/119-567VNKAYNYCQQRNDFVWKESK-------------------------------KILALKDKAREERR...........KMSS
A0A0D1CR33_USTMA/205-718MTAALFAEQSKSDYVGRETE-------------------------------KLLALRERCMDDGQ...........AYAA
B6H909_PENRW/169-617FAKALKWEQARTDYVWKESQ-------------------------------HILQMRRRARETKT...........STNN
NPR3_ASPFU/179-636FAKALKWEQARTDYVWREAQ-------------------------------HISHLKEKAKERRT...........SLNT
C5DQJ7_ZYGRC/281-783LSMLLRYAQEKSQYVSKECS-------------------------------IIMKEKEHVLKHSKTYRAI.KGANQRGKY
C4JQY3_UNCRE/143-587LGKGLKSEQATANYVWKEAQ-------------------------------TILQIKEKARENMA...........SLLA
E7A1P0_SPORE/203-720MTAALFAEQSKCDYVGRETE-------------------------------KLLALRERCMDDGQ...........AYAA
G8ZWI0_TORDC/270-767LSLLLRYSQAKSNYVSKQCN-------------------------------LILREKERVLRTSKTYESI.RGSGNKAKY
C1GWB7_PARBA/152-590FGKGLKSEQARVDYVWKEAQ-------------------------------TIVNIKEKARENKL...........SLSG
B2ALS2_PODAN/100-533INKAYKYCQERSDFVWKESK-------------------------------KILTLKDKGREERR...........KMSL
G0RDM3_HYPJQ/95-508VNKAYQYSQQHSEFVWKESK-------------------------------RILAAKEKAREDKK...........KMSA
B6QRZ0_TALMQ/155-594FSKALKYEQDHSDYVWKEAQ-------------------------------RILQIKERARERDV...........SGEN
J8Q1I2_SACAR/396-963LSLLLRYVQSKTSYTSSECH-------------------------------IILKEKERVLKHSKTYQSI.NGAGNKGKY
J7RBT2_KAZNA/205-696LSLLLRYVQSKSNYVSEECE-------------------------------IILKETESVKKNSQFYQSI.KSPGERGKY
M1VZL7_CLAP2/99-560VNKALKYSQYQYDFVWKESK-------------------------------RILSAKDRAREERK...........PMAA
F4P7C7_BATDJ/218-654VTTALKYEQLRRGYIRTETE-------------------------------LILAINDRYQVQNGG........AGDPLE
NPR3_KLULA/205-723LSLILRYIQGKTGYVTRECV-------------------------------KIMKCKDEVSKHSRYYESL.KSPWSKGKY
A7TP53_VANPO/308-811FTLALRSAQAKNSYVSKECD-------------------------------IILKEREAVMKNSKKYKSI.RGSCNKARY
NPR3_ASHGO/273-791LSLILRYIQDKKGYVVRECA-------------------------------KILKTRDRILKKSLKLKKS.HGQALQGRY
G2R1J8_THITE/107-555INKAFKYCQQRSDFVWKESK-------------------------------RILALKDKGREDKR...........KMSS
J5JA21_BEAB2/104-534VNKAFKYSQQHSDFVWKESK-------------------------------KILASKDRAREDKK...........RMNH
V5FG66_BYSSN/161-604FGKALKWEQARADYVWTEAQ-------------------------------TILHIKEKAKEQKT...........SVNS
I2H4A8_TETBL/339-898LSLFLRSAQAKTSYVSRECD-------------------------------IMLKEKESIMKTSRTYRML.KGPRNKTKY
G4U9V0_NEUT9/109-529VNKAYKYCQQRGDFIWKESK-------------------------------KILALKDKGREDKR...........KMSQ
A0A098D4P8_GIBZA/98-520VSKAFKYSQQHSEFVWKESK-------------------------------RILVAKDKAREERK...........RMSV
R7YHW5_CONA1/139-554YAKVLKEEQACSSYVWKEAR-------------------------------EILAMKQKARENKT...........PMST
W1QEY3_OGAPD/185-592MALLLRYEQQKSNYVWNQSK-------------------------------LILDLREEFSSF.............PLNE
H1V255_COLHI/104-533VNKAYKYCQQHSEFVWKESK-------------------------------RISALKDKGREDKR...........KMSS
T5A616_OPHSC/95-515VNKAYKYSQQHSDFIWKESK-------------------------------RILAAKDKAREDKT...........SMTL
D5G9F0_TUBMM/127-587FARALKYEQAKDGYVWGEAE-------------------------------KIVRLKDKANHEGT...........SFAD
M7TWW8_EUTLA/45-472VNKPYKYSQQRCDFVWKESK-------------------------------RILALKDKGREART...........KMST
G0SXZ9_RHOG2/78-582VTANIKALEKKDTWLTKEAA-------------------------------KLRRMREGALEKDT...........PWDE
C0NJI2_AJECG/153-591FGKGLKSEQARVDYVWNEAQ-------------------------------TIINIREKAKENKL...........SLSR
G1WZV0_ARTOA/142-590FTMALKTQQSDDDYVAREAE-------------------------------RILEIRERGEKRGD...........SMHE
M7X5H8_RHOT1/78-583VTANIKALEKKDTWLTKEAA-------------------------------KLRRMREGALEKDT...........PWDE
NPR3_DEBHA/205-647LSLVLRYEQSKHEYVWNQIR-------------------------------MIYNLKEEFRNQA............TMAN
K0KSM9_WICCF/157-573LSLILRYEQSKSNYVWDQVK-------------------------------KILMIKDNNENL.............SVFD
S9VYA1_SCHCR/73-478LVTGLKYEQAKRNYVENECK-------------------------------HIRKMNERYTNQRI...........PFDD
K1XTL5_MARBU/116-531LNKAMKHAQATANYVWKESE-------------------------------MILLMKEKAREERR...........PMSW
G8YSZ2_PICSO/187-642LSLVLRYEQSKHDYIWSQVR-------------------------------LIAQIREDFRSMN............TTEE
V2XGE3_MONRO/83-522VSAVLFQEQVVSNYVEKECD-------------------------------QLGSLRDDCMKKGT...........SFSE

PF06218

M3IIL9_CANMX/8-518MGQMFQVLEEQSFMLSSLDKDNVFFKEK...PFANGKNVNG......NNVKLKYSISDFTNLMT.......DVTVSTPGF
M2UFV8_COCH5/4-472LGRLLRGLEEQGGFLSKEEV..................................GVWDDDGGTIDAGLDNGVCGFGVGGG
Q6BQE8_DEBHA/7-469MGKMFQVLEEQSFILSKLDKFGSFFKNKDEYPTENSLMINE.................................FITPGF
Q0U9Y5_PHANO/4-462LGRLLRGLEEQGGFLSKEEE..................................GVWDMD..........EVAQGDIGGG
G3AQK3_SPAPN/8-551MGQMFQVLEEQNFMLSKLDKDNSFFKKG.....STGLSSNGASSDISNNINIGIDLESYTNATSMSPAASNDATVNAPGH
W6RQZ3_CAEEL/186-593CAEYLIELEMEYKFLTNPKY............................................................
A5DQL3_PICGU/6-475MGRMFRVLEEQNFSLSKQDP..AFFKDN....................................RAHLDRADTTETTPGY
K1Y0B6_MARBU/2-405LATTFTEMEIQNEYLSQEGV..................................................ATSSLNVNAQ

PF03666

Q5KFU1_CRYNJ/229-746CCRWTATHCHIDRTLNYLYLRLHQLRTQPANGLHSYLPTTITNRLAHITI...............QTVLS.......PKP
S8E9R2_FOMPI/133-565YLREALNMSSLAASMKTLYESIKE..................KTIAQITI....HELPLELQLP................
C5FU53_ARTOC/155-599VYSQLFAKSSLAQAIETLYTDISA..................SKIASVSL...GPQTSMSMQIPPMTSTP.......HLP
L8FQS0_PSED2/112-539LWDTILRKSSLAQTMKTIYTSISN..................NSIAVVQLL.SDPPVRLSVQIPKPYFLS.......MLP
H2AZX0_KAZAF/181-685VYERILSKSSLARMLTKCVDKLHK..................NEIASIKV...GDDKIISLQIPVKNEFE.......HLP
R9P8J9_PSEHS/205-717YAAQCLGISSLARCIRDLYKCIST..................SSDAFLTV...NDSIEVHTQLPPILQDP..........
F8PYL6_SERL3/132-564FNAQALLRSSLAPAMKTLYEAIQS..................STMAYITI....HDLPLELQLP................
N1J4X2_BLUG1/150-556LWREILLRSTLACAMKEIYNSISQ..................NKIATCEL...GPNFNISLQIPKPSFLM.......SLP
E9EL47_METRA/99-518LWKELLEMSSLAASVHDIYEAVSR..................NKIATLHLDTPAGVLTPSVQIPAPFFVS.......DLP
M9MFA0_PSEA3/199-702YAAQCLGISSLARCIRDLHKSIST..................SSDAFLTI...NDRIEVHLQLPPILQDP..........
NPR3_CANGA/243-797LYQRLLAKSSLARALTECVEKIKK..................NEIACLEI...TDHRTVSLQIPIQNEFS.......ILP
H6BW23_EXODN/130-559LYTELLRRSSLAAAMGKVFDNISA..................SRIAAITL...SSKLSVSFQIPPVTSTS.......YLP
G8BZL7_TETPH/286-791LYQRLLVQSSLARALVTCFDTIHK..................NDIVNLTL....DEKVVTLQIPIHDEFW.......KLP
G0WEJ7_NAUDC/230-810LYRRILEKSSLAKSLTECVHKLQK..................NQIACLDL...GNRKIVSLQVPVENEFQ.......ILP
R8BC65_TOGMI/105-536LWEEILQTSSLAASMQDLYDCIST..................NKIATLQLDTAEGAITHSVQIPVPFHIP.......DLI
V5ETE4_PSEBG/203-712YAAQCLGISSLARCIRDLYKSIST..................SSDAFLTI...NDNIEVHLQLPPILQDP..........
G8JWB1_ERECY/316-852LYEYILKSSSLARALTKCFNSIVN..................NETVSLEI...GKYKVLSLQIPIKNEFA.......KLP
C4QYA8_PICPG/201-611QWRDIIPQSDLAKLMRDTFESVSN..................ARIVNLTI....NNKLRSFQIPIKTEFH.......TLP
G8BGC4_CANPC/198-622..NKLAENSSLCKLIRDCFIGIGS..................SKVANLMI....NGKLKSFQIPLKTEFH.......SLP
G0VDK5_NAUCC/193-728YYQRILSKSSLARSLIECVDKLQQ..................NEIACLEL...GDDKIISLQIPIQNEFN.......ILP
S2K004_MUCC1/105-579VMREILRESSLARDIRQIYTAISA..................NTAAHVII...NDFIDLSLQIPVIGMHSESSMTADRES
NPR3_EMENI/170-616LYADIISQSSLARAIRTLYTSISA..................SKIASVTL...SPDVSISLQIPPLTSTP.......YLP
E7KD88_YEASA/399-966LYQRILAKSSLARALTECVDKIQR..................NEIACLEI...NDDKVISLQIPIQNEFE.......KMP
B8N792_ASPFN/172-617LYSELINHSSLARAIYTVYSNISA..................SKIASVSL...SPDVSISLQIPPLTSTP.......YLP
U1GT46_ENDPU/116-550LYATLLRISSLASAIATIYDNISR..................SMIAAITL...TPTVPISLQIPPVTSTS.......VLP
D8PLZ6_SCHCM/127-556YMTQALAQTSIAPAMQVLFDAIKT..................STIAYITI....HDLPMELQLP................
I2G095_USTH4/203-726YAAQCLGISSLARCIRDLHKSIST..................SSDAFLTI...NDRIEVHLQLPPILQDP..........
S6E8H4_ZYGB2/281-781LYQRILVKSSLARALTLCVEKLQK..................NDIACLEI...GDDKVIALQIPIQNEFS.......VLP
NPR3_PHANO/150-598TWRKIISTSPLAKSIAIMFDAISH..................DKIAHIHF...DATFNTSFQIPQADSTP.......YLP
U7Q027_SPOS1/110-529LWKDILAVSSLAASMRDTYEAISR..................NRIAVLELNLSKGSVGHSVQIPVPFFAT.......DIQ
A0A0C4E2D4_MAGP6/120-591LWHEILAASSLAQSMQDVYEAISQ..................NRIAVLQLDTQDGAVTHSVQIPIPLHVS.......DLP
S8B047_PENO1/186-645LYSELINQSTLARAIYTVYSSISA..................SKIASVSF...SPDVSISLQIPPLTSTP.......YLA
C5DHQ6_LACTC/241-731LYQKIIQRSSLARAISKCFDAISQ..................NEVANLEI...NGDKIISLQIPIINEFD.......VLP
E9D3F7_COCPS/142-585VYEELLSQSSLAQAIATIYRSIST..................SKIASITL...TPHTTMSLQIPPLTSTP.......YLP
U4LL48_PYROM/132-582LWRKIIDNSNLAHAISRIYIDISQ..................NKIAHIFL...NNHRTLSVQIPIVTEIN.......RLP
K2SR44_MACPH/175-626LWHNIISSSPLAKAIAIIYDAISS..................NKIAHINL...GSLADASYQIPQAPSTP.......YIP
S8BNA5_DACHA/141-592LWSRILRESTLADAIATLYQQISA..................SKIAALKV...N.DFDFALQIPIMMETA.......ILP
D6RLY8_COPC7/119-572FVNQALQASSIASAMKCVYEAIKT..................RSIAYVTL....NNIPIELQLP................
U5HEM2_USTV1/112-634IPASVAPMSSLAAALNHLFEALKA..................DQLANIQLGPLPVQVLFRGEVPIEEEYD.......TFY
G4MPF6_MAGO7/119-567LWDEILRTSSLAASMQDVYDNISQ..................NKIAVLQLETQDGMVTHSVQVPMPFHIA.......DLP
A0A0D1CR33_USTMA/205-718YAAQCLGISSLARCIRDLHKSISI..................SSDAFLTI...NDRIEVHLQLPPILQDP..........
B6H909_PENRW/169-617LYSELISQSSLARAIYTVFSSIST..................SKIASVSL...SPDVSISLQIPPLTSTP.......YLT
NPR3_ASPFU/179-636LYTELITQSSLARAIYTVHTSISA..................SKIASVPL...SPDVSISLQIPPLTSTP.......YLP
C5DQJ7_ZYGRC/281-783LYQCILSKSSLARALTLCVEKLQQ..................NDIACLEI...GEDKVIALQIPIQNEFA.......VLP
C4JQY3_UNCRE/143-587LYEELLSKSSLAQAIATVYRSIST..................SKIASITL...TPHTTMSLQIPPLTSTP.......YLP
E7A1P0_SPORE/203-720YAAQCLGISSLARCIRDLHRSIST..................SCDALITV...NDRMEVDLQLPPILQDP..........
G8ZWI0_TORDC/270-767LYRRILAKSSLARALTTCVDKLQK..................NEIACLEI...DDDKVISLQIPIQNEFR.......MLP
C1GWB7_PARBA/152-590LYSELLSKSSLARAISTVYTSIAN..................SRIASVTL...TPEATMSLQVPPITSTS.......YLP
B2ALS2_PODAN/100-533LWDEILSTSSLAASMRDLYEAVSQ..................NRIAALQLCTAEGMVTHSVQIPVPFHVS.......DLP
G0RDM3_HYPJQ/95-508LWKELIQNSSLAASMCEVYNAISQ..................NRIATLHLDTVDGILTPSVQIPVPFFVA.......DLP
B6QRZ0_TALMQ/155-594LHDELVSKSSLAAAIHSVFDKISK..................SDIAFVSL....KSRSADFQIPPTTSIA.......ELP
J8Q1I2_SACAR/396-963LYQRILAKSSLARALTECVDKIQR..................NEIACLEI...GDDKVISLQIPIQNEFE.......KMP
J7RBT2_KAZNA/205-696LYQRILSKSSLARCLTKCVDQLHK..................NEIACVEL...GNDKVISLQIPVNNEFQ.......DIP
M1VZL7_CLAP2/99-560LWKELIQTSSLASSLHDIYEAVCL..................NKIATLHLETPAGILTPSFQIPAPFFVS.......DIP
F4P7C7_BATDJ/218-654LQSQILKSSSLARCLAHIYHAVHG..................QLPSFLEV...NGSVSLALRMCGIIETQ..........
NPR3_KLULA/205-723MYERILYESSLARALTKCFNCIHN..................NEIANLEI...DGDKIVSLQIPIKNEFS.......ILP
A7TP53_VANPO/308-811LYQRILSKSSLARALTKCVDNIQK..................NEISRLQI...DDDKVLTLQIPIHDEFW.......KLP
NPR3_ASHGO/273-791LYECILKSSSLARALTKCFNSIIN..................NEIVTLDI...DNHKVISLQIPIKNEFS.......SLP
G2R1J8_THITE/107-555LWEEILSTSSLAASMQDIYEAVSQ..................NKIAALQLDTVEGTVTHSVQIPVPFHVS.......DLP
J5JA21_BEAB2/104-534LWKELLQQSSLAASVHDIYEAISQ..................NRIATLHLDTAAGLLSPSVQIPAPFYVA.......DLP
V5FG66_BYSSN/161-604LYSELVSHSSLAKAICTLYSSISA..................SKIASLTL...SRDVSISLQIPPLTSTS.......YLP
I2H4A8_TETBL/339-898LYKKLLTKSSLARALTVCVDSLQK..................NEIASLQM...NDEKFISLQIPIHYELK.......FLP
G4U9V0_NEUT9/109-529LWEEILSNSSLAASMQDIYDAISR..................NRIAAIQLETIEGVVTHSVQIPVPFHVP.......DLP
A0A098D4P8_GIBZA/98-520LWKEILQSSSLAAAMHDIYEAVSQ..................NKIAALHLDTASGALTPSVQIPVPFYID.......DLP
R7YHW5_CONA1/139-554LWHQIISSSALAKSIAIIFDSISS..................SKIAHVHL...DAAFETSFQIPQAISTP.......YVP
W1QEY3_OGAPD/185-592QWKKITEKSSLARMMAQTFKAVSN..................SEIINIEI....NNKMRSFQIPIRTEFS.......SLP
H1V255_COLHI/104-533LWNEILATSSLAASVQDIYEAVSQ..................NKIAALQLDTAAGPITPSVQIPVPFYIT.......DLH
T5A616_OPHSC/95-515LWKEMLHMSSLAASVHEIYEAVSQ..................NRIAALHLDTVAGPLTPSVQIPAPFFVS.......DIP
D5G9F0_TUBMM/127-587LWRDILDQSSLAYAISRIYIDISQ..................SKIAHVFL...NNNLGLSLQMPIISEIS.......VMP
M7TWW8_EUTLA/45-472LWREILEVSSLAASMQDIYEAVSH..................NKIAALQLETAEGNVTHSVQIPAPFCLA.......DLP
G0SXZ9_RHOG2/78-582FLATLPARSSLAGAISQLYTSLRG..................NKLASVHFGPLPVQVLFRGELSTDDEVDLRDHEEYLLP
C0NJI2_AJECG/153-591LYSELSSKSSLARAISTVYTSISN..................SRIASVTL...TPEATMSLQAPPLTSTS.......YLP
G1WZV0_ARTOA/142-590LWLRIIRESTLAAAIATLYQSISA..................SKIAHLKV...N.DFDFALQIPIMMETA.......ALP
M7X5H8_RHOT1/78-583FLATLPARSSLAGAISQLYTSLRA..................NKLASVHFGPLPVQVLFRGELPADDEVDLRDHEEYLLP
NPR3_DEBHA/205-647LTKYLTDKSSLCKLISECFTQISR..................SNIANLSI....NNKLRSFQIPIKTEFH.......SLP
K0KSM9_WICCF/157-573LYQKLNTESSLAKVLSQCFDSIAS..................SDIANLEI....NNKVISLQIPMKNQFS......SLLP
S9VYA1_SCHCR/73-478FCREIPLHSNLASILVTTYEALIH..................LHTAYLEI...NHSINITLLWPMTVSVS.......SLD
K1XTL5_MARBU/116-531LWTEILLKSTLAGILRDVFTAISG..................NKIVTFPVR.SKPPEDISLQIPVPSFLV.......SIP
G8YSZ2_PICSO/187-642FHNFLVERSSLCKLIADCYEQISK..................SNIANLSI....NKKLRSFQIPIKTEFS.......SLP
V2XGE3_MONRO/83-522FSSQALELSSLASAMKTLFEAIKA..................SSIAYISL....NDLPLEIQLP................

PF06218

M3IIL9_CANMX/8-518AKTKHVALSSIESLIQQIYQDLNN------------------YSECCIPL-..DTSNSVDI..KLFPLLP-------..P
M2UFV8_COCH5/4-472SK........VYALCEMVLEDLNN------------------YAECMIPI-VLDDSNTINL..KLFPTRP-------..P
Q6BQE8_DEBHA/7-469RRTQKVNLSSIESLIHQIYQDLNN------------------YSECCIPL-..DSANSVDI..KLFPILP-------..P
Q0U9Y5_PHANO/4-462SK........VYALCEMVLEDLNN------------------YAECMIPI-..DDSNTINL..KLFPTRP-------..P
G3AQK3_SPAPN/8-551SKTKRISLSSIESLVHQIYQDLNN------------------YSECCIPL-..DSSNSVDI..KLFPILP-------..A
W6RQZ3_CAEEL/186-593.......KDQVLDVMERMFNDLSN------------------KGESVIEV-SLEDEKIVTLYFKLCPLYR-------GCE
A5DQL3_PICGU/6-475ARTARITLSSIESLINQIFSDLNN------------------YSECCIPL-..DSANSVDI..KLFPILP-------..A
K1Y0B6_MARBU/2-405ER......RSIAALIEIIKEDLNN------------------YNECMIPV-..DDANTINM..KLFPAHR-------..H

PF03666

Q5KFU1_CRYNJ/229-746VNTDE....AWAHW..................GEMEEMLSDKDSEESLSDWEDDWGAGAMMGMKRPE.............
S8E9R2_FOMPI/133-565................................PFLDSMLQAQDELELDAVNPRSE....DGLLNPWGSMSV.........
C5FU53_ARTOC/155-599SPNEP....G.YPG..................LWLTTA.....DSISTTDETSA......LAASGQN.............
L8FQS0_PSED2/112-539EFDEP....S.MPG..................LWITTA.....NFFGDQE.N...........EDET.............
H2AZX0_KAZAF/181-685NFKQN....AILPN..................SYLTSILN..........................K.............
R9P8J9_PSEHS/205-717................................TNLHKMIDIETELDSNDPIFLSGGGFAGRGKENAQEDGTGGTYDRLLA
F8PYL6_SERL3/132-564................................PYLDHLLHSEEEYDLDFVDYKED....DDESRAWGREMS.........
N1J4X2_BLUG1/150-556TAREP....A.IPG..................LLVTSA.....DPMLIESRKY........DQ.................
E9EL47_METRA/99-518ADHDH....S.QHG..................LWLTTA.....NSFLSHE.Q...........LDDP.............
M9MFA0_PSEA3/199-702................................VNLPKTVDIETELDPNDPIFLSGGGFAGLGKEGADEDGGGGTYDRLLE
NPR3_CANGA/243-797QYKLY....PVLKG..................SFLTSIQN..........................N.............
H6BW23_EXODN/130-559SLSEP....PLEPG..................VWLTTA....TDPASTADDLDSTS...SGGA.................
G8BZL7_TETPH/286-791QYKIE....PVLRG..................SHLTSILN..........................Y.............
G0WEJ7_NAUDC/230-810NFKIT....PAIEN..................CYLTSILN..........................N.............
R8BC65_TOGMI/105-536PDGE.....DNFRG..................VWITTA.....NSFTAED.G...........FDES.............
V5ETE4_PSEBG/203-712................................SNLLKTVDIETDLDKNDPIFLSGGGFSGLGKEGQDEDGGGGTHDRLLG
G8JWB1_ERECY/316-852DLKIN....PVLRG..................SFLTSILN..........................L.............
C4QYA8_PICPG/201-611KE.......KVIPG..................STLSSI..........................................
G8BGC4_CANPC/198-622DATV.....PYIPG..................SYLSSTVNTVNNFGLINVGESSRYGQKDETLRYPQ.............
G0VDK5_NAUCC/193-728NFKTS....PIAEN..................CYLTSILN..........................N.............
S2K004_MUCC1/105-579LMSPTQRAKDNYTG..................SSLMDIYSVAGYEYDKY...............................
NPR3_EMENI/170-616GPTDQ....A.YPG..................LWLTTA.....DSISPADDPMT......DDNSAPH.............
E7KD88_YEASA/399-966NFKLQ....PVLRG..................SYLTSILN..........................M.............
B8N792_ASPFN/172-617GPGDK....A.YPG..................LWLTTA.....DSVTPADDPTA......DENTAPH.............
U1GT46_ENDPU/116-550SSTDPPSART.QPG..................VWLTTATAGSSDEIADTDHPQ........SA.................
D8PLZ6_SCHCM/127-556................................PYLDSLLKVESDDDVDELQEQD.......AAEMWGPHMS.........
I2G095_USTH4/203-726................................TNLPKTVDIETELDPNDPIFLSGGGFAGLGKEGADEDGGGGTYDRLLD
S6E8H4_ZYGB2/281-781NFKLH....PVLRG..................SYLSTILN..........................S.............
NPR3_PHANO/150-598TALEP....Q.MPG..................LWLTTS.....NVVLADDE.............................
U7Q027_SPOS1/110-529PQAGD....S.LKN..................LWLTTA.....NNVSRHE.T...........LDGV.............
A0A0C4E2D4_MAGP6/120-591QEGEP....D.ATG..................IWLTTA.....NSFAGSGRD...........PSEL.............
S8B047_PENO1/186-645GPTDR....A.YPG..................LWLTTA.....DSATPIDDPHSEDKNSNNNQNNAH.............
C5DHQ6_LACTC/241-731DLKTD....PVLKG..................SFLTSILN..........................R.............
E9D3F7_COCPS/142-585GPMEP....A.YPG..................LWLTTA.....DSLSATDEVTE......MEYSGPS.............
U4LL48_PYROM/132-582TLMDQ....P.MPG..................LPLTTA.....NSFGDEE.............TEGD.............
K2SR44_MACPH/175-626RPTEP....Q.MPG..................LWLTTANLTDENAEADHSFT............................
S8BNA5_DACHA/141-592SISEP....Q.LPG..................MHLTTL.....HTLGSTPS............EDED.............
D6RLY8_COPC7/119-572................................PYLDTLLHNDSELDPDSIERPDD.....EEQQNWGPELS.........
U5HEM2_USTV1/112-634AERQEVHLKDLGPGGIGGGPERRGRHDDPIDASEAARARSVSPTPPAEAFRNHRPPPLFSRMRRRPL.............
G4MPF6_MAGO7/119-567QQGDP....D.ATG..................IWLTTA.....NSFVRDDVD...........AADL.............
A0A0D1CR33_USTMA/205-718................................SSLAKTVDIETELDPNDPIFLSGGGFEGLGKEGAHQDGSGGTYKRRMA
B6H909_PENRW/169-617GPMDK....A.YPG..................LWLTTA.....DSATPVDDPSA......DENNTPH.............
NPR3_ASPFU/179-636GPTDK....A.YPG..................LWLTTA.....DSVTPVEDPTA......DEYTAPH.............
C5DQJ7_ZYGRC/281-783NFKLH....PVLRG..................SFLSSVLN..........................S.............
C4JQY3_UNCRE/143-587GPTEP....A.YPG..................LWLTTA.....DSVSATDEAPE......VEYSGPS.............
E7A1P0_SPORE/203-720................................NSLPKLVDIETELDPNDPAFLSGNGFAGRGKEGADEDGGGSTHDRLRT
G8ZWI0_TORDC/270-767NYKLN....PVLKG..................SYLTSILN..........................S.............
C1GWB7_PARBA/152-590AATET....A.YPG..................LWLTTA.....NSLSATDDVTG......METNVPN.............
B2ALS2_PODAN/100-533DNGE.....ASQPG..................LWLSTA.....NTLMSDD.A...........AEEP.............
G0RDM3_HYPJQ/95-508AEDDE....R.HRG..................LWLTTS.....NAFLSQD.A...........LEEP.............
B6QRZ0_TALMQ/155-594SSNDT....S.LAG..................MWLTTANSVTADQGAEIEVP..........N.................
J8Q1I2_SACAR/396-963NFKIQ....PVLRG..................SYVTSILN..........................M.............
J7RBT2_KAZNA/205-696NYKIH....PILPN..................SYLSTVLN..........................N.............
M1VZL7_CLAP2/99-560SEHDN....SPQRG..................LWLTTA.....NSFLRRE.Q...........LDNV.............
F4P7C7_BATDJ/218-654.........NTYPG..................SSSSTIDSYYASNSTISIPLEISS..AYFNH.................
NPR3_KLULA/205-723NLKED....AVLRG..................SFLSSILN..........................E.............
A7TP53_VANPO/308-811KFKLE....PVLRG..................SYLTTILN..........................E.............
NPR3_ASHGO/273-791DLKIN....PVLRG..................SYLTSLLN..........................D.............
G2R1J8_THITE/107-555QEGE.....ESQRG..................LWLTTV.....NSLMGEE.A...........AETP.............
J5JA21_BEAB2/104-534PDEAR....R.PRG..................LWLTTA.....NAFLTQD.F...........LEEP.............
V5FG66_BYSSN/161-604TPMDT....A.YPG..................LWLTTA.....DSLSPADDTFA......AETAPPH.............
I2H4A8_TETBL/339-898RFKLD....PVLKG..................TFLTSILN..........................S.............
G4U9V0_NEUT9/109-529QDGQA....EEQLG..................LWLTTA.....NSLQADE.N...........VEEP.............
A0A098D4P8_GIBZA/98-520QGEEG....T.QRG..................LWLTTA.....NTFLSQD.A...........LEEP.............
R7YHW5_CONA1/139-554TTTQP....Q.IPG..................LWLTTA.....SVVDDEDPE............................
W1QEY3_OGAPD/185-592PRHT.....QLLPG..................STLSST..........................................
H1V255_COLHI/104-533NYGQT....E.QRG..................LWLTTA.....NSFIGED.T...........IDEP.............
T5A616_OPHSC/95-515AEHEQ....G.QRG..................LWLTTA.....NAFLSQD.A...........LDEP.............
D5G9F0_TUBMM/127-587SITEP....Q.VPG..................LPLTTA.....NSFGDDD.............AEGD.............
M7TWW8_EUTLA/45-472AEDEP....G.SRG..................LWITTA.....HSFVAEE.N...........IDDP.............
G0SXZ9_RHOG2/78-582DKGDE...........................SNSPERRNRSVSPSGHAFPRTRQAPIFSTMRRRPP.............
C0NJI2_AJECG/153-591SATEK....A.YPG..................LWLTTA.....DSLSATDDATG......MDTSAPN.............
G1WZV0_ARTOA/142-590SISEP....Q.LPG..................MHLTTL.....RTIGATPS............EGED.............
M7X5H8_RHOT1/78-583DRGED...........................SDSPERRNRSVSPSGHAFPRTRQAPIFSTMRRRPP.............
NPR3_DEBHA/205-647DSTV.....PYLPG..................SHLSSTVNMLANTGLISVGETIRY..DVNNL.................
K0KSM9_WICCF/157-573KTT......PVLPG..................SYLSSTTQ........................................
S9VYA1_SCHCR/73-478KLELQ....ERSPT..................ILASQTIFNEEEPSLIE...............................
K1XTL5_MARBU/116-531TFNEK....A.MPG..................LLLTSA.....NPYIDEEGVE........DP.................
G8YSZ2_PICSO/187-642EPTL.....PYIPG..................SNLSSTVNILANTGLVSIGETTRYGLNSLDPVTSY.............
V2XGE3_MONRO/83-522................................PYLDLLLHNDEEADFNGFMVGDE.....EDYRAWGPEMS.........

PF06218

M3IIL9_CANMX/8-518PINLKAYQVP----------------------..IATV------------------------------------------
M2UFV8_COCH5/4-472PPPILAHQVP----------------------..LLTI------------------------------------------
Q6BQE8_DEBHA/7-469PVNTKAYQVP----------------------..ILTV------------------------------------------
Q0U9Y5_PHANO/4-462PPPISSHQVP----------------------..LLTI------------------------------------------
G3AQK3_SPAPN/8-551PINLKAYQVP----------------------..IATV------------------------------------------
W6RQZ3_CAEEL/186-593PPEIDYHMVP----------------------MFIREV------------------------------------------
A5DQL3_PICGU/6-475PVNLKGHQVP----------------------..ISTV------------------------------------------
K1Y0B6_MARBU/2-405PPPVKSWHVP----------------------..ISTM------------------------------------------

PF03666

Q5KFU1_CRYNJ/229-746................LIVKP...........................................................
S8E9R2_FOMPI/133-565............GWRLPALKP...........................................................
C5FU53_ARTOC/155-599................QVLAK...........................................................
L8FQS0_PSED2/112-539................LLLSK...........................................................
H2AZX0_KAZAF/181-685................KFLEKASFSSAPHSSSRKLHSSITL.......................................
R9P8J9_PSEHS/205-717MTPAQLSFEEWCRTTGPYLLP...........................................................
F8PYL6_SERL3/132-564...........FGWRLPALAP...........................................................
N1J4X2_BLUG1/150-556................PRLNK...........................................................
E9EL47_METRA/99-518................EFLDK...........................................................
M9MFA0_PSEA3/199-702LAPHQLSFEEWCRTTGPYLLP...........................................................
NPR3_CANGA/243-797................KFLEKSANIDDNHHAKSARDTNLISDHVNTFSN...............................
H6BW23_EXODN/130-559................LQVSK...........................................................
G8BZL7_TETPH/286-791................GFLKSTSTKNKKKDINSN..............................................
G0WEJ7_NAUDC/230-810................SFLERLSLRADGLTSTTTGTNAGTSTDWRIENDVDDETNRGRTSNNNNNRSSNIKYQSISDGKP
R8BC65_TOGMI/105-536................GYLEK...........................................................
V5ETE4_PSEBG/203-712LEPNQLSFEEWCRTTGPYLLP...........................................................
G8JWB1_ERECY/316-852................KFLKEPTDPIPGGAVVF...............................................
C4QYA8_PICPG/201-611.....................SPFTKDDSDEVD...............................................
G8BGC4_CANPC/198-622.....................EDDDS......................................................
G0VDK5_NAUCC/193-728................KFLENLSMRRTAWKMDDVDNENNTAKGQHMEQPETS...........................T
S2K004_MUCC1/105-579................PVLCP...........................................................
NPR3_EMENI/170-616................QVLAK...........................................................
E7KD88_YEASA/399-966................KFLEKSSLRIEGQNRQNDQAQFSDTHNNIYRFGNN.............................
B8N792_ASPFN/172-617................QVLAK...........................................................
U1GT46_ENDPU/116-550................MSLAK...........................................................
D8PLZ6_SCHCM/127-556...........YGWRLETLAP...........................................................
I2G095_USTH4/203-726LAPHQLSFEEWCRTTGPYLLP...........................................................
S6E8H4_ZYGB2/281-781................RFLSAPPSRDDSLNDY................................................
NPR3_PHANO/150-598................SPMTQ...........................................................
U7Q027_SPOS1/110-529................PAFDK...........................................................
A0A0C4E2D4_MAGP6/120-591................GFLDK...........................................................
S8B047_PENO1/186-645................QVLAK...........................................................
C5DHQ6_LACTC/241-731................KFLEEGSATMNEAWA.................................................
E9D3F7_COCPS/142-585................KVLAK...........................................................
U4LL48_PYROM/132-582................SILAK...........................................................
K2SR44_MACPH/175-626................VPLTP...........................................................
S8BNA5_DACHA/141-592................MLLTP...........................................................
D6RLY8_COPC7/119-572...........FGWRLPALAP...........................................................
U5HEM2_USTV1/112-634................VRFQP...........................................................
G4MPF6_MAGO7/119-567................GFLDK...........................................................
A0A0D1CR33_USTMA/205-718MTPAQLSFEEWCRTTGPYLLP...........................................................
B6H909_PENRW/169-617................QVLAK...........................................................
NPR3_ASPFU/179-636................QVLAK...........................................................
C5DQJ7_ZYGRC/281-783................QFLSAGPLAKEESLGGY...............................................
C4JQY3_UNCRE/143-587................KVLAK...........................................................
E7A1P0_SPORE/203-720LNPSQLSMEEWCRTTGPYLVP...........................................................
G8ZWI0_TORDC/270-767................KFLGVAPTRDNEGHST................................................
C1GWB7_PARBA/152-590................QTLAK...........................................................
B2ALS2_PODAN/100-533................GFLDK...........................................................
G0RDM3_HYPJQ/95-508................GFLDR...........................................................
B6QRZ0_TALMQ/155-594................QVLAK...........................................................
J8Q1I2_SACAR/396-963................KFLEKTSLRIEGQNRQNNQAQLSDTNNNLYRFSNN.............................
J7RBT2_KAZNA/205-696................NFLEGCSYNDTQYLNAEGRK............................................
M1VZL7_CLAP2/99-560................EFLDK...........................................................
F4P7C7_BATDJ/218-654................PTLRP...........................................................
NPR3_KLULA/205-723................SFIGRSTSLTNEDSD.................................................
A7TP53_VANPO/308-811................RFLGSTTNNNQETSDWN...............................................
NPR3_ASHGO/273-791................SFLKQPVDFAAGSMMP................................................
G2R1J8_THITE/107-555................GFLDK...........................................................
J5JA21_BEAB2/104-534................GFLDR...........................................................
V5FG66_BYSSN/161-604................QILAK...........................................................
I2H4A8_TETBL/339-898................KFLARSSSLDQLNATTNQINYPTSN.......................................
G4U9V0_NEUT9/109-529................EYLDK...........................................................
A0A098D4P8_GIBZA/98-520................GFLDR...........................................................
R7YHW5_CONA1/139-554................AGLSP...........................................................
W1QEY3_OGAPD/185-592.....................SPFNSLGPDLH................................................
H1V255_COLHI/104-533................GFLDR...........................................................
T5A616_OPHSC/95-515................GFLDR...........................................................
D5G9F0_TUBMM/127-587................NMLAK...........................................................
M7TWW8_EUTLA/45-472................GFLDR...........................................................
G0SXZ9_RHOG2/78-582................VQFEP...........................................................
C0NJI2_AJECG/153-591................QALAK...........................................................
G1WZV0_ARTOA/142-590................ALMTP...........................................................
M7X5H8_RHOT1/78-583................VQFEP...........................................................
NPR3_DEBHA/205-647.....................NSGGLDDFDDID...............................................
K0KSM9_WICCF/157-573.....................YDEEE......................................................
S9VYA1_SCHCR/73-478................PSVAP...........................................................
K1XTL5_MARBU/116-531................SYINK...........................................................
G8YSZ2_PICSO/187-642.....................SSKFALDNNGAFIDQ............................................
V2XGE3_MONRO/83-522...........FGWRLPALVP...........................................................

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

Q5KFU1_CRYNJ/229-746...............................WQTLLLI.DEDKNQNQEALFFGIVGLPAAVDDDDAVNNWTNGRKSPVRN
S8E9R2_FOMPI/133-565...............................WKSLLRL.DDEDERGKN..ELYR..........................
C5FU53_ARTOC/155-599...............................HFALLLL.SDENTILKDI...............................
L8FQS0_PSED2/112-539...............................HFALLLL.DDENKIIADI...............................
H2AZX0_KAZAF/181-685..........GNSLILHDGDDDYDNEDDDILNYALLLL.DDVNNILRTLE..............................
R9P8J9_PSEHS/205-717...............................WKTLLLLHDQVDD..GITPPVMASSGQA..................GLA
F8PYL6_SERL3/132-564...............................WKSLLLL.DGDQGL.....DPYM..........................
N1J4X2_BLUG1/150-556...............................NFALLLT.EDESKLLSDM...............................
E9EL47_METRA/99-518...............................NFALLLL.EDEKKVVAEL...............................
M9MFA0_PSEA3/199-702...............................WKTLLLLHDQPDEA.ARGRRTPGSAS.....................PA
NPR3_CANGA/243-797..GQTKNEIFYSKNMENALTAQNDYDDDDLLLYSILLL.DDPDKIIADLD..............................
H6BW23_EXODN/130-559...............................NFTLLFK.SSPQKILKDI...............................
G8BZL7_TETPH/286-791..................NFADDDNIDNDILNYALLLK.EEQNVIIEKLK..............................
G0WEJ7_NAUDC/230-810TNPMALNRNTVVTYYSTGDSEILEMNNNDLLNYSILLL.DDPTNIIQSLE..............................
R8BC65_TOGMI/105-536...............................NFALLLM.DDEKKIISEL...............................
V5ETE4_PSEBG/203-712...............................WKTLLLLHDHAD..PGRDRNTAGSSS.....................PS
G8JWB1_ERECY/316-852..................NDSNFFDEENDILDYALLPL.DEVSNIIRDLE..............................
C4QYA8_PICPG/201-611...................FKNIVNSDENLAFFTILLL.DDPEVIIRDIQ..............................
G8BGC4_CANPC/198-622..........................DEVVIYYALLLL.DEPENIIKDLK..............................
G0VDK5_NAUCC/193-728MGNSYMGNSRIINQFAQNDFDSTENENDDILDYALLLL.DDPTNILQTLD..............................
S2K004_MUCC1/105-579...............................YHTLLLL.EDPEEVLKNMP..............................
NPR3_EMENI/170-616...............................HFALLLL.DNEATIIKDV...............................
E7KD88_YEASA/399-966INSTGHCGAANVDDGDDNESNYYCDDNDDLLNYALLLL.DEPNNIISSLE..............................
B8N792_ASPFN/172-617...............................HFALLLL.SDEATILKDV...............................
U1GT46_ENDPU/116-550...............................HFTLLLL.DKESKILADI...............................
D8PLZ6_SCHCM/127-556...............................WKSILLL..EKDGF.....DPFA..........................
I2G095_USTH4/203-726...............................WKTLLLLHDQADETLARGRQTPGNSSPA..................GMA
S6E8H4_ZYGB2/281-781...................SNAEDEDANDLLHLALLLL.DEPANIIKELE..............................
NPR3_PHANO/150-598...............................HAALLLL.EDTETLIKDL...............................
U7Q027_SPOS1/110-529...............................CFALLLTDDDETKIIAEL...............................
A0A0C4E2D4_MAGP6/120-591...............................NFGLLLL.DEDKKIITEL...............................
S8B047_PENO1/186-645...............................HFALLLL.DSEAAVIKDV...............................
C5DHQ6_LACTC/241-731.....................RSHDENDDLLDYAVLLL.NEPAIIIQELQ..............................
E9D3F7_COCPS/142-585...............................HFALLLL.SDEASILKDI...............................
U4LL48_PYROM/132-582...............................HFTLLFL.EDIETIIKDI...............................
K2SR44_MACPH/175-626...............................HSALLLL.EDKETLLKEI...............................
S8BNA5_DACHA/141-592...............................HLALLFL.EDVDDIIKEII..............................
D6RLY8_COPC7/119-572...............................WKSLLLL.DGSDEL.....EDPIA.........................
U5HEM2_USTV1/112-634...............................WETFLPL.EDPDELRKNV...............................
G4MPF6_MAGO7/119-567...............................DFALLLM.DDEKKIVSEL...............................
A0A0D1CR33_USTMA/205-718...............................WKTLLLLHDQVDEAPNRERAKSDTCSPA..................GLA
B6H909_PENRW/169-617...............................HFALLLL.DSEAAIIKDV...............................
NPR3_ASPFU/179-636...............................HFALLLL.DNEAAILRDV...............................
C5DQJ7_ZYGRC/281-783...................TDSDHEDLTDLLNFA.LLL.DEPTNIIKELE..............................
C4JQY3_UNCRE/143-587...............................HFALLLL.SDEDTILKDV...............................
E7A1P0_SPORE/203-720...............................WKTLLLLHDQPDDTPARGRDGSPAG........................
G8ZWI0_TORDC/270-767...................GKREEDDDDDLLHYALLLL.DEPAKIIKDLE..............................
C1GWB7_PARBA/152-590...............................HFALLLL.TDEATILKDI...............................
B2ALS2_PODAN/100-533...............................NFALLLL.VDEKRIITEL...............................
G0RDM3_HYPJQ/95-508...............................NFALLLM.DDEKKIIAEL...............................
B6QRZ0_TALMQ/155-594...............................HFALLLL.ESEASIMEAL...............................
J8Q1I2_SACAR/396-963INSTANCGTSNVDDGDDNENGYYCDDNDDLLNYALLLL.DEPNNIINSLE..............................
J7RBT2_KAZNA/205-696...............GFLGATDNIGNDNDILNYSLLLL.DEPTQILETLE..............................
M1VZL7_CLAP2/99-560...............................NFALLLL.EDEKKIIAEL...............................
F4P7C7_BATDJ/218-654...............................YQALLLL.SDAEEILNTLP..............................
NPR3_KLULA/205-723.....................NLYANHDRLLDYGLLLL.DEPENIIKGLE..............................
A7TP53_VANPO/308-811..................IYSSEEDASDDLLNYALLLL.DEPSKIINNID..............................
NPR3_ASHGO/273-791...................GGDVMHDDNDVLDYALLLL.DDTPKIIKDLE..............................
G2R1J8_THITE/107-555...............................NFALLLM.MDEKRIIAEL...............................
J5JA21_BEAB2/104-534...............................NFGLLLM.EDEKKIVAEL...............................
V5FG66_BYSSN/161-604...............................HFALLLL.DNEATILKDV...............................
I2H4A8_TETBL/339-898...........SNNANENEYDTFFDDDNNLLDYALLPL.DEPSNIIKKLE..............................
G4U9V0_NEUT9/109-529...............................TFALLLM.AEEKKVINELL..............................
A0A098D4P8_GIBZA/98-520...............................NFSLLLT.DDEKKIISEL...............................
R7YHW5_CONA1/139-554...............................HCALLLL.EDAETLLKEI...............................
W1QEY3_OGAPD/185-592....................SSAQTNDDNMIHYALIML.DDPESVIRDIQ..............................
H1V255_COLHI/104-533...............................NFALLLM.GDEKKIIAEL...............................
T5A616_OPHSC/95-515...............................NFALLLM.DDEKKIISEL...............................
D5G9F0_TUBMM/127-587...............................HFTLLFL.EDVNGILKDI...............................
M7TWW8_EUTLA/45-472...............................NFALLLL.SDEKKIVAEL...............................
G0SXZ9_RHOG2/78-582...............................WQTLLLL.EDARILQRDV...............................
C0NJI2_AJECG/153-591...............................HFALLLL.TDESTVLKDI...............................
G1WZV0_ARTOA/142-590...............................HFTLLFL.EDVDDIIKEII..............................
M7X5H8_RHOT1/78-583...............................WQTLLLL.EDVRLLQRDV...............................
NPR3_DEBHA/205-647...................DNKSDSNADDIIYYALLLL.DDPETIIRDIK..............................
K0KSM9_WICCF/157-573.........................LDSNVGHMALLLL.DAPEKIITDLK..............................
S9VYA1_SCHCR/73-478...............................YWSLLLL.QDLESIMKRLP..............................
K1XTL5_MARBU/116-531...............................HYALLLL.DDESKIIPEI...............................
G8YSZ2_PICSO/187-642................DFIDEETDDNAEDIVYYALLLL.DEPESIIKDIK..............................
V2XGE3_MONRO/83-522...............................WKSLLLL.DNIDDF.....DPFS..........................

PF06218

M3IIL9_CANMX/8-518-------------------------------KLNSLID.VNWDPTMVKI-------------------------------
M2UFV8_COCH5/4-472-------------------------------SLSSLQQPVSSDLTLNRI-------------------------------
Q6BQE8_DEBHA/7-469-------------------------------KLSSLVD.INWDPTMLKI-------------------------------
Q0U9Y5_PHANO/4-462-------------------------------SLSSLQSPISSDLTLNRI-------------------------------
G3AQK3_SPAPN/8-551-------------------------------KLNSLVD.VNWDPTMVKI-------------------------------
W6RQZ3_CAEEL/186-593-------------------------------TLTDHLI.EKMDVLSQKI-------------------------------
A5DQL3_PICGU/6-475-------------------------------KLGLMVD.VNWDPTMVKI-------------------------------
K1Y0B6_MARBU/2-405-------------------------------KFSVIID.DTWDLTMKKV-------------------------------

PF03666

Q5KFU1_CRYNJ/229-746RTRRGSKITAEDDAIEDGETVLRRTLIE.ACDVTKPLYEIAHLLRYDLEGV.............................
S8E9R2_FOMPI/133-565.RLRAPQLTAEDN....ELAEQLVKFLE.IADVTLSLSDMASLLDWDLETR.............................
C5FU53_ARTOC/155-599........EASKS....TIGPPLAHYIR.SSKPTKSFA.............Q...................ISAR..SRI
L8FQS0_PSED2/112-539........QSDGG....ELTGPLLEYLK.IVRPTLSFH.............Q...................TAQQ..HAI
H2AZX0_KAZAF/181-685......TTTMNSTESNDINMIILRHLIK.HIQPTVPLNSYHYIITDALDLE.......................P..STV
R9P8J9_PSEHS/205-717SPGGGGVQPHEGDGGFERLTRNFKSLFVPSLYNSLNFGNVADMFEWNLYDD.............................
F8PYL6_SERL3/132-564.NLRGPHVRPEER....TLAQGLIKFLE.TASVTLSLADMASLLDWDLENQ.............................
N1J4X2_BLUG1/150-556........HANKT....ELSEALTECIR.LCKPTLSFA.............Q...................VAQI..NSI
E9EL47_METRA/99-518........QADRD....PTTVSMIEFAR.LAKPTMSFY.............Q...................VGQS..NVL
M9MFA0_PSEA3/199-702GHLTPAEQAPETHG.FEQLARNFTSLFRPDLMHSLNFSEVADMLGWDLYED.............................
NPR3_CANGA/243-797......NYSSNDD....IGGVILKQLVK.VIQPNVPLLSYQYIINELLAEKPLSSSTTA.....NKSKQNKDNKT..NTF
H6BW23_EXODN/130-559........QAAGG....PLALPLANFMA.KATPTKSFY.............K...................ISIA..SQM
G8BZL7_TETPH/286-791......SFSQDDN....IGGLILRQLVK.HIQPNVPIRSYQPLINELMGVK....................ENDPNRTIF
G0WEJ7_NAUDC/230-810......ESSNQDV....LGNTILRHLVK.RMQPNIPIRNYQYIIDEVL...GSG..............FKSGITD..NTI
R8BC65_TOGMI/105-536........QADPD....ESTLSMIEFVR.HSKPTMSFH.............Q...................VGQQSSNIL
V5ETE4_PSEBG/203-712GALSPSGQAPETHG.FEQLTRNFTALFQPNLYHTLNFSDVADMLGWELYED.............................
G8JWB1_ERECY/316-852......CSSFQSD....MINLLMANLVK.ILKPTVPLRSYLYLIDELLGTNSTGANTVDGGGVLGTSSSKIQAHR..NSF
C4QYA8_PICPG/201-611......VAKES..........VIARFIR.LIRPTKSMSRLATT..................................SGL
G8BGC4_CANPC/198-622......ISNES..........ILANFIS.SIEPTESLLKLSAQY.................................PQL
G0VDK5_NAUCC/193-728......KFSHQDV....IGNLILRHLVK.RIQPTIPIRSYHYIIDEILDLDSDN..............NEQTTIE..NSM
S2K004_MUCC1/105-579.....L...........DASPTLVQLVQ.ILTPTQSLQELHLLLDCSLAQ..............................
NPR3_EMENI/170-616........EAAGG....ALAPPLVHYIR.CSSPTKSFV.............Q...................ISQI..SGM
E7KD88_YEASA/399-966......TFSYQDD....IGTIILKHLVR.NIQPNIPLRSYRYLITDLLDNPSSL..............DDLTTET..NSL
B8N792_ASPFN/172-617........EASGG....ALAPALAHYIR.CSKPTKSFA.............Q...................ISAL..SGI
U1GT46_ENDPU/116-550........SQSGG....PLAAALAHYIR.VSSPTKSFA.............K...................ISAL..HSI
D8PLZ6_SCHCM/127-556.SLRGPHVSVNDR....PLVDGLIRFLE.VASITLSLADMSSLLDWDLDTQ.............................
I2G095_USTH4/203-726SPGGGGSTGPEAHG.FEQLARNFTSLFRLNLNHSLNLSEVADMLGWNLYED.............................
S6E8H4_ZYGB2/281-781......TFSYQDD....IGNIVLTHIVK.HIQPNVPLGSYQHLIDDLLGGTSE.................DTGIG..NSF
NPR3_PHANO/150-598........GGEVT....GNAAAIAFYIR.NIIPTKSLL.............K...................ISKR..HNI
U7Q027_SPOS1/110-529........EARGD....KAAATMIELVK.ASKPTLSFY.............Q...................VSQLPDTIL
A0A0C4E2D4_MAGP6/120-591........QSDPD....ESTMAMIEFIR.HSKPTLSFH.............Q...................VASQ.SNLL
S8B047_PENO1/186-645........EASGG....ALAPALAHYIR.SSKPTKSFA.............Q...................ISAS..SGI
C5DHQ6_LACTC/241-731......FSSPQND....ITSVLLTSLVK.HLKPTVPLRNYQYVIDEIVGKPVAS..............ESDVEER..NSF
E9D3F7_COCPS/142-585........EASMG....TLGPPLAHYIR.SSKPTKSFA.............Q...................ISAR..SSI
U4LL48_PYROM/132-582........VAEPT....ESSASLAHFVK.NVKPTQSFV.............Q...................ISIQ..SGI
K2SR44_MACPH/175-626........EGDAK....EHSVQLAYYIS.NLIPTKSLH.............K...................LAIQ..HKI
S8BNA5_DACHA/141-592......Q.EQDQG....SLSASFVQFIQ.NCKPTLSFA.............QM................ISASSP..NGI
D6RLY8_COPC7/119-572.SLRGPHVSVEDR....ALAEGLIRFLE.TASITLSLADMASLLDWDLESQ.............................
U5HEM2_USTV1/112-634.................QPDTLLSKFLE.FCSPNLSFAEYATLLDIDSDADD..................GA........
G4MPF6_MAGO7/119-567........QSDPD....ESTLAMIEYMR.HSKPTLSFQ.............Q...................VAIQ.SKVL
A0A0D1CR33_USTMA/205-718SPGEGASQALEAHG.FDQLARKFTSFFTPSLYNTPNFSQVADMLGWDLYDD.............................
B6H909_PENRW/169-617........EASGG....ALAPALTHYIR.CSKPTKSFA.............Q...................ISAS..SGI
NPR3_ASPFU/179-636........EASGG....ALAPALAHYLR.CSKPTKSFA.............Q...................ISAS..SGI
C5DQJ7_ZYGRC/281-783......TFSYHDD....IGNIVLSHIVK.HIQPNVPLGSYQYLIDELFGDTS..................DD.VR..GSF
C4JQY3_UNCRE/143-587........EASMG....TLGPPLAHYIR.SSKPTKSFA.............Q...................ISAR..SSI
E7A1P0_SPORE/203-720PVSPGGAPAPEVRG.FEQLSRTFTDYFKPRLHGSFNFSDVADFFGWHLYDD.............................
G8ZWI0_TORDC/270-767......NLSSDDD....IGNMVLTHLIR.RLQPTVALGTYQNIIDEMLGTAKE................SVTGSQ..NSF
C1GWB7_PARBA/152-590........EGSVG....PLGPRLAHYIR.ASKPTKSFA.............Q...................ISAQ..SGI
B2ALS2_PODAN/100-533........QDDPD....ETTLAMIEFVR.HCKPTLSFY.............Q...................VGQQSSNVL
G0RDM3_HYPJQ/95-508........QNDRD....PTTLSMIEFVR.LAKPTVSFY.............Q...................VGQS..NIL
B6QRZ0_TALMQ/155-594........KGS......ELAPALSHYIR.SSRPNKSFA.............Q...................ISAL..SGI
J8Q1I2_SACAR/396-963......TFSYQDD....AGTMILKHLVR.NIQPNIPLRSYRYLISELLDNSSSQ..............DNLSLET..NSL
J7RBT2_KAZNA/205-696.......SSTQTVKTGDLNTLILRQLVK.QIKPTTPLISYHDIITSTLQLE.......................S..SEI
M1VZL7_CLAP2/99-560........EADQD....TTTPSMVEFAR.LAKPTMSFH.............Q...................VCQS..KIL
F4P7C7_BATDJ/218-654.....V...........DASPLLVELIQ.IVTPTLSFEELQTTLSCSLSQ..............................
NPR3_KLULA/205-723......NASFDNG....VTDLLLINLVR.QLKPTIRLGQYKLLIKELIDSN.....................DSSYDDQF
A7TP53_VANPO/308-811......SFTYKDN....IGGVVLKHLVK.HLQPHVPINYYQPLVDELLGSTSG................GLSGER..SLF
NPR3_ASHGO/273-791......FSSFGSD....LANVIMINLVK.NLKPTVSLRSYLPLVSNLLEANLSLSARAA....GSRHAASNAADSHSTPL
G2R1J8_THITE/107-555........QSDPD....ETTLAMIEFVR.HCKPTLSFY.............Q...................VCQQSSNVL
J5JA21_BEAB2/104-534........QADGD....PNALPMVEFVR.ISKPTMSFY.............Q...................VGQS..NIL
V5FG66_BYSSN/161-604........EASGG....ALGPALAHYIR.CSKPTKSFA.............Q...................ISAV..SGI
I2H4A8_TETBL/339-898......TSSNQDD....LTSVLLIHIVR.HIQPTLPLRSYQYLIDDVFRFNSNE..............FGMKELENGESI
G4U9V0_NEUT9/109-529........GPESD....PTTQAMIEFVR.RCKPNLSFH.............Q...................VQQQASSIL
A0A098D4P8_GIBZA/98-520........QADPD....PTTASMVEFVR.LSKPTQSFY.............Q...................VGQS..NIL
R7YHW5_CONA1/139-554........EGDAK....ERSAPLAFYIR.NSTPTKSLQ.............K...................LAAA..FSI
W1QEY3_OGAPD/185-592......AERHS..........LIANFIR.MIKPSESLSRLATL..................................SGL
H1V255_COLHI/104-533........QADPD....PSTVAMVEFAR.LSKPTQSFC.............Q...................VGQS..NVL
T5A616_OPHSC/95-515........QADRD....PTTVSMVEFVR.LAKPTMSFY.............Q...................VGQS..NVL
D5G9F0_TUBMM/127-587........AAEAA....DSSASLARFVE.ACRPTKSFV.............LTLLLKSGY...GVNSIIRFLQISNSCGI
M7TWW8_EUTLA/45-472........QADTD....DTTTAMVEFVR.LSRPTLSFH.............Q...................IGHG..NAL
G0SXZ9_RHOG2/78-582.................LEGSLLWRFLD.ICRPKLSFADYETLLDLYSEDH....................M........
C0NJI2_AJECG/153-591........EESIG....PLGARLAHYIR.VSKPTKSFA.............Q...................ISAL..SGI
G1WZV0_ARTOA/142-590......L.DQDQS....SLSASFVQFIQ.NCRPTVSFA.............QM................LSPTSD..SSA
M7X5H8_RHOT1/78-583.................LEGSLLWRFLD.ICRPTLSFADYETLLDLYSEDH....................M........
NPR3_DEBHA/205-647......AQQQS..........TLANFIR.MIKPTESLLKLANKLKQQ.........................ASDNGFSL
K0KSM9_WICCF/157-573......TEPMS..........PLSTFIK.NINPMMSMNKLALL..................................NQL
S9VYA1_SCHCR/73-478.....L...........SRNSLLASFIT.EARPTSTFTDIANSLGISLSE..............................
K1XTL5_MARBU/116-531........QADDT....ELSAPLIECIR.LCKPTLSLL.............Q...................VAQI..NSI
G8YSZ2_PICSO/187-642......TQPQS..........PLALFIR.MIRPSESLLKLSNKI............................KTQKKNNL
V2XGE3_MONRO/83-522.DLRGPHVSPDDR....SLAEGLLKFLE.TANVTLSLTDLTSLMDWDLESQ.............................

PF06218

M3IIL9_CANMX/8-518--------------------LPYINGLN-SVKRISELADANYIL------------------------------------
M2UFV8_COCH5/4-472--------------------LPYINGIN-SIAHIAQLADTDLSL------------------------------------
Q6BQE8_DEBHA/7-469--------------------LPYIDGIN-SIKRISQLADADYIL------------------------------------
Q0U9Y5_PHANO/4-462--------------------LPYINGVH-SIARIAALADTDLSL------------------------------------
G3AQK3_SPAPN/8-551--------------------LPFINGLN-SVKRISELANANYLL------------------------------------
W6RQZ3_CAEEL/186-593--------------------IPQIDGIN-TVREIAIILELDPSL------------------------------------
A5DQL3_PICGU/6-475--------------------LPFINGVN-SVRKISRLADADYIL------------------------------------
K1Y0B6_MARBU/2-405--------------------IQQIDGIK-DVRRIAHDADVALDL------------------------------------

PF03666

Q5KFU1_CRYNJ/229-746..........VIPLARDLVQSKKAILIDVVNP..RLRTVVMPTTIDEH................................
S8E9R2_FOMPI/133-565..........IYPTVRWLVHHRRAKVVDIVHPGLRTIFTVPLKFTAP.................................
C5FU53_ARTOC/155-599PLSD......IQVLASHLVYWRRARAIPPLNK..KDVYIVSPNADMS.................................
L8FQS0_PSED2/112-539SLND......IRILAQHLIYHRRAIAVPPLHP..RDTYILSPNCPMA.................................
H2AZX0_KAZAF/181-685TYDI......LRSCALHLIYWRHARVIIPMSS..KFTYVVSPIISLE.................................
R9P8J9_PSEHS/205-717..........VYPMVRHLLYYKQARVIDVPRP..GHVYAISPLFDFA.................................
F8PYL6_SERL3/132-564..........IYPTVRWLVHHRRAKVVDIVHSGLKTIFTLPPRFEAS.................................
N1J4X2_BLUG1/150-556ELTS......LLTLASHLIFYRRALAIPPLHL..RNTYIVSPNCDCR.................................
E9EL47_METRA/99-518TASQ......VRKYAQHFIFWRRAIAIPPLHA..RDVYIVSPNCDLS.................................
M9MFA0_PSEA3/199-702..........VYPMVRHLIYYRQARVIDIPRP..GHVYAISPLFDFG.................................
NPR3_CANGA/243-797YSAL......LRSCALHLIYWRHARAILPISF..KNTYIVSPLSPVEADNSEMIKGNRKPS...................
H6BW23_EXODN/130-559ALGD......IQHLARHLVYWRRAIAIPPLHQ..RDTYIVSPNANMS.................................
G8BZL7_TETPH/286-791HINI......LKYCALHLLYWRHARAVIPLSS..KYTYIVSPLSPLVGSSKDYISEGSSH....................
G0WEJ7_NAUDC/230-810QCNI......LRSCTLHLIYWRYARVILPISS..KSFYIVSPVSSVSYSK..............................
R8BC65_TOGMI/105-536TISH......VRKYAQHFIFWRRAIAIPPLHA..RDIYILSPNADMR.................................
V5ETE4_PSEBG/203-712..........IYPMVRHLIYYRQARVIDIPKP..GHVYAISPLFDFA.................................
G8JWB1_ERECY/316-852ECNM......LRSIALHLTYWRHTRIILPISS..KNTYIVSPLAPIRGTAVDDCDS........................
C4QYA8_PICPG/201-611DLAQ......IKAFACHLVYWRRAKIIPAINT..RNIYVISALAPLD.................................
G8BGC4_CANPC/198-622DIRQ......IKSFAFHLIYWRKARIIQPLSS..RSVYIISPMAPLT.................................
G0VDK5_NAUCC/193-728QYNI......LRSCSLHLIYWRHARVIIPLSS..KNSYILSPISPIVYS...............................
S2K004_MUCC1/105-579..........IYRLAAHLIYWRKAKLIHTIST..RNIYVVSPTAKLN.................................
NPR3_EMENI/170-616PLPT......IQFLASHLVYWRRARAIPPLHQ..RDTYIVSPNCDLS.................................
E7KD88_YEASA/399-966ESSI......LRSCALHLMYWRHARIVIPLSS..KYTYIVSPLAPIQGYTIDDYKSTSQNDGNV................
B8N792_ASPFN/172-617PLST......IQMLASHLVYWRRARAIPPLHQ..RDVYFVSPNCDLS.................................
U1GT46_ENDPU/116-550SLPD......IQLLAQHLVDWRRARAIPPLHQ..RDTYIVSPNADLK.................................
D8PLZ6_SCHCM/127-556..........IYPVVRWLVEHRRAKIVDVVHPGLKTVFTLPPKFEQP.................................
I2G095_USTH4/203-726..........VYPMVRHLIYYRQARVIDIPRV..HHVYAISPLFDFA.................................
S6E8H4_ZYGB2/281-781QTSM......LRSCALHLLYQRHARVVIPISS..RNTYIVSPIAPIRGYSKNDYM.........................
NPR3_PHANO/150-598SAHD......MEYIASHLVYWRRARLIAPLSP..RDTYIVSPNADFS.................................
U7Q027_SPOS1/110-529TIHQ......IRAYAQHFIYWRRAMAVPPIHA..RDVYILSPNCDID.................................
A0A0C4E2D4_MAGP6/120-591SLSQ......IHQFAHHFIFWRRAIAIPPLHA..RDIYMLSPNCDLE.................................
S8B047_PENO1/186-645PLST......IQMLASHLVYWRRARAIPPIHQ..RDTYIVSPNCDLS.................................
C5DHQ6_LACTC/241-731QTSM......LRSLALHLMYWRHARVIIPVSS..KNTYIVSPLAPITGNTKDDFSG........................
E9D3F7_COCPS/142-585PLND......IQVLAAHLIYWRRARAVPPLNK..QDTYIVSPNCDLS.................................
U4LL48_PYROM/132-582ALHE......IQVLARHLIQWRKARPIPPIHQ..RNTYIVSPNADMK.................................
K2SR44_MACPH/175-626PVAD......LEFIAAHLIYWRRARAIPPLHH..RDIYIVSPNADMR.................................
S8BNA5_DACHA/141-592IHPENPEYQYIEYFARHLIYWRKARAIMPLHY..RRYYIVSPNADMK.................................
D6RLY8_COPC7/119-572..........VYPVVRWLVQHRRAKIVDIVNPGLKTIFALPSKFPAS.................................
U5HEM2_USTV1/112-634..........LRDVVQHLVYWRKGKIIGVVSL..KGVYTASSTIPLA.................................
G4MPF6_MAGO7/119-567NLAQ......VRRFAHHFIFWRRAIAIPPLHA..RDVYILSPNCDLS.................................
A0A0D1CR33_USTMA/205-718..........VYPMVRHLIYYRQARVIDVPRP..GHVYAISPLFDFA.................................
B6H909_PENRW/169-617PLSH......IQMLSSHLVYWRRARAIPPIHQ..RDTYVVSPNCDLS.................................
NPR3_ASPFU/179-636PLST......IQMLASHLVYWRRARAIPPIHQ..RDTYIVSPNCDLS.................................
C5DQJ7_ZYGRC/281-783QTNM......LRSCALHLLYRRHARLIIPISS..RNTYIVSPLAPIRGYSKNDYD.........................
C4JQY3_UNCRE/143-587PLSD......IQVLATHLIYWRRARAVPPLNK..QDTYIVSPNCDLS.................................
E7A1P0_SPORE/203-720..........VYPMVRHLIYYRQARVIDVPRP..GHVYAISPLFDFA.................................
G8ZWI0_TORDC/270-767QTSM......LRSCALHLLYRRHARVVIPISS..KCTYIVSPLAPIDGFSHDNDLD........................
C1GWB7_PARBA/152-590PLSD......IQVLASHLAYWRRARAVPPLSR..RDTYIVSPNADLN.................................
B2ALS2_PODAN/100-533SPTQ......VRKFAQHFIFWRRAIAIPPLHA..RDMYIVSPNCDMR.................................
G0RDM3_HYPJQ/95-508TLDQ......VRKYAQHFIFWRRAIAIPPLHP..RDVYIVSPNCDLE.................................
B6QRZ0_TALMQ/155-594PLDT......IHDLAQHLIYWRRARAIPPLHQ..RDTYIVSPNCDLS.................................
J8Q1I2_SACAR/396-963ESSI......LRSCALHLMYWRHARIVIPLSS..KYTYIVSPLAPIQGHTVDDFKSTSQNDEQV................
J7RBT2_KAZNA/205-696TYDI......LRSCAIHLIYWRYARVIIPLSS..KHIYIVSPLLSLD.................................
M1VZL7_CLAP2/99-560TSSQ......VREYAQHFIFWRRAIAVPPLHD..RDVYIVSPNCDVS.................................
F4P7C7_BATDJ/218-654..........IYRLAAHLYVWSKAKIIHVVSN..RNVYIVSPQAQLS.................................
NPR3_KLULA/205-723CETT......LKSLCLHLIYWRHARLILPISS..RNTYIVSPLAPISGFSTDDFKHGEYDTL..................
A7TP53_VANPO/308-811QVNI......LKYCALHLLYWRHARVISPINS..KNTYIVTPLAPIQGTAKDDTVSH.......................
NPR3_ASHGO/273-791QHSM......IRSIVLHLVYWRYARIILPLSS..KNTYIVSPLAPIRGTAADDFEN........................
G2R1J8_THITE/107-555TPAQ......VRKFAQHFIFWRRAIAIPPLHA..RDTYIVSPNCDLR.................................
J5JA21_BEAB2/104-534SLSQ......VRKFAQHFIFWRRAIAIPPLHA..RDTYIVSPNCDLA.................................
V5FG66_BYSSN/161-604PLSN......IQLLASHLVYWRRARAIPPLHQ..RDTYIVSPNCDLS.................................
I2H4A8_TETBL/339-898KINL......LKSCTLHLLYWRYVRVIIPISS..RNTYIISPLSPIQGSNKDLLITNKNCLKSYNDYNNKDNNENNNNND
G4U9V0_NEUT9/109-529SPAQ......VRRFAEHFIFWRRAIAIPPLHG..RDMYIVSPNCDLR.................................
A0A098D4P8_GIBZA/98-520TLGQ......VRKYAQHFIFWRRAIAIPPLHA..KDQYILSPNSDLS.................................
R7YHW5_CONA1/139-554KIQH......IQLLANHLIYWRRARAIPPLNH..RDTYIVSPNAGMR.................................
W1QEY3_OGAPD/185-592DIAE......VKLFANHLVYWRRAKAFLPLSP..RNVYIVSPLAPLS.................................
H1V255_COLHI/104-533TLSQ......VRKYAQHFIFWRRAIAIPPLHA..RDVYIMSPNCDTR.................................
T5A616_OPHSC/95-515TLGQ......VRKYAQHFIFWRRAIAIPPLHA..RDTYVVSPSCHLA.................................
D5G9F0_TUBMM/127-587PLHE......IQVMARHLVHWRKARAIPPIHQ..RDTYIVSPNADMKKFFPSIPLP........................
M7TWW8_EUTLA/45-472SPAQ......VRKYAQHFIFWRRAIAIPPLHA..RDTYVLSPNCDLA.................................
G0SXZ9_RHOG2/78-582..........LEDVVDHLVHWKKARVVDLVSL..KGAYAVSAEFEVK.................................
C0NJI2_AJECG/153-591PLSD......IQVLASHLVYWRRARAVPPLSQ..RDTYIVSPNADMS.................................
G1WZV0_ARTOA/142-590PHPENPEYQYIEYFARHLIYWRKARAIMPLHY..RRYYIVSPNADMK.................................
M7X5H8_RHOT1/78-583..........LEDIVDHLVHWKKARVVDLVSL..KGAYAVSAEFEVK.................................
NPR3_DEBHA/205-647DAGQ......IKSFAFHLIYWRRARVILPIST..RSVYIVSPMAPIT.................................
K0KSM9_WICCF/157-573DINQ......VKAFANHLIYWRRARSIIPLQA..KSVFIVSPMAPIE.................................
S9VYA1_SCHCR/73-478..........CFLLAKHLIHWRKAIAIPPLLI..RNTYVTSPTADLS.................................
K1XTL5_MARBU/116-531EVGS......LLILANHLIQYRRAVAIPPLHA..REIYIVSPNCDNR.................................
G8YSZ2_PICSO/187-642DLDQ......IKSFAFHLIYWRRARVILPLNP..RSVYIVSPMAPLT.................................
V2XGE3_MONRO/83-522..........VYPIVRWLVQHRRAKVVDIVHSGLKTVFMLPPKFDYP.................................

PF06218

M3IIL9_CANMX/8-518----------TKQCIQHLMHYKCIEIIDIFQF--SNIYAPTNHIGDF---------------------------------
M2UFV8_COCH5/4-472----------TRKAIQHLVYYGCLVLLDIFSF--GAIYAPTAEIGGF---------------------------------
Q6BQE8_DEBHA/7-469----------TKQCIQHLMHYKCINMIDIFQF--SNIYAPTNHIGNF---------------------------------
Q0U9Y5_PHANO/4-462----------TRRAIQHLVYYGCLVLLDIFSF--SAIYAPTAEIGGF---------------------------------
G3AQK3_SPAPN/8-551----------TKQCIQHLMHYKCIEIIDIFQF--SNIYAPTNHIGDF---------------------------------
W6RQZ3_CAEEL/186-593----------VARCVRNLHFYECVSLVPMFLY--YNTYVATERVHDF---------------------------------
A5DQL3_PICGU/6-475----------TKQCLQHLLYYRCIEILDIFQF--SNIYAPTNNISRF---------------------------------
K1Y0B6_MARBU/2-405----------TKIALQHLLYYDSILLLDLFLF--SNIYAPTPGVNDF---------------------------------

PF03666

Q5KFU1_CRYNJ/229-746...............NSSFDQYTARFARD---------------------------------------------------
S8E9R2_FOMPI/133-565..................MSALSADFDRR---------------------------------------------------
C5FU53_ARTOC/155-599.................KLTIATAAYEAT---------------------------------------------------
L8FQS0_PSED2/112-539.................SLPQFCALWSQK---------------------------------------------------
H2AZX0_KAZAF/181-685................KMYNVDKVQFKKR---------------------------------------------------
R9P8J9_PSEHS/205-717.................RLRPLSHVWAET---------------------------------------------------
F8PYL6_SERL3/132-564..................LSSLSIDFKRE---------------------------------------------------
N1J4X2_BLUG1/150-556.................KLPDAIKEWKEA---------------------------------------------------
E9EL47_METRA/99-518.................RLPKDAAEWQRA---------------------------------------------------
M9MFA0_PSEA3/199-702.................RLGALSRVWAHT---------------------------------------------------
NPR3_CANGA/243-797..ITDLNVTSNSSSKIPVIYLNQQSFKLK---------------------------------------------------
H6BW23_EXODN/130-559.................KLVSACKSYEAT---------------------------------------------------
G8BZL7_TETPH/286-791....FSFNRREDNHYEPLFYQHQIEFGQT---------------------------------------------------
G0WEJ7_NAUDC/230-810.............ENESKFVTDSISFKEK---------------------------------------------------
R8BC65_TOGMI/105-536.................QLPGASAVWARQ---------------------------------------------------
V5ETE4_PSEBG/203-712.................RLGPLSHVWARS---------------------------------------------------
G8JWB1_ERECY/316-852.......RDMDIVEGEALIYQNQEIFHSK---------------------------------------------------
C4QYA8_PICPG/201-611.................RLEVHSMEFRTK---------------------------------------------------
G8BGC4_CANPC/198-622................VRLYEDISEFNKK---------------------------------------------------
G0VDK5_NAUCC/193-728...............VDKFKEDELTFRDR---------------------------------------------------
S2K004_MUCC1/105-579.................DIASLEADFKLH---------------------------------------------------
NPR3_EMENI/170-616.................KLEVASAAYKVA---------------------------------------------------
E7KD88_YEASA/399-966KKMEDRENNKNGSDRVPLIYQNSMLFRSK---------------------------------------------------
B8N792_ASPFN/172-617.................KLEVATAAYQLA---------------------------------------------------
U1GT46_ENDPU/116-550.................KLSTAVKSYESA---------------------------------------------------
D8PLZ6_SCHCM/127-556..................LSELTAEFEQE---------------------------------------------------
I2G095_USTH4/203-726.................RLGPLSTIWAQT---------------------------------------------------
S6E8H4_ZYGB2/281-781.........GARFSGMPLIYQNQSIFKGK---------------------------------------------------
NPR3_PHANO/150-598.................LLPSAVTAYAQR---------------------------------------------------
U7Q027_SPOS1/110-529.................HLARASAVFAET---------------------------------------------------
A0A0C4E2D4_MAGP6/120-591.................KLPQASVKFARA---------------------------------------------------
S8B047_PENO1/186-645.................KLEIATIAYQAT---------------------------------------------------
C5DHQ6_LACTC/241-731.......NRLDSEESKPLILQNQEVFSKK---------------------------------------------------
E9D3F7_COCPS/142-585.................KLGLATAAYELA---------------------------------------------------
U4LL48_PYROM/132-582.................RVPQLIPVYSKT---------------------------------------------------
K2SR44_MACPH/175-626.................KLPQAIPAYASR---------------------------------------------------
S8BNA5_DACHA/141-592.................RLVPQSIIFNKL---------------------------------------------------
D6RLY8_COPC7/119-572..................LSTLSHQFNQQ---------------------------------------------------
U5HEM2_USTV1/112-634.................SLAQLTIDFGTQ---------------------------------------------------
G4MPF6_MAGO7/119-567.................KLPSASLDFSRA---------------------------------------------------
A0A0D1CR33_USTMA/205-718.................RLGSLSYNWAQT---------------------------------------------------
B6H909_PENRW/169-617.................KLEIATIAYQTA---------------------------------------------------
NPR3_ASPFU/179-636.................KLEVATAAYQAA---------------------------------------------------
C5DQJ7_ZYGRC/281-783.........GLQNSSMPLIYQNQTIFKER---------------------------------------------------
C4JQY3_UNCRE/143-587.................KLPLATAAYEAA---------------------------------------------------
E7A1P0_SPORE/203-720.................RLGALSRVWAHA---------------------------------------------------
G8ZWI0_TORDC/270-767........SVENHMERPLIYQNQEIFKKR---------------------------------------------------
C1GWB7_PARBA/152-590.................KLAQATEAYEAA---------------------------------------------------
B2ALS2_PODAN/100-533.................KLPQAAAHWARQ---------------------------------------------------
G0RDM3_HYPJQ/95-508.................RLPQDAQDWQRA---------------------------------------------------
B6QRZ0_TALMQ/155-594.................QLKKATQSYATT---------------------------------------------------
J8Q1I2_SACAR/396-963NTMGNGKNNVDQSDNIPLIYQNSILFRSK---------------------------------------------------
J7RBT2_KAZNA/205-696................LCYSGDEKKFREK---------------------------------------------------
M1VZL7_CLAP2/99-560.................RLPQDTVEWQRA---------------------------------------------------
F4P7C7_BATDJ/218-654.................ELPKLSTEFSSR---------------------------------------------------
NPR3_KLULA/205-723..IRQQEVPVNNNDEPSLIYQNKKVFNEK---------------------------------------------------
A7TP53_VANPO/308-811.......HHINKDNPKTLIYQNEDIFKKA---------------------------------------------------
NPR3_ASHGO/273-791.......TDMVKQGCKALIYQHQDLFHEK---------------------------------------------------
G2R1J8_THITE/107-555.................KLPQASAEWARQ---------------------------------------------------
J5JA21_BEAB2/104-534.................RLPEAAVEWQRA---------------------------------------------------
V5FG66_BYSSN/161-604.................KIEAATAAYAAA---------------------------------------------------
I2H4A8_TETBL/339-898RYHSNKSTDSKVENKKPLIYQYQDMFKET---------------------------------------------------
G4U9V0_NEUT9/109-529.................RLPQAAAQWARQ---------------------------------------------------
A0A098D4P8_GIBZA/98-520.................RLPLDTLEWQRA---------------------------------------------------
R7YHW5_CONA1/139-554.................ALPSAIVGYAAR---------------------------------------------------
W1QEY3_OGAPD/185-592.................DVYKDSNLFKQH---------------------------------------------------
H1V255_COLHI/104-533.................NLPKASLEWQKT---------------------------------------------------
T5A616_OPHSC/95-515.................HLPSASQEWQRA---------------------------------------------------
D5G9F0_TUBMM/127-587........ITIVLTDQPRLHTLIPIYNTL---------------------------------------------------
M7TWW8_EUTLA/45-472.................ELPRASQAWARA---------------------------------------------------
G0SXZ9_RHOG2/78-582.................RLPSLVASFSDI---------------------------------------------------
C0NJI2_AJECG/153-591.................KLAQAAEVYEAA---------------------------------------------------
G1WZV0_ARTOA/142-590.................RLVSQSIVFARL---------------------------------------------------
M7X5H8_RHOT1/78-583.................RLPSLVASFSDT---------------------------------------------------
NPR3_DEBHA/205-647................LKFHHDIFIFKKT---------------------------------------------------
K0KSM9_WICCF/157-573.................YINEDMKSFRHD---------------------------------------------------
S9VYA1_SCHCR/73-478.................KLESDARLFART---------------------------------------------------
K1XTL5_MARBU/116-531.................KLPVASLAWKKA---------------------------------------------------
G8YSZ2_PICSO/187-642................IRLYEDISKFKDM---------------------------------------------------
V2XGE3_MONRO/83-522..................LSQLIKEFERD---------------------------------------------------

PF06218

M3IIL9_CANMX/8-518------------LRFDGKMAEECQAYVVATETNTTETPFYS....NASSQIHS.PHPGNGDHLPTYNYKQSF.GSASVSP
M2UFV8_COCH5/4-472------------IIDA.EVKDECMRYVRVPRMKL.......................................GPNAKSA
Q6BQE8_DEBHA/7-469------------LTLN.NIAEECQAYIITNEPNLL.NELPV....NEDSDIQS................STF..PNSASP
Q0U9Y5_PHANO/4-462------------VLDP.DVKDECARYIRVPRLRL.......................................GSAATAS
G3AQK3_SPAPN/8-551------------LKINGKMAEECQAYVVTSESNIEGSSYFS....HTPSTYHN.............NNTSSFHGSNSVSP
W6RQZ3_CAEEL/186-593------------YKNQTEIND.CLEFVKIQ..................................................
A5DQL3_PICGU/6-475------------LTVP.DIAEDCQAYIVTDSGERL.ADLPTGSMENSASGVSSVVGSAPLQRSSEASPVSTF...NSVSP
K1Y0B6_MARBU/2-405------------VADRDGLQDECANYVYINGPRL..............................................

PF03666

Q5KFU1_CRYNJ/229-746-----------------------------------------F..PDLPPFPRFISAISLS...............PIPFR
S8E9R2_FOMPI/133-565-----------------------------------------FAEHDVPPLPKILSMVSMSIHQ.........QSANHFYG
C5FU53_ARTOC/155-599-----------------------------------------F..PTLPSLPKMLSALSCGS..............PRPYY
L8FQS0_PSED2/112-539-----------------------------------------F..PLAPPLPTLLSALS.HA..............PRPYK
H2AZX0_KAZAF/181-685-----------------------------------------F..PSLPTLSYFLSKLSGGKSSINTSKDGDDIKWPYSFN
R9P8J9_PSEHS/205-717-----------------------------------------F..PDLAPLPVFLSQLSSST..............SRTLS
F8PYL6_SERL3/132-564-----------------------------------------FPHPSIPHLPTILSNVSTATSK.........QSDNHFFA
N1J4X2_BLUG1/150-556-----------------------------------------F..PTAPSLRSFLSALS.TD..............PRPYK
E9EL47_METRA/99-518-----------------------------------------F..PLAPPLPNFLSELS.YT..............PRPYK
M9MFA0_PSEA3/199-702-----------------------------------------F..PELAPLPVFLSQLSSS...............SRALS
NPR3_CANGA/243-797-----------------------------------------F..PSLPSLPTFLNILSLGK..............PKAFG
H6BW23_EXODN/130-559-----------------------------------------F..PMMPSLPKMLNSLS.GT..............PVPYG
G8BZL7_TETPH/286-791-----------------------------------------F..PSLPSLVSFLSLLSNGK..............PRPFG
G0WEJ7_NAUDC/230-810-----------------------------------------F..PLLPTLENMLSIISNNGT...........GKVECFN
R8BC65_TOGMI/105-536-----------------------------------------F..PFAPPLPNFLADLS.AA..............PRLYK
V5ETE4_PSEBG/203-712-----------------------------------------F..PDVAPLPVFLSQLSSS...............SRAFY
G8JWB1_ERECY/316-852-----------------------------------------F..PTLPTLPSFLSSISTLK..............PRSFG
C4QYA8_PICPG/201-611-----------------------------------------F..PSLPVLSKFLSLLSTSSN............KPKQIS
G8BGC4_CANPC/198-622-----------------------------------------F..PTLPSLPHFLKLLSPKSR............KPQQFA
G0VDK5_NAUCC/193-728-----------------------------------------F..SSLPSLPILLSSISKNSE...........QNKMFFN
S2K004_MUCC1/105-579-----------------------------------------I..PNL.SLPVLLSKLSH................AQQYH
NPR3_EMENI/170-616-----------------------------------------F..PTLPSLPKMLSALS.GT..............PRPYG
E7KD88_YEASA/399-966-----------------------------------------F..PSLPSLPIFLSLLSTDK..............PQAYS
B8N792_ASPFN/172-617-----------------------------------------F..PTLPSLPKMLSALS.GT..............PRPYG
U1GT46_ENDPU/116-550-----------------------------------------F..PTLPSLPKMLQALS.GI..............PRPYS
D8PLZ6_SCHCM/127-556-----------------------------------------FTDPSVASLPEILSLISTAPSK.........QSDNHFYA
I2G095_USTH4/203-726-----------------------------------------F..PDMVPLPVFLSQLSSS...............ARPLS
S6E8H4_ZYGB2/281-781-----------------------------------------F..PTLPSLPSFLQLLSTGR..............PKPYG
NPR3_PHANO/150-598-----------------------------------------F..PTLPTLPKVLNMLS.GT..............PRPFR
U7Q027_SPOS1/110-529-----------------------------------------F..PFAPPLPDLLASLS.SA..............PRPYK
A0A0C4E2D4_MAGP6/120-591-----------------------------------------F..PHCPPLPNILADLS.AA..............PRPYK
S8B047_PENO1/186-645-----------------------------------------F..PTLPSLPKMLSALS.GT..............PRPYG
C5DHQ6_LACTC/241-731-----------------------------------------F..PSLPPLPVFLSLVSSMK..............PRAFG
E9D3F7_COCPS/142-585-----------------------------------------F..PTMPSLPKMLAVLS.GT..............PRPYA
U4LL48_PYROM/132-582-----------------------------------------F..PTMPGLEKMLGMLS.GP..............PRSFA
K2SR44_MACPH/175-626-----------------------------------------F..PTLPSLPKMLSLLSNQS..............PRTYG
S8BNA5_DACHA/141-592-----------------------------------------F..PALPPLPKMLSLLS.GK..............PRPYS
D6RLY8_COPC7/119-572-----------------------------------------FNHPAIPSLPRILAAISYSLAQ.........QSNNHFFA
U5HEM2_USTV1/112-634-----------------------------------------F..QDLPSLPVLLSKLSP................SAPFS
G4MPF6_MAGO7/119-567-----------------------------------------F..PHCPPLPNILTDLS.AA..............PRPYK
A0A0D1CR33_USTMA/205-718-----------------------------------------F..PDVAPLPVFLSQLSSST..............SRTLS
B6H909_PENRW/169-617-----------------------------------------F..PTYPSLPKMLSTLS.GT..............PRPYS
NPR3_ASPFU/179-636-----------------------------------------F..PTLPSLPKMLSALS.GT..............PRPYG
C5DQJ7_ZYGRC/281-783-----------------------------------------F..PTLPSLPSFLHLLSNGK..............PKPYG
C4JQY3_UNCRE/143-587-----------------------------------------F..PTMPSLPKMLAMLS.GT..............PRPYA
E7A1P0_SPORE/203-720-----------------------------------------F..PDVAPLPVFLSQLSSS...............SRALS
G8ZWI0_TORDC/270-767-----------------------------------------F..PSLPSLISFLNLLSCKK..............PKPFG
C1GWB7_PARBA/152-590-----------------------------------------F..PTLPSLPKMLHALS.DT..............PKPYS
B2ALS2_PODAN/100-533-----------------------------------------F..PLVPALPSFLAELS.VA..............PRPYK
G0RDM3_HYPJQ/95-508-----------------------------------------F..PLAPPLSTFLAELS.VL..............PRPYK
B6QRZ0_TALMQ/155-594-----------------------------------------F..PTLPSLPKMLSALS.GT..............PRPYA
J8Q1I2_SACAR/396-963-----------------------------------------F..PLLPALPIFLNLISADK..............PQAYN
J7RBT2_KAZNA/205-696-----------------------------------------F..SSLPSLAYFLSRLSGSTSMENA...QNGGTHPRQFG
M1VZL7_CLAP2/99-560-----------------------------------------F..PQAPTLPNFLSELS.QA..............PRPFK
F4P7C7_BATDJ/218-654-----------------------------------------F..PQM.ELVRILQDLSI................PRPYS
NPR3_KLULA/205-723-----------------------------------------F..PSLPSLPSFLQLMSTQK..............PRPFG
A7TP53_VANPO/308-811-----------------------------------------F..PSLPPLVSFLSLLSNGK..............PHPFG
NPR3_ASHGO/273-791-----------------------------------------F..PTLPTLPSFLSSISTCK..............PRSFG
G2R1J8_THITE/107-555-----------------------------------------F..PLSPALPNFLAELS.VA..............PRPYK
J5JA21_BEAB2/104-534-----------------------------------------F..PLAPPLANLLSDMS.VC..............PRPYK
V5FG66_BYSSN/161-604-----------------------------------------F..PTLPSLPKMLSALS.RT..............PRPYG
I2H4A8_TETBL/339-898-----------------------------------------F..PSLPILPLFLNLLSNGK..............PKPYG
G4U9V0_NEUT9/109-529-----------------------------------------F..PLSPPLPNFLAELS.VA..............PRPYK
A0A098D4P8_GIBZA/98-520-----------------------------------------F..PLAPPLPNFLAELS.QA..............PRPYK
R7YHW5_CONA1/139-554-----------------------------------------F..PTLPPLMKMLERLS.GA..............PRPYG
W1QEY3_OGAPD/185-592-----------------------------------------F..PNLPPLANFLSLISSSSS............KPRPIN
H1V255_COLHI/104-533-----------------------------------------F..PLAPPLTNFLAELS.YA..............PRPYK
T5A616_OPHSC/95-515-----------------------------------------F..PVAPPLPNFLAELS.MC..............PKPYK
D5G9F0_TUBMM/127-587-----------------------------------------F..PTLQPLPKLLTLLS.SK..............PKPFS
M7TWW8_EUTLA/45-472-----------------------------------------F..PLAPPLPNFLADLS.TA..............PRHYK
G0SXZ9_RHOG2/78-582-----------------------------------------F..PNLPPLPVLLSQLSP................AEPFA
C0NJI2_AJECG/153-591-----------------------------------------F..PTLPSLPKMLHALS.DT..............PKPYS
G1WZV0_ARTOA/142-590-----------------------------------------F..PALPPLPKMLSLLS.GK..............PRPYS
M7X5H8_RHOT1/78-583-----------------------------------------F..PALPPLPVLLSQLSP................AEPFA
NPR3_DEBHA/205-647-----------------------------------------F..PALPSLPHFLKLLSNSS.............KPRQLA
K0KSM9_WICCF/157-573-----------------------------------------F..PSLPSLPSFISLISTSK..............PRQYS
S9VYA1_SCHCR/73-478-----------------------------------------F..PSLPSLPTFLAILSFK...............PRPFV
K1XTL5_MARBU/116-531-----------------------------------------F..PLAPSLSNFLATLS.VA..............PRQYK
G8YSZ2_PICSO/187-642-----------------------------------------F..PTMPSLPHFLALLSSPSK............KPRQFA
V2XGE3_MONRO/83-522-----------------------------------------FSESNLPPLPQILSAISTSSAN.........QSGNHFFA

PF06218

M3IIL9_CANMX/8-518YT................KTNFLSKSPKNTIFGNA...HTEVQVPTKTTLFYLYRSLNQ...............-....G
M2UFV8_COCH5/4-472VG................STLKISEFDAHIAAQKKEEEEEKAIQTSHETLITLYTSLRQ...............-....G
Q6BQE8_DEBHA/7-469TS................KHSSIFKASKKKFSGET......TVIPSKASLFYLYRSLNQ...............-....G
Q0U9Y5_PHANO/4-462..................TTILEHPSPSSPTAASTDDDKEEEWHIPHTTLIHLYTSLRQ...............-....G
G3AQK3_SPAPN/8-551YSTAGLKYDSVSSSYPKPSSSYLSKSPKTV..GNSPNISVNVKVPTKTTLFYLYRSLNQ...............-....G
W6RQZ3_CAEEL/186-593..............................TEIGADGSEIPTRTPEFSDVFRLYLSMKVVGPKLPIDESDSNRL-RFQCG
A5DQL3_PICGU/6-475LA................RTSYFSSSSATTAKPRT......IHVPSKATLFYLYRSLNQ...............-....G
K1Y0B6_MARBU/2-405.............................................PNFYLCRLFTSLAT...............-....S

PF03666

Q5KFU1_CRYNJ/229-746KVIPNPDPDHATREK---------YMSALLWLLKQDLVVQVHTRARV---------------------------------
S8E9R2_FOMPI/133-565TVVGS..KER..IPL---------YQDVVVWMLKRDLLLTLHLRIRI---------------------------------
C5FU53_ARTOC/155-599SFIPS..RDH..KEV---------YYEILAWLVRGGWVTQLRTFGWV---------------------------------
L8FQS0_PSED2/112-539TFIPT..KTH..RPI---------YTAMLAFLLRHGWATQLRTFAWI---------------------------------
H2AZX0_KAZAF/181-685NIIPS..REH..KGI---------YLDVLSWLIRRGYVTQLLTFVYI---------------------------------
R9P8J9_PSEHS/205-717NLLPA..RHQ..KEL---------ALDVLIWLLRRDVVVKMHVRLRL---------------------------------
F8PYL6_SERL3/132-564TVVQS..KEL..IPL---------YHDVVLWMLKHELLLTLHLRIRI---------------------------------
N1J4X2_BLUG1/150-556TFLPS..RDH..RLV---------YIEMLSWLIRGGWVTQLRTFAWI---------------------------------
E9EL47_METRA/99-518TFCPS..KPH..RPL---------YLRMLAWLLRGGWVTQLCTFAYV---------------------------------
M9MFA0_PSEA3/199-702ALFPG..RHQ..REL---------ALEVLIWLLRRDVVVKMHIRLRL---------------------------------
NPR3_CANGA/243-797NIIPS..KEH..KPI---------YMAALIWLIQKGYLTQLLTFVYI---------------------------------
H6BW23_EXODN/130-559TLIPS..SDH..KEE---------YYRVLAWLMRDGWVTQLRTFAFV---------------------------------
G8BZL7_TETPH/286-791TIIPS..KEH..KPI---------YLGALAWLIRSGYLTQLLTYVCI---------------------------------
G0WEJ7_NAUDC/230-810NIIPT..REH..KPT---------YLGALAWLIRYGYVTPLLSFIYI---------------------------------
R8BC65_TOGMI/105-536TFSPG..KSY..RPA---------YLTMLAWLMRGGWVTQLCTFAYV---------------------------------
V5ETE4_PSEBG/203-712ALFPA..RHQ..REL---------ALDVLIWLLRREVVVKMHIRLRL---------------------------------
G8JWB1_ERECY/316-852HLIPS..KEH..KFL---------YLNALSWLIRYGYLTQLLTFVWI---------------------------------
C4QYA8_PICPG/201-611RFIPS..KDH..RDL---------YLDAVSWLLKKGYILQLHTFLFL---------------------------------
G8BGC4_CANPC/198-622ASIPS..RDH..RDS---------YMRALAWLNRFGYATQQLTFIWL---------------------------------
G0VDK5_NAUCC/193-728NVIPS..KEH..KPI---------YLGALAWLIKHGYMTQLLTFIYI---------------------------------
S2K004_MUCC1/105-579LVYHV..KEL..KNQ---------YLEAITYLIRKDLVVQLHMYLVL---------------------------------
NPR3_EMENI/170-616NFIPS..KDH..KAT---------YFLILAWLLRGGWVTQLRSFARV---------------------------------
E7KD88_YEASA/399-966NIIPS..REH..KPV---------YLNALAWLIQYGYVTQLLTFINI---------------------------------
B8N792_ASPFN/172-617SFIPS..KDH..KEA---------YFAILAWLLRGGWVTQLRTFARV---------------------------------
U1GT46_ENDPU/116-550SLIPS..KDH..KQA---------YFRILAWLLRGGWVTQLRSFAFV---------------------------------
D8PLZ6_SCHCM/127-556TVVQS..RDL..IPI---------YHDVVLWMLKRGLLIRLSLRIRI---------------------------------
I2G095_USTH4/203-726TYFPS..RHQ..REL---------ALDVLIWLLRREVVVKMHIRLRL---------------------------------
S6E8H4_ZYGB2/281-781NIIPS..KEH..KSI---------YLGALSWLLRYGYVTQLLTFVCI---------------------------------
NPR3_PHANO/150-598NFIPT..TEH..REA---------YMDILAWLMRGGWVTQLRTFAWV---------------------------------
U7Q027_SPOS1/110-529SFCPT..KSL..RPA---------YLRILAWLIRGGWVCQLCTFAYV---------------------------------
A0A0C4E2D4_MAGP6/120-591FFCPN..KTI..RAE---------YMRILTWLMRGGWVTQLCTFAYV---------------------------------
S8B047_PENO1/186-645SFIPS..KDH..KET---------YFSILAWLLRGGWVTQLRSFARV---------------------------------
C5DHQ6_LACTC/241-731SIIPS..KDH..KSV---------YLSALAWLIRYGYLTQLLTFAWV---------------------------------
E9D3F7_COCPS/142-585SFIPS..RDH..KGI---------YYDILAWLMRGGWVTQLRTFGWI---------------------------------
U4LL48_PYROM/132-582SFIPS..KDH..RGA---------YLEILAWLIRHSLVTELRTFAWI---------------------------------
K2SR44_MACPH/175-626TIIPS..KDH..RTA---------YMEILAWLMRGGWVTQLRTFAWI---------------------------------
S8BNA5_DACHA/141-592AYIPS..KDH..RQA---------YMEMLAWLMRYGWVTNLLTFAFL---------------------------------
D6RLY8_COPC7/119-572AVVQR..KEL..IPM---------YHDVVLWMLKRELLITLHLRIRI---------------------------------
U5HEM2_USTV1/112-634SVIPP..DSRPLRTT---------YYNALLFLLRNNLVEKQRTFVRL---------------------------------
G4MPF6_MAGO7/119-567FFCPN..KTI..RAE---------YMRILAWLMRGGWVTQLCTFAYV---------------------------------
A0A0D1CR33_USTMA/205-718NLFPA..RHQ..REL---------ALEVLIWLLRHEVVVKMHIRLRL---------------------------------
B6H909_PENRW/169-617NFIPS..KDH..KEI---------YFTILAWLLRGGWVTQLRTFARI---------------------------------
NPR3_ASPFU/179-636SFIPS..KDH..KET---------YFAILAWLLRGGWVTQLRSFARV---------------------------------
C5DQJ7_ZYGRC/281-783NIIPS..KEH..KSI---------YLGALAWLLKYGYVTQLLTFVCI---------------------------------
C4JQY3_UNCRE/143-587YFIPS..REH..KDV---------YYDILAWLMRGGWVTQLRTFGWL---------------------------------
E7A1P0_SPORE/203-720ALFPA..RHQ..REL---------ALDVLVWLLRHDVVVKMHIRLRL---------------------------------
G8ZWI0_TORDC/270-767SIIPS..KEH..KPI---------YLGALTWLMRYGYVTQLLTFVCI---------------------------------
C1GWB7_PARBA/152-590RLIPS..RDH..KET---------YYDILAWLLRGGWVTQLRTFGWV---------------------------------
B2ALS2_PODAN/100-533LHCPS..KAH..RPT---------YMAMLAWLIRGGWVTQICTFAYV---------------------------------
G0RDM3_HYPJQ/95-508HISPS..KAH..RPL---------YLRMLAWLMRGGWVTQLCTFAYV---------------------------------
B6QRZ0_TALMQ/155-594TFIPS..KDH..KET---------YFAILAWLLRGGWVTQLRTFSRV---------------------------------
J8Q1I2_SACAR/396-963NIIPS..REH..RPI---------YLNALAWLIKFGYATQLLTFINI---------------------------------
J7RBT2_KAZNA/205-696ALIPS..KEH..KGA---------YLNALSWLVRHGYVCQLLTFALI---------------------------------
M1VZL7_CLAP2/99-560SFCPS..KPQ..RPL---------YLSMLAWLLRGGWVTQLCTFAYV---------------------------------
F4P7C7_BATDJ/218-654AIAHS..KEN..RNL---------YLEIITFLLRKNLVVQLHMYIYL---------------------------------
NPR3_KLULA/205-723HIIPS..NEH..KSM---------YLNALAWLMRYGYLTQLLTFVYV---------------------------------
A7TP53_VANPO/308-811TIIPS..KEH..KPI---------YLGALAWLIRYGYVTQLFTYVCI---------------------------------
NPR3_ASHGO/273-791HLIPS..KDH..NLL---------YLSVLAWLIRYGYLTQLLTFVWL---------------------------------
G2R1J8_THITE/107-555LHCPS..KAH..RPV---------YMAMLAWLMRGGWVTQLCTFAYV---------------------------------
J5JA21_BEAB2/104-534TFCPS..KVH..RPL---------YLRMLAWLMRGGWVTQLCTFAYV---------------------------------
V5FG66_BYSSN/161-604SFIPS..NDH..KEA---------YFSILAWLLRGGWVTQLRAFARV---------------------------------
I2H4A8_TETBL/339-898IIIPS..KDH..KPI---------YLKALSWLLRNGFVYQQLTFICI---------------------------------
G4U9V0_NEUT9/109-529LHCPS..KAH..RPL---------YMAMLAWLMRGGWVTQLCTFAYV---------------------------------
A0A098D4P8_GIBZA/98-520QFSPS..KAH..RPT---------YLLMLAWLMRRGWVTQLCTFAYV---------------------------------
R7YHW5_CONA1/139-554SFIPS..KDH..RSA---------YMEILAWLMRGGWVTQLRTFAWV---------------------------------
W1QEY3_OGAPD/185-592TIIPS..KDH..RDL---------YLDAVAWLLRHGYITQLQTFLYL---------------------------------
H1V255_COLHI/104-533HFCPS..KAH..RPT---------YLAMLAWLMRGAWVTQLCTFAYV---------------------------------
T5A616_OPHSC/95-515TFCPS..KAH..RQL---------YLRMLAWLMRGGWVTQLCTFGYV---------------------------------
D5G9F0_TUBMM/127-587AFIPS..RAH..RPA---------YLEILAFLIRHGLATQLRNFAWL---------------------------------
M7TWW8_EUTLA/45-472WHSPS..KNH..RPA---------YLAMLAWLMRGGWVTQLCTFAYV---------------------------------
G0SXZ9_RHOG2/78-582SIVPS..AQ...RAS---------YLNALVWLLQHEVVEKQRTYVRI---------------------------------
C0NJI2_AJECG/153-591RLIPS..RDH..KDT---------YYAILAWLLRGGWVTQLRTFGWV---------------------------------
G1WZV0_ARTOA/142-590AYIPS..KDH..RQA---------YMDMLAWLMRYGWVTNLLTFAYL---------------------------------
M7X5H8_RHOT1/78-583SIVRS..AQ...RAS---------YLNALVWLLQHEVVEKQRTYVRI---------------------------------
NPR3_DEBHA/205-647TVIPS..KDH..RDA---------YLNALSWLIRYGYVTQLHTFIWL---------------------------------
K0KSM9_WICCF/157-573AIIPS..RDH..RDL---------YLEALAWLIRHGYVTQLMTFVWL---------------------------------
S9VYA1_SCHCR/73-478SIIPS..KDH..EST---------YLEMLAWLCRRNWVYEQNSYIYV---------------------------------
K1XTL5_MARBU/116-531IHAPS..KDH..RPT---------YLDMLAWLIRGGWVTQLRSFAWI---------------------------------
G8YSZ2_PICSO/187-642SIIPS..KDH..KDI---------YLLALAWLIRHGYVTQLLTFIWL---------------------------------
V2XGE3_MONRO/83-522SVVQS..KDM..IPT---------YHEVVVWMLKRDMLTTLHLRIRI---------------------------------

PF06218

M3IIL9_CANMX/8-518QTVKEWYIQQ--SKL....LANIDIRRFINFGILRGIIYRVYSYPLLNS...............................
M2UFV8_COCH5/4-472LTLKNWVLEN--LDL....LSGIDVRRLITFGVIKGFLYRHLQQQQQSSPHHLGAPKTEEAHHQLLHNSGIIDDRDTSG.
Q6BQE8_DEBHA/7-469QTVKEWYMQH--RKY....LNNIDVRRFINFGVIRGILYRVHSYPILNS...............................
Q0U9Y5_PHANO/4-462LTLKNWVLAN--LSH....LPGIDVRRLITFGVIKGFVYRVHKYAIASTSAGSTAPPTSLA..........TSTREETGA
G3AQK3_SPAPN/8-551QTVKEWYIQH--RKL....LTSIDIRRFINFGVLRGIIYRVHSYPLVNS...............................
W6RQZ3_CAEEL/186-593NNLAEWADLE--KPR....SMGIDEQRLVQFGMHHQFLRKLSKYPICVANPGNNT.........................
A5DQL3_PICGU/6-475QTIREWYVQH--RKQ....LQFIDVRRFITFGVLRGLIYRVHSYPISDP...............................
K1Y0B6_MARBU/2-405RTVKEWLKLH--IDQGFPVLNFVDVRRFIQFGIIKGLIYRVHKYAVSPA.................YVKSLVTGRNKVGG

PF03666

Q5KFU1_CRYNJ/229-746-----------------------------------------FAKSEIKV-------
S8E9R2_FOMPI/133-565-----------------------------------------VATEELKH-------
C5FU53_ARTOC/155-599-----------------------------------------KVSPEVKS-------
L8FQS0_PSED2/112-539-----------------------------------------IAWPEIKY-------
H2AZX0_KAZAF/181-685-----------------------------------------RIDKRIKI-------
R9P8J9_PSEHS/205-717-----------------------------------------VATESVMR-------
F8PYL6_SERL3/132-564-----------------------------------------VATSELKK-------
N1J4X2_BLUG1/150-556-----------------------------------------QVWPEIQY-------
E9EL47_METRA/99-518-----------------------------------------VVWPEILY-------
M9MFA0_PSEA3/199-702-----------------------------------------FATEAVKR-------
NPR3_CANGA/243-797-----------------------------------------RVDKKIKM-------
H6BW23_EXODN/130-559-----------------------------------------RVGPEVKK-------
G8BZL7_TETPH/286-791-----------------------------------------RIDSQIKM-------
G0WEJ7_NAUDC/230-810-----------------------------------------RVDKKIKM-------
R8BC65_TOGMI/105-536-----------------------------------------VVWPEIIY-------
V5ETE4_PSEBG/203-712-----------------------------------------IATESVKR-------
G8JWB1_ERECY/316-852-----------------------------------------RVDRRIKV-------
C4QYA8_PICPG/201-611-----------------------------------------IISKEIKM-------
G8BGC4_CANPC/198-622-----------------------------------------KIARKIKI-------
G0VDK5_NAUCC/193-728-----------------------------------------RVDKRIKM-------
S2K004_MUCC1/105-579-----------------------------------------LVPPNKKQ-------
NPR3_EMENI/170-616-----------------------------------------KVSPEIKM-------
E7KD88_YEASA/399-966-----------------------------------------RVDKHIKM-------
B8N792_ASPFN/172-617-----------------------------------------KVSPEIKM-------
U1GT46_ENDPU/116-550-----------------------------------------RIDSSIKI-------
D8PLZ6_SCHCM/127-556-----------------------------------------VATRELKE-------
I2G095_USTH4/203-726-----------------------------------------IATENVKR-------
S6E8H4_ZYGB2/281-781-----------------------------------------RVDRQIKM-------
NPR3_PHANO/150-598-----------------------------------------RVTPEIKA-------
U7Q027_SPOS1/110-529-----------------------------------------VVWPEIQY-------
A0A0C4E2D4_MAGP6/120-591-----------------------------------------VVWPEIIY-------
S8B047_PENO1/186-645-----------------------------------------KVSPEIKL-------
C5DHQ6_LACTC/241-731-----------------------------------------RVDSRIKI-------
E9D3F7_COCPS/142-585-----------------------------------------KVDQELKS-------
U4LL48_PYROM/132-582-----------------------------------------KIPRHIKQ-------
K2SR44_MACPH/175-626-----------------------------------------RVSPEVQA-------
S8BNA5_DACHA/141-592-----------------------------------------KIPKDIKV-------
D6RLY8_COPC7/119-572-----------------------------------------VVTPEIKQ-------
U5HEM2_USTV1/112-634-----------------------------------------IASEAIKK-------
G4MPF6_MAGO7/119-567-----------------------------------------VVWPEIIY-------
A0A0D1CR33_USTMA/205-718-----------------------------------------IATESVKR-------
B6H909_PENRW/169-617-----------------------------------------KVSPEIKM-------
NPR3_ASPFU/179-636-----------------------------------------KVTPEIKM-------
C5DQJ7_ZYGRC/281-783-----------------------------------------RVDRQIKM-------
C4JQY3_UNCRE/143-587-----------------------------------------KVDPEVKS-------
E7A1P0_SPORE/203-720-----------------------------------------IATEAVKR-------
G8ZWI0_TORDC/270-767-----------------------------------------RVDKQIKM-------
C1GWB7_PARBA/152-590-----------------------------------------RVSPEIKQ-------
B2ALS2_PODAN/100-533-----------------------------------------VVWPEIIY-------
G0RDM3_HYPJQ/95-508-----------------------------------------VVWPEILY-------
B6QRZ0_TALMQ/155-594-----------------------------------------KVTPEIKF-------
J8Q1I2_SACAR/396-963-----------------------------------------RVDKHIKM-------
J7RBT2_KAZNA/205-696-----------------------------------------RIDRKIKI-------
M1VZL7_CLAP2/99-560-----------------------------------------VVWPEILY-------
F4P7C7_BATDJ/218-654-----------------------------------------SVPARLLA-------
NPR3_KLULA/205-723-----------------------------------------RVDKRIKI-------
A7TP53_VANPO/308-811-----------------------------------------RVDKQIKM-------
NPR3_ASHGO/273-791-----------------------------------------RVDRRIKI-------
G2R1J8_THITE/107-555-----------------------------------------VVWPEIIY-------
J5JA21_BEAB2/104-534-----------------------------------------VVWPEIIY-------
V5FG66_BYSSN/161-604-----------------------------------------KITPEVKM-------
I2H4A8_TETBL/339-898-----------------------------------------RVDKQVKM-------
G4U9V0_NEUT9/109-529-----------------------------------------VVWPEIIY-------
A0A098D4P8_GIBZA/98-520-----------------------------------------VVWPEILY-------
R7YHW5_CONA1/139-554-----------------------------------------RVSAKVKG-------
W1QEY3_OGAPD/185-592-----------------------------------------RITKEVKI-------
H1V255_COLHI/104-533-----------------------------------------VVWPEIIY-------
T5A616_OPHSC/95-515-----------------------------------------VVWPEILY-------
D5G9F0_TUBMM/127-587-----------------------------------------RVTRQIKR-------
M7TWW8_EUTLA/45-472-----------------------------------------VVWPEILY-------
G0SXZ9_RHOG2/78-582-----------------------------------------VASEEIKR-------
C0NJI2_AJECG/153-591-----------------------------------------RVDPEIKR-------
G1WZV0_ARTOA/142-590-----------------------------------------KIPKDIKV-------
M7X5H8_RHOT1/78-583-----------------------------------------VASEEIKR-------
NPR3_DEBHA/205-647-----------------------------------------KISRKIKM-------
K0KSM9_WICCF/157-573-----------------------------------------KISNRIKL-------
S9VYA1_SCHCR/73-478-----------------------------------------CVTPEIKE-------
K1XTL5_MARBU/116-531-----------------------------------------LVWPEIIY-------
G8YSZ2_PICSO/187-642-----------------------------------------KVSKKVKI-------
V2XGE3_MONRO/83-522-----------------------------------------VATAQLKA-------

PF06218

M3IIL9_CANMX/8-518............ITSSIERDDTKTYDELMNKLKRKKSRR..KVNLGPHNDNLLKTK
M2UFV8_COCH5/4-472..........LPLLKFL..DGMHCFDEICTDL.........GLAERVVEGKIRGM.
Q6BQE8_DEBHA/7-469............LTKSLENKNDNELDKIIDLFKAKTNPNVYPVNESLANKSLLKSI
Q0U9Y5_PHANO/4-462EGMGMGTENALPMLRFL..DGLCCFDQICVEL.........GVPERTVEGRVKGLG
G3AQK3_SPAPN/8-551............LTRSIESGDLAQYDEFLGSYKEKKSKK..KVKVKHTDESLLKTK
W6RQZ3_CAEEL/186-593............LLKRC..NGKTSIDELSLQH.........NVDPEQLCSLLEETG
A5DQL3_PICGU/6-475............LVKAIESDTLQELDEAMKEKIEKLKERT.KSNSHVNNPRVVRTP
K1Y0B6_MARBU/2-405ADL.........MLKYL..NGCHSFDQIVTEN.........NIGEPKIREHLRKIA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window