Sequence alignment for CL0435

PF03666

NPR3_PICGU/189-627GFDK---------------------------------------------------EYLCELLCPPRSMCNSRFEIT--VD
NPR3_DEBHA/205-648GFEA---------------------------------------------------DYLCEMLCPPKQMCNSRFEIM--ID
Q6PB11_XENLA/76-432GFSD---------------------------------------------------VILATILATKSDMCGKKFELK--ID
A7RUK4_NEMVE/58-409RFSD---------------------------------------------------STLANILTPKPMLCGQRFELK--ID
Q29ED8_DROPS/76-449GFAD---------------------------------------------------DVLSALFAVKPQLCNQKFELK--LN
NPRL3_CAEEL/80-411DMSL---------------------------------------------------GMLAYVFKTQEIACNDGFDMK--IN
NPR3_COCIM/142-586GLGT---------------------------------------------------DVWEKLLCPSSSWHKRRFEVG--VN
NPR3_PHANO/150-599GFKT---------------------------------------------------DALEKMLSPGKEFNKRRFELG--VE
Q7SGC4_NEUCR/109-530GFPT---------------------------------------------------KDLENILTPARAYHKRLFQVS--LD
Q2HAI2_CHAGB/107-530GFPT---------------------------------------------------KDLENILKPARAYHKRLFQVS--LD
NPR3_CANGA/243-798EFDI---------------------------------------------------DFLAELCCPSREMCNTRFELT--VD
A7TP53_VANPO/308-812DFDA---------------------------------------------------EFVAEFCSPEREMCNTNFEFT--VD
NPR3_ASHGO/273-792NFDA---------------------------------------------------EFVAELCSPPKEMCNTRFELT--VD
NPR3_KLULA/205-724NFNT---------------------------------------------------EFVAELCSPRKEMCNTRFEFT--VD
NPR3_CANAL/154-550GTDA---------------------------------------------------AYICEMLAPPKQMCNTRFEMT--IQ
NPR3_PICST/142-551GIEP---------------------------------------------------AYLCEMLAPPKKMCNSRFEIM--ID
NPR3_LODEL/219-622GMAP---------------------------------------------------GYLCEILSPPRQMCNTRYEVT--IQ
NPRL3_SCHPO/76-481GYEK---------------------------------------------------GFLANMLSPRIELCNQKFEIW--VD
Q4PA65_USTMA/205-719GYDI---------------------------------------------------DILASILNPRPELSHKKFELV--ID

PF06218

Q6BQE8_DEBHA/5-471GFVP.ITAIFYAVFHPTEGTKVLNQVPEGSIGNSSTSDS.........NGIIFNFDTIKNYIIPKPKLCNKLISIK..ID
A5DQL3_PICGU/4-471GFEP.ITAVFYSVFHPTEGTKIVHQVPD.VI......SR........DQPSLFDFDAVRNYVIPKPQLCNKLVSFK..IG
Q55BD9_DICDI/1-392MSDI.IKCIFYSEFHNIYGTKILHQYPEGFV...................SNEVFEGFAEYIIPKPKLCGKIITLT..AF
A3GHC2_PICST/6-481GFIP.IAAIFYAVFHPTQGTKIVHQVPEGSIST..IHER.........ANTLFNFDTVKNYVIPKPHLCNKLISFK..IN
Q9VXA0_DROME/35-412STEGKIRCIFLSEFHATAGCKISCQVPDNYI...................SKDVFDAINVYIIPKQHLQRCILTVN..AM
Q6CSH1_KLULA/7-517GFVP.IHTVFYTLFHPTEGSKVRFQFPPNSL.................ENGKIDFDTIKNYIIPKPQLCNKLLTFK..YG
NPR2_YEAST/7-528GFVP.IHTIFYSVFHPTEGSKIKYEFPPNNL.................KNHGINFNTFKNYIIPKPILCHKLITFK..YG
NPR2_SCHPO/14-409SFPPRLLAIFFALFDPLQGPIVACEAPAGSV........TNV...DGGKNCLLPFETISDYVIPKRELCNKTITVC..TN
Q75CA3_ASHGO/14-531GFVP.IHCIFYALFHPTEGTKVRFQFPSDSL.................EKSGIRFDTIKNYVIPKSQLCNKLVTFK..FG
Q5AEE0_CANAL/6-515GFIP.IVAIFYSVFHPIEGTKIVHQFPENSL.....ST.GRSP.TSIGDGGLFDFDTIKNYVIPKPQLCNRLISLK..ID
Q6C343_YARLI/5-464GFAP.ILAIFYSTFHPTEGPRVEVQVPRDSI........VPDAESLDQPGALVAFNAVKNYVIPKPPLCNRVVTIK..SN
NPRL2_HUMAN/2-380GSGCRIECIFFSEFHPTLGPKITYQVPEDFI...................SRELFDTVQVYIITKPELQNKLITVT..AM
A7TI78_VANPO/6-544GFEP.IHTIFYSVFHPTEGPKVCYQFPPNNL.................DNYSINFDSIRSYVIPKPQLCNKLLTLK..YG
Q16E62_AEDAE/15-395GREGPIRCILLSEFHAVAGSKISCQVPDNYI...................SKEVFDSIRFFIIPKPQLQRCTLTVN..AL
A7EKL1_SCLS1/45-458PIQTRILTRITKYLKGNLCTKVVHQSPPGCI........VPE..PDVDKPRLFDFEKLAEYIIPRQAFCNRYVTVCDPEN
Q0U9Y5_PHANO/1-469MPTRAIEAIFYTRFHHEKGSRVLHQVPPGSI......TPSPKPSKSDLAETLFPFSSVTSYLIPSQHFCDRLLTFV..VN

PF03666

NPR3_PICGU/189-627DHVFIGLPVHCYDNGSWRHKTKTKS..TRSGSKVSA...................................DGQLYEDSQ
NPR3_DEBHA/205-648DLVFLGLPIHSYDNGSWKSKHSHRP..KSGKSSKGRS.....................KNA...ADNASIDEGIDYETTS
Q6PB11_XENLA/76-432NVRFVGHPTLLQHA..QVSKT...........................................................
A7RUK4_NEMVE/58-409NMLFVGHPMLLNESNRGDGRK...........................................................
Q29ED8_DROPS/76-449DVRFVSHPTLIPHKEQRPSNA...........................................................
NPRL3_CAEEL/80-411NQRFVAYP......KTWKARG...........................................................
NPR3_COCIM/142-586DLTFVGWPVFVREDGTWRKKRK.....KKKTRA...GDSVLDTAP......TLGSEKGGYADGGEKLESERDPNVDGRSD
NPR3_PHANO/150-599SIVFVGAPMFVREDGLWKKLKRRKK..KRSDKEKLDDADFVKNLTISEEDEEADTVDEIPVKSKPEPFVYPEGFEPGYGH
Q7SGC4_NEUCR/109-530SLYCVSYPIYVPENGVWRKKSKKQQ..KHRDH.............................D.DTAPADTDGPARTSDKG
Q2HAI2_CHAGB/107-530PIYCVSYPIHVPENGVWKKKKAKEP..GKQRHPPKEPGPA................KKED.D.DPFATDAGGSARSGGER
NPR3_CANGA/243-798EYCFLGHPIHVDSSGNWRKSRKRNN..SLSKSKRSGSLTG...............SRKRS.G.SKSSNHDKSFSAETPNS
A7TP53_VANPO/308-812NLSFLGFPIHIDADGNWKKSKKKKS..TRSKRSSSIYTKDD..............RKSIT.Q.SPMINNNNSSDVEEEDD
NPR3_ASHGO/273-792DLCFLGLPIHVDESGRWRKQKVKRQ..QTNTRSKRSSSGGKPD..........AGSRTSV.G.LPHGTQERQPSTDQSGS
NPR3_KLULA/205-724DLCFLGLPIHADHKGRWKKSKKRKQ..ASKRSARSSTARNSISRNSV.GRNSIGRNRSKT.E.SQGHINDVEEPADDENS
NPR3_CANAL/154-550DKLFLGLPVHRSDNGQWRSIG..................................................HNNEHDEEE
NPR3_PICST/142-551DKIFLGLPVHKYDNGSWRLKGSSKR........................................INRNKEENTHQHEVD
NPR3_LODEL/219-622DKIFLGLPIHQHADGTWTNARSSKR..SQSGRSNSLH......................F...........ENLTSSTEA
NPRL3_SCHPO/76-481GLTFLGCPVHIGPNGEWAKRRKPRT................................................TVESNAS
Q4PA65_USTMA/205-719DLAFLGHPVTPNKNGVWGDQDDESQDDRVEARDEKTAAHAQQRG........RSGLRKEI.R.PYDPSDDRVASNDKIDK

PF06218

Q6BQE8_DEBHA/5-471RFKVLGYPVNI.ENEKYSRNS-----------------------------------------------------------
A5DQL3_PICGU/4-471RYRVMGYPVNI.ENTDYARNS-----------------------------------------------------------
Q55BD9_DICDI/1-392DYKILGYPILM.QDVKYHRNA-----------------------------------------------------------
A3GHC2_PICST/6-481KFKVIGYPVNI.ENDQYSRNS-----------------------------------------------------------
Q9VXA0_DROME/35-412DVKIVGYPVGIQDQQKYARNA-----------------------------------------------------------
Q6CSH1_KLULA/7-517EYRIVCYPVNV.NARYYARNS-----------------------------------------------------------
NPR2_YEAST/7-528TYRIVCYPVTI.NSPIYARNF-----------------------------------------------------------
NPR2_SCHPO/14-409HYQVIGHPISI.IGSNYERNA-----------------------------------------------------------
Q75CA3_ASHGO/14-531SYRLVCYPVNI.KAPYYARNS-----------------------------------------------------------
Q5AEE0_CANAL/6-515KYKVIGYPVNM.ESSHYARNS-----------------------------------------------------------
Q6C343_YARLI/5-464AYRVSSYPVHI.YSNEYARNS-----------------------------------------------------------
NPRL2_HUMAN/2-380EKKLIGCPVCI.EHKKYSRNA-----------------------------------------------------------
A7TI78_VANPO/6-544NYRIIGYPITI.NCSIYARNN-----------------------------------------------------------
Q16E62_AEDAE/15-395GHKVIGYPVRI.DHQRYPRNA-----------------------------------------------------------
A7EKL1_SCLS1/45-458KYRILGHPVCI.KNEKYERNE-----------------------------------------------------------
Q0U9Y5_PHANO/1-469HHRIIGYPVCI.QGAKYSRNE-----------------------------------------------------------

PF03666

NPR3_PICGU/189-627NSNSTS.....................RATMSMFHLVFIMD.P......PVVEYNYRVDEMFHFVISRLALVLRYEQSKH
NPR3_DEBHA/205-648KSQS.......................KNSMSMFHLVFIMN.P......PIIECNYRIDEMFHYVISRLSLVLRYEQSKH
Q6PB11_XENLA/76-432....................DPSPKREAPTMILFNVVFALR..........ANADPSVINCLHNLSRRIAIVLQHEERRC
A7RUK4_NEMVE/58-409..........................EEVMMKLFNIVFILK..........AEADPTLISSYHDLSKRLAIALKHEERRC
Q29ED8_DROPS/76-449SSSISLPSAGGVTANPAPAAPSSVLAVKKQQMLINIVFALH..........AQASYSIVKCYHELSKRLGLALKFEEQRS
NPRL3_CAEEL/80-411...........................ESTNYQISIVFALK..........NGCEQHTASAYQTLSNKIAVSLVMLQNYF
NPR3_COCIM/142-586KDEEPSRSLIESHPDEDGS...VTDGTKDAMTMFNVVFVMN.P......PILEHNLRIKENYDNVIKKFGKGLKSEQATA
NPR3_PHANO/150-599GSISSGPSGAPSEAGSDARSNSTSQDNNPDMNMFNVVFVLN.P......PALEYQQRVKEMYDNVTRKYAKALKYEEARF
Q7SGC4_NEUCR/109-530PSDVDQ.........LAAKPAEEAEDKKSSMTMFNLVFILN.P......RRHEVADLVDILYTHIIKKVNKAYKYCQQRG
Q2HAI2_CHAGB/107-530GSGSAEGIEVRDTLKPLTKSAEEAEDKKSSMTMFNLVFFLN.P......KKHEVKPLVDIMFTHIIKKINKAYKYCQQRS
NPR3_CANGA/243-798PESSKIIEEVGSLHKSRTLSNPQNDHFTKDMTMFHVCFIMD.P......NLIEYNKRVDDMYQYVVARLSVLLRYLQSKN
A7TP53_VANPO/308-812DYKYKETEMSSRKSIKVEANIPFSPDDGKNLTMFHVCFVMN.P......HLIEYNQRVNDMFRHIVSKFTLALRSAQAKN
NPR3_ASHGO/273-792GAPYLAQSSSESGQLRDPEQSDDVEDLQKAVHMFHVCFIMN.P......QLVEYNERIDDMYHYIVTRLSLILRYIQDKK
NPR3_KLULA/205-724DYEPSKSEMLNEMYCVPDAENDEFESLQQSINMFQVCFIMN.P......KIIEYNERVDDMYHYVVTRLSLILRYIQGKT
NPR3_CANAL/154-550THTA.......................KNSLNMFHLVFVMN.P......PVIESNYRVDEMFHYVISRLSLVLRYEQQKH
NPR3_PICST/142-551NSKS.......................KLNLNMFHLVFIMN.P......PVIEYNYRIDEMFHYVISRLSLVLRYEQSKN
NPR3_LODEL/219-622QLASTT.....................AQSLTMFHLVFIMN.P......PATECSYRIDEMFQHVASRTSLGLRLAQQKH
NPRL3_SCHPO/76-481SSHLVSKPESSHPSTGSFEVKSSSSKSRSSMSLFHVVFVLNVP......TATVYRPTVNTMYDHIVVKLVTGLKYEQAKR
Q4PA65_USTMA/205-719SAKTGAKSRNASLTRIEQTNDIPTSRSKAPLTQFHLVLILDRPDPSTAVPGVDLSSWLQLFYDNIVFKMTAALFAEQSKS

PF06218

Q6BQE8_DEBHA/5-471-------------------------------FNFNFCFVFP------------YN.SDTTPYESAIKRMGKMFQVLEEQS
A5DQL3_PICGU/4-471-------------------------------FTFNFCFVFP------------YD.SDTTPYESAVRRMGRMFRVLEEQN
Q55BD9_DICDI/1-392-------------------------------LLFNLCFVFD------------KS.TDTTNYNQIVRKLGTILRTLEKET
A3GHC2_PICST/6-481-------------------------------FNFNFCFVFP------------YDIGDVTPYEPAIRRMGKMFQVLEEQN
Q9VXA0_DROME/35-412-------------------------------FLFNLCFVCD------------SR.ARSVQYEPVVKKLSEYLIMMEEES
Q6CSH1_KLULA/7-517-------------------------------FNFNFVFVFP------------YD.CATSPYEPAIARLGKMFKVLEEQS
NPR2_YEAST/7-528-------------------------------FSFNFVFVFP------------YD.CETSPYEPAITRLGKMFKVLEEQN
NPR2_SCHPO/14-409-------------------------------LIFNMCMIFH------------EE.EDSACYIPLVKRLARNLEVLEKQI
Q75CA3_ASHGO/14-531-------------------------------FSFNLVFVFP------------YD.SATSPYEPAIARLAKMLRVLEEQS
Q5AEE0_CANAL/6-515-------------------------------FNFNFCFVFR------------YDMGDVSPYESAIKRMGQMFQVLEEQS
Q6C343_YARLI/5-464-------------------------------FIFNFAFVFS------------YE.SASGAYDAAIRRIGKMFEALEIQS
NPRL2_HUMAN/2-380-------------------------------LLFNLGFVCD------------AQ.AKTCALEPIVKKLAGYLTTLELES
A7TI78_VANPO/6-544-------------------------------FSFNLVFVFP------------YE.CKTSPYESVIVKLGKMFRVLEEQS
Q16E62_AEDAE/15-395-------------------------------FYFNLCFVCD------------SW.ARSVQYEPVVKKLSEYL.LMEEET
A7EKL1_SCLS1/45-458-------------------------------LMFNFCIVTR------------VE.VDKIPYEAVVKRLASTFTEMEIQN
Q0U9Y5_PHANO/1-469-------------------------------FIFNFALVIG------------ESEVDWACYGEVVRKLGRLLRGLEEQG

PF03666

NPR3_PICGU/189-627DYVWKQVKLISKLKE...DHRLSQGNDEG........------------------------------------..LHEFL
NPR3_DEBHA/205-648EYVWNQIRMIYNLKE....EFRNQATMAN........------------------------------------..LTKYL
Q6PB11_XENLA/76-432QYLTREAKLILAIQDEVTAMSETNGGPQS........------------------------------------..PFHHI
A7RUK4_NEMVE/58-409RYLTKERETMLAVHDEVCSMPE.VDCAES........------------------------------------..PFLHM
Q29ED8_DROPS/76-449GYLTEQTAHMARTHD.....EQQQQPLER........------------------------------------..TLELI
NPRL3_CAEEL/80-411GFLEREDKWADNAEE...PNKDH..............------------------------------------..PLEEF
NPR3_COCIM/142-586NYVWKEAQKILHIKE...KGRENKSSLSS........------------------------------------..VYEEL
NPR3_PHANO/150-599QYVWKESKRIIDLKQ...RAKESNESLTS........------------------------------------..TWRKI
Q7SGC4_NEUCR/109-530DFIWKESKKILALKD...KGREDKRKMSQ........------------------------------------..LWEEI
Q2HAI2_CHAGB/107-530DFVWKESKRILALKD...KGRED..............------------------------------------.......
NPR3_CANGA/243-798DYVSEQCELILKEKE...KVFKNSKHYKSLSLPSEKG------------------------------------RYLYQRL
A7TP53_VANPO/308-812SYVSKECDIILKERE...AVMKNSKKYKSIRGSCNKA------------------------------------RYLYQRI
NPR3_ASHGO/273-792GYVVRECAKILKTRD...RILKKSLKLKKSHGQALQG------------------------------------RYLYECI
NPR3_KLULA/205-724GYVTRECVKIMKCKD...EVSKHSRYYESLKSPWSKG------------------------------------KYMYERI
NPR3_CANAL/154-550DYVSQQVKNILALRE..........SLEG........------------------------------------..NESLL
NPR3_PICST/142-551DFISNQVKMILNLKE.......QFKEKEE........------------------------------------..LESQL
NPR3_LODEL/219-622NYVGNQMKAIQRARE...........QEC........------------------------------------..KEVDL
NPRL3_SCHPO/76-481NYVENECIHILKLTE...KYSSQNVPFDV........------------------------------------..YAAQI
Q4PA65_USTMA/205-719DYVGRETEKLLALRE...RCMDDGQAYAA........------------------------------------..YAAQC

PF06218

Q6BQE8_DEBHA/5-471FILSKLDKFGSFFKNKDEYPTENSLMI........................................NEFITPGFRRTQK
A5DQL3_PICGU/4-471FSLSKQD..PAFFKDNRAHLDRADTT...........................................ETTPGYARTAR
Q55BD9_DICDI/1-392EYLFNQSKEIGLK...................................................................
A3GHC2_PICST/6-481FMLSKLDKDNSFFKKSNVSNATANTNI.........................................HMNTPGYSKTKR
Q9VXA0_DROME/35-412CFLSRED.........................................................................
Q6CSH1_KLULA/7-517QILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEH....................TDIKSTGDDGEKYLEIIKELAKN
NPR2_YEAST/7-528QLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTP...........THPTSEKDTKDMRSSRYSDLIKDLGLP
NPR2_SCHPO/14-409HYISDLN.........................................................................
Q75CA3_ASHGO/14-531QMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNL.................DKKSRAQHNATTKYHEIMKHINSD
Q5AEE0_CANAL/6-515FMLSSLDKDNSFFKDKAIKSNKALISSSLSSDGTTREPLDEG...........GNENHFHPHNVQNGTSINTPGFAKTKK
Q6C343_YARLI/5-464KLLSARP.........................................................................
NPRL2_HUMAN/2-380SFVSMEE.........................................................................
A7TI78_VANPO/6-544QFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKNSSYLFEKYKEIQEFVSND
Q16E62_AEDAE/15-395AFLSNPE.........................................................................
A7EKL1_SCLS1/45-458EFLSQEDTLLSQ....................................................................
Q0U9Y5_PHANO/1-469GFLSKEEEGVWDMDEVAQ...........................................................GDI

PF03666

NPR3_PICGU/189-627VNRSSLCRSIKDCYEAISKHDIANLFVNK....KLRSFQIPIKTEFHSLPEPTV.PHLPGSYLSTTVNLLAGTGLINIGE
NPR3_DEBHA/205-648TDKSSLCKLISECFTQISRSNIANLSINN....KLRSFQIPIKTEFHSLPDSTV.PYLPGSHLSSTVNMLANTGLISVG.
Q6PB11_XENLA/76-432LPKCKLARDLKEAYDSLCTTGVVRLHINNW...LEVSFCLPHKIH..CVGSNFIPPDAIEKSLKS...............
A7RUK4_NEMVE/58-409LPKSKLAVDLKDSFESLCTTGVVQIRINGW...VNVSFCLPQKVHNLHQGMLTITPKAIETSLAS...............
Q29ED8_DROPS/76-449AERCSLAQALKSIFHDLCTTGLLSTSLNQN...LTLCFCLPAKAHQLHKKGSMVDPETIDRCLRA...............
NPRL3_CAEEL/80-411AKTSFIVQPLAEMFEEVRNRGNIHKYLINF.......VELGFCDEAHALTKLNVVPKGR.....................
NPR3_COCIM/142-586LSQSSLAQAIATIYRSISTSKIASITLTPH...TTMSLQIPPLTSTPYLPGPME.PAYPGLWLTT...............
NPR3_PHANO/150-599ISTSPLAKSIAIMFDAISHDKIAHIHFDAT...FNTSFQIPQADSTPYLPTALE.PQMPGLWLTT...............
Q7SGC4_NEUCR/109-530LSNSSLAASMQDIYDAISRNRIAAIQLETIEGVVTHSVQIPVPFHVPDLPQDGQAEEQLGLWLTT...............
Q2HAI2_CHAGB/107-530......TASMQDIYEAVSLNRIAVLQLDTVEGAVTHSVQIPVPFHVPDLPQEGE.KGQSGVWLTT...............
NPR3_CANGA/243-798LAKSSLARALTECVEKIKKNEIACLEITDH...RTVSLQIPIQNEFSILPQYKLYPVLKGSFLTSIQNNKFLEKSANIDD
A7TP53_VANPO/308-812LSKSSLARALTKCVDNIQKNEISRLQIDDD...KVLTLQIPIHDEFWKLPKFKLEPVLRGSYLTTILNER..........
NPR3_ASHGO/273-792LKSSSLARALTKCFNSIINNEIVTLDIDNH...KVISLQIPIKNEFSSLPDLKINPVLRGSYLTSLLNDSF.........
NPR3_KLULA/205-724LYESSLARALTKCFNCIHNNEIANLEIDGD...KIVSLQIPIKNEFSILPNLKEDAVLRGSFLSSILNES..........
NPR3_CANAL/154-550TEKSSLSRVIRDCFEGISTSTIANLSING....KLRSFQIPIKTEFHSLPDPSV.PFLPASYLSSTVELLGDTS......
NPR3_PICST/142-551LNKSSLCKMIHDCYLSISQSKIANLSVNN....KLRSFQIPIKTEFHSLPESSV.PFIPGSHLSSTVGLLGTTG......
NPR3_LODEL/219-622DKTLSLCKLIKECYLAISTSRIANLEIDG....KQVVCQIPTKYEFDSLPEPSV.PYIPRSFLSSSIHSF..........
NPRL3_SCHPO/76-481PHHSNLASVLATTYEALINMHTAYLEINQS...INLSLLWPMSVSTNTLENYEL.QVRPSTILAS...............
Q4PA65_USTMA/205-719LGISSLARCIRDLHKSISISSDAFLTINDR...IEVHLQLPPILQD...PSSLAKTVDIETELDPNDPIFLSGGGFEGLG

PF06218

Q6BQE8_DEBHA/5-471VNLSSIESLIHQIYQDLNNYSECCIPLDSA---NSVDIKL-----FPILPPP----------------------------
A5DQL3_PICGU/4-471ITLSSIESLINQIFSDLNNYSECCIPLDSA---NSVDIKL-----FPILPAP----------------------------
Q55BD9_DICDI/1-392.DQPDLSKILETLYIELNTYGESTFTVDDA---NTINVKL-----LSRPDEP----------------------------
A3GHC2_PICST/6-481INLSSIESLINQIYQDLNNYSECCIPLDSA---NSVDIKL-----FPILPPP----------------------------
Q9VXA0_DROME/35-412.DKRRLQNIFETVLRDLNERKVATI.VEGD---NTIYLKI-----VMHKPDP----------------------------
Q6CSH1_KLULA/7-517QKSLIIEDLLMKLFLDLNNYSECLIPIDEG---NSIDIKL-----FPVRTPP----------------------------
NPR2_YEAST/7-528QSAFSIQDLLMRIFQDLNNYSECLIPIDEG---NAVDIKI-----FPLLRPP----------------------------
NPR2_SCHPO/14-409.KRPVIFSVIEQILEDMNNFCECMIQLDDQ---NSINIKL-----FPVFPSP----------------------------
Q75CA3_ASHGO/14-531EKNLYIEDLITKLYEDLNNYSECLIPMDSG---NAIDIKL-----FPLLTPP----------------------------
Q5AEE0_CANAL/6-515IALSSIESLIQQIYQDLNNYSECCIPLDTS---NSVDIKL-----FPILPPP----------------------------
Q6C343_YARLI/5-464.DIVFIDNIIQQLFQDLNNYSECLVAINDS---NAINIKL-----FPIFPSP----------------------------
NPRL2_HUMAN/2-380.SKQKLVPIMTILLEELNASGRCTLPIDES---NTIHLKV-----IEQRPDP----------------------------
A7TI78_VANPO/6-544ESDFSIQDFIMRLYQDLNNYSECLIPIDAG---NAVDIKL-----FPLLRPP----------------------------
Q16E62_AEDAE/15-395.NNARIQNLLMSILRDLNEKQVATI.VEGE---TTIYLKI-----SKLKPDP----------------------------
A7EKL1_SCLS1/45-458.DRRSIAALLEIIKEDLNNYNECMIPVDDA---NTINMKL-----FPIHKHP----------------------------
Q0U9Y5_PHANO/1-469GGGSKVYALCEMVLEDLNNYAECMIPIDDS---NTINLKL-----FPTRPPP----------------------------

PF03666

NPR3_PICGU/189-627TTRYGMQGSLSSITPGSTYDADEDSLQTDSGSK.............TDDII..YFSLLLLDDPNSIIRDINAEPQSA...
NPR3_DEBHA/205-648.....ETIRYDVNNLNSGGLDDFDDIDDNKSDSN............ADDII..YYALLLLDDPETIIRDIKAQQQST...
Q6PB11_XENLA/76-432..................................................IRPYHALLLLKDEKNLLNDLPL.DCSP...
A7RUK4_NEMVE/58-409..................................................MRPYHTLLFLVDEVSLLGLLPG.DCSP...
Q29ED8_DROPS/76-449..................................................LKPYHGMLLLVDFAELL......DCVPPTG
NPRL3_CAEEL/80-411.......................QEIDEIVRK..................MKPYHGILLLEDV......WPTPDANP...
NPR3_COCIM/142-586....................ADSLSATDEVTEMEY.........SGPSKVLAKHFALLLLSDEASILKDIEASMGTL...
NPR3_PHANO/150-599....................SNVVLADD...................ESPMTQHAALLLLEDTETLIKDLGGEVTGN...
Q7SGC4_NEUCR/109-530....................ANSLQADENVEE...............PEYLDKTFALLLMAEEKKVINELLGPESDP..T
Q2HAI2_CHAGB/107-530....................ANSLMGEEAAET...............PGFLDKNFALLLVMDEKRVTAEL...QNDADET
NPR3_CANGA/243-798NHHAKSARDTNLISDHVNTFSNGQTKNEIFYSKNMENALTAQNDYDDDDLL..LYSILLLDDPDKIIADLDNYSSNDDIG
A7TP53_VANPO/308-812.............FLGSTTNNNQETSDWNIYSSEE.........DASDDLL..NYALLLLDEPSKIINNIDSFTYKDNIG
NPR3_ASHGO/273-792............LKQPVDFAAGSMMPGGDVMHD.............DNDVL..DYALLLLDDTPKIIKELEFSSFGSDLA
NPR3_KLULA/205-724..............FIGRSTSLTNEDSDNLYAN.............HDRLL..DYGLLLLDEPENIIKGLENASFDNGVT
NPR3_CANAL/154-550.........FINVGETSRYGHAFNSVQDEENSA.............EKIIV..YFALLLLDDPESIIKDMKTETDST...
NPR3_PICST/142-551.........LINVGETTRYGEAMNDENEGISEA.............ADDIV..YFALLLLDDAESIIRDIKTESSGT...
NPR3_LODEL/219-622.............GMWDRSNIEQQKLDDDFLQ...............ESIM..CFALLLLAEPHNILQDMNIVTNSP...
NPRL3_SCHPO/76-481.....................QTIFSEEHPSSI..............EPFVAPYWTLLLLKDTDTIMKRVPLLQNSL...
Q4PA65_USTMA/205-719KEGAHQDGSGGTYKRRMAMTPAQLSFEEWCRTT..............GPYLLPWKTLLLLHDQVDEAPNRERAKSDTCSP

PF06218

Q6BQE8_DEBHA/5-471-----------------------------------------------VN.TKAYQVPILTVKLSSLVD.INWDPTML---
A5DQL3_PICGU/4-471-----------------------------------------------VN.LKGHQVPISTVKLGLMVD.VNWDPTMV---
Q55BD9_DICDI/1-392-----------------------------------------------PE.ILPHQVPVLVEEIDTTND.SEWDLTVL---
A3GHC2_PICST/6-481-----------------------------------------------IN.IKAFQVPIATVKLNSLVD.VNWDPTMI---
Q9VXA0_DROME/35-412-----------------------------------------------PP.VKDHMVPLLLANLRDAPL.DNWDLTTQ---
Q6CSH1_KLULA/7-517-----------------------------------------------SSNISVEDVPIAVVNLSDIID.VNWDPTMV---
NPR2_YEAST/7-528-----------------------------------------------TTCVSLEDVPLSSVNLKKIID.VNWDPTMM---
NPR2_SCHPO/14-409-----------------------------------------------PT.VKSFHVPILTAQLDLLMD.KNWDMTVQ---
Q75CA3_ASHGO/14-531-----------------------------------------------NSCLSFEDVPIAKVNLMNLVD.VNWDPTML---
Q5AEE0_CANAL/6-515-----------------------------------------------IN.IKAYQVPIATVRLNSLVD.VNWDPTMI---
Q6C343_YARLI/5-464-----------------------------------------------PD.LRASYVPIATVRLEQMVD.ENWDPTME---
NPRL2_HUMAN/2-380-----------------------------------------------PV.AQEYDVPVFTKDKEDFFN.SQWDLTTQ---
A7TI78_VANPO/6-544-----------------------------------------------PATISIEDVPISRVNLKEIID.VNWDPTML---
Q16E62_AEDAE/15-395-----------------------------------------------PP.VQDHQVPLLCKGFENISL.ESWDLTTQ---
A7EKL1_SCLS1/45-458-----------------------------------------------PP.IKSWHVPISKIKFAEIVD.DTWDLTMR---
Q0U9Y5_PHANO/1-469-----------------------------------------------PP.ISSHQVPLLTISLSSLQSPISSDLTLN---

PF03666

NPR3_PICGU/189-627...IA...................RFIHSIKP....TESLERLAHKL........................NHHEKMESN
NPR3_DEBHA/205-648...LA...................NFIRMIKP....TESLLKLANKLKQ.....................QASDNGFSLD
Q6PB11_XENLA/76-432..ALV...................RIIKSASA....VKNLQQLAQ..............................DADLA
A7RUK4_NEMVE/58-409..AVT...................RLIRMATP....LKSFTALSQ..............................DTDIP
Q29ED8_DROPS/76-449ARMLW...................QLVDAYNP....LISLQSMAS..............................NADLS
NPRL3_CAEEL/80-411..IVA...................KLLSHCSP....DRSILDMST..............................ASGIP
NPR3_COCIM/142-586GPPLA...................HYIRSSKP....TKSFAQISA..............................RSSIP
NPR3_PHANO/150-599AAAIA...................FYIRNIIP....TKSLLKISK..............................RHNIS
Q7SGC4_NEUCR/109-530TQAMI...................EFVRRCKP....NLSFHQVQQ............................QASSILS
Q2HAI2_CHAGB/107-530TLAMI...................EFVRHCKP....TLSFYQVCQ............................QSSNILT
NPR3_CANGA/243-798GVILK...................QLVKVIQP....NVPLLSYQYIINELLAEKPLSS...STTANKSKQNKDNKTNTFY
A7TP53_VANPO/308-812GVVLK...................HLVKHLQP....HVPINYYQPLVDELLG..............STSGGLSGERSLFQ
NPR3_ASHGO/273-792NVIMI...................NLVKNLKP....TVSLRSYLPLVSNLLEANLSLSARAAGSRHAASNAADSHSTPLQ
NPR3_KLULA/205-724DLLLI...................NLVRQLKP....TIRLGQYKLLIKELI.................DSNDSSYDDQFC
NPR3_CANAL/154-550...LA...................KFIRMIEP....TESLLKLSA.............................RNSKLD
NPR3_PICST/142-551...LA...................KFIRMINP....TESLLKLST.............................RSNSLD
NPR3_LODEL/219-622...FG...................KFIMLLHP....SESLLKFCS............................KNSQHFE
NPRL3_SCHPO/76-481...LS...................SFIAIVKP....NLTFTDIAN..............................RLGIS
Q4PA65_USTMA/205-719AGLASPGEGASQALEAHGFDQLARKFTSFFTPSLYNTPNFSQVAD..............................MLGWD

PF06218

Q6BQE8_DEBHA/5-471------------------------KILPYIDG----INSIKRISQ------------------------------LADAD
A5DQL3_PICGU/4-471------------------------KILPFING----VNSVRKISR------------------------------LADAD
Q55BD9_DICDI/1-392------------------------QILPYIDG----INYVARISK------------------------------LTEID
A3GHC2_PICST/6-481------------------------KILPYING----LNSVKKISE------------------------------LADAN
Q9VXA0_DROME/35-412------------------------QILPYING----INHVARIAA------------------------------EADVE
Q6CSH1_KLULA/7-517------------------------KIVPYING----INSVAQIAV------------------------------SARSD
NPR2_YEAST/7-528------------------------SIVPYIDG----LNSIAKISK------------------------------LSNSD
NPR2_SCHPO/14-409------------------------KVYPFING----INSVQRIAE------------------------------LANVS
Q75CA3_ASHGO/14-531------------------------KIVPFING----INSIAKISK------------------------------CSDSA
Q5AEE0_CANAL/6-515------------------------KILPYING----LNSVKKISE------------------------------LADAN
Q6C343_YARLI/5-464------------------------KIVPFING----INSIRRIAD------------------------------LADAD
NPRL2_HUMAN/2-380------------------------QILPYIDG----FRHIQKISA------------------------------EADVE
A7TI78_VANPO/6-544------------------------KIVPHIDG----VNSIAKIAK------------------------------LSDSD
Q16E62_AEDAE/15-395------------------------QVVPFING----ISHVARIAA------------------------------EADVE
A7EKL1_SCLS1/45-458------------------------KVIKHIDG----IKDVRRIAH------------------------------DANVA
Q0U9Y5_PHANO/1-469------------------------RILPYING----VHSIARIAA------------------------------LADTD

PF03666

NPR3_PICGU/189-627I.AEVKSFAFHLVYWRRARVIQPLSSRSVYIVSPMAPLS.............................FNLYNDIKAFKA
NPR3_DEBHA/205-648A.GQIKSFAFHLIYWRRARVILPISTRSVYIVSPMAPIT.............................LKFHHDIFIFKK
Q6PB11_XENLA/76-432L.LQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNATVG..............................LYSSLAEQFSH
A7RUK4_NEMVE/58-409L.SQVFAIAAHLVHWGKASIIYPLCESNLYVVAQSLNMN..............................TLSPLAEGYAA
Q29ED8_DROPS/76-449I.EHVYKLVSHLVYWAKATIIYPLCETNVYVIAPDAPLH..............................TKSHLVEKFST
NPRL3_CAEEL/80-411I.FEVFMIIRHLLQWTRAILIYPLCNTNIYTSATSPQ................................PLDKMAEKFTA
NPR3_COCIM/142-586L.NDIQVLAAHLIYWRRARAVPPLNKQDTYIVSPNCDLS..............................KLGLATAAYEL
NPR3_PHANO/150-599A.HDMEYIASHLVYWRRARLIAPLSPRDTYIVSPNADFS..............................LLPSAVTAYAQ
Q7SGC4_NEUCR/109-530P.AQVRRFAEHFIFWRRAIAIPPLHGRDMYIVSPNCDLR..............................RLPQAAAQWAR
Q2HAI2_CHAGB/107-530P.TQVRKFAQHFIFWRRAIAIPPLHARDMYIVSPNCDLR..............................KLPQAATQWAR
NPR3_CANGA/243-798S.ALLRSCALHLIYWRHARAILPISFKNTYIVSPLSPVEADNSEMIKGNRKPS.ITDLNVTSNSSSKIPVIYLNQQSFKL
A7TP53_VANPO/308-812V.NILKYCALHLLYWRHARVISPINSKNTYIVTPLAPIQGTAKDDTVSH..........HHINKDNPKTLIYQNEDIFKK
NPR3_ASHGO/273-792H.SMIRSIVLHLVYWRYARIILPLSSKNTYIVSPLAPIRGTAADDFEN...........TDMVKQGCKALIYQHQDLFHE
NPR3_KLULA/205-724E.TTLKSLCLHLIYWRHARLILPISSRNTYIVSPLAPISGFSTDDFKHGEYDTLIRQQEVPVNNNDEPSLIYQNKKVFNE
NPR3_CANAL/154-550I.SQIKDFAFHLIYWRRARVILPLSSRSVYIVSPMAPIT.............................IKLYDDISFFNR
NPR3_PICST/142-551T.LQVKSFAFHLIYWRRARVIQPLSTRSVYFVSPMAPIT.............................TNLYTDIREFKK
NPR3_LODEL/219-622P.SEVKSYALHLIYWKKARAIQPLSSRSVYVASPMASLT.............................TKLFEDIYRFKA
NPRL3_SCHPO/76-481V.SECFILAKHLIHWRKAIAIPPLLIRNTYVTSPTANLF..............................NLEEESKLFKK
Q4PA65_USTMA/205-719LYDDVYPMVRHLIYYRQARVIDVPRPGHVYAISPLFDFA..............................RLGSLSYNWAQ

PF06218

Q6BQE8_DEBHA/5-471Y-ILTKQCIQHLMHYKCINMIDIFQFSNIYAPTNHIGNF-------------------------LTLN.NIAEECQAYII
A5DQL3_PICGU/4-471Y-ILTKQCLQHLLYYRCIEILDIFQFSNIYAPTNNISRF-------------------------LTVP.DIAEDCQAYIV
Q55BD9_DICDI/1-392I-NLVSSCVQHLVYYGIVKMVDIFQYSNIYNPTPKIRKL-------------------------ASNL.DMQRECQRYIT
A3GHC2_PICST/6-481Y-VLTKQCIQHLMHYKCIEIIDIFQFGNIYAPTNHIGSF-------------------------LKSNAKMAEECQAYVI
Q9VXA0_DROME/35-412T-DLVKSCIQNLVYYGVVQLLPILKYSNVYM.TQNLKHL-------------------------IQSA.SLSGACRKYVA
Q6CSH1_KLULA/7-517V-ELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNF-------------------------LTNP.AVAKACQLFVQ
NPR2_YEAST/7-528P-GLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNF-------------------------LTDP.LMASDCQSYVT
NPR2_SCHPO/14-409Y-RSCQKCMEHFLYYGCLIIADIFQFHNIYAMTTNAPNL-------------------------LQDP.DFQRECTAYVS
Q75CA3_ASHGO/14-531V-ELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDF-------------------------LFDF.ILPRECQVYVV
Q5AEE0_CANAL/6-515Y-LLTKQCIQHLMHYKCIEVIDIFQFGNIYAPTNHIGEF-------------------------LKHDGKMAEECQAYVV
Q6C343_YARLI/5-464Y-NLTKDCIQQLMYYRCIIIVDLFQFSNIYAPTSDIGDF-------------------------IEDA.DMGRECQAYVF
NPRL2_HUMAN/2-380L-NLVRIAIQNLLYYGVVTLVSILQYSNVYCPTPKVQDL-------------------------VDDK.SLQEACLSYVT
A7TI78_VANPO/6-544T-VLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNF-------------------------LTDP.LMATECQTYVT
Q16E62_AEDAE/15-395N-QLVKSCIQNLVYYGVVQLLPLLKYSNVYMCTRNLQNL-------------------------SKDH.QFAEDCRRYVQ
A7EKL1_SCLS1/45-458L-DLTKIALQHLLYYDSILMLDIFLFSNIYAPTSEMNDF-------------------------VANKDGMQEECASYVY
Q0U9Y5_PHANO/1-469L-SLTRRAIQHLVYYGCLVLLDIFSFSAIYAPTAEIGGF-------------------------VLDP.DVKDECARYIR

PF03666

NPR3_PICGU/189-627--------------------------------------------------------------------------------
NPR3_DEBHA/205-648--------------------------------------------------------------------------------
Q6PB11_XENLA/76-432--------------------------------------------------------------------------------
A7RUK4_NEMVE/58-409--------------------------------------------------------------------------------
Q29ED8_DROPS/76-449--------------------------------------------------------------------------------
NPRL3_CAEEL/80-411--------------------------------------------------------------------------------
NPR3_COCIM/142-586--------------------------------------------------------------------------------
NPR3_PHANO/150-599--------------------------------------------------------------------------------
Q7SGC4_NEUCR/109-530--------------------------------------------------------------------------------
Q2HAI2_CHAGB/107-530--------------------------------------------------------------------------------
NPR3_CANGA/243-798--------------------------------------------------------------------------------
A7TP53_VANPO/308-812--------------------------------------------------------------------------------
NPR3_ASHGO/273-792--------------------------------------------------------------------------------
NPR3_KLULA/205-724--------------------------------------------------------------------------------
NPR3_CANAL/154-550--------------------------------------------------------------------------------
NPR3_PICST/142-551--------------------------------------------------------------------------------
NPR3_LODEL/219-622--------------------------------------------------------------------------------
NPRL3_SCHPO/76-481--------------------------------------------------------------------------------
Q4PA65_USTMA/205-719--------------------------------------------------------------------------------

PF06218

Q6BQE8_DEBHA/5-471TNEPNLLNEL...................PVNEDSDIQSSTFPN..............................SASPTS
A5DQL3_PICGU/4-471TDSGERLADLPTGSMENSASGVSSVVGSAPLQRSSEASPVSTFN..............................SVSPLA
Q55BD9_DICDI/1-392ISGA............................................................................
A3GHC2_PICST/6-481TSDVNY............................DTSSFSNTPNNSPFNTLNN...........NSPYGGSLLKRMNPVY
Q9VXA0_DROME/35-412LRPDK...........................................................................
Q6CSH1_KLULA/7-517GDSLKQSLLPFEG.............RPNNIYPTGRKQASTSTVHSRRRDSNDTA........TTGSTSSVRDTHRNYLS
NPR2_YEAST/7-528FPEVSKISNLPL................NKSLGSGDQDSPSFSVRRKSKSSSIPSNP...DSRTTSFSSTSRVSQNSSLN
NPR2_SCHPO/14-409TNSSNA..........................................................................
Q75CA3_ASHGO/14-531SSEDCEIHRLPFES............RPNGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQ
Q5AEE0_CANAL/6-515SADFSM............................DNTSYVNTPTQMHLPYPGSDAH.....SPTYNYRSSYGTSSVSPYT
Q6C343_YARLI/5-464SPAGTLGGMM...................PAPGLNRKRHMSRTSLFSNELSTSFRQ.....RYERQMRDQSGHLSIPPLS
NPRL2_HUMAN/2-380KQGH............................................................................
A7TI78_VANPO/6-544VPESSTLHQLPLES............LSKLKLDSDGSDSQNLRKSKNGIDSRAAS........FVSSRGASSHNENSSLY
Q16E62_AEDAE/15-395LLHSESE.........................PK..............................................
A7EKL1_SCLS1/45-458ING.............................................................................
Q0U9Y5_PHANO/1-469VPRLRL............................GSAATASTTI.............................L......

PF03666

NPR3_PICGU/189-627-------------------------------AFSSLPSLPHFLKLLSASSRKPKQFAAAIP...SK----D--HRDIYME
NPR3_DEBHA/205-648-------------------------------TFPALPSLPHFLKLLS.NSSKPRQLATVIP...SK----D--HRDAYLN
Q6PB11_XENLA/76-432-------------------------------QFPGH.DLPSVLSKFS....LPVSLSELKNPLSPP----G--QEPHLIQ
A7RUK4_NEMVE/58-409-------------------------------SFPGK.SLHATLADFS....LPSPLAEHYNPLASP----Q--QQAEQVQ
Q29ED8_DROPS/76-449-------------------------------RFAGM.SLFEVISDFS....LPTSIGHLTTPLQQP----A--RQGILAQ
NPRL3_CAEEL/80-411-------------------------------QFGNTIHLAAGLAHFN....PPKTLDTFIRKNLPL----H--EQGVRAK
NPR3_COCIM/142-586-------------------------------AFPTMPSLPKMLAVLS...GTPRPYASFIP...SR----D--HKGIYYD
NPR3_PHANO/150-599-------------------------------RFPTLPTLPKVLNMLS...GTPRPFRNFIP...TT----E--HREAYMD
Q7SGC4_NEUCR/109-530-------------------------------QFPLSPPLPNFLAELG...VAPRPYKLHCP...SK----A--HRPLYMA
Q2HAI2_CHAGB/107-530-------------------------------QFPLSPTLPNFLAELS...VAPRPYKLHCP...SK----A--HRPVYMA
NPR3_CANGA/243-798-------------------------------KFPSLPSLPTFLNILS..LGKPKAFGNIIP...SK----E--HKPIYMA
A7TP53_VANPO/308-812-------------------------------AFPSLPPLVSFLSLLS..NGKPHPFGTIIP...SK----E--HKPIYLG
NPR3_ASHGO/273-792-------------------------------KFPTLPTLPSFLSSIS..TCKPRSFGHLIP...SK----D--HNLLYLS
NPR3_KLULA/205-724-------------------------------KFPSLPSLPSFLQLMS..TQKPRPFGHIIP...SN----E--HKSMYLN
NPR3_CANAL/154-550-------------------------------RFPTLPSLPHFLKLLSPQSRKPQQFATVIP...SK----D--HRDRYLQ
NPR3_PICST/142-551-------------------------------SFPTLPSLPQFLKLLSPQSKKPSQFATVIP...SK----D--HRDIYFE
NPR3_LODEL/219-622-------------------------------RFPMSPSLPQFLKLLSPQLKKPQQFASIIP...SR----D--HRASYFE
NPRL3_SCHPO/76-481-------------------------------EFPSLPSLSTFLAILS...FKPRPFASIIP...SK----D--HELVYLE
Q4PA65_USTMA/205-719-------------------------------TFPDVAPLPVFLSQLS..SSTSRTLSNLFP...AR----H--QRELALE

PF06218

Q6BQE8_DEBHA/5-471KHSSI..FKASKKKFSGETT...........VIPSKASLFYLYRSLN----QGQTVKEWYMQHRKY....L..NNIDVRR
A5DQL3_PICGU/4-471RTSYF..SSSSATTAKPRTI...........HVPSKATLFYLYRSLN----QGQTIREWYVQHRKQ....L..QFIDVRR
Q55BD9_DICDI/1-392...............................TPCSFEFIFSLYSSLS----IDTTFREYCLENSLT....S..WGIDERA
A3GHC2_PICST/6-481EHS......ASKGAIT...V...........KVPSKATLFYLYRSLN----QGQTVKEWYIQHRKL....L..VNVDIRR
Q9VXA0_DROME/35-412...............................TLPSVQRIFQFYASMT----HGVTLRAICQRLCPQ....H..HNIDERR
Q6CSH1_KLULA/7-517SSSTSSYFRAHASENTSL.ATGEN...QMKRILPTRSCLFDLYKSLS----QGKTVKDWYKQNFEI....IRDNRIDVRK
NPR2_YEAST/7-528SSFSSIYKDWRQSQTSCS.SSNIHVINNRNRFLPTRSCLFDLYRSLS----QGQTLKTWYESKYMI....LKENNIDIRR
NPR2_SCHPO/14-409...............................KNVTFATIFKLYCSLR----QGLRVKDWMNENKEI....F..KGLDVRR
Q75CA3_ASHGO/14-531SNKDYYYNRSRNLESNCK............RTLPTRRVLFDLYRSLT----QGQTLKEWYKANYSA....IRENQIDVRR
Q5AEE0_CANAL/6-515K..YSFLSRSPKNPMVNG.SD.........VKVPTKTTLFYLYRSLN----QGQTVKEWYMQHKKI....L..GNVDIRR
Q6C343_YARLI/5-464SSATSALSTSSSSSLSQR.SNSFSSSHSMSGTVPSVVQLFKLYKSLH----QGQTLGDWYAENQKE....L..VNIDIRR
NPRL2_HUMAN/2-380...............................KRASLRDVFQLYCSLS----PGTTVRDLIGRHPQQ....L..QHVDERK
A7TI78_VANPO/6-544SR.SDLYLNRHRSESSIS.SQNTNDLNGNVKQLPTRSTLFDLYRSLS----QGVTLKEWYKENFFE....IRNNGIDIRK
Q16E62_AEDAE/15-395...............................RLPSLHKILQLYSQMT----HGVTLRALCQRLCPR....D..NGIDERK
A7EKL1_SCLS1/45-458...............................PRLSNFILCRLFTTLC----TSRTLKEWLKLHMDQGLNVL..NYADIRR
Q0U9Y5_PHANO/1-469.........EHPSPSSPT.AASTDDDKEEEWHIP.HTTLIHLYTSLR----QGLTLKNWVLANLSH....L..PGIDVRR

PF03666

NPR3_PICGU/189-627ALGWLMKYGYVTQLHTFVW----LKISK----------------------------------------------------
NPR3_DEBHA/205-648ALSWLIRYGYVTQLHTFIW----LKISR----------------------------------------------------
Q6PB11_XENLA/76-432MVIFMLQHRLLIQIHTYVC----LLVPP----------------------------------------------------
A7RUK4_NEMVE/58-409MVVWMLQHRLLIQLHTYIF----LV..P----------------------------------------------------
Q29ED8_DROPS/76-449MVLWMLQHHLLMQLHTYVQ----FM..P----------------------------------------------------
NPRL3_CAEEL/80-411LVVALLRHQMLMQLHQFYY----ILKPY----------------------------------------------------
NPR3_COCIM/142-586ILAWLMRGGWVTQLRTFGW----IKVDQ----------------------------------------------------
NPR3_PHANO/150-599ILAWLMRGGWVTQLRTFAW----VRVTP----------------------------------------------------
Q7SGC4_NEUCR/109-530MLAWLMRGGWVTQLCTFAY----VVVWP----------------------------------------------------
Q2HAI2_CHAGB/107-530MLAWLMRGGWVTQLCTFAY----VVVWP----------------------------------------------------
NPR3_CANGA/243-798ALIWLIQKGYLTQLLTFVY----IRVDK----------------------------------------------------
A7TP53_VANPO/308-812ALAWLIRYGYVTQLFTYVC----IRVDK----------------------------------------------------
NPR3_ASHGO/273-792VLAWLIRYGYLTQLLTFVW----LRVDR----------------------------------------------------
NPR3_KLULA/205-724ALAWLMRYGYLTQLLTFVY----VRVDK----------------------------------------------------
NPR3_CANAL/154-550ALGWLIKHGYVTQLQTFIW----LKISR----------------------------------------------------
NPR3_PICST/142-551ALSWLIRFGYVTQLQTFIW----LKISR----------------------------------------------------
NPR3_LODEL/219-622ALAWLIRFGYVNQQLTFVW----LKIPK----------------------------------------------------
NPRL3_SCHPO/76-481MLAWLCRRNWVYEQNIYMY----ILVPE----------------------------------------------------
Q4PA65_USTMA/205-719VLIWLLRHEVVVKMHIRLR----LIATE----------------------------------------------------

PF06218

Q6BQE8_DEBHA/5-471FINFGVIRGILYRVHSYPI....LNSLT..KSLENKNDNELDKI.........................IDLFKAKTNPN
A5DQL3_PICGU/4-471FITFGVLRGLIYRVHSYPI....SDPLV..KAIESDTLQELDEAMKE.....................KIEKLKERTKSN
Q55BD9_DICDI/1-392FIMFGVINDFLRRKQRYPL....LTNLQSLDSLPPSHKKHLLNGTKN......................YDEICCILSIG
A3GHC2_PICST/6-481FINFGVLRGIIYRVHTYPI....LNSIT..RLIENNDEEQYAKL.........................VDIIRKKHRPR
Q9VXA0_DROME/35-412MVIFGLQHRFIRCIHKYPV....FTGSV......PSGRQKMYTGLIS......................FDEICCKTGLS
Q6CSH1_KLULA/7-517LIMFGITRRLIYRVNSYPI....VKNVG.....TWDILKSLVSKEP.......................KTHYGSGSSKN
NPR2_YEAST/7-528FITFGLEKRIIYRCYSFPV....MINAG......SREPKEMTPIITKDL..................VNNDKLLEKRNHN
NPR2_SCHPO/14-409LISFGTIKGLIYRVHKYPY....LERRTMRNNLTEEEKKLLGLLDGKH....................HFDELCVTLKKS
Q75CA3_ASHGO/14-531LIIFGVFHRLIYRCYSYPV....AKSIG.....TLELLKRFDYVSTTD....................NFIPTGTSAGNN
Q5AEE0_CANAL/6-515FINFGVLRGIIYRVYTYPL....LNSFT..GAIERNDTEQYDEL.........................LSNLKKKKPKR
Q6C343_YARLI/5-464FITFGVIKGIIYRAHSYPI....LEGIT.....PFNRNRH.............................VQDVSATPRGG
NPRL2_HUMAN/2-380LIQFGLMKNLIRRLQKYPV....RVTRE.....EQSHPARLYTGCHS......................YDEICCKTGMS
A7TI78_VANPO/6-544FIIFGIINGLLYRCQSFPV....TANFE.....EINKVKKFKDIQNRKE..................TRKDKLQKQLSQD
Q16E62_AEDAE/15-395LVTFGLQHSLIRCINKYPI....FTGSY......PSPRHKLYTGLNS......................LDEICCKTGLS
A7EKL1_SCLS1/45-458FIQFGVIKGLIYRVHRYAVSSRYLTSILSRYAMPFEARDRALQRYTNGC..................HCFDQITTELNIG
Q0U9Y5_PHANO/1-469LITFGVIKGFVYRVHKYAI....ASTSAGSTAPPTSLATSTREETGAEGMGMGTENALPMLRFLDGLCCFDQICVELGVP

PF03666

NPR3_PICGU/189-627---------------------KIKMK
NPR3_DEBHA/205-648---------------------KIKMK
Q6PB11_XENLA/76-432---------------------NEDVA
A7RUK4_NEMVE/58-409---------------------SAQLE
Q29ED8_DROPS/76-449---------------------SEDEF
NPRL3_CAEEL/80-411---------------------SIAIL
NPR3_COCIM/142-586---------------------ELKSA
NPR3_PHANO/150-599---------------------EIKAK
Q7SGC4_NEUCR/109-530---------------------EIIYE
Q2HAI2_CHAGB/107-530---------------------EIIYE
NPR3_CANGA/243-798---------------------KIKMK
A7TP53_VANPO/308-812---------------------QIKMA
NPR3_ASHGO/273-792---------------------RIKIA
NPR3_KLULA/205-724---------------------RIKIA
NPR3_CANAL/154-550---------------------KIKIK
NPR3_PICST/142-551---------------------KIKIK
NPR3_LODEL/219-622---------------------NLRVK
NPRL3_SCHPO/76-481---------------------EIKKK
Q4PA65_USTMA/205-719---------------------SVKRR

PF06218

Q6BQE8_DEBHA/5-471VYPVNES.......LANKSLLKSIVH
A5DQL3_PICGU/4-471SHVNNPR..................V
Q55BD9_DICDI/1-392VEAVEKLL....FEIAHPDSFIVILK
A3GHC2_PICST/6-481KKEVLSRPKSSEGNLLKTRVNEQVLK
Q9VXA0_DROME/35-412PCTIERD.......IEKDTNVTVIWK
Q6CSH1_KLULA/7-517IFSAADI..............KVVDT
NPR2_YEAST/7-528.....................HLLSA
NPR2_SCHPO/14-409PKVVNEM.......IAGLGDACFIYV
Q75CA3_ASHGO/14-531VFSTSDI..............RVDFD
Q5AEE0_CANAL/6-515IVSIGRN..............ENLLK
Q6C343_YARLI/5-464RRRVGLG...........PDQERIKK
NPRL2_HUMAN/2-380YHELDER.......LENDPNIIICWK
A7TI78_VANPO/6-544IFSTSDI..............KVGED
Q16E62_AEDAE/15-395PSRIEED.......IDVDSNVTVIWK
A7EKL1_SCLS1/45-458EAKIMERL.....RKFPKGDVEVIYR
Q0U9Y5_PHANO/1-469ERTVEGR.......VKGLGEGLGVIV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window