Sequence alignment for CL0435

PF03666

S8B047_PENO1/190-645------------------------------------------------------------------....SVWEKLLSPS
H1V255_COLHI/104-533------------------------------------------------------------------GFPTKDLASILTPG
G1WZV0_ARTOA/142-590------------------------------------------------------------------GFRHNVLAGLLSVP
C4QYA8_PICPG/201-611------------------------------------------------------------------GFDINFLSEIVTPP
K2SR44_MACPH/175-626------------------------------------------------------------------GFKSEGLEKLLCPG
R9P8J9_PSEHS/205-716------------------------------------------------------------------GYDIDILASILNPR
NPR3_CANGA/243-797------------------------------------------------------------------EFDIDFLAELCCPS
C0NJI2_AJECG/154-591------------------------------------------------------------------.LPTNVWEKLLSPS
G8JWB1_ERECY/316-852------------------------------------------------------------------NFNSEFVAEICCPP
NPR3_PHANO/150-598------------------------------------------------------------------GFKTDALEKMLSPG
B6QRZ0_PENMQ/156-593------------------------------------------------------------------.LPSEVWEKLLSPS
NPR3_KLULA/205-723------------------------------------------------------------------NFNTEFVAELCSPR
B8N792_ASPFN/172-617------------------------------------------------------------------GLQADVWEKLLSPS
M7X5H8_RHOT1/78-583------------------------------------------------------------------GFPDPVLASLLTPS
NPR3_DEBHA/205-647------------------------------------------------------------------GFEADYLCEMLCPP
D6RLY8_COPC7/119-572------------------------------------------------------------------GYSGEFLASLLCPQ
V2XGE3_MONRO/83-521------------------------------------------------------------------GYSSEFLAGILCPH
T5A616_OPHSC/95-514------------------------------------------------------------------GFPTRDLAGILTPA
E9EL47_METAR/99-517------------------------------------------------------------------GFPTRDLASILTPA
NPR3_ASPFU/179-636------------------------------------------------------------------GLPADVWEKLLSPS
NPR3_ASHGO/273-791------------------------------------------------------------------NFDAEFVAELCSPP
Q4PA65_USTMA/205-718------------------------------------------------------------------GYDIDILASILNPR
N1J4X2_BLUG1/150-556------------------------------------------------------------------EFSTTDLESILTPS
C4JQY3_UNCRE/143-586------------------------------------------------------------------GLATNTWEKLLCPS
U4LL48_PYROM/132-582------------------------------------------------------------------GFKTEFLADMLAPK
M4G219_MAGP6/120-591------------------------------------------------------------------GFPTKDLESILTPG
I1RCJ1_GIBZE/98-519------------------------------------------------------------------GFPARDLAGILTPA
J7RBT2_KAZNA/205-696------------------------------------------------------------------GFDSEFVAEFCCPD
D5G9F0_TUBMM/127-587------------------------------------------------------------------GFKEEFLAGLLAPK
I2G095_USTH4/203-726------------------------------------------------------------------GYDIEILASILNPR
C5FU53_ARTOC/156-599------------------------------------------------------------------.LKYDVWEKLLSPS
H2AZX0_KAZAF/181-685------------------------------------------------------------------GFDSEFVAEFCCPD
V5ETE4_PSEBG/203-712------------------------------------------------------------------GYDIELLASILNPR
W1QEY3_OGAPD/185-592------------------------------------------------------------------GFDVDFVSELVTPP
S6E8H4_ZYGB2/281-781------------------------------------------------------------------GFDPEFVAEFCSPE
B6H909_PENCW/173-617------------------------------------------------------------------....SVWEKLLSPS
C5DHQ6_LACTC/242-731------------------------------------------------------------------.FDKDFFAEISSPP
M1VZL7_CLAP2/99-559------------------------------------------------------------------GFPTRDLASILTPA
M7TWW8_EUTLA/45-471------------------------------------------------------------------GFPTKDLESLLTPA
G8YSZ2_PICSO/187-642------------------------------------------------------------------GYEPDYLSEMLCPP
L8FQS0_PSED2/113-539------------------------------------------------------------------.FHTKDLASILTPA
F8PYL6_SERL3/132-563------------------------------------------------------------------GYSSEFLASMLCPQ
S8BNA5_DACHA/141-592------------------------------------------------------------------GFRHDVISGLLNVP
J8Q1I2_SACAR/396-963------------------------------------------------------------------EFDHDFVAEFCSPE
A7TP53_VANPO/308-811------------------------------------------------------------------DFDAEFVAEFCSPE
D8PLZ6_SCHCM/127-556------------------------------------------------------------------GYNAEFLTNLLCPH
E9D3F7_COCPS/143-585------------------------------------------------------------------.LGTDVWEKLLCPS
H6BW23_EXODN/132-559------------------------------------------------------------------G..EDGLANLLAPG
U1GT46_ENDPU/116-550------------------------------------------------------------------GLDASALERLLMPS
C5DQJ7_ZYGRC/281-783------------------------------------------------------------------GLDAEFVAEFCSPE
B2ALS2_PODAN/100-533------------------------------------------------------------------GYPTKDLENLLTPN
G4U9V0_NEUT9/109-529------------------------------------------------------------------GFPTKDLENILTPA
R8BC65_TOGMI/105-536------------------------------------------------------------------GFPTKDLESILTPG
U7Q027_SPOS1/111-529------------------------------------------------------------------.LPTKALEGILTPP
G8BGC4_CANPC/198-622------------------------------------------------------------------GMDPSYLCEMLAPP
E7A1P0_SPORE/203-720------------------------------------------------------------------GYDIEILASILNPR
G0RDM3_HYPJQ/95-507------------------------------------------------------------------GFPARDLAYILTPA
K0KSM9_WICCF/157-573------------------------------------------------------------------GFDAEFLGEFLSPP
M9MFA0_PSEA3/199-702------------------------------------------------------------------GYDIEILASILNPR
J4HS73_FIBRA/136-569------------------------------------------------------------------GYPAEFLAGMLCPQ
G0VDK5_NAUCC/193-728------------------------------------------------------------------GFDSDFVAEFCSPE
E7KD88_YEASA/399-966------------------------------------------------------------------EFDNDFVAEFCSPE
G4MPF6_MAGO7/119-567------------------------------------------------------------------GFPTKDLESILTPS
G8ZWI0_TORDC/270-767------------------------------------------------------------------DFDPEFVAEFCSPE
S9VYA1_SCHCR/73-478------------------------------------------------------------------GYEKGFLANMLSPR
I2H4A8_TETBL/339-898------------------------------------------------------------------DFDSEFVAEFCSPE
V5FG66_BYSSN/161-604------------------------------------------------------------------GLTTDVWEKLLSPS
G2R1J8_THITE/107-555------------------------------------------------------------------GFPTKDLENILTPA
U5HEM2_USTV1/112-634------------------------------------------------------------------GFPSTVLASLLSPS
F4P7C7_BATDJ/218-651------------------------------------------------------------------GLDCEFLSDILSPK
G0WEJ7_NAUDC/230-810------------------------------------------------------------------GFDSDFVAEFCSPE
Q5KFU1_CRYNJ/231-746------------------------------------------------------------------..PLEVLADMLTPP
S2K004_MUCC1/106-577------------------------------------------------------------------.IDVSFLADALAPK
J5JA21_BEAB2/104-534------------------------------------------------------------------GFPTRDLASILTPA
C1GWB7_PARBA/96-533------------------------------------------------------------------.LPTSVWEKLLSPS
G0SXZ9_RHOG2/78-582------------------------------------------------------------------GFPDPVLASLLTPS
R7YHW5_CONA1/139-553------------------------------------------------------------------GFNIESLEKLLSPP
G8BZL7_TETPH/286-791------------------------------------------------------------------GFDSEFIAEVCSPD
K1XTL5_MARBU/117-531------------------------------------------------------------------.FYTTDLESILTPS
S8E9R2_FOMPI/133-565------------------------------------------------------------------GYSAEYLAGLLCPQ
NPR3_EMENI/171-616------------------------------------------------------------------.LPVDVWEKLLSPS

PF06218

M3IIL9_CANMX/8-518IPIVAIFYSVFHPIEGTKIVHQFPENTISTGRKRK................DDTEEEDNEDNEDEGIFEFDTIRNYVIPK
M2UFV8_COCH5/4-472RAIKAIFYTRFHHEKGNRVLHQVPPGAIIPSTL..........................PSALTTPLFPFSSVTQYLIPT
Q6BQE8_DEBHA/7-469VPITAIFYAVFHPTEGTKVLNQVPEGSIGNSS...........................TSDSNGIIFNFDTIKNYIIPK
Q0U9Y5_PHANO/4-462RAIEAIFYTRFHHEKGSRVLHQVPPGSITPSPKPS........................KSDLAETLFPFSSVTSYLIPS
G3AQK3_SPAPN/8-551IPIVAVFYAVFHPTEGTKIIHQVPENSIVTTSHQRTKVVKNVSRLSMDSTNSDSRQRQEDEDEDDGLFNFDTVKNYVIPK
W6RQZ3_CAEEL/186-593..LLGILLAEFHNTLGAIIKHSVPK..................................ENNKVEATFHFT..KGLIIPK
A5DQL3_PICGU/6-475EPITAVFYSVFHPTEGTKIVHQVPDV.................................ISRDQPSLFDFDAVRNYVIPK
K1Y0B6_MARBU/2-405..IQGIFFARFLSEKGTKVVHQSPPGCIVAE............................PDVDKARLFDFEVLAEYIIPR

PF03666

S8B047_PENO1/190-645.RSWHKKRFEVGI--NDLALIGWPVFVREDGTWRKQ.........RRKK..KKKKSAPEWD...................
H1V255_COLHI/104-533.RAYHKKLFQLSL--DPLYCVSYPIHVPESGTWKKK.........KKKKKGKTERAKSVRT...................
G1WZV0_ARTOA/142-590.RALAKSRFELSV--DHSVFLGYPCYSRIDGTWQRK.........KKER..KIKSEGPK.....................
C4QYA8_PICPG/201-611.KKLCNTRFELTV--DEMVFLGLPIH.PKSSRYKKS............................................
K2SR44_MACPH/175-626.RGFNKRKFEVGM--EGLSFLGHPMFAKGNGAWRKR.........KKRA..NA...SQEDV...................
R9P8J9_PSEHS/205-716.TALAHQKFELVV--DDLAFLGHPVAAHPERGWDEEGNE..TLQSDRDS...............................
NPR3_CANGA/243-797.REMCNTRFELTV--DEYCFLGHPIHVDSSGNWRKS.........R..K..RNNS.........................
C0NJI2_AJECG/154-591.PAWHKRRFEVGV--NDLVFVGWPVFVKDDGTWRKR.........KRKK..KVRTQQGE.....................
G8JWB1_ERECY/316-852.KDMCNTRFEFTI--DESCFLGLPIHVDESGRWRKR.........RN.R..KTPL.........................
NPR3_PHANO/150-598.KEFNKRRFELGV--ESIVFVGAPMFVREDGLWKKL.........KRRK..KKRSDKEKLD...................
B6QRZ0_PENMQ/156-593.RAWHKRRFEIGI--NDLAFVGWPVFVRDDGHWRKK.........SRRR..KRKKTKSGGEGKQHGSG............
NPR3_KLULA/205-723.KEMCNTRFEFTV--DDLCFLGLPIHADHKGRWKKS.........K..K..RKQA.........................
B8N792_ASPFN/172-617.RSWHKRRFEVGI--NDLAFVGWPVFVREDGTWRKQ.........RRKK..KKTKP..EWE...................
M7X5H8_RHOT1/78-583.RELCDQPFELVV--DHLAFVGHPVWLGDDEGPRERLDGAANETGEQEK...............................
NPR3_DEBHA/205-647.KQMCNSRFEIMI--DDLVFLGLPIHSYDNGSWKSK............................................
D6RLY8_COPC7/119-572.SNKCHQKFELIV--DDLAFLGHPVAANERGEWEFR............................................
V2XGE3_MONRO/83-521.ASMCHQKFELVV--DDLAFIGHPVCAEAGGIWHFK............................................
T5A616_OPHSC/95-514.RSYHKSLFQLSL--DPLLCISYPIHVPDNGKWKRP.........KRAD..KA...........................
E9EL47_METAR/99-517.RSYHKKLFQLSL--DPVHCISYPIHVPENGKWKRH.........KKSN..KA...........................
NPR3_ASPFU/179-636.PAWHKRRFEVGI--NDLAFIGWPVFVREDGTWRKQ.........RRKK..KKKRRA.DWE...................
NPR3_ASHGO/273-791.KEMCNTRFELTV--DDLCFLGLPIHVDESGRWRKQ.........KV.K..RQQT.........................
Q4PA65_USTMA/205-718.PELSHKKFELVI--DDLAFLGHPVTPNKNGVWGDQDDE..SQDDRVEA...............................
N1J4X2_BLUG1/150-556.RAYHKSRFEMIL--DPLCFLTYPVHIREDGRWKKR.........MTKKSQRTRRKVASNR...................
C4JQY3_UNCRE/143-586.SSWHKRRFEVGV--NDLAFVGWPVFVREDGRWRKK.........WKKK..KKKTPAGYTVLDEASLG............
U4LL48_PYROM/132-582.AAAARGRFEMSV--DDIVYIGMPVHVRPDGTWRRS.........RKRK..KKGDVEEDDDPDE................
M4G219_MAGP6/120-591.RAYHKTLFQLSL--DPIYCVSYPIHVPESGSWKKR.........KKKK..KKNELKKKAS...................
I1RCJ1_GIBZE/98-519.RSYHKRLFQLSL--DPLYCVSYPIHVPENGRWKKP.........KKTS..RT...........................
J7RBT2_KAZNA/205-696.RELCNTKFEFTI--DQLAFLGLPIHCDSKGKWRKS.........K..H..KRQF.........................
D5G9F0_TUBMM/127-587.ERMCRAKFELSI--DDMVFLGYPLHVRPDGTWRKQ.........KKKR...............................
I2G095_USTH4/203-726.PELAHQKFELIV--DDLAFLGHPVSAGKAGTWGDPENNRDGNDKDADD...............................
C5FU53_ARTOC/156-599.PAWHKRRFEVGV--NDLTFVGWPVFVRKDGTWRKK.........KKKKKEKEKEKGKTDRKKHGGNGSISGLGAAISAG
H2AZX0_KAZAF/181-685.RELCNSRFEFTV--DDLCFLGLPIRRDASGYWRKS.........K..R..KKHT.........................
V5ETE4_PSEBG/203-712.QELTHHKFELMI--DDLAFLGHPVSLDRSDILGGQDDE........DA...............................
W1QEY3_OGAPD/185-592.KQLCNSRFEVSV--EDMAFLGLPIHVNEDGNWRVS............................................
S6E8H4_ZYGB2/281-781.REMCNTRYEFTV--DTLCFLGLPIHVDQHGNWRKS.........K..R..KKQM.........................
B6H909_PENCW/173-617.RSWHKRRFEVGI--NDLALIGWPVFVREDGSWRKQ.........RRKK..QKKPRA.EWD...................
C5DHQ6_LACTC/242-731.KEMCNTRFELTI--DELALVGLPIHRNADGQWRKT.........K..K..RKSS.........................
M1VZL7_CLAP2/99-559.RSYDKKLFQLSL--DPIHCISYPIHVPEDGKWKRN.........KKIH..KANKLNRANK...................
M7TWW8_EUTLA/45-471.RSFHKKRFQVSL--DQLFFVSYPVFVPENGIWRKT.........KKKKQPQSQPSRPPEN...................
G8YSZ2_PICSO/187-642.RQMCNSRFEIMI--DDLIFLGLPIHSFEDGSWRQS............................................
L8FQS0_PSED2/113-539.RAFHKRCFELTL--DPLTFVTYPMHIREDGRWKKK.........KREKRSRRRKEEEERQENGSIAD............
F8PYL6_SERL3/132-563.RSLCHQKFELRI--DDLVFLGHPVGAESDGSWRFK............................................
S8BNA5_DACHA/141-592.RALSRTRFELSV--EQFVFLGYPCYNRPDGTWQRR.........RREK..KPKPETPKTD...................
J8Q1I2_SACAR/396-963.REMCNTRFEFTV--DNFCFLGLPIHVDSQGRWRKS.........K..H..KNK..........................
A7TP53_VANPO/308-811.REMCNTNFEFTV--DNLSFLGFPIHIDADGNWKKS.........K..K..KKS..........................
D8PLZ6_SCHCM/127-556.VSMCHQKFELIV--DELAFIGHPVCAYPDGTWKFK............................................
E9D3F7_COCPS/143-585.SSWHKRRFEVGV--NDLTFVGWPVFVREDGTWRKK.........RKKK....KTRAGDSVLDTAPTLG...........
H6BW23_EXODN/132-559.RAWHKRKFELGI--NDFTFLGRPVYAREDGLWRKP.........KSKKSSRAEDDSVQQSSDTA...............
U1GT46_ENDPU/116-550DRSWHKRKFEVGF--NDLVFVGWPIFIREDGTWRKK.........RRKE..RVNTVKAEDNRVDSSLE............
C5DQJ7_ZYGRC/281-783.REMCNTRYEFTV--DTLCFLGLPVHVDQHGNWRKS.........K..R..KKHT.........................
B2ALS2_PODAN/100-533.RAYHKRLFRVSL--DNIYCVSYPIYVPENGMWQKK.........KRKK..KQ...........................
G4U9V0_NEUT9/109-529.RAYHKRLFQVSL--DSLYCVSYPIYVPENGVWRKK.........SKKQ...............................
R8BC65_TOGMI/105-536.RAYHKGLFQISL--DPLICVSYPIYAPENGIWKKK.........SKKKKKKSKTSRKGEEEV.................
U7Q027_SPOS1/111-529.RAFHKKRFQMSL--DSVTYISYPVHVPSNGVWARR.........RNAT...............................
G8BGC4_CANPC/198-622.AAMCNARFEMMI--EGKTFLGLPIHKSIDGGWKTR............................................
E7A1P0_SPORE/203-720.PELAHQKFELVV--DDLAFLGHPVAATKGGTWSDESDEGKDNDKDGHG...............................
G0RDM3_HYPJQ/95-507.RPYHKKIFQLSL--DPLLCISYPIHVPENGKWKKT.........KKAN...............................
K0KSM9_WICCF/157-573.KRLCNSRFELTV--DDMAFLGLPIHKNDDGLWRNH.........KSKR...............................
M9MFA0_PSEA3/199-702.PELAHQKFELIV--DDLAFLGHPVAASKAGTWGEPDNH.DGHPGATDS...............................
J4HS73_FIBRA/136-569.SSMCHQRFGFVV--DDLVFLGHPVCAEPDGTWRFK............................................
G0VDK5_NAUCC/193-728.REMCNNKFEFTV--DEFAFLGLPVHVDSNGKWRRQ.........RH.K..RHNA.........................
E7KD88_YEASA/399-966.REMCNTRFEFTV--DNFCFLGLPIHVDSQGRWRKS.........K..H..KNK..........................
G4MPF6_MAGO7/119-567.KAYHKKLFQISL--DPIYCVSYPIHVPENGIWKKK.........KKKKDQEPKRKGS......................
G8ZWI0_TORDC/270-767.RELCNTRFEFTV--DEICFLGLPIRVDADGQWRKS.........R..R..RKQS.........................
S9VYA1_SCHCR/73-478.PELCNQKFEMWV--DGLTFLGCPVHIGPSGEWVKR.........KNPP..KNVEVSSLVDPFG................
I2H4A8_TETBL/339-898.REMCNTKFEFTI--DKFCFLGLPIHVDEEGNWKKS.........K..K..KKHS.........................
V5FG66_BYSSN/161-604.RTWHKRRFEVGI--NDLSFVGWPVFVRDDGTWRKQ.........KRKK..KK.PRA.EWE...................
G2R1J8_THITE/107-555.RAYHKRLFQVSL--DPVHCVSYPIYVPENGVWRKK.........KSKKPRNQPPQSQQHR...................
U5HEM2_USTV1/112-634.RELCDQPFELVV--DHLAFVGHPVWLGDDEPSTGLNRGPAGGRAQHRG...............................
F4P7C7_BATDJ/218-651.VALCDKQFHLTV--DNVDFVGHPTLLNADRPGTGL.........RFARMVQKRKLI.......................
G0WEJ7_NAUDC/230-810.REMCNTRFEFTI--DELCFLGLPVHIDSDGKWRKS.........RHSK..RRQG.........................
Q5KFU1_CRYNJ/231-746.RSACNRRFELCV--GNVVFLGHPVCATPDGKWEAP............................................
S2K004_MUCC1/106-577.SPLCDRKFQLSM--DDLTFVGHPVSLSSPQQQQQQ............................................
J5JA21_BEAB2/104-534.RPYHKKLFQLSL--DPLLCVSYPIHVPESGKWKRV.........KKSK..AG...........................
C1GWB7_PARBA/96-533.PAWHKRKFEVGV--NDLVFVGWPVFVREDGTWRKR.........KRKK..RTRKKEAS.....................
G0SXZ9_RHOG2/78-582.RELCDQPFELVV--DHLAFVGHPVWLGDDEGPRERLDGAANEAGEQEK...............................
R7YHW5_CONA1/139-553.RGFNKRRFEVGL--EGLVFLGAPMFVRADGLWKKK.........RRRHSERRDHQAACDQDEAA...............
G8BZL7_TETPH/286-791.REMCNTSFEFTV--DNLCFLGLPIHSDKDGNWRTS.........K..N..KSN..........................
K1XTL5_MARBU/117-531.RAYHKKRFELSL--DPLYFVSYPMHVYPNGLWNKK........LKKSKKSKGV..........................
S8E9R2_FOMPI/133-565.DSMCHQKFELVV--DDLAFIGHPVCAEPDGSWRFK............................................
NPR3_EMENI/171-616.RSWHKRRFELGI--NDLAFVGWPVFVREDGNWRKQ.........RRKK..KKKQRA.EWE...................

PF06218

M3IIL9_CANMX/8-518-PQLCNRLISLKI..DKYKVIGYPVNMENSYYSRNSF-------------------------------------------
M2UFV8_COCH5/4-472-QQFCDRLLTFCV..NHHRVIGYPVCIREGKYSRNEF-------------------------------------------
Q6BQE8_DEBHA/7-469-PKLCNKLISIKI..DRFKVLGYPVNIENEKYSRNSF-------------------------------------------
Q0U9Y5_PHANO/4-462-QHFCDRLLTFVV..NHHRIIGYPVCIQGAKYSRNEF-------------------------------------------
G3AQK3_SPAPN/8-551-PQLCNRLISFKI..NKYKVIGYPVNMENPRYSRNSF-------------------------------------------
W6RQZ3_CAEEL/186-593-PSMFRNSFSLTIKSLRCKVLMFPVGIDHKSYERGRF-------------------------------------------
A5DQL3_PICGU/6-475-PQLCNKLVSFKI..GRYRVMGYPVNIENTDYARNSF-------------------------------------------
K1Y0B6_MARBU/2-405-QGFCNRFVTICCPENKYRILGHPVCIQDEKYARNEF-------------------------------------------

PF03666

S8B047_PENO1/190-645.............GGELGHNENSEDGQGEDDLTATPDMGGSVATITELSLTASP.....TDYKRTSTASSRL........
H1V255_COLHI/104-533.............EESAVLVDFDPNEDNED..................................................
G1WZV0_ARTOA/142-590.............GEEEKEVHTSDVDNDDED.......................TKGNDADDEDPDAVALSR........
C4QYA8_PICPG/201-611...................DRNSHSHHSHSHHSRATSLDEDEFEVK..................................
K2SR44_MACPH/175-626.............RPNNGHQDADGPYESGAP..........................ADTEDEGVNVTGPEDGMPIDLPP
R9P8J9_PSEHS/205-716...............QGETSTAQSQQRGRSGLRKEIRPFDPPNGIDGSND..............................
NPR3_CANGA/243-797................LSKSKRSGSLTGSRKRSGSKSSNHDKSF............................S.AETPNS
C0NJI2_AJECG/154-591.............NGEPGVEDKERGDLRNND....................MSSKQASETEGDNCPVGELKK........
G8JWB1_ERECY/316-852................NTRSKRSESGGAVNTTDTSLGRAGSSGSKA........HEELQQNEQQQQNIDSDLG.EGLGIP
NPR3_PHANO/150-598.............DADFVKNLTISEEDEEA...............................DTVDEIPVKSKPEPFVYPE
B6QRZ0_PENMQ/156-593.............EAKIGQDDDDANLNSDND..................VPDSTQSSRDEDN.....ADKTD........
NPR3_KLULA/205-723................SKRSARSSTARNSISRN........SVGRN........SIGRNRSKTESQGHINDVE.E.....
B8N792_ASPFN/172-617.............GGELGHNEIPGDVRDDAD...........EAIAASTETLSPHTMTASESQRASMGSIRS........
M7X5H8_RHOT1/78-583...............READTEDDEDERGRSRLSRKGSMAEGAAEEEDDDARRVDRDQTVGPPASREASLPPHARALLIPE
NPR3_DEBHA/205-647..................HSHRPKSGKSSKGRSKNAADNASIDEGI..................................
D6RLY8_COPC7/119-572..................PEPTKGSVRGREGKEKKAKEGEGSGKSKSPNPASALAPE.......................
V2XGE3_MONRO/83-521..................QEKPKVSSRGRESHNRPTSRNDSAPRNDSSPSRSPSNEK.......................
T5A616_OPHSC/95-514.................RTSSAASKQPDDH.............................VYPHETEVPPPT.........
E9EL47_METAR/99-517.....................KAPRLSEEN.............................LAPHETEPPTPS.........
NPR3_ASPFU/179-636.............GGELGHNENAEDAPDDEDGDAGGNASGGGGLMAASTETLSPKQVTLSEAKRGSGSSGKA........
NPR3_ASHGO/273-791................NTRSKRSSSGGKPD...........AGSRT........SVGLPHGTQERQP.............
Q4PA65_USTMA/205-718...............RDEKTAAHAQQRGRSGLRKEIRPYDPSDDRVASND..............................
N1J4X2_BLUG1/150-556.............DIKNRQVVNNERGNEDN..................................................
C4JQY3_UNCRE/143-586.............ADYDGHTNDGEDYEAEHS....................HNMPDQPDNDDEPSRSSMETN........
U4LL48_PYROM/132-582.............DGDEGENEGYAPEQEEEGQEGEEVEKGVEDLSIEDTGKVPEDEATKAADED................
M4G219_MAGP6/120-591.............VFSSGSLFSTIRDPDAHH....DSDAARQLGESVRLAAKAGSDTVGLSPLAGDGSSRQ.........
I1RCJ1_GIBZE/98-519....................EKRSTYNDEQ.............................LAPHEAG.PATT.........
J7RBT2_KAZNA/205-696...................SRKLTNSTSHGNLSRKG..HSVGSRRS........KNEN..........DLERRMTRVDTL
D5G9F0_TUBMM/127-587.................GRGRSGSGGGDDDGNVGVEGNPDVGGIII..................................
I2G095_USTH4/203-726...............DNDRSKAQTQQRGRSGLRKEVRPYDLQDGEETSKDSTAPTSAK......................
C5FU53_ARTOC/156-599EASMSVPLVSIPGDAHDDATNDDSDELSEEE.................................................
H2AZX0_KAZAF/181-685...................SKK.SSSLSHAKVTRSSSNRSESSKRT........QSSNTAKAYPNSNSDVEQ........
V5ETE4_PSEBG/203-712...............DAEGHDRSAGQRGRSGLRKEIRPYDVSDGGDASKDAACSLRQN......................
W1QEY3_OGAPD/185-592...............SHAKSRRKKTSRRKKVSSSSESSGEDDESDH..................................
S6E8H4_ZYGB2/281-781.................TRSKRSSST..TTRISKQR......SNVS........Q...PEGSNNGTGLARIEG.SPTRDH
B6H909_PENCW/173-617.............GGELGHNDSAEEGKKDEQLVTSPDLGASVASIAESLTSP.......TDSKRGSGSGRPG........
C5DHQ6_LACTC/242-731.................SRSKRSNSSSRTRKVSRSHYEGTDVTG....................................
M1VZL7_CLAP2/99-559.............TNKTSKANKAGKNSRTNK....ANKTSKTSKASKASKSSRHTADYQLAPHEAETPMPS.........
M7TWW8_EUTLA/45-471.............GDAVNRSDHSPAPQPDT..................................................
G8YSZ2_PICSO/187-642..................DSKRVASRISSKIKYKSQEDDKSKKSSN..................................
L8FQS0_PSED2/113-539.............DTAISESPAERSGAEDE..................................................
F8PYL6_SERL3/132-563..................SEKLKSGSRGRGSRNRDATQQDDGKSEISSIAEKGPPAQ.......................
S8BNA5_DACHA/141-592.............ETKDQEDDTADAVNDEGD.......................ITGNDADDEDPDALTLSR........
J8Q1I2_SACAR/396-963.................TRSKRSSST..TTNISRKKSIASKISSLS........ENTLKKVNSGEAETDY..........
A7TP53_VANPO/308-811.................TRSKRSSSI..YTKDDR........KSIT........QSPMINNNN.........S.SDVEEE
D8PLZ6_SCHCM/127-556..................PEVGKGLNRGRGSRNRQMSSATNDDADPSDAHPAEHLGT.......................
E9D3F7_COCPS/143-585.............SEKGGYADGGEKLESERD....................PNVDGRSDNDEEPSRSLIESH........
H6BW23_EXODN/132-559.............NGSDSDKDEEAPADDETH.................................................
U1GT46_ENDPU/116-550.............VVHKGEYATEDELNHERHVD...............................................
C5DQJ7_ZYGRC/281-783.................TRSKRSSST..TTRLSKQR......SSLS........QNGDGESGENDMDSSQLRS.SSHNLQ
B2ALS2_PODAN/100-533.............EQEQHQAESGPGAKEDD.............................ALPTETDTGFKS.........
G4U9V0_NEUT9/109-529......................QKHRDHDD.............................TAPTDTDGPART.........
R8BC65_TOGMI/105-536.............APDIEPRDDAPAPTEEDHVEVRDM......................AAPPPSKVPAA..........
U7Q027_SPOS1/111-529.............DKNNSKAKDKAASTRGA..................................................
G8BGC4_CANPC/198-622................AISNSKHATQGGTRSRSNSKPLDPKTKPSH..................................
E7A1P0_SPORE/203-720...............SNDKAAAQAQQRGRSGLRKEIRPYDLPDGSDNLDKAPAASDKQ......................
G0RDM3_HYPJQ/95-507........................KEVDDN.............................IAPDEPN.PPPT.........
K0KSM9_WICCF/157-573................DQKSKHSGNTSGNNTRSGSTKGESETEDAT..................................
M9MFA0_PSEA3/199-702...............DDAHAAAPSQRRGRSGLRKEIRPYDVPDGQTPAKEPDADSAKK......................
J4HS73_FIBRA/136-569..................PEKNKLAPRGRVSRKGETPQSVEKPLTPDRAEKHRRAPP.......................
G0VDK5_NAUCC/193-728.............TTKSVKSKKSSSG..GSLTSRQKR.RQKSTSLS........NTNTI...........DEGYE.....
E7KD88_YEASA/399-966.................TRSKRSSST..TTNISRKKSIASKISSLS........ENILKKVNSGEADTVY..........
G4MPF6_MAGO7/119-567.............IISAGGIMVSATDEDGNE............................LPPLNPDHIRPVIDTTRLSPH
G8ZWI0_TORDC/270-767.................NRSRRSNST..AGRNSKRG......SSVK........NSEFNETN....DTADIES.SVLNL.
S9VYA1_SCHCR/73-478.............IKEDSTSAASANLSELK..................................................
I2H4A8_TETBL/339-898.................SRSKRSSSI..GTKCSVNNHSTTANTNTD........ITRRRENSDLTPFISDTTE.KDLVTK
V5FG66_BYSSN/161-604.............GGDLGHEDQLDKSQPEEG...........DTAAESNAPAGSKSSTFTDGKNPTDAKRKS........
G2R1J8_THITE/107-555.............EPGVGPGTGAAKKDDDD.............................ALPTDAGASARSG........
U5HEM2_USTV1/112-634.........DLHGHGSDSDSEEDGGERRGRTRRRPPPPNQGPFANLSGDFSRSSSEELGSGSGSLAS.............
F4P7C7_BATDJ/218-651...................ASATSYRQSLGEIDSSSTFTAAVSDPS..................................
G0WEJ7_NAUDC/230-810................SVKSKKSSSG..RSSSSNFKRSRKRSISLH........RSKSRRSEDSDPEVADDEGIENNINQ
Q5KFU1_CRYNJ/231-746..............PDEDELEERAPSRGRRMRDQGGTMTNLDT.....................................
S2K004_MUCC1/106-577..............QQQQQQQQQQQQQSMDAEDHDADFLTSPLSPNPTSQLNSPTTQSTPSTPSQQPLTSPASYNTSSNK
J5JA21_BEAB2/104-534.....................RASSAVDDD.................AQVAWRAPLIAVSAPCAPSAPADS.........
C1GWB7_PARBA/96-533.............TEQDLRDGDERRYEKRDD....................GSSIQALQTDGKNDPIPGDKV........
G0SXZ9_RHOG2/78-582...............RETETEDDEDERGRSRLSRKGSMAEGAA.EDDDDARRADRDQTVGPPASREASLPPHARALLIPE
R7YHW5_CONA1/139-553.............QATDGRPQTDGPSDEDEGVNMRGGEEPFDPALN..................................
G8BZL7_TETPH/286-791.................RKSAKTSST..HSKGSRRHSINSKESTSK........TNEDENIES.........S.ENHDDE
K1XTL5_MARBU/117-531.............DTETKASSKTRSVQSDG..................................................
S8E9R2_FOMPI/133-565.....................PKVINRGRGSRKGEAPKLAETSLTPDRVERHKRPLP.......................
NPR3_EMENI/171-616.............SGELGHNDATEDSQDDGN...........DAVAASTETLSPFSALHPISQRPSVPNSRS........

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

S8B047_PENO1/190-645...................GKHAEDGI...DTEDND.QMT......MFNVVFVMD.PPLL...E...YSTR.....IKDI
H1V255_COLHI/104-533.........TPNGADASQIDSKEEETTQQDEADDKRASMT......MFNLVFIMN.PKKH...E...AKEL.....IATL
G1WZV0_ARTOA/142-590..........SKSPNPPPSERKKIKREPRK.VEATPSKLA......MFHIVFVMN.PPQL...E...YHSR.....MHDM
C4QYA8_PICPG/201-611....................PLLDSLNDLHFIESEKCPMH......MFNLVFVMN.PPVV...E...YNHR.....VDEM
K2SR44_MACPH/175-626GFEPGYGH.....GISDEASDAGSDAKSASTAGGDT.EMT......MFNVVFVLN.PPAL...E...YQLR.....TGEM
R9P8J9_PSEHS/205-716..GTDISASTGAKSRHASRTRIEKPDD..APSSRAKAPLT......QFHLVLVLDRPDPSTALPTMDLSSW.....LQLF
NPR3_CANGA/243-797PESSKIIEEVGSLHKSRTLSNPQN........DHFTKDMT......MFHVCFIMD.PNLI...E...YNKR.....VDDM
C0NJI2_AJECG/154-591...................IVE.DDVLPGSPEADKD.SMT......MFNVVFVLN.PPLL...E...YGLR.....VREK
G8JWB1_ERECY/316-852VKSDQGGGGYEHEGKT...........QRDDNEEMQKAVN......MFHVCFIMN.PQLV...E...YNER.....VDDM
NPR3_PHANO/150-598GFEPGYGHGSISSGPSGAPSEAGSDARSNSTSQDNNPDMN......MFNVVFVLN.PPAL...E...YQQR.....VKEM
B6QRZ0_PENMQ/156-593...................IEDNADSQTGSPESDKD.TMS......MFNVVFVMA.PPVL...E...YSIH.....LKEM
NPR3_KLULA/205-723.PADDENSDYEPSKSEMLNEMYCVPDAENDEFESLQQSIN......MFQVCFIMN.PKII...E...YNER.....VDDM
B8N792_ASPFN/172-617...................SRTLSEML...DGDDKD.SMT......MFNVVFVLD.PPLL...E...YSMR.....IREI
M7X5H8_RHOT1/78-583RDDSPSPRRPGALAHSHSSASTLHAGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS...H...LSSH.....LEGY
NPR3_DEBHA/205-647.........................DYETTSKSQSKNSMS......MFHLVFIMN.PPII...E...CNYR.....IDEM
D6RLY8_COPC7/119-572..............NGKEGVASSTTTTTAAVKPKKPSWMQ......KFQLAFVLDLPDPSSSASGN.VLKY.....FDII
V2XGE3_MONRO/83-521...........................SVAVPSNKCAWLH......TFHLVMVLDLPDPSSSAAGN.VSKY.....FDVI
T5A616_OPHSC/95-514....PK....PSDVKDA.....PKKE...EADDEKRSSMT......MFNLVFILN.PKKN...E...VKDL.....VDVL
E9EL47_METAR/99-517....VVISSEPARDKDG......KKD...DVDEEKRSSMT......MFNLVFILN.PKKS...E...DKEL.....VDAL
NPR3_ASPFU/179-636...................ARSLVDCL...DGDDKD.SMT......MFNVVFVLD.PPLL...E...YSMR.....TKEV
NPR3_ASHGO/273-791.STDQSGSGAPYLAQSSSESGQLRDPEQSDDVEDLQKAVH......MFHVCFIMN.PQLV...E...YNER.....IDDM
Q4PA65_USTMA/205-718..KIDKSAKTGAKSRNASLTRIEQTND..IPTSRSKAPLT......QFHLVLILDRPDPSTAVPGVDLSSW.....LQLF
N1J4X2_BLUG1/150-556.............................LSEDSDDGGMT......MFNAVFILD.VSKY...D...LKEK.....ASEM
C4JQY3_UNCRE/143-586.......................TEEDESVTDGNKE.SMT......MFNVVFVMN.PPIL...E...HNSR.....IKEN
U4LL48_PYROM/132-582...................ADDEREGETPTEQTNTESSMN......MFHIVFVLN.PPEL...E...YQAR.....TLQI
M4G219_MAGP6/120-591.DEADGCGQEPRQDEEEENDKGKDQE...KDKNDKVSSMT......MLNLVFFLN.PKKH...E...VKEL.....VSSM
I1RCJ1_GIBZE/98-519....GKATEQPAEEKEV......KKEDGKDKDDEKRSSMT......MFNLVFILN.PSSN...E...VKDV.....IESL
J7RBT2_KAZNA/205-696EPDDEMISSHIGK...................DNLDKNMN......MFHVCFVMN.PPLT...E...YNKR.....IDDM
D5G9F0_TUBMM/127-587..........GNGGHEDDADDEKDDEDGESSQGGNFGNMT......MFHVVFVLN.PPEL...E...YHSR.....TQEM
I2G095_USTH4/203-726..NDKAELQSSAKSRSISQSCMELTTDS.TTSSKSHAPLS......SFHLVLVLDRPDPSAAMSGMDLSSW.....LQLF
C5FU53_ARTOC/156-599..............................QLTIKD.GMT......MFNVVFVLN.PPTL...E...YNVR.....IREM
H2AZX0_KAZAF/181-685ENNEESLD....K...................DDLERNMN......MFHICFVLN.PPLT...E...YNKR.....ADDL
V5ETE4_PSEBG/203-712..GGKTEAAAPTKARNASQTRMEQTSD..SSVSRSYAPLT......QFHLVLVLDRPDPSTAMHGMDISSW.....LQLF
W1QEY3_OGAPD/185-592............................GEKPTKNDCQMY......MFHLVFVMN.PPVI...E...YNHR.....IDEM
S6E8H4_ZYGB2/281-781DEDSQSGDDH....NS.......DNQIPELSKEDLEKNMN......MFHVCFVMN.PLLV...E...YNQR.....IDDM
B6H909_PENCW/173-617.....................KQDESL...DPEDKD.HMT......MFNVVFVVD.PPLL...E...YSMR.....VKEI
C5DHQ6_LACTC/242-731..DSEILEEQLSGSQLFEEETGKAEY......EALEKSVN......MFHLCFLTN.PRLV...E...YNKR.....VDDI
M1VZL7_CLAP2/99-559....IFLSADAAKDKDP......KKD...GADDEKRSSMT......MFNLVFILN.PRKS...E...GKAL.....VDAL
M7TWW8_EUTLA/45-471...........LQTEVKGIAEDSAYQNQADEAEEKKSGMT......MFNLVFILN.PKRH...E...AREL.....VDTL
G8YSZ2_PICSO/187-642......................ENNAQDNPPAADSKNSLN......MFHLVFIMN.PPII...E...SNYR.....IDEM
L8FQS0_PSED2/113-539.................ARNVRKPKGTSFASDDTNDGGMT......MFNLVFIMN.PKTT...E...APMR.....VSDM
F8PYL6_SERL3/132-563...................................SLWLQ......MFHFVIVLDLPDPSSSASGN.VAKY.....FDVI
S8BNA5_DACHA/141-592..........SKSPNPPPSLRKKFKREPRKPLEQVPSKLA......MFHVVFVMS.PPQL...E...YHSR.....MNDM
J8Q1I2_SACAR/396-963..DNNTGDENCTDTPNLKVDTDFNRTEFEREKEDLGKNMN......MFHVCFVMN.PHLI...E...YNKR.....VDDM
A7TP53_VANPO/308-811DDDYKYKETEMSSRKSIKVEANIPFS......PDDGKNLT......MFHVCFVMN.PHLI...E...YNQR.....VNDM
D8PLZ6_SCHCM/127-556..................................KSAWLQ......SFHVVLVLDLPDPSSSNSGN.VWKY.....FDII
E9D3F7_COCPS/143-585.......................PDEDGSVTDGTKD.AMT......MFNVVFVMN.PPIL...E...HNLR.....IKEN
H6BW23_EXODN/132-559..................AVKDKAETKEHRTVEPPKSQLT......MFHAVFVMD.PPPL...E...HTLR.....VKDM
U1GT46_ENDPU/116-550...................LENSPATNPASSQADESREMT......IFNVVFVLN.PPIL...E...YSLR.....VNEM
C5DQJ7_ZYGRC/281-783DDNGEINEDNDECENS.......NNQ...NIKEDLEKNMN......MFHVCFVMN.PSLV...E...YNER.....IDDM
B2ALS2_PODAN/100-533.GDRVARDGEPLGAGDAEGKE........KAEKEKKASMT......MFNLVFFLR.PKKH...E...AKDL.....VDIM
G4U9V0_NEUT9/109-529.SDKGPSDVDQLAAKPA............EEAEDKKSSMT......MFNLVFILN.PRRH...E...VADL.....VDIL
R8BC65_TOGMI/105-536.............................EEAEDKVSSMT......MFNLVFILN.PQKH...E...AKEM.....VELM
U7Q027_SPOS1/111-529..........STGRAGETSAGGAASATQGKDKEEKVSSMT......MFTLVFIMS.PKRH...E...ANEL.....LDTM
G8BGC4_CANPC/198-622.......................NVPDGKIEIEDSKSNLN......MFHLVFVMN.PPTM...E...NNYR.....IDEM
E7A1P0_SPORE/203-720..AANKDTTPSAKSRNVSQTRMEPTHDA.LPSSRSQAPLT......QFHLVLVLDRPDPSSAMAGMDLSSW.....LQLY
G0RDM3_HYPJQ/95-507....SKTDSNPEKTKDG......KRD...ESDEDKRSSMT......MFNLVFFLD.PKRH...E...AKEL.....VDSL
K0KSM9_WICCF/157-573...........SGPEVENIQDEKSNFSKTENDDSDSNSME......MFHVVFVMN.PSLV...E...YNYR.....LDEM
M9MFA0_PSEA3/199-702..................GKSEPKTSDTEAPASKAAAPLT......QFHLVLVLDRPDPSTAMSGMDLSSW.....LQLF
J4HS73_FIBRA/136-569..................................DSKWLT......TFHFVVVLDRPDPSSSSPAS.VWKY.....MDTI
G0VDK5_NAUCC/193-728........TGDEKTDHMRARMSDVEQSEMDDINDLDKNMN......MFHVCFIMD.PPLT...E...YNKR.....VDDM
E7KD88_YEASA/399-966..DSNIGHEASTDTQNLRINTDVSGNEFEREKEDLGKNMN......MFHVCFVMN.PHLI...E...YNKR.....IDDM
G4MPF6_MAGO7/119-567AQDGSGLDTAKNGDKEEE...........EQQDDKVSSMT......MFNLVFFLN.PKKS...E...VNEL.....IDTM
G8ZWI0_TORDC/270-767..DESTGYDESEVLES.......KKH......DDLDKSMD......MFHVCFVMN.PSLV...V...YNEK.....VDDM
S9VYA1_SCHCR/73-478.............................INQSKPTSSMS......LFHVVFVLNVPTAS...I...YRPT.....INTM
I2H4A8_TETBL/339-898LNDTISVESYDESGK.................DDLQNNMT......MFHVVFIMD.PSLI...E...YNQR.....VNDM
V5FG66_BYSSN/161-604...................SK..SDEL...PDSDKD.SMT......MFNVVFVLD.PPQL...E...YSIR.....IMEN
G2R1J8_THITE/107-555.GEKGASDAEKIEARDMLKPPVKPA....DETEDKKSSMT......MFNLVFFLH.PKKH...E...VKPL.....VDIM
U5HEM2_USTV1/112-634.NPATPPARPTPMMRNSSSTSTVHPLSSFASSDQSATGIHGTGRLLAFNFVCVIDTPPDS...H...LSSH.....LEGY
F4P7C7_BATDJ/218-651..........SSCVSEDKPSANAFSSKLPSPVDHHHHQLT......MFNLVFALQ.PDGRGTSH...HSKE.....VKNI
G0WEJ7_NAUDC/230-810NNNNDIVDNGDDKTVE.....DSVEQVGECDKNNFDKNMN......MFHVCFIMN.PPLT...E...YNKK.....TDDM
Q5KFU1_CRYNJ/231-746.VDEGIEAYTSAITKFASIESETKRSSQSNHKDDDVPNLT......MFHLVLIIDKPDPKPGTESHDEHHSQTMGIYDEI
S2K004_MUCC1/106-577RTLPNDDTNGDTSNDDDDDDENDDESASDTFPSSTSIHMT......LFHVVFVMTPPDLE.......LNAQ.....VETI
J5JA21_BEAB2/104-534....DA.AVEKEKEKDK......EKK...EEEEEKRSSMT......MFNLVFILR.PRKE...Q...TREL.....VEAL
C1GWB7_PARBA/96-533...................NAE.GDSLQRLQESDKG.SMT......MFNVVFVLN.PPLL...E...YGLR.....IREK
G0SXZ9_RHOG2/78-582RDDSPSPRRPDALAHTHSSASTLHPGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS...H...LSSH.....LEGY
R7YHW5_CONA1/139-553.....................................DMS......MFNVVFVLN.PPAL...E...YQLR.....VKET
G8BZL7_TETPH/286-791DDKSYMNPIAMHDLNS................PDYEKNMN......MFHVCFVMN.PPIS...E...YNQR.....VDDM
K1XTL5_MARBU/117-531................KDRSTSATSAENASENGEDHGGMT......MFNVVFILN.VAKD...E...ADER.....ILTI
S8E9R2_FOMPI/133-565..................................DPSWLQ......TFHLVLVLDRPDPSSSTSGT.IWKY.....FDTI
NPR3_EMENI/171-616...................SQMSSEPL...DADDKD.MMT......MFNVVFVLD.PPLL...E...YSMR.....VREI

PF06218

M3IIL9_CANMX/8-518----------------------------------------------NFNFCFVFR------------YDMG-----NTSP
M2UFV8_COCH5/4-472----------------------------------------------IFNFAIVIG------------ENER-----DWAC
Q6BQE8_DEBHA/7-469----------------------------------------------NFNFCFVFP------------YN.S-----DTTP
Q0U9Y5_PHANO/4-462----------------------------------------------IFNFALVIG------------ESEV-----DWAC
G3AQK3_SPAPN/8-551----------------------------------------------SFNFCFVFP------------YDKG-----DISP
W6RQZ3_CAEEL/186-593----------------------------------------------TFDMAFIVD------------MTSS-----AETM
A5DQL3_PICGU/6-475----------------------------------------------TFNFCFVFP------------YD.S-----DTTP
K1Y0B6_MARBU/2-405----------------------------------------------MFNFCIVIG------------VE.V-----DKTP

PF03666

S8B047_PENO1/190-645YENVIKKFAKALKWEQARNDYVWRESQ------------------------------------------HILQVRRRARE
H1V255_COLHI/104-533YLNIIKKVNKAYKYCQQHSEFVWKESK------------------------------------------RISALKDKGRE
G1WZV0_ARTOA/142-590YD.VAKQFTMALKTQQSDDDYVAREAE------------------------------------------RILEIRERGEK
C4QYA8_PICPG/201-611FHYVISRLCLLLRYEQDKHNFVWKEAL------------------------------------------NIMKLKEETAG
K2SR44_MACPH/175-626YDNVIRKFSKDLKYEQAKTNYVWRESK------------------------------------------AILNLKNKAKE
R9P8J9_PSEHS/205-716YDNIVFKMTAALFAEQQRVDYVGRETE------------------------------------------KLLALRERCMD
NPR3_CANGA/243-797YQYVVARLSVLLRYLQSKNDYVSEQCE------------------------------------------LILKEKEKVFK
C0NJI2_AJECG/154-591YENVIKKFGKGLKSEQARVDYVWNEAQ------------------------------------------TIINIREKAKE
G8JWB1_ERECY/316-852YHYVVTRLSLILRYLQDKTGYVVEECH------------------------------------------KILKTRDRILK
NPR3_PHANO/150-598YDNVTRKYAKALKYEEARFQYVWKESK------------------------------------------RIIDLKQRAKE
B6QRZ0_PENMQ/156-593YEHVIKKFSKALKYEQDHSDYVWKEAQ------------------------------------------RILQIKERARE
NPR3_KLULA/205-723YHYVVTRLSLILRYIQGKTGYVTRECV------------------------------------------KIMKCKDEVSK
B8N792_ASPFN/172-617YDNIIKKFAKALKWEQARTDYVWREAQ------------------------------------------HISHIKEKAKE
M7X5H8_RHOT1/78-583YKDVVVPVTANIKALEKKDTWLTKEAA------------------------------------------KLRRMREGALE
NPR3_DEBHA/205-647FHYVISRLSLVLRYEQSKHEYVWNQIR------------------------------------------MIYNLKEEFRN
D6RLY8_COPC7/119-572YEQVVFTFTAVLFQEQVLSNFVEAECD------------------------------------------VLIPMKESFAE
V2XGE3_MONRO/83-521YEQAAFIVSAVLFQEQVVSNYVEKECD------------------------------------------QLGSLRDDCMK
T5A616_OPHSC/95-514YGNIVKKVNKAYKYSQQHSDFIWKESK------------------------------------------RILAAKDKARE
E9EL47_METAR/99-517YHNVVKKVNKAYKYSQQHCEFVWKESK------------------------------------------RILLAKDRARE
NPR3_ASPFU/179-636YDNIIKKFAKALKWEQARTDYVWREAQ------------------------------------------HISHLKEKAKE
NPR3_ASHGO/273-791YHYIVTRLSLILRYIQDKKGYVVRECA------------------------------------------KILKTRDRILK
Q4PA65_USTMA/205-718YDNIVFKMTAALFAEQSKSDYVGRETE------------------------------------------KLLALRERCMD
N1J4X2_BLUG1/150-556YEHVVKTFNRALLETQANSGYVWNESE------------------------------------------LILAMKEKARE
C4JQY3_UNCRE/143-586YDNVIKKLGKGLKSEQATANYVWKEAQ------------------------------------------TILQIKEKARE
U4LL48_PYROM/132-582YDYVVRRFSRTLKYEQDKDGYVWKEAE------------------------------------------KIARLKEQAAH
M4G219_MAGP6/120-591YTHIIRQVNKYYKYCQERNDFVWKESK------------------------------------------KILALKEKARE
I1RCJ1_GIBZE/98-519YDHIIKKVSKAFKYSQQHSEFVWKESK------------------------------------------RILVAKDKARE
J7RBT2_KAZNA/205-696YQYVVAKLSLLLRYVQSKSNYVSEECE------------------------------------------IILKETESVKK
D5G9F0_TUBMM/127-587FDYVVKRFARALKYEQAKDGYVWGEAE------------------------------------------KIVRLKDKANH
I2G095_USTH4/203-726YDNIVFKMTAALFAEQSKSDYVGCETE------------------------------------------KLLSLRERCMD
C5FU53_ARTOC/156-599YENVVKKFGKALKSEQARANYVWKEAL------------------------------------------NILRIKEKCRE
H2AZX0_KAZAF/181-685YQYIVARLSILLRYFQAKNNYVSKECS------------------------------------------IILKERENVVK
V5ETE4_PSEBG/203-712YDNIIFKMTSALFAEQRESDYIGRETE------------------------------------------KLLALRERCMD
W1QEY3_OGAPD/185-592FHYIVSRMALLLRYEQQKSNYVWNQSK------------------------------------------LILDLREEFSS
S6E8H4_ZYGB2/281-781FHYAVARLSMLLRYAQAKSNYVSRECH------------------------------------------IIMKEKERVLK
B6H909_PENCW/173-617YENIIKKFAKALKWEQARTDYVWKESQ------------------------------------------HILQMRRRARE
C5DHQ6_LACTC/242-731YHYVVSRLSLVLRYAQIKSGYVTRECY------------------------------------------EIIKTQDRILK
M1VZL7_CLAP2/99-559YPNVVKKVNKALKYSQYQYDFVWKESK------------------------------------------RILSAKDRARE
M7TWW8_EUTLA/45-471YFHIIKKVNKPYKYSQQRCDFVWKESK------------------------------------------RILALKDKGRE
G8YSZ2_PICSO/187-642FHYVISRLSLVLRYEQSKHDYIWSQVR------------------------------------------LIAQIREDFRS
L8FQS0_PSED2/113-539FEHVAKDINKALRYAQNYSNYVWKESE------------------------------------------RILNLKEKARE
F8PYL6_SERL3/132-563YEQIAFTVTAVLFQEQVLSNFVEAECD------------------------------------------ILVSLKDEYID
S8BNA5_DACHA/141-592YD.VAKQFTLALKTQQAEDDYVARETE------------------------------------------RIIELRERGEK
J8Q1I2_SACAR/396-963YQFVVTRLSLLLRYVQSKTSYTSSECH------------------------------------------IILKEKERVLK
A7TP53_VANPO/308-811FRHIVSKFTLALRSAQAKNSYVSKECD------------------------------------------IILKEREAVMK
D8PLZ6_SCHCM/127-556YERIAFNLTAVLFREQVLSNFVEMECE------------------------------------------QLMSIRESCIA
E9D3F7_COCPS/143-585YDNVIKKFGKGLKSEQATANYVWKEAQ------------------------------------------KILHIKEKGRE
H6BW23_EXODN/132-559YDHVARKMSKVLKWEQSHHDYVWEQSE------------------------------------------LMHSIKASHFQ
U1GT46_ENDPU/116-550YDHVVKKLGKALKWEQARANYVWQQSD------------------------------------------LILKAKTQARH
C5DQJ7_ZYGRC/281-783FHYAVARLSMLLRYAQEKSQYVSKECS------------------------------------------IIMKEKEHVLK
B2ALS2_PODAN/100-533YTNIIKKINKAYKYCQERSDFVWKESK------------------------------------------KILTLKDKGRE
G4U9V0_NEUT9/109-529YTHIIKKVNKAYKYCQQRGDFIWKESK------------------------------------------KILALKDKGRE
R8BC65_TOGMI/105-536YSNIVRKVNKAYKYVQQRSDFVWKESK------------------------------------------RILTLKDKARE
U7Q027_SPOS1/111-529YTHVVREVNKVYKYCQESGDFIWQECK------------------------------------------KIIQLKDHARE
G8BGC4_CANPC/198-622FHHVISKLSLILRRAQLKHDYIGSEVK------------------------------------------RIISLREELHD
E7A1P0_SPORE/203-720YDNVVFKMTAALFAEQSKCDYVGRETE------------------------------------------KLLALRERCMD
G0RDM3_HYPJQ/95-507FSNIVKKVNKAYQYSQQHSEFVWKESK------------------------------------------RILAAKEKARE
K0KSM9_WICCF/157-573FHYVVSRLSLILRYEQSKSNYVWDQVK------------------------------------------KILMIKDNNEN
M9MFA0_PSEA3/199-702YDNIVFKMTAALFAEQSKSDYVGRETE------------------------------------------KLLALRERCMD
J4HS73_FIBRA/136-569YERLVFAITAVLFQEQILHNYVETECD------------------------------------------KLGSLKDDYTS
G0VDK5_NAUCC/193-728YQYIVAKLSLLLRYLQAKSSYVSQQCT------------------------------------------MILRERERVLK
E7KD88_YEASA/399-966YQFVVTRLSLLLRYVQSKTSYISSECH------------------------------------------IILKEKERVLK
G4MPF6_MAGO7/119-567HTHIIRKVNKAYNYCQQRNDFVWKESK------------------------------------------KILALKDKARE
G8ZWI0_TORDC/270-767FRYVVARLSLLLRYSQAKSNYVSKQCN------------------------------------------LILREKERVLR
S9VYA1_SCHCR/73-478YESIVVKLVTGLKYEQAKRNYVENECK------------------------------------------HIRKMNERYTN
I2H4A8_TETBL/339-898FRNVAARLSLFLRSAQAKTSYVSRECD------------------------------------------IMLKEKESIMK
V5FG66_BYSSN/161-604YENVIKKFGKALKWEQARADYVWTEAQ------------------------------------------TILHIKEKAKE
G2R1J8_THITE/107-555FTHIIKKINKAFKYCQQRSDFVWKESK------------------------------------------RILALKDKGRE
U5HEM2_USTV1/112-634YKDVIIPVTANVKALERQEQWLGKESF------------------------------------------KLLKAIEKAHD
F4P7C7_BATDJ/218-651YDHVVVKVTTALKYEQLRRGYIRTETE------------------------------------------LILAINDRYQV
G0WEJ7_NAUDC/230-810YQYVVAKLSLLLRYVQAKDSYVSKQCN------------------------------------------LILKERERVLK
Q5KFU1_CRYNJ/231-746YREIAFKWTAAAYNLQCESNLVAREAW------------------------------------------MIVKYKEKCLN
S2K004_MUCC1/106-577YKNVILRYSSALRYEQLRCGYVQEEIE------------------------------------------KVLGLKEEAFN
J5JA21_BEAB2/104-534YSNIAKKVNKAFKYSQQHSDFVWKESK------------------------------------------KILASKDRARE
C1GWB7_PARBA/96-533YENVIKKFGKGLKSEQARVDYVWKEAQ------------------------------------------TIVNIKEKARE
G0SXZ9_RHOG2/78-582YKDVVVPVTANIKALEKKDTWLTKEAA------------------------------------------KLRRMREGALE
R7YHW5_CONA1/139-553YDNVVRKYAKVLKEEQACSSYVWKEAR------------------------------------------EILAMKQKARE
G8BZL7_TETPH/286-791YHYIVMRLAHTLKILQAKSFYVSKEVE------------------------------------------ILLKEKEYVLK
K1XTL5_MARBU/117-531YEHVIKKLNKAMKHAQATANYVWKESE------------------------------------------MILLMKEKARE
S8E9R2_FOMPI/133-565YEQIAFTTTAVLYQEQVLHNFVEDECD------------------------------------------VLGALRDEYSR
NPR3_EMENI/171-616YDNVIKKFSKALKWEQSRTNYVWRECQ------------------------------------------HILNIKEKAKE

PF06218

M3IIL9_CANMX/8-518YESAIKRMGQMFQVLEEQSFMLSSLDKDNVFFKEK...PFANGKNVNG......NNVKLKYSISDFTNLMT.......DV
M2UFV8_COCH5/4-472YGEVARKLGRLLRGLEEQGGFLSKEEV..................................GVWDDDGGTIDAGLDNGVC
Q6BQE8_DEBHA/7-469YESAIKRMGKMFQVLEEQSFILSKLDKFGSFFKNKDEYPTENSLMINE................................
Q0U9Y5_PHANO/4-462YGEVVRKLGRLLRGLEEQGGFLSKEEE..................................GVWDMD..........EVA
G3AQK3_SPAPN/8-551YEPAIKRMGQMFQVLEEQNFMLSKLDKDNSFFKKG.....STGLSSNGASSDISNNINIGIDLESYTNATSMSPAASNDA
W6RQZ3_CAEEL/186-593YEPIVQKCAEYLIELEMEYKFLTNPKY.....................................................
A5DQL3_PICGU/6-475YESAVRRMGRMFRVLEEQNFSLSKQDP..AFFKDN....................................RAHLDRADT
K1Y0B6_MARBU/2-405YEAVVRRLATTFTEMEIQNEYLSQEGV..................................................ATS

PF03666

S8B047_PENO1/190-645NRT...........SVHNLYSELINQSTLARAIYTVYSSIS..................ASKIASVSF...SPDVSISL.
H1V255_COLHI/104-533DKR...........KMSSLWNEILATSSLAASVQDIYEAVS..................QNKIAALQLDTAAGPITPSV.
G1WZV0_ARTOA/142-590RGD...........SMHELWLRIIRESTLAAAIATLYQSIS..................ASKIAHLKV....NDFDFAL.
C4QYA8_PICPG/201-611L.............DIVSQWRDIIPQSDLAKLMRDTFESVS..................NARIVNLTI....NNKLRSF.
K2SR44_MACPH/175-626NRE...........PMSMLWHNIISSSPLAKAIAIIYDAIS..................SNKIAHINL...GSLADASY.
R9P8J9_PSEHS/205-716DGQ...........AYSAYAAQCLGISSLARCIRDLYKCIS..................TSSDAFLTV...NDSIEVHT.
NPR3_CANGA/243-797NSKHYKSLSLPSE.KGRYLYQRLLAKSSLARALTECVEKIK..................KNEIACLEI...TDHRTVSL.
C0NJI2_AJECG/154-591NKL...........SLSRLYSELSSKSSLARAISTVYTSIS..................NSRIASVTL...TPEATMSL.
G8JWB1_ERECY/316-852QLKQIKKVRGQQALQGRYLYEYILKSSSLARALTKCFNSIV..................NNETVSLEI...GKYKVLSL.
NPR3_PHANO/150-598SNE...........SLTSTWRKIISTSPLAKSIAIMFDAIS..................HDKIAHIHF...DATFNTSF.
B6QRZ0_PENMQ/156-593RDV...........SGENLHDELVSKSSLAAAIHSVFDKIS..................KSDIAFVSL...KSR.SADF.
NPR3_KLULA/205-723HSRYYESLKSPWS.KGKYMYERILYESSLARALTKCFNCIH..................NNEIANLEI...DGDKIVSL.
B8N792_ASPFN/172-617TRT...........SVNTLYSELINHSSLARAIYTVYSNIS..................ASKIASVSL...SPDVSISL.
M7X5H8_RHOT1/78-583KDT...........PWDEFLATLPARSSLAGAISQLYTSLR..................ANKLASVHF....GPLPVQVL
NPR3_DEBHA/205-647QA............TMANLTKYLTDKSSLCKLISECFTQIS..................RSNIANLSI....NNKLRSF.
D6RLY8_COPC7/119-572QGQ...........PYKEFVNQALQASSIASAMKCVYEAIK..................TRSIAYVTL....NNIPIEL.
V2XGE3_MONRO/83-521KGT...........SFSEFSSQALELSSLASAMKTLFEAIK..................ASSIAYISL....NDLPLEI.
T5A616_OPHSC/95-514DKT...........SMTLLWKEMLHMSSLAASVHEIYEAVS..................QNRIAALHLDTVAGPLTPSV.
E9EL47_METAR/99-517DEK...........SMNVLWKELLEMSSLAASVHDIYEAVS..................RNKIATLHLDTPAGVLTPSV.
NPR3_ASPFU/179-636RRT...........SLNTLYTELITQSSLARAIYTVHTSIS..................ASKIASVPL...SPDVSISL.
NPR3_ASHGO/273-791KSLKLKKSHG.QALQGRYLYECILKSSSLARALTKCFNSII..................NNEIVTLDI...DNHKVISL.
Q4PA65_USTMA/205-718DGQ...........AYAAYAAQCLGISSLARCIRDLHKSIS..................ISSDAFLTI...NDRIEVHL.
N1J4X2_BLUG1/150-556DRR...........PMSWLWREILLRSTLACAMKEIYNSIS..................QNKIATCEL...GPNFNISL.
C4JQY3_UNCRE/143-586NMA...........SLLALYEELLSKSSLAQAIATVYRSIS..................TSKIASITL...TPHTTMSL.
U4LL48_PYROM/132-582EDI...........SYSELWRKIIDNSNLAHAISRIYIDIS..................QNKIAHIFL...NNHRTLSV.
M4G219_MAGP6/120-591ERT...........KMTALWHEILAASSLAQSMQDVYEAIS..................QNRIAVLQLDTQDGAVTHSV.
I1RCJ1_GIBZE/98-519ERK...........RMSVLWKEILQSSSLAAAMHDIYEAVS..................QNKIAALHLDTASGALTPSV.
J7RBT2_KAZNA/205-696NSQFYQSIKSPGE.RGKYLYQRILSKSSLARCLTKCVDQLH..................KNEIACVEL...GNDKVISL.
D5G9F0_TUBMM/127-587EGT...........SFADLWRDILDQSSLAYAISRIYIDIS..................QSKIAHVFL...NNNLGLSL.
I2G095_USTH4/203-726DGQ...........AYAAYAAQCLGISSLARCIRDLHKSIS..................TSSDAFLTI...NDRIEVHL.
C5FU53_ARTOC/156-599ERC...........SLSAVYSQLFAKSSLAQAIETLYTDIS..................ASKIASVSL...GPQTSMSM.
H2AZX0_KAZAF/181-685YSKSYESALTPAA.KAKCVYERILSKSSLARMLTKCVDKLH..................KNEIASIKV...GDDKIISL.
V5ETE4_PSEBG/203-712DGQ...........AYAAYAAQCLGISSLARCIRDLYKSIS..................TSSDAFLTI...NDNIEVHL.
W1QEY3_OGAPD/185-592F.............PLNEQWKKITEKSSLARMMAQTFKAVS..................NSEIINIEI....NNKMRSF.
S6E8H4_ZYGB2/281-781HSKTYRSIKGAHN.RGKYLYQRILVKSSLARALTLCVEKLQ..................KNDIACLEI...GDDKVIAL.
B6H909_PENCW/173-617TKT...........STNNLYSELISQSSLARAIYTVFSSIS..................TSKIASVSL...SPDVSISL.
C5DHQ6_LACTC/242-731SSERYKSIKGPAN.KARYLYQKIIQRSSLARAISKCFDAIS..................QNEVANLEI...NGDKIISL.
M1VZL7_CLAP2/99-559ERK...........PMAALWKELIQTSSLASSLHDIYEAVC..................LNKIATLHLETPAGILTPSF.
M7TWW8_EUTLA/45-471ART...........KMSTLWREILEVSSLAASMQDIYEAVS..................HNKIAALQLETAEGNVTHSV.
G8YSZ2_PICSO/187-642MN............TTEEFHNFLVERSSLCKLIADCYEQIS..................KSNIANLSI....NKKLRSF.
L8FQS0_PSED2/113-539ERR...........PMSTLWDTILRKSSLAQTMKTIYTSIS..................NNSIAVVQL.LSDPPVRLSV.
F8PYL6_SERL3/132-563KGE...........PYSEFNAQALLRSSLAPAMKTLYEAIQ..................SSTMAYITI....HDLPLEL.
S8BNA5_DACHA/141-592RGD...........SIHELWSRILRESTLADAIATLYQQIS..................ASKIAALKV....NDFDFAL.
J8Q1I2_SACAR/396-963HSKTYQSINGAGN.KGKYLYQRILAKSSLARALTECVDKIQ..................RNEIACLEI...GDDKVISL.
A7TP53_VANPO/308-811NSKKYKSIRGSCN.KARYLYQRILSKSSLARALTKCVDNIQ..................KNEISRLQI...DDDKVLTL.
D8PLZ6_SCHCM/127-556KGE...........HFSTYMTQALAQTSIAPAMQVLFDAIK..................TSTIAYITI....HDLPMEL.
E9D3F7_COCPS/143-585NKS...........SLSSVYEELLSQSSLAQAIATIYRSIS..................TSKIASITL...TPHTTMSL.
H6BW23_EXODN/132-559QKS...........PTKALYTELLRRSSLAAAMGKVFDNIS..................ASRIAAITL...SSKLSVSF.
U1GT46_ENDPU/116-550KRS...........SITALYATLLRISSLASAIATIYDNIS..................RSMIAAITL...TPTVPISL.
C5DQJ7_ZYGRC/281-783HSKTYRAIKGANQ.RGKYLYQCILSKSSLARALTLCVEKLQ..................QNDIACLEI...GEDKVIAL.
B2ALS2_PODAN/100-533ERR...........KMSLLWDEILSTSSLAASMRDLYEAVS..................QNRIAALQLCTAEGMVTHSV.
G4U9V0_NEUT9/109-529DKR...........KMSQLWEEILSNSSLAASMQDIYDAIS..................RNRIAAIQLETIEGVVTHSV.
R8BC65_TOGMI/105-536DKR...........KMSLLWEEILQTSSLAASMQDLYDCIS..................TNKIATLQLDTAEGAITHSV.
U7Q027_SPOS1/111-529DRV...........KMSVLWKDILAVSSLAASMRDTYEAIS..................RNRIAVLELNLSKGSVGHSV.
G8BGC4_CANPC/198-622E...................NKLAENSSLCKLIRDCFIGIG..................SSKVANLMI....NGKLKSF.
E7A1P0_SPORE/203-720DGQ...........AYAAYAAQCLGISSLARCIRDLHRSIS..................TSCDALITV...NDRMEVDL.
G0RDM3_HYPJQ/95-507DKK...........KMSALWKELIQNSSLAASMCEVYNAIS..................QNRIATLHLDTVDGILTPSV.
K0KSM9_WICCF/157-573L.............SVFDLYQKLNTESSLAKVLSQCFDSIA..................SSDIANLEI....NNKVISL.
M9MFA0_PSEA3/199-702DGQ...........AYSAYAAQCLGISSLARCIRDLHKSIS..................TSSDAFLTI...NDRIEVHL.
J4HS73_FIBRA/136-569KGM...........PFSEYMSEALNVSSLAPAMKTLYDSIK..................ASSIARITI....HDLPLEL.
G0VDK5_NAUCC/193-728YSNKYKSIKEENL.KAKYYYQRILSKSSLARSLIECVDKLQ..................QNEIACLEL...GDDKIISL.
E7KD88_YEASA/399-966HSKTYQSIRGAGN.KGKYLYQRILAKSSLARALTECVDKIQ..................RNEIACLEI...NDDKVISL.
G4MPF6_MAGO7/119-567ERR...........KMSSLWDEILRTSSLAASMQDVYDNIS..................QNKIAVLQLETQDGMVTHSV.
G8ZWI0_TORDC/270-767TSKTYESIRGSGN.KAKYLYRRILAKSSLARALTTCVDKLQ..................KNEIACLEI...DDDKVISL.
S9VYA1_SCHCR/73-478QRI...........PFDDFCREIPLHSNLASILVTTYEALI..................HLHTAYLEI...NHSINITL.
I2H4A8_TETBL/339-898TSRTYRMLKGPRN.KTKYLYKKLLTKSSLARALTVCVDSLQ..................KNEIASLQM...NDEKFISL.
V5FG66_BYSSN/161-604QKT...........SVNSLYSELVSHSSLAKAICTLYSSIS..................ASKIASLTL...SRDVSISL.
G2R1J8_THITE/107-555DKR...........KMSSLWEEILSTSSLAASMQDIYEAVS..................QNKIAALQLDTVEGTVTHSV.
U5HEM2_USTV1/112-634QGI...........RNREIPASVAPMSSLAAALNHLFEALK..................ADQLANIQL....GPLPVQVL
F4P7C7_BATDJ/218-651QNGGAG........DPLELQSQILKSSSLARCLAHIYHAVH..................GQLPSFLEV...NGSVSLAL.
G0WEJ7_NAUDC/230-810FSQKYKSIKGKHN.KAKYLYRRILEKSSLAKSLTECVHKLQ..................KNQIACLDL...GNRKIVSL.
Q5KFU1_CRYNJ/231-746EGI...........GITECCRWTATHCHIDRTLNYLYLRLHQLRTQPANGLHSYLPTTITNRLAHITI............
S2K004_MUCC1/106-577KGI...........PYEQVMREILRESSLARDIRQIYTAIS..................ANTAAHVII...NDFIDLSL.
J5JA21_BEAB2/104-534DKK...........RMNHLWKELLQQSSLAASVHDIYEAIS..................QNRIATLHLDTAAGLLSPSV.
C1GWB7_PARBA/96-533NKL...........SLSGLYSELLSKSSLARAISTVYTSIA..................NSRIASVTL...TPEATMSL.
G0SXZ9_RHOG2/78-582KDT...........PWDEFLATLPARSSLAGAISQLYTSLR..................GNKLASVHF....GPLPVQVL
R7YHW5_CONA1/139-553NKT...........PMSTLWHQIISSSALAKSIAIIFDSIS..................SSKIAHVHL...DAAFETSF.
G8BZL7_TETPH/286-791SSRVYKNLKGAAN.KGQYLYQRLLVQSSLARALVTCFDTIH..................KNDIVNLTL....DEKVVTL.
K1XTL5_MARBU/117-531ERR...........PMSWLWTEILLKSTLAGILRDVFTAIS..................GNKIVTFPV.RSKPPEDISL.
S8E9R2_FOMPI/133-565RGE...........QFADYLREALNMSSLAASMKTLYESIK..................EKTIAQITI....HELPLEL.
NPR3_EMENI/171-616KRS...........SLNSLYADIISQSSLARAIRTLYTSIS..................ASKIASVTL...SPDVSISL.

PF06218

M3IIL9_CANMX/8-518TVS-----------TPGFAKTKHVALSSIESLIQQIYQDLN------------------NYSECCIPL-..DTSNSVDI-
M2UFV8_COCH5/4-472GFG-----------VGGGSK........VYALCEMVLEDLN------------------NYAECMIPI-VLDDSNTINL-
Q6BQE8_DEBHA/7-469.FI-----------TPGFRRTQKVNLSSIESLIHQIYQDLN------------------NYSECCIPL-..DSANSVDI-
Q0U9Y5_PHANO/4-462QGD-----------IGGGSK........VYALCEMVLEDLN------------------NYAECMIPI-..DDSNTINL-
G3AQK3_SPAPN/8-551TVN-----------APGHSKTKRISLSSIESLVHQIYQDLN------------------NYSECCIPL-..DSSNSVDI-
W6RQZ3_CAEEL/186-593...-----------...........KDQVLDVMERMFNDLS------------------NKGESVIEV-SLEDEKIVTL-
A5DQL3_PICGU/6-475TET-----------TPGYARTARITLSSIESLINQIFSDLN------------------NYSECCIPL-..DSANSVDI-
K1Y0B6_MARBU/2-405SLN-----------VNAQER......RSIAALIEIIKEDLN------------------NYNECMIPV-..DDANTINM-

PF03666

S8B047_PENO1/190-645...QIP..PLTSTPYL.AGPTDR....A.YPGLWLTTA.....DSATPI...............................
H1V255_COLHI/104-533...QIP..VPFYITDL.HNYGQT....E.QRGLWLTTA.....NSFIGE...............................
G1WZV0_ARTOA/142-590...QIP..IMMETAAL.PSISEP....Q.LPGMHLTTL.....RTIGAT...............................
C4QYA8_PICPG/201-611...QIP..IKTEFHTL.PKE.......KVIPGSTLSSISPFTK.....................................
K2SR44_MACPH/175-626...QIP..QAPSTPYI.PRPTEP....Q.MPGLWLTTA.....NLT..................................
R9P8J9_PSEHS/205-716...QLP...........PILQDP....TNLHKMIDIET..........................................
NPR3_CANGA/243-797...QIP..IQNEFSIL.PQYKLY....PVLKGSFLTSIQNNKFLEKSA...........................NIDDN
C0NJI2_AJECG/154-591...QAP..PLTSTSYL.PSATEK....A.YPGLWLTTA.....DSLSAT...............................
G8JWB1_ERECY/316-852...QIP..IKNEFAKL.PDLKIN....PVLRGSFLTSILNLKFLKEPTD...........................PIPG
NPR3_PHANO/150-598...QIP..QADSTPYL.PTALEP....Q.MPGLWLTTS.....NVVLAD...............................
B6QRZ0_PENMQ/156-593...QIP..PTTSIAEL.PSSNDT....S.LAGMWLTTA.....NSVTA................................
NPR3_KLULA/205-723...QIP..IKNEFSIL.PNLKED....AVLRGSFLSSILNESFIGRSTS...............................
B8N792_ASPFN/172-617...QIP..PLTSTPYL.PGPGDK....A.YPGLWLTTA.....DSVTPA...............................
M7X5H8_RHOT1/78-583FRGELP..ADDEVDLR................................................................
NPR3_DEBHA/205-647...QIP..IKTEFHSL.PDSTV.....PYLPGSHLSSTVNMLANTGLISVGETIRYDVNNLNSGGL..............
D6RLY8_COPC7/119-572...QLP...........PYLDTLLHNDSELDPDSIERP..........................................
V2XGE3_MONRO/83-521...QLP...........PYLDLLLHNDEEADFNGFMVG..........................................
T5A616_OPHSC/95-514...QIP..APFFVSDI.PAEHEQ....G.QRGLWLTTA.....NAFLSQ...............................
E9EL47_METAR/99-517...QIP..APFFVSDL.PADHDH....S.QHGLWLTTA.....NSFLSH...............................
NPR3_ASPFU/179-636...QIP..PLTSTPYL.PGPTDK....A.YPGLWLTTA.....DSVTPV...............................
NPR3_ASHGO/273-791...QIP..IKNEFSSL.PDLKIN....PVLRGSYLTSLLNDSFLKQPVDF......................AAGSMMPG
Q4PA65_USTMA/205-718...QLP...........PILQDP....SSLAKTVDIET..........................................
N1J4X2_BLUG1/150-556...QIP..KPSFLMSL.PTAREP....A.IPGLLVTSA.....DPMLIE...............................
C4JQY3_UNCRE/143-586...QIP..PLTSTPYL.PGPTEP....A.YPGLWLTTA.....DSVSAT...............................
U4LL48_PYROM/132-582...QIP..IVTEINRL.PTLMDQ....P.MPGLPLTTA.....NSFG.................................
M4G219_MAGP6/120-591...QIP..IPLHVSDL.PQEGEP....D.ATGIWLTTA.....NSFAGS...............................
I1RCJ1_GIBZE/98-519...QIP..VPFYIDDL.PQGEEG....T.QRGLWLTTA.....NTFLSQ...............................
J7RBT2_KAZNA/205-696...QIP..VNNEFQDI.PNYKIH....PILPNSYLSTVLNNNFLEGCS........YNDTQYLNAEGRKGFLGATDNIGN
D5G9F0_TUBMM/127-587...QMP..IISEISVM.PSITEP....Q.VPGLPLTTA.....NSFG.................................
I2G095_USTH4/203-726...QLP...........PILQDP....TNLPKTVDIET..........................................
C5FU53_ARTOC/156-599...QIP..PMTSTPHL.PSPNEP....G.YPGLWLTTA.....DSISTT...............................
H2AZX0_KAZAF/181-685...QIP..VKNEFEHL.PNFKQN....AILPNSYLTSILNKKFLEKAS........FSSAPH..SSSRK..LHSSITLGN
V5ETE4_PSEBG/203-712...QLP...........PILQDP....SNLLKTVDIET..........................................
W1QEY3_OGAPD/185-592...QIP..IRTEFSSLPPRHT......QLLPGSTLSSTSPF.......................................
S6E8H4_ZYGB2/281-781...QIP..IQNEFSVL.PNFKLH....PVLRGSYLSTILNSRFLSAPP............................SRDD
B6H909_PENCW/173-617...QIP..PLTSTPYL.TGPMDK....A.YPGLWLTTA.....DSATPV...............................
C5DHQ6_LACTC/242-731...QIP..IINEFDVL.PDLKTD....PVLKGSFLTSILNRKFLEEGS............................ATMN
M1VZL7_CLAP2/99-559...QIP..APFFVSDI.PSEHDN....SPQRGLWLTTA.....NSFLRR...............................
M7TWW8_EUTLA/45-471...QIP..APFCLADL.PAEDEP....G.SRGLWITTA.....HSFVAE...............................
G8YSZ2_PICSO/187-642...QIP..IKTEFSSL.PEPTL.....PYIPGSNLSSTVNILANTGLVSIGETTRYGLNSLDPVTSYSSKFALDNNGAFI
L8FQS0_PSED2/113-539...QIP..KPYFLSML.PEFDEP....S.MPGLWITTA.....NFFGDQ...............................
F8PYL6_SERL3/132-563...QLP...........PYLDHLLHSEEEYDLDFVDYK..........................................
S8BNA5_DACHA/141-592...QIP..IMMETAIL.PSISEP....Q.LPGMHLTTL.....HTLGST...............................
J8Q1I2_SACAR/396-963...QIP..IQNEFEKM.PNFKIQ....PVLRGSYVTSILNMKFLEKTSLR......................IEGQNRQN
A7TP53_VANPO/308-811...QIP..IHDEFWKL.PKFKLE....PVLRGSYLTTILNERFLGSTT..........................NNNQET
D8PLZ6_SCHCM/127-556...QLP...........PYLDSLLKVESDDDVDEL.............................................
E9D3F7_COCPS/143-585...QIP..PLTSTPYL.PGPMEP....A.YPGLWLTTA.....DSLSAT...............................
H6BW23_EXODN/132-559...QIP..PVTSTSYL.PSLSEP....PLEPGVWLTTATDPASTA...................................
U1GT46_ENDPU/116-550...QIP..PVTSTSVL.PSSTDPPSART.QPGVWLTTATAGSSDEIADT...............................
C5DQJ7_ZYGRC/281-783...QIP..IQNEFAVL.PNFKLH....PVLRGSFLSSVLNSQFLSAGPL...........................AKEE
B2ALS2_PODAN/100-533...QIP..VPFHVSDL.PDNGE.....ASQPGLWLSTA.....NTLMSD...............................
G4U9V0_NEUT9/109-529...QIP..VPFHVPDL.PQDGQA....EEQLGLWLTTA.....NSLQAD...............................
R8BC65_TOGMI/105-536...QIP..VPFHIPDLIPDGEDN......FRGVWITTA.....NSFTAE...............................
U7Q027_SPOS1/111-529...QIP..VPFFATDIQPQAGDS......LKNLWLTTA.....NNVSRH...............................
G8BGC4_CANPC/198-622...QIP..LKTEFHSL.PDATV.....PYIPGSYLSSTVNTVNNFGLINVGESSRYGQ......................
E7A1P0_SPORE/203-720...QLP...........PILQDP....NSLPKLVDIET..........................................
G0RDM3_HYPJQ/95-507...QIP..VPFFVADL.PAEDDE....R.HRGLWLTTS.....NAFLSQ...............................
K0KSM9_WICCF/157-573...QIP..MKNQFSSLLPKTT......PVLPGSYLSSTTQY.......................................
M9MFA0_PSEA3/199-702...QLP...........PILQDP....VNLPKTVDIET..........................................
J4HS73_FIBRA/136-569...HLP...........PSLESMLRAEEDDNADMADRE..........................................
G0VDK5_NAUCC/193-728...QIP..IQNEFNIL.PNFKTS....PIAENCYLTSILNNKFLENLSMR...............RTAWKM.DDVDNENN
E7KD88_YEASA/399-966...QIP..IQNEFEKM.PNFKLQ....PVLRGSYLTSILNMKFLEKSSLR......................IEGQNRQN
G4MPF6_MAGO7/119-567...QVP..MPFHIADL.PQQGDP....D.ATGIWLTTA.....NSFVRD...............................
G8ZWI0_TORDC/270-767...QIP..IQNEFRML.PNYKLN....PVLKGSYLTSILNSKFLGVAP............................TRDN
S9VYA1_SCHCR/73-478...LWP..MTVSVSSL.DKLELQ....ERSPTILASQT..........................................
I2H4A8_TETBL/339-898...QIP..IHYELKFL.PRFKLD....PVLKGTFLTSILNSKFLARSSSL......................DQLNATTN
V5FG66_BYSSN/161-604...QIP..PLTSTSYL.PTPMDT....A.YPGLWLTTA.....DSLSPA...............................
G2R1J8_THITE/107-555...QIP..VPFHVSDL.PQEGE.....ESQRGLWLTTV.....NSLMGE...............................
U5HEM2_USTV1/112-634FRGEVP..IEEEYDTFYAERQEV.........................................................
F4P7C7_BATDJ/218-651...RMC..GIIETQNTYPGSSS.....STIDSYYASNSTISIPLEISSAYFNHPT.........................
G0WEJ7_NAUDC/230-810...QVP..VENEFQIL.PNFKIT....PAIENCYLTSILNNSFLERLSLRADGLTSTTTGTNAGTSTDWRIENDVDDETN
Q5KFU1_CRYNJ/231-746...QTVLSPK.......PVNTDEAWAHWGEMEEMLSDK..........................................
S2K004_MUCC1/106-577...QIPVIGMHSESSMTADRESLMSPTQRAKDNYTGSSLMDIYSVAGYEYDKYPV.........................
J5JA21_BEAB2/104-534...QIP..APFYVADL.PPDEAR....R.PRGLWLTTA.....NAFLTQ...............................
C1GWB7_PARBA/96-533...QVP..PITSTSYL.PAATET....A.YPGLWLTTA.....NSLSAT...............................
G0SXZ9_RHOG2/78-582FRGELS..TDDEVDLR................................................................
R7YHW5_CONA1/139-553...QIP..QAISTPYV.PTTTQP....Q.IPGLWLTTA.....SVVD.................................
G8BZL7_TETPH/286-791...QIP..IHDEFWKL.PQYKIE....PVLRGSHLTSILNYGFLKSTS..........................TKNKKK
K1XTL5_MARBU/117-531...QIP..VPSFLVSI.PTFNEK....A.MPGLLLTSA.....NPYIDE...............................
S8E9R2_FOMPI/133-565...QLP...........PFLDSMLQAQDELELDAVNPR..........................................
NPR3_EMENI/171-616...QIP..PLTSTPYL.PGPTDQ....A.YPGLWLTTA.....DSISPA...............................

PF06218

M3IIL9_CANMX/8-518--------..KLFPLL-P..PPINLKAYQVP..IATVK------------------------------------------
M2UFV8_COCH5/4-472--------..KLFPTR-P..PPPPILAHQVP..LLTIS------------------------------------------
Q6BQE8_DEBHA/7-469--------..KLFPIL-P..PPVNTKAYQVP..ILTVK------------------------------------------
Q0U9Y5_PHANO/4-462--------..KLFPTR-P..PPPPISSHQVP..LLTIS------------------------------------------
G3AQK3_SPAPN/8-551--------..KLFPIL-P..APINLKAYQVP..IATVK------------------------------------------
W6RQZ3_CAEEL/186-593--------YFKLCPLY-RGCEPPEIDYHMVPMFIREVT------------------------------------------
A5DQL3_PICGU/6-475--------..KLFPIL-P..APVNLKGHQVP..ISTVK------------------------------------------
K1Y0B6_MARBU/2-405--------..KLFPAH-R..HPPPVKSWHVP..ISTMK------------------------------------------

PF03666

S8B047_PENO1/190-645................................................DD..........PHSEDKNSNNNQNNAHQV..
H1V255_COLHI/104-533................................................D...........TIDEPGF.............
G1WZV0_ARTOA/142-590................................................P...........SEGEDAL.............
C4QYA8_PICPG/201-611................................................DDSDEVDFKNIVNSDENLA.............
K2SR44_MACPH/175-626................................................DE..........NAEADHS........FTVP.
R9P8J9_PSEHS/205-716................................................EL..........DSNDPIFLSGGGFAGRGKEN
NPR3_CANGA/243-797HHAKSARDTNLISDHVNTFSNGQTKNEIFYSKNMENA......LTAQNDY..........DDDD.LL.............
C0NJI2_AJECG/154-591................................................DD..........A.TGMDT.....SAPNQA..
G8JWB1_ERECY/316-852GAVVFNDSNF......................................FD..........EEND.IL.............
NPR3_PHANO/150-598................................................DE..........SP..................
B6QRZ0_PENMQ/156-593................................................DQ..........G.AEIEV.......PNQV..
NPR3_KLULA/205-723..LTNEDSDN......................................LY..........ANHDRLL.............
B8N792_ASPFN/172-617................................................DD..........P.TADEN.....TAPHQV..
M7X5H8_RHOT1/78-583............................................................DHEEYLL.............
NPR3_DEBHA/205-647................................................DDFDDIDDNKSDSNADDII.............
D6RLY8_COPC7/119-572............................................................DDEEQ...............
V2XGE3_MONRO/83-521............................................................DEEDY...............
T5A616_OPHSC/95-514................................................D...........ALDEPGF.............
E9EL47_METAR/99-517................................................E...........QLDDPEF.............
NPR3_ASPFU/179-636................................................ED..........P.TADEY.....TAPHQV..
NPR3_ASHGO/273-791GDVMHDD.......................................................ND.VL.............
Q4PA65_USTMA/205-718................................................EL..........DPNDPIFLSGGGFEGLGKEG
N1J4X2_BLUG1/150-556................................................SR..........KYDQPR..............
C4JQY3_UNCRE/143-586................................................DE..........A.PEVEY.....SGPSKV..
U4LL48_PYROM/132-582................................................DE..........ETEGDSI.............
M4G219_MAGP6/120-591................................................GR..........DPSELGF.............
I1RCJ1_GIBZE/98-519................................................D...........ALEEPGF.............
J7RBT2_KAZNA/205-696.............................................................DND.IL.............
D5G9F0_TUBMM/127-587................................................DD..........DAEGDNM.............
I2G095_USTH4/203-726................................................EL..........DPNDPIFLSGGGFAGLGKEG
C5FU53_ARTOC/156-599................................................DE..........T.SALAA.....SGQNQV..
H2AZX0_KAZAF/181-685SLILHDGDDD.....................................YDN..........EDDD.IL.............
V5ETE4_PSEBG/203-712................................................DL..........DKNDPIFLSGGGFSGLGKEG
W1QEY3_OGAPD/185-592................................................NSLGPDLHSSAQTNDDNMI.............
S6E8H4_ZYGB2/281-781SLNDYSNAED......................................ED...........AND.LL.............
B6H909_PENCW/173-617................................................DD..........P.SADEN.....NTPHQV..
C5DHQ6_LACTC/242-731EAWARSH.........................................DE...........NDD.LL.............
M1VZL7_CLAP2/99-559................................................E...........QLDNVEF.............
M7TWW8_EUTLA/45-471................................................E...........NIDDPGF.............
G8YSZ2_PICSO/187-642................................................DQ..DFIDEETDDNAEDIV.............
L8FQS0_PSED2/113-539................................................E...........NEDETLL.............
F8PYL6_SERL3/132-563............................................................EDDDES..............
S8BNA5_DACHA/141-592................................................P...........SEDEDML.............
J8Q1I2_SACAR/396-963NQAQLSDTNNNLYRFSNNINSTANCGTSNVDDGDDNE......NGYYCDD...........NDD.LL.............
A7TP53_VANPO/308-811SDWNIYSSEE......................................DA...........SDD.LL.............
D8PLZ6_SCHCM/127-556............................................................QEQDAA..............
E9D3F7_COCPS/143-585................................................DE..........V.TEMEY.....SGPSKV..
H6BW23_EXODN/132-559................................................DDLDSTSSGGALQ...................
U1GT46_ENDPU/116-550................................................DH..........PQSAMS..............
C5DQJ7_ZYGRC/281-783SLGGYTDSDH......................................ED...........LTD.LL.............
B2ALS2_PODAN/100-533................................................D...........AAEEPGF.............
G4U9V0_NEUT9/109-529................................................E...........NVEEPEY.............
R8BC65_TOGMI/105-536................................................D...........GFDESGY.............
U7Q027_SPOS1/111-529................................................E...........TLDGVPA.............
G8BGC4_CANPC/198-622................................................KDETLRYPQEDDDSDEVVI.............
E7A1P0_SPORE/203-720................................................EL..........DPNDPAFLSGNGFAGRGKEG
G0RDM3_HYPJQ/95-507................................................D...........ALEEPGF.............
K0KSM9_WICCF/157-573................................................DE.........EELDSNVG.............
M9MFA0_PSEA3/199-702................................................EL..........DPNDPIFLSGGGFAGLGKEG
J4HS73_FIBRA/136-569............................................................DENDLTSVWD..........
G0VDK5_NAUCC/193-728TAKGQHMEQPETSTMGNSYMGNSRIINQFAQN...........DFDSTEN..........ENDD.IL.............
E7KD88_YEASA/399-966DQAQFSDTHNNIYRFGNNINSTGHCGAANVDDGDDNE......SNYYCDD...........NDD.LL.............
G4MPF6_MAGO7/119-567................................................DV..........DAADLGF.............
G8ZWI0_TORDC/270-767EGHSTGKREE......................................DD...........DDD.LL.............
S9VYA1_SCHCR/73-478................................................IF..........NEEEPSL........IEPS.
I2H4A8_TETBL/339-898QINYPTSNSN.....................NANENE......YDTFFDD...........DNN.LL.............
V5FG66_BYSSN/161-604................................................DD..........T.FAAET.....APPHQI..
G2R1J8_THITE/107-555................................................E...........AAETPGF.............
U5HEM2_USTV1/112-634.............................................................................HLK
F4P7C7_BATDJ/218-651................................................................................
G0WEJ7_NAUDC/230-810RGRTSNNNNNRSSNIKYQSISDGKPTNPMALNRNTVVTYYSTGDSEILEM..........NNND.LL.............
Q5KFU1_CRYNJ/231-746............................................................DSEESLS.............
S2K004_MUCC1/106-577................................................................................
J5JA21_BEAB2/104-534................................................D...........FLEEPGF.............
C1GWB7_PARBA/96-533................................................DD..........V.TGMET.....NVPNQT..
G0SXZ9_RHOG2/78-582............................................................DHEEYLL.............
R7YHW5_CONA1/139-553................................................DE..........DPEAG...............
G8BZL7_TETPH/286-791DINSNNFADD......................................DN..........IDND.IL.............
K1XTL5_MARBU/117-531................................................E...........GVEDPSY.............
S8E9R2_FOMPI/133-565............................................................SEDGLL..............
NPR3_EMENI/171-616................................................DD..........P.MTDDN.....SAPHQV..

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

S8B047_PENO1/190-645............................................................LAKHFALLLL..........
H1V255_COLHI/104-533............................................................LDRNFALLLM..........
G1WZV0_ARTOA/142-590............................................................MTPHFTLLFL..........
C4QYA8_PICPG/201-611...............................................................FFTILLL..........
K2SR44_MACPH/175-626............................................................LTPHSALLLL..........
R9P8J9_PSEHS/205-716AQEDGTGGTYDRLLAMTPAQLSFEEWCRTTGPY...........................LLPWKTLLLLH.........
NPR3_CANGA/243-797...............................................................LYSILLL..........
C0NJI2_AJECG/154-591............................................................LAKHFALLLL..........
G8JWB1_ERECY/316-852...............................................................DYALLPL..........
NPR3_PHANO/150-598............................................................MTQHAALLLL..........
B6QRZ0_PENMQ/156-593............................................................LAKHFALLLL..........
NPR3_KLULA/205-723...............................................................DYGLLLL..........
B8N792_ASPFN/172-617............................................................LAKHFALLLL..........
M7X5H8_RHOT1/78-583.................PDRGEDSDSPERRNRSVSPSGHAFPRTRQAPIFSTMRRRPPVQFEPWQTLLLL..........
NPR3_DEBHA/205-647...............................................................YYALLLL..........
D6RLY8_COPC7/119-572.............................................QNWGPELSFGWRLPALAPWKSLLLL..........
V2XGE3_MONRO/83-521.............................................RAWGPEMSFGWRLPALVPWKSLLLL..........
T5A616_OPHSC/95-514............................................................LDRNFALLLM..........
E9EL47_METAR/99-517............................................................LDKNFALLLL..........
NPR3_ASPFU/179-636............................................................LAKHFALLLL..........
NPR3_ASHGO/273-791...............................................................DYALLLL..........
Q4PA65_USTMA/205-718AHQDGSGGTYKRRMAMTPAQLSFEEWCRTTGPY...........................LLPWKTLLLLH.........
N1J4X2_BLUG1/150-556............................................................LNKNFALLLT..........
C4JQY3_UNCRE/143-586............................................................LAKHFALLLL..........
U4LL48_PYROM/132-582............................................................LAKHFTLLFL..........
M4G219_MAGP6/120-591............................................................LDKNFGLLLL..........
I1RCJ1_GIBZE/98-519............................................................LDRNFSLLLT..........
J7RBT2_KAZNA/205-696...............................................................NYSLLLL..........
D5G9F0_TUBMM/127-587............................................................LAKHFTLLFL..........
I2G095_USTH4/203-726ADEDGGGGTYDRLLDLAPHQLSFEEWCRTTGPY...........................LLPWKTLLLLH.........
C5FU53_ARTOC/156-599............................................................LAKHFALLLL..........
H2AZX0_KAZAF/181-685...............................................................NYALLLL..........
V5ETE4_PSEBG/203-712QDEDGGGGTHDRLLGLEPNQLSFEEWCRTTGPY...........................LLPWKTLLLLH.........
W1QEY3_OGAPD/185-592...............................................................HYALIML..........
S6E8H4_ZYGB2/281-781...............................................................HLALLLL..........
B6H909_PENCW/173-617............................................................LAKHFALLLL..........
C5DHQ6_LACTC/242-731...............................................................DYAVLLL..........
M1VZL7_CLAP2/99-559............................................................LDKNFALLLL..........
M7TWW8_EUTLA/45-471............................................................LDRNFALLLL..........
G8YSZ2_PICSO/187-642...............................................................YYALLLL..........
L8FQS0_PSED2/113-539............................................................LSKHFALLLL..........
F8PYL6_SERL3/132-563.............................................RAWGREMSFGWRLPALAPWKSLLLL..........
S8BNA5_DACHA/141-592............................................................LTPHLALLFL..........
J8Q1I2_SACAR/396-963...............................................................NYALLLL..........
A7TP53_VANPO/308-811...............................................................NYALLLL..........
D8PLZ6_SCHCM/127-556.............................................EMWGPHMSYGWRLETLAPWKSILLL..........
E9D3F7_COCPS/143-585............................................................LAKHFALLLL..........
H6BW23_EXODN/132-559............................................................VSKNFTLLFK..........
U1GT46_ENDPU/116-550............................................................LAKHFTLLLL..........
C5DQJ7_ZYGRC/281-783...............................................................NFA.LLL..........
B2ALS2_PODAN/100-533............................................................LDKNFALLLL..........
G4U9V0_NEUT9/109-529............................................................LDKTFALLLM..........
R8BC65_TOGMI/105-536............................................................LEKNFALLLM..........
U7Q027_SPOS1/111-529............................................................FDKCFALLLTD.........
G8BGC4_CANPC/198-622...............................................................YYALLLL..........
E7A1P0_SPORE/203-720ADEDGGGSTHDRLRTLNPSQLSMEEWCRTTGPY...........................LVPWKTLLLLH.........
G0RDM3_HYPJQ/95-507............................................................LDRNFALLLM..........
K0KSM9_WICCF/157-573...............................................................HMALLLL..........
M9MFA0_PSEA3/199-702ADEDGGGGTYDRLLELAPHQLSFEEWCRTTGPY...........................LLPWKTLLLLH.........
J4HS73_FIBRA/136-569.............................................DTWG.....SRGFMAVAPWKSLLLL..........
G0VDK5_NAUCC/193-728...............................................................DYALLLL..........
E7KD88_YEASA/399-966...............................................................NYALLLL..........
G4MPF6_MAGO7/119-567............................................................LDKDFALLLM..........
G8ZWI0_TORDC/270-767...............................................................HYALLLL..........
S9VYA1_SCHCR/73-478............................................................VAPYWSLLLL..........
I2H4A8_TETBL/339-898...............................................................DYALLPL..........
V5FG66_BYSSN/161-604............................................................LAKHFALLLL..........
G2R1J8_THITE/107-555............................................................LDKNFALLLM..........
U5HEM2_USTV1/112-634DLGPGGIGGGPERRGRHDDPIDASEAARARSVSPTPPAEAFRNHRPPPLFSRMRRRPLVRFQPWETFLPL..........
F4P7C7_BATDJ/218-651............................................................LRPYQALLLL..........
G0WEJ7_NAUDC/230-810...............................................................NYSILLL..........
Q5KFU1_CRYNJ/231-746........................................DWEDDWGAGAMMGMKRPELIVKPWQTLLLIDEDKNQNQEA
S2K004_MUCC1/106-577............................................................LCPYHTLLLL..........
J5JA21_BEAB2/104-534............................................................LDRNFGLLLM..........
C1GWB7_PARBA/96-533............................................................LAKHFALLLL..........
G0SXZ9_RHOG2/78-582.................PDKGDESNSPERRNRSVSPSGHAFPRTRQAPIFSTMRRRPPVQFEPWQTLLLL..........
R7YHW5_CONA1/139-553............................................................LSPHCALLLL..........
G8BZL7_TETPH/286-791...............................................................NYALLLK..........
K1XTL5_MARBU/117-531............................................................INKHYALLLL..........
S8E9R2_FOMPI/133-565.............................................NPWG.SMSVGWRLPALKPWKSLLRL..........
NPR3_EMENI/171-616............................................................LAKHFALLLL..........

PF06218

M3IIL9_CANMX/8-518---------------------------------------------------------------LNSLID.----------
M2UFV8_COCH5/4-472---------------------------------------------------------------LSSLQQP----------
Q6BQE8_DEBHA/7-469---------------------------------------------------------------LSSLVD.----------
Q0U9Y5_PHANO/4-462---------------------------------------------------------------LSSLQSP----------
G3AQK3_SPAPN/8-551---------------------------------------------------------------LNSLVD.----------
W6RQZ3_CAEEL/186-593---------------------------------------------------------------LTDHLI.----------
A5DQL3_PICGU/6-475---------------------------------------------------------------LGLMVD.----------
K1Y0B6_MARBU/2-405---------------------------------------------------------------FSVIID.----------

PF03666

S8B047_PENO1/190-645............DSEAAVIK.................DV...EAS....GGA.LAPALAH.YIRSSKP....TKSFA...
H1V255_COLHI/104-533............GDEKKIIA.................EL...QAD....PDP.STVAMVE.FARLSKP....TQSFC...
G1WZV0_ARTOA/142-590............EDVDDIIK.................EIIL.DQD....QSS.LSASFVQ.FIQNCRP....TVSFA...
C4QYA8_PICPG/201-611............DDPEVIIR.................DIQVAKES...........VIAR.FIRLIRP....TKSMSRLA
K2SR44_MACPH/175-626............EDKETLLK.................EI...EGD....AKE.HSVQLAY.YISNLIP....TKSLH...
R9P8J9_PSEHS/205-716............DQVDD..GITPPVMASSGQAGLASPGGGGVQPH....EGDGGFERLTRNFKSLFVPSLYNSLNFGNV.
NPR3_CANGA/243-797............DDPDKIIA.................DLDNYSSN....DDI.GGVILKQ.LVKVIQP....NVPLLSYQ
C0NJI2_AJECG/154-591............TDESTVLK.................DI...EES....IGP.LGARLAH.YIRVSKP....TKSFA...
G8JWB1_ERECY/316-852............DEVSNIIR.................DLECSSFQ....SDM.INLLMAN.LVKILKP....TVPLRSYL
NPR3_PHANO/150-598............EDTETLIK.................DL...GGE....VTG.NAAAIAF.YIRNIIP....TKSLL...
B6QRZ0_PENMQ/156-593............ESEASIME.................AL...KGS......E.LAPALSH.YIRSSRP....NKSFA...
NPR3_KLULA/205-723............DEPENIIK.................GLENASFD....NGV.TDLLLIN.LVRQLKP....TIRLGQYK
B8N792_ASPFN/172-617............SDEATILK.................DV...EAS....GGA.LAPALAH.YIRCSKP....TKSFA...
M7X5H8_RHOT1/78-583............EDVRLLQR.............................DVL.EGSLLWR.FLDICRP....TLSFADY.
NPR3_DEBHA/205-647............DDPETIIR.................DIKAQQQS...........TLAN.FIRMIKP....TESLLKLA
D6RLY8_COPC7/119-572............DGSDEL.........EDPIASLRGPHVSVEDRA........LAEGLIR.FLETASI....TLSLADM.
V2XGE3_MONRO/83-521............DNIDDF..........DPFSDLRGPHVSPDDRS........LAEGLLK.FLETANV....TLSLTDL.
T5A616_OPHSC/95-514............DDEKKIIS.................EL...QAD....RDP.TTVSMVE.FVRLAKP....TMSFY...
E9EL47_METAR/99-517............EDEKKVVA.................EL...QAD....RDP.TTVSMIE.FARLAKP....TMSFY...
NPR3_ASPFU/179-636............DNEAAILR.................DV...EAS....GGA.LAPALAH.YLRCSKP....TKSFA...
NPR3_ASHGO/273-791............DDTPKIIK.................DLEFSSFG....SDL.ANVIMIN.LVKNLKP....TVSLRSYL
Q4PA65_USTMA/205-718............DQVDEAPNRERAKSDTCSPAGLASPGEGASQAL....EAH.GFDQLARKFTSFFTPSLYNTPNFSQV.
N1J4X2_BLUG1/150-556............EDESKLLS.................DM...HAN....KTE.LSEALTE.CIRLCKP....TLSFA...
C4JQY3_UNCRE/143-586............SDEDTILK.................DV...EAS....MGT.LGPPLAH.YIRSSKP....TKSFA...
U4LL48_PYROM/132-582............EDIETIIK.................DI...VAE....PTE.SSASLAH.FVKNVKP....TQSFV...
M4G219_MAGP6/120-591............DEDKKIIT.................EL...QSD....PDE.STMAMIE.FIRHSKP....TLSFH...
I1RCJ1_GIBZE/98-519............DDEKKIIS.................EL...QAD....PDP.TTASMVE.FVRLSKP....TQSFY...
J7RBT2_KAZNA/205-696............DEPTQILE.................TLESST.QTVKTGDL.NTLILRQ.LVKQIKP....TTPLISYH
D5G9F0_TUBMM/127-587............EDVNGILK.................DI...AAE....AAD.SSASLAR.FVEACRP....TKSFVLTL
I2G095_USTH4/203-726............DQADETLARGRQTPGNSSPAGMASPGGGGSTGP....EAH.GFEQLARNFTSLFRLNLNHSLNLSEV.
C5FU53_ARTOC/156-599............SDENTILK.................DI...EAS....KST.IGPPLAH.YIRSSKP....TKSFA...
H2AZX0_KAZAF/181-685............DDVNNILR.................TLETTTMNSTESNDI.NMIILRH.LIKHIQP....TVPLNSYH
V5ETE4_PSEBG/203-712............DHAD..PGRDRNTAGSSSPSGALSP...SGQAP....ETH.GFEQLTRNFTALFQPNLYHTLNFSDV.
W1QEY3_OGAPD/185-592............DDPESVIR.................DIQAERHS...........LIAN.FIRMIKP....SESLSRLA
S6E8H4_ZYGB2/281-781............DEPANIIK.................ELETFSYQ....DDI.GNIVLTH.IVKHIQP....NVPLGSYQ
B6H909_PENCW/173-617............DSEAAIIK.................DV...EAS....GGA.LAPALTH.YIRCSKP....TKSFA...
C5DHQ6_LACTC/242-731............NEPAIIIQ.................ELQFSSPQ....NDI.TSVLLTS.LVKHLKP....TVPLRNYQ
M1VZL7_CLAP2/99-559............EDEKKIIA.................EL...EAD....QDT.TTPSMVE.FARLAKP....TMSFH...
M7TWW8_EUTLA/45-471............SDEKKIVA.................EL...QAD....TDD.TTTAMVE.FVRLSRP....TLSFH...
G8YSZ2_PICSO/187-642............DEPESIIK.................DIKTQPQS...........PLAL.FIRMIRP....SESLLKLS
L8FQS0_PSED2/113-539............DDENKIIA.................DI...QSD....GGE.LTGPLLE.YLKIVRP....TLSFH...
F8PYL6_SERL3/132-563............DGDQGL..........DPYMNLRGPHVRPEERT........LAQGLIK.FLETASV....TLSLADM.
S8BNA5_DACHA/141-592............EDVDDIIK.................EIIQ.EQD....QGS.LSASFVQ.FIQNCKP....TLSFA...
J8Q1I2_SACAR/396-963............DEPNNIIN.................SLETFSYQ....DDA.GTMILKH.LVRNIQP....NIPLRSYR
A7TP53_VANPO/308-811............DEPSKIIN.................NIDSFTYK....DNI.GGVVLKH.LVKHLQP....HVPINYYQ
D8PLZ6_SCHCM/127-556.............EKDGF..........DPFASLRGPHVSVNDRP........LVDGLIR.FLEVASI....TLSLADM.
E9D3F7_COCPS/143-585............SDEASILK.................DI...EAS....MGT.LGPPLAH.YIRSSKP....TKSFA...
H6BW23_EXODN/132-559............SSPQKILK.................DI...QAA....GGP.LALPLAN.FMAKATP....TKSFY...
U1GT46_ENDPU/116-550............DKESKILA.................DI...SQS....GGP.LAAALAH.YIRVSSP....TKSFA...
C5DQJ7_ZYGRC/281-783............DEPTNIIK.................ELETFSYH....DDI.GNIVLSH.IVKHIQP....NVPLGSYQ
B2ALS2_PODAN/100-533............VDEKRIIT.................EL...QDD....PDE.TTLAMIE.FVRHCKP....TLSFY...
G4U9V0_NEUT9/109-529............AEEKKVIN.................ELLGPESD......P.TTQAMIE.FVRRCKP....NLSFH...
R8BC65_TOGMI/105-536............DDEKKIIS.................EL...QAD....PDE.STLSMIE.FVRHSKP....TMSFH...
U7Q027_SPOS1/111-529............DDETKIIA.................EL...EAR....GDK.AAATMIE.LVKASKP....TLSFY...
G8BGC4_CANPC/198-622............DEPENIIK.................DLKISNES...........ILAN.FISSIEP....TESLLKLS
E7A1P0_SPORE/203-720............DQPDDTPARGR....DGSPAGPVSP..GGAPAP....EVR.GFEQLSRTFTDYFKPRLHGSFNFSDV.
G0RDM3_HYPJQ/95-507............DDEKKIIA.................EL...QND....RDP.TTLSMIE.FVRLAKP....TVSFY...
K0KSM9_WICCF/157-573............DAPEKIIT.................DLKTEPMS...........PLST.FIKNINP....MMSMNKLA
M9MFA0_PSEA3/199-702............DQPDEA.ARGRRTPGSASPAGHLTP...AEQAP....ETH.GFEQLARNFTSLFRPDLMHSLNFSEV.
J4HS73_FIBRA/136-569............DDEDEQGY........ELYMRLRGPQLMPEDRE........LAEQLMK.FLDLASI....SLSLADM.
G0VDK5_NAUCC/193-728............DDPTNILQ.................TLDKFSHQ....DVI.GNLILRH.LVKRIQP....TIPIRSYH
E7KD88_YEASA/399-966............DEPNNIIS.................SLETFSYQ....DDI.GTIILKH.LVRNIQP....NIPLRSYR
G4MPF6_MAGO7/119-567............DDEKKIVS.................EL...QSD....PDE.STLAMIE.YMRHSKP....TLSFQ...
G8ZWI0_TORDC/270-767............DEPAKIIK.................DLENLSSD....DDI.GNMVLTH.LIRRLQP....TVALGTYQ
S9VYA1_SCHCR/73-478............QDLESIMK.................RLPLSRNS...........LLAS.FITEARP....TSTFTD..
I2H4A8_TETBL/339-898............DEPSNIIK.................KLETSSNQ....DDL.TSVLLIH.IVRHIQP....TLPLRSYQ
V5FG66_BYSSN/161-604............DNEATILK.................DV...EAS....GGA.LGPALAH.YIRCSKP....TKSFA...
G2R1J8_THITE/107-555............MDEKRIIA.................EL...QSD....PDE.TTLAMIE.FVRHCKP....TLSFY...
U5HEM2_USTV1/112-634............EDPDELRK.............................NVQ.PDTLLSK.FLEFCSP....NLSFAEY.
F4P7C7_BATDJ/218-651............SDAEEILN.................TL..........PVD.ASPLLVE.LIQIVTP....TLSFEELQ
G0WEJ7_NAUDC/230-810............DDPTNIIQ.................SLEESSNQ....DVL.GNTILRH.LVKRMQP....NIPIRNYQ
Q5KFU1_CRYNJ/231-746LFFGIVGLPAAVDDDDAVNNWTNGRKSPVRNRTRRGSKITAEDDA....IED.GETVLRRTLIEACDV....TKPLYEI.
S2K004_MUCC1/106-577............EDPEEVLK.................NM..........PLD.ASPTLVQ.LVQILTP....TQSLQELH
J5JA21_BEAB2/104-534............EDEKKIVA.................EL...QAD....GDP.NALPMVE.FVRISKP....TMSFY...
C1GWB7_PARBA/96-533............TDEATILK.................DI...EGS....VGP.LGPRLAH.YIRASKP....TKSFA...
G0SXZ9_RHOG2/78-582............EDARILQR.............................DVL.EGSLLWR.FLDICRP....KLSFADY.
R7YHW5_CONA1/139-553............EDAETLLK.................EI...EGD....AKE.RSAPLAF.YIRNSTP....TKSLQ...
G8BZL7_TETPH/286-791............EEQNVIIE.................KLKSFSQD....DNI.GGLILRQ.LVKHIQP....NVPIRSYQ
K1XTL5_MARBU/117-531............DDESKIIP.................EI...QAD....DTE.LSAPLIE.CIRLCKP....TLSLL...
S8E9R2_FOMPI/133-565............DDEDERGK.......NELYRRLRAPQLTAEDNE........LAEQLVK.FLEIADV....TLSLSDM.
NPR3_EMENI/171-616............DNEATIIK.................DV...EAA....GGA.LAPPLVH.YIRCSSP....TKSFV...

PF06218

M3IIL9_CANMX/8-518------------VNWDPTMV---------------------------------KILPYIN-GLNSVKR----ISELA---
M2UFV8_COCH5/4-472------------VSSDLTLN---------------------------------RILPYIN-GINSIAH----IAQLA---
Q6BQE8_DEBHA/7-469------------INWDPTML---------------------------------KILPYID-GINSIKR----ISQLA---
Q0U9Y5_PHANO/4-462------------ISSDLTLN---------------------------------RILPYIN-GVHSIAR----IAALA---
G3AQK3_SPAPN/8-551------------VNWDPTMV---------------------------------KILPFIN-GLNSVKR----ISELA---
W6RQZ3_CAEEL/186-593------------EKMDVLSQ---------------------------------KIIPQID-GINTVRE----IAIIL---
A5DQL3_PICGU/6-475------------VNWDPTMV---------------------------------KILPFIN-GVNSVRK----ISRLA---
K1Y0B6_MARBU/2-405------------DTWDLTMK---------------------------------KVIQQID-GIKDVRR----IAHDA---

PF03666

S8B047_PENO1/190-645...............Q.ISA..SS..........................GIPLST......IQMLASHLVYWRRARAIP
H1V255_COLHI/104-533...............Q.VGQ..SN..........................VLTLSQ......VRKYAQHFIFWRRAIAIP
G1WZV0_ARTOA/142-590...............QMLSPTSDS..........................SAPHPENPEYQYIEYFARHLIYWRKARAIM
C4QYA8_PICPG/201-611TTS...............................................GLDLAQ......IKAFACHLVYWRRAKIIP
K2SR44_MACPH/175-626...............K.LAI..QH..........................KIPVAD......LEFIAAHLIYWRRARAIP
R9P8J9_PSEHS/205-716......................AD..........................MFEWNLYDD...VYPMVRHLLYYKQARVID
NPR3_CANGA/243-797YIINELLAEKPLSSST.TAN..KS...............KQNKDNKTN..TFYSAL......LRSCALHLIYWRHARAIL
C0NJI2_AJECG/154-591...............Q.ISA..LS..........................GIPLSD......IQVLASHLVYWRRARAVP
G8JWB1_ERECY/316-852YLIDELLG..........TN...STGANTVDGGGVLGTSSSKIQAHRN..SFECNM......LRSIALHLTYWRHTRIIL
NPR3_PHANO/150-598...............K.ISK..RH..........................NISAHD......MEYIASHLVYWRRARLIA
B6QRZ0_PENMQ/156-593...............Q.ISA..LS..........................GIPLDT......IHDLAQHLIYWRRARAIP
NPR3_KLULA/205-723LLIKELID..........SN..DS....................SYDD..QFCETT......LKSLCLHLIYWRHARLIL
B8N792_ASPFN/172-617...............Q.ISA..LS..........................GIPLST......IQMLASHLVYWRRARAIP
M7X5H8_RHOT1/78-583..................................................ETLLDLYSEDHMLEDIVDHLVHWKKARVVD
NPR3_DEBHA/205-647NKLKQQASDNGF......................................SLDAGQ......IKSFAFHLIYWRRARVIL
D6RLY8_COPC7/119-572......................AS..........................LLDWDLESQ...VYPVVRWLVQHRRAKIVD
V2XGE3_MONRO/83-521......................TS..........................LMDWDLESQ...VYPIVRWLVQHRRAKVVD
T5A616_OPHSC/95-514...............Q.VGQ..SN..........................VLTLGQ......VRKYAQHFIFWRRAIAIP
E9EL47_METAR/99-517...............Q.VGQ..SN..........................VLTASQ......VRKYAQHFIFWRRAIAIP
NPR3_ASPFU/179-636...............Q.ISA..SS..........................GIPLST......IQMLASHLVYWRRARAIP
NPR3_ASHGO/273-791PLVSNLLE..........AN..LSLSAR...AAGSRHAASNAADSHST..PLQHSM......IRSIVLHLVYWRYARIIL
Q4PA65_USTMA/205-718......................AD..........................MLGWDLYDD...VYPMVRHLIYYRQARVID
N1J4X2_BLUG1/150-556...............Q.VAQ..IN..........................SIELTS......LLTLASHLIFYRRALAIP
C4JQY3_UNCRE/143-586...............Q.ISA..RS..........................SIPLSD......IQVLATHLIYWRRARAVP
U4LL48_PYROM/132-582...............Q.ISI..QS..........................GIALHE......IQVLARHLIQWRKARPIP
M4G219_MAGP6/120-591...............Q.VASQ.SN..........................LLSLSQ......IHQFAHHFIFWRRAIAIP
I1RCJ1_GIBZE/98-519...............Q.VGQ..SN..........................ILTLGQ......VRKYAQHFIFWRRAIAIP
J7RBT2_KAZNA/205-696DIITSTLQ..........LE..SS..........................EITYDI......LRSCAIHLIYWRYARVII
D5G9F0_TUBMM/127-587LLKSGYGVNSIIRFLQ.ISN..SC..........................GIPLHE......IQVMARHLVHWRKARAIP
I2G095_USTH4/203-726......................AD..........................MLGWNLYED...VYPMVRHLIYYRQARVID
C5FU53_ARTOC/156-599...............Q.ISA..RS..........................RIPLSD......IQVLASHLVYWRRARAIP
H2AZX0_KAZAF/181-685YIITDALD..........LE..PS..........................TVTYDI......LRSCALHLIYWRHARVII
V5ETE4_PSEBG/203-712......................AD..........................MLGWELYED...IYPMVRHLIYYRQARVID
W1QEY3_OGAPD/185-592TLS...............................................GLDIAE......VKLFANHLVYWRRAKAFL
S6E8H4_ZYGB2/281-781HLIDDLLG..........GT..S.................ED.TGIGN..SFQTSM......LRSCALHLLYQRHARVVI
B6H909_PENCW/173-617...............Q.ISA..SS..........................GIPLSH......IQMLSSHLVYWRRARAIP
C5DHQ6_LACTC/242-731YVIDEIVG..........KP..VA...............SESDVEERN..SFQTSM......LRSLALHLMYWRHARVII
M1VZL7_CLAP2/99-559...............Q.VCQ..SK..........................ILTSSQ......VREYAQHFIFWRRAIAVP
M7TWW8_EUTLA/45-471...............Q.IGH..GN..........................ALSPAQ......VRKYAQHFIFWRRAIAIP
G8YSZ2_PICSO/187-642NKIKTQKKN.........................................NLDLDQ......IKSFAFHLIYWRRARVIL
L8FQS0_PSED2/113-539...............Q.TAQ..QH..........................AISLND......IRILAQHLIYHRRAIAVP
F8PYL6_SERL3/132-563......................AS..........................LLDWDLENQ...IYPTVRWLVHHRRAKVVD
S8BNA5_DACHA/141-592...............QMISASSPN..........................GIIHPENPEYQYIEYFARHLIYWRKARAIM
J8Q1I2_SACAR/396-963YLISELLD..........NS..SS...............QDNLSLETN..SLESSI......LRSCALHLMYWRHARIVI
A7TP53_VANPO/308-811PLVDELLG..........ST..S.................GGLSGERS..LFQVNI......LKYCALHLLYWRHARVIS
D8PLZ6_SCHCM/127-556......................SS..........................LLDWDLDTQ...IYPVVRWLVEHRRAKIVD
E9D3F7_COCPS/143-585...............Q.ISA..RS..........................SIPLND......IQVLAAHLIYWRRARAVP
H6BW23_EXODN/132-559...............K.ISI..AS..........................QMALGD......IQHLARHLVYWRRAIAIP
U1GT46_ENDPU/116-550...............K.ISA..LH..........................SISLPD......IQLLAQHLVDWRRARAIP
C5DQJ7_ZYGRC/281-783YLIDELFG..........DT..S.................DD...VRG..SFQTNM......LRSCALHLLYRRHARLII
B2ALS2_PODAN/100-533...............Q.VGQQSSN..........................VLSPTQ......VRKFAQHFIFWRRAIAIP
G4U9V0_NEUT9/109-529...............Q.VQQQASS..........................ILSPAQ......VRRFAEHFIFWRRAIAIP
R8BC65_TOGMI/105-536...............Q.VGQQSSN..........................ILTISH......VRKYAQHFIFWRRAIAIP
U7Q027_SPOS1/111-529...............Q.VSQLPDT..........................ILTIHQ......IRAYAQHFIYWRRAMAVP
G8BGC4_CANPC/198-622AQYP..............................................QLDIRQ......IKSFAFHLIYWRKARIIQ
E7A1P0_SPORE/203-720......................AD..........................FFGWHLYDD...VYPMVRHLIYYRQARVID
G0RDM3_HYPJQ/95-507...............Q.VGQ..SN..........................ILTLDQ......VRKYAQHFIFWRRAIAIP
K0KSM9_WICCF/157-573LLN...............................................QLDINQ......VKAFANHLIYWRRARSII
M9MFA0_PSEA3/199-702......................AD..........................MLGWDLYED...VYPMVRHLIYYRQARVID
J4HS73_FIBRA/136-569......................AT..........................LLDWDLESQ...VYPTVRWLVHHRRAKVVD
G0VDK5_NAUCC/193-728YIIDEILD..........LD..SD...............NNEQTTIEN..SMQYNI......LRSCSLHLIYWRHARVII
E7KD88_YEASA/399-966YLITDLLD..........NP..SS...............LDDLTTETN..SLESSI......LRSCALHLMYWRHARIVI
G4MPF6_MAGO7/119-567...............Q.VAIQ.SK..........................VLNLAQ......VRRFAHHFIFWRRAIAIP
G8ZWI0_TORDC/270-767NIIDEMLG..........TA..K.................ESVTGSQN..SFQTSM......LRSCALHLLYRRHARVVI
S9VYA1_SCHCR/73-478.................IAN..SL..........................GISLSE......CFLLAKHLIHWRKAIAIP
I2H4A8_TETBL/339-898YLIDDVFR..........FN..SN...............EFGMKELENGESIKINL......LKSCTLHLLYWRYVRVII
V5FG66_BYSSN/161-604...............Q.ISA..VS..........................GIPLSN......IQLLASHLVYWRRARAIP
G2R1J8_THITE/107-555...............Q.VCQQSSN..........................VLTPAQ......VRKFAQHFIFWRRAIAIP
U5HEM2_USTV1/112-634......................AT..........................LLDIDSDADDGALRDVVQHLVYWRKGKIIG
F4P7C7_BATDJ/218-651TTL...............................................SCSLSQ......IYRLAAHLYVWSKAKIIH
G0WEJ7_NAUDC/230-810YIIDEVL...............GS...............GFKSGITDN..TIQCNI......LRSCTLHLIYWRYARVIL
Q5KFU1_CRYNJ/231-746......................AH..........................LLRYDLEGV...VIPLARDLVQSKKAILID
S2K004_MUCC1/106-577LLL...............................................DCSLAQ......IYRLAAHLIYWRKAKLIH
J5JA21_BEAB2/104-534...............Q.VGQ..SN..........................ILSLSQ......VRKFAQHFIFWRRAIAIP
C1GWB7_PARBA/96-533...............Q.ISA..QS..........................GIPLSD......IQVLASHLAYWRRARAVP
G0SXZ9_RHOG2/78-582..................................................ETLLDLYSEDHMLEDVVDHLVHWKKARVVD
R7YHW5_CONA1/139-553...............K.LAA..AF..........................SIKIQH......IQLLANHLIYWRRARAIP
G8BZL7_TETPH/286-791PLINELMG..........VK..EN...............DPNRT......IFHINI......LKYCALHLLYWRHARAVI
K1XTL5_MARBU/117-531...............Q.VAQ..IN..........................SIEVGS......LLILANHLIQYRRAVAIP
S8E9R2_FOMPI/133-565......................AS..........................LLDWDLETR...IYPTVRWLVHHRRAKVVD
NPR3_EMENI/171-616...............Q.ISQ..IS..........................GMPLPT......IQFLASHLVYWRRARAIP

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------DANYIL------TKQCIQHLMHYKCIEIID
M2UFV8_COCH5/4-472--------------------------------------------------DTDLSL------TRKAIQHLVYYGCLVLLD
Q6BQE8_DEBHA/7-469--------------------------------------------------DADYIL------TKQCIQHLMHYKCINMID
Q0U9Y5_PHANO/4-462--------------------------------------------------DTDLSL------TRRAIQHLVYYGCLVLLD
G3AQK3_SPAPN/8-551--------------------------------------------------NANYLL------TKQCIQHLMHYKCIEIID
W6RQZ3_CAEEL/186-593--------------------------------------------------ELDPSL------VARCVRNLHFYECVSLVP
A5DQL3_PICGU/6-475--------------------------------------------------DADYIL------TKQCLQHLLYYRCIEILD
K1Y0B6_MARBU/2-405--------------------------------------------------DVALDL------TKIALQHLLYYDSILLLD

PF03666

S8B047_PENO1/190-645PIHQR..DTYIVSPNCDLS...................................................KLEIATIAYQ
H1V255_COLHI/104-533PLHAR..DVYIMSPNCDTR...................................................NLPKASLEWQ
G1WZV0_ARTOA/142-590PLHYR..RYYIVSPNADMK...................................................RLVSQSIVFA
C4QYA8_PICPG/201-611AINTR..NIYVISALAPLD...................................................RLEVHSMEFR
K2SR44_MACPH/175-626PLHHR..DIYIVSPNADMR...................................................KLPQAIPAYA
R9P8J9_PSEHS/205-716VPRPG..HVYAISPLFDFA...................................................RLRPLSHVWA
NPR3_CANGA/243-797PISFK..NTYIVSPLSPVEADN.SEMIKGNRKPSITDLNVTS..................NSS...SKIPVIYLNQQSFK
C0NJI2_AJECG/154-591PLSQR..DTYIVSPNADMS...................................................KLAQAAEVYE
G8JWB1_ERECY/316-852PISSK..NTYIVSPLAPIRGTA.VD.............DC.................DSRDMDIVEG.EALIYQNQEIFH
NPR3_PHANO/150-598PLSPR..DTYIVSPNADFS...................................................LLPSAVTAYA
B6QRZ0_PENMQ/156-593PLHQR..DTYIVSPNCDLS...................................................QLKKATQSYA
NPR3_KLULA/205-723PISSR..NTYIVSPLAPISGFS.TD.............DFKH.GEYDTLIRQQEVPVNNNDE......PSLIYQNKKVFN
B8N792_ASPFN/172-617PLHQR..DVYFVSPNCDLS...................................................KLEVATAAYQ
M7X5H8_RHOT1/78-583LVSLK..GAYAVSAEFEVK...................................................RLPSLVASFS
NPR3_DEBHA/205-647PISTR..SVYIVSPMAPITL..................................................KFHHDIFIFK
D6RLY8_COPC7/119-572IVNPGLKTIFALPSKFPAS....................................................LSTLSHQFN
V2XGE3_MONRO/83-521IVHSGLKTVFMLPPKFDYP....................................................LSQLIKEFE
T5A616_OPHSC/95-514PLHAR..DTYVVSPSCHLA...................................................HLPSASQEWQ
E9EL47_METAR/99-517PLHAR..DVYIVSPNCDLS...................................................RLPKDAAEWQ
NPR3_ASPFU/179-636PIHQR..DTYIVSPNCDLS...................................................KLEVATAAYQ
NPR3_ASHGO/273-791PLSSK..NTYIVSPLAPIRGTA.AD.............DF.................ENTDM.VKQGCKALIYQHQDLFH
Q4PA65_USTMA/205-718VPRPG..HVYAISPLFDFA...................................................RLGSLSYNWA
N1J4X2_BLUG1/150-556PLHLR..NTYIVSPNCDCR...................................................KLPDAIKEWK
C4JQY3_UNCRE/143-586PLNKQ..DTYIVSPNCDLS...................................................KLPLATAAYE
U4LL48_PYROM/132-582PIHQR..NTYIVSPNADMK...................................................RVPQLIPVYS
M4G219_MAGP6/120-591PLHAR..DIYMLSPNCDLE...................................................KLPQASVKFA
I1RCJ1_GIBZE/98-519PLHAK..DQYILSPNSDLS...................................................RLPLDTLEWQ
J7RBT2_KAZNA/205-696PLSSK..HIYIVSPLLSLDLCYSGD..................................................EKKFR
D5G9F0_TUBMM/127-587PIHQR..DTYIVSPNADMK.................................KFFPSIPLPITIVLTDQPRLHTLIPIYN
I2G095_USTH4/203-726IPRVH..HVYAISPLFDFA...................................................RLGPLSTIWA
C5FU53_ARTOC/156-599PLNKK..DVYIVSPNADMS...................................................KLTIATAAYE
H2AZX0_KAZAF/181-685PMSSK..FTYVVSPIISLEKMYNVD..................................................KVQFK
V5ETE4_PSEBG/203-712IPKPG..HVYAISPLFDFA...................................................RLGPLSHVWA
W1QEY3_OGAPD/185-592PLSPR..NVYIVSPLAPLS...................................................DVYKDSNLFK
S6E8H4_ZYGB2/281-781PISSR..NTYIVSPIAPIRGYS.KN.............DYMG.................ARFS....GMPLIYQNQSIFK
B6H909_PENCW/173-617PIHQR..DTYVVSPNCDLS...................................................KLEIATIAYQ
C5DHQ6_LACTC/242-731PVSSK..NTYIVSPLAPITGNT.KD.............DFSG...............NRLDSE...ESKPLILQNQEVFS
M1VZL7_CLAP2/99-559PLHDR..DVYIVSPNCDVS...................................................RLPQDTVEWQ
M7TWW8_EUTLA/45-471PLHAR..DTYVLSPNCDLA...................................................ELPRASQAWA
G8YSZ2_PICSO/187-642PLNPR..SVYIVSPMAPLTI..................................................RLYEDISKFK
L8FQS0_PSED2/113-539PLHPR..DTYILSPNCPMA...................................................SLPQFCALWS
F8PYL6_SERL3/132-563IVHSGLKTIFTLPPRFEAS....................................................LSSLSIDFK
S8BNA5_DACHA/141-592PLHYR..RYYIVSPNADMK...................................................RLVPQSIIFN
J8Q1I2_SACAR/396-963PLSSK..YTYIVSPLAPIQGHT.VD.............DFKSTSQNDEQVNTMGNGKNNVDQS...DNIPLIYQNSILFR
A7TP53_VANPO/308-811PINSK..NTYIVTPLAPIQGTA.KD.............DTVS..............HHHINKD...NPKTLIYQNEDIFK
D8PLZ6_SCHCM/127-556VVHPGLKTVFTLPPKFEQP....................................................LSELTAEFE
E9D3F7_COCPS/143-585PLNKQ..DTYIVSPNCDLS...................................................KLGLATAAYE
H6BW23_EXODN/132-559PLHQR..DTYIVSPNANMS...................................................KLVSACKSYE
U1GT46_ENDPU/116-550PLHQR..DTYIVSPNADLK...................................................KLSTAVKSYE
C5DQJ7_ZYGRC/281-783PISSR..NTYIVSPLAPIRGYS.KN.............DYDG.................LQNS....SMPLIYQNQTIFK
B2ALS2_PODAN/100-533PLHAR..DMYIVSPNCDMR...................................................KLPQAAAHWA
G4U9V0_NEUT9/109-529PLHGR..DMYIVSPNCDLR...................................................RLPQAAAQWA
R8BC65_TOGMI/105-536PLHAR..DIYILSPNADMR...................................................QLPGASAVWA
U7Q027_SPOS1/111-529PIHAR..DVYILSPNCDID...................................................HLARASAVFA
G8BGC4_CANPC/198-622PLSSR..SVYIISPMAPLTV..................................................RLYEDISEFN
E7A1P0_SPORE/203-720VPRPG..HVYAISPLFDFA...................................................RLGALSRVWA
G0RDM3_HYPJQ/95-507PLHPR..DVYIVSPNCDLE...................................................RLPQDAQDWQ
K0KSM9_WICCF/157-573PLQAK..SVFIVSPMAPIE...................................................YINEDMKSFR
M9MFA0_PSEA3/199-702IPRPG..HVYAISPLFDFG...................................................RLGALSRVWA
J4HS73_FIBRA/136-569FVHPGLKTVFSIPQKFSAP....................................................LSELSAEFD
G0VDK5_NAUCC/193-728PLSSK..NSYILSPISPIVYSV............................................D...KFKEDELTFR
E7KD88_YEASA/399-966PLSSK..YTYIVSPLAPIQGYT.ID.............DYKSTSQNDGNVKKMEDRENNKNGS...DRVPLIYQNSMLFR
G4MPF6_MAGO7/119-567PLHAR..DVYILSPNCDLS...................................................KLPSASLDFS
G8ZWI0_TORDC/270-767PISSK..CTYIVSPLAPIDGFSHDN.............DLDS.................VENH...MERPLIYQNQEIFK
S9VYA1_SCHCR/73-478PLLIR..NTYVTSPTADLS...................................................KLESDARLFA
I2H4A8_TETBL/339-898PISSR..NTYIISPLSPIQGSN.KDLLITNKNCLKSYNDYNNKDNNENNNNNDRYHSNKSTDSKVENKKPLIYQYQDMFK
V5FG66_BYSSN/161-604PLHQR..DTYIVSPNCDLS...................................................KIEAATAAYA
G2R1J8_THITE/107-555PLHAR..DTYIVSPNCDLR...................................................KLPQASAEWA
U5HEM2_USTV1/112-634VVSLK..GVYTASSTIPLA...................................................SLAQLTIDFG
F4P7C7_BATDJ/218-651VVSNR..NVYIVSPQAQLS...................................................ELPKLSTEFS
G0WEJ7_NAUDC/230-810PISSK..SFYIVSPVSSVSYSK............................................ENESKFVTDSISFK
Q5KFU1_CRYNJ/231-746VVNPR..LRTVVMPTTIDEHNS................................................SFDQYTARFA
S2K004_MUCC1/106-577TISTR..NIYVVSPTAKLN...................................................DIASLEADFK
J5JA21_BEAB2/104-534PLHAR..DTYIVSPNCDLA...................................................RLPEAAVEWQ
C1GWB7_PARBA/96-533PLSRR..DTYIVSPNADLN...................................................KLAQATEAYE
G0SXZ9_RHOG2/78-582LVSLK..GAYAVSAEFEVK...................................................RLPSLVASFS
R7YHW5_CONA1/139-553PLNHR..DTYIVSPNAGMR...................................................ALPSAIVGYA
G8BZL7_TETPH/286-791PLSSK..YTYIVSPLSPLVGSS.K..............DYIS.......EGSSHFSFNRREDN...HYEPLFYQHQIEFG
K1XTL5_MARBU/117-531PLHAR..EIYIVSPNCDNR...................................................KLPVASLAWK
S8E9R2_FOMPI/133-565IVHPGLRTIFTVPLKFTAP....................................................MSALSADFD
NPR3_EMENI/171-616PLHQR..DTYIVSPNCDLS...................................................KLEVASAAYK

PF06218

M3IIL9_CANMX/8-518IFQFS--NIYAPTNHIGDFLRFDG----------------------------------------------KMAEECQAYV
M2UFV8_COCH5/4-472IFSFG--AIYAPTAEIGGFIIDA.----------------------------------------------EVKDECMRYV
Q6BQE8_DEBHA/7-469IFQFS--NIYAPTNHIGNFLTLN.----------------------------------------------NIAEECQAYI
Q0U9Y5_PHANO/4-462IFSFS--AIYAPTAEIGGFVLDP.----------------------------------------------DVKDECARYI
G3AQK3_SPAPN/8-551IFQFS--NIYAPTNHIGDFLKING----------------------------------------------KMAEECQAYV
W6RQZ3_CAEEL/186-593MFLYY--NTYVATERVHDFYKNQT----------------------------------------------EIND.CLEFV
A5DQL3_PICGU/6-475IFQFS--NIYAPTNNISRFLTVP.----------------------------------------------DIAEDCQAYI
K1Y0B6_MARBU/2-405LFLFS--NIYAPTPGVNDFVADRD----------------------------------------------GLQDECANYV

PF03666

S8B047_PENO1/190-645AT------------------------------------------------------------------------------
H1V255_COLHI/104-533KT------------------------------------------------------------------------------
G1WZV0_ARTOA/142-590RL------------------------------------------------------------------------------
C4QYA8_PICPG/201-611TK------------------------------------------------------------------------------
K2SR44_MACPH/175-626SR------------------------------------------------------------------------------
R9P8J9_PSEHS/205-716ET------------------------------------------------------------------------------
NPR3_CANGA/243-797LK------------------------------------------------------------------------------
C0NJI2_AJECG/154-591AA------------------------------------------------------------------------------
G8JWB1_ERECY/316-852SK------------------------------------------------------------------------------
NPR3_PHANO/150-598QR------------------------------------------------------------------------------
B6QRZ0_PENMQ/156-593TT------------------------------------------------------------------------------
NPR3_KLULA/205-723EK------------------------------------------------------------------------------
B8N792_ASPFN/172-617LA------------------------------------------------------------------------------
M7X5H8_RHOT1/78-583DT------------------------------------------------------------------------------
NPR3_DEBHA/205-647KT------------------------------------------------------------------------------
D6RLY8_COPC7/119-572QQ------------------------------------------------------------------------------
V2XGE3_MONRO/83-521RD------------------------------------------------------------------------------
T5A616_OPHSC/95-514RA------------------------------------------------------------------------------
E9EL47_METAR/99-517RA------------------------------------------------------------------------------
NPR3_ASPFU/179-636AA------------------------------------------------------------------------------
NPR3_ASHGO/273-791EK------------------------------------------------------------------------------
Q4PA65_USTMA/205-718QT------------------------------------------------------------------------------
N1J4X2_BLUG1/150-556EA------------------------------------------------------------------------------
C4JQY3_UNCRE/143-586AA------------------------------------------------------------------------------
U4LL48_PYROM/132-582KT------------------------------------------------------------------------------
M4G219_MAGP6/120-591RA------------------------------------------------------------------------------
I1RCJ1_GIBZE/98-519RA------------------------------------------------------------------------------
J7RBT2_KAZNA/205-696EK------------------------------------------------------------------------------
D5G9F0_TUBMM/127-587TL------------------------------------------------------------------------------
I2G095_USTH4/203-726QT------------------------------------------------------------------------------
C5FU53_ARTOC/156-599AT------------------------------------------------------------------------------
H2AZX0_KAZAF/181-685KR------------------------------------------------------------------------------
V5ETE4_PSEBG/203-712RS------------------------------------------------------------------------------
W1QEY3_OGAPD/185-592QH------------------------------------------------------------------------------
S6E8H4_ZYGB2/281-781GK------------------------------------------------------------------------------
B6H909_PENCW/173-617TA------------------------------------------------------------------------------
C5DHQ6_LACTC/242-731KK------------------------------------------------------------------------------
M1VZL7_CLAP2/99-559RA------------------------------------------------------------------------------
M7TWW8_EUTLA/45-471RA------------------------------------------------------------------------------
G8YSZ2_PICSO/187-642DM------------------------------------------------------------------------------
L8FQS0_PSED2/113-539QK------------------------------------------------------------------------------
F8PYL6_SERL3/132-563RE------------------------------------------------------------------------------
S8BNA5_DACHA/141-592KL------------------------------------------------------------------------------
J8Q1I2_SACAR/396-963SK------------------------------------------------------------------------------
A7TP53_VANPO/308-811KA------------------------------------------------------------------------------
D8PLZ6_SCHCM/127-556QE------------------------------------------------------------------------------
E9D3F7_COCPS/143-585LA------------------------------------------------------------------------------
H6BW23_EXODN/132-559AT------------------------------------------------------------------------------
U1GT46_ENDPU/116-550SA------------------------------------------------------------------------------
C5DQJ7_ZYGRC/281-783ER------------------------------------------------------------------------------
B2ALS2_PODAN/100-533RQ------------------------------------------------------------------------------
G4U9V0_NEUT9/109-529RQ------------------------------------------------------------------------------
R8BC65_TOGMI/105-536RQ------------------------------------------------------------------------------
U7Q027_SPOS1/111-529ET------------------------------------------------------------------------------
G8BGC4_CANPC/198-622KK------------------------------------------------------------------------------
E7A1P0_SPORE/203-720HA------------------------------------------------------------------------------
G0RDM3_HYPJQ/95-507RA------------------------------------------------------------------------------
K0KSM9_WICCF/157-573HD------------------------------------------------------------------------------
M9MFA0_PSEA3/199-702HT------------------------------------------------------------------------------
J4HS73_FIBRA/136-569RV------------------------------------------------------------------------------
G0VDK5_NAUCC/193-728DR------------------------------------------------------------------------------
E7KD88_YEASA/399-966SK------------------------------------------------------------------------------
G4MPF6_MAGO7/119-567RA------------------------------------------------------------------------------
G8ZWI0_TORDC/270-767KR------------------------------------------------------------------------------
S9VYA1_SCHCR/73-478RT------------------------------------------------------------------------------
I2H4A8_TETBL/339-898ET------------------------------------------------------------------------------
V5FG66_BYSSN/161-604AA------------------------------------------------------------------------------
G2R1J8_THITE/107-555RQ------------------------------------------------------------------------------
U5HEM2_USTV1/112-634TQ------------------------------------------------------------------------------
F4P7C7_BATDJ/218-651SR------------------------------------------------------------------------------
G0WEJ7_NAUDC/230-810EK------------------------------------------------------------------------------
Q5KFU1_CRYNJ/231-746RD------------------------------------------------------------------------------
S2K004_MUCC1/106-577LH------------------------------------------------------------------------------
J5JA21_BEAB2/104-534RA------------------------------------------------------------------------------
C1GWB7_PARBA/96-533AA------------------------------------------------------------------------------
G0SXZ9_RHOG2/78-582DI------------------------------------------------------------------------------
R7YHW5_CONA1/139-553AR------------------------------------------------------------------------------
G8BZL7_TETPH/286-791QT------------------------------------------------------------------------------
K1XTL5_MARBU/117-531KA------------------------------------------------------------------------------
S8E9R2_FOMPI/133-565RR------------------------------------------------------------------------------
NPR3_EMENI/171-616VA------------------------------------------------------------------------------

PF06218

M3IIL9_CANMX/8-518VATETNTTETPFYS....NASSQIHS.PHPGNGDHLPTYNYKQSF.GSASVSPYT................KTNFLSKSP
M2UFV8_COCH5/4-472RVPRMKL.......................................GPNAKSAVG................STLKISEFD
Q6BQE8_DEBHA/7-469ITNEPNLL.NELPV....NEDSDIQS................STF..PNSASPTS................KHSSIFKAS
Q0U9Y5_PHANO/4-462RVPRLRL.......................................GSAATAS..................TTILEHPSP
G3AQK3_SPAPN/8-551VTSESNIEGSSYFS....HTPSTYHN.............NNTSSFHGSNSVSPYSTAGLKYDSVSSSYPKPSSSYLSKSP
W6RQZ3_CAEEL/186-593KIQ.............................................................................
A5DQL3_PICGU/6-475VTDSGERL.ADLPTGSMENSASGVSSVVGSAPLQRSSEASPVSTF...NSVSPLA................RTSYFSSSS
K1Y0B6_MARBU/2-405YINGPRL.........................................................................

PF03666

S8B047_PENO1/190-645--------------F..PTLPSLPKMLSALS....GT..............PRPYGSFIPS..KDH..K----ETYFSI-
H1V255_COLHI/104-533--------------F..PLAPPLTNFLAELS....YA..............PRPYKHFCPS..KAH..R----PTYLAM-
G1WZV0_ARTOA/142-590--------------F..PALPPLPKMLSLLS....GK..............PRPYSAYIPS..KDH..R----QAYMDM-
C4QYA8_PICPG/201-611--------------F..PSLPVLSKFLSLLS.TSSNK..............PKQISRFIPS..KDH..R----DLYLDA-
K2SR44_MACPH/175-626--------------F..PTLPSLPKMLSLLS...NQS..............PRTYGTIIPS..KDH..R----TAYMEI-
R9P8J9_PSEHS/205-716--------------F..PDLAPLPVFLSQLS...SST..............SRTLSNLLPA..RHQ..K----ELALDV-
NPR3_CANGA/243-797--------------F..PSLPSLPTFLNILS...LGK..............PKAFGNIIPS..KEH..K----PIYMAA-
C0NJI2_AJECG/154-591--------------F..PTLPSLPKMLHALS....DT..............PKPYSRLIPS..RDH..K----DTYYAI-
G8JWB1_ERECY/316-852--------------F..PTLPTLPSFLSSIS...TLK..............PRSFGHLIPS..KEH..K----FLYLNA-
NPR3_PHANO/150-598--------------F..PTLPTLPKVLNMLS....GT..............PRPFRNFIPT..TEH..R----EAYMDI-
B6QRZ0_PENMQ/156-593--------------F..PTLPSLPKMLSALS....GT..............PRPYATFIPS..KDH..K----ETYFAI-
NPR3_KLULA/205-723--------------F..PSLPSLPSFLQLMS...TQK..............PRPFGHIIPS..NEH..K----SMYLNA-
B8N792_ASPFN/172-617--------------F..PTLPSLPKMLSALS....GT..............PRPYGSFIPS..KDH..K----EAYFAI-
M7X5H8_RHOT1/78-583--------------F..PALPPLPVLLSQLSP...................AEPFASIVRS...AQ..R----ASYLNA-
NPR3_DEBHA/205-647--------------F..PALPSLPHFLKLLS..NSSK..............PRQLATVIPS..KDH..R----DAYLNA-
D6RLY8_COPC7/119-572--------------FNHPAIPSLPRILAAISYSLAQQSN............NHFFAAVVQR..KEL..I----PMYHDV-
V2XGE3_MONRO/83-521--------------FSESNLPPLPQILSAISTSSANQSG............NHFFASVVQS..KDM..I----PTYHEV-
T5A616_OPHSC/95-514--------------F..PVAPPLPNFLAELS....MC..............PKPYKTFCPS..KAH..R----QLYLRM-
E9EL47_METAR/99-517--------------F..PLAPPLPNFLSELS....YT..............PRPYKTFCPS..KPH..R----PLYLRM-
NPR3_ASPFU/179-636--------------F..PTLPSLPKMLSALS....GT..............PRPYGSFIPS..KDH..K----ETYFAI-
NPR3_ASHGO/273-791--------------F..PTLPTLPSFLSSIS...TCK..............PRSFGHLIPS..KDH..N----LLYLSV-
Q4PA65_USTMA/205-718--------------F..PDVAPLPVFLSQLS...SST..............SRTLSNLFPA..RHQ..R----ELALEV-
N1J4X2_BLUG1/150-556--------------F..PTAPSLRSFLSALS....TD..............PRPYKTFLPS..RDH..R----LVYIEM-
C4JQY3_UNCRE/143-586--------------F..PTMPSLPKMLAMLS....GT..............PRPYAYFIPS..REH..K----DVYYDI-
U4LL48_PYROM/132-582--------------F..PTMPGLEKMLGMLS....GP..............PRSFASFIPS..KDH..R----GAYLEI-
M4G219_MAGP6/120-591--------------F..PHCPPLPNILADLS....AA..............PRPYKFFCPN..KTI..R----AEYMRI-
I1RCJ1_GIBZE/98-519--------------F..PLAPPLPNFLAELS....QA..............PRPYKQFSPS..KAH..R----PTYLLM-
J7RBT2_KAZNA/205-696--------------F..SSLPSLAYFLSRLS...GSTSMENAQNGGTH...PRQFGALIPS..KEH..K----GAYLNA-
D5G9F0_TUBMM/127-587--------------F..PTLQPLPKLLTLLS....SK..............PKPFSAFIPS..RAH..R----PAYLEI-
I2G095_USTH4/203-726--------------F..PDMVPLPVFLSQLS....SS..............ARPLSTYFPS..RHQ..R----ELALDV-
C5FU53_ARTOC/156-599--------------F..PTLPSLPKMLSALS...CGS..............PRPYYSFIPS..RDH..K----EVYYEI-
H2AZX0_KAZAF/181-685--------------F..PSLPTLSYFLSKLS...GGKSSINTSKDGDDIKWPYSFNNIIPS..REH..K----GIYLDV-
V5ETE4_PSEBG/203-712--------------F..PDVAPLPVFLSQLS....SS..............SRAFYALFPA..RHQ..R----ELALDV-
W1QEY3_OGAPD/185-592--------------F..PNLPPLANFLSLIS.SSSSK..............PRPINTIIPS..KDH..R----DLYLDA-
S6E8H4_ZYGB2/281-781--------------F..PTLPSLPSFLQLLS...TGR..............PKPYGNIIPS..KEH..K----SIYLGA-
B6H909_PENCW/173-617--------------F..PTYPSLPKMLSTLS....GT..............PRPYSNFIPS..KDH..K----EIYFTI-
C5DHQ6_LACTC/242-731--------------F..PSLPPLPVFLSLVS...SMK..............PRAFGSIIPS..KDH..K----SVYLSA-
M1VZL7_CLAP2/99-559--------------F..PQAPTLPNFLSELS....QA..............PRPFKSFCPS..KPQ..R----PLYLSM-
M7TWW8_EUTLA/45-471--------------F..PLAPPLPNFLADLS....TA..............PRHYKWHSPS..KNH..R----PAYLAM-
G8YSZ2_PICSO/187-642--------------F..PTMPSLPHFLALLS.SPSKK..............PRQFASIIPS..KDH..K----DIYLLA-
L8FQS0_PSED2/113-539--------------F..PLAPPLPTLLSALS....HA..............PRPYKTFIPT..KTH..R----PIYTAM-
F8PYL6_SERL3/132-563--------------FPHPSIPHLPTILSNVSTATSKQSD............NHFFATVVQS..KEL..I----PLYHDV-
S8BNA5_DACHA/141-592--------------F..PALPPLPKMLSLLS....GK..............PRPYSAYIPS..KDH..R----QAYMEM-
J8Q1I2_SACAR/396-963--------------F..PLLPALPIFLNLIS...ADK..............PQAYNNIIPS..REH..R----PIYLNA-
A7TP53_VANPO/308-811--------------F..PSLPPLVSFLSLLS...NGK..............PHPFGTIIPS..KEH..K----PIYLGA-
D8PLZ6_SCHCM/127-556--------------FTDPSVASLPEILSLISTAPSKQSD............NHFYATVVQS..RDL..I----PIYHDV-
E9D3F7_COCPS/143-585--------------F..PTMPSLPKMLAVLS....GT..............PRPYASFIPS..RDH..K----GIYYDI-
H6BW23_EXODN/132-559--------------F..PMMPSLPKMLNSLS....GT..............PVPYGTLIPS..SDH..K----EEYYRV-
U1GT46_ENDPU/116-550--------------F..PTLPSLPKMLQALS....GI..............PRPYSSLIPS..KDH..K----QAYFRI-
C5DQJ7_ZYGRC/281-783--------------F..PTLPSLPSFLHLLS...NGK..............PKPYGNIIPS..KEH..K----SIYLGA-
B2ALS2_PODAN/100-533--------------F..PLVPALPSFLAELS....VA..............PRPYKLHCPS..KAH..R----PTYMAM-
G4U9V0_NEUT9/109-529--------------F..PLSPPLPNFLAELS....VA..............PRPYKLHCPS..KAH..R----PLYMAM-
R8BC65_TOGMI/105-536--------------F..PFAPPLPNFLADLS....AA..............PRLYKTFSPG..KSY..R----PAYLTM-
U7Q027_SPOS1/111-529--------------F..PFAPPLPDLLASLS....SA..............PRPYKSFCPT..KSL..R----PAYLRI-
G8BGC4_CANPC/198-622--------------F..PTLPSLPHFLKLLS.PKSRK..............PQQFAASIPS..RDH..R----DSYMRA-
E7A1P0_SPORE/203-720--------------F..PDVAPLPVFLSQLS....SS..............SRALSALFPA..RHQ..R----ELALDV-
G0RDM3_HYPJQ/95-507--------------F..PLAPPLSTFLAELS....VL..............PRPYKHISPS..KAH..R----PLYLRM-
K0KSM9_WICCF/157-573--------------F..PSLPSLPSFISLIS...TSK..............PRQYSAIIPS..RDH..R----DLYLEA-
M9MFA0_PSEA3/199-702--------------F..PELAPLPVFLSQLS....SS..............SRALSALFPG..RHQ..R----ELALEV-
J4HS73_FIBRA/136-569--------------FASSGVPPLSKLVSVVSMASQQQSA............NHFFATVVKS..KDL..I----PLYEDV-
G0VDK5_NAUCC/193-728--------------F..SSLPSLPILLSSISKNSEQN..............KMFFNNVIPS..KEH..K----PIYLGA-
E7KD88_YEASA/399-966--------------F..PSLPSLPIFLSLLS...TDK..............PQAYSNIIPS..REH..K----PVYLNA-
G4MPF6_MAGO7/119-567--------------F..PHCPPLPNILTDLS....AA..............PRPYKFFCPN..KTI..R----AEYMRI-
G8ZWI0_TORDC/270-767--------------F..PSLPSLISFLNLLS...CKK..............PKPFGSIIPS..KEH..K----PIYLGA-
S9VYA1_SCHCR/73-478--------------F..PSLPSLPTFLAILS....FK..............PRPFVSIIPS..KDH..E----STYLEM-
I2H4A8_TETBL/339-898--------------F..PSLPILPLFLNLLS...NGK..............PKPYGIIIPS..KDH..K----PIYLKA-
V5FG66_BYSSN/161-604--------------F..PTLPSLPKMLSALS....RT..............PRPYGSFIPS..NDH..K----EAYFSI-
G2R1J8_THITE/107-555--------------F..PLSPALPNFLAELS....VA..............PRPYKLHCPS..KAH..R----PVYMAM-
U5HEM2_USTV1/112-634--------------F..QDLPSLPVLLSKLSP...................SAPFSSVIPPDSRPL..R----TTYYNA-
F4P7C7_BATDJ/218-651--------------F..PQM.ELVRILQDLSI...................PRPYSAIAHS..KEN..R----NLYLEI-
G0WEJ7_NAUDC/230-810--------------F..PLLPTLENMLSIISNNGTGK..............VECFNNIIPT..REH..K----PTYLGA-
Q5KFU1_CRYNJ/231-746--------------F..PDLPPFPRFISAISLS..................PIPFRKVIPNPDPDHATR----EKYMSA-
S2K004_MUCC1/106-577--------------I..PNL.SLPVLLSKLSH...................AQQYHLVYHV..KEL..K----NQYLEA-
J5JA21_BEAB2/104-534--------------F..PLAPPLANLLSDMS....VC..............PRPYKTFCPS..KVH..R----PLYLRM-
C1GWB7_PARBA/96-533--------------F..PTLPSLPKMLHALS....DT..............PKPYSRLIPS..RDH..K----ETYYDI-
G0SXZ9_RHOG2/78-582--------------F..PNLPPLPVLLSQLSP...................AEPFASIVPS...AQ..R----ASYLNA-
R7YHW5_CONA1/139-553--------------F..PTLPPLMKMLERLS....GA..............PRPYGSFIPS..KDH..R----SAYMEI-
G8BZL7_TETPH/286-791--------------F..PSLPSLVSFLSLLS...NGK..............PRPFGTIIPS..KEH..K----PIYLGA-
K1XTL5_MARBU/117-531--------------F..PLAPSLSNFLATLS....VA..............PRQYKIHAPS..KDH..R----PTYLDM-
S8E9R2_FOMPI/133-565--------------FAEHDVPPLPKILSMVSMSIHQQSA............NHFYGTVVGS..KER..I----PLYQDV-
NPR3_EMENI/171-616--------------F..PTLPSLPKMLSALS....GT..............PRPYGNFIPS..KDH..K----ATYFLI-

PF06218

M3IIL9_CANMX/8-518KNTIFGNA...HTEVQVPTKTTLFYLYRSLNQ...................GQTVKEWYIQ--QSK--L....LANIDIR
M2UFV8_COCH5/4-472AHIAAQKKEEEEEKAIQTSHETLITLYTSLRQ...................GLTLKNWVLE--NLD--L....LSGIDVR
Q6BQE8_DEBHA/7-469KKKFSGET......TVIPSKASLFYLYRSLNQ...................GQTVKEWYMQ--HRK--Y....LNNIDVR
Q0U9Y5_PHANO/4-462SSPTAASTDDDKEEEWHIPHTTLIHLYTSLRQ...................GLTLKNWVLA--NLS--H....LPGIDVR
G3AQK3_SPAPN/8-551KTV..GNSPNISVNVKVPTKTTLFYLYRSLNQ...................GQTVKEWYIQ--HRK--L....LTSIDIR
W6RQZ3_CAEEL/186-593...TEIGADGSEIPTRTPEFSDVFRLYLSMKVVGPKLPIDESDSNRLRFQCGNNLAEWADL--EKP--R....SMGIDEQ
A5DQL3_PICGU/6-475ATTAKPRT......IHVPSKATLFYLYRSLNQ...................GQTIREWYVQ--HRK--Q....LQFIDVR
K1Y0B6_MARBU/2-405..................PNFYLCRLFTSLAT...................SRTVKEWLKL--HID--QGFPVLNFVDVR

PF03666

S8B047_PENO1/190-645--LAWLLRGGWVTQLRSFARV-----------------------------------------------------------
H1V255_COLHI/104-533--LAWLMRGAWVTQLCTFAYV-----------------------------------------------------------
G1WZV0_ARTOA/142-590--LAWLMRYGWVTNLLTFAYL-----------------------------------------------------------
C4QYA8_PICPG/201-611--VSWLLKKGYILQLHTFLFL-----------------------------------------------------------
K2SR44_MACPH/175-626--LAWLMRGGWVTQLRTFAWI-----------------------------------------------------------
R9P8J9_PSEHS/205-716--LIWLLRRDVVVKMHVRLRL-----------------------------------------------------------
NPR3_CANGA/243-797--LIWLIQKGYLTQLLTFVYI-----------------------------------------------------------
C0NJI2_AJECG/154-591--LAWLLRGGWVTQLRTFGWV-----------------------------------------------------------
G8JWB1_ERECY/316-852--LSWLIRYGYLTQLLTFVWI-----------------------------------------------------------
NPR3_PHANO/150-598--LAWLMRGGWVTQLRTFAWV-----------------------------------------------------------
B6QRZ0_PENMQ/156-593--LAWLLRGGWVTQLRTFSRV-----------------------------------------------------------
NPR3_KLULA/205-723--LAWLMRYGYLTQLLTFVYV-----------------------------------------------------------
B8N792_ASPFN/172-617--LAWLLRGGWVTQLRTFARV-----------------------------------------------------------
M7X5H8_RHOT1/78-583--LVWLLQHEVVEKQRTYVRI-----------------------------------------------------------
NPR3_DEBHA/205-647--LSWLIRYGYVTQLHTFIWL-----------------------------------------------------------
D6RLY8_COPC7/119-572--VLWMLKRELLITLHLRIRI-----------------------------------------------------------
V2XGE3_MONRO/83-521--VVWMLKRDMLTTLHLRIRI-----------------------------------------------------------
T5A616_OPHSC/95-514--LAWLMRGGWVTQLCTFGYV-----------------------------------------------------------
E9EL47_METAR/99-517--LAWLLRGGWVTQLCTFAYV-----------------------------------------------------------
NPR3_ASPFU/179-636--LAWLLRGGWVTQLRSFARV-----------------------------------------------------------
NPR3_ASHGO/273-791--LAWLIRYGYLTQLLTFVWL-----------------------------------------------------------
Q4PA65_USTMA/205-718--LIWLLRHEVVVKMHIRLRL-----------------------------------------------------------
N1J4X2_BLUG1/150-556--LSWLIRGGWVTQLRTFAWI-----------------------------------------------------------
C4JQY3_UNCRE/143-586--LAWLMRGGWVTQLRTFGWL-----------------------------------------------------------
U4LL48_PYROM/132-582--LAWLIRHSLVTELRTFAWI-----------------------------------------------------------
M4G219_MAGP6/120-591--LTWLMRGGWVTQLCTFAYV-----------------------------------------------------------
I1RCJ1_GIBZE/98-519--LAWLMRRGWVTQLCTFAYV-----------------------------------------------------------
J7RBT2_KAZNA/205-696--LSWLVRHGYVCQLLTFALI-----------------------------------------------------------
D5G9F0_TUBMM/127-587--LAFLIRHGLATQLRNFAWL-----------------------------------------------------------
I2G095_USTH4/203-726--LIWLLRREVVVKMHIRLRL-----------------------------------------------------------
C5FU53_ARTOC/156-599--LAWLVRGGWVTQLRTFGWV-----------------------------------------------------------
H2AZX0_KAZAF/181-685--LSWLIRRGYVTQLLTFVYI-----------------------------------------------------------
V5ETE4_PSEBG/203-712--LIWLLRREVVVKMHIRLRL-----------------------------------------------------------
W1QEY3_OGAPD/185-592--VAWLLRHGYITQLQTFLYL-----------------------------------------------------------
S6E8H4_ZYGB2/281-781--LSWLLRYGYVTQLLTFVCI-----------------------------------------------------------
B6H909_PENCW/173-617--LAWLLRGGWVTQLRTFARI-----------------------------------------------------------
C5DHQ6_LACTC/242-731--LAWLIRYGYLTQLLTFAWV-----------------------------------------------------------
M1VZL7_CLAP2/99-559--LAWLLRGGWVTQLCTFAYV-----------------------------------------------------------
M7TWW8_EUTLA/45-471--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
G8YSZ2_PICSO/187-642--LAWLIRHGYVTQLLTFIWL-----------------------------------------------------------
L8FQS0_PSED2/113-539--LAFLLRHGWATQLRTFAWI-----------------------------------------------------------
F8PYL6_SERL3/132-563--VLWMLKHELLLTLHLRIRI-----------------------------------------------------------
S8BNA5_DACHA/141-592--LAWLMRYGWVTNLLTFAFL-----------------------------------------------------------
J8Q1I2_SACAR/396-963--LAWLIKFGYATQLLTFINI-----------------------------------------------------------
A7TP53_VANPO/308-811--LAWLIRYGYVTQLFTYVCI-----------------------------------------------------------
D8PLZ6_SCHCM/127-556--VLWMLKRGLLIRLSLRIRI-----------------------------------------------------------
E9D3F7_COCPS/143-585--LAWLMRGGWVTQLRTFGWI-----------------------------------------------------------
H6BW23_EXODN/132-559--LAWLMRDGWVTQLRTFAFV-----------------------------------------------------------
U1GT46_ENDPU/116-550--LAWLLRGGWVTQLRSFAFV-----------------------------------------------------------
C5DQJ7_ZYGRC/281-783--LAWLLKYGYVTQLLTFVCI-----------------------------------------------------------
B2ALS2_PODAN/100-533--LAWLIRGGWVTQICTFAYV-----------------------------------------------------------
G4U9V0_NEUT9/109-529--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
R8BC65_TOGMI/105-536--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
U7Q027_SPOS1/111-529--LAWLIRGGWVCQLCTFAYV-----------------------------------------------------------
G8BGC4_CANPC/198-622--LAWLNRFGYATQQLTFIWL-----------------------------------------------------------
E7A1P0_SPORE/203-720--LVWLLRHDVVVKMHIRLRL-----------------------------------------------------------
G0RDM3_HYPJQ/95-507--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
K0KSM9_WICCF/157-573--LAWLIRHGYVTQLMTFVWL-----------------------------------------------------------
M9MFA0_PSEA3/199-702--LIWLLRRDVVVKMHIRLRL-----------------------------------------------------------
J4HS73_FIBRA/136-569--VIWMLKRDLLITLHLRIRI-----------------------------------------------------------
G0VDK5_NAUCC/193-728--LAWLIKHGYMTQLLTFIYI-----------------------------------------------------------
E7KD88_YEASA/399-966--LAWLIQYGYVTQLLTFINI-----------------------------------------------------------
G4MPF6_MAGO7/119-567--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
G8ZWI0_TORDC/270-767--LTWLMRYGYVTQLLTFVCI-----------------------------------------------------------
S9VYA1_SCHCR/73-478--LAWLCRRNWVYEQNSYIYV-----------------------------------------------------------
I2H4A8_TETBL/339-898--LSWLLRNGFVYQQLTFICI-----------------------------------------------------------
V5FG66_BYSSN/161-604--LAWLLRGGWVTQLRAFARV-----------------------------------------------------------
G2R1J8_THITE/107-555--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
U5HEM2_USTV1/112-634--LLFLLRNNLVEKQRTFVRL-----------------------------------------------------------
F4P7C7_BATDJ/218-651--ITFLLRKNLVVQLHMYIYL-----------------------------------------------------------
G0WEJ7_NAUDC/230-810--LAWLIRYGYVTPLLSFIYI-----------------------------------------------------------
Q5KFU1_CRYNJ/231-746--LLWLLKQDLVVQVHTRARV-----------------------------------------------------------
S2K004_MUCC1/106-577--ITYLIRKDLVVQLHMYLVL-----------------------------------------------------------
J5JA21_BEAB2/104-534--LAWLMRGGWVTQLCTFAYV-----------------------------------------------------------
C1GWB7_PARBA/96-533--LAWLLRGGWVTQLRTFGWV-----------------------------------------------------------
G0SXZ9_RHOG2/78-582--LVWLLQHEVVEKQRTYVRI-----------------------------------------------------------
R7YHW5_CONA1/139-553--LAWLMRGGWVTQLRTFAWV-----------------------------------------------------------
G8BZL7_TETPH/286-791--LAWLIRSGYLTQLLTYVCI-----------------------------------------------------------
K1XTL5_MARBU/117-531--LAWLIRGGWVTQLRSFAWI-----------------------------------------------------------
S8E9R2_FOMPI/133-565--VVWMLKRDLLLTLHLRIRI-----------------------------------------------------------
NPR3_EMENI/171-616--LAWLLRGGWVTQLRSFARV-----------------------------------------------------------

PF06218

M3IIL9_CANMX/8-518RFINFGILRGIIYRVYSYPLLNS...........................................ITSSIERDDTKTYD
M2UFV8_COCH5/4-472RLITFGVIKGFLYRHLQQQQQSSPHHLGAPKTEEAHHQLLHNSGIIDDRDTSG...........LPLLKFL..DGMHCFD
Q6BQE8_DEBHA/7-469RFINFGVIRGILYRVHSYPILNS...........................................LTKSLENKNDNELD
Q0U9Y5_PHANO/4-462RLITFGVIKGFVYRVHKYAIASTSAGSTAPPTSLA..........TSTREETGAEGMGMGTENALPMLRFL..DGLCCFD
G3AQK3_SPAPN/8-551RFINFGVLRGIIYRVHSYPLVNS...........................................LTRSIESGDLAQYD
W6RQZ3_CAEEL/186-593RLVQFGMHHQFLRKLSKYPICVANPGNNT.....................................LLKRC..NGKTSID
A5DQL3_PICGU/6-475RFITFGVLRGLIYRVHSYPISDP...........................................LVKAIESDTLQELD
K1Y0B6_MARBU/2-405RFIQFGIIKGLIYRVHKYAVSPA.................YVKSLVTGRNKVGGADL.........MLKYL..NGCHSFD

PF03666

S8B047_PENO1/190-645---------------KVSPEIKL-------
H1V255_COLHI/104-533---------------VVWPEIIY-------
G1WZV0_ARTOA/142-590---------------KIPKDIKV-------
C4QYA8_PICPG/201-611---------------IISKEIKM-------
K2SR44_MACPH/175-626---------------RVSPEVQA-------
R9P8J9_PSEHS/205-716---------------VATESVM.-------
NPR3_CANGA/243-797---------------RVDKKIKM-------
C0NJI2_AJECG/154-591---------------RVDPEIKR-------
G8JWB1_ERECY/316-852---------------RVDRRIKV-------
NPR3_PHANO/150-598---------------RVTPEIKA-------
B6QRZ0_PENMQ/156-593---------------KVTPEIK.-------
NPR3_KLULA/205-723---------------RVDKRIKI-------
B8N792_ASPFN/172-617---------------KVSPEIKM-------
M7X5H8_RHOT1/78-583---------------VASEEIKR-------
NPR3_DEBHA/205-647---------------KISRKIKM-------
D6RLY8_COPC7/119-572---------------VVTPEIKQ-------
V2XGE3_MONRO/83-521---------------VATAQLK.-------
T5A616_OPHSC/95-514---------------VVWPEIL.-------
E9EL47_METAR/99-517---------------VVWPEIL.-------
NPR3_ASPFU/179-636---------------KVTPEIKM-------
NPR3_ASHGO/273-791---------------RVDRRIKI-------
Q4PA65_USTMA/205-718---------------IATESVKR-------
N1J4X2_BLUG1/150-556---------------QVWPEIQY-------
C4JQY3_UNCRE/143-586---------------KVDPEVK.-------
U4LL48_PYROM/132-582---------------KIPRHIKQ-------
M4G219_MAGP6/120-591---------------VVWPEIIY-------
I1RCJ1_GIBZE/98-519---------------VVWPEIL.-------
J7RBT2_KAZNA/205-696---------------RIDRKIKI-------
D5G9F0_TUBMM/127-587---------------RVTRQIKR-------
I2G095_USTH4/203-726---------------IATENVKR-------
C5FU53_ARTOC/156-599---------------KVSPEVKS-------
H2AZX0_KAZAF/181-685---------------RIDKRIKI-------
V5ETE4_PSEBG/203-712---------------IATESVKR-------
W1QEY3_OGAPD/185-592---------------RITKEVKI-------
S6E8H4_ZYGB2/281-781---------------RVDRQIKM-------
B6H909_PENCW/173-617---------------KVSPEIKM-------
C5DHQ6_LACTC/242-731---------------RVDSRIKI-------
M1VZL7_CLAP2/99-559---------------VVWPEIL.-------
M7TWW8_EUTLA/45-471---------------VVWPEIL.-------
G8YSZ2_PICSO/187-642---------------KVSKKVKI-------
L8FQS0_PSED2/113-539---------------IAWPEIKY-------
F8PYL6_SERL3/132-563---------------VATSELK.-------
S8BNA5_DACHA/141-592---------------KIPKDIKV-------
J8Q1I2_SACAR/396-963---------------RVDKHIKM-------
A7TP53_VANPO/308-811---------------RVDKQIKM-------
D8PLZ6_SCHCM/127-556---------------VATRELKE-------
E9D3F7_COCPS/143-585---------------KVDQELKS-------
H6BW23_EXODN/132-559---------------RVGPEVKK-------
U1GT46_ENDPU/116-550---------------RIDSSIKI-------
C5DQJ7_ZYGRC/281-783---------------RVDRQIKM-------
B2ALS2_PODAN/100-533---------------VVWPEIIY-------
G4U9V0_NEUT9/109-529---------------VVWPEIIY-------
R8BC65_TOGMI/105-536---------------VVWPEIIY-------
U7Q027_SPOS1/111-529---------------VVWPEIQY-------
G8BGC4_CANPC/198-622---------------KIARKIKI-------
E7A1P0_SPORE/203-720---------------IATEAVKR-------
G0RDM3_HYPJQ/95-507---------------VVWPEIL.-------
K0KSM9_WICCF/157-573---------------KISNRIKL-------
M9MFA0_PSEA3/199-702---------------FATEAVKR-------
J4HS73_FIBRA/136-569---------------VATEELK.-------
G0VDK5_NAUCC/193-728---------------RVDKRIKM-------
E7KD88_YEASA/399-966---------------RVDKHIKM-------
G4MPF6_MAGO7/119-567---------------VVWPEIIY-------
G8ZWI0_TORDC/270-767---------------RVDKQIKM-------
S9VYA1_SCHCR/73-478---------------CVTPEIKE-------
I2H4A8_TETBL/339-898---------------RVDKQVKM-------
V5FG66_BYSSN/161-604---------------KITPEVKM-------
G2R1J8_THITE/107-555---------------VVWPEIIY-------
U5HEM2_USTV1/112-634---------------IASEAIKK-------
F4P7C7_BATDJ/218-651---------------SVPAR...-------
G0WEJ7_NAUDC/230-810---------------RVDKKIKM-------
Q5KFU1_CRYNJ/231-746---------------FAKSEIKV-------
S2K004_MUCC1/106-577---------------LVPPNK..-------
J5JA21_BEAB2/104-534---------------VVWPEIIY-------
C1GWB7_PARBA/96-533---------------RVSPEIKQ-------
G0SXZ9_RHOG2/78-582---------------VASEEIKR-------
R7YHW5_CONA1/139-553---------------RVSAKVK.-------
G8BZL7_TETPH/286-791---------------RIDSQIKM-------
K1XTL5_MARBU/117-531---------------LVWPEIIY-------
S8E9R2_FOMPI/133-565---------------VATEELKH-------
NPR3_EMENI/171-616---------------KVSPEIKM-------

PF06218

M3IIL9_CANMX/8-518ELMNKLKRKKSRR..KVNLGPHNDNLLKTK
M2UFV8_COCH5/4-472EICTDL.........GLAERVVEGKIRGM.
Q6BQE8_DEBHA/7-469KIIDLFKAKTNPNVYPVNESLANKSLLKSI
Q0U9Y5_PHANO/4-462QICVEL.........GVPERTVEGRVKGLG
G3AQK3_SPAPN/8-551EFLGSYKEKKSKK..KVKVKHTDESLLKTK
W6RQZ3_CAEEL/186-593ELSLQH.........NVDPEQLCSLLEETG
A5DQL3_PICGU/6-475EAMKEKIEKLKERT.KSNSHVNNPRVVRTP
K1Y0B6_MARBU/2-405QIVTEN.........NIGEPKIREHLRKIA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window