Sequence alignment for CL0435

PF03666

S8E9R2_FOMPI/133-565------------------------------------------------------------------GYSAEYLAGLLCPQ
C5FU53_ARTOC/155-599------------------------------------------------------------------GLKYDVWEKLLSPS
L8FQS0_PSED2/112-539------------------------------------------------------------------AFHTKDLASILTPA
H2AZX0_KAZAF/181-685------------------------------------------------------------------GFDSEFVAEFCCPD
R9P8J9_PSEHS/205-717------------------------------------------------------------------GYDIDILASILNPR
F8PYL6_SERL3/132-564------------------------------------------------------------------GYSSEFLASMLCPQ
N1J4X2_BLUG1/150-556------------------------------------------------------------------EFSTTDLESILTPS
E9EL47_METRA/99-518------------------------------------------------------------------GFPTRDLASILTPA
M9MFA0_PSEA3/199-702------------------------------------------------------------------GYDIEILASILNPR
NPR3_CANGA/243-797------------------------------------------------------------------EFDIDFLAELCCPS
H6BW23_EXODN/130-559------------------------------------------------------------------GLGEDGLANLLAPG
G8BZL7_TETPH/286-791------------------------------------------------------------------GFDSEFIAEVCSPD
G0WEJ7_NAUDC/230-810------------------------------------------------------------------GFDSDFVAEFCSPE
R8BC65_TOGMI/105-536------------------------------------------------------------------GFPTKDLESILTPG
V5ETE4_PSEBG/203-712------------------------------------------------------------------GYDIELLASILNPR
G8JWB1_ERECY/316-852------------------------------------------------------------------NFNSEFVAEICCPP
C4QYA8_PICPG/201-611------------------------------------------------------------------GFDINFLSEIVTPP
G8BGC4_CANPC/198-622------------------------------------------------------------------GMDPSYLCEMLAPP
G0VDK5_NAUCC/193-728------------------------------------------------------------------GFDSDFVAEFCSPE
S2K004_MUCC1/105-579------------------------------------------------------------------NIDVSFLADALAPK
NPR3_EMENI/170-616------------------------------------------------------------------GLPVDVWEKLLSPS
E7KD88_YEASA/399-966------------------------------------------------------------------EFDNDFVAEFCSPE
B8N792_ASPFN/172-617------------------------------------------------------------------GLQADVWEKLLSPS
U1GT46_ENDPU/116-550------------------------------------------------------------------GLDASALERLLMPS
D8PLZ6_SCHCM/127-556------------------------------------------------------------------GYNAEFLTNLLCPH
I2G095_USTH4/203-726------------------------------------------------------------------GYDIEILASILNPR
S6E8H4_ZYGB2/281-781------------------------------------------------------------------GFDPEFVAEFCSPE
NPR3_PHANO/150-598------------------------------------------------------------------GFKTDALEKMLSPG
U7Q027_SPOS1/110-529------------------------------------------------------------------GLPTKALEGILTPP
A0A0C4E2D4_MAGP6/120-591------------------------------------------------------------------GFPTKDLESILTPG
S8B047_PENO1/186-645------------------------------------------------------------------GLPGSVWEKLLSPS
C5DHQ6_LACTC/241-731------------------------------------------------------------------RFDKDFFAEISSPP
E9D3F7_COCPS/142-585------------------------------------------------------------------GLGTDVWEKLLCPS
U4LL48_PYROM/132-582------------------------------------------------------------------GFKTEFLADMLAPK
K2SR44_MACPH/175-626------------------------------------------------------------------GFKSEGLEKLLCPG
S8BNA5_DACHA/141-592------------------------------------------------------------------GFRHDVISGLLNVP
D6RLY8_COPC7/119-572------------------------------------------------------------------GYSGEFLASLLCPQ
U5HEM2_USTV1/112-634------------------------------------------------------------------GFPSTVLASLLSPS
G4MPF6_MAGO7/119-567------------------------------------------------------------------GFPTKDLESILTPS
A0A0D1CR33_USTMA/205-718------------------------------------------------------------------GYDIDILASILNPR
B6H909_PENCW/169-617------------------------------------------------------------------GVPGSVWEKLLSPS
NPR3_ASPFU/179-636------------------------------------------------------------------GLPADVWEKLLSPS
C5DQJ7_ZYGRC/281-783------------------------------------------------------------------GLDAEFVAEFCSPE
C4JQY3_UNCRE/143-587------------------------------------------------------------------GLATNTWEKLLCPS
E7A1P0_SPORE/203-720------------------------------------------------------------------GYDIEILASILNPR
G8ZWI0_TORDC/270-767------------------------------------------------------------------DFDPEFVAEFCSPE
C1GWB7_PARBA/152-590------------------------------------------------------------------GLPTSVWEKLLSPS
B2ALS2_PODAN/100-533------------------------------------------------------------------GYPTKDLENLLTPN
G0RDM3_HYPJQ/95-508------------------------------------------------------------------GFPARDLAYILTPA
B6QRZ0_PENMQ/155-594------------------------------------------------------------------GLPSEVWEKLLSPS
J8Q1I2_SACAR/396-963------------------------------------------------------------------EFDHDFVAEFCSPE
J7RBT2_KAZNA/205-696------------------------------------------------------------------GFDSEFVAEFCCPD
M1VZL7_CLAP2/99-560------------------------------------------------------------------GFPTRDLASILTPA
F4P7C7_BATDJ/218-654------------------------------------------------------------------GLDCEFLSDILSPK
NPR3_KLULA/205-723------------------------------------------------------------------NFNTEFVAELCSPR
A7TP53_VANPO/308-811------------------------------------------------------------------DFDAEFVAEFCSPE
NPR3_ASHGO/273-791------------------------------------------------------------------NFDAEFVAELCSPP
G2R1J8_THITE/107-555------------------------------------------------------------------GFPTKDLENILTPA
J5JA21_BEAB2/104-534------------------------------------------------------------------GFPTRDLASILTPA
V5FG66_BYSSN/161-604------------------------------------------------------------------GLTTDVWEKLLSPS
I2H4A8_TETBL/339-898------------------------------------------------------------------DFDSEFVAEFCSPE
G4U9V0_NEUT9/109-529------------------------------------------------------------------GFPTKDLENILTPA
J4HS73_FIBRA/136-570------------------------------------------------------------------GYPAEFLAGMLCPQ
A0A098D4P8_GIBZA/98-520------------------------------------------------------------------GFPARDLAGILTPA
R7YHW5_CONA1/139-554------------------------------------------------------------------GFNIESLEKLLSPP
Q5KFU1_CRYNJ/229-746------------------------------------------------------------------GWPLEVLADMLTPP
W1QEY3_OGAPD/185-592------------------------------------------------------------------GFDVDFVSELVTPP
H1V255_COLHI/104-533------------------------------------------------------------------GFPTKDLASILTPG
T5A616_OPHSC/95-515------------------------------------------------------------------GFPTRDLAGILTPA
D5G9F0_TUBMM/127-587------------------------------------------------------------------GFKEEFLAGLLAPK
M7TWW8_EUTLA/45-472------------------------------------------------------------------GFPTKDLESLLTPA
G0SXZ9_RHOG2/78-582------------------------------------------------------------------GFPDPVLASLLTPS
C0NJI2_AJECG/153-591------------------------------------------------------------------GLPTNVWEKLLSPS
G1WZV0_ARTOA/142-590------------------------------------------------------------------GFRHNVLAGLLSVP
M7X5H8_RHOT1/78-583------------------------------------------------------------------GFPDPVLASLLTPS
NPR3_DEBHA/205-647------------------------------------------------------------------GFEADYLCEMLCPP
K0KSM9_WICCF/157-573------------------------------------------------------------------GFDAEFLGEFLSPP
S9VYA1_SCHCR/73-478------------------------------------------------------------------GYEKGFLANMLSPR
K1XTL5_MARBU/116-531------------------------------------------------------------------DFYTTDLESILTPS
G8YSZ2_PICSO/187-642------------------------------------------------------------------GYEPDYLSEMLCPP
V2XGE3_MONRO/83-522------------------------------------------------------------------GYSSEFLAGILCPH

PF06218

M3IIL9_CANMX/8-518IPIVAIFYSVFHPIEGTKIVHQFPENTISTGRKRK................DDTEEEDNEDNEDEGIFEFDTIRNYVIPK
M2UFV8_COCH5/4-472RAIKAIFYTRFHHEKGNRVLHQVPPGAIIPSTL..........................PSALTTPLFPFSSVTQYLIPT
Q6BQE8_DEBHA/7-469VPITAIFYAVFHPTEGTKVLNQVPEGSIGNSS...........................TSDSNGIIFNFDTIKNYIIPK
Q0U9Y5_PHANO/4-462RAIEAIFYTRFHHEKGSRVLHQVPPGSITPSPKPS........................KSDLAETLFPFSSVTSYLIPS
G3AQK3_SPAPN/8-551IPIVAVFYAVFHPTEGTKIIHQVPENSIVTTSHQRTKVVKNVSRLSMDSTNSDSRQRQEDEDEDDGLFNFDTVKNYVIPK
W6RQZ3_CAEEL/186-593..LLGILLAEFHNTLGAIIKHSVPK..................................ENNKVEATFHFT..KGLIIPK
A5DQL3_PICGU/6-475EPITAVFYSVFHPTEGTKIVHQVPDV.................................ISRDQPSLFDFDAVRNYVIPK
K1Y0B6_MARBU/2-405..IQGIFFARFLSEKGTKVVHQSPPGCIVAE............................PDVDKARLFDFEVLAEYIIPR

PF03666

S8E9R2_FOMPI/133-565.DSMCHQKFELVV--DDLAFIGHPVCAEPDG...SWRFKPKVI.......................NRGRGSRKGEAPKL
C5FU53_ARTOC/155-599.PAWHKRRFEVGV--NDLTFVGWPVFVRKDG...TWRKK...........................KKKKKEKEKEKGKT
L8FQS0_PSED2/112-539.RAFHKRCFELTL--DPLTFVTYPMHIREDG...RWKKK...........................KREK..........
H2AZX0_KAZAF/181-685.RELCNSRFEFTV--DDLCFLGLPIRRDASG...YWRKSKR.........KKHT............SKKSSSLSHAKVTR
R9P8J9_PSEHS/205-717.TALAHQKFELVV--DDLAFLGHPVAAHPER...GWDEEGNE..TLQSDRDSQGETSTAQSQ....QRGRSGLRKEIRPF
F8PYL6_SERL3/132-564.RSLCHQKFELRI--DDLVFLGHPVGAESDG...SWRFKSEKLKSG....................SRGRGSRNRDATQQ
N1J4X2_BLUG1/150-556.RAYHKSRFEMIL--DPLCFLTYPVHIREDG...RWKKRMT.........................KKSQRTRRKV....
E9EL47_METRA/99-518.RSYHKKLFQLSL--DPVHCISYPIHVPENG...KWKRH...........................KKSN..........
M9MFA0_PSEA3/199-702.PELAHQKFELIV--DDLAFLGHPVAASKAG...TWGEPDNH.DGHPGATDSDDAHAAAPSQ....RRGRSGLRKEIRPY
NPR3_CANGA/243-797.REMCNTRFELTV--DEYCFLGHPIHVDSSG...NWRKSRK.........RNN.S...LSKS....KRSGSLTGSRKRSG
H6BW23_EXODN/130-559.RAWHKRKFELGI--NDFTFLGRPVYAREDG...LWRKP...........................KSKKSSRAEDDSVQ
G8BZL7_TETPH/286-791.REMCNTSFEFTV--DNLCFLGLPIHSDKDG...NWRTSKN.........KSN......RKS....AKTSST..HSKGSR
G0WEJ7_NAUDC/230-810.REMCNTRFEFTI--DELCFLGLPVHIDSDG...KWRKSRHS........KRRQG...SVKS....KKSSSGRSSSSNFK
R8BC65_TOGMI/105-536.RAYHKGLFQISL--DPLICVSYPIYAPENG...IWKKKSKK........................KKKK..........
V5ETE4_PSEBG/203-712.QELTHHKFELMI--DDLAFLGHPVSLDRSD...ILGGQDDE....DADAEGHDRSAG........QRGRSGLRKEIRPY
G8JWB1_ERECY/316-852.KDMCNTRFEFTI--DESCFLGLPIHVDESG...RWRKRRN.........RKTPL...NTRS....KRSESGGAVNTTDT
C4QYA8_PICPG/201-611.KKLCNTRFELTV--DEMVFLGLPIHPKSS....RYKKS...........................DRNSHSHHSHSHHS
G8BGC4_CANPC/198-622.AAMCNARFEMMI--EGKTFLGLPIHKSIDG...GWKTRAI.........................SNSKHATQGGTRSR
G0VDK5_NAUCC/193-728.REMCNNKFEFTV--DEFAFLGLPVHVDSNG...KWRRQRH.........KRHNATTKSVKS....KKSSSGGSLTSRQK
S2K004_MUCC1/105-579.SPLCDRKFQLSM--DDLTFVGHPVSLSSPQQQQQQQQQQQQQQQQQQQSMDAEDHDADFLTSPLSPNPTSQLNSPTTQS
NPR3_EMENI/170-616.RSWHKRRFELGI--NDLAFVGWPVFVREDG...NWRKQ...........................RRKKKKKQRAE...
E7KD88_YEASA/399-966.REMCNTRFEFTV--DNFCFLGLPIHVDSQG...RWRKSKH.........KNK......TRS....KRSSST..TTNISR
B8N792_ASPFN/172-617.RSWHKRRFEVGI--NDLAFVGWPVFVREDG...TWRKQ...........................RRKKKKTKPE....
U1GT46_ENDPU/116-550DRSWHKRKFEVGF--NDLVFVGWPIFIREDG...TWRKK...........................RRKERVNTVKAEDN
D8PLZ6_SCHCM/127-556.VSMCHQKFELIV--DELAFIGHPVCAYPDG...TWKFKPEVGKGL....................NRGRGSRNRQMSSA
I2G095_USTH4/203-726.PELAHQKFELIV--DDLAFLGHPVSAGKAG...TWGDPENNRDGNDKDADDDNDRSKAQTQ....QRGRSGLRKEVRPY
S6E8H4_ZYGB2/281-781.REMCNTRYEFTV--DTLCFLGLPIHVDQHG...NWRKSKR.........KKQ.....MTRS....KRSSST..TTRISK
NPR3_PHANO/150-598.KEFNKRRFELGV--ESIVFVGAPMFVREDG...LWKKL...........................KRRKKKRSDKEKLD
U7Q027_SPOS1/110-529.RAFHKKRFQMSL--DSVTYISYPVHVPSNG...VWARR...........................RNAT..........
A0A0C4E2D4_MAGP6/120-591.RAYHKTLFQLSL--DPIYCVSYPIHVPESG...SWKKR...........................KKKK..KKNELK..
S8B047_PENO1/186-645.RSWHKKRFEVGI--NDLALIGWPVFVREDG...TWRKQ...........................RRKKKKKKSAPE..
C5DHQ6_LACTC/241-731.KEMCNTRFELTI--DELALVGLPIHRNADG...QWRKTKK.........RKS.....SSRS....KRSNSSSRTRKVSR
E9D3F7_COCPS/142-585.SSWHKRRFEVGV--NDLTFVGWPVFVREDG...TWRKK...........................RKKKK..TRAGDSV
U4LL48_PYROM/132-582.AAAARGRFEMSV--DDIVYIGMPVHVRPDG...TWRRS...........................RKRKKKGDVEEDDD
K2SR44_MACPH/175-626.RGFNKRKFEVGM--EGLSFLGHPMFAKGNG...AWRKR...........................KKRANASQEDVRPN
S8BNA5_DACHA/141-592.RALSRTRFELSV--EQFVFLGYPCYNRPDG...TWQRR...........................RREKKPKPETPKTD
D6RLY8_COPC7/119-572.SNKCHQKFELIV--DDLAFLGHPVAANERG...EWEFRPEPTKGS....................VRGREGKEKKAKEG
U5HEM2_USTV1/112-634.RELCDQPFELVV--DHLAFVGHPVWLGDDEPSTGLNRGPAGGRAQHRGDLHGHGSDSDSEEDGGERRGRTRRRPPPPNQ
G4MPF6_MAGO7/119-567.KAYHKKLFQISL--DPIYCVSYPIHVPENG...IWKKK...........................KKKKDQEPK.....
A0A0D1CR33_USTMA/205-718.PELSHKKFELVI--DDLAFLGHPVTPNKNG...VWGDQDDE..SQDDRVEARDEKTAAHAQ....QRGRSGLRKEIRPY
B6H909_PENCW/169-617.RSWHKRRFEVGI--NDLALIGWPVFVREDG...SWRKQ...........................RRKKQKKPRAE...
NPR3_ASPFU/179-636.PAWHKRRFEVGI--NDLAFIGWPVFVREDG...TWRKQ...........................RRKKKKKRRAD...
C5DQJ7_ZYGRC/281-783.REMCNTRYEFTV--DTLCFLGLPVHVDQHG...NWRKSKR.........KKH.....TTRS....KRSSST..TTRLSK
C4JQY3_UNCRE/143-587.SSWHKRRFEVGV--NDLAFVGWPVFVREDG...RWRKK...........................WKKKKKKTPAGYTV
E7A1P0_SPORE/203-720.PELAHQKFELVV--DDLAFLGHPVAATKGG...TWSDESDEGKDNDKDGHGSNDKAAAQAQ....QRGRSGLRKEIRPY
G8ZWI0_TORDC/270-767.RELCNTRFEFTV--DEICFLGLPIRVDADG...QWRKSRR.........RKQ.....SNRS....RRSNST..AGRNSK
C1GWB7_PARBA/152-590.PAWHKRKFEVGV--NDLVFVGWPVFVREDG...TWRKR...........................KRKKRTRKKE....
B2ALS2_PODAN/100-533.RAYHKRLFRVSL--DNIYCVSYPIYVPENG...MWQKK...........................KRKK..........
G0RDM3_HYPJQ/95-508.RPYHKKIFQLSL--DPLLCISYPIHVPENG...KWKKT...........................KKAN..........
B6QRZ0_PENMQ/155-594.RAWHKRRFEIGI--NDLAFVGWPVFVRDDG...HWRKKSR.........................RRKRKKTKSGGEGK
J8Q1I2_SACAR/396-963.REMCNTRFEFTV--DNFCFLGLPIHVDSQG...RWRKSKH.........KNK......TRS....KRSSST..TTNISR
J7RBT2_KAZNA/205-696.RELCNTKFEFTI--DQLAFLGLPIHCDSKG...KWRKSKH.........KRQFS...........RKLTNSTSHGNLSR
M1VZL7_CLAP2/99-560.RSYDKKLFQLSL--DPIHCISYPIHVPEDG...KWKRN...........................KKIH....KANKLN
F4P7C7_BATDJ/218-654.VALCDKQFHLTV--DNVDFVGHPTLLNADRPGTGLRFARM.........................VQKRKLIASATSYR
NPR3_KLULA/205-723.KEMCNTRFEFTV--DDLCFLGLPIHADHKG...RWKKSKK.........RKQAS...........KRSARSSTARNSIS
A7TP53_VANPO/308-811.REMCNTNFEFTV--DNLSFLGFPIHIDADG...NWKKSKK.........KKS......TRS....KRSSSI..YTKDDR
NPR3_ASHGO/273-791.KEMCNTRFELTV--DDLCFLGLPIHVDESG...RWRKQKV.........KRQQT...NTRS....KRSSSGGKPDAGSR
G2R1J8_THITE/107-555.RAYHKRLFQVSL--DPVHCVSYPIYVPENG...VWRKK...........................KSKK..........
J5JA21_BEAB2/104-534.RPYHKKLFQLSL--DPLLCVSYPIHVPESG...KWKRV...........................KKSK..AG......
V5FG66_BYSSN/161-604.RTWHKRRFEVGI--NDLSFVGWPVFVRDDG...TWRKQ...........................KRKKKKPRAE....
I2H4A8_TETBL/339-898.REMCNTKFEFTI--DKFCFLGLPIHVDEEG...NWKKSKK.........KKH.....SSRS....KRSSSI..GTKCSV
G4U9V0_NEUT9/109-529.RAYHKRLFQVSL--DSLYCVSYPIYVPENG...VWRKK...........................SKKQ..........
J4HS73_FIBRA/136-570.SSMCHQRFGFVV--DDLVFLGHPVCAEPDG...TWRFKPEKNKLA....................PRGRVSRKGETPQS
A0A098D4P8_GIBZA/98-520.RSYHKRLFQLSL--DPLYCVSYPIHVPENG...RWKKP...........................KKTS..RT......
R7YHW5_CONA1/139-554.RGFNKRRFEVGL--EGLVFLGAPMFVRADG...LWKKK...........................RRRHSERRDHQAAC
Q5KFU1_CRYNJ/229-746.RSACNRRFELCV--GNVVFLGHPVCATPDG...KWEAPPDEDELEERAP................SRGRRMRDQGGTMT
W1QEY3_OGAPD/185-592.KQLCNSRFEVSV--EDMAFLGLPIHVNEDG...NWRVSSHAKS......................RRKKTSRRKKVSSS
H1V255_COLHI/104-533.RAYHKKLFQLSL--DPLYCVSYPIHVPESG...TWKKK...........................KKKK..........
T5A616_OPHSC/95-515.RSYHKSLFQLSL--DPLLCISYPIHVPDNG...KWKRP...........................KRAD..........
D5G9F0_TUBMM/127-587.ERMCRAKFELSI--DDMVFLGYPLHVRPDG...TWRKQ...........................KKKRGRGRSGSGGG
M7TWW8_EUTLA/45-472.RSFHKKRFQVSL--DQLFFVSYPVFVPENG...IWRKT...........................KKKK..........
G0SXZ9_RHOG2/78-582.RELCDQPFELVV--DHLAFVGHPVWLGDDE...GPRERLDGAANEAGEQEKRETETEDDED....ERGRSRLSRKGSMA
C0NJI2_AJECG/153-591.PAWHKRRFEVGV--NDLVFVGWPVFVKDDG...TWRKR...........................KRKKKVRTQQ....
G1WZV0_ARTOA/142-590.RALAKSRFELSV--DHSVFLGYPCYSRIDG...TWQRK...........................KKERKIKSEGPKGE
M7X5H8_RHOT1/78-583.RELCDQPFELVV--DHLAFVGHPVWLGDDE...GPRERLDGAANETGEQEKREADTEDDED....ERGRSRLSRKGSMA
NPR3_DEBHA/205-647.KQMCNSRFEIMI--DDLVFLGLPIHSYDNG...SWKSKHS.........................HRPKSGKSSKGRSK
K0KSM9_WICCF/157-573.KRLCNSRFELTV--DDMAFLGLPIHKNDDG...LWRNHKS.........................KRDQKSKHSGNTSG
S9VYA1_SCHCR/73-478.PELCNQKFEMWV--DGLTFLGCPVHIGPSG...EWVKR...........................KNPPKNVEVSSLVD
K1XTL5_MARBU/116-531.RAYHKKRFELSL--DPLYFVSYPMHVYPNG...LWNKKL..........................KKSKKSKGVDTETK
G8YSZ2_PICSO/187-642.RQMCNSRFEIMI--DDLIFLGLPIHSFEDG...SWRQSDS.........................KRVASRISSKIKYK
V2XGE3_MONRO/83-522.ASMCHQKFELVV--DDLAFIGHPVCAEAGG...IWHFKQEKPKVS....................SRGRESHNRPTSRN

PF06218

M3IIL9_CANMX/8-518-PQLCNRLISLKI..DKYKVIGYPVNMENSY-------------------------------------------------
M2UFV8_COCH5/4-472-QQFCDRLLTFCV..NHHRVIGYPVCIREGK-------------------------------------------------
Q6BQE8_DEBHA/7-469-PKLCNKLISIKI..DRFKVLGYPVNIENEK-------------------------------------------------
Q0U9Y5_PHANO/4-462-QHFCDRLLTFVV..NHHRIIGYPVCIQGAK-------------------------------------------------
G3AQK3_SPAPN/8-551-PQLCNRLISFKI..NKYKVIGYPVNMENPR-------------------------------------------------
W6RQZ3_CAEEL/186-593-PSMFRNSFSLTIKSLRCKVLMFPVGIDHKS-------------------------------------------------
A5DQL3_PICGU/6-475-PQLCNKLVSFKI..GRYRVMGYPVNIENTD-------------------------------------------------
K1Y0B6_MARBU/2-405-QGFCNRFVTICCPENKYRILGHPVCIQDEK-------------------------------------------------

PF03666

S8E9R2_FOMPI/133-565AETSLTPDRVERHKR.................................................................
C5FU53_ARTOC/155-599DRKKHGGNGSISGLGAAISAGEASMSVPLVSIPGDAHDDATNDDS...................................
L8FQS0_PSED2/112-539........................RSRRRKEEEERQENGSIADDT...................................
H2AZX0_KAZAF/181-685SSSNRSESSKRTQSSNTAKAYPNSNSDVEQENNEESLD..........................................
R9P8J9_PSEHS/205-717DPPNGIDGSND........GTDISASTGAKSRHASRTRIEKPDD....................................
F8PYL6_SERL3/132-564DDGKSEISSIAEKG..................................................................
N1J4X2_BLUG1/150-556........................ASNRDIKNRQVVNNERGNEDN...................................
E9EL47_METRA/99-518..................................KAKAPRLSEEN.........................LAPHETEPPT
M9MFA0_PSEA3/199-702DVPDGQTPAKEPDADSAKKGKSEPKTSDTE..................................................
NPR3_CANGA/243-797SKSSNHDKSFSAETPNSPESSKIIEEVGSLHKSRTLSNPQN.......................................
H6BW23_EXODN/130-559Q.......................SSDTANGSDSDKDEEAPADDE...................................
G8BZL7_TETPH/286-791RHSINSKESTSKTN.........................EDENIE...................................
G0WEJ7_NAUDC/230-810RSRKRSISLHRSKSRRSEDSDPEVADDEGIENNINQNNNNDIVDN...................................
R8BC65_TOGMI/105-536........................SKTSRKGEEEVAPDIEPRDDA.........................PAPTEEDHVE
V5ETE4_PSEBG/203-712DVSDGGDASKDAACSLRQNGGKTEAAAPTKARNASQTRMEQTSD....................................
G8JWB1_ERECY/316-852SLGRAGSSGSKAHEELQQNEQQQQNIDSDLGEGLGIPVKSDQGGG...................................
C4QYA8_PICPG/201-611RATSLDEDEFEVKPLLDSLNDLHF........................................................
G8BGC4_CANPC/198-622SNSKPLDPKTKPSHNVPDGKIE..........................................................
G0VDK5_NAUCC/193-728R.RQKSTSLSNTNTI...........DEGYE.............T...................................
S2K004_MUCC1/105-579TPSTPSQQPLTSPASYNTSSNKRTLPNDDTNGDTSNDDDDDDEND...................................
NPR3_EMENI/170-616........................WESGELGHNDATEDSQDDGND..................................A
E7KD88_YEASA/399-966KKSIASKISSLSENILKKVNSGEADTVY...........DSNIGH...................................
B8N792_ASPFN/172-617........................WEGGELGHNEIPGDVRDDADE..................................A
U1GT46_ENDPU/116-550RVDSSLEV................VHKGEYATEDELNHERHVDLE...................................
D8PLZ6_SCHCM/127-556TNDDADPSDAHPAEH.................................................................
I2G095_USTH4/203-726DLQDGEETSKDSTAPTSAKNDKAELQSSAKSRSISQSCMELTTDS...................................
S6E8H4_ZYGB2/281-781QR......SNVSQ...PEGSNNGTGLARIEGSPTRDHDEDSQSGD...................................
NPR3_PHANO/150-598DADFVKNLTISEEDEEADTVDEIPVKSKP....................................EPFVYPEGFEPGYGH
U7Q027_SPOS1/110-529..................................DKNNSKAKDKA.............................ASTRGA
A0A0C4E2D4_MAGP6/120-591........................KKASVFSSGSLFSTIRDPDAHHDSDAARQLGESVRLAAKAGSDTVGLSPLAGDGSS
S8B047_PENO1/186-645........................WDGGELGHNENSEDGQGEDDL..............................TATPD
C5DHQ6_LACTC/241-731SHYEGTDVTG.............................DSEILE...................................
E9D3F7_COCPS/142-585LDTAPTLGSEKGGYADG.......GEKLESERDPNVDGRSDNDEE...................................
U4LL48_PYROM/132-582P.......................DEDGDEGENEGYAPEQEEEGQ....................EGEEVEKGVEDLSIE
K2SR44_MACPH/175-626NGHQDADGPY..............ESGAPADTEDEGVNVTGPEDG....................MPIDLPPGFEPGYGH
S8BNA5_DACHA/141-592ETKDQE..................DDTADAVNDEGDITGNDADDE...................................
D6RLY8_COPC7/119-572EGSGKSKSPNPASALAPENGKEGVASSTTTTTAAV.............................................
U5HEM2_USTV1/112-634GPFANLSGDFSRSSSEELGSGSGSLASNPATPPARPTPMMRNSSS...................................
G4MPF6_MAGO7/119-567........................RKGSIISAGGIMVSATDEDGN.......ELPPLNPDHIRPVIDTTRLSPHAQDGSG
A0A0D1CR33_USTMA/205-718DPSDDRVASND........KIDKSAKTGAKSRNASLTRIEQTND....................................
B6H909_PENCW/169-617........................WDGGELGHNDSAEEGKKDEQL..............................VTSPD
NPR3_ASPFU/179-636........................WEGGELGHNENAEDAPDDEDG.......................DAGGNASGGGGL
C5DQJ7_ZYGRC/281-783QR......SSLSQNGDGESGENDMDSSQLRSSSHNLQDDNGEINE...................................
C4JQY3_UNCRE/143-587LDEA.SLGADYDGHTND.......GEDYEAEHSHNMPDQPDNDDE...................................
E7A1P0_SPORE/203-720DLPDGSDNLDKAPAASDKQAANKDTTPSAKSRNVSQTRMEPTHDA...................................
G8ZWI0_TORDC/270-767RG......SSVKNSEFNETN....DTADIESSVLNL...DESTGY...................................
C1GWB7_PARBA/152-590........................ASTEQDLRDGDERRYEKRDDG...................................
B2ALS2_PODAN/100-533.........................KQEQEQHQAESGPGAKEDDA..........................LPTETDTGF
G0RDM3_HYPJQ/95-508.......................................KEVDDN.........................IAPDEPN.PP
B6QRZ0_PENMQ/155-594QHGSGEAKIGQDDDDANLNSDNDVPDSTQSSRDEDNADKTDIEDN...................................
J8Q1I2_SACAR/396-963KKSIASKISSLSENTLKKVNSGEAETDY...........DNNTGD...................................
J7RBT2_KAZNA/205-696KGHSVGSRRSKNENDLERRMTRVDTLEPDDEMISSHIG..........................................
M1VZL7_CLAP2/99-560RANKTNKTSKANKAGKNSRTNKANKTSKTSKASKASKSSRHTADY........................QLAPHEAETPM
F4P7C7_BATDJ/218-654QSLGEIDSSSTFTAAVSDPSSSCVSEDKPSANAFSSKLPSPVDHH...................................
NPR3_KLULA/205-723RNSVGRNSIGRNRSKTESQGHINDVEEPADDENSDYEPSKSEMLN...................................
A7TP53_VANPO/308-811........KSITQSPMINNNN.........SSDVEEEDDDYKYKE...................................
NPR3_ASHGO/273-791TSVGLPHGTQERQPSTDQSGSGAPYLAQSSSESGQLRDPEQSDDV...................................
G2R1J8_THITE/107-555................PRNQPPQSQQHREPGVGPGTGAAKKDDDD.........................ALPTDAGASA
J5JA21_BEAB2/104-534....................................RASSAVDDD.............AQVAWRAPLIAVSAPCAPSAPA
V5FG66_BYSSN/161-604........................WEGGDLGHEDQLDKSQPEEGD..................................T
I2H4A8_TETBL/339-898NNHSTTANTNTDITRRRENSDLTPFISDTTEKDLVTKLNDTISVE...................................
G4U9V0_NEUT9/109-529....................................QKHRDHDDT..........................APTDTDGPA
J4HS73_FIBRA/136-570VEKPLTPDRAEKHRR.................................................................
A0A098D4P8_GIBZA/98-520...................................EKRSTYNDEQ.........................LAPHEAG.PA
R7YHW5_CONA1/139-554DQDEAAQATDGR............PQTDGPSDEDEGVNMRGGEEP...................................
Q5KFU1_CRYNJ/229-746NLDTVDEGIEAYTSAITKFASIESETKRSSQSNH..............................................
W1QEY3_OGAPD/185-592SESSGEDDESDHGEK.................................................................
H1V255_COLHI/104-533.............................KGKTERAKSVRTEESA.....................VLVDFDPNEDNEDT
T5A616_OPHSC/95-515..............................KARTSSAASKQPDDH.........................VYPHETEVPP
D5G9F0_TUBMM/127-587DDDGNVGVEGNPDVGGIIIGNGGHEDDADDEKDDEDGESSQGGNF...................................
M7TWW8_EUTLA/45-472........................QPQSQPSRPPENGDAVNRSDH........................SPAPQPDTLQT
G0SXZ9_RHOG2/78-582EGAA.EDDDDARRADRDQTVGPPASREASLPPHARALLIPERDDS...................................
C0NJI2_AJECG/153-591........................GENGEPGVEDKERGDLRNNDM...................................
G1WZV0_ARTOA/142-590EEK..E..................VHTSDVDNDDEDTKGNDADDE...................................
M7X5H8_RHOT1/78-583EGAAEEEDDDARRVDRDQTVGPPASREASLPPHARALLIPERDDS...................................
NPR3_DEBHA/205-647NAADNASIDEGIDYETTS..............................................................
K0KSM9_WICCF/157-573NNTRSGSTKGESETEDATSGPEVENIQDEKSNFSKTEN..........................................
S9VYA1_SCHCR/73-478PFGIKEDSTSAASANLSELKIN..........................................................
K1XTL5_MARBU/116-531ASSK....................TRSVQSDGKDRSTSATSAENA...................................
G8YSZ2_PICSO/187-642SQEDDKSKKSSNENNAQDNPP...........................................................
V2XGE3_MONRO/83-522DSAPRNDSSPSRSPSNEKSVAV..........................................................

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

S8E9R2_FOMPI/133-565......................................PLPDPSWLQTFHLVLVLDRPDPS......SSTSGTIWKYFDT
C5FU53_ARTOC/155-599...............................DELSEEEQLTIKDGMTMFNVVFVLN.PPTL......EYNVR.....IRE
L8FQS0_PSED2/112-539......AISESP..AERSGAEDEARNVRKPKGTSFASDDTND.GGMTMFNLVFIMN.PKTT......EAPMR.....VSD
H2AZX0_KAZAF/181-685......................................KDDLERNMNMFHICFVLN.PPLT......EYNKR.....ADD
R9P8J9_PSEHS/205-717....................................APSSRAKAPLTQFHLVLVLDRPDPSTALPTMDLSSW.....LQL
F8PYL6_SERL3/132-564......................................PPAQSLWLQMFHFVIVLDLPDPS......SSASGNVAKYFDV
N1J4X2_BLUG1/150-556....................................LSEDSDDGGMTMFNAVFILD.VSKY......DLKEK.....ASE
E9EL47_METRA/99-518PS....VVISSE..PARDKDG.........KKD...DVDEEKRSSMTMFNLVFILN.PKKS......EDKEL.....VDA
M9MFA0_PSEA3/199-702....................................APASKAAAPLTQFHLVLVLDRPDPSTAMSGMDLSSW.....LQL
NPR3_CANGA/243-797.......................................DHFTKDMTMFHVCFIMD.PNLI......EYNKR.....VDD
H6BW23_EXODN/130-559.......................THAVKDKAETKEHRTVEPPKSQLTMFHAVFVMD.PPPL......EHTLR.....VKD
G8BZL7_TETPH/286-791......SSENHD..DEDDKSYMNPIAMHDLN.......SPDYEKNMNMFHVCFVMN.PPIS......EYNQR.....VDD
G0WEJ7_NAUDC/230-810......GDDKTV..E.....DSVEQVGECD........KNNFDKNMNMFHVCFIMN.PPLT......EYNKK.....TDD
R8BC65_TOGMI/105-536VR....DMAAPP..PSKVPAA...............EEAEDKVSSMTMFNLVFILN.PQKH......EAKEM.....VEL
V5ETE4_PSEBG/203-712....................................SSVSRSYAPLTQFHLVLVLDRPDPSTAMHGMDISSW.....LQL
G8JWB1_ERECY/316-852......GYEHEG..KT...........QRDD.......NEEMQKAVNMFHVCFIMN.PQLV......EYNER.....VDD
C4QYA8_PICPG/201-611......................................IESEKCPMHMFNLVFVMN.PPVV......EYNHR.....VDE
G8BGC4_CANPC/198-622......................................IEDSKSNLNMFHLVFVMN.PPTM......ENNYR.....IDE
G0VDK5_NAUCC/193-728......GDEKTD..HMRARMSDVEQSEMDD........INDLDKNMNMFHVCFIMD.PPLT......EYNKR.....VDD
S2K004_MUCC1/105-579..............................DESASDTFPSSTSIHMTLFHVVFVMT.PPDL......ELNAQ.....VET
NPR3_EMENI/170-616VAASTETLSPFS..ALHPISQRPSVPNSRSSQMSSEPLDADDKDMMTMFNVVFVLD.PPLL......EYSMR.....VRE
E7KD88_YEASA/399-966......EASTDT..QNLRINTDVSGNEFERE.......KEDLGKNMNMFHVCFVMN.PHLI......EYNKR.....IDD
B8N792_ASPFN/172-617IAASTETLSPHT..MTASESQRASMGSIRSSRTLSEMLDGDDKDSMTMFNVVFVLD.PPLL......EYSMR.....IRE
U1GT46_ENDPU/116-550............................NSPATNPASSQADESREMTIFNVVFVLN.PPIL......EYSLR.....VNE
D8PLZ6_SCHCM/127-556......................................LGTKSAWLQSFHVVLVLDLPDPS......SSNSGNVWKYFDI
I2G095_USTH4/203-726....................................TTSSKSHAPLSSFHLVLVLDRPDPSAAMSGMDLSSW.....LQL
S6E8H4_ZYGB2/281-781......DH......NS.......DNQIPELS.......KEDLEKNMNMFHVCFVMN.PLLV......EYNQR.....IDD
NPR3_PHANO/150-598GSISSGPSGAPS..EAGSDARS.............NSTSQDNNPDMNMFNVVFVLN.PPAL......EYQQR.....VKE
U7Q027_SPOS1/110-529STGRAGETSAGG..AASATQG...............KDKEEKVSSMTMFTLVFIMS.PKRH......EANEL.....LDT
A0A0C4E2D4_MAGP6/120-591RQ....DEADGC..GQEPRQDEEEENDKGKDQE...KDKNDKVSSMTMLNLVFFLN.PKKH......EVKEL.....VSS
S8B047_PENO1/186-645MGGSVATITELSLTASPTDYKRTSTASSRLGKHAEDGIDTEDNDQMTMFNVVFVMD.PPLL......EYSTR.....IKD
C5DHQ6_LACTC/241-731......EQLSGS..QLFEEETGKAEY.............EALEKSVNMFHLCFLTN.PRLV......EYNKR.....VDD
E9D3F7_COCPS/142-585......................PSRSLIESHPDEDGSVTDGTKDAMTMFNVVFVMN.PPIL......EHNLR.....IKE
U4LL48_PYROM/132-582DTGKVPEDEATK..AADEDADDEREGET.......PTEQTNTESSMNMFHIVFVLN.PPEL......EYQAR.....TLQ
K2SR44_MACPH/175-626GISDEASDAGSD..AKSAS...................TAGGDTEMTMFNVVFVLN.PPAL......EYQLR.....TGE
S8BNA5_DACHA/141-592......DPDALT..LSRSKSPNPPPSLRKKFKREPRKPLEQVPSKLAMFHVVFVMS.PPQL......EYHSR.....MND
D6RLY8_COPC7/119-572......................................KPKKPSWMQKFQLAFVLDLPDPS......SSASGNVLKYFDI
U5HEM2_USTV1/112-634....................TSTVHPLSSFASSDQSATGIHGTGRLLAFNFVCVIDTPPDS......HLSSH.....LEG
G4MPF6_MAGO7/119-567LD....TAKNGD..KEEE..................EQQDDKVSSMTMFNLVFFLN.PKKS......EVNEL.....IDT
A0A0D1CR33_USTMA/205-718....................................IPTSRSKAPLTQFHLVLILDRPDPSTAVPGVDLSSW.....LQL
B6H909_PENCW/169-617LGASVASIAESL..TSPTDSKRGSGSGRPGKQD..ESLDPEDKDHMTMFNVVFVVD.PPLL......EYSMR.....VKE
NPR3_ASPFU/179-636MAASTETLSPKQ..VTLSEAKRGSGSSGKAARSLVDCLDGDDKDSMTMFNVVFVLD.PPLL......EYSMR.....TKE
C5DQJ7_ZYGRC/281-783......DNDECE..NS.......NNQ...NI.......KEDLEKNMNMFHVCFVMN.PSLV......EYNER.....IDD
C4JQY3_UNCRE/143-587......................PSRSSMETNTEEDESVTDGNKESMTMFNVVFVMN.PPIL......EHNSR.....IKE
E7A1P0_SPORE/203-720....................................LPSSRSQAPLTQFHLVLVLDRPDPSSAMAGMDLSSW.....LQL
G8ZWI0_TORDC/270-767......DESEVL..ES.......KKH.............DDLDKSMDMFHVCFVMN.PSLV......VYNEK.....VDD
C1GWB7_PARBA/152-590......SSIQAL..QTDGKNDPIPGDKVNAEGDSLQRLQESDKGSMTMFNVVFVLN.PPLL......EYGLR.....IRE
B2ALS2_PODAN/100-533KS.GDRVARDGE..PLGAGDAEGKE...........KAEKEKKASMTMFNLVFFLR.PKKH......EAKDL.....VDI
G0RDM3_HYPJQ/95-508PT....SKTDSN..PEKTKDG.........KRD...ESDEDKRSSMTMFNLVFFLD.PKRH......EAKEL.....VDS
B6QRZ0_PENMQ/155-594...............................ADSQTGSPESDKDTMSMFNVVFVMA.PPVL......EYSIH.....LKE
J8Q1I2_SACAR/396-963......ENCTDT..PNLKVDTDFNRTEFERE.......KEDLGKNMNMFHVCFVMN.PHLI......EYNKR.....VDD
J7RBT2_KAZNA/205-696......................................KDNLDKNMNMFHVCFVMN.PPLT......EYNKR.....IDD
M1VZL7_CLAP2/99-560PS....IFLSAD..AAKDKDP.........KKD...GADDEKRSSMTMFNLVFILN.PRKS......EGKAL.....VDA
F4P7C7_BATDJ/218-654..........................................HHQLTMFNLVFALQ.PDGR...GTSHHSKE.....VKN
NPR3_KLULA/205-723..........................EMYCVPDAENDEFESLQQSINMFQVCFIMN.PKII......EYNER.....VDD
A7TP53_VANPO/308-811......TEMSSR..KSIKVEANIPFS.............PDDGKNLTMFHVCFVMN.PHLI......EYNQR.....VND
NPR3_ASHGO/273-791.......................................EDLQKAVHMFHVCFIMN.PQLV......EYNER.....IDD
G2R1J8_THITE/107-555RSGGEKGASDAE..KIEARDMLKPPVKPA.......DETEDKKSSMTMFNLVFFLH.PKKH......EVKPL.....VDI
J5JA21_BEAB2/104-534DS....DA.AVE..KEKEKDK.........EKK...EEEEEKRSSMTMFNLVFILR.PRKE......QTREL.....VEA
V5FG66_BYSSN/161-604AAESNAPAGSKS..STFTDGKNPTDAKRKSSKS..DELPDSDKDSMTMFNVVFVLD.PPQL......EYSIR.....IME
I2H4A8_TETBL/339-898......SYDESG..K........................DDLQNNMTMFHVVFIMD.PSLI......EYNQR.....VND
G4U9V0_NEUT9/109-529RT.SDKGPSDVD..QLAAKPA...............EEAEDKKSSMTMFNLVFILN.PRRH......EVADL.....VDI
J4HS73_FIBRA/136-570......................................APPDSKWLTTFHFVVVLDRPDPS......SSSPASVWKYMDT
A0A098D4P8_GIBZA/98-520TT....GKATEQ..PAEEKEV.........KKEDGKDKDDEKRSSMTMFNLVFILN.PSSN......EVKDV.....IES
R7YHW5_CONA1/139-554......................................FDPALNDMSMFNVVFVLN.PPAL......EYQLR.....VKE
Q5KFU1_CRYNJ/229-746......................................KDDDVPNLTMFHLVLIIDKPDPKPGTESHDEHHSQTMGIYDE
W1QEY3_OGAPD/185-592......................................PTKNDCQMYMFHLVFVMN.PPVI......EYNHR.....IDE
H1V255_COLHI/104-533PNGADASQIDSK..EEETTQQ...............DEADDKRASMTMFNLVFIMN.PKKH......EAKEL.....IAT
T5A616_OPHSC/95-515PT........PK..PSDVKDA........PKKE...EADDEKRSSMTMFNLVFILN.PKKN......EVKDL.....VDV
D5G9F0_TUBMM/127-587...........................................GNMTMFHVVFVLN.PPEL......EYHSR.....TQE
M7TWW8_EUTLA/45-472EV....KGIAED..SAYQNQA...............DEAEEKKSGMTMFNLVFILN.PKRH......EAREL.....VDT
G0SXZ9_RHOG2/78-582.....PSPRRPDALAHTHSSASTLHPGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS......HLSSH.....LEG
C0NJI2_AJECG/153-591......SSKQAS..ETEGDNCPVGELKKIVEDDVLPGSPEADKDSMTMFNVVFVLN.PPLL......EYGLR.....VRE
G1WZV0_ARTOA/142-590......DPDAVA..LSRSKSPNPPPSERKKIKREPRK.VEATPSKLAMFHIVFVMN.PPQL......EYHSR.....MHD
M7X5H8_RHOT1/78-583.....PSPRRPGALAHSHSSASTLHAGTSLASSQHSHNSLATAGRLVSFNLLCVIDTPPDS......HLSSH.....LEG
NPR3_DEBHA/205-647......................................KSQSKNSMSMFHLVFIMN.PPII......ECNYR.....IDE
K0KSM9_WICCF/157-573......................................DDSDSNSMEMFHVVFVMN.PSLV......EYNYR.....LDE
S9VYA1_SCHCR/73-478......................................QSKPTSSMSLFHVVFVLNVPTAS......IYRPT.....INT
K1XTL5_MARBU/116-531....................................SENGEDHGGMTMFNVVFILN.VAKD......EADER.....ILT
G8YSZ2_PICSO/187-642......................................AADSKNSLNMFHLVFIMN.PPII......ESNYR.....IDE
V2XGE3_MONRO/83-522......................................PSNKCAWLHTFHLVMVLDLPDPS......SSAAGNVSKYFDV

PF06218

M3IIL9_CANMX/8-518-----------------------------------------YSRNSFNFNFCFVF------------RYDMG-----NTS
M2UFV8_COCH5/4-472-----------------------------------------YSRNEFIFNFAIVI------------GENER-----DWA
Q6BQE8_DEBHA/7-469-----------------------------------------YSRNSFNFNFCFVF------------PYN.S-----DTT
Q0U9Y5_PHANO/4-462-----------------------------------------YSRNEFIFNFALVI------------GESEV-----DWA
G3AQK3_SPAPN/8-551-----------------------------------------YSRNSFSFNFCFVF------------PYDKG-----DIS
W6RQZ3_CAEEL/186-593-----------------------------------------YERGRFTFDMAFIV------------DMTSS-----AET
A5DQL3_PICGU/6-475-----------------------------------------YARNSFTFNFCFVF------------PYD.S-----DTT
K1Y0B6_MARBU/2-405-----------------------------------------YARNEFMFNFCIVI------------GVE.V-----DKT

PF03666

S8E9R2_FOMPI/133-565IYEQIAFTTTAVLYQEQVLHNFVEDECD------------------------------------------VLGALRDEYS
C5FU53_ARTOC/155-599MYENVVKKFGKALKSEQARANYVWKEAL------------------------------------------NILRIKEKCR
L8FQS0_PSED2/112-539MFEHVAKDINKALRYAQNYSNYVWKESE------------------------------------------RILNLKEKAR
H2AZX0_KAZAF/181-685LYQYIVARLSILLRYFQAKNNYVSKECS------------------------------------------IILKERENVV
R9P8J9_PSEHS/205-717FYDNIVFKMTAALFAEQQRVDYVGRETE------------------------------------------KLLALRERCM
F8PYL6_SERL3/132-564IYEQIAFTVTAVLFQEQVLSNFVEAECD------------------------------------------ILVSLKDEYI
N1J4X2_BLUG1/150-556MYEHVVKTFNRALLETQANSGYVWNESE------------------------------------------LILAMKEKAR
E9EL47_METRA/99-518LYHNVVKKVNKAYKYSQQHCEFVWKESK------------------------------------------RILLAKDRAR
M9MFA0_PSEA3/199-702FYDNIVFKMTAALFAEQSKSDYVGRETE------------------------------------------KLLALRERCM
NPR3_CANGA/243-797MYQYVVARLSVLLRYLQSKNDYVSEQCE------------------------------------------LILKEKEKVF
H6BW23_EXODN/130-559MYDHVARKMSKVLKWEQSHHDYVWEQSE------------------------------------------LMHSIKASHF
G8BZL7_TETPH/286-791MYHYIVMRLAHTLKILQAKSFYVSKEVE------------------------------------------ILLKEKEYVL
G0WEJ7_NAUDC/230-810MYQYVVAKLSLLLRYVQAKDSYVSKQCN------------------------------------------LILKERERVL
R8BC65_TOGMI/105-536MYSNIVRKVNKAYKYVQQRSDFVWKESK------------------------------------------RILTLKDKAR
V5ETE4_PSEBG/203-712FYDNIIFKMTSALFAEQRESDYIGRETE------------------------------------------KLLALRERCM
G8JWB1_ERECY/316-852MYHYVVTRLSLILRYLQDKTGYVVEECH------------------------------------------KILKTRDRIL
C4QYA8_PICPG/201-611MFHYVISRLCLLLRYEQDKHNFVWKEAL------------------------------------------NIMKLKEETA
G8BGC4_CANPC/198-622MFHHVISKLSLILRRAQLKHDYIGSEVK------------------------------------------RIISLREELH
G0VDK5_NAUCC/193-728MYQYIVAKLSLLLRYLQAKSSYVSQQCT------------------------------------------MILRERERVL
S2K004_MUCC1/105-579IYKNVILRYSSALRYEQLRCGYVQEEIE------------------------------------------KVLGLKEEAF
NPR3_EMENI/170-616IYDNVIKKFSKALKWEQSRTNYVWRECQ------------------------------------------HILNIKEKAK
E7KD88_YEASA/399-966MYQFVVTRLSLLLRYVQSKTSYISSECH------------------------------------------IILKEKERVL
B8N792_ASPFN/172-617IYDNIIKKFAKALKWEQARTDYVWREAQ------------------------------------------HISHIKEKAK
U1GT46_ENDPU/116-550MYDHVVKKLGKALKWEQARANYVWQQSD------------------------------------------LILKAKTQAR
D8PLZ6_SCHCM/127-556IYERIAFNLTAVLFREQVLSNFVEMECE------------------------------------------QLMSIRESCI
I2G095_USTH4/203-726FYDNIVFKMTAALFAEQSKSDYVGCETE------------------------------------------KLLSLRERCM
S6E8H4_ZYGB2/281-781MFHYAVARLSMLLRYAQAKSNYVSRECH------------------------------------------IIMKEKERVL
NPR3_PHANO/150-598MYDNVTRKYAKALKYEEARFQYVWKESK------------------------------------------RIIDLKQRAK
U7Q027_SPOS1/110-529MYTHVVREVNKVYKYCQESGDFIWQECK------------------------------------------KIIQLKDHAR
A0A0C4E2D4_MAGP6/120-591MYTHIIRQVNKYYKYCQERNDFVWKESK------------------------------------------KILALKEKAR
S8B047_PENO1/186-645IYENVIKKFAKALKWEQARNDYVWRESQ------------------------------------------HILQVRRRAR
C5DHQ6_LACTC/241-731IYHYVVSRLSLVLRYAQIKSGYVTRECY------------------------------------------EIIKTQDRIL
E9D3F7_COCPS/142-585NYDNVIKKFGKGLKSEQATANYVWKEAQ------------------------------------------KILHIKEKGR
U4LL48_PYROM/132-582IYDYVVRRFSRTLKYEQDKDGYVWKEAE------------------------------------------KIARLKEQAA
K2SR44_MACPH/175-626MYDNVIRKFSKDLKYEQAKTNYVWRESK------------------------------------------AILNLKNKAK
S8BNA5_DACHA/141-592MYD.VAKQFTLALKTQQAEDDYVARETE------------------------------------------RIIELRERGE
D6RLY8_COPC7/119-572IYEQVVFTFTAVLFQEQVLSNFVEAECD------------------------------------------VLIPMKESFA
U5HEM2_USTV1/112-634YYKDVIIPVTANVKALERQEQWLGKESF------------------------------------------KLLKAIEKAH
G4MPF6_MAGO7/119-567MHTHIIRKVNKAYNYCQQRNDFVWKESK------------------------------------------KILALKDKAR
A0A0D1CR33_USTMA/205-718FYDNIVFKMTAALFAEQSKSDYVGRETE------------------------------------------KLLALRERCM
B6H909_PENCW/169-617IYENIIKKFAKALKWEQARTDYVWKESQ------------------------------------------HILQMRRRAR
NPR3_ASPFU/179-636VYDNIIKKFAKALKWEQARTDYVWREAQ------------------------------------------HISHLKEKAK
C5DQJ7_ZYGRC/281-783MFHYAVARLSMLLRYAQEKSQYVSKECS------------------------------------------IIMKEKEHVL
C4JQY3_UNCRE/143-587NYDNVIKKLGKGLKSEQATANYVWKEAQ------------------------------------------TILQIKEKAR
E7A1P0_SPORE/203-720YYDNVVFKMTAALFAEQSKCDYVGRETE------------------------------------------KLLALRERCM
G8ZWI0_TORDC/270-767MFRYVVARLSLLLRYSQAKSNYVSKQCN------------------------------------------LILREKERVL
C1GWB7_PARBA/152-590KYENVIKKFGKGLKSEQARVDYVWKEAQ------------------------------------------TIVNIKEKAR
B2ALS2_PODAN/100-533MYTNIIKKINKAYKYCQERSDFVWKESK------------------------------------------KILTLKDKGR
G0RDM3_HYPJQ/95-508LFSNIVKKVNKAYQYSQQHSEFVWKESK------------------------------------------RILAAKEKAR
B6QRZ0_PENMQ/155-594MYEHVIKKFSKALKYEQDHSDYVWKEAQ------------------------------------------RILQIKERAR
J8Q1I2_SACAR/396-963MYQFVVTRLSLLLRYVQSKTSYTSSECH------------------------------------------IILKEKERVL
J7RBT2_KAZNA/205-696MYQYVVAKLSLLLRYVQSKSNYVSEECE------------------------------------------IILKETESVK
M1VZL7_CLAP2/99-560LYPNVVKKVNKALKYSQYQYDFVWKESK------------------------------------------RILSAKDRAR
F4P7C7_BATDJ/218-654IYDHVVVKVTTALKYEQLRRGYIRTETE------------------------------------------LILAINDRYQ
NPR3_KLULA/205-723MYHYVVTRLSLILRYIQGKTGYVTRECV------------------------------------------KIMKCKDEVS
A7TP53_VANPO/308-811MFRHIVSKFTLALRSAQAKNSYVSKECD------------------------------------------IILKEREAVM
NPR3_ASHGO/273-791MYHYIVTRLSLILRYIQDKKGYVVRECA------------------------------------------KILKTRDRIL
G2R1J8_THITE/107-555MFTHIIKKINKAFKYCQQRSDFVWKESK------------------------------------------RILALKDKGR
J5JA21_BEAB2/104-534LYSNIAKKVNKAFKYSQQHSDFVWKESK------------------------------------------KILASKDRAR
V5FG66_BYSSN/161-604NYENVIKKFGKALKWEQARADYVWTEAQ------------------------------------------TILHIKEKAK
I2H4A8_TETBL/339-898MFRNVAARLSLFLRSAQAKTSYVSRECD------------------------------------------IMLKEKESIM
G4U9V0_NEUT9/109-529LYTHIIKKVNKAYKYCQQRGDFIWKESK------------------------------------------KILALKDKGR
J4HS73_FIBRA/136-570IYERLVFAITAVLFQEQILHNYVETECD------------------------------------------KLGSLKDDYT
A0A098D4P8_GIBZA/98-520LYDHIIKKVSKAFKYSQQHSEFVWKESK------------------------------------------RILVAKDKAR
R7YHW5_CONA1/139-554TYDNVVRKYAKVLKEEQACSSYVWKEAR------------------------------------------EILAMKQKAR
Q5KFU1_CRYNJ/229-746IYREIAFKWTAAAYNLQCESNLVAREAW------------------------------------------MIVKYKEKCL
W1QEY3_OGAPD/185-592MFHYIVSRMALLLRYEQQKSNYVWNQSK------------------------------------------LILDLREEFS
H1V255_COLHI/104-533LYLNIIKKVNKAYKYCQQHSEFVWKESK------------------------------------------RISALKDKGR
T5A616_OPHSC/95-515LYGNIVKKVNKAYKYSQQHSDFIWKESK------------------------------------------RILAAKDKAR
D5G9F0_TUBMM/127-587MFDYVVKRFARALKYEQAKDGYVWGEAE------------------------------------------KIVRLKDKAN
M7TWW8_EUTLA/45-472LYFHIIKKVNKPYKYSQQRCDFVWKESK------------------------------------------RILALKDKGR
G0SXZ9_RHOG2/78-582YYKDVVVPVTANIKALEKKDTWLTKEAA------------------------------------------KLRRMREGAL
C0NJI2_AJECG/153-591KYENVIKKFGKGLKSEQARVDYVWNEAQ------------------------------------------TIINIREKAK
G1WZV0_ARTOA/142-590MYD.VAKQFTMALKTQQSDDDYVAREAE------------------------------------------RILEIRERGE
M7X5H8_RHOT1/78-583YYKDVVVPVTANIKALEKKDTWLTKEAA------------------------------------------KLRRMREGAL
NPR3_DEBHA/205-647MFHYVISRLSLVLRYEQSKHEYVWNQIR------------------------------------------MIYNLKEEFR
K0KSM9_WICCF/157-573MFHYVVSRLSLILRYEQSKSNYVWDQVK------------------------------------------KILMIKDNNE
S9VYA1_SCHCR/73-478MYESIVVKLVTGLKYEQAKRNYVENECK------------------------------------------HIRKMNERYT
K1XTL5_MARBU/116-531IYEHVIKKLNKAMKHAQATANYVWKESE------------------------------------------MILLMKEKAR
G8YSZ2_PICSO/187-642MFHYVISRLSLVLRYEQSKHDYIWSQVR------------------------------------------LIAQIREDFR
V2XGE3_MONRO/83-522IYEQAAFIVSAVLFQEQVVSNYVEKECD------------------------------------------QLGSLRDDCM

PF06218

M3IIL9_CANMX/8-518PYESAIKRMGQMFQVLEEQSFMLSSLDKDNVFFKEK...PFANGKNVNG......NNVKLKYSISDFTNLMT.......D
M2UFV8_COCH5/4-472CYGEVARKLGRLLRGLEEQGGFLSKEEV..................................GVWDDDGGTIDAGLDNGV
Q6BQE8_DEBHA/7-469PYESAIKRMGKMFQVLEEQSFILSKLDKFGSFFKNKDEYPTENSLMINE...............................
Q0U9Y5_PHANO/4-462CYGEVVRKLGRLLRGLEEQGGFLSKEEE..................................GVWDMD..........EV
G3AQK3_SPAPN/8-551PYEPAIKRMGQMFQVLEEQNFMLSKLDKDNSFFKKG.....STGLSSNGASSDISNNINIGIDLESYTNATSMSPAASND
W6RQZ3_CAEEL/186-593MYEPIVQKCAEYLIELEMEYKFLTNPKY....................................................
A5DQL3_PICGU/6-475PYESAVRRMGRMFRVLEEQNFSLSKQDP..AFFKDN....................................RAHLDRAD
K1Y0B6_MARBU/2-405PYEAVVRRLATTFTEMEIQNEYLSQEGV..................................................AT

PF03666

S8E9R2_FOMPI/133-565RRGE...........QFADYLREALNMSSLAASMKTLYESIKE..................KTIAQITI....HELPLEL
C5FU53_ARTOC/155-599EERC...........SLSAVYSQLFAKSSLAQAIETLYTDISA..................SKIASVSL...GPQTSMSM
L8FQS0_PSED2/112-539EERR...........PMSTLWDTILRKSSLAQTMKTIYTSISN..................NSIAVVQLLS.DPPVRLSV
H2AZX0_KAZAF/181-685KYSKSYESALTPAA.KAKCVYERILSKSSLARMLTKCVDKLHK..................NEIASIKV...GDDKIISL
R9P8J9_PSEHS/205-717DDGQ...........AYSAYAAQCLGISSLARCIRDLYKCIST..................SSDAFLTV...NDSIEVHT
F8PYL6_SERL3/132-564DKGE...........PYSEFNAQALLRSSLAPAMKTLYEAIQS..................STMAYITI....HDLPLEL
N1J4X2_BLUG1/150-556EDRR...........PMSWLWREILLRSTLACAMKEIYNSISQ..................NKIATCEL...GPNFNISL
E9EL47_METRA/99-518EDEK...........SMNVLWKELLEMSSLAASVHDIYEAVSR..................NKIATLHLDTPAGVLTPSV
M9MFA0_PSEA3/199-702DDGQ...........AYSAYAAQCLGISSLARCIRDLHKSIST..................SSDAFLTI...NDRIEVHL
NPR3_CANGA/243-797KNSKHYKSLSLPSE.KGRYLYQRLLAKSSLARALTECVEKIKK..................NEIACLEI...TDHRTVSL
H6BW23_EXODN/130-559QQKS...........PTKALYTELLRRSSLAAAMGKVFDNISA..................SRIAAITL...SSKLSVSF
G8BZL7_TETPH/286-791KSSRVYKNLKGAAN.KGQYLYQRLLVQSSLARALVTCFDTIHK..................NDIVNLTL....DEKVVTL
G0WEJ7_NAUDC/230-810KFSQKYKSIKGKHN.KAKYLYRRILEKSSLAKSLTECVHKLQK..................NQIACLDL...GNRKIVSL
R8BC65_TOGMI/105-536EDKR...........KMSLLWEEILQTSSLAASMQDLYDCIST..................NKIATLQLDTAEGAITHSV
V5ETE4_PSEBG/203-712DDGQ...........AYAAYAAQCLGISSLARCIRDLYKSIST..................SSDAFLTI...NDNIEVHL
G8JWB1_ERECY/316-852KQLKQIKKVRGQQALQGRYLYEYILKSSSLARALTKCFNSIVN..................NETVSLEI...GKYKVLSL
C4QYA8_PICPG/201-611GL.............DIVSQWRDIIPQSDLAKLMRDTFESVSN..................ARIVNLTI....NNKLRSF
G8BGC4_CANPC/198-622DE...................NKLAENSSLCKLIRDCFIGIGS..................SKVANLMI....NGKLKSF
G0VDK5_NAUCC/193-728KYSNKYKSIKEENL.KAKYYYQRILSKSSLARSLIECVDKLQQ..................NEIACLEL...GDDKIISL
S2K004_MUCC1/105-579NKGI...........PYEQVMREILRESSLARDIRQIYTAISA..................NTAAHVII...NDFIDLSL
NPR3_EMENI/170-616EKRS...........SLNSLYADIISQSSLARAIRTLYTSISA..................SKIASVTL...SPDVSISL
E7KD88_YEASA/399-966KHSKTYQSIRGAGN.KGKYLYQRILAKSSLARALTECVDKIQR..................NEIACLEI...NDDKVISL
B8N792_ASPFN/172-617ETRT...........SVNTLYSELINHSSLARAIYTVYSNISA..................SKIASVSL...SPDVSISL
U1GT46_ENDPU/116-550HKRS...........SITALYATLLRISSLASAIATIYDNISR..................SMIAAITL...TPTVPISL
D8PLZ6_SCHCM/127-556AKGE...........HFSTYMTQALAQTSIAPAMQVLFDAIKT..................STIAYITI....HDLPMEL
I2G095_USTH4/203-726DDGQ...........AYAAYAAQCLGISSLARCIRDLHKSIST..................SSDAFLTI...NDRIEVHL
S6E8H4_ZYGB2/281-781KHSKTYRSIKGAHN.RGKYLYQRILVKSSLARALTLCVEKLQK..................NDIACLEI...GDDKVIAL
NPR3_PHANO/150-598ESNE...........SLTSTWRKIISTSPLAKSIAIMFDAISH..................DKIAHIHF...DATFNTSF
U7Q027_SPOS1/110-529EDRV...........KMSVLWKDILAVSSLAASMRDTYEAISR..................NRIAVLELNLSKGSVGHSV
A0A0C4E2D4_MAGP6/120-591EERT...........KMTALWHEILAASSLAQSMQDVYEAISQ..................NRIAVLQLDTQDGAVTHSV
S8B047_PENO1/186-645ENRT...........SVHNLYSELINQSTLARAIYTVYSSISA..................SKIASVSF...SPDVSISL
C5DHQ6_LACTC/241-731KSSERYKSIKGPAN.KARYLYQKIIQRSSLARAISKCFDAISQ..................NEVANLEI...NGDKIISL
E9D3F7_COCPS/142-585ENKS...........SLSSVYEELLSQSSLAQAIATIYRSIST..................SKIASITL...TPHTTMSL
U4LL48_PYROM/132-582HEDI...........SYSELWRKIIDNSNLAHAISRIYIDISQ..................NKIAHIFL...NNHRTLSV
K2SR44_MACPH/175-626ENRE...........PMSMLWHNIISSSPLAKAIAIIYDAISS..................NKIAHINL...GSLADASY
S8BNA5_DACHA/141-592KRGD...........SIHELWSRILRESTLADAIATLYQQISA..................SKIAALKV...N.DFDFAL
D6RLY8_COPC7/119-572EQGQ...........PYKEFVNQALQASSIASAMKCVYEAIKT..................RSIAYVTL....NNIPIEL
U5HEM2_USTV1/112-634DQGI...........RNREIPASVAPMSSLAAALNHLFEALKA..................DQLANIQLGPLPVQVLFRG
G4MPF6_MAGO7/119-567EERR...........KMSSLWDEILRTSSLAASMQDVYDNISQ..................NKIAVLQLETQDGMVTHSV
A0A0D1CR33_USTMA/205-718DDGQ...........AYAAYAAQCLGISSLARCIRDLHKSISI..................SSDAFLTI...NDRIEVHL
B6H909_PENCW/169-617ETKT...........STNNLYSELISQSSLARAIYTVFSSIST..................SKIASVSL...SPDVSISL
NPR3_ASPFU/179-636ERRT...........SLNTLYTELITQSSLARAIYTVHTSISA..................SKIASVPL...SPDVSISL
C5DQJ7_ZYGRC/281-783KHSKTYRAIKGANQ.RGKYLYQCILSKSSLARALTLCVEKLQQ..................NDIACLEI...GEDKVIAL
C4JQY3_UNCRE/143-587ENMA...........SLLALYEELLSKSSLAQAIATVYRSIST..................SKIASITL...TPHTTMSL
E7A1P0_SPORE/203-720DDGQ...........AYAAYAAQCLGISSLARCIRDLHRSIST..................SCDALITV...NDRMEVDL
G8ZWI0_TORDC/270-767RTSKTYESIRGSGN.KAKYLYRRILAKSSLARALTTCVDKLQK..................NEIACLEI...DDDKVISL
C1GWB7_PARBA/152-590ENKL...........SLSGLYSELLSKSSLARAISTVYTSIAN..................SRIASVTL...TPEATMSL
B2ALS2_PODAN/100-533EERR...........KMSLLWDEILSTSSLAASMRDLYEAVSQ..................NRIAALQLCTAEGMVTHSV
G0RDM3_HYPJQ/95-508EDKK...........KMSALWKELIQNSSLAASMCEVYNAISQ..................NRIATLHLDTVDGILTPSV
B6QRZ0_PENMQ/155-594ERDV...........SGENLHDELVSKSSLAAAIHSVFDKISK..................SDIAFVSL....KSRSADF
J8Q1I2_SACAR/396-963KHSKTYQSINGAGN.KGKYLYQRILAKSSLARALTECVDKIQR..................NEIACLEI...GDDKVISL
J7RBT2_KAZNA/205-696KNSQFYQSIKSPGE.RGKYLYQRILSKSSLARCLTKCVDQLHK..................NEIACVEL...GNDKVISL
M1VZL7_CLAP2/99-560EERK...........PMAALWKELIQTSSLASSLHDIYEAVCL..................NKIATLHLETPAGILTPSF
F4P7C7_BATDJ/218-654VQNGGAG........DPLELQSQILKSSSLARCLAHIYHAVHG..................QLPSFLEV...NGSVSLAL
NPR3_KLULA/205-723KHSRYYESLKSPWS.KGKYMYERILYESSLARALTKCFNCIHN..................NEIANLEI...DGDKIVSL
A7TP53_VANPO/308-811KNSKKYKSIRGSCN.KARYLYQRILSKSSLARALTKCVDNIQK..................NEISRLQI...DDDKVLTL
NPR3_ASHGO/273-791KKSLKLKKSHGQAL.QGRYLYECILKSSSLARALTKCFNSIIN..................NEIVTLDI...DNHKVISL
G2R1J8_THITE/107-555EDKR...........KMSSLWEEILSTSSLAASMQDIYEAVSQ..................NKIAALQLDTVEGTVTHSV
J5JA21_BEAB2/104-534EDKK...........RMNHLWKELLQQSSLAASVHDIYEAISQ..................NRIATLHLDTAAGLLSPSV
V5FG66_BYSSN/161-604EQKT...........SVNSLYSELVSHSSLAKAICTLYSSISA..................SKIASLTL...SRDVSISL
I2H4A8_TETBL/339-898KTSRTYRMLKGPRN.KTKYLYKKLLTKSSLARALTVCVDSLQK..................NEIASLQM...NDEKFISL
G4U9V0_NEUT9/109-529EDKR...........KMSQLWEEILSNSSLAASMQDIYDAISR..................NRIAAIQLETIEGVVTHSV
J4HS73_FIBRA/136-570SKGM...........PFSEYMSEALNVSSLAPAMKTLYDSIKA..................SSIARITI....HDLPLEL
A0A098D4P8_GIBZA/98-520EERK...........RMSVLWKEILQSSSLAAAMHDIYEAVSQ..................NKIAALHLDTASGALTPSV
R7YHW5_CONA1/139-554ENKT...........PMSTLWHQIISSSALAKSIAIIFDSISS..................SKIAHVHL...DAAFETSF
Q5KFU1_CRYNJ/229-746NEGI...........GITECCRWTATHCHIDRTLNYLYLRLHQLRTQPANGLHSYLPTTITNRLAHITI...........
W1QEY3_OGAPD/185-592SF.............PLNEQWKKITEKSSLARMMAQTFKAVSN..................SEIINIEI....NNKMRSF
H1V255_COLHI/104-533EDKR...........KMSSLWNEILATSSLAASVQDIYEAVSQ..................NKIAALQLDTAAGPITPSV
T5A616_OPHSC/95-515EDKT...........SMTLLWKEMLHMSSLAASVHEIYEAVSQ..................NRIAALHLDTVAGPLTPSV
D5G9F0_TUBMM/127-587HEGT...........SFADLWRDILDQSSLAYAISRIYIDISQ..................SKIAHVFL...NNNLGLSL
M7TWW8_EUTLA/45-472EART...........KMSTLWREILEVSSLAASMQDIYEAVSH..................NKIAALQLETAEGNVTHSV
G0SXZ9_RHOG2/78-582EKDT...........PWDEFLATLPARSSLAGAISQLYTSLRG..................NKLASVHFGPLPVQVLFRG
C0NJI2_AJECG/153-591ENKL...........SLSRLYSELSSKSSLARAISTVYTSISN..................SRIASVTL...TPEATMSL
G1WZV0_ARTOA/142-590KRGD...........SMHELWLRIIRESTLAAAIATLYQSISA..................SKIAHLKV...N.DFDFAL
M7X5H8_RHOT1/78-583EKDT...........PWDEFLATLPARSSLAGAISQLYTSLRA..................NKLASVHFGPLPVQVLFRG
NPR3_DEBHA/205-647NQA............TMANLTKYLTDKSSLCKLISECFTQISR..................SNIANLSI....NNKLRSF
K0KSM9_WICCF/157-573NL.............SVFDLYQKLNTESSLAKVLSQCFDSIAS..................SDIANLEI....NNKVISL
S9VYA1_SCHCR/73-478NQRI...........PFDDFCREIPLHSNLASILVTTYEALIH..................LHTAYLEI...NHSINITL
K1XTL5_MARBU/116-531EERR...........PMSWLWTEILLKSTLAGILRDVFTAISG..................NKIVTFPVRS.KPPEDISL
G8YSZ2_PICSO/187-642SMN............TTEEFHNFLVERSSLCKLIADCYEQISK..................SNIANLSI....NKKLRSF
V2XGE3_MONRO/83-522KKGT...........SFSEFSSQALELSSLASAMKTLFEAIKA..................SSIAYISL....NDLPLEI

PF06218

M3IIL9_CANMX/8-518VTVS-----------TPGFAKTKHVALSSIESLIQQIYQDLNN------------------YSECCIPL-..DTSNSVDI
M2UFV8_COCH5/4-472CGFG-----------VGGGSK........VYALCEMVLEDLNN------------------YAECMIPI-VLDDSNTINL
Q6BQE8_DEBHA/7-469..FI-----------TPGFRRTQKVNLSSIESLIHQIYQDLNN------------------YSECCIPL-..DSANSVDI
Q0U9Y5_PHANO/4-462AQGD-----------IGGGSK........VYALCEMVLEDLNN------------------YAECMIPI-..DDSNTINL
G3AQK3_SPAPN/8-551ATVN-----------APGHSKTKRISLSSIESLVHQIYQDLNN------------------YSECCIPL-..DSSNSVDI
W6RQZ3_CAEEL/186-593....-----------...........KDQVLDVMERMFNDLSN------------------KGESVIEV-SLEDEKIVTL
A5DQL3_PICGU/6-475TTET-----------TPGYARTARITLSSIESLINQIFSDLNN------------------YSECCIPL-..DSANSVDI
K1Y0B6_MARBU/2-405SSLN-----------VNAQER......RSIAALIEIIKEDLNN------------------YNECMIPV-..DDANTINM

PF03666

S8E9R2_FOMPI/133-565QLP................................................PFLDSMLQAQDELELDAVNPRSEDGLL..
C5FU53_ARTOC/155-599QIPPMTSTP.......HLPSPNEP....G.YPG..................LWLTTA.....DSISTTDETSALAA....
L8FQS0_PSED2/112-539QIPKPYFLS.......MLPEFDEP....S.MPG..................LWITTA.....NFFGDQE.N.........
H2AZX0_KAZAF/181-685QIPVKNEFE.......HLPNFKQN....AILPN..................SYLTSILN.....................
R9P8J9_PSEHS/205-717QLPPILQDP..........................................TNLHKMIDIETELDSNDPIFLSGGGFAGR
F8PYL6_SERL3/132-564QLP................................................PYLDHLLHSEEEYDLDFVDYKEDDDES..
N1J4X2_BLUG1/150-556QIPKPSFLM.......SLPTAREP....A.IPG..................LLVTSA.....DPMLIESRKYDQ......
E9EL47_METRA/99-518QIPAPFFVS.......DLPADHDH....S.QHG..................LWLTTA.....NSFLSHE.Q.........
M9MFA0_PSEA3/199-702QLPPILQDP..........................................VNLPKTVDIETELDPNDPIFLSGGGFAGL
NPR3_CANGA/243-797QIPIQNEFS.......ILPQYKLY....PVLKG..................SFLTSIQN.....................
H6BW23_EXODN/130-559QIPPVTSTS.......YLPSLSEP....PLEPG..................VWLTTA....TDPASTADDLDSTSSGGA.
G8BZL7_TETPH/286-791QIPIHDEFW.......KLPQYKIE....PVLRG..................SHLTSILN.....................
G0WEJ7_NAUDC/230-810QVPVENEFQ.......ILPNFKIT....PAIEN..................CYLTSILN.....................
R8BC65_TOGMI/105-536QIPVPFHIP.......DLIPDGE.....DNFRG..................VWITTA.....NSFTAED.G.........
V5ETE4_PSEBG/203-712QLPPILQDP..........................................SNLLKTVDIETDLDKNDPIFLSGGGFSGL
G8JWB1_ERECY/316-852QIPIKNEFA.......KLPDLKIN....PVLRG..................SFLTSILN.....................
C4QYA8_PICPG/201-611QIPIKTEFH.......TLPKE.......KVIPG..................STLSSI.......................
G8BGC4_CANPC/198-622QIPLKTEFH.......SLPDATV.....PYIPG..................SYLSSTVNTVNNFGLINVGESSRYGQKDE
G0VDK5_NAUCC/193-728QIPIQNEFN.......ILPNFKTS....PIAEN..................CYLTSILN.....................
S2K004_MUCC1/105-579QIPVIGMHSESSMTADRESLMSPTQRAKDNYTG..................SSLMDIYSVAGYEYDKY............
NPR3_EMENI/170-616QIPPLTSTP.......YLPGPTDQ....A.YPG..................LWLTTA.....DSISPADDPMTDDN....
E7KD88_YEASA/399-966QIPIQNEFE.......KMPNFKLQ....PVLRG..................SYLTSILN.....................
B8N792_ASPFN/172-617QIPPLTSTP.......YLPGPGDK....A.YPG..................LWLTTA.....DSVTPADDPTADEN....
U1GT46_ENDPU/116-550QIPPVTSTS.......VLPSSTDPPSART.QPG..................VWLTTATAGSSDEIADTDHPQSA......
D8PLZ6_SCHCM/127-556QLP................................................PYLDSLLKVESDDDVDELQEQDAA.....
I2G095_USTH4/203-726QLPPILQDP..........................................TNLPKTVDIETELDPNDPIFLSGGGFAGL
S6E8H4_ZYGB2/281-781QIPIQNEFS.......VLPNFKLH....PVLRG..................SYLSTILN.....................
NPR3_PHANO/150-598QIPQADSTP.......YLPTALEP....Q.MPG..................LWLTTS.....NVVLADDE..........
U7Q027_SPOS1/110-529QIPVPFFAT.......DIQPQAGD....S.LKN..................LWLTTA.....NNVSRHE.T.........
A0A0C4E2D4_MAGP6/120-591QIPIPLHVS.......DLPQEGEP....D.ATG..................IWLTTA.....NSFAGSGRD.........
S8B047_PENO1/186-645QIPPLTSTP.......YLAGPTDR....A.YPG..................LWLTTA.....DSATPIDDPHSEDKNSNN
C5DHQ6_LACTC/241-731QIPIINEFD.......VLPDLKTD....PVLKG..................SFLTSILN.....................
E9D3F7_COCPS/142-585QIPPLTSTP.......YLPGPMEP....A.YPG..................LWLTTA.....DSLSATDEVTEMEY....
U4LL48_PYROM/132-582QIPIVTEIN.......RLPTLMDQ....P.MPG..................LPLTTA.....NSFGDEE...........
K2SR44_MACPH/175-626QIPQAPSTP.......YIPRPTEP....Q.MPG..................LWLTTANLTDENAEADHSFT.........
S8BNA5_DACHA/141-592QIPIMMETA.......ILPSISEP....Q.LPG..................MHLTTL.....HTLGSTPS..........
D6RLY8_COPC7/119-572QLP................................................PYLDTLLHNDSELDPDSIERPDDEEQ...
U5HEM2_USTV1/112-634EVPIEEEYD.......TFYAERQEVHLKDLGPGGIGGGPERRGRHDDPIDASEAARARSVSPTPPAEAFRNHRPPPLFSR
G4MPF6_MAGO7/119-567QVPMPFHIA.......DLPQQGDP....D.ATG..................IWLTTA.....NSFVRDDVD.........
A0A0D1CR33_USTMA/205-718QLPPILQDP..........................................SSLAKTVDIETELDPNDPIFLSGGGFEGL
B6H909_PENCW/169-617QIPPLTSTP.......YLTGPMDK....A.YPG..................LWLTTA.....DSATPVDDPSADEN....
NPR3_ASPFU/179-636QIPPLTSTP.......YLPGPTDK....A.YPG..................LWLTTA.....DSVTPVEDPTADEY....
C5DQJ7_ZYGRC/281-783QIPIQNEFA.......VLPNFKLH....PVLRG..................SFLSSVLN.....................
C4JQY3_UNCRE/143-587QIPPLTSTP.......YLPGPTEP....A.YPG..................LWLTTA.....DSVSATDEAPEVEY....
E7A1P0_SPORE/203-720QLPPILQDP..........................................NSLPKLVDIETELDPNDPAFLSGNGFAGR
G8ZWI0_TORDC/270-767QIPIQNEFR.......MLPNYKLN....PVLKG..................SYLTSILN.....................
C1GWB7_PARBA/152-590QVPPITSTS.......YLPAATET....A.YPG..................LWLTTA.....NSLSATDDVTGMET....
B2ALS2_PODAN/100-533QIPVPFHVS.......DLPDNGE.....ASQPG..................LWLSTA.....NTLMSDD.A.........
G0RDM3_HYPJQ/95-508QIPVPFFVA.......DLPAEDDE....R.HRG..................LWLTTS.....NAFLSQD.A.........
B6QRZ0_PENMQ/155-594QIPPTTSIA.......ELPSSNDT....S.LAG..................MWLTTANSVTADQGAEIEVPN........
J8Q1I2_SACAR/396-963QIPIQNEFE.......KMPNFKIQ....PVLRG..................SYVTSILN.....................
J7RBT2_KAZNA/205-696QIPVNNEFQ.......DIPNYKIH....PILPN..................SYLSTVLN.....................
M1VZL7_CLAP2/99-560QIPAPFFVS.......DIPSEHDN....SPQRG..................LWLTTA.....NSFLRRE.Q.........
F4P7C7_BATDJ/218-654RMCGIIETQ...................NTYPG..................SSSSTIDSYYASNSTISIPLEISSAYFNH
NPR3_KLULA/205-723QIPIKNEFS.......ILPNLKED....AVLRG..................SFLSSILN.....................
A7TP53_VANPO/308-811QIPIHDEFW.......KLPKFKLE....PVLRG..................SYLTTILN.....................
NPR3_ASHGO/273-791QIPIKNEFS.......SLPDLKIN....PVLRG..................SYLTSLLN.....................
G2R1J8_THITE/107-555QIPVPFHVS.......DLPQEGE.....ESQRG..................LWLTTV.....NSLMGEE.A.........
J5JA21_BEAB2/104-534QIPAPFYVA.......DLPPDEAR....R.PRG..................LWLTTA.....NAFLTQD.F.........
V5FG66_BYSSN/161-604QIPPLTSTS.......YLPTPMDT....A.YPG..................LWLTTA.....DSLSPADDTFAAET....
I2H4A8_TETBL/339-898QIPIHYELK.......FLPRFKLD....PVLKG..................TFLTSILN.....................
G4U9V0_NEUT9/109-529QIPVPFHVP.......DLPQDGQA....EEQLG..................LWLTTA.....NSLQADE.N.........
J4HS73_FIBRA/136-570HLP................................................PSLESMLRAEEDDNADMADREDENDLTSV
A0A098D4P8_GIBZA/98-520QIPVPFYID.......DLPQGEEG....T.QRG..................LWLTTA.....NTFLSQD.A.........
R7YHW5_CONA1/139-554QIPQAISTP.......YVPTTTQP....Q.IPG..................LWLTTA.....SVVDDEDPE.........
Q5KFU1_CRYNJ/229-746....QTVLS.......PKPVNTDE....AWAHW..................GEMEEMLSDKDSEESLSDWEDDWGAGAMM
W1QEY3_OGAPD/185-592QIPIRTEFS.......SLPPRHT.....QLLPG..................STLSST.......................
H1V255_COLHI/104-533QIPVPFYIT.......DLHNYGQT....E.QRG..................LWLTTA.....NSFIGED.T.........
T5A616_OPHSC/95-515QIPAPFFVS.......DIPAEHEQ....G.QRG..................LWLTTA.....NAFLSQD.A.........
D5G9F0_TUBMM/127-587QMPIISEIS.......VMPSITEP....Q.VPG..................LPLTTA.....NSFGDDD...........
M7TWW8_EUTLA/45-472QIPAPFCLA.......DLPAEDEP....G.SRG..................LWITTA.....HSFVAEE.N.........
G0SXZ9_RHOG2/78-582ELSTDDEVDLRDHEEYLLPDKGDE...........................SNSPERRNRSVSPSGHAFPRTRQAPIFST
C0NJI2_AJECG/153-591QAPPLTSTS.......YLPSATEK....A.YPG..................LWLTTA.....DSLSATDDATGMDT....
G1WZV0_ARTOA/142-590QIPIMMETA.......ALPSISEP....Q.LPG..................MHLTTL.....RTIGATPS..........
M7X5H8_RHOT1/78-583ELPADDEVDLRDHEEYLLPDRGED...........................SDSPERRNRSVSPSGHAFPRTRQAPIFST
NPR3_DEBHA/205-647QIPIKTEFH.......SLPDSTV.....PYLPG..................SHLSSTVNMLANTGLISVGETIRYDVNNL
K0KSM9_WICCF/157-573QIPMKNQFS......SLLPKTT......PVLPG..................SYLSSTTQ.....................
S9VYA1_SCHCR/73-478LWPMTVSVS.......SLDKLELQ....ERSPT..................ILASQTIFNEEEPSLIE............
K1XTL5_MARBU/116-531QIPVPSFLV.......SIPTFNEK....A.MPG..................LLLTSA.....NPYIDEEGVEDP......
G8YSZ2_PICSO/187-642QIPIKTEFS.......SLPEPTL.....PYIPG..................SNLSSTVNILANTGLVSIGETTRYGLNSL
V2XGE3_MONRO/83-522QLP................................................PYLDLLLHNDEEADFNGFMVGDEEDY...

PF06218

M3IIL9_CANMX/8-518..KLFPLLP-------..PPINLKAYQVP----------------------..IATV-----------------------
M2UFV8_COCH5/4-472..KLFPTRP-------..PPPPILAHQVP----------------------..LLTI-----------------------
Q6BQE8_DEBHA/7-469..KLFPILP-------..PPVNTKAYQVP----------------------..ILTV-----------------------
Q0U9Y5_PHANO/4-462..KLFPTRP-------..PPPPISSHQVP----------------------..LLTI-----------------------
G3AQK3_SPAPN/8-551..KLFPILP-------..APINLKAYQVP----------------------..IATV-----------------------
W6RQZ3_CAEEL/186-593YFKLCPLYR-------GCEPPEIDYHMVP----------------------MFIREV-----------------------
A5DQL3_PICGU/6-475..KLFPILP-------..APVNLKGHQVP----------------------..ISTV-----------------------
K1Y0B6_MARBU/2-405..KLFPAHR-------..HPPPVKSWHVP----------------------..ISTM-----------------------

PF03666

S8E9R2_FOMPI/133-565..NPWG.SMSVGWRL....................PALKP........................................
C5FU53_ARTOC/155-599..SGQN.............................QVLAK........................................
L8FQS0_PSED2/112-539..EDET.............................LLLSK........................................
H2AZX0_KAZAF/181-685.....K.............................KFLEKASFSSAPHSSSRKLHSSITLGNSLILHDGDDDYDN.....
R9P8J9_PSEHS/205-717GKENAQEDGTGGTYDRLLAMTPAQLSFEEWCRTTGPYLLP........................................
F8PYL6_SERL3/132-564..RAWGREMSFGWRL....................PALAP........................................
N1J4X2_BLUG1/150-556...................................PRLNK........................................
E9EL47_METRA/99-518..LDDP.............................EFLDK........................................
M9MFA0_PSEA3/199-702GKEGADEDGGGGTYDRLLELAPHQLSFEEWCRTTGPYLLP........................................
NPR3_CANGA/243-797.....N.............................KFLEKSA...................................NID
H6BW23_EXODN/130-559...................................LQVSK........................................
G8BZL7_TETPH/286-791.....Y.............................GFLKSTSTK.............................NKKKDIN
G0WEJ7_NAUDC/230-810.....N.............................SFLERLSLRADGLTSTTTGTNAGTSTDWRIENDVDDETNRGRTSN
R8BC65_TOGMI/105-536..FDES.............................GYLEK........................................
V5ETE4_PSEBG/203-712GKEGQDEDGGGGTHDRLLGLEPNQLSFEEWCRTTGPYLLP........................................
G8JWB1_ERECY/316-852.....L.............................KFLKEPTD..................................PIP
C4QYA8_PICPG/201-611................................................................................
G8BGC4_CANPC/198-622TLRYPQ..........................................................................
G0VDK5_NAUCC/193-728.....N.............................KFLENLSMR...............RTAWKM.DDVDNENNTAKGQH
S2K004_MUCC1/105-579...................................PVLCP........................................
NPR3_EMENI/170-616..SAPH.............................QVLAK........................................
E7KD88_YEASA/399-966.....M.............................KFLEKSSLR.............................IEGQNRQ
B8N792_ASPFN/172-617..TAPH.............................QVLAK........................................
U1GT46_ENDPU/116-550...................................MSLAK........................................
D8PLZ6_SCHCM/127-556..EMWGPHMSYGWRL....................ETLAP........................................
I2G095_USTH4/203-726GKEGADEDGGGGTYDRLLDLAPHQLSFEEWCRTTGPYLLP........................................
S6E8H4_ZYGB2/281-781.....S.............................RFLSAPP...................................SRD
NPR3_PHANO/150-598...................................SPMTQ........................................
U7Q027_SPOS1/110-529..LDGV.............................PAFDK........................................
A0A0C4E2D4_MAGP6/120-591..PSEL.............................GFLDK........................................
S8B047_PENO1/186-645NQNNAH.............................QVLAK........................................
C5DHQ6_LACTC/241-731.....R.............................KFLEEGS...................................ATM
E9D3F7_COCPS/142-585..SGPS.............................KVLAK........................................
U4LL48_PYROM/132-582..TEGD.............................SILAK........................................
K2SR44_MACPH/175-626...................................VPLTP........................................
S8BNA5_DACHA/141-592..EDED.............................MLLTP........................................
D6RLY8_COPC7/119-572..QNWGPELSFGWRL....................PALAP........................................
U5HEM2_USTV1/112-634MRRRPL.............................VRFQP........................................
G4MPF6_MAGO7/119-567..AADL.............................GFLDK........................................
A0A0D1CR33_USTMA/205-718GKEGAHQDGSGGTYKRRMAMTPAQLSFEEWCRTTGPYLLP........................................
B6H909_PENCW/169-617..NTPH.............................QVLAK........................................
NPR3_ASPFU/179-636..TAPH.............................QVLAK........................................
C5DQJ7_ZYGRC/281-783.....S.............................QFLSAGPL..................................AKE
C4JQY3_UNCRE/143-587..SGPS.............................KVLAK........................................
E7A1P0_SPORE/203-720GKEGADEDGGGSTHDRLRTLNPSQLSMEEWCRTTGPYLVP........................................
G8ZWI0_TORDC/270-767.....S.............................KFLGVAP...................................TRD
C1GWB7_PARBA/152-590..NVPN.............................QTLAK........................................
B2ALS2_PODAN/100-533..AEEP.............................GFLDK........................................
G0RDM3_HYPJQ/95-508..LEEP.............................GFLDR........................................
B6QRZ0_PENMQ/155-594...................................QVLAK........................................
J8Q1I2_SACAR/396-963.....M.............................KFLEKTSLR.............................IEGQNRQ
J7RBT2_KAZNA/205-696.....N.............................NFLEGCSYNDTQYLNAEGRKGFLGATDNIG...............
M1VZL7_CLAP2/99-560..LDNV.............................EFLDK........................................
F4P7C7_BATDJ/218-654...................................PTLRP........................................
NPR3_KLULA/205-723.....E.............................SFIGRSTSLTNEDSDNLYA..........................
A7TP53_VANPO/308-811.....E.............................RFLGSTT.................................NNNQE
NPR3_ASHGO/273-791.....D.............................SFLKQPVDFAAGSMMPGGDVMH.......................
G2R1J8_THITE/107-555..AETP.............................GFLDK........................................
J5JA21_BEAB2/104-534..LEEP.............................GFLDR........................................
V5FG66_BYSSN/161-604..APPH.............................QILAK........................................
I2H4A8_TETBL/339-898.....S.............................KFLARSSSL.............................DQLNATT
G4U9V0_NEUT9/109-529..VEEP.............................EYLDK........................................
J4HS73_FIBRA/136-570WDDTWGSRGF.........................MAVAP........................................
A0A098D4P8_GIBZA/98-520..LEEP.............................GFLDR........................................
R7YHW5_CONA1/139-554...................................AGLSP........................................
Q5KFU1_CRYNJ/229-746GMKRPE.............................LIVKP........................................
W1QEY3_OGAPD/185-592................................................................................
H1V255_COLHI/104-533..IDEP.............................GFLDR........................................
T5A616_OPHSC/95-515..LDEP.............................GFLDR........................................
D5G9F0_TUBMM/127-587..AEGD.............................NMLAK........................................
M7TWW8_EUTLA/45-472..IDDP.............................GFLDR........................................
G0SXZ9_RHOG2/78-582MRRRPP.............................VQFEP........................................
C0NJI2_AJECG/153-591..SAPN.............................QALAK........................................
G1WZV0_ARTOA/142-590..EGED.............................ALMTP........................................
M7X5H8_RHOT1/78-583MRRRPP.............................VQFEP........................................
NPR3_DEBHA/205-647................................................................................
K0KSM9_WICCF/157-573................................................................................
S9VYA1_SCHCR/73-478...................................PSVAP........................................
K1XTL5_MARBU/116-531...................................SYINK........................................
G8YSZ2_PICSO/187-642DPVTSY..........................................................................
V2XGE3_MONRO/83-522..RAWGPEMSFGWRL....................PALVP........................................

PF06218

M3IIL9_CANMX/8-518--------------------------------------------------------------------------------
M2UFV8_COCH5/4-472--------------------------------------------------------------------------------
Q6BQE8_DEBHA/7-469--------------------------------------------------------------------------------
Q0U9Y5_PHANO/4-462--------------------------------------------------------------------------------
G3AQK3_SPAPN/8-551--------------------------------------------------------------------------------
W6RQZ3_CAEEL/186-593--------------------------------------------------------------------------------
A5DQL3_PICGU/6-475--------------------------------------------------------------------------------
K1Y0B6_MARBU/2-405--------------------------------------------------------------------------------

PF03666

S8E9R2_FOMPI/133-565....................................................WKSLLRL.DDEDERGKN...........
C5FU53_ARTOC/155-599....................................................HFALLLL.SDENTILKD...........
L8FQS0_PSED2/112-539....................................................HFALLLL.DDENKIIAD...........
H2AZX0_KAZAF/181-685..............................................EDDDILNYALLLL.DDVNNILRT...........
R9P8J9_PSEHS/205-717....................................................WKTLLLLHDQVDD..GI...........
F8PYL6_SERL3/132-564....................................................WKSLLLL.DGDQGL..............
N1J4X2_BLUG1/150-556....................................................NFALLLT.EDESKLLSD...........
E9EL47_METRA/99-518....................................................NFALLLL.EDEKKVVAE...........
M9MFA0_PSEA3/199-702....................................................WKTLLLLHDQPDEA.AR...........
NPR3_CANGA/243-797DNHHAKSARDTNLISDHVNTFSNGQTKNEIFYSKNMENALTAQNDYDDDDLLLYSILLL.DDPDKIIAD...........
H6BW23_EXODN/130-559....................................................NFTLLFK.SSPQKILKD...........
G8BZL7_TETPH/286-791SNNFADDD...................................N..IDNDILNYALLLK.EEQNVIIEK...........
G0WEJ7_NAUDC/230-810NNNNRSSNIKYQSISDGKPTNPMALNRNTVVTYYSTGDSEILEM..NNNDLLNYSILLL.DDPTNIIQS...........
R8BC65_TOGMI/105-536....................................................NFALLLM.DDEKKIISE...........
V5ETE4_PSEBG/203-712....................................................WKTLLLLHDHAD..PGR...........
G8JWB1_ERECY/316-852GGAVVFNDSNF..............................FDE..END.ILDYALLPL.DEVSNIIRD...........
C4QYA8_PICPG/201-611............................SPFTKDDSDEVDFKNIVNSDENLAFFTILLL.DDPEVIIRD...........
G8BGC4_CANPC/198-622..........................................EDDDSDEVVIYYALLLL.DEPENIIKD...........
G0VDK5_NAUCC/193-728MEQPETSTMGNSYMGNSRIINQFAQN...........DFDSTEN..ENDDILDYALLLL.DDPTNILQT...........
S2K004_MUCC1/105-579....................................................YHTLLLL.EDPEEVLKN...........
NPR3_EMENI/170-616....................................................HFALLLL.DNEATIIKD...........
E7KD88_YEASA/399-966NDQAQFSDTHNNIYRFGNNINSTGHCGAANVDDGDDNESNYYCD..DNDDLLNYALLLL.DEPNNIISS...........
B8N792_ASPFN/172-617....................................................HFALLLL.SDEATILKD...........
U1GT46_ENDPU/116-550....................................................HFTLLLL.DKESKILAD...........
D8PLZ6_SCHCM/127-556....................................................WKSILLL..EKDGF..............
I2G095_USTH4/203-726....................................................WKTLLLLHDQADETLAR...........
S6E8H4_ZYGB2/281-781DSLNDYSNAED................................E..DANDLLHLALLLL.DEPANIIKE...........
NPR3_PHANO/150-598....................................................HAALLLL.EDTETLIKD...........
U7Q027_SPOS1/110-529....................................................CFALLLTDDDETKIIAE...........
A0A0C4E2D4_MAGP6/120-591....................................................NFGLLLL.DEDKKIITE...........
S8B047_PENO1/186-645....................................................HFALLLL.DSEAAVIKD...........
C5DHQ6_LACTC/241-731NEAWARSH...................................D..ENDDLLDYAVLLL.NEPAIIIQE...........
E9D3F7_COCPS/142-585....................................................HFALLLL.SDEASILKD...........
U4LL48_PYROM/132-582....................................................HFTLLFL.EDIETIIKD...........
K2SR44_MACPH/175-626....................................................HSALLLL.EDKETLLKE...........
S8BNA5_DACHA/141-592....................................................HLALLFL.EDVDDIIKE...........
D6RLY8_COPC7/119-572....................................................WKSLLLL.DGSDEL..............
U5HEM2_USTV1/112-634....................................................WETFLPL.EDPDELRKN...........
G4MPF6_MAGO7/119-567....................................................DFALLLM.DDEKKIVSE...........
A0A0D1CR33_USTMA/205-718....................................................WKTLLLLHDQVDEAPNR...........
B6H909_PENCW/169-617....................................................HFALLLL.DSEAAIIKD...........
NPR3_ASPFU/179-636....................................................HFALLLL.DNEAAILRD...........
C5DQJ7_ZYGRC/281-783ESLGGYTDSDH................................E..DLTDLLNFA.LLL.DEPTNIIKE...........
C4JQY3_UNCRE/143-587....................................................HFALLLL.SDEDTILKD...........
E7A1P0_SPORE/203-720....................................................WKTLLLLHDQPDDTPAR...........
G8ZWI0_TORDC/270-767NEGHSTGKREE................................D..DDDDLLHYALLLL.DEPAKIIKD...........
C1GWB7_PARBA/152-590....................................................HFALLLL.TDEATILKD...........
B2ALS2_PODAN/100-533....................................................NFALLLL.VDEKRIITE...........
G0RDM3_HYPJQ/95-508....................................................NFALLLM.DDEKKIIAE...........
B6QRZ0_PENMQ/155-594....................................................HFALLLL.ESEASIMEA...........
J8Q1I2_SACAR/396-963NNQAQLSDTNNNLYRFSNNINSTANCGTSNVDDGDDNENGYYCD..DNDDLLNYALLLL.DEPNNIINS...........
J7RBT2_KAZNA/205-696..............................................NDNDILNYSLLLL.DEPTQILET...........
M1VZL7_CLAP2/99-560....................................................NFALLLL.EDEKKIIAE...........
F4P7C7_BATDJ/218-654....................................................YQALLLL.SDAEEILNT...........
NPR3_KLULA/205-723..............................................NHDRLLDYGLLLL.DEPENIIKG...........
A7TP53_VANPO/308-811TSDWNIYSSEE................................D..ASDDLLNYALLLL.DEPSKIINN...........
NPR3_ASHGO/273-791..............................................DDNDVLDYALLLL.DDTPKIIKD...........
G2R1J8_THITE/107-555....................................................NFALLLM.MDEKRIIAE...........
J5JA21_BEAB2/104-534....................................................NFGLLLM.EDEKKIVAE...........
V5FG66_BYSSN/161-604....................................................HFALLLL.DNEATILKD...........
I2H4A8_TETBL/339-898NQINYPTSNSN.....................NANENEYDTFFD..DDNNLLDYALLPL.DEPSNIIKK...........
G4U9V0_NEUT9/109-529....................................................TFALLLM.AEEKKVINE...........
J4HS73_FIBRA/136-570....................................................WKSLLLL.DDEDEQGYE...........
A0A098D4P8_GIBZA/98-520....................................................NFSLLLT.DDEKKIISE...........
R7YHW5_CONA1/139-554....................................................HCALLLL.EDAETLLKE...........
Q5KFU1_CRYNJ/229-746....................................................WQTLLLI.DEDKNQNQEALFFGIVGLPA
W1QEY3_OGAPD/185-592..............................SPFNSLGPDLHSSAQTNDDNMIHYALIML.DDPESVIRD...........
H1V255_COLHI/104-533....................................................NFALLLM.GDEKKIIAE...........
T5A616_OPHSC/95-515....................................................NFALLLM.DDEKKIISE...........
D5G9F0_TUBMM/127-587....................................................HFTLLFL.EDVNGILKD...........
M7TWW8_EUTLA/45-472....................................................NFALLLL.SDEKKIVAE...........
G0SXZ9_RHOG2/78-582....................................................WQTLLLL.EDARILQRD...........
C0NJI2_AJECG/153-591....................................................HFALLLL.TDESTVLKD...........
G1WZV0_ARTOA/142-590....................................................HFTLLFL.EDVDDIIKE...........
M7X5H8_RHOT1/78-583....................................................WQTLLLL.EDVRLLQRD...........
NPR3_DEBHA/205-647............................NSGGLDDFDDIDDNKSDSNADDIIYYALLLL.DDPETIIRD...........
K0KSM9_WICCF/157-573.........................................YDEEELDSNVGHMALLLL.DAPEKIITD...........
S9VYA1_SCHCR/73-478....................................................YWSLLLL.QDLESIMKR...........
K1XTL5_MARBU/116-531....................................................HYALLLL.DDESKIIPE...........
G8YSZ2_PICSO/187-642......................SSKFALDNNGAFIDQDFIDEETDDNAEDIVYYALLLL.DEPESIIKD...........
V2XGE3_MONRO/83-522....................................................WKSLLLL.DNIDDF..............

PF06218

M3IIL9_CANMX/8-518----------------------------------------------------KLNSLID.VNWDPTMVK-----------
M2UFV8_COCH5/4-472----------------------------------------------------SLSSLQQPVSSDLTLNR-----------
Q6BQE8_DEBHA/7-469----------------------------------------------------KLSSLVD.INWDPTMLK-----------
Q0U9Y5_PHANO/4-462----------------------------------------------------SLSSLQSPISSDLTLNR-----------
G3AQK3_SPAPN/8-551----------------------------------------------------KLNSLVD.VNWDPTMVK-----------
W6RQZ3_CAEEL/186-593----------------------------------------------------TLTDHLI.EKMDVLSQK-----------
A5DQL3_PICGU/6-475----------------------------------------------------KLGLMVD.VNWDPTMVK-----------
K1Y0B6_MARBU/2-405----------------------------------------------------KFSVIID.DTWDLTMKK-----------

PF03666

S8E9R2_FOMPI/133-565..................ELYRRLRAPQLTAEDN....ELAEQLVKFLE.IADVTLSLSDMASLLDWDLETR........
C5FU53_ARTOC/155-599.......I.....................EASKS....TIGPPLAHYIR.SSKPTKSFA.....................
L8FQS0_PSED2/112-539.......I.....................QSDGG....ELTGPLLEYLK.IVRPTLSFH.....................
H2AZX0_KAZAF/181-685.......LE..................TTTMNSTESNDINMIILRHLIK.HIQPTVPLNSYHYIITDALDLE........
R9P8J9_PSEHS/205-717.......TPPVMASSGQAGLASPGGGGVQPHEGDGGFERLTRNFKSLFVPSLYNSLNFGNVADMFEWNLYDD........
F8PYL6_SERL3/132-564..................DPYMNLRGPHVRPEER....TLAQGLIKFLE.TASVTLSLADMASLLDWDLENQ........
N1J4X2_BLUG1/150-556.......M.....................HANKT....ELSEALTECIR.LCKPTLSFA.....................
E9EL47_METRA/99-518.......L.....................QADRD....PTTVSMIEFAR.LAKPTMSFY.....................
M9MFA0_PSEA3/199-702.......GRRTPGSASPAGHLTP...AEQAPETH.GFEQLARNFTSLFRPDLMHSLNFSEVADMLGWDLYED........
NPR3_CANGA/243-797.......LD..................NYSSNDD....IGGVILKQLVK.VIQPNVPLLSYQYIINELLAEK......PL
H6BW23_EXODN/130-559.......I.....................QAAGG....PLALPLANFMA.KATPTKSFY.....................
G8BZL7_TETPH/286-791.......LK..................SFSQDDN....IGGLILRQLVK.HIQPNVPIRSYQPLINELMGVK........
G0WEJ7_NAUDC/230-810.......LE..................ESSNQDV....LGNTILRHLVK.RMQPNIPIRNYQYIIDEVL...........
R8BC65_TOGMI/105-536.......L.....................QADPD....ESTLSMIEFVR.HSKPTMSFH.....................
V5ETE4_PSEBG/203-712.......DRNTAGSSSPSGALSP...SGQAPETH.GFEQLTRNFTALFQPNLYHTLNFSDVADMLGWELYED........
G8JWB1_ERECY/316-852.......LE..................CSSFQSD....MINLLMANLVK.ILKPTVPLRSYLYLIDELLGTN.STGANTV
C4QYA8_PICPG/201-611.......IQ..................VAKES..........VIARFIR.LIRPTKSMSRLATT................
G8BGC4_CANPC/198-622.......LK..................ISNES..........ILANFIS.SIEPTESLLKLSAQY...............
G0VDK5_NAUCC/193-728.......LD..................KFSHQDV....IGNLILRHLVK.RIQPTIPIRSYHYIIDEILDLD........
S2K004_MUCC1/105-579.......MPL............................DASPTLVQLVQ.ILTPTQSLQELHLLLDCSLAQ.........
NPR3_EMENI/170-616.......V.....................EAAGG....ALAPPLVHYIR.CSSPTKSFV.....................
E7KD88_YEASA/399-966.......LE..................TFSYQDD....IGTIILKHLVR.NIQPNIPLRSYRYLITDLLDNP........
B8N792_ASPFN/172-617.......V.....................EASGG....ALAPALAHYIR.CSKPTKSFA.....................
U1GT46_ENDPU/116-550.......I.....................SQSGG....PLAAALAHYIR.VSSPTKSFA.....................
D8PLZ6_SCHCM/127-556..................DPFASLRGPHVSVNDR....PLVDGLIRFLE.VASITLSLADMSSLLDWDLDTQ........
I2G095_USTH4/203-726.......GRQTPGNSSPAGMASPGGGGSTGPEAH.GFEQLARNFTSLFRLNLNHSLNLSEVADMLGWNLYED........
S6E8H4_ZYGB2/281-781.......LE..................TFSYQDD....IGNIVLTHIVK.HIQPNVPLGSYQHLIDDLLGGT........
NPR3_PHANO/150-598.......L.....................GGEVT....GNAAAIAFYIR.NIIPTKSLL.....................
U7Q027_SPOS1/110-529.......L.....................EARGD....KAAATMIELVK.ASKPTLSFY.....................
A0A0C4E2D4_MAGP6/120-591.......L.....................QSDPD....ESTMAMIEFIR.HSKPTLSFH.....................
S8B047_PENO1/186-645.......V.....................EASGG....ALAPALAHYIR.SSKPTKSFA.....................
C5DHQ6_LACTC/241-731.......LQ..................FSSPQND....ITSVLLTSLVK.HLKPTVPLRNYQYVIDEIVGKP........
E9D3F7_COCPS/142-585.......I.....................EASMG....TLGPPLAHYIR.SSKPTKSFA.....................
U4LL48_PYROM/132-582.......I.....................VAEPT....ESSASLAHFVK.NVKPTQSFV.....................
K2SR44_MACPH/175-626.......I.....................EGDAK....EHSVQLAYYIS.NLIPTKSLH.....................
S8BNA5_DACHA/141-592.......II..................Q.EQDQG....SLSASFVQFIQ.NCKPTLSFA.....................
D6RLY8_COPC7/119-572.................EDPIASLRGPHVSVEDR....ALAEGLIRFLE.TASITLSLADMASLLDWDLESQ........
U5HEM2_USTV1/112-634.......V..............................QPDTLLSKFLE.FCSPNLSFAEYATLLDIDSDADDGA.....
G4MPF6_MAGO7/119-567.......L.....................QSDPD....ESTLAMIEYMR.HSKPTLSFQ.....................
A0A0D1CR33_USTMA/205-718.......ERAKSDTCSPAGLASPGEGASQALEAH.GFDQLARKFTSFFTPSLYNTPNFSQVADMLGWDLYDD........
B6H909_PENCW/169-617.......V.....................EASGG....ALAPALTHYIR.CSKPTKSFA.....................
NPR3_ASPFU/179-636.......V.....................EASGG....ALAPALAHYLR.CSKPTKSFA.....................
C5DQJ7_ZYGRC/281-783.......LE..................TFSYHDD....IGNIVLSHIVK.HIQPNVPLGSYQYLIDELFGDT........
C4JQY3_UNCRE/143-587.......V.....................EASMG....TLGPPLAHYIR.SSKPTKSFA.....................
E7A1P0_SPORE/203-720.......GR....DGSPAGPVSP..GGAPAPEVR.GFEQLSRTFTDYFKPRLHGSFNFSDVADFFGWHLYDD........
G8ZWI0_TORDC/270-767.......LE..................NLSSDDD....IGNMVLTHLIR.RLQPTVALGTYQNIIDEMLGTA........
C1GWB7_PARBA/152-590.......I.....................EGSVG....PLGPRLAHYIR.ASKPTKSFA.....................
B2ALS2_PODAN/100-533.......L.....................QDDPD....ETTLAMIEFVR.HCKPTLSFY.....................
G0RDM3_HYPJQ/95-508.......L.....................QNDRD....PTTLSMIEFVR.LAKPTVSFY.....................
B6QRZ0_PENMQ/155-594.......L.....................KGS......ELAPALSHYIR.SSRPNKSFA.....................
J8Q1I2_SACAR/396-963.......LE..................TFSYQDD....AGTMILKHLVR.NIQPNIPLRSYRYLISELLDNS........
J7RBT2_KAZNA/205-696.......LE...................SSTQTVKTGDLNTLILRQLVK.QIKPTTPLISYHDIITSTLQLE........
M1VZL7_CLAP2/99-560.......L.....................EADQD....TTTPSMVEFAR.LAKPTMSFH.....................
F4P7C7_BATDJ/218-654.......LPV............................DASPLLVELIQ.IVTPTLSFEELQTTLSCSLSQ.........
NPR3_KLULA/205-723.......LE..................NASFDNG....VTDLLLINLVR.QLKPTIRLGQYKLLIKELIDSN........
A7TP53_VANPO/308-811.......ID..................SFTYKDN....IGGVVLKHLVK.HLQPHVPINYYQPLVDELLGST........
NPR3_ASHGO/273-791.......LE..................FSSFGSD....LANVIMINLVK.NLKPTVSLRSYLPLVSNLLEANLSLSARAA
G2R1J8_THITE/107-555.......L.....................QSDPD....ETTLAMIEFVR.HCKPTLSFY.....................
J5JA21_BEAB2/104-534.......L.....................QADGD....PNALPMVEFVR.ISKPTMSFY.....................
V5FG66_BYSSN/161-604.......V.....................EASGG....ALGPALAHYIR.CSKPTKSFA.....................
I2H4A8_TETBL/339-898.......LE..................TSSNQDD....LTSVLLIHIVR.HIQPTLPLRSYQYLIDDVFRFN........
G4U9V0_NEUT9/109-529.......LL....................GPESD....PTTQAMIEFVR.RCKPNLSFH.....................
J4HS73_FIBRA/136-570...................LYMRLRGPQLMPEDR....ELAEQLMKFLD.LASISLSLADMATLLDWDLESQ........
A0A098D4P8_GIBZA/98-520.......L.....................QADPD....PTTASMVEFVR.LSKPTQSFY.....................
R7YHW5_CONA1/139-554.......I.....................EGDAK....ERSAPLAFYIR.NSTPTKSLQ.....................
Q5KFU1_CRYNJ/229-746AVDDDDAVNNWTNGRKSPVRNRTRRGSKITAEDDAIEDGETVLRRTLIE.ACDVTKPLYEIAHLLRYDLEGV........
W1QEY3_OGAPD/185-592.......IQ..................AERHS..........LIANFIR.MIKPSESLSRLATL................
H1V255_COLHI/104-533.......L.....................QADPD....PSTVAMVEFAR.LSKPTQSFC.....................
T5A616_OPHSC/95-515.......L.....................QADRD....PTTVSMVEFVR.LAKPTMSFY.....................
D5G9F0_TUBMM/127-587.......I.....................AAEAA....DSSASLARFVE.ACRPTKSFV....................L
M7TWW8_EUTLA/45-472.......L.....................QADTD....DTTTAMVEFVR.LSRPTLSFH.....................
G0SXZ9_RHOG2/78-582.......V..............................LEGSLLWRFLD.ICRPKLSFADYETLLDLYSEDHM.......
C0NJI2_AJECG/153-591.......I.....................EESIG....PLGARLAHYIR.VSKPTKSFA.....................
G1WZV0_ARTOA/142-590.......II..................L.DQDQS....SLSASFVQFIQ.NCRPTVSFA.....................
M7X5H8_RHOT1/78-583.......V..............................LEGSLLWRFLD.ICRPTLSFADYETLLDLYSEDHM.......
NPR3_DEBHA/205-647.......IK..................AQQQS..........TLANFIR.MIKPTESLLKLANKLKQQ............
K0KSM9_WICCF/157-573.......LK..................TEPMS..........PLSTFIK.NINPMMSMNKLALL................
S9VYA1_SCHCR/73-478.......LPL............................SRNSLLASFIT.EARPTSTFTDIANSLGISLSE.........
K1XTL5_MARBU/116-531.......I.....................QADDT....ELSAPLIECIR.LCKPTLSLL.....................
G8YSZ2_PICSO/187-642.......IK..................TQPQS..........PLALFIR.MIRPSESLLKLSNKI...............
V2XGE3_MONRO/83-522..................DPFSDLRGPHVSPDDR....SLAEGLLKFLE.TANVTLSLTDLTSLMDWDLESQ........

PF06218

M3IIL9_CANMX/8-518----------------------------------------ILPYINGLN-SVKRISELADANYIL---------------
M2UFV8_COCH5/4-472----------------------------------------ILPYINGIN-SIAHIAQLADTDLSL---------------
Q6BQE8_DEBHA/7-469----------------------------------------ILPYIDGIN-SIKRISQLADADYIL---------------
Q0U9Y5_PHANO/4-462----------------------------------------ILPYINGVH-SIARIAALADTDLSL---------------
G3AQK3_SPAPN/8-551----------------------------------------ILPFINGLN-SVKRISELANANYLL---------------
W6RQZ3_CAEEL/186-593----------------------------------------IIPQIDGIN-TVREIAIILELDPSL---------------
A5DQL3_PICGU/6-475----------------------------------------ILPFINGVN-SVRKISRLADADYIL---------------
K1Y0B6_MARBU/2-405----------------------------------------VIQQIDGIK-DVRRIAHDADVALDL---------------

PF03666

S8E9R2_FOMPI/133-565...................................IYPTVRWLVHHRRAKVVDIVHPGLRTIFTVPLKFTAP........
C5FU53_ARTOC/155-599............QI...SA..RSRIPLSD......IQVLASHLVYWRRARAIPPLNK..KDVYIVSPNADMS........
L8FQS0_PSED2/112-539............QT...AQ..QHAISLND......IRILAQHLIYHRRAIAVPPLHP..RDTYILSPNCPMA........
H2AZX0_KAZAF/181-685.....................PSTVTYDI......LRSCALHLIYWRHARVIIPMSS..KFTYVVSPIISLEK.......
R9P8J9_PSEHS/205-717...................................VYPMVRHLLYYKQARVIDVPRP..GHVYAISPLFDFA........
F8PYL6_SERL3/132-564...................................IYPTVRWLVHHRRAKVVDIVHSGLKTIFTLPPRFEAS........
N1J4X2_BLUG1/150-556............QV...AQ..INSIELTS......LLTLASHLIFYRRALAIPPLHL..RNTYIVSPNCDCR........
E9EL47_METRA/99-518............QV...GQ..SNVLTASQ......VRKYAQHFIFWRRAIAIPPLHA..RDVYIVSPNCDLS........
M9MFA0_PSEA3/199-702...................................VYPMVRHLIYYRQARVIDIPRP..GHVYAISPLFDFG........
NPR3_CANGA/243-797SSSTTANKSKQNKD...NKTN..TFYSAL......LRSCALHLIYWRHARAILPISF..KNTYIVSPLSPVEADN.SEMI
H6BW23_EXODN/130-559............KI...SI..ASQMALGD......IQHLARHLVYWRRAIAIPPLHQ..RDTYIVSPNANMS........
G8BZL7_TETPH/286-791.............E...NDPNRTIFHINI......LKYCALHLLYWRHARAVIPLSS..KYTYIVSPLSPLVGSS.K...
G0WEJ7_NAUDC/230-810.......GSGFKSG...ITDN..TIQCNI......LRSCTLHLIYWRYARVILPISS..KSFYIVSPVSSVSYSK.....
R8BC65_TOGMI/105-536............QV...GQQSSNILTISH......VRKYAQHFIFWRRAIAIPPLHA..RDIYILSPNADMR........
V5ETE4_PSEBG/203-712...................................IYPMVRHLIYYRQARVIDIPKP..GHVYAISPLFDFA........
G8JWB1_ERECY/316-852DGGGVLGTSSSKIQ...AHRN..SFECNM......LRSIALHLTYWRHTRIILPISS..KNTYIVSPLAPIRGTA.VD..
C4QYA8_PICPG/201-611......................SGLDLAQ......IKAFACHLVYWRRAKIIPAINT..RNIYVISALAPLD........
G8BGC4_CANPC/198-622......................PQLDIRQ......IKSFAFHLIYWRKARIIQPLSS..RSVYIISPMAPLTV.......
G0VDK5_NAUCC/193-728.......SDNNEQT...TIEN..SMQYNI......LRSCSLHLIYWRHARVIIPLSS..KNSYILSPISPIVYSV.....
S2K004_MUCC1/105-579...................................IYRLAAHLIYWRKAKLIHTIST..RNIYVVSPTAKLN........
NPR3_EMENI/170-616............QI...SQ..ISGMPLPT......IQFLASHLVYWRRARAIPPLHQ..RDTYIVSPNCDLS........
E7KD88_YEASA/399-966.......SSLDDLT...TETN..SLESSI......LRSCALHLMYWRHARIVIPLSS..KYTYIVSPLAPIQGYT.ID..
B8N792_ASPFN/172-617............QI...SA..LSGIPLST......IQMLASHLVYWRRARAIPPLHQ..RDVYFVSPNCDLS........
U1GT46_ENDPU/116-550............KI...SA..LHSISLPD......IQLLAQHLVDWRRARAIPPLHQ..RDTYIVSPNADLK........
D8PLZ6_SCHCM/127-556...................................IYPVVRWLVEHRRAKIVDVVHPGLKTVFTLPPKFEQP........
I2G095_USTH4/203-726...................................VYPMVRHLIYYRQARVIDIPRV..HHVYAISPLFDFA........
S6E8H4_ZYGB2/281-781.......S..ED.T...GIGN..SFQTSM......LRSCALHLLYQRHARVVIPISS..RNTYIVSPIAPIRGYS.KN..
NPR3_PHANO/150-598............KI...SK..RHNISAHD......MEYIASHLVYWRRARLIAPLSP..RDTYIVSPNADFS........
U7Q027_SPOS1/110-529............QV...SQLPDTILTIHQ......IRAYAQHFIYWRRAMAVPPIHA..RDVYILSPNCDID........
A0A0C4E2D4_MAGP6/120-591............QV...ASQ.SNLLSLSQ......IHQFAHHFIFWRRAIAIPPLHA..RDIYMLSPNCDLE........
S8B047_PENO1/186-645............QI...SA..SSGIPLST......IQMLASHLVYWRRARAIPPIHQ..RDTYIVSPNCDLS........
C5DHQ6_LACTC/241-731.......VASESDV...EERN..SFQTSM......LRSLALHLMYWRHARVIIPVSS..KNTYIVSPLAPITGNT.KD..
E9D3F7_COCPS/142-585............QI...SA..RSSIPLND......IQVLAAHLIYWRRARAVPPLNK..QDTYIVSPNCDLS........
U4LL48_PYROM/132-582............QI...SI..QSGIALHE......IQVLARHLIQWRKARPIPPIHQ..RNTYIVSPNADMK........
K2SR44_MACPH/175-626............KL...AI..QHKIPVAD......LEFIAAHLIYWRRARAIPPLHH..RDIYIVSPNADMR........
S8BNA5_DACHA/141-592............QMISASS..PNGIIHPENPEYQYIEYFARHLIYWRKARAIMPLHY..RRYYIVSPNADMK........
D6RLY8_COPC7/119-572...................................VYPVVRWLVQHRRAKIVDIVNPGLKTIFALPSKFPAS........
U5HEM2_USTV1/112-634...................................LRDVVQHLVYWRKGKIIGVVSL..KGVYTASSTIPLA........
G4MPF6_MAGO7/119-567............QV...AIQ.SKVLNLAQ......VRRFAHHFIFWRRAIAIPPLHA..RDVYILSPNCDLS........
A0A0D1CR33_USTMA/205-718...................................VYPMVRHLIYYRQARVIDVPRP..GHVYAISPLFDFA........
B6H909_PENCW/169-617............QI...SA..SSGIPLSH......IQMLSSHLVYWRRARAIPPIHQ..RDTYVVSPNCDLS........
NPR3_ASPFU/179-636............QI...SA..SSGIPLST......IQMLASHLVYWRRARAIPPIHQ..RDTYIVSPNCDLS........
C5DQJ7_ZYGRC/281-783.......S..DD......VRG..SFQTNM......LRSCALHLLYRRHARLIIPISS..RNTYIVSPLAPIRGYS.KN..
C4JQY3_UNCRE/143-587............QI...SA..RSSIPLSD......IQVLATHLIYWRRARAVPPLNK..QDTYIVSPNCDLS........
E7A1P0_SPORE/203-720...................................VYPMVRHLIYYRQARVIDVPRP..GHVYAISPLFDFA........
G8ZWI0_TORDC/270-767.......K..ESVT...GSQN..SFQTSM......LRSCALHLLYRRHARVVIPISS..KCTYIVSPLAPIDGFSHDN..
C1GWB7_PARBA/152-590............QI...SA..QSGIPLSD......IQVLASHLAYWRRARAVPPLSR..RDTYIVSPNADLN........
B2ALS2_PODAN/100-533............QV...GQQSSNVLSPTQ......VRKFAQHFIFWRRAIAIPPLHA..RDMYIVSPNCDMR........
G0RDM3_HYPJQ/95-508............QV...GQ..SNILTLDQ......VRKYAQHFIFWRRAIAIPPLHP..RDVYIVSPNCDLE........
B6QRZ0_PENMQ/155-594............QI...SA..LSGIPLDT......IHDLAQHLIYWRRARAIPPLHQ..RDTYIVSPNCDLS........
J8Q1I2_SACAR/396-963.......SSQDNLS...LETN..SLESSI......LRSCALHLMYWRHARIVIPLSS..KYTYIVSPLAPIQGHT.VD..
J7RBT2_KAZNA/205-696.....................SSEITYDI......LRSCAIHLIYWRYARVIIPLSS..KHIYIVSPLLSLDL.......
M1VZL7_CLAP2/99-560............QV...CQ..SKILTSSQ......VREYAQHFIFWRRAIAVPPLHD..RDVYIVSPNCDVS........
F4P7C7_BATDJ/218-654...................................IYRLAAHLYVWSKAKIIHVVSN..RNVYIVSPQAQLS........
NPR3_KLULA/205-723.................DSSYDDQFCETT......LKSLCLHLIYWRHARLILPISS..RNTYIVSPLAPISGFSTDDFK
A7TP53_VANPO/308-811.......S..GGLS...GERS..LFQVNI......LKYCALHLLYWRHARVISPINS..KNTYIVTPLAPIQGTA.KD..
NPR3_ASHGO/273-791GSRHAASNA........ADSHSTPLQHSM......IRSIVLHLVYWRYARIILPLSS..KNTYIVSPLAPIRGTAADD..
G2R1J8_THITE/107-555............QV...CQQSSNVLTPAQ......VRKFAQHFIFWRRAIAIPPLHA..RDTYIVSPNCDLR........
J5JA21_BEAB2/104-534............QV...GQ..SNILSLSQ......VRKFAQHFIFWRRAIAIPPLHA..RDTYIVSPNCDLA........
V5FG66_BYSSN/161-604............QI...SA..VSGIPLSN......IQLLASHLVYWRRARAIPPLHQ..RDTYIVSPNCDLS........
I2H4A8_TETBL/339-898.......SNEFGMK...ELENGESIKINL......LKSCTLHLLYWRYVRVIIPISS..RNTYIISPLSPIQGSN.KDLL
G4U9V0_NEUT9/109-529............QV...QQQASSILSPAQ......VRRFAEHFIFWRRAIAIPPLHG..RDMYIVSPNCDLR........
J4HS73_FIBRA/136-570...................................VYPTVRWLVHHRRAKVVDFVHPGLKTVFSIPQKFSAP........
A0A098D4P8_GIBZA/98-520............QV...GQ..SNILTLGQ......VRKYAQHFIFWRRAIAIPPLHA..KDQYILSPNSDLS........
R7YHW5_CONA1/139-554............KL...AA..AFSIKIQH......IQLLANHLIYWRRARAIPPLNH..RDTYIVSPNAGMR........
Q5KFU1_CRYNJ/229-746...................................VIPLARDLVQSKKAILIDVVNP..RLRTVVMPTTIDEHNS.....
W1QEY3_OGAPD/185-592......................SGLDIAE......VKLFANHLVYWRRAKAFLPLSP..RNVYIVSPLAPLS........
H1V255_COLHI/104-533............QV...GQ..SNVLTLSQ......VRKYAQHFIFWRRAIAIPPLHA..RDVYIMSPNCDTR........
T5A616_OPHSC/95-515............QV...GQ..SNVLTLGQ......VRKYAQHFIFWRRAIAIPPLHA..RDTYVVSPSCHLA........
D5G9F0_TUBMM/127-587TLLLKSGYGVNSIIRFLQISNSCGIPLHE......IQVMARHLVHWRKARAIPPIHQ..RDTYIVSPNADMK........
M7TWW8_EUTLA/45-472............QI...GH..GNALSPAQ......VRKYAQHFIFWRRAIAIPPLHA..RDTYVLSPNCDLA........
G0SXZ9_RHOG2/78-582...................................LEDVVDHLVHWKKARVVDLVSL..KGAYAVSAEFEVK........
C0NJI2_AJECG/153-591............QI...SA..LSGIPLSD......IQVLASHLVYWRRARAVPPLSQ..RDTYIVSPNADMS........
G1WZV0_ARTOA/142-590............QMLSPTS..DSSAPHPENPEYQYIEYFARHLIYWRKARAIMPLHY..RRYYIVSPNADMK........
M7X5H8_RHOT1/78-583...................................LEDIVDHLVHWKKARVVDLVSL..KGAYAVSAEFEVK........
NPR3_DEBHA/205-647.................ASDNGFSLDAGQ......IKSFAFHLIYWRRARVILPIST..RSVYIVSPMAPITL.......
K0KSM9_WICCF/157-573......................NQLDINQ......VKAFANHLIYWRRARSIIPLQA..KSVFIVSPMAPIE........
S9VYA1_SCHCR/73-478...................................CFLLAKHLIHWRKAIAIPPLLI..RNTYVTSPTADLS........
K1XTL5_MARBU/116-531............QV...AQ..INSIEVGS......LLILANHLIQYRRAVAIPPLHA..REIYIVSPNCDNR........
G8YSZ2_PICSO/187-642.................KTQKKNNLDLDQ......IKSFAFHLIYWRRARVILPLNP..RSVYIVSPMAPLTI.......
V2XGE3_MONRO/83-522...................................VYPIVRWLVQHRRAKVVDIVHSGLKTVFMLPPKFDYP........

PF06218

M3IIL9_CANMX/8-518-----------------------------------TKQCIQHLMHYKCIEIIDIFQF--SNIYAPTNHIGDFLRFDG---
M2UFV8_COCH5/4-472-----------------------------------TRKAIQHLVYYGCLVLLDIFSF--GAIYAPTAEIGGFIIDA.---
Q6BQE8_DEBHA/7-469-----------------------------------TKQCIQHLMHYKCINMIDIFQF--SNIYAPTNHIGNFLTLN.---
Q0U9Y5_PHANO/4-462-----------------------------------TRRAIQHLVYYGCLVLLDIFSF--SAIYAPTAEIGGFVLDP.---
G3AQK3_SPAPN/8-551-----------------------------------TKQCIQHLMHYKCIEIIDIFQF--SNIYAPTNHIGDFLKING---
W6RQZ3_CAEEL/186-593-----------------------------------VARCVRNLHFYECVSLVPMFLY--YNTYVATERVHDFYKNQT---
A5DQL3_PICGU/6-475-----------------------------------TKQCLQHLLYYRCIEILDIFQF--SNIYAPTNNISRFLTVP.---
K1Y0B6_MARBU/2-405-----------------------------------TKIALQHLLYYDSILLLDLFLF--SNIYAPTPGVNDFVADRD---

PF03666

S8E9R2_FOMPI/133-565............................................MSALSADFDRR-------------------------
C5FU53_ARTOC/155-599...........................................KLTIATAAYEAT-------------------------
L8FQS0_PSED2/112-539...........................................SLPQFCALWSQK-------------------------
H2AZX0_KAZAF/181-685...........................................MYNVDKVQFKKR-------------------------
R9P8J9_PSEHS/205-717...........................................RLRPLSHVWAET-------------------------
F8PYL6_SERL3/132-564............................................LSSLSIDFKRE-------------------------
N1J4X2_BLUG1/150-556...........................................KLPDAIKEWKEA-------------------------
E9EL47_METRA/99-518...........................................RLPKDAAEWQRA-------------------------
M9MFA0_PSEA3/199-702...........................................RLGALSRVWAHT-------------------------
NPR3_CANGA/243-797KGNRKPSITDLNVTS..................NSS...SKIPVIYLNQQSFKLK-------------------------
H6BW23_EXODN/130-559...........................................KLVSACKSYEAT-------------------------
G8BZL7_TETPH/286-791...........DYIS.......EGSSHFSFNRREDN...HYEPLFYQHQIEFGQT-------------------------
G0WEJ7_NAUDC/230-810.......................................ENESKFVTDSISFKEK-------------------------
R8BC65_TOGMI/105-536...........................................QLPGASAVWARQ-------------------------
V5ETE4_PSEBG/203-712...........................................RLGPLSHVWARS-------------------------
G8JWB1_ERECY/316-852...........DC.................DSRDMDIVEG.EALIYQNQEIFHSK-------------------------
C4QYA8_PICPG/201-611...........................................RLEVHSMEFRTK-------------------------
G8BGC4_CANPC/198-622...........................................RLYEDISEFNKK-------------------------
G0VDK5_NAUCC/193-728.......................................D...KFKEDELTFRDR-------------------------
S2K004_MUCC1/105-579...........................................DIASLEADFKLH-------------------------
NPR3_EMENI/170-616...........................................KLEVASAAYKVA-------------------------
E7KD88_YEASA/399-966...........DYKSTSQNDGNVKKMEDRENNKNGS...DRVPLIYQNSMLFRSK-------------------------
B8N792_ASPFN/172-617...........................................KLEVATAAYQLA-------------------------
U1GT46_ENDPU/116-550...........................................KLSTAVKSYESA-------------------------
D8PLZ6_SCHCM/127-556............................................LSELTAEFEQE-------------------------
I2G095_USTH4/203-726...........................................RLGPLSTIWAQT-------------------------
S6E8H4_ZYGB2/281-781...........DYMG.................ARFS....GMPLIYQNQSIFKGK-------------------------
NPR3_PHANO/150-598...........................................LLPSAVTAYAQR-------------------------
U7Q027_SPOS1/110-529...........................................HLARASAVFAET-------------------------
A0A0C4E2D4_MAGP6/120-591...........................................KLPQASVKFARA-------------------------
S8B047_PENO1/186-645...........................................KLEIATIAYQAT-------------------------
C5DHQ6_LACTC/241-731...........DFSG...............NRLDSE...ESKPLILQNQEVFSKK-------------------------
E9D3F7_COCPS/142-585...........................................KLGLATAAYELA-------------------------
U4LL48_PYROM/132-582...........................................RVPQLIPVYSKT-------------------------
K2SR44_MACPH/175-626...........................................KLPQAIPAYASR-------------------------
S8BNA5_DACHA/141-592...........................................RLVPQSIIFNKL-------------------------
D6RLY8_COPC7/119-572............................................LSTLSHQFNQQ-------------------------
U5HEM2_USTV1/112-634...........................................SLAQLTIDFGTQ-------------------------
G4MPF6_MAGO7/119-567...........................................KLPSASLDFSRA-------------------------
A0A0D1CR33_USTMA/205-718...........................................RLGSLSYNWAQT-------------------------
B6H909_PENCW/169-617...........................................KLEIATIAYQTA-------------------------
NPR3_ASPFU/179-636...........................................KLEVATAAYQAA-------------------------
C5DQJ7_ZYGRC/281-783...........DYDG.................LQNS....SMPLIYQNQTIFKER-------------------------
C4JQY3_UNCRE/143-587...........................................KLPLATAAYEAA-------------------------
E7A1P0_SPORE/203-720...........................................RLGALSRVWAHA-------------------------
G8ZWI0_TORDC/270-767...........DLDS.................VENH...MERPLIYQNQEIFKKR-------------------------
C1GWB7_PARBA/152-590...........................................KLAQATEAYEAA-------------------------
B2ALS2_PODAN/100-533...........................................KLPQAAAHWARQ-------------------------
G0RDM3_HYPJQ/95-508...........................................RLPQDAQDWQRA-------------------------
B6QRZ0_PENMQ/155-594...........................................QLKKATQSYATT-------------------------
J8Q1I2_SACAR/396-963...........DFKSTSQNDEQVNTMGNGKNNVDQS...DNIPLIYQNSILFRSK-------------------------
J7RBT2_KAZNA/205-696...........................................CYSGDEKKFREK-------------------------
M1VZL7_CLAP2/99-560...........................................RLPQDTVEWQRA-------------------------
F4P7C7_BATDJ/218-654...........................................ELPKLSTEFSSR-------------------------
NPR3_KLULA/205-723HGEYDTLIRQQEVPVNNN.....................DEPSLIYQNKKVFNEK-------------------------
A7TP53_VANPO/308-811...........DTVS..............HHHINKD...NPKTLIYQNEDIFKKA-------------------------
NPR3_ASHGO/273-791..............................FENTDMVKQGCKALIYQHQDLFHEK-------------------------
G2R1J8_THITE/107-555...........................................KLPQASAEWARQ-------------------------
J5JA21_BEAB2/104-534...........................................RLPEAAVEWQRA-------------------------
V5FG66_BYSSN/161-604...........................................KIEAATAAYAAA-------------------------
I2H4A8_TETBL/339-898ITNKNCLKSYNDYNNKDNNENNNNNDRYHSNKSTDSKVENKKPLIYQYQDMFKET-------------------------
G4U9V0_NEUT9/109-529...........................................RLPQAAAQWARQ-------------------------
J4HS73_FIBRA/136-570............................................LSELSAEFDRV-------------------------
A0A098D4P8_GIBZA/98-520...........................................RLPLDTLEWQRA-------------------------
R7YHW5_CONA1/139-554...........................................ALPSAIVGYAAR-------------------------
Q5KFU1_CRYNJ/229-746...........................................SFDQYTARFARD-------------------------
W1QEY3_OGAPD/185-592...........................................DVYKDSNLFKQH-------------------------
H1V255_COLHI/104-533...........................................NLPKASLEWQKT-------------------------
T5A616_OPHSC/95-515...........................................HLPSASQEWQRA-------------------------
D5G9F0_TUBMM/127-587.........................KFFPSIPLPITIVLTDQPRLHTLIPIYNTL-------------------------
M7TWW8_EUTLA/45-472...........................................ELPRASQAWARA-------------------------
G0SXZ9_RHOG2/78-582...........................................RLPSLVASFSDI-------------------------
C0NJI2_AJECG/153-591...........................................KLAQAAEVYEAA-------------------------
G1WZV0_ARTOA/142-590...........................................RLVSQSIVFARL-------------------------
M7X5H8_RHOT1/78-583...........................................RLPSLVASFSDT-------------------------
NPR3_DEBHA/205-647...........................................KFHHDIFIFKKT-------------------------
K0KSM9_WICCF/157-573...........................................YINEDMKSFRHD-------------------------
S9VYA1_SCHCR/73-478...........................................KLESDARLFART-------------------------
K1XTL5_MARBU/116-531...........................................KLPVASLAWKKA-------------------------
G8YSZ2_PICSO/187-642...........................................RLYEDISKFKDM-------------------------
V2XGE3_MONRO/83-522............................................LSQLIKEFERD-------------------------

PF06218

M3IIL9_CANMX/8-518-------------------------------------------KMAEECQAYVVATETNTTETPFYS....NASSQIHS.
M2UFV8_COCH5/4-472-------------------------------------------EVKDECMRYVRVPRMKL....................
Q6BQE8_DEBHA/7-469-------------------------------------------NIAEECQAYIITNEPNLL.NELPV....NEDSDIQS.
Q0U9Y5_PHANO/4-462-------------------------------------------DVKDECARYIRVPRLRL....................
G3AQK3_SPAPN/8-551-------------------------------------------KMAEECQAYVVTSESNIEGSSYFS....HTPSTYHN.
W6RQZ3_CAEEL/186-593-------------------------------------------EIND.CLEFVKIQ........................
A5DQL3_PICGU/6-475-------------------------------------------DIAEDCQAYIVTDSGERL.ADLPTGSMENSASGVSSV
K1Y0B6_MARBU/2-405-------------------------------------------GLQDECANYVYINGPRL....................

PF03666

S8E9R2_FOMPI/133-565-------------------------------------------------------------------FAEHDVPPLPKIL
C5FU53_ARTOC/155-599-------------------------------------------------------------------F..PTLPSLPKML
L8FQS0_PSED2/112-539-------------------------------------------------------------------F..PLAPPLPTLL
H2AZX0_KAZAF/181-685-------------------------------------------------------------------F..PSLPTLSYFL
R9P8J9_PSEHS/205-717-------------------------------------------------------------------F..PDLAPLPVFL
F8PYL6_SERL3/132-564-------------------------------------------------------------------FPHPSIPHLPTIL
N1J4X2_BLUG1/150-556-------------------------------------------------------------------F..PTAPSLRSFL
E9EL47_METRA/99-518-------------------------------------------------------------------F..PLAPPLPNFL
M9MFA0_PSEA3/199-702-------------------------------------------------------------------F..PELAPLPVFL
NPR3_CANGA/243-797-------------------------------------------------------------------F..PSLPSLPTFL
H6BW23_EXODN/130-559-------------------------------------------------------------------F..PMMPSLPKML
G8BZL7_TETPH/286-791-------------------------------------------------------------------F..PSLPSLVSFL
G0WEJ7_NAUDC/230-810-------------------------------------------------------------------F..PLLPTLENML
R8BC65_TOGMI/105-536-------------------------------------------------------------------F..PFAPPLPNFL
V5ETE4_PSEBG/203-712-------------------------------------------------------------------F..PDVAPLPVFL
G8JWB1_ERECY/316-852-------------------------------------------------------------------F..PTLPTLPSFL
C4QYA8_PICPG/201-611-------------------------------------------------------------------F..PSLPVLSKFL
G8BGC4_CANPC/198-622-------------------------------------------------------------------F..PTLPSLPHFL
G0VDK5_NAUCC/193-728-------------------------------------------------------------------F..SSLPSLPILL
S2K004_MUCC1/105-579-------------------------------------------------------------------I..PNL.SLPVLL
NPR3_EMENI/170-616-------------------------------------------------------------------F..PTLPSLPKML
E7KD88_YEASA/399-966-------------------------------------------------------------------F..PSLPSLPIFL
B8N792_ASPFN/172-617-------------------------------------------------------------------F..PTLPSLPKML
U1GT46_ENDPU/116-550-------------------------------------------------------------------F..PTLPSLPKML
D8PLZ6_SCHCM/127-556-------------------------------------------------------------------FTDPSVASLPEIL
I2G095_USTH4/203-726-------------------------------------------------------------------F..PDMVPLPVFL
S6E8H4_ZYGB2/281-781-------------------------------------------------------------------F..PTLPSLPSFL
NPR3_PHANO/150-598-------------------------------------------------------------------F..PTLPTLPKVL
U7Q027_SPOS1/110-529-------------------------------------------------------------------F..PFAPPLPDLL
A0A0C4E2D4_MAGP6/120-591-------------------------------------------------------------------F..PHCPPLPNIL
S8B047_PENO1/186-645-------------------------------------------------------------------F..PTLPSLPKML
C5DHQ6_LACTC/241-731-------------------------------------------------------------------F..PSLPPLPVFL
E9D3F7_COCPS/142-585-------------------------------------------------------------------F..PTMPSLPKML
U4LL48_PYROM/132-582-------------------------------------------------------------------F..PTMPGLEKML
K2SR44_MACPH/175-626-------------------------------------------------------------------F..PTLPSLPKML
S8BNA5_DACHA/141-592-------------------------------------------------------------------F..PALPPLPKML
D6RLY8_COPC7/119-572-------------------------------------------------------------------FNHPAIPSLPRIL
U5HEM2_USTV1/112-634-------------------------------------------------------------------F..QDLPSLPVLL
G4MPF6_MAGO7/119-567-------------------------------------------------------------------F..PHCPPLPNIL
A0A0D1CR33_USTMA/205-718-------------------------------------------------------------------F..PDVAPLPVFL
B6H909_PENCW/169-617-------------------------------------------------------------------F..PTYPSLPKML
NPR3_ASPFU/179-636-------------------------------------------------------------------F..PTLPSLPKML
C5DQJ7_ZYGRC/281-783-------------------------------------------------------------------F..PTLPSLPSFL
C4JQY3_UNCRE/143-587-------------------------------------------------------------------F..PTMPSLPKML
E7A1P0_SPORE/203-720-------------------------------------------------------------------F..PDVAPLPVFL
G8ZWI0_TORDC/270-767-------------------------------------------------------------------F..PSLPSLISFL
C1GWB7_PARBA/152-590-------------------------------------------------------------------F..PTLPSLPKML
B2ALS2_PODAN/100-533-------------------------------------------------------------------F..PLVPALPSFL
G0RDM3_HYPJQ/95-508-------------------------------------------------------------------F..PLAPPLSTFL
B6QRZ0_PENMQ/155-594-------------------------------------------------------------------F..PTLPSLPKML
J8Q1I2_SACAR/396-963-------------------------------------------------------------------F..PLLPALPIFL
J7RBT2_KAZNA/205-696-------------------------------------------------------------------F..SSLPSLAYFL
M1VZL7_CLAP2/99-560-------------------------------------------------------------------F..PQAPTLPNFL
F4P7C7_BATDJ/218-654-------------------------------------------------------------------F..PQM.ELVRIL
NPR3_KLULA/205-723-------------------------------------------------------------------F..PSLPSLPSFL
A7TP53_VANPO/308-811-------------------------------------------------------------------F..PSLPPLVSFL
NPR3_ASHGO/273-791-------------------------------------------------------------------F..PTLPTLPSFL
G2R1J8_THITE/107-555-------------------------------------------------------------------F..PLSPALPNFL
J5JA21_BEAB2/104-534-------------------------------------------------------------------F..PLAPPLANLL
V5FG66_BYSSN/161-604-------------------------------------------------------------------F..PTLPSLPKML
I2H4A8_TETBL/339-898-------------------------------------------------------------------F..PSLPILPLFL
G4U9V0_NEUT9/109-529-------------------------------------------------------------------F..PLSPPLPNFL
J4HS73_FIBRA/136-570-------------------------------------------------------------------FASSGVPPLSKLV
A0A098D4P8_GIBZA/98-520-------------------------------------------------------------------F..PLAPPLPNFL
R7YHW5_CONA1/139-554-------------------------------------------------------------------F..PTLPPLMKML
Q5KFU1_CRYNJ/229-746-------------------------------------------------------------------F..PDLPPFPRFI
W1QEY3_OGAPD/185-592-------------------------------------------------------------------F..PNLPPLANFL
H1V255_COLHI/104-533-------------------------------------------------------------------F..PLAPPLTNFL
T5A616_OPHSC/95-515-------------------------------------------------------------------F..PVAPPLPNFL
D5G9F0_TUBMM/127-587-------------------------------------------------------------------F..PTLQPLPKLL
M7TWW8_EUTLA/45-472-------------------------------------------------------------------F..PLAPPLPNFL
G0SXZ9_RHOG2/78-582-------------------------------------------------------------------F..PNLPPLPVLL
C0NJI2_AJECG/153-591-------------------------------------------------------------------F..PTLPSLPKML
G1WZV0_ARTOA/142-590-------------------------------------------------------------------F..PALPPLPKML
M7X5H8_RHOT1/78-583-------------------------------------------------------------------F..PALPPLPVLL
NPR3_DEBHA/205-647-------------------------------------------------------------------F..PALPSLPHFL
K0KSM9_WICCF/157-573-------------------------------------------------------------------F..PSLPSLPSFI
S9VYA1_SCHCR/73-478-------------------------------------------------------------------F..PSLPSLPTFL
K1XTL5_MARBU/116-531-------------------------------------------------------------------F..PLAPSLSNFL
G8YSZ2_PICSO/187-642-------------------------------------------------------------------F..PTMPSLPHFL
V2XGE3_MONRO/83-522-------------------------------------------------------------------FSESNLPPLPQIL

PF06218

M3IIL9_CANMX/8-518PHPGNGDHLPTYNYKQSF.GSASVSPYT................KTNFLSKSPKNTIFGNA...HTEVQVPTKTTLFYLY
M2UFV8_COCH5/4-472...................GPNAKSAVG................STLKISEFDAHIAAQKKEEEEEKAIQTSHETLITLY
Q6BQE8_DEBHA/7-469...............STF..PNSASPTS................KHSSIFKASKKKFSGET......TVIPSKASLFYLY
Q0U9Y5_PHANO/4-462...................GSAATAS..................TTILEHPSPSSPTAASTDDDKEEEWHIPHTTLIHLY
G3AQK3_SPAPN/8-551............NNTSSFHGSNSVSPYSTAGLKYDSVSSSYPKPSSSYLSKSPKTV..GNSPNISVNVKVPTKTTLFYLY
W6RQZ3_CAEEL/186-593........................................................TEIGADGSEIPTRTPEFSDVFRLY
A5DQL3_PICGU/6-475VGSAPLQRSSEASPVSTF...NSVSPLA................RTSYFSSSSATTAKPRT......IHVPSKATLFYLY
K1Y0B6_MARBU/2-405.......................................................................PNFYLCRLF

PF03666

S8E9R2_FOMPI/133-565SMVSMSIHQQSA.........NHFYGTVVGS..KER..IPL---------YQDVVVWMLKRDLLLTLHLRIRI-------
C5FU53_ARTOC/155-599SALSCGS..............PRPYYSFIPS..RDH..KEV---------YYEILAWLVRGGWVTQLRTFGWV-------
L8FQS0_PSED2/112-539SALS.HA..............PRPYKTFIPT..KTH..RPI---------YTAMLAFLLRHGWATQLRTFAWI-------
H2AZX0_KAZAF/181-685SKLSGGKSSINTSKDGDDIKWPYSFNNIIPS..REH..KGI---------YLDVLSWLIRRGYVTQLLTFVYI-------
R9P8J9_PSEHS/205-717SQLSSST..............SRTLSNLLPA..RHQ..KEL---------ALDVLIWLLRRDVVVKMHVRLRL-------
F8PYL6_SERL3/132-564SNVSTATSKQSD.........NHFFATVVQS..KEL..IPL---------YHDVVLWMLKHELLLTLHLRIRI-------
N1J4X2_BLUG1/150-556SALS.TD..............PRPYKTFLPS..RDH..RLV---------YIEMLSWLIRGGWVTQLRTFAWI-------
E9EL47_METRA/99-518SELS.YT..............PRPYKTFCPS..KPH..RPL---------YLRMLAWLLRGGWVTQLCTFAYV-------
M9MFA0_PSEA3/199-702SQLSSS...............SRALSALFPG..RHQ..REL---------ALEVLIWLLRRDVVVKMHIRLRL-------
NPR3_CANGA/243-797NILSLGK..............PKAFGNIIPS..KEH..KPI---------YMAALIWLIQKGYLTQLLTFVYI-------
H6BW23_EXODN/130-559NSLS.GT..............PVPYGTLIPS..SDH..KEE---------YYRVLAWLMRDGWVTQLRTFAFV-------
G8BZL7_TETPH/286-791SLLSNGK..............PRPFGTIIPS..KEH..KPI---------YLGALAWLIRSGYLTQLLTYVCI-------
G0WEJ7_NAUDC/230-810SIISNNGTGK...........VECFNNIIPT..REH..KPT---------YLGALAWLIRYGYVTPLLSFIYI-------
R8BC65_TOGMI/105-536ADLS.AA..............PRLYKTFSPG..KSY..RPA---------YLTMLAWLMRGGWVTQLCTFAYV-------
V5ETE4_PSEBG/203-712SQLSSS...............SRAFYALFPA..RHQ..REL---------ALDVLIWLLRREVVVKMHIRLRL-------
G8JWB1_ERECY/316-852SSISTLK..............PRSFGHLIPS..KEH..KFL---------YLNALSWLIRYGYLTQLLTFVWI-------
C4QYA8_PICPG/201-611SLLSTSSNK............PKQISRFIPS..KDH..RDL---------YLDAVSWLLKKGYILQLHTFLFL-------
G8BGC4_CANPC/198-622KLLSPKSRK............PQQFAASIPS..RDH..RDS---------YMRALAWLNRFGYATQQLTFIWL-------
G0VDK5_NAUCC/193-728SSISKNSEQN...........KMFFNNVIPS..KEH..KPI---------YLGALAWLIKHGYMTQLLTFIYI-------
S2K004_MUCC1/105-579SKLSH................AQQYHLVYHV..KEL..KNQ---------YLEAITYLIRKDLVVQLHMYLVL-------
NPR3_EMENI/170-616SALS.GT..............PRPYGNFIPS..KDH..KAT---------YFLILAWLLRGGWVTQLRSFARV-------
E7KD88_YEASA/399-966SLLSTDK..............PQAYSNIIPS..REH..KPV---------YLNALAWLIQYGYVTQLLTFINI-------
B8N792_ASPFN/172-617SALS.GT..............PRPYGSFIPS..KDH..KEA---------YFAILAWLLRGGWVTQLRTFARV-------
U1GT46_ENDPU/116-550QALS.GI..............PRPYSSLIPS..KDH..KQA---------YFRILAWLLRGGWVTQLRSFAFV-------
D8PLZ6_SCHCM/127-556SLISTAPSKQSD.........NHFYATVVQS..RDL..IPI---------YHDVVLWMLKRGLLIRLSLRIRI-------
I2G095_USTH4/203-726SQLSSS...............ARPLSTYFPS..RHQ..REL---------ALDVLIWLLRREVVVKMHIRLRL-------
S6E8H4_ZYGB2/281-781QLLSTGR..............PKPYGNIIPS..KEH..KSI---------YLGALSWLLRYGYVTQLLTFVCI-------
NPR3_PHANO/150-598NMLS.GT..............PRPFRNFIPT..TEH..REA---------YMDILAWLMRGGWVTQLRTFAWV-------
U7Q027_SPOS1/110-529ASLS.SA..............PRPYKSFCPT..KSL..RPA---------YLRILAWLIRGGWVCQLCTFAYV-------
A0A0C4E2D4_MAGP6/120-591ADLS.AA..............PRPYKFFCPN..KTI..RAE---------YMRILTWLMRGGWVTQLCTFAYV-------
S8B047_PENO1/186-645SALS.GT..............PRPYGSFIPS..KDH..KET---------YFSILAWLLRGGWVTQLRSFARV-------
C5DHQ6_LACTC/241-731SLVSSMK..............PRAFGSIIPS..KDH..KSV---------YLSALAWLIRYGYLTQLLTFAWV-------
E9D3F7_COCPS/142-585AVLS.GT..............PRPYASFIPS..RDH..KGI---------YYDILAWLMRGGWVTQLRTFGWI-------
U4LL48_PYROM/132-582GMLS.GP..............PRSFASFIPS..KDH..RGA---------YLEILAWLIRHSLVTELRTFAWI-------
K2SR44_MACPH/175-626SLLSNQS..............PRTYGTIIPS..KDH..RTA---------YMEILAWLMRGGWVTQLRTFAWI-------
S8BNA5_DACHA/141-592SLLS.GK..............PRPYSAYIPS..KDH..RQA---------YMEMLAWLMRYGWVTNLLTFAFL-------
D6RLY8_COPC7/119-572AAISYSLAQQSN.........NHFFAAVVQR..KEL..IPM---------YHDVVLWMLKRELLITLHLRIRI-------
U5HEM2_USTV1/112-634SKLSP................SAPFSSVIPP..DSRPLRTT---------YYNALLFLLRNNLVEKQRTFVRL-------
G4MPF6_MAGO7/119-567TDLS.AA..............PRPYKFFCPN..KTI..RAE---------YMRILAWLMRGGWVTQLCTFAYV-------
A0A0D1CR33_USTMA/205-718SQLSSST..............SRTLSNLFPA..RHQ..REL---------ALEVLIWLLRHEVVVKMHIRLRL-------
B6H909_PENCW/169-617STLS.GT..............PRPYSNFIPS..KDH..KEI---------YFTILAWLLRGGWVTQLRTFARI-------
NPR3_ASPFU/179-636SALS.GT..............PRPYGSFIPS..KDH..KET---------YFAILAWLLRGGWVTQLRSFARV-------
C5DQJ7_ZYGRC/281-783HLLSNGK..............PKPYGNIIPS..KEH..KSI---------YLGALAWLLKYGYVTQLLTFVCI-------
C4JQY3_UNCRE/143-587AMLS.GT..............PRPYAYFIPS..REH..KDV---------YYDILAWLMRGGWVTQLRTFGWL-------
E7A1P0_SPORE/203-720SQLSSS...............SRALSALFPA..RHQ..REL---------ALDVLVWLLRHDVVVKMHIRLRL-------
G8ZWI0_TORDC/270-767NLLSCKK..............PKPFGSIIPS..KEH..KPI---------YLGALTWLMRYGYVTQLLTFVCI-------
C1GWB7_PARBA/152-590HALS.DT..............PKPYSRLIPS..RDH..KET---------YYDILAWLLRGGWVTQLRTFGWV-------
B2ALS2_PODAN/100-533AELS.VA..............PRPYKLHCPS..KAH..RPT---------YMAMLAWLIRGGWVTQICTFAYV-------
G0RDM3_HYPJQ/95-508AELS.VL..............PRPYKHISPS..KAH..RPL---------YLRMLAWLMRGGWVTQLCTFAYV-------
B6QRZ0_PENMQ/155-594SALS.GT..............PRPYATFIPS..KDH..KET---------YFAILAWLLRGGWVTQLRTFSRV-------
J8Q1I2_SACAR/396-963NLISADK..............PQAYNNIIPS..REH..RPI---------YLNALAWLIKFGYATQLLTFINI-------
J7RBT2_KAZNA/205-696SRLSGSTSMENAQNGGTH...PRQFGALIPS..KEH..KGA---------YLNALSWLVRHGYVCQLLTFALI-------
M1VZL7_CLAP2/99-560SELS.QA..............PRPFKSFCPS..KPQ..RPL---------YLSMLAWLLRGGWVTQLCTFAYV-------
F4P7C7_BATDJ/218-654QDLSI................PRPYSAIAHS..KEN..RNL---------YLEIITFLLRKNLVVQLHMYIYL-------
NPR3_KLULA/205-723QLMSTQK..............PRPFGHIIPS..NEH..KSM---------YLNALAWLMRYGYLTQLLTFVYV-------
A7TP53_VANPO/308-811SLLSNGK..............PHPFGTIIPS..KEH..KPI---------YLGALAWLIRYGYVTQLFTYVCI-------
NPR3_ASHGO/273-791SSISTCK..............PRSFGHLIPS..KDH..NLL---------YLSVLAWLIRYGYLTQLLTFVWL-------
G2R1J8_THITE/107-555AELS.VA..............PRPYKLHCPS..KAH..RPV---------YMAMLAWLMRGGWVTQLCTFAYV-------
J5JA21_BEAB2/104-534SDMS.VC..............PRPYKTFCPS..KVH..RPL---------YLRMLAWLMRGGWVTQLCTFAYV-------
V5FG66_BYSSN/161-604SALS.RT..............PRPYGSFIPS..NDH..KEA---------YFSILAWLLRGGWVTQLRAFARV-------
I2H4A8_TETBL/339-898NLLSNGK..............PKPYGIIIPS..KDH..KPI---------YLKALSWLLRNGFVYQQLTFICI-------
G4U9V0_NEUT9/109-529AELS.VA..............PRPYKLHCPS..KAH..RPL---------YMAMLAWLMRGGWVTQLCTFAYV-------
J4HS73_FIBRA/136-570SVVSMASQQQSA.........NHFFATVVKS..KDL..IPL---------YEDVVIWMLKRDLLITLHLRIRI-------
A0A098D4P8_GIBZA/98-520AELS.QA..............PRPYKQFSPS..KAH..RPT---------YLLMLAWLMRRGWVTQLCTFAYV-------
R7YHW5_CONA1/139-554ERLS.GA..............PRPYGSFIPS..KDH..RSA---------YMEILAWLMRGGWVTQLRTFAWV-------
Q5KFU1_CRYNJ/229-746SAISLS...............PIPFRKVIPNPDPDHATREK---------YMSALLWLLKQDLVVQVHTRARV-------
W1QEY3_OGAPD/185-592SLISSSSSK............PRPINTIIPS..KDH..RDL---------YLDAVAWLLRHGYITQLQTFLYL-------
H1V255_COLHI/104-533AELS.YA..............PRPYKHFCPS..KAH..RPT---------YLAMLAWLMRGAWVTQLCTFAYV-------
T5A616_OPHSC/95-515AELS.MC..............PKPYKTFCPS..KAH..RQL---------YLRMLAWLMRGGWVTQLCTFGYV-------
D5G9F0_TUBMM/127-587TLLS.SK..............PKPFSAFIPS..RAH..RPA---------YLEILAFLIRHGLATQLRNFAWL-------
M7TWW8_EUTLA/45-472ADLS.TA..............PRHYKWHSPS..KNH..RPA---------YLAMLAWLMRGGWVTQLCTFAYV-------
G0SXZ9_RHOG2/78-582SQLSP................AEPFASIVPS..AQ...RAS---------YLNALVWLLQHEVVEKQRTYVRI-------
C0NJI2_AJECG/153-591HALS.DT..............PKPYSRLIPS..RDH..KDT---------YYAILAWLLRGGWVTQLRTFGWV-------
G1WZV0_ARTOA/142-590SLLS.GK..............PRPYSAYIPS..KDH..RQA---------YMDMLAWLMRYGWVTNLLTFAYL-------
M7X5H8_RHOT1/78-583SQLSP................AEPFASIVRS..AQ...RAS---------YLNALVWLLQHEVVEKQRTYVRI-------
NPR3_DEBHA/205-647KLLSNSSK.............PRQLATVIPS..KDH..RDA---------YLNALSWLIRYGYVTQLHTFIWL-------
K0KSM9_WICCF/157-573SLISTSK..............PRQYSAIIPS..RDH..RDL---------YLEALAWLIRHGYVTQLMTFVWL-------
S9VYA1_SCHCR/73-478AILSFK...............PRPFVSIIPS..KDH..EST---------YLEMLAWLCRRNWVYEQNSYIYV-------
K1XTL5_MARBU/116-531ATLS.VA..............PRQYKIHAPS..KDH..RPT---------YLDMLAWLIRGGWVTQLRSFAWI-------
G8YSZ2_PICSO/187-642ALLSSPSKK............PRQFASIIPS..KDH..KDI---------YLLALAWLIRHGYVTQLLTFIWL-------
V2XGE3_MONRO/83-522SAISTSSANQSG.........NHFFASVVQS..KDM..IPT---------YHEVVVWMLKRDMLTTLHLRIRI-------

PF06218

M3IIL9_CANMX/8-518RSLNQ...............-....GQTVKEWYIQQ--SKL....LANIDIRRFINFGILRGIIYRVYSYPLLNS.....
M2UFV8_COCH5/4-472TSLRQ...............-....GLTLKNWVLEN--LDL....LSGIDVRRLITFGVIKGFLYRHLQQQQQSSPHHLG
Q6BQE8_DEBHA/7-469RSLNQ...............-....GQTVKEWYMQH--RKY....LNNIDVRRFINFGVIRGILYRVHSYPILNS.....
Q0U9Y5_PHANO/4-462TSLRQ...............-....GLTLKNWVLAN--LSH....LPGIDVRRLITFGVIKGFVYRVHKYAIASTSAGST
G3AQK3_SPAPN/8-551RSLNQ...............-....GQTVKEWYIQH--RKL....LTSIDIRRFINFGVLRGIIYRVHSYPLVNS.....
W6RQZ3_CAEEL/186-593LSMKVVGPKLPIDESDSNRL-RFQCGNNLAEWADLE--KPR....SMGIDEQRLVQFGMHHQFLRKLSKYPICVANPGNN
A5DQL3_PICGU/6-475RSLNQ...............-....GQTIREWYVQH--RKQ....LQFIDVRRFITFGVLRGLIYRVHSYPISDP.....
K1Y0B6_MARBU/2-405TSLAT...............-....SRTVKEWLKLH--IDQGFPVLNFVDVRRFIQFGIIKGLIYRVHKYAVSPA.....

PF03666

S8E9R2_FOMPI/133-565-------------------------------------------------------------------VATEELKH-----
C5FU53_ARTOC/155-599-------------------------------------------------------------------KVSPEVKS-----
L8FQS0_PSED2/112-539-------------------------------------------------------------------IAWPEIKY-----
H2AZX0_KAZAF/181-685-------------------------------------------------------------------RIDKRIKI-----
R9P8J9_PSEHS/205-717-------------------------------------------------------------------VATESVMR-----
F8PYL6_SERL3/132-564-------------------------------------------------------------------VATSELKK-----
N1J4X2_BLUG1/150-556-------------------------------------------------------------------QVWPEIQY-----
E9EL47_METRA/99-518-------------------------------------------------------------------VVWPEILY-----
M9MFA0_PSEA3/199-702-------------------------------------------------------------------FATEAVKR-----
NPR3_CANGA/243-797-------------------------------------------------------------------RVDKKIKM-----
H6BW23_EXODN/130-559-------------------------------------------------------------------RVGPEVKK-----
G8BZL7_TETPH/286-791-------------------------------------------------------------------RIDSQIKM-----
G0WEJ7_NAUDC/230-810-------------------------------------------------------------------RVDKKIKM-----
R8BC65_TOGMI/105-536-------------------------------------------------------------------VVWPEIIY-----
V5ETE4_PSEBG/203-712-------------------------------------------------------------------IATESVKR-----
G8JWB1_ERECY/316-852-------------------------------------------------------------------RVDRRIKV-----
C4QYA8_PICPG/201-611-------------------------------------------------------------------IISKEIKM-----
G8BGC4_CANPC/198-622-------------------------------------------------------------------KIARKIKI-----
G0VDK5_NAUCC/193-728-------------------------------------------------------------------RVDKRIKM-----
S2K004_MUCC1/105-579-------------------------------------------------------------------LVPPNKKQ-----
NPR3_EMENI/170-616-------------------------------------------------------------------KVSPEIKM-----
E7KD88_YEASA/399-966-------------------------------------------------------------------RVDKHIKM-----
B8N792_ASPFN/172-617-------------------------------------------------------------------KVSPEIKM-----
U1GT46_ENDPU/116-550-------------------------------------------------------------------RIDSSIKI-----
D8PLZ6_SCHCM/127-556-------------------------------------------------------------------VATRELKE-----
I2G095_USTH4/203-726-------------------------------------------------------------------IATENVKR-----
S6E8H4_ZYGB2/281-781-------------------------------------------------------------------RVDRQIKM-----
NPR3_PHANO/150-598-------------------------------------------------------------------RVTPEIKA-----
U7Q027_SPOS1/110-529-------------------------------------------------------------------VVWPEIQY-----
A0A0C4E2D4_MAGP6/120-591-------------------------------------------------------------------VVWPEIIY-----
S8B047_PENO1/186-645-------------------------------------------------------------------KVSPEIKL-----
C5DHQ6_LACTC/241-731-------------------------------------------------------------------RVDSRIKI-----
E9D3F7_COCPS/142-585-------------------------------------------------------------------KVDQELKS-----
U4LL48_PYROM/132-582-------------------------------------------------------------------KIPRHIKQ-----
K2SR44_MACPH/175-626-------------------------------------------------------------------RVSPEVQA-----
S8BNA5_DACHA/141-592-------------------------------------------------------------------KIPKDIKV-----
D6RLY8_COPC7/119-572-------------------------------------------------------------------VVTPEIKQ-----
U5HEM2_USTV1/112-634-------------------------------------------------------------------IASEAIKK-----
G4MPF6_MAGO7/119-567-------------------------------------------------------------------VVWPEIIY-----
A0A0D1CR33_USTMA/205-718-------------------------------------------------------------------IATESVKR-----
B6H909_PENCW/169-617-------------------------------------------------------------------KVSPEIKM-----
NPR3_ASPFU/179-636-------------------------------------------------------------------KVTPEIKM-----
C5DQJ7_ZYGRC/281-783-------------------------------------------------------------------RVDRQIKM-----
C4JQY3_UNCRE/143-587-------------------------------------------------------------------KVDPEVKS-----
E7A1P0_SPORE/203-720-------------------------------------------------------------------IATEAVKR-----
G8ZWI0_TORDC/270-767-------------------------------------------------------------------RVDKQIKM-----
C1GWB7_PARBA/152-590-------------------------------------------------------------------RVSPEIKQ-----
B2ALS2_PODAN/100-533-------------------------------------------------------------------VVWPEIIY-----
G0RDM3_HYPJQ/95-508-------------------------------------------------------------------VVWPEILY-----
B6QRZ0_PENMQ/155-594-------------------------------------------------------------------KVTPEIKF-----
J8Q1I2_SACAR/396-963-------------------------------------------------------------------RVDKHIKM-----
J7RBT2_KAZNA/205-696-------------------------------------------------------------------RIDRKIKI-----
M1VZL7_CLAP2/99-560-------------------------------------------------------------------VVWPEILY-----
F4P7C7_BATDJ/218-654-------------------------------------------------------------------SVPARLLA-----
NPR3_KLULA/205-723-------------------------------------------------------------------RVDKRIKI-----
A7TP53_VANPO/308-811-------------------------------------------------------------------RVDKQIKM-----
NPR3_ASHGO/273-791-------------------------------------------------------------------RVDRRIKI-----
G2R1J8_THITE/107-555-------------------------------------------------------------------VVWPEIIY-----
J5JA21_BEAB2/104-534-------------------------------------------------------------------VVWPEIIY-----
V5FG66_BYSSN/161-604-------------------------------------------------------------------KITPEVKM-----
I2H4A8_TETBL/339-898-------------------------------------------------------------------RVDKQVKM-----
G4U9V0_NEUT9/109-529-------------------------------------------------------------------VVWPEIIY-----
J4HS73_FIBRA/136-570-------------------------------------------------------------------VATEELKD-----
A0A098D4P8_GIBZA/98-520-------------------------------------------------------------------VVWPEILY-----
R7YHW5_CONA1/139-554-------------------------------------------------------------------RVSAKVKG-----
Q5KFU1_CRYNJ/229-746-------------------------------------------------------------------FAKSEIKV-----
W1QEY3_OGAPD/185-592-------------------------------------------------------------------RITKEVKI-----
H1V255_COLHI/104-533-------------------------------------------------------------------VVWPEIIY-----
T5A616_OPHSC/95-515-------------------------------------------------------------------VVWPEILY-----
D5G9F0_TUBMM/127-587-------------------------------------------------------------------RVTRQIKR-----
M7TWW8_EUTLA/45-472-------------------------------------------------------------------VVWPEILY-----
G0SXZ9_RHOG2/78-582-------------------------------------------------------------------VASEEIKR-----
C0NJI2_AJECG/153-591-------------------------------------------------------------------RVDPEIKR-----
G1WZV0_ARTOA/142-590-------------------------------------------------------------------KIPKDIKV-----
M7X5H8_RHOT1/78-583-------------------------------------------------------------------VASEEIKR-----
NPR3_DEBHA/205-647-------------------------------------------------------------------KISRKIKM-----
K0KSM9_WICCF/157-573-------------------------------------------------------------------KISNRIKL-----
S9VYA1_SCHCR/73-478-------------------------------------------------------------------CVTPEIKE-----
K1XTL5_MARBU/116-531-------------------------------------------------------------------LVWPEIIY-----
G8YSZ2_PICSO/187-642-------------------------------------------------------------------KVSKKVKI-----
V2XGE3_MONRO/83-522-------------------------------------------------------------------VATAQLKA-----

PF06218

M3IIL9_CANMX/8-518......................................ITSSIERDDTKTYDELMNKLKRKKSRR..KVNLGPHNDNLLK
M2UFV8_COCH5/4-472APKTEEAHHQLLHNSGIIDDRDTSG...........LPLLKFL..DGMHCFDEICTDL.........GLAERVVEGKIRG
Q6BQE8_DEBHA/7-469......................................LTKSLENKNDNELDKIIDLFKAKTNPNVYPVNESLANKSLLK
Q0U9Y5_PHANO/4-462APPTSLA..........TSTREETGAEGMGMGTENALPMLRFL..DGLCCFDQICVEL.........GVPERTVEGRVKG
G3AQK3_SPAPN/8-551......................................LTRSIESGDLAQYDEFLGSYKEKKSKK..KVKVKHTDESLLK
W6RQZ3_CAEEL/186-593T.....................................LLKRC..NGKTSIDELSLQH.........NVDPEQLCSLLEE
A5DQL3_PICGU/6-475......................................LVKAIESDTLQELDEAMKEKIEKLKERT.KSNSHVNNPRVVR
K1Y0B6_MARBU/2-405............YVKSLVTGRNKVGGADL.........MLKYL..NGCHSFDQIVTEN.........NIGEPKIREHLRK

PF03666

S8E9R2_FOMPI/133-565--
C5FU53_ARTOC/155-599--
L8FQS0_PSED2/112-539--
H2AZX0_KAZAF/181-685--
R9P8J9_PSEHS/205-717--
F8PYL6_SERL3/132-564--
N1J4X2_BLUG1/150-556--
E9EL47_METRA/99-518--
M9MFA0_PSEA3/199-702--
NPR3_CANGA/243-797--
H6BW23_EXODN/130-559--
G8BZL7_TETPH/286-791--
G0WEJ7_NAUDC/230-810--
R8BC65_TOGMI/105-536--
V5ETE4_PSEBG/203-712--
G8JWB1_ERECY/316-852--
C4QYA8_PICPG/201-611--
G8BGC4_CANPC/198-622--
G0VDK5_NAUCC/193-728--
S2K004_MUCC1/105-579--
NPR3_EMENI/170-616--
E7KD88_YEASA/399-966--
B8N792_ASPFN/172-617--
U1GT46_ENDPU/116-550--
D8PLZ6_SCHCM/127-556--
I2G095_USTH4/203-726--
S6E8H4_ZYGB2/281-781--
NPR3_PHANO/150-598--
U7Q027_SPOS1/110-529--
A0A0C4E2D4_MAGP6/120-591--
S8B047_PENO1/186-645--
C5DHQ6_LACTC/241-731--
E9D3F7_COCPS/142-585--
U4LL48_PYROM/132-582--
K2SR44_MACPH/175-626--
S8BNA5_DACHA/141-592--
D6RLY8_COPC7/119-572--
U5HEM2_USTV1/112-634--
G4MPF6_MAGO7/119-567--
A0A0D1CR33_USTMA/205-718--
B6H909_PENCW/169-617--
NPR3_ASPFU/179-636--
C5DQJ7_ZYGRC/281-783--
C4JQY3_UNCRE/143-587--
E7A1P0_SPORE/203-720--
G8ZWI0_TORDC/270-767--
C1GWB7_PARBA/152-590--
B2ALS2_PODAN/100-533--
G0RDM3_HYPJQ/95-508--
B6QRZ0_PENMQ/155-594--
J8Q1I2_SACAR/396-963--
J7RBT2_KAZNA/205-696--
M1VZL7_CLAP2/99-560--
F4P7C7_BATDJ/218-654--
NPR3_KLULA/205-723--
A7TP53_VANPO/308-811--
NPR3_ASHGO/273-791--
G2R1J8_THITE/107-555--
J5JA21_BEAB2/104-534--
V5FG66_BYSSN/161-604--
I2H4A8_TETBL/339-898--
G4U9V0_NEUT9/109-529--
J4HS73_FIBRA/136-570--
A0A098D4P8_GIBZA/98-520--
R7YHW5_CONA1/139-554--
Q5KFU1_CRYNJ/229-746--
W1QEY3_OGAPD/185-592--
H1V255_COLHI/104-533--
T5A616_OPHSC/95-515--
D5G9F0_TUBMM/127-587--
M7TWW8_EUTLA/45-472--
G0SXZ9_RHOG2/78-582--
C0NJI2_AJECG/153-591--
G1WZV0_ARTOA/142-590--
M7X5H8_RHOT1/78-583--
NPR3_DEBHA/205-647--
K0KSM9_WICCF/157-573--
S9VYA1_SCHCR/73-478--
K1XTL5_MARBU/116-531--
G8YSZ2_PICSO/187-642--
V2XGE3_MONRO/83-522--

PF06218

M3IIL9_CANMX/8-518TK
M2UFV8_COCH5/4-472M.
Q6BQE8_DEBHA/7-469SI
Q0U9Y5_PHANO/4-462LG
G3AQK3_SPAPN/8-551TK
W6RQZ3_CAEEL/186-593TG
A5DQL3_PICGU/6-475TP
K1Y0B6_MARBU/2-405IA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window