Sequence alignment for CL0437

PF00679

GUF1_SCHPO/451-540ELLEPTVDAT----------------------------------------------------------------------
Q95Y73_CAEEL/633-723VLTEPVMEVQ----------------------------------------------------------------------
GUF1_MAGO7/504-593GFYEPFVAAT----------------------------------------------------------------------
C1L1Y4_LISMC/399-487VKCEPVEDVQ----------------------------------------------------------------------
Q4WCL6_ASPFU/842-931RLMEPIYSCT----------------------------------------------------------------------
Q96WU0_BLAAD/659-746VILEPIMDVS----------------------------------------------------------------------
RRF2M_HUMAN/684-771QVLEPLMNLE----------------------------------------------------------------------
GUF1_PICGU/463-552KLMEPYVNAI----------------------------------------------------------------------
GUF1_OSTLU/451-540EIEEPLVEAT----------------------------------------------------------------------
Q5FDV4_EHRRW/423-511QVLEPIEEVV----------------------------------------------------------------------
RRF2M_ANOGA/641-729RLLEPDMFLE----------------------------------------------------------------------
Q1IH98_KORVE/598-685TLLEPIMNVE----------------------------------------------------------------------
Q83NS0_TROW8/410-497SLHEPYELLT----------------------------------------------------------------------
A4ARW7_MARSH/610-697NLMEPVQELT----------------------------------------------------------------------
Q2S5C1_SALRD/429-517ETREPYETAE----------------------------------------------------------------------
LEPA_DESRM/402-491IIEEPFVKAT----------------------------------------------------------------------
LEPA_CAMHC/398-487MIKEPYSHAT----------------------------------------------------------------------
A1AR09_PELPD/594-681YLLEPIMALE----------------------------------------------------------------------
EF2_METTE/620-707CLLEPYQKVF----------------------------------------------------------------------
A5TRL8_FUSNP/592-680ILLEPVVRME----------------------------------------------------------------------
TETQ_BACFR/535-622DILEPMLCFE----------------------------------------------------------------------
A4BV85_9GAMM/583-670IVLEPLAELV----------------------------------------------------------------------
A5Z4P7_9FIRM/513-598VLLEPYYNFT----------------------------------------------------------------------
A5Z6T1_9FIRM/598-686ILLEPIALLS----------------------------------------------------------------------
EFG_SALCH/611-698VLLEPIMKVE----------------------------------------------------------------------
A8MDB4_CALMQ/627-715TLLEPLLLID----------------------------------------------------------------------
A4BRZ1_9GAMM/403-491EIREPIIQAS----------------------------------------------------------------------
A6DEJ7_9PROT/393-481VKLEPYEYVV----------------------------------------------------------------------
A9KSY1_CLOPH/512-598ILLEPYYSFQ----------------------------------------------------------------------
Q7NGS6_GLOVI/576-666VLLEPIVELD----------------------------------------------------------------------
Q94BR7_ARATH/686-774RMLEPIMRVE----------------------------------------------------------------------
A7BTE3_9GAMM/109-197LVLEPIVKAE----------------------------------------------------------------------
Q1YUM4_9GAMM/396-484KVYEPFEQVV----------------------------------------------------------------------
A7FZA2_CLOB1/594-682TLLEPIMRLE----------------------------------------------------------------------
Q4DGU6_TRYCC/750-839RLVEPVYECT----------------------------------------------------------------------
A4BCQ5_9GAMM/578-666IILEPVVDVQ----------------------------------------------------------------------
Q825F0_STRAW/553-640RVHEPLHRFG----------------------------------------------------------------------
EF2_NANEQ/639-726VLYEPVQVIL----------------------------------------------------------------------
Q8RMN6_9BACI/534-621ELLEPYLSFK----------------------------------------------------------------------
Q6MC59_PARUW/398-486EKYEPIERVH----------------------------------------------------------------------
EFG2_SYNWW/598-685VFLEPVMDLE----------------------------------------------------------------------
A5G260_ACICJ/565-655VLLEPIHRIT----------------------------------------------------------------------
Q381P2_TRYB2/848-937QLLEPVLKVD----------------------------------------------------------------------
A5L3A1_9GAMM/51-139NHHEPYNKCF----------------------------------------------------------------------
Q1VQ31_9FLAO/545-632HLLEPILSFE----------------------------------------------------------------------
Q5GBH8_ENTFL/541-628EILEPYLKYT----------------------------------------------------------------------
Q21YN7_RHOFD/584-672IVLEPLVDIE----------------------------------------------------------------------
Q4N6X5_THEPA/510-600SSEEPWTDVT----------------------------------------------------------------------
Q3DTP4_STRAG/598-685AILEPMMLVT----------------------------------------------------------------------
Q4Y6S3_PLACH/682-769VLLEPIMLVE----------------------------------------------------------------------
Q9AIG7_CARRU/590-678FLLEPIMKVE----------------------------------------------------------------------
Q72IJ8_THET2/563-650VLLEPIYRLK----------------------------------------------------------------------
Q7UQ85_RHOBA/433-520KKHEPFETLR----------------------------------------------------------------------
Q7YYP3_CRYPV/897-986RIYEIYLNLV----------------------------------------------------------------------
Q4FPA2_PELUB/397-485NRLEPIEEIT----------------------------------------------------------------------
A0L3V8_MAGSM/615-702VLLEPLMSME----------------------------------------------------------------------
A6G6E0_9DELT/585-672QLLEPIMRVE----------------------------------------------------------------------
A4E859_9ACTN/521-606VLLEPWYRFE----------------------------------------------------------------------
Q0SU42_CLOPS/519-604KLLEPYYKFK----------------------------------------------------------------------
A3ZLH3_9PLAN/604-691VLLEPIMKLQ----------------------------------------------------------------------
A7VYF9_9CLOT/584-669ILLEPWYAFR----------------------------------------------------------------------
Q5P806_AROAE/584-672IVLEPLVTVT----------------------------------------------------------------------
A5JZM2_PLAVS/561-649NLLEPVEEFH----------------------------------------------------------------------
A0NK81_OENOE/401-489FVEEPFVKAE----------------------------------------------------------------------
Q00WM1_OSTTA/464-553RKTEPLEELI----------------------------------------------------------------------
A5K1M2_PLAVS/827-915RLLEPMMNLN----------------------------------------------------------------------
GUF1_BABBO/505-595VSMEPWTNVT----------------------------------------------------------------------
LEPA_MYCGE/399-488AISEPFVKVF----------------------------------------------------------------------
EFGM_CAEEL/641-728LLLEPIMKVE----------------------------------------------------------------------
EFG_EHRCR/599-686ILLEPIMKVE----------------------------------------------------------------------
EFGM_DANRE/638-725VILEPVMSVE----------------------------------------------------------------------
Q729W6_DESVH/400-488QLLEPVEHLY----------------------------------------------------------------------
A9A4F5_NITMS/619-706AVLEPTLAIE----------------------------------------------------------------------
A8MHU5_ALKOO/394-482GLMEPIEILY----------------------------------------------------------------------
A7S680_NEMVE/415-504EYQEPYVLGT----------------------------------------------------------------------
A0YPA8_LYNSP/395-483QPYEPFEYLV----------------------------------------------------------------------
Q9RXC2_DEIRA/579-666GLLEPVVLLS----------------------------------------------------------------------
A7AQL3_BABBO/720-808RLLEPIMKVN----------------------------------------------------------------------
A9CJ73_AGRT5/541-628FVCEPFDHFH----------------------------------------------------------------------
A9BJK9_PETMO/590-678VILEPIMHVE----------------------------------------------------------------------
Q97J38_CLOAB/542-629VLLEPLYEFE----------------------------------------------------------------------
Q6F0Z6_MESFL/400-487TLLEPMEKVI----------------------------------------------------------------------
A0YMH4_LYNSP/585-675ILLEPIAVVE----------------------------------------------------------------------
A3I5Y0_9BACI/519-604VLLEPYYRFK----------------------------------------------------------------------
LEPA_CHLAB/404-493HMEEPWVHVN----------------------------------------------------------------------
A6C5F4_9PLAN/612-699ALLEPIMKLE----------------------------------------------------------------------
Q0YPH2_9CHLB/398-486TMLEPIEHVT----------------------------------------------------------------------
Q3LWJ5_BIGNA/768-857RILEPYSEIE----------------------------------------------------------------------
A3Q803_MYCSJ/621-709NLLEPVDAVT----------------------------------------------------------------------
Q2KBB2_RHIEC/552-642VLMQPVFRSE----------------------------------------------------------------------
A8F3S7_THELT/400-490KIYEPFVKLS----------------------------------------------------------------------
Q1Q141_9BACT/597-684ILLEPIMSIE----------------------------------------------------------------------
A6DLC3_9BACT/400-489YIEEPVIAAN----------------------------------------------------------------------
A2XK54_ORYSI/887-976RLVEAMYFCE----------------------------------------------------------------------
EFG1_SYNAS/596-683VILEPIMKVV----------------------------------------------------------------------
A7AM19_BABBO/644-731IILEPVMQVE----------------------------------------------------------------------
Q25003_9MICR/731-819ILYEPIFHAE----------------------------------------------------------------------
GUFP_OSTLU/403-492RIEEPYCRLD----------------------------------------------------------------------
OTRA_STRRM/555-642EVHEPVSSFE----------------------------------------------------------------------
LEPA_WIGBR/398-486ELREPIVNCK----------------------------------------------------------------------
LEPA_BUCAP/402-490KIKEPIVECN----------------------------------------------------------------------
GUF1_TRYB2/565-655CYMEPHVTAT----------------------------------------------------------------------
A6G4Z2_9DELT/410-499MIEEPMIIGR----------------------------------------------------------------------
Q9RV32_DEIRA/392-479EKHEPIEHLV----------------------------------------------------------------------
A0CDU0_PARTE/436-524KTLEPMEKVT----------------------------------------------------------------------
Q3LVZ0_BIGNA/720-809RIMEPIFSVF----------------------------------------------------------------------
Q387N2_TRYB2/438-524EMCEPYERVT----------------------------------------------------------------------
A5KT16_9BACT/399-487ILQEPVEELL----------------------------------------------------------------------
A5FQ33_DEHSB/411-499KIHEPVEALT----------------------------------------------------------------------
A4S0M6_OSTLU/604-691KLLEPIMKVD----------------------------------------------------------------------
LEPA_CHLTE/406-495WIEEPYVSMQ----------------------------------------------------------------------
A4EBU6_9ACTN/400-487NKMEPVEQAV----------------------------------------------------------------------
Q3ADH6_CARHZ/573-660VLLEPVMLVE----------------------------------------------------------------------
Q73P52_TREDE/591-679ILLEPIMNLT----------------------------------------------------------------------
Q4CXN3_TRYCC/388-475TLVEPYMDVE----------------------------------------------------------------------
Q6AKJ8_DESPS/591-678VLLEPYMNMV----------------------------------------------------------------------
EF2_SULTO/628-715TLLEPLQKLD----------------------------------------------------------------------
A4A194_9PLAN/587-675VLLEPMADLE----------------------------------------------------------------------
A0Q2C8_CLONN/546-631IILEPIYKFK----------------------------------------------------------------------
Q5JMX4_ORYSJ/461-551ERLEPIEEVT----------------------------------------------------------------------
A7VSS3_9CLOT/592-680TLLEPIGNLK----------------------------------------------------------------------
EFG_PLARO/34-121VILEPLMAVE----------------------------------------------------------------------
A5UPI8_ROSS1/397-485VKYEPIEQVE----------------------------------------------------------------------
A0C124_PARTE/799-888KIMEPMLLTE----------------------------------------------------------------------
A0E802_PARTE/956-1045RLVESVYKCT----------------------------------------------------------------------
A5VM44_LACRD/512-598QLLEPWYAFH----------------------------------------------------------------------
Q5BXM1_SCHJA/221-327HLMEPMMEIE----------------------------------------------------------------------
A0DGW7_PARTE/623-710EILEPVMAVE----------------------------------------------------------------------
A4CM35_ROBBH/393-480QKCEPVESLT----------------------------------------------------------------------
Q820H1_NITEU/395-483EKCEPFEVLT----------------------------------------------------------------------
B2JWX8_BURP8/582-670VLLEPIVNIE----------------------------------------------------------------------
Q4N072_THEPA/424-514NIVEALQRMI----------------------------------------------------------------------
A8FY81_SHESH/586-674VILEPVVEME----------------------------------------------------------------------
GUF1_CAEEL/442-531SFLEPMVKVR----------------------------------------------------------------------
A3LU88_PICST/836-924RLMEPIYSVT----------------------------------------------------------------------
LEPA_ARTS2/411-500EVREPMVSAT----------------------------------------------------------------------
EF2_PYRKO/621-708VLYEPYQKVI----------------------------------------------------------------------
A4YUJ6_BRASO/582-669ILLEPVMRVV----------------------------------------------------------------------
A7ADA9_9PORP/620-707KILEPVYDVE----------------------------------------------------------------------
B4SGB3_PELPB/597-684FLLEPVFALH----------------------------------------------------------------------
Q8KTP5_TREPR/606-694VILEPIMAVE----------------------------------------------------------------------
LEPA_BDEBA/400-489KFEEPYVKVT----------------------------------------------------------------------
TYPA_BUCBP/399-488LIQEPMETVV----------------------------------------------------------------------
Q6CXP1_KLULA/782-874IIMEPIYEVD----------------------------------------------------------------------
Q1NU00_9DELT/397-484VQQEPYEELT----------------------------------------------------------------------
A0D5J3_PARTE/683-779IILEPIMDLE----------------------------------------------------------------------
Q4MLL7_BACCE/540-627YVYEPVNKFE----------------------------------------------------------------------
Q87JC6_VIBPA/578-666IVLEPIVQME----------------------------------------------------------------------
A0C617_PARTE/693-782RLQEPVFLVE----------------------------------------------------------------------
EFG1_BDEBA/606-694ELLEPIFKLE----------------------------------------------------------------------
EF2_ENCCU/731-819ILYEPIYEVE----------------------------------------------------------------------
Q55ME0_CRYNB/490-580HVEEPMINAT----------------------------------------------------------------------
D2BIG2_DEHSV/583-670ILLEPIENMR----------------------------------------------------------------------
A3ZM42_9PLAN/402-491EFLQPIVRVS----------------------------------------------------------------------
Q2G8V2_NOVAD/588-678CLLEPVFRVS----------------------------------------------------------------------
Q74FV3_GEOSL/395-482TKMEPMEYLV----------------------------------------------------------------------
A4QD62_CORGB/423-512KLHEPYEIIV----------------------------------------------------------------------
C0A700_9BACT/633-720ILLEPIMGVE----------------------------------------------------------------------
A4HGQ1_LEIBR/665-751ALLEPMMRVE----------------------------------------------------------------------
Q04U99_LEPBJ/401-489QKLEPYEYLV----------------------------------------------------------------------
EF2_HALMA/620-707KLLEPIQQVR----------------------------------------------------------------------
LEPA_EHRRG/400-488SIKEPWICAT----------------------------------------------------------------------
Q2S3F5_SALRD/609-696VLLEPIHEVT----------------------------------------------------------------------
B9LLE2_CHLSY/601-689IILEPIYNME----------------------------------------------------------------------
A5DX67_LODEL/884-973RLMEPVYRLD----------------------------------------------------------------------
Q4XSF0_PLACH/117-206HIYEPYVKTN----------------------------------------------------------------------
A4Z0F0_BRASO/584-674VLLEPIHTVE----------------------------------------------------------------------
Q5WBK2_BACSK/540-627SVYEPLERIE----------------------------------------------------------------------
A4EB71_9ACTN/620-708VVLEPIEEIT----------------------------------------------------------------------
Q7WT01_9BACE/535-622ELLEPILDFK----------------------------------------------------------------------
A4ES82_9RHOB/546-636VLLQPIMKVS----------------------------------------------------------------------
Q1NJS4_9DELT/398-487RVDEPYIKAT----------------------------------------------------------------------

PF09186

C6BGR5_RALP1/135-190--------------------------------------------------------------------------------
Q1C2C8_YERPA/96-151--------------------------------------------------------------------------------
A4VQI4_PSEU5/132-188--------------------------------------------------------------------------------
Q2G059_STAA8/140-195--------------------------------------------------------------------------------
A6AE70_VIBCL/143-198--------------------------------------------------------------------------------
Q13Q97_BURXL/135-190--------------------------------------------------------------------------------
Q4ZYM8_PSEU2/132-188--------------------------------------------------------------------------------
A0ALK0_LISW6/140-195--------------------------------------------------------------------------------
A1VBZ9_DESVV/146-201--------------------------------------------------------------------------------
A8FHY7_BACP2/140-195--------------------------------------------------------------------------------
A4FXB8_METM5/145-199--------------------------------------------------------------------------------
A5KKP5_9FIRM/161-216--------------------------------------------------------------------------------
Y722_HAEIN/141-196--------------------------------------------------------------------------------
Q9L6L3_SALTY/141-196--------------------------------------------------------------------------------
Q5JF15_PYRKO/139-194--------------------------------------------------------------------------------
A6T3Y8_JANMA/133-188--------------------------------------------------------------------------------
Q12TB2_SHEDO/146-201--------------------------------------------------------------------------------
A2RL93_LACLM/137-192--------------------------------------------------------------------------------
A2SM12_METPP/134-189--------------------------------------------------------------------------------
A3IC74_9BACI/140-195--------------------------------------------------------------------------------
Q49VU7_STAS1/140-195--------------------------------------------------------------------------------
Q0I0T1_SHESR/142-197--------------------------------------------------------------------------------
Q8RAS2_THETN/140-195--------------------------------------------------------------------------------
Q312M8_DESDG/143-198--------------------------------------------------------------------------------
A3Q8U6_SHELP/142-197--------------------------------------------------------------------------------
A1A054_BIFAA/142-197--------------------------------------------------------------------------------
Q5HQY1_STAEQ/140-195--------------------------------------------------------------------------------
A4J830_DESRM/140-195--------------------------------------------------------------------------------
A3N2N7_ACTP2/174-229--------------------------------------------------------------------------------
A0NII2_OENOE/139-194--------------------------------------------------------------------------------
Q0S531_RHOSR/142-195--------------------------------------------------------------------------------
Q8XJ08_CLOPE/138-193--------------------------------------------------------------------------------
Q5H177_XANOR/157-213--------------------------------------------------------------------------------
B1YLL5_EXIS2/141-196--------------------------------------------------------------------------------
Q38YD6_LACSS/139-194--------------------------------------------------------------------------------
A1W832_ACISJ/159-214--------------------------------------------------------------------------------
A5VIF6_LACRD/140-195--------------------------------------------------------------------------------
Q4MM25_BACCE/140-195--------------------------------------------------------------------------------
A7JQV0_PASHA/140-195--------------------------------------------------------------------------------
A0QPN6_MYCS2/140-193--------------------------------------------------------------------------------
Q4JW71_CORJK/159-212--------------------------------------------------------------------------------
Q1BMU3_BURCA/134-189--------------------------------------------------------------------------------
Q2T656_BURTA/142-197--------------------------------------------------------------------------------
A6BHR1_9FIRM/140-195--------------------------------------------------------------------------------
Q8FNW9_COREF/165-220--------------------------------------------------------------------------------
Q08A37_SHEFN/142-197--------------------------------------------------------------------------------
Q21FZ6_SACD2/148-203--------------------------------------------------------------------------------
A8MHP1_ALKOO/140-195--------------------------------------------------------------------------------
B8I4L4_CLOCE/140-195--------------------------------------------------------------------------------
A4QFI9_CORGB/146-201--------------------------------------------------------------------------------
A7VIJ4_9CLOT/140-195--------------------------------------------------------------------------------
A6FWP6_9DELT/138-193--------------------------------------------------------------------------------
Q1D8G7_MYXXD/143-198--------------------------------------------------------------------------------
Q9CGK5_LACLA/137-192--------------------------------------------------------------------------------
A7B7M9_RUMGN/138-193--------------------------------------------------------------------------------
Q0JYJ3_CUPNH/150-208--------------------------------------------------------------------------------
B8G4C5_CHLAD/143-198--------------------------------------------------------------------------------
Q9CKV8_PASMU/141-196--------------------------------------------------------------------------------
A6VZC4_MARMS/141-196--------------------------------------------------------------------------------
A5LQV6_STRPN/138-193--------------------------------------------------------------------------------
A1RDW8_SHESW/142-197--------------------------------------------------------------------------------
Q1EM54_BACLI/140-195--------------------------------------------------------------------------------
Q5E8X5_VIBF1/143-198--------------------------------------------------------------------------------
Q1IFE1_PSEE4/132-188--------------------------------------------------------------------------------
B9LFJ9_CHLSY/142-197--------------------------------------------------------------------------------
Q2BF26_9BACI/140-195--------------------------------------------------------------------------------
Q1JYD9_DESAC/142-197--------------------------------------------------------------------------------
Q6NGE7_CORDI/143-198--------------------------------------------------------------------------------
B0K946_THEP3/140-195--------------------------------------------------------------------------------
Q87TN8_VIBPA/143-198--------------------------------------------------------------------------------
Q03AP8_LACC3/140-195--------------------------------------------------------------------------------
A7VZA1_9CLOT/138-193--------------------------------------------------------------------------------
A3Y741_9GAMM/141-196--------------------------------------------------------------------------------
Q7MZ94_PHOLL/141-196--------------------------------------------------------------------------------
Q8DDK7_VIBVU/143-198--------------------------------------------------------------------------------
A4RVU2_OSTLU/174-231--------------------------------------------------------------------------------
Q8G426_BIFLO/103-158--------------------------------------------------------------------------------
A4STE9_AERS4/142-197--------------------------------------------------------------------------------
A6TQB9_ALKMQ/140-195--------------------------------------------------------------------------------
Q1J2A7_DEIGD/140-196--------------------------------------------------------------------------------
A7MQN8_CROS8/141-196--------------------------------------------------------------------------------
A1WAA0_ACISJ/134-189--------------------------------------------------------------------------------
Q65W79_MANSM/140-195--------------------------------------------------------------------------------
Q5FL79_LACAC/142-197--------------------------------------------------------------------------------
Q03SQ4_LACBA/140-195--------------------------------------------------------------------------------
Q826X2_STRAW/140-195--------------------------------------------------------------------------------
Q927X7_LISIN/140-195--------------------------------------------------------------------------------
Q1R464_ECOUT/142-197--------------------------------------------------------------------------------
A6VLN9_ACTSZ/140-195--------------------------------------------------------------------------------
A1TPX1_ACIAC/145-200--------------------------------------------------------------------------------
Q5KV49_GEOKA/140-195--------------------------------------------------------------------------------
A1HN60_9FIRM/139-194--------------------------------------------------------------------------------
Q7NTX7_CHRVO/133-188--------------------------------------------------------------------------------
Q03ZJ9_LEUMM/140-195--------------------------------------------------------------------------------
A0PZT9_CLONN/138-193--------------------------------------------------------------------------------
Q83VY2_STRCJ/140-195--------------------------------------------------------------------------------
A7BDK8_9ACTO/143-198--------------------------------------------------------------------------------
Q2S3C2_SALRD/140-195--------------------------------------------------------------------------------
A4WFX2_ENT38/141-196--------------------------------------------------------------------------------
A4E749_9ACTN/101-156--------------------------------------------------------------------------------
Q1ZHQ0_9GAMM/142-197--------------------------------------------------------------------------------
Q4KIR2_PSEF5/132-188--------------------------------------------------------------------------------
B2JNM8_BURP8/228-283--------------------------------------------------------------------------------
B1JFA8_PSEPW/132-188--------------------------------------------------------------------------------
Q042C5_LACGA/143-198--------------------------------------------------------------------------------
Q9ZNK1_CLOHI/138-193--------------------------------------------------------------------------------
Q48AT4_COLP3/142-197--------------------------------------------------------------------------------
A3KLC0_BACAM/140-195--------------------------------------------------------------------------------
A4FQ90_SACEN/136-191--------------------------------------------------------------------------------
Q9ANV5_9LACO/142-197--------------------------------------------------------------------------------
A8FP65_SHESH/142-197--------------------------------------------------------------------------------
A6UWS9_META3/137-190--------------------------------------------------------------------------------
Q97GS0_CLOAB/138-193--------------------------------------------------------------------------------
Q5WDD8_BACSK/140-195--------------------------------------------------------------------------------
Q92SD8_RHIME/131-187--------------------------------------------------------------------------------
Q1WRU9_LACS1/140-195--------------------------------------------------------------------------------
Q8FVG7_BRUSU/165-222--------------------------------------------------------------------------------
A9KI52_CLOPH/140-195--------------------------------------------------------------------------------
Q9K6U5_BACHD/140-195--------------------------------------------------------------------------------
Q7WI30_BORBR/132-188--------------------------------------------------------------------------------
A6FJ22_9GAMM/103-158--------------------------------------------------------------------------------
B9LQ76_HALLT/151-205--------------------------------------------------------------------------------
Q3A1N7_PELCD/144-199--------------------------------------------------------------------------------
Q1YZP6_PHOPR/144-199--------------------------------------------------------------------------------
Q67MH5_SYMTH/155-210--------------------------------------------------------------------------------
Q5M5T5_STRT2/138-193--------------------------------------------------------------------------------
Q03H02_PEDPA/139-194--------------------------------------------------------------------------------
A4AK74_9ACTN/149-205--------------------------------------------------------------------------------
Q6DAP3_ERWCT/141-196--------------------------------------------------------------------------------
A1S1J0_SHEAM/142-197--------------------------------------------------------------------------------
A0KEL4_AERHH/142-197--------------------------------------------------------------------------------
A4XYN2_PSEMY/132-188--------------------------------------------------------------------------------
Q1LGN1_RALME/177-235--------------------------------------------------------------------------------
A3DH56_CLOTH/141-196--------------------------------------------------------------------------------
A1SRE9_PSYIN/141-196--------------------------------------------------------------------------------
Q1ZL43_PHOAS/144-199--------------------------------------------------------------------------------
A6NVX0_9FIRM/138-193--------------------------------------------------------------------------------
Q8TSL2_METAC/140-194--------------------------------------------------------------------------------
Q6LYD0_METMP/142-196--------------------------------------------------------------------------------
A6TGM6_KLEP7/141-196--------------------------------------------------------------------------------
Q189Y5_CLOD6/139-194--------------------------------------------------------------------------------
Q0A6M1_ALHEH/143-194--------------------------------------------------------------------------------
Q12W19_METBU/138-192--------------------------------------------------------------------------------
Q47L82_THEFY/136-191--------------------------------------------------------------------------------
B1KCZ5_SHEWM/142-197--------------------------------------------------------------------------------
Q2KZZ6_BORA1/132-188--------------------------------------------------------------------------------
Q5QXI9_IDILO/143-198--------------------------------------------------------------------------------
A3CPW4_STRSV/138-193--------------------------------------------------------------------------------
A5I6F5_CLOBH/138-193--------------------------------------------------------------------------------
A9B2B3_HERA2/142-197--------------------------------------------------------------------------------
Q8ENG2_OCEIH/140-196--------------------------------------------------------------------------------
A6M153_CLOB8/138-193--------------------------------------------------------------------------------
Q6ADS2_LEIXX/134-189--------------------------------------------------------------------------------
A2RH67_BACME/140-195--------------------------------------------------------------------------------
Q46BW0_METBF/112-166--------------------------------------------------------------------------------
A3WIH7_9GAMM/143-198--------------------------------------------------------------------------------
Q46QX5_CUPPJ/142-200--------------------------------------------------------------------------------
Q74KA9_LACJO/143-198--------------------------------------------------------------------------------
A6U5M1_SINMW/131-187--------------------------------------------------------------------------------
A6UP69_METVS/142-196--------------------------------------------------------------------------------
A4XI40_CALS8/138-193--------------------------------------------------------------------------------
Q4L4H3_STAHJ/140-195--------------------------------------------------------------------------------
A6D7Z9_9VIBR/143-198--------------------------------------------------------------------------------
Q1MS48_LAWIP/146-201--------------------------------------------------------------------------------
A1WPG9_VEREI/149-204--------------------------------------------------------------------------------
Q02UR0_PSEAB/132-188--------------------------------------------------------------------------------
A5N211_CLOK5/151-206--------------------------------------------------------------------------------
Q834A0_ENTFA/140-195--------------------------------------------------------------------------------
A8GYG2_SHEPA/142-197--------------------------------------------------------------------------------
A4GA80_HERAR/133-188--------------------------------------------------------------------------------
Q8PVM6_METMA/50-104--------------------------------------------------------------------------------
A5ZXJ4_9FIRM/140-195--------------------------------------------------------------------------------
Q3KII0_PSEPF/132-188--------------------------------------------------------------------------------
Q24W98_DESHY/138-193--------------------------------------------------------------------------------
A9CFZ6_AGRT5/94-151--------------------------------------------------------------------------------
A6CP46_9BACI/140-195--------------------------------------------------------------------------------
Q0I5B1_HAES1/140-195--------------------------------------------------------------------------------
Q18DK9_HALWD/167-221--------------------------------------------------------------------------------
Q891Z4_CLOTE/138-193--------------------------------------------------------------------------------
A3UZ73_VIBSP/143-198--------------------------------------------------------------------------------
A1SF98_NOCSJ/148-203--------------------------------------------------------------------------------

PF09377

SBDS_MOUSE/106-227QMFRDIATIVADKCVNPETKRPYTVILIERAM.KDIHYS.........................................
SDO1_METJA/103-225QKKRQIITIISRNTINPQTDTPHPPHRIEKAM.EELRIN.........................................
Q8TYB8_METKA/100-222EVKRKIIHIIARRAVDPRTGAPHPPERIERAM.EEAGVH.........................................
Q8ZVM7_PYRAE/96-218DKKRQIVEWISRNCIDVRTKTPVPPQRVENAL.EQARVS.........................................
Q3HWW0_RECAM/98-219EKRQQIIGYIARNYVDPKTRLPHPAMRVELAF.EEAKPK.........................................
A8BTW1_GIAIC/134-259EKKQEIAGFLHNNYLS.NTNSIVPVARILAAMDQVIGLK.........................................
Q5DG22_SCHJA/106-231ALFRDVAKIVSERCVNPENNRAYTVTMVEKMM.KDCHIS.........................................
Q7Q3H9_ANOGA/107-230SMFKEIATTVADKCVNPETKRPYPVSIIEKSM.KDIHYS.........................................
SBDS_CAEEL/108-230QSLKEVSQLIASMVVNPETKRPVPPSVIDKAL.QEMHFS.........................................
SBDS_DICDI/106-229QTFKDIATIVAEKCVNTETQRPIPVSIIEKAM.KDVHYS.........................................
Q3HWV4_PORYE/106-229RLFSSIASIVADKCVDAETHRPIPVGVIERSMKDLLGYS.........................................
Q6ZD69_ORYSJ/108-230SQFHEIATIVMDKTINPETRRPYTITMIERLM.HDVHFA.........................................
Q2TYA0_ASPOR/107-325RVEKEVLDIVSGRLVDPTTKRVYTPGMISKAL.DQLSSASGQMQQAQSQNNNGEAS...........GAGDESRPAQPRK
Q2H9G7_CHAGB/107-306RVHNEVISIVASKLVDPRTKRVYTSGMIEKAL.DMLSANAHQQQQQDKDNKKDNNNNNDSNNPSATGTPATGEAGESKPR
SDO1_YEAST/106-233KVNNEMLTIVSAKCINPVSKKRYPPTMIHKAL.QELKFS.........................................
Q75F96_ASHGO/143-267KITNELLTLVSAKCVNPNSKKRYPPTMIHKAL.AELKFN.........................................
Q5AF99_CANAL/107-232QKQNEFLNIISTKCINPRSKKRYPPSMIEKVL.NEVKFH.........................................
Q6C0F0_YARLI/107-228QLQTEIIQLVSQKCVNSKTKRPYTATMIEKALIGELKFN.........................................
Q5K9W6_CRYNJ/105-228SLSREIATIVSEMTVDPNTSRKHTVGMVEKAM.AEVGFS.........................................
Q4P379_USTMA/106-229NTWKDIATQVAEKCVDPSSQRPYTVGMIEKAM.HDVHYS.........................................
SDO1_SCHPO/106-229STYRDIVSHVTAMCMDPNSKRPYPASIIEKAL.SDCGFS.........................................
Q583Z1_TRYB2/109-243QMFTDIALIISQKCVNEVTQRPFPAQVIEQAL.RSIGAA.........................................
Q4Q394_LEIMA/109-243EMFKDIAVIISQKCINTKTQRPFPPQVVEQAL.RSIGAA.........................................
SDO1_ENCCU/102-205KTEREIVQILRNKVT..RGGRHLSEASLREAIGKVHNIY.........................................
Q5CNW7_CRYHO/106-230KQFTDICHMLNRMTVNPKNNLPLSVKIIESEL.KDSGFS.........................................
Q4N8W7_THEPA/101-252SIFNDIITILHEITINPQTGNSLSRTMLENAL.KSSGFS.........................................
A8B6U5_GIAIC/107-233RKFTEIASIVALRLTNPATGAAYPRTLIEFAMKNDLHYR.........................................

PF14492

A4TWL9_9PROT/422-496-FPEPVISV-----------------------------------------------------------------------
F2NVW3_TRES6/401-475-FPEPVISI-----------------------------------------------------------------------
D1Y3B4_9BACT/398-472-FPRPVYSV-----------------------------------------------------------------------
F0T210_SYNGF/365-439-FPLPCLPV-----------------------------------------------------------------------
D8PG84_9BACT/404-478-FPRPVVSF-----------------------------------------------------------------------
A9NEZ0_ACHLI/398-472-LPTPVIYQ-----------------------------------------------------------------------
A6DPN1_9BACT/407-481-FPDTVISM-----------------------------------------------------------------------
C6UN06_HODCD/398-472-FPKPVVQV-----------------------------------------------------------------------
RRF2M_DANRE/469-543-VPEPVFFC-----------------------------------------------------------------------
E6N8V0_9ARCH/385-458-VSEPVVTI-----------------------------------------------------------------------
B0P8B7_9FIRM/401-475-FPEPCLSM-----------------------------------------------------------------------
E8R235_ISOPI/389-463-FPPPMVPR-----------------------------------------------------------------------
RRF2M_KLULA/449-523-IPPPVFNA-----------------------------------------------------------------------
A9E504_9FLAO/404-478-ISEAVISL-----------------------------------------------------------------------
D3F1B7_CONWI/394-468-LPAPVMAF-----------------------------------------------------------------------
C6XHJ4_LIBAP/408-482-FPEPVIQI-----------------------------------------------------------------------
D1RMA4_LEGLO/400-474-FPEPVISI-----------------------------------------------------------------------
C4FC14_9ACTN/392-466-FPNSQYRI-----------------------------------------------------------------------
A9V2W3_MONBE/968-1042-IPEPVFSC-----------------------------------------------------------------------
A4X5U8_SALTO/427-500-MPEPLLPV-----------------------------------------------------------------------
D0WJ45_9ACTN/394-468-FPEPLYPV-----------------------------------------------------------------------
B9XK85_9BACT/434-508-FPEPVVSM-----------------------------------------------------------------------
C5KH54_PERM5/576-650-IPAPVVSL-----------------------------------------------------------------------
D3EPW6_UCYNA/400-474-IPEPVISV-----------------------------------------------------------------------
B1I3X3_DESAP/379-453-FPAPTLSL-----------------------------------------------------------------------
F2JHA0_CELLD/398-472-FPKGLVKK-----------------------------------------------------------------------
B3LCX4_PLAKH/489-563-VPKPVISV-----------------------------------------------------------------------
E4Q3P1_CALOW/397-471-FPRPWLML-----------------------------------------------------------------------
E6MJ20_9FIRM/398-472-FPKPVISM-----------------------------------------------------------------------
D5MKJ7_9BACT/401-475-IPHSIVEY-----------------------------------------------------------------------
D3PEH1_DEFDS/400-474-VPEPVISF-----------------------------------------------------------------------
Q4CXN3_TRYCC/185-259-IPPRVISS-----------------------------------------------------------------------
E3DPX3_HALPG/401-475-FPEPVIGV-----------------------------------------------------------------------
E9CJE1_CAPO3/563-637-IPTPVFFC-----------------------------------------------------------------------
E4Z2J0_OIKDI/428-502-VPKGVVSM-----------------------------------------------------------------------
F0GVR2_9FIRM/397-471-YPKPVLFY-----------------------------------------------------------------------
D7FYU3_ECTSI/447-527-VPEPVMSL-----------------------------------------------------------------------
E7NJM7_YEASO/469-543-IPPPVFGV-----------------------------------------------------------------------
C8W6F4_DESAS/377-451-FPIPTLTA-----------------------------------------------------------------------
A9A021_DESOH/403-477-FEEPVISI-----------------------------------------------------------------------
E0VF81_PEDHC/435-509-VPDPVISM-----------------------------------------------------------------------
D1N1L0_9BACT/378-452-FPAPVMSY-----------------------------------------------------------------------
B6K7Y9_SCHJY/432-506-IPEPMCMA-----------------------------------------------------------------------
F0RYS7_SPHGB/397-471-FPQPIYSL-----------------------------------------------------------------------
B5RQ33_BORRA/401-475-FPEPVVLI-----------------------------------------------------------------------
D7VYC2_9FLAO/453-527-IPTPVIRV-----------------------------------------------------------------------
F0Y5M1_AURAN/428-505-VPRPVISI-----------------------------------------------------------------------
C1A5I9_GEMAT/402-476-FPDSVVHF-----------------------------------------------------------------------
A5V1W8_ROSS1/401-475-FPAPAFTA-----------------------------------------------------------------------
E3QA26_COLGM/478-552-IPPPVAFL-----------------------------------------------------------------------
E0TJ49_ZINIC/408-482-FPETVISQ-----------------------------------------------------------------------
F2UT40_SALS5/495-568-VPQPVFTC-----------------------------------------------------------------------
C7NEM3_LEPBD/374-448-FPKPQLFV-----------------------------------------------------------------------
C9LTI7_9FIRM/398-472-FPMPMLAQ-----------------------------------------------------------------------
D5X9E5_THEPJ/380-454-FPVPTLSV-----------------------------------------------------------------------
D6HPL8_9FIRM/401-475-FSEPMLGM-----------------------------------------------------------------------
B5YJI2_THEYD/400-474-FSEPIISY-----------------------------------------------------------------------
EFG_CARRP/393-467-IPLPVISV-----------------------------------------------------------------------
Q4UAY6_THEAN/488-562-VPEPVVSM-----------------------------------------------------------------------
EFG_THELT/405-479-FPEPVISI-----------------------------------------------------------------------
F0ST56_PLABD/409-483-FPDTVISM-----------------------------------------------------------------------
D6TKZ6_9CHLR/387-461-FPEPCFTL-----------------------------------------------------------------------
E5SX34_TRISP/552-626-VPEPVFYC-----------------------------------------------------------------------
Q8KTP5_TREPR/410-484-FPNPVISQ-----------------------------------------------------------------------
D8EYC8_9DELT/404-478-VNEPVISV-----------------------------------------------------------------------
EFG1_SYNWW/397-471-FPQPVIQI-----------------------------------------------------------------------
Q2YZP5_9DELT/400-474-VPPPIMSY-----------------------------------------------------------------------
E1X373_BACMS/418-492-VPIPVIEL-----------------------------------------------------------------------
E1P6D8_GEOBB/413-487-VPEPVVSI-----------------------------------------------------------------------
D9X5U2_STRVR/398-472-VPEPVVSV-----------------------------------------------------------------------
A7AQL3_BABBO/524-598-FPEPVISL-----------------------------------------------------------------------
D1Y774_9BACT/402-476-FPAPVITL-----------------------------------------------------------------------
E7RAH2_PICAD/489-563-VPPPVFSV-----------------------------------------------------------------------
B7KCA7_CYAP7/400-474-TPPPVITL-----------------------------------------------------------------------
A6GCI1_9DELT/430-504-IPDPVIFR-----------------------------------------------------------------------
D7CL94_SYNLT/396-470-FPEPVIQI-----------------------------------------------------------------------
B2A2Z5_NATTJ/399-473-FPDPVISF-----------------------------------------------------------------------
D1CGA5_THET1/397-471-FPHPIYTA-----------------------------------------------------------------------
RRF2M_YARLI/441-515-VPPPVFFV-----------------------------------------------------------------------
A1ZR77_9BACT/405-479-FPEPVIGY-----------------------------------------------------------------------
RRF2M_PENMQ/545-619-VPPPVFFA-----------------------------------------------------------------------
A6C5G4_9PLAN/359-433-FPHPVVGL-----------------------------------------------------------------------
E4RLV1_HALSL/394-468-FPKPMYTR-----------------------------------------------------------------------
D2VIA4_NAEGR/392-466-VPKPVFFC-----------------------------------------------------------------------
D8K0Z6_DEHLB/390-464-FPPSSYSV-----------------------------------------------------------------------
F0VGQ1_NEOCL/414-488-VPEPVVSL-----------------------------------------------------------------------
E1K1T2_DESFR/398-472-LPPPMISY-----------------------------------------------------------------------
B1C971_9FIRM/398-472-FPQSIIFT-----------------------------------------------------------------------
B8E030_DICTD/399-473-FPEPVFAV-----------------------------------------------------------------------
B7IDJ1_THEAB/390-464-FPEPMISK-----------------------------------------------------------------------
A6G6E0_9DELT/388-462-IPDPVVSR-----------------------------------------------------------------------
B2V037_CLOBA/400-474-FPVPVISM-----------------------------------------------------------------------
A4YUJ6_BRASO/385-459-IPEPVIEA-----------------------------------------------------------------------
E0E580_9FIRM/374-448-FPKPQIYF-----------------------------------------------------------------------
E3NGB7_CAERE/427-501-TPDAVFFC-----------------------------------------------------------------------
C0EB48_9CLOT/384-458-FPEPCYSM-----------------------------------------------------------------------
Q1IH98_KORVE/402-476-FAEPAITY-----------------------------------------------------------------------
C5SZM6_ACIDE/398-472-VPEPVIHV-----------------------------------------------------------------------
EFG_ORITI/417-491-FPKPVIEL-----------------------------------------------------------------------
A0LUL8_ACIC1/428-502-MPEPLLPV-----------------------------------------------------------------------
E7MLG8_9FIRM/397-471-YPHPMLGY-----------------------------------------------------------------------
B0VHJ0_CLOAI/392-466-LPTPTTWQ-----------------------------------------------------------------------
D4G8N6_RIEPU/424-498-FPKPVISI-----------------------------------------------------------------------
D2QZV7_PIRSD/398-472-IAKPVIKV-----------------------------------------------------------------------
C7PBW2_CHIPD/404-478-FPEPMIGY-----------------------------------------------------------------------
F2LWG4_HIPMA/375-449-MPLPYISA-----------------------------------------------------------------------
A9U7W1_PHYPA/98-171-LPEPNVPV-----------------------------------------------------------------------
E0RSW5_SPITD/394-468-LPQPIFSL-----------------------------------------------------------------------
D3NS37_AZOS1/404-478-IPEPVIEI-----------------------------------------------------------------------
Q4N936_THEPA/512-586-FPEPVISL-----------------------------------------------------------------------
C0K071_9BACT/399-473-IPPAVIEM-----------------------------------------------------------------------
B0TAY7_HELMI/385-459-FPNPSLSM-----------------------------------------------------------------------
E1X0M6_BACMS/403-477-FPESVISI-----------------------------------------------------------------------
A4A194_9PLAN/368-442-FPEPMVGV-----------------------------------------------------------------------
E1R4A8_SPISS/397-471-LPQPVFGL-----------------------------------------------------------------------
C9RLE0_FIBSS/410-484-VPNPVIEL-----------------------------------------------------------------------
D3RWR2_FERPA/385-459-FSEPVVTM-----------------------------------------------------------------------
A6NVY7_9FIRM/396-470-FPEPCYSV-----------------------------------------------------------------------
F0SRV0_PLABD/433-507-VPEPVIRL-----------------------------------------------------------------------
EFG2_SYNWW/402-476-FPQPVIDV-----------------------------------------------------------------------
B5JPE3_9BACT/421-495-YPKPNIHG-----------------------------------------------------------------------
A0LEB9_SYNFM/399-473-LPPAIYSL-----------------------------------------------------------------------
C3WDZ3_FUSMR/397-471-FPAPCFYS-----------------------------------------------------------------------
C4R6N4_PICPG/452-526-VPPPMFSV-----------------------------------------------------------------------
C1D0A1_DEIDV/376-449-LPDVVHTV-----------------------------------------------------------------------
EF2_PYRAE/393-467-ISEPVVTV-----------------------------------------------------------------------
A3ZLH3_9PLAN/406-480-FPETVIAM-----------------------------------------------------------------------
E1R4A6_SPISS/399-473-FPEPVISV-----------------------------------------------------------------------
B0N553_9FIRM/395-469-FSTPYYGK-----------------------------------------------------------------------

PF00679

GUF1_SCHPO/451-540-----IITP---.....SEYLGDVIKLCE---S.CR-G.LQKDCTYM.......S.ES......R--CMIKYQLPLAHLV
Q95Y73_CAEEL/633-723-----IEIR---....NDDPTQPILNELL---R.RR-A.HFEHSDAT......ES.TE......I--RRICAILPLSETE
GUF1_MAGO7/504-593-----IAVP---.....EEYLGRIIKLCE---D.SR-G.EQESIEFF.......G.AQ......Q--VIVKYALPSMALV
C1L1Y4_LISMC/399-487-----IDTP---.....EEFMGSVIESIS---Q.RK-G.EMKNMIND.......G.NG......Q--VRLQFMVPARGLI
Q4WCL6_ASPFU/842-931-----MTGP---.....ANAVASVYTVLS---R.RR-G.HVLSDGPI......AG.TP......L--YTVQGLIPVIDSF
Q96WU0_BLAAD/659-746-----VTAP---.....SEFQSSVIGLLN---K.RG-A.TIADSDIG.........TE......E--FTISAECSLNSMF
RRF2M_HUMAN/684-771-----VTVA---.....RDYLSPVLADLA---Q.RR-G.NIQEIQTR.........QD......N--KVVIGFVPLAEIM
GUF1_PICGU/463-552-----MTIP---.....DEYIGAVMSLCE---N.NR-G.IQKELEYL.......T.NG......Q--VLMRYEIPLAQLV
GUF1_OSTLU/451-540-----IICQ---.....PHVVGKVV.ELC---MDRR-G.EQLEQNFL.......D.DS......R--VILRYRLPLGEVA
Q5FDV4_EHRRW/423-511-----IDVD---.....EVYSGIIMEKLN---L.RK-G.DMQDLRPS.......G.KN......R--VRMVFLVPSRGLI
RRF2M_ANOGA/641-729-----IVTP---.....SEYLPPILADLS---R.RR-A.RIEDVAPR.......G.SA......N--KVVTVIAPLAELG
Q1IH98_KORVE/598-685-----ITAP---.....DEFAGGIMGDLN---S.RR-G.RIQGMDNK.........AG......S--TVVKAEVPMAEML
Q83NS0_TROW8/410-497-----VNLM---.....DEYFGSVTKLLA---E.RK-C.RVESVISN.........AG......W--TNADFVVPSRGLI
A4ARW7_MARSH/610-697-----VKVP---.....EEMVGSVMTDLQ---S.RR-S.IIQGIDTN.........GH......F--QILKCMVPAAELY
Q2S5C1_SALRD/429-517-----IDIP---.....EEYMGVVMERLG---E.RK-G.QMEHMVHQ.......D.SG......R--VRLTFRVPSRGLI
LEPA_DESRM/402-491-----VMVP---.....KDFVGTVM.DLC---QGKR-G.IFSNMEYL.......G.IN......R--VMLTYEIPLSEII
LEPA_CAMHC/398-487-----IITP---.....AEFLGNLI.TLL---NSRR-G.IQTKMDYI.......T.SD......R--VLLEYDIPTNEII
A1AR09_PELPD/594-681-----LSVP---.....TEYLGKVLGALQ---Q.KR-G.RVEGVSAS.........GE......N--ELIRATAPLAGMF
EF2_METTE/620-707-----VQVP---.....QLTMGGATKELQ---G.RR-G.IILNMTTE.........GD......L--AIIEARVPVAEMF
A5TRL8_FUSNP/592-680-----IRIP---.....EEYMGDVMGDLN---K.RR-G.RVLGMDHT.......E.TG......E--QLLLAEVPEAEIL
TETQ_BACFR/535-622-----LQIP---.....QVASSKAITDLQ---K.LM-S.EIEDISCN.........NE......W--CHIKGKVPLNTSK
A4BV85_9GAMM/583-670-----IDAP---.....SAAMGDITGDIA---A.RR-G.RIQDTQSH.........SE......H--ITLQALAPLAELE
A5Z4P7_9FIRM/513-598-----LKIP---.....SENIGRAMTDID---Q.MS-G.NINQPETE.........GE......M--SVITGFAPAATIG
A5Z6T1_9FIRM/598-686-----VTAP---.....DKYSGDIMGDLN---K.RR-G.RITNMIPT.......D.TG......K--QIIEAEVPMLELS
EFG_SALCH/611-698-----VETP---.....EENTGDVIGDLS---R.RR-G.MLKGQESE.........VT......G--VKIHAEVPLSEMF
A8MDB4_CALMQ/627-715-----AKTT---.....VDNMGPVTSVIT---R.HR-G.RVIDVTQT.......E.TM......E--VIVKGEIPVIESF
A4BRZ1_9GAMM/403-491-----ILVP---.....QEYLGNVI.KLC---EDKR-G.SQKSLQYV.........GN......Q--IALEYEMPMSEVV
A6DEJ7_9PROT/393-481-----VDVP---.....DEYSGAVIEKLG---T.RG-G.VMKNMVPL.......S.DG......S--TRIEFEMPARGLI
A9KSY1_CLOPH/512-598-----LELP---.....EKMVGRAMTDIE---K.MY-G.TCEISRTD.........GE......M--SVLVGSAPVITMR
Q7NGS6_GLOVI/576-666-----VSVP---.....VEFTARALRLLS---G.KR-G.QILHYQGDG.....ER.RE......W--DCVNAFLPLAQMN
Q94BR7_ARATH/686-774-----VVTP---.....EEHLGDVIGDLN---S.RR-G.QINSFGDK.......P.GG......L--KVVDSLVPLAEMF
A7BTE3_9GAMM/109-197-----ITVP---.....EDNMGAITGDIS---G.KR-G.RIQGSEVR.......P.PN......M--VCVKAEVPLSELT
Q1YUM4_9GAMM/396-484-----IDVE---.....EQHQGSVMEELG---M.RK-A.ELTNMEPD.......G.KG......R--VRLEFSMPSRGLI
A7FZA2_CLOB1/594-682-----VISS---.....EEYMGDIIGDIN---R.KR-G.KILGMEQE.......A.NN......L--ERIVAEVPQAEIL
Q4DGU6_TRYCC/750-839-----VYSF---.....GATQGKIYGSLS---R.RR-A.EIIEEVPN......EG.SD......L--FYIRCLLPAVEAF
A4BCQ5_9GAMM/578-666-----VAIP---.....SDCMGDVSGDMA---S.HR-G.VITDTRIE.......G.KN......K--TLLRCKAPLSEMS
Q825F0_STRAW/553-640-----LEAP---.....ADTLGAVLPVLA---G.LR-A.VVRTTRMR.........EA......V--CVLEGLVPAAHVH
EF2_NANEQ/639-726-----VDVP---.....PDYIGDVTALIN---S.RR-G.AILDIQTE.........ED......R--ALIKAKVPVREMI
Q8RMN6_9BACI/534-621-----IYAP---.....QEYLSRAYNDAP---K.YC-A.NIVDTQLK.........NN......E--VILSGEIPARCIQ
Q6MC59_PARUW/398-486-----IEVP---.....QDYSGTVIEELS---R.RK-G.ELQLLDTD.......E.NG......I--TAIDFLIPTRGLM
EFG2_SYNWW/598-685-----IICP---.....EEYLGDVISDLN---A.RR-G.RIIALEEN.........RD......T--KAVKGLVPLAETF
A5G260_ACICJ/565-655-----VSAP---.....NGFTAGVQRLLT---G.RR-G.QILGYAERA.....GW.PG......W--DDTEALLPAAELH
Q381P2_TRYB2/848-937-----IMCP---.....PGSVEKIAEVLQ---M.RR-G.SIVSEEPI......AA.TT......F--VCVRALVPAIDSF
A5L3A1_9GAMM/51-139-----ITCY---.....NKNISDIIYELT---N.RE-A.TLISSETA.......G.DD......Q--SNLVFRGSLRGML
Q1VQ31_9FLAO/545-632-----IKAN---.....EALLGKIVSELS---T.RR-A.NFETPQFV.........DD......T--FRLRGTIPVATSL
Q5GBH8_ENTFL/541-628-----VQVP---.....NDFCGRVMSDLR---K.MR-A.SIEDIIAK.........GE......E--TTLSGKIPVDTSK
Q21YN7_RHOFD/584-672-----VLAP---.....ESSMGDLTGDLA---A.KR-G.HVTGTQPR.......L.SG......N--VAISGQIPLVELD
Q4N6X5_THEPA/510-600-----LRVP---.....EDCSGAVISMMG---R.MG-G.KLNDEYKI.......KDTN......M--KILEYEVPLSEIL
Q3DTP4_STRAG/598-685-----ITAP---.....EDNLGDVMGHVT---A.RR-G.RVDGMEAR.........GN......T--QVVRAFVPLAEMF
Q4Y6S3_PLACH/682-769-----IISN---.....YEHQSNILTSIT---K.RK-G.LVTNIVNN.........MN......I--IYVYADIPLKHMF
Q9AIG7_CARRU/590-678-----IISP---.....KEYLGIVISDIS---K.KR-G.NIISVVDN.......N.NN......L--KIINSLIPLRELF
Q72IJ8_THET2/563-650-----VLVP---.....QERVGDVLSDLQ---A.RR-G.RILGMEQE.........GA......L--SVVHAEVPLAEVL
Q7UQ85_RHOBA/433-520-----VEVP---.....TEVMGPVMELVG---L.RR-G.QLEEMKQR.........GE......Y--SLLRFIVPSRGLI
Q7YYP3_CRYPV/897-986-----IYCE---.....QSVLGKVYSVIN---K.RR-G.NVFNEELK......EG.TS......T--FKIEAYIPIIESL
Q4FPA2_PELUB/397-485-----VDVD---.....EEFSSKIIDSMN---R.RK-G.KLLDLKDT.......G.KD......K--KRLIFHAPTRGLM
A0L3V8_MAGSM/615-702-----ISVP---.....DEVMGDVIGDMN---S.RR-G.KITGVTPR.........GN......G--QTIHCETPMSEIL
A6G6E0_9DELT/585-672-----VDAP---.....SSSFGAISGSLT---A.RR-G.AIVDSQIQ.........GE......R--VAITARVPLAEMF
A4E859_9ACTN/521-606-----LEVP---.....GECVGRALSDAT---R.MG-A.EYEPPTMA.........GD......R--AKLVGRVPASEVQ
Q0SU42_CLOPS/519-604-----IDVD---.....LNLIGRVMNDIQ---K.MH-G.EFKDPIID.........GE......R--ATIEGNGPVSTFI
A3ZLH3_9PLAN/604-691-----IITP---.....EENLGDFVGDIM---K.RR-G.EIAKTEHR.........SG......E--ALIEAHAPLAELF
A7VYF9_9CLOT/584-669-----IQAD---.....SRQLGRILSDIQ---R.LQ-G.VFEPPRQQ.........EN......R--VTVNGRGPAAGFI
Q5P806_AROAE/584-672-----VKVE---.....DSHFGDITAEFA---A.RR-G.RLTATESP.......A.SG......W--TVLTATVPMAEME
A5JZM2_PLAVS/561-649-----ITIP---.....SVISSNVIEKLN---T.RK-A.EIVDIIND.......D.NE......N--TFIKCICPSRNFF
A0NK81_OENOE/401-489-----ITTP---.....SELLNEVI.KLA---DKHK-G.NLLNMENE.........AA......L--IMLTYKMPISEIA
Q00WM1_OSTTA/464-553-----LEVD---.....ANDVGTVIEAVT---H.RK-G.ELSDMEPNA.....GE.EG......R--TRLVFVAPSRGLI
A5K1M2_PLAVS/827-915-----VSVP---.....TEYLGDVISDLV---K.KR-G.KIQHIDES.......D.EY......T--KEIVARAPMASIL
GUF1_BABBO/505-595-----VRIP---.....GDCHKKVSNLLT---Q.MR-G.EFQKKSEF.......AGGK......S--LVLEYKVPMIEII
LEPA_MYCGE/399-488-----IDLP---.....DQYLGSVI.DLC---QNFR-G.QYESLNEI.......D.IN......R--KRICYLMPLGEII
EFGM_CAEEL/641-728-----ATVP---.....TEFQGNVVTSLT---Q.RN-A.LITTTDST.........EG......Y--ATVICEAPLSDMF
EFG_EHRCR/599-686-----IITP---.....DEYMGDVIGDIN---S.RR-G.RVAEMQDR.........HN......T--KVILAFIPLAKMF
EFGM_DANRE/638-725-----IVAP---.....NEFQGAVIAGVN---R.RH-G.VISGQDGA.........DG......Y--FTLYADIPLNDMF
Q729W6_DESVH/400-488-----VDCD---.....EGFMGVVTEKIT---Q.RK-G.RMLNCVNN.......G.TG......R--VRLEYSVPSRGLI
A9A4F5_NITMS/619-706-----VRVP---.....TDLVGNVATVLS---G.KR-G.KVLDMAQK.........GA......S--SIVTGEIPASETF
A8MHU5_ALKOO/394-482-----IEVP---.....EESSSAVIEKVS---I.RK-G.EMLNMEPT.......G.TG......I--MKLQFRIPARGLI
A7S680_NEMVE/415-504-----LMFP---.....QEYMGKML.TLC---QERR-G.VQEDVVFI.......D.EL......R--VMLKYKLPLNEII
A0YPA8_LYNSP/395-483-----LDVP---.....EEAVGSCMERLG---Q.RR-A.EMQDMRVG.......G.NG......R--AQLEFVVPARGLI
Q9RXC2_DEIRA/579-666-----VRAP---.....AQLTGDLISDLQ---T.RR-A.RVQGMDPE.........GT......V--IVIRAVVPQAELQ
A7AQL3_BABBO/720-808-----VVCP---.....LANYNVVRGDLL---R.RR-G.QVQTIRDG.......Y.GG......V--KEISATVPLQEMK
A9CJ73_AGRT5/541-628-----IEAP---.....AAAITRLISLLA---K.AG-A.ATKNSVIS.........GG......V--ATLEGTIASAAVQ
A9BJK9_PETMO/590-678-----IFLP---.....TENTGDVIGEVT---A.KR-G.RPLGMESA.......G.KG......Y--DKIVAEIPLAEML
Q97J38_CLOAB/542-629-----LRIP---.....QDVLSKAIWDLE---T.MR-A.IFDSPIVI.........GD......E--FSIRGLIPVENSK
Q6F0Z6_MESFL/400-487-----LNIP---.....TEYSGTVINKLN---Q.RK-G.LMTDMDSD.........GV......R--DKIVYNIPLRALI
A0YMH4_LYNSP/585-675-----FSAP---.....NEFTSQMFQLIT---G.RR-G.QVLNYEVIM.....GW.KG......W--DKITAYLAISEMQ
A3I5Y0_9BACI/519-604-----MKAS---.....NDFIGRMMTDIQ---Q.AA-G.TFDDPVLT.........ET......D--VVLTGRAPVATFM
LEPA_CHLAB/404-493-----IITP---.....QEYLSSIM.NLC---LDKR-G.VCLKTEML.......D.QH......R--LVLSYDLPLNEIV
A6C5F4_9PLAN/612-699-----VEVP---.....EEYQGPVSGHIA---Q.KR-G.VINTSETR.........MG......T--STFIAEVPLASMF
Q0YPH2_9CHLB/398-486-----IDIP---.....EEYTGVIIEKMG---R.RK-A.EMIHMGTL.......R.GG......M--VRVEFEIPTRGLI
Q3LWJ5_BIGNA/768-857-----VVTP---.....FESSKMIFNILL---N.RR-A.IILNDMPI......QG.TL......H--YRILFLIPTINTI
A3Q803_MYCSJ/621-709-----ITVP---.....DDLVGTVMGDLS---G.RR-G.RVLGTEQA.......G.AD......R--TVVRAEVPQVELT
Q2KBB2_RHIEC/552-642-----IHIP---.....SIYSGSLVQIVS---A.LK-G.QVLGFDRDE.....TA.KG......W--DIFRALIPGGALD
A8F3S7_THELT/400-490-----IITP---.....SDYVGDIFTNLQ---NERR-A.NLLHTENA.......G.KN......R--VIMYFKVPLAEII
Q1Q141_9BACT/597-684-----ITVP---.....EQYMGDVIGEVH---S.RR-A.NILEMITK.........GN......I--RIIKGEVPLAEMF
A6DLC3_9BACT/400-489-----IMIP---.....NDYIGAAM.SLI---MEKR-G.LCENTTAV.......D.ER......H--VMLSASLPLHEIV
A2XK54_ORYSI/887-976-----LTTP---.....TEQLGATYAVLS---R.KR-A.RVLKEEMQ......EG.TS......L--FTVHAYLPVAESV
EFG1_SYNAS/596-683-----VETP---.....NEFQGAVMGLLN---Q.RR-G.MIVGTQDE.........GQ......T--CVIEAQTPLAEMF
A7AM19_BABBO/644-731-----VVTP---.....HEFQAAVLSTIT---K.RK-G.LVTDTSTY.........GT......N--VILQAQVALRNMF
Q25003_9MICR/731-819-----INVS---.....AEQLGGVNSVLA---Q.RR-G.VAEEYKSD.........GG.....LR--TVVSGYLPVRESF
GUFP_OSTLU/403-492-----MIAP---.....SDYVGTLM.ELA---SQRR-G.EFIDMTYL.......S.ET......R--TSIKYDIPLAEVV
OTRA_STRRM/555-642-----LEVP---.....AARLSPVLAKLA---E.LG-A.TPGVPTAE.........GD......V--FRLEGTMPTSLVH
LEPA_WIGBR/398-486-----ILSP---.....KKYLGKII.SLC---VEKR-G.IQNNLIYL.........EN......K--VIIIYIIPMSEII
LEPA_BUCAP/402-490-----ILLP---.....PKFLGPVM.KLC---IKKR-G.TEINMIYH.........EQ......Q--VSLKYHIPMNEVV
GUF1_TRYB2/565-655-----VVTP---.....SEYAQIIDGEAQ---RHYR-G.KQLDMRVM.......D.DA......R--VLLRYKMPLADMV
A6G4Z2_9DELT/410-499-----IQLP---.....EDYLGPVI.KLC---QERR-G.IQQDLTYM.......T.TT......R--VQLTYELPLAEVV
Q9RV32_DEIRA/392-479-----IDVP---.....EQHASTVIGVLG---A.RK-G.QMVNMEPQ.........GS......R--VRVEFKIPARALF
A0CDU0_PARTE/436-524-----IEID---.....QQYMTGLIDKMS---Q.RK-A.IYEDCINI......D..KT......R--VKLIFSAPTRGLV
Q3LVZ0_BIGNA/720-809-----ISVP---.....LKHLGAIYSVVS---N.RR-G.KVYEEVTK......PG.NP......V--CEIKVKLPVAESF
Q387N2_TRYB2/438-524-----LEFR---.....ENLVGDMVSFFS---S.KM-A.EIGEITQL.......S.DG......R--VCMECLMPVRLLS
A5KT16_9BACT/399-487-----VEVE---.....KGFVGVVNQELG---V.RR-A.NLIKQETP......S..SG......A--ARMTFTVPTRGLI
A5FQ33_DEHSB/411-499-----IDVR---.....EDFVGEVTELLG---K.RQ-A.RMTDMHND.......G.EG......N--VRLEYNIPTRGLI
A4S0M6_OSTLU/604-691-----ITVP---.....SEFQGTVIGNIN---R.RK-G.TINDSTAE.........GD......D--VIISSMVPLSQMF
LEPA_CHLTE/406-495-----IITM---.....SEYIGNIM.KLG---MERR-G.EYKNTDYL.......D.TS......R--VNIHFEFPLGEVV
A4EBU6_9ACTN/400-487-----VECP---.....DEYSGKVVEVFG---T.SG-G.IMTSMDTS.........GI......V--THLEFKIPTRGIM
Q3ADH6_CARHZ/573-660-----VTVP---.....EQFMGDVISDFN---G.KR-G.HVLGMETQ.........GR......W--ARVKAYVPYAEML
Q73P52_TREDE/591-679-----VFVE---.....TSYLGDIMSDLS---S.RR-G.RILGQSSP.......A.SG......I--EEIRAQVPHKELL
Q4CXN3_TRYCC/388-475-----IVVP---.....AQCMTEVTTEFS---K.RE-G.IVTETSIN.........GA......D--AVIRGETALDTMF
Q6AKJ8_DESPS/591-678-----INVD---.....KDHVGDIMGDLS---S.RR-G.KVMGMDSD.........GK......H--EIINAQVPQAEIQ
EF2_SULTO/628-715-----IRVP---.....MDFVGNVSGVIT---R.KR-G.KILNMTQM.........GS......I--ARITAEIPVSESF
A4A194_9PLAN/587-675-----ITVP---.....ESNMGDVYSDLS---T.RR-G.QVMGAQNA.......T.PG......Y--QTVSATAPLSEVI
A0Q2C8_CLONN/546-631-----IVVN---.....KEMGGKIMTDIL---K.MG-G.SFNEPEVK.........GE......K--IIITGEVPVATSM
Q5JMX4_ORYSJ/461-551-----VEVD---.....EEHVGFVMETLT---H.RK-G.EVMDMGPVP.....GT.TG......R--TRIFLTCPSRGLV
A7VSS3_9CLOT/592-680-----ASVP---.....DANMGDVMGEIN---K.RR-G.RVLGMNPG.......E.NG......M--QVVEADVPMAEMG
EFG_PLARO/34-121-----VTTP---.....EDYMGDVIGDLK---G.PR-R.QIRAMDER.........AG......A--RVVQALVTLLDIF
A5UPI8_ROSS1/397-485-----LEVA---.....EQYQGAVIELMG---Q.RR-G.QMRDMSIR.......D.GG......L--VHMIFHVPTRGLL
A0C124_PARTE/799-888-----IMCF---.....QDCIPAIHNVLL---R.RR-G.HILSEQAK......PG.TP......F--SVVRAHIPTIDHF
A0E802_PARTE/956-1045-----LQTD---.....FTNYGKSIDVLN---Q.RR-G.NVVNEVLN......SC.TS......L--FTVQARLPLSSSF
A5VM44_LACRD/512-598-----LKVP---.....NDQVGRAINDIQ---Q.MH-G.TFELDEAN.........SQ.....AL--TLITGTAPVVGMR
Q5BXM1_SCHJA/221-327-----LQLP---AKKGYDSELSTFLHDLT---N.RR-A.EIISVDNADIDERYQG.ENACGIEKY--HCIRAIAPLSELG
A0DGW7_PARTE/623-710-----IMVP---.....APSYQQAMVGIA---K.RR-G.SVTNTESR.........GD......M--FVLNADVPLSQMF
A4CM35_ROBBH/393-480-----IDLP---.....EEVSGKAVEMVA---L.RK-G.EMTRMESR.........GD......R--MVCEFLIPSRGII
Q820H1_NITEU/395-483-----VDID---.....EANQGAVMEALG---T.RR-G.DLLDMVTD.......G.RG......R--VRLDYRIPARGLI
B2JWX8_BURP8/582-670-----VMTP---.....ETTMGDIIGDLS---S.RR-A.QVQGTRNL.......A.GH......A--VVVAGKVPLSELT
Q4N072_THEPA/424-514-----AYVP---.....SEFSAKVVDNVN---S.RN-M.EITKYTELE.....GS.EK......Y--TKLEFEGSTSQMM
A8FY81_SHESH/586-674-----VVVA---.....QEHVGDITGDIS---S.CR-G.MVCGTQAQ.......G.NS......K--VVVSVEAPLATVD
GUF1_CAEEL/442-531-----MIVP---.....NEMMGTVN.GLC---SECR-G.ERGEITSI.......D.ST......R--LVILWRLPLAEVA
A3LU88_PICST/836-924-----VVCT---.....HSAKALVSKLLD---G.RR-G.NIIKDWPV......PG.TP......L--FELEGHVPVIESV
LEPA_ARTS2/411-500-----ILAP---.....NEFVGAIM.ELC---QSRR-G.VMGGMDYL.......S.ED......R--VEIRYRLPLAEIV
EF2_PYRKO/621-708-----INVP---.....YEYMGAVSRELN---Q.RR-G.QLIDMRQE.........GE......V--MIIIGEAPVAEMF
A4YUJ6_BRASO/582-669-----VTTP---.....EDYLGGIIGDLQ---S.RR-G.RIVATEPI.........PR......G--QEVIAEVPLARLF
A7ADA9_9PORP/620-707-----VSVP---.....ADYLGDVMSDLQ---G.RR-A.IIMGMNSE.........KG......Y--EKLLAKVPLKEMS
B4SGB3_PELPB/597-684-----VYAP---.....EQYTGEIVGDIS---S.KR-G.KILGMDSD.........VR......L--QIIHALIPQSSLT
Q8KTP5_TREPR/606-694-----VETP---.....PEYLGPIVGDVL---A.RR-G.LVKSTAHQ.......G.YG......T--KVVRSEIPLATMF
LEPA_BDEBA/400-489-----LHTP---.....TDYIGGIL.KLC---EDKR-G.IQQKMEYV.......T.DK......K--VIIEYKLPMNEMV
TYPA_BUCBP/399-488-----LDIE---.....NKYQGTIMKTIG---Q.RK-G.TISNITPD......QN.NE......R--TRLDCIISSRSLI
Q6CXP1_KLULA/782-874-----IIVS---.....GVLESVIQNLLK---R.RR-GGRIYKTEKI......VA.SP......F--IEIKAQLPVIESI
Q1NU00_9DELT/397-484-----IDVD---.....EQYSGTVIEKLG---Q.LK-G.KMLEMHQD.........NG......M--TRLLYKIPTRGLL
A0D5J3_PARTE/683-779-----ISCP---.....NSLQQRIINDLI---SHRR-G.KIIEIKQDQNRAGSQN.SN......R--VILTATIPSQETI
Q4MLL7_BACCE/540-627-----LTVP---.....EHAISTAMYKLA---A.IS-A.TFAEPIFN.........ND......S--YQLTGSLPVAKTE
Q87JC6_VIBPA/578-666-----LHIP---.....TANVGDVSGDLS---G.NR-G.LIEGTEPI.......D.SS......F--TLLRAKSPVNELQ
A0C617_PARTE/693-782-----IHSN---.....IQVIDQVYKCIN---N.AQ-G.IVIEEKSF......AK.TS......F--QKIIAYVNGPNIF
EFG1_BDEBA/606-694-----VTCP---.....DDFVGNIVGDLN---A.RR-G.KILAMNVK.......Q.GG......G--QVISAEAPLASLF
EF2_ENCCU/731-819-----ITTP---.....NDYSGAVTTILL---S.KR-G.TAEDFKTL.......PGND......T--TMITGTLPVKESF
Q55ME0_CRYNB/490-580-----IFVP---.....NDYIGPMM.DLC---ARYR-G.VQQEYRIL.......ENSD......R--AVLRYTLPLSEIV
D2BIG2_DEHSV/583-670-----IIVP---.....KDYMGAVIGDLN---T.KR-A.QVQGMDTE.........GD......E--SVVIAQAPLGEVQ
A3ZM42_9PLAN/402-491-----LLQP---.....SEFIGPVM.QLC---TERR-G.VQVRTEYL.......S.PT......R--AMLVYDLPLAEVI
Q2G8V2_NOVAD/588-678-----VDMP---.....AGTGAKAGSALS---A.RR-G.QILGLDQHP.....EW.ER......W--ERVEALLPEAALH
Q74FV3_GEOSL/395-482-----VDVP---.....SEFQGAIIEKMG---P.RK-G.EMTSLQPM.........GE......T--VRLEFVVPARGLI
A4QD62_CORGB/423-512-----IDVP---.....SEYQGNVTQLLA---T.RK-G.LMQSMSTT.......PGSD......W--IRMEFRIPARGLI
C0A700_9BACT/633-720-----LTTP---.....EEYQGDLMGDIN---R.RR-G.SIQGIENK.........NG......A--AIVTAHVPLELLF
A4HGQ1_LEIBR/665-751-----VHLS---....DIAYIGNVVSSLN---E.HH-A.LTVDMQED.................G--RSVAAVVALRNTL
Q04U99_LEPBJ/401-489-----MDIP---.....DQFTGQIIAELN---R.RK-G.ELQLMDAH.......P.SG......M--TRVEFVIPTRGII
EF2_HALMA/620-707-----IDVP---.....NDHMGAASGEIQ---G.RR-G.RVDDMYQE.........GD......L--MVVEGVAPVDEMI
LEPA_EHRRG/400-488-----IMVP---.....DQYLGVVM.SLC---NNKR-G.EKVDLSYS.........GN......T--ALLKYRLPLSEVV
Q2S3F5_SALRD/609-696-----ITTP---.....DDYTGDIISDLN---T.RR-G.RVQGIDTQ.........GA......L--QKITAEVPEAELH
B9LLE2_CHLSY/601-689-----IIVP---.....DQFAGDVMSDMS---T.RR-G.RVQGMMPT.......G.TG......K--TVIHAQAPLVEIQ
A5DX67_LODEL/884-973-----AICF---.....YKNIRVVDELLK---S.RR-G.HIETRDPI......EG.TA......L--HYIVGYIPVVDSF
Q4XSF0_PLACH/117-206-----IITP---.....EEYQKHIMNECF---K.RR-G.IFIKKEHI.........ND......Q--IIFTFDMPLSEIL
A4Z0F0_BRASO/584-674-----IVCP---.....TDATARINAILA---A.RR-G.QILSFDTRD.....GW.PG......W--DCVRAMMPEAEIG
Q5WBK2_BACSK/540-627-----VIVP---.....ERFLSTLLSRIV---Q.LG-G.NVLEPAFH.........QA......G--VLIKGTIPVRTAT
A4EB71_9ACTN/620-708-----VTIP---.....ESYAGAVMGDIS---A.SR-G.RVTGMETD.......E.RG......D--TVVIAQAPLAELT
Q7WT01_9BACE/535-622-----LQIP---.....LAVNARAITDIN---K.MQ-G.EISTITSD.........GD......W--TTILGNIPLDTSK
A4ES82_9RHOB/546-636-----IHVP---.....AIFTGGLVPMVS---G.MK-G.QILGFSAEE.....GA.AG......W--DVFETLLPQAAQD
Q1NJS4_9DELT/398-487-----ILIP---.....ERYMGAVM.KLC---MERR-G.VNDRHHYP.......I.PG......R--IEFSCEIPLSEVI

PF09186

C6BGR5_RALP1/135-190-----LATD--------YADEARIRRWID...D.RG.Y-VLLDAAY----------DA------G..VTLTVRLPVTDEA
Q1C2C8_YERPA/96-151-----LQCD--------YAQLAMVEMLLQ...Q.VE.G-QILRGEY----------TE------L..VTLHLTLPATQAS
A4VQI4_PSEU5/132-188-----CHCR--------FAELALFKARLA...E.FE.A-LLEAEHF----------DA------E.GATLEIALPAAQLQ
Q2G059_STAA8/140-195-----VTLN--------YDQTGKFEYELA...S.TH.F-MLRNQTY----------TD------K..VSYYIDVVKSDYE
A6AE70_VIBCL/143-198-----LTLD--------YAMIPLLHSLMA...Q.FS.A-TEMEAHY----------NE------Q..VEMVVELEALQSD
Q13Q97_BURXL/135-190-----VEVS--------YADEAKVRRWID...A.EG.Y-TLADSAY----------AM------L..VKMTIRLPVNAVD
Q4ZYM8_PSEU2/132-188-----LECS--------FSELALVKLRLG...E.LN.G-LVESENF----------MA------N.GVQMSIAIGPEHTD
A0ALK0_LISW6/140-195-----CSFA--------YSLVGKIENALE...Q.KN.Y-QINDKEF----------TD------K..VVFHVFVDNDDIP
A1VBZ9_DESVV/146-201-----VVID--------YTQVTLFHRLLP...T.FE.A-VTVAERF----------GV------D..AVFEVSLPHERLA
A8FHY7_BACP2/140-195-----TTID--------YTWLGKVENELR...A.SS.F-QLKEIHY----------AE------D..VIFETYVEETQTE
A4FXB8_METM5/145-199-----AEFD--------YSEIQKVKQIVE...N.F..G-KIVDENY----------SD------V..VKFNMEVKKGLED
A5KKP5_9FIRM/161-216-----IITD--------YTGLGKIQYILG...Q.RG.L-SVLDTVY----------TD------K..VELTVLVPDDEEG
Y722_HAEIN/141-196-----LDCD--------YGQLRLVQQLCE...K.YQ.V-EILSQGF----------QA------N..IHLILGISEKTIE
Q9L6L3_SALTY/141-196-----LQCE--------YGQLAGIEALLG...Q.FA.G-KIVSSDY----------QA------S..VRLRVALPFAHVN
Q5JF15_PYRKO/139-194-----VTFP--------YNLFHTVRSTIE...E.NG.G-RVVGEEY----------GE------L..VKFTVETRKGEAE
A6T3Y8_JANMA/133-188-----YALQ--------FADESTFRRYCE...Q.QG.V-SVLDAQY----------GD------I..VTLRLKMKCSQAE
Q12TB2_SHEDO/146-201-----LKCH--------YNQLADVEHVIH...K.YQ.G-VIVDRQF----------TE------T..IELDFELALSHQD
A2RL93_LACLM/137-192-----LKLD--------YSLYDSVQRFLL...T.QN.L-QISDSEF----------LS------E..VTVRCFIDEEKIN
A2SM12_METPP/134-189-----CVLP--------YALEGWLRRELD...A.AG.A-GTLQVSH----------GM------H..VELQFSLPEGDAA
A3IC74_9BACI/140-195-----VAID--------YTWLGKVENEVR...G.SS.Y-SLEDIRY----------LE------G..VEIIVSVLKEEEE
Q49VU7_STAS1/140-195-----VTIN--------YDLTGKFEYELE...S.TS.Y-LLRDQSY----------TD------K..VSYQIDVVASDYD
Q0I0T1_SHESR/142-197-----LHCD--------YTQLRDVEHLLQ...Q.LE.A-VIIDKQF----------AE------A..VDIHFEIGKQQQG
Q8RAS2_THETN/140-195-----LTFD--------YNLLGKIQNELL...R.RD.Y-LIKDISY----------AD------K..VIITLPVVEEKVS
Q312M8_DESDG/143-198-----IIME--------YTHVTVFKRLIE...E.HE.A-VVTHEEY----------AA------D..AGFTITLPQENVA
A3Q8U6_SHELP/142-197-----LACD--------YHQLKDVEHFLE...L.CE.G-LVVDKVF----------TD------R..VSLSFEMPKATQS
A1A054_BIFAA/142-197-----VTLD--------YPQLGSFQNLLS...T.VE.G-EQTDAQY----------TD------R..IALTVVVPQEQAN
Q5HQY1_STAEQ/140-195-----VTLD--------YDQTGKFEYELA...S.TT.F-LLREQFY----------TD------K..VSYQIDVVKNEYD
A4J830_DESRM/140-195-----VQFE--------LPLFGLIKRVIE...Q.SE.A-KILEVSV----------TD------K..AVIVVRVPLQEVE
A3N2N7_ACTP2/174-229-----LVCE--------YDQFNTLQHLIA...E.HD.I-VLLEQQF----------SE------K..IHLTLAVNPNELE
A0NII2_OENOE/139-194-----LIFD--------YSLIDKLKYFIE...K.QK.A-VVMETNY----------QA------K..VQAVILVETSDSK
Q0S531_RHOSR/142-195-----LAVG--------HVEAGRVESELR...G.RG.V-VVVDTTY----------GE------S..AVLTLAAR..DSA
Q8XJ08_CLOPE/138-193-----TEID--------YDLYGKIQYICG...Q.NN.W-HIEDTEF----------TD------N..VKIYILAEKTMIE
Q5H177_XANOR/157-213-----VQCR--------FDDLGLVHAALA...A.FH.A-DRLDEHF----------DA------N.GAALRVQLPADQLA
B1YLL5_EXIS2/141-196-----VTVD--------YTWLGKLENELR...A.TE.H-IIDQIHY----------LD------H..VKIDVWVEETAVP
Q38YD6_LACSS/139-194-----LTID--------YAQFDSLQNRLA...Q.LA.L-TAQDIQY----------TT------N..IQLTVWLPTEEVP
A1W832_ACISJ/159-214-----CSVP--------YALEGLLRRMID...G.AG.A-QLLQVQH----------AT------L..VTLQLRLPEAEAE
A5VIF6_LACRD/140-195-----ITVT--------YALHDPLLYYLK...E.NN.L-EVAGEEY----------GV------N..VETSIYVNETDLK
Q4MM25_BACCE/140-195-----TEID--------YTLLGKIENELR...N.SK.Y-AIKDIHY----------LE------N..VTFDTYVEEDGKQ
A7JQV0_PASHA/140-195-----LQCE--------YEQFNTISHLIS...E.KD.I-VIVEQLF----------SD------K..VDLLLAFNPSEVE
A0QPN6_MYCS2/140-193-----LAAD--------HADAGWIEAELR...R.RG.F-EVTGVAY----------GD------R..AVLTLATR..DTE
Q4JW71_CORJK/159-212-----CEVP--------HADAGRVEAEVR...A.AG.Y-TVVGVEY----------KA------A..AELAIACEPG..A
Q1BMU3_BURCA/134-189-----IEIG--------YPEEARVRRWIE...Q.AG.Y-ALVDSAY----------GM------T..VKLVIKLPEAAEA
Q2T656_BURTA/142-197-----IEIG--------YPDEARVRRWIE...Q.EG.H-DLVDSAY----------GM------T..VRLVIRLPATALD
A6BHR1_9FIRM/140-195-----IETD--------YTTFGKIQYILA...Q.RE.L-KILDTVY----------TD------K..VELEVLIPKTDVD
Q8FNW9_COREF/165-220-----VHFS--------HNDAGRIEANLR...G.LG.V-VITDTEY----------GS------D..VRFTLALRPGEKT
Q08A37_SHEFN/142-197-----LVCH--------YAQLTDVEYFVA...Q.YD.G-VVMDKEF----------TD------K..VEIHFELAKSHHQ
Q21FZ6_SACD2/148-203-----VEIS--------FALEERVRHRLQ...Q.AN.I-TVDAAEY----------GE------H..VTLFAKAAASILE
A8MHP1_ALKOO/140-195-----IKID--------YTMLGKIQNEIL...Q.NG.Y-LIKTTEY----------DD------S..VHFYLYIEVPRIQ
B8I4L4_CLOCE/140-195-----IIIE--------YTIFGRLQNMLI...S.NN.N-IIKDIRY----------EQ------D..VELCVLIEVGNEE
A4QFI9_CORGB/146-201-----IDLP--------HSDAGRIEANLR...G.MG.T-IITDTEY----------GA------E..VTYTLALLPGEQA
A7VIJ4_9CLOT/140-195-----ITCS--------YNDSGKVQYLLS...T.NE.I-SIENTEY----------GA------D..VTFHTAVPVADVT
A6FWP6_9DELT/138-193-----LRFD--------YAIASAVQRVLH...R.HG.L-EPAHADY----------AA------R..VCLTLHLEAGRVD
Q1D8G7_MYXXD/143-198-----VEVE--------YTHVDGLRRLLP...S.YE.V-QVLAEEY----------SA------T..VGYRLELPVTQVE
Q9CGK5_LACLA/137-192-----LNLD--------YNLYDSLQRFLI...D.PK.I-KISDSEF----------LS------D..IKVKCFIDEEKVD
A7B7M9_RUMGN/138-193-----LTTD--------YTGLGKIQYLLG...Q.RG.L-TILDSVY----------TE------K..VDLTVLIPKEEES
Q0JYJ3_CUPNH/150-208-----VSVD--------YADEPRVRRWLDYDAQ.PG.C-TLADTAY----------GA------L..ATLVLRMPATQLD
B8G4C5_CHLAD/143-198-----LHVP--------YADYTMIRRLLE...A.NA.A-VIIDETF----------AA------A..ITMTVGLPADQAA
Q9CKV8_PASMU/141-196-----VHCD--------YSHINALQLLCE...K.QD.V-MIINQHF----------VD------R..VAFELGIRDDKLT
A6VZC4_MARMS/141-196-----LKIA--------YSLLGKVEYWLE...Q.SD.I-EITNKTY----------SD------S..IVIDLAVIERTWP
A5LQV6_STRPN/138-193-----IQMS--------YAQYQEYSNFLK...E.HD.L-MELDTNF----------TD------Q..IDTMIYVDKEEKE
A1RDW8_SHESW/142-197-----LQCD--------YSQLRDVEYSLQ...Q.VD.A-VMINKQF----------AE------V..VYIEFEIGKLQQE
Q1EM54_BACLI/140-195-----TTVN--------YTWIGKLENELR...E.SP.Y-QIKDVHY----------AD------D..VEFETYVKESEKQ
Q5E8X5_VIBF1/143-198-----LHCD--------YNLVSLVETLLS...Q.FE.G-IQVDAQY----------SD------K..VVMSVELEKRVIE
Q1IFE1_PSEE4/132-188-----CSCT--------FSELALVKLRLA...E.VD.G-LVLDEQF----------TA------N.GVDLRIALGDSHLE
B9LFJ9_CHLSY/142-197-----VHLQ--------YSDYTAIRRLLE...A.HA.A-VIVEEVF----------AV------D..VVITADLPTDHVA
Q2BF26_9BACI/140-195-----VKVE--------YTWLGKLENELR...E.SV.Y-SIKDIHY----------LE------N..VEFEVFVEEAGIN
Q1JYD9_DESAC/142-197-----IGCD--------YALLEPLQRLFD...A.YE.V-VVDDQQF----------AD------Q..VTLFLRLPEEHLT
Q6NGE7_CORDI/143-198-----IEAN--------HSDAGRLESELR...R.RD.V-DIVDVSY----------SN------R..VTMTIAVEIGQRE
B0K946_THEP3/140-195-----LTFD--------YTFLGRIQNELL...K.KG.Y-YIKDIIY----------SD------R..VSIVLHIEEDHLL
Q87TN8_VIBPA/143-198-----LTLD--------YGFMPIAQSIMP...Q.FG.A-VEVAAEY----------SD------Q..VILVVEIELREVS
Q03AP8_LACC3/140-195-----FTIP--------YADFDPIQHFLT...T.NH.L-SIANTDY----------GT------A..VTITLYLDDEHLQ
A7VZA1_9CLOT/138-193-----LVCD--------YNQYGRLLSLIP...E.AG.G-VVTDTQF----------TD------V..VEISFQIPGESLP
A3Y741_9GAMM/141-196-----LKIS--------YALLGKVEYWLE...Q.SD.I-EVNNKHF----------DS------D..IIFDLAVIPNSWI
Q7MZ94_PHOLL/141-196-----LQCE--------YAHISMIEQLLQ...K.SS.G-QIISSEY----------AE------N..VTLRISLPATLVG
Q8DDK7_VIBVU/143-198-----LELD--------YAFVPIAQSIMQ...Q.FN.A-VEVDAQY----------SE------S..VVLVVELEVRNVE
A4RVU2_OSTLU/174-231-----VNAA--------PGDLGKIFLALD...E.FA.A-EKIDEEY----------SD------DGSVHIQIECEEEVAE
Q8G426_BIFLO/103-158-----VRLE--------YPQLARFQQILA...Q.LG.G-SQEDESY----------AV------N..VELTAVVPQNDCA
A4STE9_AERS4/142-197-----IQCD--------YTDMGAVEALLS...S.HH.G-QVLDADY----------GA------R..VTLQVAWESSVWA
A6TQB9_ALKMQ/140-195-----VTVD--------YTQLGKVQNEIL...Q.HG.Y-TIKETKY----------DE------A..VHFIVYVKLEDVS
Q1J2A7_DEIGD/140-196-----VSVP--------FEHLSALYHLLG...T.FD.T-ERGEETY----------TA------S.GVTLAVQVYPEDAD
A7MQN8_CROS8/141-196-----LLCD--------YAQLAGVEGLLG...Q.FN.G-KVVESAF----------QA------N..VALRVALPHTQVA
A1WAA0_ACISJ/134-189-----CQVP--------YALEGMVRREVE...L.AG.A-TLVDVQH----------GT------L..VHLQIHLPASQAA
Q65W79_MANSM/140-195-----LYCD--------YGQVNWLQLLCE...R.YN.V-LIENQLF----------QE------N..VWFQLAISDDKLE
Q5FL79_LACAC/142-197-----FNVP--------YNRFDEVDHYLK...T.NN.V-FIANTEY----------GV------D..VTIHIFLDNDNQA
Q03SQ4_LACBA/140-195-----LTVD--------YANYDRLSPYLT...E.QN.I-TVLGTDY----------AA------A..VTVTIAVDLAAVS
Q826X2_STRAW/140-195-----VTVD--------HQRAGKVQNDLR...S.TG.R-TVRDVRY----------GE------A..VTIEIGLPDADVD
Q927X7_LISIN/140-195-----CSFA--------YPLLGKIENALE...Q.KN.Y-QIVHKEF----------TE------K..VVLQVFVDNEDLS
Q1R464_ECOUT/142-197-----LQCE--------YSQLTGIEALLG...Q.CD.G-KIINSDY----------LA------F..VLLRVALPAAKVA
A6VLN9_ACTSZ/140-195-----LRCD--------YGQINWLQFLCE...K.YD.I-VIENQNF----------QE------K..VQFILAISDDRLA
A1TPX1_ACIAC/145-200-----CLVP--------YALEGLVRREVE...A.AG.A-RLQDVEH----------GS------L..VLLRLTIPASRAG
Q5KV49_GEOKA/140-195-----VTVD--------YTWLGKVENELR...S.SV.Y-TIKNIHY----------AD------R..VTFDILVPEDGQL
A1HN60_9FIRM/139-194-----LKTN--------YDLFGIVENYLH...S.NN.Y-IIKKKDF----------AE------Q..VTLHVLVEKNRET
Q7NTX7_CHRVO/133-188-----LAVD--------FAGEARLRHACQ...E.MG.L-AVVDQQY----------AD------R..VWLTVELPEAEID
Q03ZJ9_LEUMM/140-195-----ISID--------YKHGETLNYWLN...S.HN.Y-QIIDTQY----------DT------N..VHVVVPVSEEDLT
A0PZT9_CLONN/138-193-----INID--------YDLLGKVQYVCG...Q.NL.W-HMEDTEY----------TD------K..VSILILTESSNCE
Q83VY2_STRCJ/140-195-----VTVD--------HQRAGKLQNDLR...A.TG.R-EVREVAY----------GE------G..VRIGIGLPEADVE
A7BDK8_9ACTO/143-198-----TQLN--------PGDAGRIEAELR...A.RG.A-AVIDTIW----------GA------D..VTLRIAIDPSDRD
Q2S3C2_SALRD/140-195-----IRYD--------YDDTAPAERVLR...Q.FD.A-DVRASEY----------TD------V..TTLTVGVRQSEVD
A4WFX2_ENT38/141-196-----LLCD--------YAQLSGIETLLK...Q.FN.G-VIVQSDY----------QA------T..VQLRVALPLAEHS
A4E749_9ACTN/101-156-----VHVA--------YPQYEQVLRLAQ...D.SG.A-KVSDTDY----------AD------T..VTIHLVFKAGEQE
Q1ZHQ0_9GAMM/142-197-----LQCD--------HGQMALIENVLK...D.YS.A-HIVDIEY----------TY------Q..VDVILAIDVRQCA
Q4KIR2_PSEF5/132-188-----CACS--------FSELALVKLRVA...E.LG.G-LLVQEDF----------TA------N.GVELQLALGEEQID
B2JNM8_BURP8/228-283-----IEIG--------YADEARVRRWIE...Q.EN.H-VLEASAY----------GM------S..VQLTIRMPVTAID
B1JFA8_PSEPW/132-188-----CSCS--------FSELALVKLRLA...E.VD.A-LVLEERF----------TA------N.GVDLHIAVGEEHIG
Q042C5_LACGA/143-198-----FSIP--------YNRIDEINHYLE...E.NR.I-SIANQEY----------TT------N..VTIQIYLDLDQIQ
Q9ZNK1_CLOHI/138-193-----IDVE--------YELLGKIQYTFS...Q.KN.I-YIEDIQY----------SD------K..VTITVFLELDKIA
Q48AT4_COLP3/142-197-----LACQ--------YSQIDDVLHLLR...Q.IE.G-QVVTQDY----------QQ------T..VIFRLAIPIEKLG
A3KLC0_BACAM/140-195-----TSAD--------YTWLGKIENELR...E.SV.F-LLKDIHY----------AD------H..VEFETYVEEKDKD
A4FQ90_SACEN/136-191-----TTVD--------YLQAGKLENDLR...S.AG.H-RITGVEY----------GE------R..VRIDIGVGEASVA
Q9ANV5_9LACO/142-197-----FSIP--------YNRYDKVDHFLK...E.KE.V-FVDGTEY----------GV------N..ITISIYLDLDQID
A8FP65_SHESH/142-197-----LVCE--------YSQLKDVEYLLN...Q.YD.A-VVEDRSF----------AE------K..VTLEFEIPKRYQE
A6UWS9_META3/137-190-----IIIS--------YNLLNTVKKILQ...N....E-TILNEEY----------SE------T..VKLTVGIKTEAVE
Q97GS0_CLOAB/138-193-----IGIN--------YDLLGKLQYHFS...N.KN.W-HIENIDY----------TD------E..VNILFNCESDKLE
Q5WDD8_BACSK/140-195-----TTID--------YTWLGKIENEIR...Q.SP.Y-LLQGIDY----------LD------N..VVIRTYVKEAETE
Q92SD8_RHIME/131-187-----IACD--------FADLALIKARLA...A.RG.V-SIASETF----------TG------T.GAVLSAEIRQDAVD
Q1WRU9_LACS1/140-195-----LKVS--------YSAWGKLQNYLE...N.NQ.V-NVSDTVF----------MT------D..VTAVVYVDTPEVE
Q8FVG7_BRUSU/165-222-----LACD--------FSDHALLKARLT...AVKN.V-AILQENF----------TA------T.GVEMTGAMPIAAKD
A9KI52_CLOPH/140-195-----ITTD--------YNGIGKLQYIAG...T.MN.L-TILSTDY----------TD------I..VKATLLIPPDAFG
Q9K6U5_BACHD/140-195-----TSID--------YHWLGKVENELR...Q.SH.Y-LLKEISY----------LE------N..VDVQTYVLEAEVE
Q7WI30_BORBR/132-188-----CRCG--------FAELPLLQARLA...Q.AG.A-SVRSETF----------DA------D.GAQLELDVPCAALE
A6FJ22_9GAMM/103-158-----LTCD--------YAQIAAIESLFS...V.YN.G-KLKHAEY----------GA------Q..VVMQLDVDARHIQ
B9LQ76_HALLT/151-205-----VETA--------YDDSGTVRGVIE...S.SG.V-EF.DADY----------DE------R..VRLVLRVPVAEVE
Q3A1N7_PELCD/144-199-----LLVP--------FADEDAVRRLVA...D.KG.F-TLADIRY----------AQ------T..VEMFVNLPSCRVS
Q1YZP6_PHOPR/144-199-----LSCE--------YNQVSLVETLLT...E.YS.G-VQLHADY----------GH------Q..VDMILELDNRDVE
Q67MH5_SYMTH/155-210-----VRVD--------YALLGRVQYLLQ...Q.HG.A-LTLQTDF----------GQ------E..VVIVFRVLETDRD
Q5M5T5_STRT2/138-193-----VELT--------YSQYQVFSNFLE...K.EG.I-QEFDTTF----------LS------D..VSTTLFVEESEIE
Q03H02_PEDPA/139-194-----IKLD--------YQNNDQLVYYLE...Q.HH.L-NQLETEY----------TT------Q..VTTTISISKEQLE
A4AK74_9ACTN/149-205-----LSLA--------HSDAGRVESELR...QYAD.V-AVLGTVY----------GA------S..AVVSLATALGQEQ
Q6DAP3_ERWCT/141-196-----LQCD--------YALLPQIESLIF...Q.LG.G-KILHSEY----------GM------D..VVLRFSIPVRGTE
A1S1J0_SHEAM/142-197-----LSCD--------YAQLADIEYLLG...K.HG.A-DICSRDF----------SG------A..VSLSFVLAKDKLT
A0KEL4_AERHH/142-197-----IQCD--------YTDMGAVEALIQ...A.HQ.G-QLLAADY----------GA------S..VTLQVAWEAAVWS
A4XYN2_PSEMY/132-188-----CHLQ--------FAELALFKARLN...E.FD.S-LIEREDY----------DA------T.GARLQLAVAPAERE
Q1LGN1_RALME/177-235-----IEVD--------YADESRVRRWLELSAA.EG.C-TLVDTRY----------DA------L..ATLLIRLPATLRD
A3DH56_CLOTH/141-196-----IILE--------YTLFGKVQNILI...S.KG.F-TIKDVIY----------EQ------D..VEIIVFVPKDEVD
A1SRE9_PSYIN/141-196-----LHCD--------YAQMAQIESLLV...V.LS.G-RIVEVDY----------LQ------S..IQALIEVDQQLCQ
Q1ZL43_PHOAS/144-199-----LSCE--------YNQVSLVEALLS...E.YN.G-TQLHADY----------GN------Q..VTMQIELDNRIVE
A6NVX0_9FIRM/138-193-----VPCP--------YSFFDRVRLEVE...A.HG.G-VLGETEY----------AA------D..VTVHALLPEGQVE
Q8TSL2_METAC/140-194-----MRFG--------YPEIQKLKNLIE...K.Y..G-RVEEEKY----------SD------A..VEFIFLVKKSFEE
Q6LYD0_METMP/142-196-----LEFD--------YSEIQKIKDISK...I.F..G-KIVDENY----------SD------I..VKFKLEIKKGLED
A6TGM6_KLEP7/141-196-----LQCE--------YGQLAGVEALLA...Q.FS.G-NVVESEY----------LA------S..VRLRVALPQAEVA
Q189Y5_CLOD6/139-194-----VKID--------YTQLGKVQNELM...N.LG.Y-FIKDTVY----------ED------N..VEIVVYSRLEDVE
Q0A6M1_ALHEH/143-194-----LALD--------FAQEQPLRHWAA...Q.HQ.A-TVEAVAY----------GE------G..VTLTLRLPEGAVA
Q12W19_METBU/138-192-----VRFD--------YSDMHSIKRLAE...E.Y..G-QVTGESY----------CD------V..VELSVKVRKGEED
Q47L82_THEFY/136-191-----VLAD--------YQQAGRLESDLR...E.SP.H-RVVDVRY----------GA------D..VEIDVALYGTDPA
B1KCZ5_SHEWM/142-197-----LVCD--------YNQLKDVEYLLA...Q.YD.G-VIEERDF----------ME------K..VTLNFAIPKRFQT
Q2KZZ6_BORA1/132-188-----CRCG--------FAELALLRARLG...S.AG.A-VVLDEVF----------DE------P.GVALTLEMPAAVQA
Q5QXI9_IDILO/143-198-----LNFA--------YTDQGDVEPLLL...E.AN.A-ETESSEY----------EE------S..VRLKVLLRPVNVG
A3CPW4_STRSV/138-193-----LRLS--------YSQYQDFTNFLK...A.EN.L-AEYDTEF----------TD------T..VSTLLFVDKGERE
A5I6F5_CLOBH/138-193-----FIVE--------YDALGKIQYLFE...Q.NL.W-HIENIEY----------TE------K..VSLAIFCEVNIIS
A9B2B3_HERA2/142-197-----VTIN--------YNQYELLRRLLN...T.FD.P-VIESEDF----------AS------D..ITLMLALPQDRWQ
Q8ENG2_OCEIH/140-196-----VKVE--------YPLLGKLENELR...Q.STEF-ILDDIHY----------LE------N..VEFIVYIIEGEEA
A6M153_CLOB8/138-193-----FEME--------YDLFGKVQYTCG...Q.NS.W-HIEDTEY----------SD------K..VVVNILAEKLMAE
Q6ADS2_LEIXX/134-189-----LAAD--------YTDAETVKRWAE...G.ES.F-TVAEPEY----------GA------E..VLLTLRLPETRAP
A2RH67_BACME/140-195-----TTVD--------YTWLGKLENELR...S.SV.Y-LLKEIHY----------AD------M..VEIETFVEEAQTE
Q46BW0_METBF/112-166-----ICLS--------YSESQKVRNLVE...K.Y..A-ELQEETY----------SD------N..VEFIILVRKDLED
A3WIH7_9GAMM/143-198-----LVYE--------YGDQGAVESILS...S.CE.Y-KVIEQTY----------TE------T..VHQIIAIEPEYRA
Q46QX5_CUPPJ/142-200-----VEVD--------YADEPRVRRWLEQAAQ.DG.C-TLADTAY----------GA------M..ARLVIRLPANQRD
Q74KA9_LACJO/143-198-----FTIP--------YNRLDEVNHYLN...E.NK.I-LIDNQIY----------TT------D..VTIQIFLDLDQIT
A6U5M1_SINMW/131-187-----IACD--------FADLALIRARLA...A.RG.V-TTAAETF----------TD------T.GSVLSVEIPQNAVD
A6UP69_METVS/142-196-----LEFE--------YSHIETIKKAIE...N.L..G-KIIEETY----------FE------K..VRYKVEVNFGFEE
A4XI40_CALS8/138-193-----VTLD--------YPNFEKIRWLIE...K.TN.A-KILGIEY----------SQ------V..VDIIVLVRVEDVE
Q4L4H3_STAHJ/140-195-----VTIN--------YDLTGKLEYELA...S.TT.Y-FLRDTTY----------TD------K..VSYQIDVVQTEYD
A6D7Z9_9VIBR/143-198-----LELD--------YAFVATAQSELS...K.CS.A-VEVESHY----------SD------K..VILIVEVEVNKVD
Q1MS48_LAWIP/146-201-----VVLS--------YEHISSFLHLLQ...Q.FH.C-IIINELF----------TS------D..VTYVISIQNEYIQ
A1WPG9_VEREI/149-204-----CQLP--------YALEGWLRREIE...A.AG.A-QLLAVQH----------GA------R..VTLQLRLPQAQAA
Q02UR0_PSEAB/132-188-----FACA--------FADHALLKARSL...A.LG.A-SVAAEDY----------GA------D.GVVLTLELPVARFE
A5N211_CLOK5/151-206-----IFID--------YYNLGKLQYMFE...Q.KS.I-YIENIEY----------AD------K..VKVSINCVVEDVD
Q834A0_ENTFA/140-195-----ITIA--------YPLLGKAQAFLE...H.SP.Y-TLKETIY----------TE------S..IQLICLVDEQATE
A8GYG2_SHEPA/142-197-----LVCE--------YHQLKDVEHLFT...Q.FD.V-LIEDKLF----------SD------K..IVIQFAIPKAFKQ
A4GA80_HERAR/133-188-----FVLQ--------FADESSLRRYCE...Q.QD.V-SVIDAQY----------GD------A..VTLLLKMKCSQVD
Q8PVM6_METMA/50-104-----IRFG--------YPDLQKIRRLVE...E.Y..G-RIEQEKY----------SD------T..VEFEFLIKKDFEE
A5ZXJ4_9FIRM/140-195-----ITTD--------YTGLGKIQYIAG...E.RN.I-PVLDSEY----------TD------K..VVMKLLVPVQDVG
Q3KII0_PSEPF/132-188-----CACA--------FGELALVKLRVA...D.LG.G-LVIEENF----------TA------N.GVELQLAVSEAHIE
Q24W98_DESHY/138-193-----IEAG--------YDWYEPLKYWFK...Q.FS.W-ATGEEEF----------LA------T..VKLQVYIPWEENQ
A9CFZ6_AGRT5/94-151-----LSCP--------FSDLALVKSRLS...ATPN.L-RLEREEF----------TG------T.GADMLLSVPAEEAE
A6CP46_9BACI/140-195-----TKID--------YTWLGKVENEVR...S.SK.Y-PLKEIYY----------LD------Y..VEVETYVEEDKKE
Q0I5B1_HAES1/140-195-----LYCA--------YHQVNWLHVLFE...K.YN.I-RIISQHF----------LQ------D..VQFELGISDDKLA
Q18DK9_HALWD/167-221-----ITVE--------YDDSGTVRRLLR...S.AD.I-EF.EASY----------DT------V..VTFSVNVPTNKTA
Q891Z4_CLOTE/138-193-----IIIE--------YDILGKIQYICE...Q.NN.W-HIEDSIY----------TE------K..VEIIIYCTEDMKN
A3UZ73_VIBSP/143-198-----LELD--------YGFVPIAQSIMA...Q.HQ.A-VEVQADY----------GV------Q..VELIIEIELLQVD
A1SF98_NOCSJ/148-203-----LDLG--------HADAGRVESELR...S.RG.V-VVLDSTY----------GV------H..VTLRLGVPPDEEE

PF09377

SBDS_MOUSE/106-227.....VKPN--------KSTKQQALEVIK---QLKE-.-.KMKIER----------AH---------MRLRFILPVNEGK
SDO1_METJA/103-225.....IDIY--------KSAEEQVPEIVK---KLKK-.-.VLPIRF----------EK---------RDIAVKIPAEFAS
Q8TYB8_METKA/100-222.....IDPM--------KSAEEQVKDVIK---QLRP-.-.VLPMKF----------EE---------VKVAIRIPAKYTG
Q8ZVM7_PYRAE/96-218.....IDPF--------KSVEEQVQEVLK---EIQR-.-.IIPIKV----------AT---------ARVALAVSSTYAQ
Q3HWW0_RECAM/98-219.....IDPE--------VPAERQAPDILK---RLQG-.-LLSFAKI----------AD---------LEGSVTVPTKHIG
A8BTW1_GIAIC/134-259.....IDPF--------IEASAQAPGIVE---MLEK-K-DIILLHP----------GG---------IEGSLSVPYSAVS
Q5DG22_SCHJA/106-231.....LKAN--------KSAKQHALEVIK---QLRS-A-PGLKIAP----------SM---------MEVNITMLKDISE
Q7Q3H9_ANOGA/107-230.....IKPH--------RNAKQQALDVIR---LLRD-.-.TIPLER----------AK---------MRLKLALPAKEAK
SBDS_CAEEL/108-230.....LKPN--------RSSKQQALDAIP---KLRE-.-.TLKIER----------AK---------MKIRVAIPTKEAK
SBDS_DICDI/106-229.....IHPT--------KSSKQQSLEVIK---QISS-.-.VIPIQR----------AQ---------MRLNITIPTKESK
Q3HWV4_PORYE/106-229.....VVPG--------RSAKAQALEVIK---GLAA-.-.HMPIER----------AQ---------MRLDVEAPVKWGK
Q6ZD69_ORYSJ/108-230.....VDPN--------LTSKEQALKVIK---KLTE-.-.HFPIKR----------AP---------LRVRFTAPKSKFA
Q2TYA0_ASPOR/107-325PLWTGVTPN--------KSAKIQALEAMK---ALIA-W-QPIPVMR----------AR---------MRLRVTCPVPLLK
Q2H9G7_CHAGB/107-306PTWTGVSAN--------KSAKSQALDAMK---ALIA-H-QPIPVAR----------AR---------MRLRITCSTNVLK
SDO1_YEAST/106-233.....PVIN--------KPAKLQALEAIK---LLVS-K-QIIPIVR----------AK---------MKVKVAISEPSRQ
Q75F96_ASHGO/143-267.....VVTN--------KPAKLQALEAIK---LLVQ-R-QIIPIAR----------AK---------MRVKAVLPREGNA
Q5AF99_CANAL/107-232.....LNPT--------KPTKIQALDAIK---LLVE-K-QIIPIAR----------AQ---------MKVRITLSKKAYL
Q6C0F0_YARLI/107-228.....IVPK--------KSAKIQAMDAIK---LLVE-K-QIIPIAR----------AR---------MRIRVTGDVKKLG
Q5K9W6_CRYNJ/105-228.....VRAD--------RPAKAQALELIK---KLAE-G-DVLPVRR----------VR---------MRVRITMPGKDAK
Q4P379_USTMA/106-229.....VKTA--------RSAKQQALDVIR---LLQE-K-KTIPIER----------AR---------MRIRITMPNKDGK
SDO1_SCHPO/106-229.....VSTS--------KTAKSQALEAIK---KLQE-K-NEIPIVR----------AR---------MRIRIVVDVKQGK
Q583Z1_TRYB2/109-243.....VRLD--------QPAKKQALALIH---RLMD-A-QIIPIAR----------AP---------MKLRCTTVDEQSL
Q4Q394_LEIMA/109-243.....VKLD--------QSVKKQALGLIH---LLID-S-DILPIAR----------AN---------MKIRCTTTSEAAL
SDO1_ENCCU/102-205........V--------GNSKKQSQEILS---KLEK-.-..MGFDR----------VG---------VRVSVEMSDKVAE
Q5CNW7_CRYHO/106-230.....VSLN--------KTTKEQALKAFD---ILKK-R-IPDQIER----------AK---------MMLKLSVDIVNKQ
Q4N8W7_THEPA/101-252.....ISLN--------KSTKIQSLKALQ---TLQQ-K-YPNLIQR----------CK---------MKLKLNFQSSQYY
A8B6U5_GIAIC/107-233......VTQ--------QPASAQAAHVIR---QLEE-F-MGVHLPQ----------.K---------VNISVELPLSHAK

PF14492

A4TWL9_9PROT/422-496-----SVEA...KT...KNDQEKFGMALG---KMVR-ADPSLRLET----------DR------ETGQTILRGMGELHLE
F2NVW3_TRES6/401-475-----AIEP...ET...MGDRAKLQETLE---ILSR-EDPTFTFRD----------DE------ETGQLVISGMGELHLD
D1Y3B4_9BACT/398-472-----AVDP...ES...RADEDKLGTAVR---RITE-EDPTVSFEK----------NA------ETNDNILSGMGNLHLD
F0T210_SYNGF/365-439-----SIKP...KS...KGDEDKLGTALN---RLMD-EDPTISVQK----------NT------ETKQTILSGRGETQLD
D8PG84_9BACT/404-478-----AIEP...KS...KTDIEKVSLGLH---KLIE-EDPSLEFVR----------HI------ETKEMVLSGMGQLHID
A9NEZ0_ACHLI/398-472-----AIEP...DN...EKDEDKISMALT---KLNI-EDPSFDIQR----------NK------ETGQLLIGGYGISHIK
A6DPN1_9BACT/407-481-----VIEP...KS...SSEKDKLEVALK---ALSD-EDPTFNISF----------NE------ETAQTLISGMGELHLE
C6UN06_HODCD/398-472-----ALEP...KT...KLDSDKLLAALG---KLSA-EDPTLTSAA----------DL------ESGQIVMSGMGELHLE
RRF2M_DANRE/469-543-----SIEP...PT...MAKQADLEHALN---CLQR-EDPSLKVRI----------DP------DSGQTVLCGMGELHIE
E6N8V0_9ARCH/385-458-----SVEP...KY...SRDLPKLVEFLN---KLTI-EDPTLVTVV----------RP------ETGEYLISGMGTLHLE
B0P8B7_9FIRM/401-475-----AVKV...KN...KGDEGKVAQGMQ---RLIE-EDPSIGFEQ----------NA------ETHQQVISGLGEQHLD
E8R235_ISOPI/389-463-----AVEA...KT...REDETKLSASFA---KIAD-EDPTFQVKR----------DP------QTHELVISGMSELHLE
RRF2M_KLULA/449-523-----AIEP...KT...LGNKKPMEQALS---QLTR-EDPSLVVTH----------DE------ETGQTLLSGMGELHLD
A9E504_9FLAO/404-478-----AIEP...VS...KNDEKNFGDALA---KLLD-EDPSLRASY----------DN------QTGQTLLHGMGELHLE
D3F1B7_CONWI/394-468-----SIEP...KT...KGDEDKVFTALR---RLQE-EDPTIDLHR----------DQ------QTGEQIVAGLSAIHVE
C6XHJ4_LIBAP/408-482-----AIEP...KS...KGDQERMSLALS---RLVA-EDPSLRVSM----------DP------NSGQTNLSGMGELHLE
D1RMA4_LEGLO/400-474-----AVTP...KD...KGSTEKMSIAIG---KMVA-EDPTFRVET----------DE------DSGETILRGMGELHLD
C4FC14_9ACTN/392-466-----AIEA...EN...RSDEDKLFTFIE---KACE-ADPTMSIDR----------DE------ETAQTIISAVGEAQVS
A9V2W3_MONBE/968-1042-----VVEP...ET...VSAQASLDAALA---AMIR-EDPSLRVHV----------DE------ETGQTVLSGMGELHLE
A4X5U8_SALTO/427-500-----AIVA...RT...RADEDALARNLA---RLVA-GDPSLRLHR----------DS------ETHQLVLWCMGEAHAD
D0WJ45_9ACTN/394-468-----AIEA...AE...KKEEGKLGTFLA---RLTE-TDPTIRVER----------RE------ETHQTVITTMGEAQVE
B9XK85_9BACT/434-508-----AIEP...AR...STDLQRLAGHLQ---MLSE-DDPTFRVST----------HP------ETGQTLIAGMGELHLD
C5KH54_PERM5/576-650-----SITP...AS...REDSTKMAKALA---RFKR-EDPTFIVST----------DP------GTKETIVSGMGELHLF
D3EPW6_UCYNA/400-474-----AIET...QT...KQELEKLSKALQ---SLSD-EDPTFRVSI----------NP------ETNQTVIAGMGELHLE
B1I3X3_DESAP/379-453-----AISP...KS...KGDEDKLSTALA---RIVE-EEPTVQIKK----------ST------ETKQTVITGMGEAQLD
F2JHA0_CELLD/398-472-----AIFP...TG...KGDEEKMSSSLM---KLMA-EDYTLSVEN----------DK------ETHETILCGIGEQQLD
B3LCX4_PLAKH/489-563-----AVEI...EK...KGDMTKLTKALN---KFVK-EDPTFHVKT----------DE------QTKEIIFEGIGELQLE
E4Q3P1_CALOW/397-471-----AIEP...KT...KGDEEKISNGLH---RLME-EDLTFRIEK----------NN------ETGQNVIYGIGEMHID
E6MJ20_9FIRM/398-472-----AIEA...TN...KSNIDKLSTGLH---KLIE-EDPTIAVTR----------NP------ETKQTIISGLGEMQLE
D5MKJ7_9BACT/401-475-----AIVP...KT...RGDEEKMSSGLQ---RLRE-EDPSLQIRR----------DP------QTKEIILAGMGKTHLE
D3PEH1_DEFDS/400-474-----SLQP...KS...KEDEDKVSNGLH---KLME-EDVGIRVGR----------DE------QTNELLLSGMGQMHIE
Q4CXN3_TRYCC/185-259-----SIKA...KD...DRDLNRLRDRMA---AFMR-EDPTFFFYR----------NS------ETNEDILEGMGELHLD
E3DPX3_HALPG/401-475-----AIEP...KS...KADQDKLGEALQ---RLAE-EDPTFRVHT----------DE------ETGQTIIEGMGELHLE
E9CJE1_CAPO3/563-637-----RVEP...AT...SADQPALDHALA---CLQR-EDPSFRSFF----------DG------DSGQQVMSGMGELHLD
E4Z2J0_OIKDI/428-502-----SIKP...SN...KKATQNFLKALV---RFAN-EDPSFTWVF----------DQ------ESGEYHMTGMGELHLE
F0GVR2_9FIRM/397-471-----AIKA...LS...KNDEDKISEALQ---KLAE-EDPTFKEER----------NQ------ETSQSILSGLGNVQLE
D7FYU3_ECTSI/447-527-----AITPKKSKKGGGSDTADKFSKAFA---RFTK-EDPTLRVHT----------DD------DSKQTIVSGMGELHLE
E7NJM7_YEASO/469-543-----SIEP...RT...LSNKKSMEEALN---TLIT-EDPSLSISQ----------ND------ETGQTVLNGMGELHLE
C8W6F4_DESAS/377-451-----AVNP...KS...KNDEDKLSDAMS---KILD-EDPTLKLEK----------NT------ETKQTLLTAMGELHVN
A9A021_DESOH/403-477-----AVEP...KT...HADQEKMTEVLS---KFSA-EDPTLRVRI----------DE------DTGQTILSGMGELHLE
E0VF81_PEDHC/435-509-----SIKP...AS...LTNREVFSKAIA---RFVK-EDPTFKMFY----------DP------DSKETLVSGMGELHLD
D1N1L0_9BACT/378-452-----AVSA...QK...SGDDEKIAAGLH---KIIE-CIPTVRLGR----------DE------QTHEVLLSGMGDQQLA
B6K7Y9_SCHJY/432-506-----TLLP...KT...VKDEKPMLKALE---CITR-EDPSIRYIR----------DE------GTDEWLLQGLGEMHLE
F0RYS7_SPHGB/397-471-----AISS...DD...KKSEVKMNESLH---KVTE-EDFTFRIKF----------NE------ETKENVVAGMGELHLN
B5RQ33_BORRA/401-475-----SIEP...ER...ASDDARLKEVLE---IIAK-EDPTFSYRE----------DK------ETGQLLISGMGELHLE
D7VYC2_9FLAO/453-527-----AIEP...KT...NGDEKSFGLVLA---KIQE-EDPSLVVER----------NP------QTGETLLSGLGELHLE
F0Y5M1_AURAN/428-505-----AVAP...KKGAAPNVIDAFGNALQ---RFAR-EDPTLRVHV----------DA------ESKQTILSGMGELHLD
C1A5I9_GEMAT/402-476-----AVRA...TA...RGEEDKLQQGLH---RLHD-EDPTLTVHY----------NP------ETHETIVGGMGERHLD
A5V1W8_ROSS1/401-475-----TVKP...KT...RADLDKLGNALH---NVVE-EDPSVRVSR----------DP------DTGESLLSGLGESHLQ
E3QA26_COLGM/478-552-----AIDP...HG...TTAAKELEIALD---NASR-EDPSLRWSR----------DE------KTEQFILQGMGKLHLD
E0TJ49_ZINIC/408-482-----SIEV...SS...KSEQEKLNIALN---KLIQ-EDPSFNTRF----------DN------ESGQTIISGMGELHLE
F2UT40_SALS5/495-568-----SIEA....D...GSDDKEVEHALD---CIQR-EDPSVRVSL----------DE------ETGQTLLSGMGELHLE
C7NEM3_LEPBD/374-448-----AIEP...LN...KNDDEKMSSGLN---RLME-EDPSFTWHR----------NL------ETGQTVLGVQGELHSA
C9LTI7_9FIRM/398-472-----AVYV...KK...KGEEDKVFAALA---KECE-EDPSLKLEK----------DA------ETKETLIRGIGEVHLE
D5X9E5_THEPJ/380-454-----AIAP...RT...KGDEDKLGNAIH---KCLE-EDPCLRVEK----------NM------ETHETILTGMGEAHID
D6HPL8_9FIRM/401-475-----AVFP...KS...KNDEDKMSNALA---RMVE-EDPTLRLEN----------NK------ETKQTILYGIGDQHID
B5YJI2_THEYD/400-474-----AIAP...KT...RGDEEKVSAGLH---KLLE-EDPTLKFSR----------DE------ESKDMILSGMGQVHIE
EFG_CARRP/393-467-----SVEP...IV...KNDYEKLLNLIN---KFCK-EDPSLLFKI----------NE------NTGELILSGMGELHLE
Q4UAY6_THEAN/488-562-----ALKN...IN...KSDSVKLSKALN---RFQK-EDPTFRINI----------DQ------ESKETILSGMGELHLN
EFG_THELT/405-479-----AIEP...LT...RDDEERMVKAVA---ALSE-EDPTLRINV----------DR------ETGQVVLSGMGELHLE
F0ST56_PLABD/409-483-----AVEP...ES...NADRKKLNEVLS---RLEK-QDPTFQVVT----------SE------ETGQQIISGMGELHLE
D6TKZ6_9CHLR/387-461-----TIIP...KS...QNDLDKMGNVLA---RIVQ-EDRTLRVSR----------DP------ETAETLLSGMGEAHLQ
E5SX34_TRISP/552-626-----TVEP...SA...VSEQNKLDLALT---KLAR-EDPSIRTRI----------DS------DSQQTILEAMGELHVE
Q8KTP5_TREPR/410-484-----SVIP...AT...KEDHDKLGDVLG---RLAQ-EDPSFRVHT----------DQ------DTGQTVICGMGELHLD
D8EYC8_9DELT/404-478-----AVEP...KK...VQDNDRLLDALN---KLAD-EDPTFRTKI----------DE------ETGQTLISGMGELHLE
EFG1_SYNWW/397-471-----AIEP...KN...QAGLDKISEALN---RISA-EDPTFKISY----------NK------ETGQVLLAGMGELHLE
Q2YZP5_9DELT/400-474-----AMEP...KT...RGDEDKIASSIH---RLTE-EDPTIVFSR----------NV------ETKEMILSGMGQVHIE
E1X373_BACMS/418-492-----SISC...KD...KNEQAKMSKGLA---KFLK-EDPTFHVFT----------DE------ESGETRIAGMGELHLE
E1P6D8_GEOBB/413-487-----AVEA...KG...VEDRAGLLTSLE---YFQW-EDPTFRVHE----------DQ------ETGQTILTGMGELHLE
D9X5U2_STRVR/398-472-----AVEP...RG...AGDTDRLATGLA---RLTE-EDPSLVVRT----------DP------ETGQTVLSGMGELHLE
A7AQL3_BABBO/524-598-----KVEP...TD...SNDLERMCDVFR---KFMT-EDPAFRMYM----------KP------ETQETIISGMGELHLD
D1Y774_9BACT/402-476-----AVEP...AT...TEDKTKLAKGLI---ALSD-EDPTFVVKD----------NE------ETGQTTISGMGELHLD
E7RAH2_PICAD/489-563-----SIEP...AS...VSENRKLETCLN---TLLR-EDPSLHLSY----------DE------ETGQNILSGMGELHLE
B7KCA7_CYAP7/400-474-----ALTP...KS...HDDEERMKKALH---RFTR-EDPTLHVSN----------DP------ESSKILLSGMGELHLD
A6GCI1_9DELT/430-504-----SVEA...RS...AADQRDLDQALE---RIQK-EDPSFTVYE----------DK------DSGQTLMAGQGELHLE
D7CL94_SYNLT/396-470-----AVNP...AQ...AREQSRIAEALA---RIAA-EDPTLRVAT----------DH------ETGETILSGMGELHLE
B2A2Z5_NATTJ/399-473-----AVVT...QD...KGDEEKVGTSLS---KFLE-EDPILNLEK----------ND------ETKETLISGMGELQLE
D1CGA5_THET1/397-471-----SIRP...KT...KADLDKMGSALQ---RMLE-EDPTLHVSR----------DP------QTGETLVSGMGESHIE
RRF2M_YARLI/441-515-----RIDP...AS...IGDTRPMNEALE---LLLR-EDPSLNVSF----------DD------ETNQTTLSGMGELHLE
A1ZR77_9BACT/405-479-----AIEA...QN...QKEADKLGKALE---KVKE-EDPSIKLEV----------NH------QTGQTILRGMGELHLE
RRF2M_PENMQ/545-619-----SIEP...HS...LSEEKNMQEALA---LLLR-EDPSLHVTV----------DE------DSGQTLLSGMGELHLE
A6C5G4_9PLAN/359-433-----AVEP...KS...QNDQQKISGALH---KIEE-EDQTFHVIH----------DE------ETHEMVMQGMSELHLK
E4RLV1_HALSL/394-468-----AAHP...AD...GVDEEKMASVLQ---RYSD-SDPTFNVEY----------NK------NTKELLLTGMGTIHFI
D2VIA4_NAEGR/392-466-----SIEA...EN...SADQDALDNALS---IMQK-EDPSLQITN----------NE------ETNQTLVSGMGELHLE
D8K0Z6_DEHLB/390-464-----AVHP...RS...KADVDKLSQAIT---RLLE-EDPTLSSHR----------DS------DTHETIVSGLGDTQMD
F0VGQ1_NEOCL/414-488-----SVNV...KK...KDDQQRFAKALN---RFQR-EDPTFRMTV----------DE------ESKETLISGMGELHLQ
E1K1T2_DESFR/398-472-----ALAP...AE...KGDEDKVFAAMS---KLLD-EDITLSITR----------DE------ETGDILLSGMGQTHLE
B1C971_9FIRM/398-472-----GIEP...KS...RGDEDKLSTGLA---KLKE-EDPTIVVER----------DE------ETHQNVLYGMGETHLE
B8E030_DICTD/399-473-----AVVP...KT...RADEDRMSTAIA---RILE-EDPTLRVQR----------NI------ETNETLIYGLGDSHLE
B7IDJ1_THEAB/390-464-----SINP...KS...KSDIDKISNGLA---RLAD-SDPTFSWEF----------DP------ETSETVISGIGNIHLD
A6G6E0_9DELT/388-462-----TLRP...QR...SADLEALGKALA---RYAR-EDPSLRVGR----------DP------ESGLPLIAGTGALQLE
B2V037_CLOBA/400-474-----SVIP...KA...KGDEEKISQALT---KLKD-EDLVFDITR----------DN------ESSEIIISGLGETHID
A4YUJ6_BRASO/385-459-----VVEP...RL...GQDQERLGQALA---LMAR-SDPSLRVVV----------DA------DSGQTLLRGMGELHLQ
E0E580_9FIRM/374-448-----AIAP...KN...KNDEDKMANVLT---RLVG-EDPTLHYYR----------NN------ETHQALIGGQGELHIK
E3NGB7_CAERE/427-501-----CIEP...PS...NRQQQQFNRALE---ELQR-EDPSMKIRF----------DR------DTGQTIVETQGELHLE
C0EB48_9CLOT/384-458-----AVQA...KG...KGDESKISAAIT---KLLQ-EDLTLWYHN----------NT------ETKQQVLTGLGEQHLD
Q1IH98_KORVE/402-476-----AIEP...KT...RADEDKLSNGIH---KMME-EDALLRFFR----------DP------QTKEFLVAGTGQQHIE
C5SZM6_ACIDE/398-472-----AIEP...KA...SADQQGLSKALQ---SLLR-EDPSLRLQH----------DA------ESGQTILSGMGELQLE
EFG_ORITI/417-491-----AVEP...KT...PADQEKISAALV---KLAA-EDPSLVFTV----------DS------ETNQMVIKGMGELHLE
A0LUL8_ACIC1/428-502-----AIHA...KS...KSDEDKLSQSIN---RLAA-EDPTLRIEM----------NA------ETHQLVLWCMGEAHAD
E7MLG8_9FIRM/397-471-----AIHP...KT...KADEDKLSSGIH---NLML-EDHTIKLVN----------NE------ETHEQVLYGVGDQHID
B0VHJ0_CLOAI/392-466-----TIKA...VN...QADEDKIGTVLQ---RVIA-EDPTIRYEL----------NV------ETHENVLSGMGEQQLQ
D4G8N6_RIEPU/424-498-----AIEP...KT...KSDQEKIGSVLN---RLSQ-EDPSFYYST----------DQ------ESGQIIISGMGELHLE
D2QZV7_PIRSD/398-472-----AVTP...VN...RADSDKLSKALQ---RFRK-EDPTFNVFN----------DE------ETSETIIAGMGELHLD
C7PBW2_CHIPD/404-478-----AIEA...KV...AKDVSKLSEALS---KLVE-EDPTLSVSV----------DP------ASGQTILKGMGELHLE
F2LWG4_HIPMA/375-449-----AIYG...AS...KGDEEKIGAAIS---KIIE-ADPSLSFTR----------ND------ETGEFILTGMGKLHLE
A9U7W1_PHYPA/98-171-----AIRP...KG...RTDEAKLGEALR---KLLE-EDPSLKLER----------QE------ETGEFLLWGHGELHLT
E0RSW5_SPITD/394-468-----AIGT...DS...KKEQDKLGELLH---REAE-EDLTFTLTY----------NP------ETKETVISGMGELHIN
D3NS37_AZOS1/404-478-----VVEP...RS...DADHEKMAAALN---RLGH-EDPSLRVAL----------DR------ESGQTIIRGMGELHLD
Q4N936_THEPA/512-586-----SIDI...VN...PQDEPRIQQILD---RYAE-EDPSFKVHR----------NY------ETGETLISGMGELHLD
C0K071_9BACT/399-473-----KVNL...DD...KKNRSKLSEALA---KLCN-EDPSFHAHF----------DE------ETEETIIAGMGELHLE
B0TAY7_HELMI/385-459-----AFYP...AT...KADEDKLGTSLQ---RLLE-EEPCLKIHR----------NT------ETKETILTGMGTLHME
E1X0M6_BACMS/403-477-----AIEP...KT...TADEKKLMDSLS---RLKL-EDPSFTFNN----------NK------ETGQLLIFGMGELHLE
A4A194_9PLAN/368-442-----AIRP...KS...RNDEAKLAAALH---KLVE-EDQTVRVEH----------DP------QTHEVVLRGMSDLHLC
E1R4A8_SPISS/397-471-----TVNA...AS...KKAEDKLNEFLH---RASE-EDPTFDVSF----------NK------ETKESVISGMGELHIT
C9RLE0_FIBSS/410-484-----VIEA...KN...RDDLDNMSKALN---RFTK-EDPTFQVEV----------DK------ESGQTIIKGMGELHLD
D3RWR2_FERPA/385-459-----AIEA...KN...PRDLPKLIEVLR---KLAK-EDPTLQVTL----------NE------ETGEHLISGMGELHLE
A6NVY7_9FIRM/396-470-----AIAP...KT...KGQEDKVASGLT---RMNE-EDLTFAWVN----------NA------ETHQMVVSGTGDMQMD
F0SRV0_PLABD/433-507-----SIEP...AK...RDSADKLGKALE---RFRR-EDPTFHVQT----------DE------ETGQTIIAGMGQLHLE
EFG2_SYNWW/402-476-----AIEA...KT...RADQERIEESLR---RLAE-EDPTFQTRQ----------DK------ESGQMIISGMGELHLE
B5JPE3_9BACT/421-495-----SLVA...LH...KGDEDKLAAGLA---TLHE-EDPTFLFGY----------NP------ETHELVVSGQGELHLE
A0LEB9_SYNFM/399-473-----AVEP...KS...KGDEEKIFSSLS---RLME-EDLTLKLER----------NE------ETKEMILSGMGEIHIE
C3WDZ3_FUSMR/397-471-----GVEP...AE...KADDEKLSTCLQ---RMME-EDPTFKVYR----------NH------ETKQLLIGGLGEKHLY
C4R6N4_PICPG/452-526-----SLQP...MT...AGDRRGLDQSLN---TLLM-EDPSLHVHV----------DE------DSGQTILSGMGELHLD
C1D0A1_DEIDV/376-449-----ALHP...QT...RQDEDRLGDALG---KLLE-EDPTLNYSR----------EP------QTGEMLLGGMGEMHTT
EF2_PYRAE/393-467-----AIEP...KN...PAELARLVEALK---DLVV-EDPTLDLKI----------DQ------ETGQILLSGVGTLHLE
A3ZLH3_9PLAN/406-480-----AIEP...ES...SAERDKLHDTLE---MMKR-QDPTFRATE----------SA------DTGQTIISGMGELHLE
E1R4A6_SPISS/399-473-----AIEP...KT...ASDQEKLHKVLD---QLHR-EDPTFTVRE----------NV------DTGQLLISGMGELHLD
B0N553_9FIRM/395-469-----AIVP...LG...KSNEEKIANAIN---KLLE-EDPTLKFES----------NP------ETKQQCIYGIGDIHLD

PF00679

GUF1_SCHPO/451-540EDFF-----------------------------------------------------------GRLKGTTS---------
Q95Y73_CAEEL/633-723.NLS-----------------------------------------------------------KTVRTLTS---------
GUF1_MAGO7/504-593DDLF-----------------------------------------------------------GKLKGASR---------
C1L1Y4_LISMC/399-487.GYT-----------------------------------------------------------TDFLSMTR---------
Q4WCL6_ASPFU/842-931.GFE-----------------------------------------------------------TDLRIHTQ---------
Q96WU0_BLAAD/659-746.GFA-----------------------------------------------------------TNLRAATQ---------
RRF2M_HUMAN/684-771.GYS-----------------------------------------------------------TVLRTLTS---------
GUF1_PICGU/463-552EDFF-----------------------------------------------------------GKLKGCTK---------
GUF1_OSTLU/451-540ADFA-----------------------------------------------------------DELKSRSS---------
Q5FDV4_EHRRW/423-511.GYQ-----------------------------------------------------------GEFLTDSH---------
RRF2M_ANOGA/641-729.DYS-----------------------------------------------------------TVLRTISS---------
Q1IH98_KORVE/598-685.TYG-----------------------------------------------------------TDLTSMTQ---------
Q83NS0_TROW8/410-497.GFR-----------------------------------------------------------TEFLTITR---------
A4ARW7_MARSH/610-697.GYS-----------------------------------------------------------TNLRSMTQ---------
Q2S5C1_SALRD/429-517.GYR-----------------------------------------------------------SKFLTDTK---------
LEPA_DESRM/402-491YDFF-----------------------------------------------------------DQLKSRTK---------
LEPA_CAMHC/398-487MDFY-----------------------------------------------------------DKLKSGTK---------
A1AR09_PELPD/594-681.GFM-----------------------------------------------------------TELRSATR---------
EF2_METTE/620-707.GFA-----------------------------------------------------------GEIRSATE---------
A5TRL8_FUSNP/592-680.KYS-----------------------------------------------------------IDLRALTQ---------
TETQ_BACFR/535-622.DYA-----------------------------------------------------------SEVSSYTK---------
A4BV85_9GAMM/583-670.DFP-----------------------------------------------------------SKLKAMTG---------
A5Z4P7_9FIRM/513-598.DYI-----------------------------------------------------------NTVNEYTH---------
A5Z6T1_9FIRM/598-686.GYS-----------------------------------------------------------TSLRSITG---------
EFG_SALCH/611-698.GYA-----------------------------------------------------------TQLRSLTK---------
A8MDB4_CALMQ/627-715.NIS-----------------------------------------------------------DELRSATT---------
A4BRZ1_9GAMM/403-491LDFF-----------------------------------------------------------DRLKSASR---------
A6DEJ7_9PROT/393-481.GYR-----------------------------------------------------------GEFMTDTK---------
A9KSY1_CLOPH/512-598.NYQ-----------------------------------------------------------KEVTSYTK---------
Q7NGS6_GLOVI/576-666.EFA-----------------------------------------------------------IELRSLSL---------
Q94BR7_ARATH/686-774.QYV-----------------------------------------------------------STLRGMTK---------
A7BTE3_9GAMM/109-197.NYQ-----------------------------------------------------------TELKSATG---------
Q1YUM4_9GAMM/396-484.GFR-----------------------------------------------------------GAFLTLTS---------
A7FZA2_CLOB1/594-682.NYS-----------------------------------------------------------TDLRSITQ---------
Q4DGU6_TRYCC/750-839.GLQ-----------------------------------------------------------DELRVITQ---------
A4BCQ5_9GAMM/578-666.DYS-----------------------------------------------------------HRLKSLAS---------
Q825F0_STRAW/553-640.ELG-----------------------------------------------------------QVLPGLTR---------
EF2_NANEQ/639-726.GFT-----------------------------------------------------------DTLRSATS---------
Q8RMN6_9BACI/534-621.EYR-----------------------------------------------------------SDLTFFTN---------
Q6MC59_PARUW/398-486.GYR-----------------------------------------------------------NDFLTATR---------
EFG2_SYNWW/598-685.GYA-----------------------------------------------------------TSLRSLTQ---------
A5G260_ACICJ/565-655.GLA-----------------------------------------------------------VELRSQTA---------
Q381P2_TRYB2/848-937.GLE-----------------------------------------------------------TQLRVVTL---------
A5L3A1_9GAMM/51-139.GLR-----------------------------------------------------------HCLNNLSG---------
Q1VQ31_9FLAO/545-632.DFS-----------------------------------------------------------IKLNAITS---------
Q5GBH8_ENTFL/541-628.SYQ-----------------------------------------------------------SELLSYSN---------
Q21YN7_RHOFD/584-672.DYQ-----------------------------------------------------------GRLKSLTG---------
Q4N6X5_THEPA/510-600SDFF-----------------------------------------------------------NKLKAVTN---------
Q3DTP4_STRAG/598-685.GYA-----------------------------------------------------------TVLRSATQ---------
Q4Y6S3_PLACH/682-769.NYI-----------------------------------------------------------NEIRAITQ---------
Q9AIG7_CARRU/590-678.GYS-----------------------------------------------------------TDLRSNTK---------
Q72IJ8_THET2/563-650.EYY-----------------------------------------------------------KALPGLTG---------
Q7UQ85_RHOBA/433-520.GLR-----------------------------------------------------------TRLLNATR---------
Q7YYP3_CRYPV/897-986.GIS-----------------------------------------------------------QELRSKAS---------
Q4FPA2_PELUB/397-485.GYT-----------------------------------------------------------SRFLTLTK---------
A0L3V8_MAGSM/615-702.DYG-----------------------------------------------------------NSLNAMTS---------
A6G6E0_9DELT/585-672.DYA-----------------------------------------------------------TRLGSLTG---------
A4E859_9ACTN/521-606.DYA-----------------------------------------------------------LEVAAYTS---------
Q0SU42_CLOPS/519-604.NYG-----------------------------------------------------------MEFQSFTK---------
A3ZLH3_9PLAN/604-691.GYS-----------------------------------------------------------SAMRSLSQ---------
A7VYF9_9CLOT/584-669.NYS-----------------------------------------------------------RELAAFTK---------
Q5P806_AROAE/584-672.GFE-----------------------------------------------------------ARLKAICA---------
A5JZM2_PLAVS/561-649.GMR-----------------------------------------------------------SYLRDVSK---------
A0NK81_OENOE/401-489FDFF-----------------------------------------------------------NQLKSVSH---------
Q00WM1_OSTTA/464-553.GFR-----------------------------------------------------------QDFINATR---------
A5K1M2_PLAVS/827-915.SYV-----------------------------------------------------------SDLRKITK---------
GUF1_BABBO/505-595STFF-----------------------------------------------------------DNLKSMTN---------
LEPA_MYCGE/399-488YSFF-----------------------------------------------------------DKLKSISK---------
EFGM_CAEEL/641-728.GYT-----------------------------------------------------------SELRSLTE---------
EFG_EHRCR/599-686.GYV-----------------------------------------------------------KDLRSMSQ---------
EFGM_DANRE/638-725.GYA-----------------------------------------------------------TELRSCTE---------
Q729W6_DESVH/400-488.GYR-----------------------------------------------------------DEFLTDTK---------
A9A4F5_NITMS/619-706.TLS-----------------------------------------------------------EEMRGQTA---------
A8MHU5_ALKOO/394-482.GYR-----------------------------------------------------------SEFLTDTK---------
A7S680_NEMVE/415-504TDFY-----------------------------------------------------------DQLKTLSS---------
A0YPA8_LYNSP/395-483.GFR-----------------------------------------------------------GDFMRITR---------
Q9RXC2_DEIRA/579-666.TYS-----------------------------------------------------------ADLRSLTG---------
A7AQL3_BABBO/720-808.GYI-----------------------------------------------------------TELRSMSQ---------
A9CJ73_AGRT5/541-628.GVQ-----------------------------------------------------------QQVPGLTS---------
A9BJK9_PETMO/590-678.DFS-----------------------------------------------------------PRLSSISS---------
Q97J38_CLOAB/542-629.EYK-----------------------------------------------------------MKIASYTK---------
Q6F0Z6_MESFL/400-487.GFR-----------------------------------------------------------SEFTNDTH---------
A0YMH4_LYNSP/585-675.DLI-----------------------------------------------------------VELRSLTM---------
A3I5Y0_9BACI/519-604.SYS-----------------------------------------------------------TIFAAYTN---------
LEPA_CHLAB/404-493SDFN-----------------------------------------------------------DKLKSVTK---------
A6C5F4_9PLAN/612-699.DYA-----------------------------------------------------------NELRSMTQ---------
Q0YPH2_9CHLB/398-486.GYN-----------------------------------------------------------LEFTTDTK---------
Q3LWJ5_BIGNA/768-857.GLE-----------------------------------------------------------TDIRYHTQ---------
A3Q803_MYCSJ/621-709.RYA-----------------------------------------------------------VDLRSLAH---------
Q2KBB2_RHIEC/552-642.DLA-----------------------------------------------------------RALRSATQ---------
A8F3S7_THELT/400-490TDFF-----------------------------------------------------------DRLKAISH---------
Q1Q141_9BACT/597-684.GYS-----------------------------------------------------------TTLRSITQ---------
A6DLC3_9BACT/400-489IDFN-----------------------------------------------------------DRLKSMTK---------
A2XK54_ORYSI/887-976.GFS-----------------------------------------------------------NELRSVTA---------
EFG1_SYNAS/596-683.GFS-----------------------------------------------------------TVIRSATQ---------
A7AM19_BABBO/644-731.GYI-----------------------------------------------------------TDLRAATK---------
Q25003_9MICR/731-819.GFN-----------------------------------------------------------SALLMATR---------
GUFP_OSTLU/403-492TNYF-----------------------------------------------------------DDMKSRSR---------
OTRA_STRRM/555-642.DFN-----------------------------------------------------------QRVPGLTQ---------
LEPA_WIGBR/398-486LDFF-----------------------------------------------------------DKLQSISN---------
LEPA_BUCAP/402-490LNFF-----------------------------------------------------------DELKSVSS---------
GUF1_TRYB2/565-655RGFF-----------------------------------------------------------TFVKSQSH---------
A6G4Z2_9DELT/410-499FGFY-----------------------------------------------------------DQLKSCSR---------
Q9RV32_DEIRA/392-479.GFR-----------------------------------------------------------TQFLSMTQ---------
A0CDU0_PARTE/436-524.GLR-----------------------------------------------------------AELINDTR---------
Q3LVZ0_BIGNA/720-809.GFS-----------------------------------------------------------NELRSSTS---------
Q387N2_TRYB2/438-524.HVP-----------------------------------------------------------LRFHTLTA---------
A5KT16_9BACT/399-487.GLR-----------------------------------------------------------NILLTATK---------
A5FQ33_DEHSB/411-499.GFR-----------------------------------------------------------NSFLTATR---------
A4S0M6_OSTLU/604-691.GYS-----------------------------------------------------------TELRSMTQ---------
LEPA_CHLTE/406-495FDFH-----------------------------------------------------------DKLKSISK---------
A4EBU6_9ACTN/400-487.GLK-----------------------------------------------------------NRIMNVTH---------
Q3ADH6_CARHZ/573-660.KYN-----------------------------------------------------------IDLKAMTQ---------
Q73P52_TREDE/591-679.RYA-----------------------------------------------------------IDLRSMTS---------
Q4CXN3_TRYCC/388-475.GFI-----------------------------------------------------------SDLRRLTK---------
Q6AKJ8_DESPS/591-678.SYA-----------------------------------------------------------TELTSMTG---------
EF2_SULTO/628-715.ELA-----------------------------------------------------------SELRAASA---------
A4A194_9PLAN/587-675.SYA-----------------------------------------------------------RTLSSMTG---------
A0Q2C8_CLONN/546-631.NYK-----------------------------------------------------------LELLSSTS---------
Q5JMX4_ORYSJ/461-551.GFK-----------------------------------------------------------GIFSSFTR---------
A7VSS3_9CLOT/592-680.DFA-----------------------------------------------------------TFIRQCTQ---------
EFG_PLARO/34-121.GYV-----------------------------------------------------------GDLRSKTQ---------
A5UPI8_ROSS1/397-485.GFR-----------------------------------------------------------QTFLTATR---------
A0C124_PARTE/799-888.GFE-----------------------------------------------------------TDLRVHTS---------
A0E802_PARTE/956-1045.DFY-----------------------------------------------------------CQVQSATS---------
A5VM44_LACRD/512-598.DYA-----------------------------------------------------------QSVRAYTH---------
Q5BXM1_SCHJA/221-327.NYS-----------------------------------------------------------ATVRRLSS---------
A0DGW7_PARTE/623-710.GYA-----------------------------------------------------------TELRGFTS---------
A4CM35_ROBBH/393-480.GLR-----------------------------------------------------------NQLLTATA---------
Q820H1_NITEU/395-483.GFQ-----------------------------------------------------------SEFMTLTR---------
B2JWX8_BURP8/582-670.DYQ-----------------------------------------------------------SRLNAIAG---------
Q4N072_THEPA/424-514.GLM-----------------------------------------------------------PVLRDVTR---------
A8FY81_SHESH/586-674.DYS-----------------------------------------------------------TRLKSMTG---------
GUF1_CAEEL/442-531VDFF-----------------------------------------------------------ERLKKLTS---------
A3LU88_PICST/836-924.GLE-----------------------------------------------------------TDIRIRAQ---------
LEPA_ARTS2/411-500FDFF-----------------------------------------------------------DILKSKTR---------
EF2_PYRKO/621-708.GFA-----------------------------------------------------------GAIRGATS---------
A4YUJ6_BRASO/582-669.NYV-----------------------------------------------------------SALRSLSQ---------
A7ADA9_9PORP/620-707.SYS-----------------------------------------------------------TSLSSITG---------
B4SGB3_PELPB/597-684.TFH-----------------------------------------------------------HALTRLTQ---------
Q8KTP5_TREPR/606-694.GYS-----------------------------------------------------------TSLRSMTQ---------
LEPA_BDEBA/400-489MDFY-----------------------------------------------------------DRLKSISK---------
TYPA_BUCBP/399-488.GFR-----------------------------------------------------------TEFSTLTS---------
Q6CXP1_KLULA/782-874.GFE-----------------------------------------------------------TDLRVATA---------
Q1NU00_9DELT/397-484.GYR-----------------------------------------------------------ARFMTDTK---------
A0D5J3_PARTE/683-779.GYS-----------------------------------------------------------TAIRSISQ---------
Q4MLL7_BACCE/540-627.NFK-----------------------------------------------------------RMLHSFTE---------
Q87JC6_VIBPA/578-666.DYA-----------------------------------------------------------RRLRSITG---------
A0C617_PARTE/693-782.QFH-----------------------------------------------------------DQLNEMTQ---------
EFG1_BDEBA/606-694.GYA-----------------------------------------------------------TDVRSLSQ---------
EF2_ENCCU/731-819.TFN-----------------------------------------------------------EDLKSGSR---------
Q55ME0_CRYNB/490-580TEFF-----------------------------------------------------------SELKSQSS---------
D2BIG2_DEHSV/583-670.HYA-----------------------------------------------------------IDLKSITQ---------
A3ZM42_9PLAN/402-491YDLH-----------------------------------------------------------DKLKSATR---------
Q2G8V2_NOVAD/588-678.GLD-----------------------------------------------------------AELRALSQ---------
Q74FV3_GEOSL/395-482.GLR-----------------------------------------------------------GELLTETR---------
A4QD62_CORGB/423-512.GFR-----------------------------------------------------------TQFMTETR---------
C0A700_9BACT/633-720.GYV-----------------------------------------------------------TDIRSLSK---------
A4HGQ1_LEIBR/665-751.RFA-----------------------------------------------------------MELRKAVK---------
Q04U99_LEPBJ/401-489.GFR-----------------------------------------------------------GFFISETR---------
EF2_HALMA/620-707.GFS-----------------------------------------------------------SDIRSATE---------
LEPA_EHRRG/400-488FDFY-----------------------------------------------------------DRIKSISK---------
Q2S3F5_SALRD/609-696.QYS-----------------------------------------------------------TTLRSLTQ---------
B9LLE2_CHLSY/601-689.RYA-----------------------------------------------------------TDLRGMTQ---------
A5DX67_LODEL/884-973.GFA-----------------------------------------------------------SDVKLYTY---------
Q4XSF0_PLACH/117-206INFL-----------------------------------------------------------DEIKSSTK---------
A4Z0F0_BRASO/584-674.ELI-----------------------------------------------------------VELRSATA---------
Q5WBK2_BACSK/540-627.RLK-----------------------------------------------------------SSIHALSG---------
A4EB71_9ACTN/620-708.DYS-----------------------------------------------------------TRLRSITR---------
Q7WT01_9BACE/535-622.EYS-----------------------------------------------------------AEVSSYTQ---------
A4ES82_9RHOB/546-636.ELC-----------------------------------------------------------HTLASATR---------
Q1NJS4_9DELT/398-487YDFY-----------------------------------------------------------DKLKSVTQ---------

PF09186

C6BGR5_RALP1/135-190-AAR-----------------------------------------------------------VALRDLTQ---------
Q1C2C8_YERPA/96-151-QVG-----------------------------------------------------------DKLRDLSR---------
A4VQI4_PSEU5/132-188-PLD-----------------------------------------------------------RLLTDITR---------
Q2G059_STAA8/140-195-AFI-----------------------------------------------------------NFLNQMTA---------
A6AE70_VIBCL/143-198-AFT-----------------------------------------------------------QALINKSG---------
Q13Q97_BURXL/135-190-AAQ-----------------------------------------------------------RALVDMTQ---------
Q4ZYM8_PSEU2/132-188-TLQ-----------------------------------------------------------RQLADLSR---------
A0ALK0_LISW6/140-195-HFR-----------------------------------------------------------KWITEMAN---------
A1VBZ9_DESVV/146-201-MFE-----------------------------------------------------------AALVEMTG---------
A8FHY7_BACP2/140-195-QFI-----------------------------------------------------------EWMTELTN---------
A4FXB8_METM5/145-199-ELI-----------------------------------------------------------KKLVNLTK---------
A5KKP5_9FIRM/161-216-FLM-----------------------------------------------------------KELMEGTN---------
Y722_HAEIN/141-196-AFS-----------------------------------------------------------SELTEKSS---------
Q9L6L3_SALTY/141-196-AFS-----------------------------------------------------------TKLADFSR---------
Q5JF15_PYRKO/139-194-PLM-----------------------------------------------------------ELLTERTR---------
A6T3Y8_JANMA/133-188-EFQ-----------------------------------------------------------RAAFDLLR---------
Q12TB2_SHEDO/146-201-NFI-----------------------------------------------------------LELAAMSQ---------
A2RL93_LACLM/137-192-NFL-----------------------------------------------------------ELLTESFN---------
A2SM12_METPP/134-189-ALR-----------------------------------------------------------RRLDDGGQ---------
A3IC74_9BACI/140-195-QFR-----------------------------------------------------------SWMTEITN---------
Q49VU7_STAS1/140-195-EFI-----------------------------------------------------------AFLNRTTS---------
Q0I0T1_SHESR/142-197-ILN-----------------------------------------------------------ESLATLSQ---------
Q8RAS2_THETN/140-195-EFK-----------------------------------------------------------NFITDLTA---------
Q312M8_DESDG/143-198-ALR-----------------------------------------------------------QALTELTN---------
A3Q8U6_SHELP/142-197-RFN-----------------------------------------------------------QELATLSQ---------
A1A054_BIFAA/142-197-VFE-----------------------------------------------------------SRVVETFN---------
Q5HQY1_STAEQ/140-195-AFI-----------------------------------------------------------DFLNRITS---------
A4J830_DESRM/140-195-RLV-----------------------------------------------------------AKIIENSA---------
A3N2N7_ACTP2/174-229-RFS-----------------------------------------------------------QQITQRFA---------
A0NII2_OENOE/139-194-NFQ-----------------------------------------------------------KRLIDLFS---------
Q0S531_RHOSR/142-195-ELA-----------------------------------------------------------DLVAAVTS---------
Q8XJ08_CLOPE/138-193-EIE-----------------------------------------------------------KSFTEVTN---------
Q5H177_XANOR/157-213-GLK-----------------------------------------------------------TRLCDATG---------
B1YLL5_EXIS2/141-196-AFF-----------------------------------------------------------EWMTNLTN---------
Q38YD6_LACSS/139-194-AFE-----------------------------------------------------------AQMTELLN---------
A1W832_ACISJ/159-214-AFV-----------------------------------------------------------HQVNEAGQ---------
A5VIF6_LACRD/140-195-NVK-----------------------------------------------------------EKLINRFN---------
Q4MM25_BACCE/140-195-AFT-----------------------------------------------------------DWMIELTN---------
A7JQV0_PASHA/140-195-AFA-----------------------------------------------------------DELTQRFS---------
A0QPN6_MYCS2/140-193-SLI-----------------------------------------------------------AAIDQITS---------
Q4JW71_CORJK/159-212-PLP-----------------------------------------------------------DFLASITS---------
Q1BMU3_BURCA/134-189-AAR-----------------------------------------------------------AELFDLTQ---------
Q2T656_BURTA/142-197-AAR-----------------------------------------------------------DALFDQTQ---------
A6BHR1_9FIRM/140-195-QVM-----------------------------------------------------------HAITEGTN---------
Q8FNW9_COREF/165-220-ATE-----------------------------------------------------------SQLSSLAG---------
Q08A37_SHEFN/142-197-AFN-----------------------------------------------------------QALATQTQ---------
Q21FZ6_SACD2/148-203-QLE-----------------------------------------------------------QDIPQLSS---------
A8MHP1_ALKOO/140-195-QFK-----------------------------------------------------------EQIIEWTN---------
B8I4L4_CLOCE/140-195-ELM-----------------------------------------------------------KDIVEVSN---------
A4QFI9_CORGB/146-201-SVE-----------------------------------------------------------SQLSSMMG---------
A7VIJ4_9CLOT/140-195-MIE-----------------------------------------------------------KKITEATA---------
A6FWP6_9DELT/138-193-GLV-----------------------------------------------------------SELRDASG---------
Q1D8G7_MYXXD/143-198-ALR-----------------------------------------------------------TALNDLTL---------
Q9CGK5_LACLA/137-192-EVM-----------------------------------------------------------NLLTETFN---------
A7B7M9_RUMGN/138-193-KLI-----------------------------------------------------------AEITEATN---------
Q0JYJ3_CUPNH/150-208-AAR-----------------------------------------------------------DALRDATH---------
B8G4C5_CHLAD/143-198-TIS-----------------------------------------------------------KQIDEYSA---------
Q9CKV8_PASMU/141-196-AFE-----------------------------------------------------------QALIERFS---------
A6VZC4_MARMS/141-196-EHK-----------------------------------------------------------IVLTDLCQ---------
A5LQV6_STRPN/138-193-TIK-----------------------------------------------------------AALVEFFN---------
A1RDW8_SHESW/142-197-RFS-----------------------------------------------------------ELLMTLSQ---------
Q1EM54_BACLI/140-195-AFT-----------------------------------------------------------EWITELTN---------
Q5E8X5_VIBF1/143-198-EFK-----------------------------------------------------------IAIINKSG---------
Q1IFE1_PSEE4/132-188-TLQ-----------------------------------------------------------QQYADISR---------
B9LFJ9_CHLSY/142-197-VVN-----------------------------------------------------------HQIGEISA---------
Q2BF26_9BACI/140-195-LFS-----------------------------------------------------------EWITELTN---------
Q1JYD9_DESAC/142-197-RFT-----------------------------------------------------------THITDLSH---------
Q6NGE7_CORDI/143-198-QTQ-----------------------------------------------------------GLLSSLTS---------
B0K946_THEP3/140-195-EFQ-----------------------------------------------------------TFINDLTS---------
Q87TN8_VIBPA/143-198-AFT-----------------------------------------------------------QAIINKSG---------
Q03AP8_LACC3/140-195-ATL-----------------------------------------------------------AALNDFLN---------
A7VZA1_9CLOT/138-193-ALN-----------------------------------------------------------RKLADATS---------
A3Y741_9GAMM/141-196-EQK-----------------------------------------------------------AALTNLCQ---------
Q7MZ94_PHOLL/141-196-EVG-----------------------------------------------------------DKLRDLSR---------
Q8DDK7_VIBVU/143-198-MFT-----------------------------------------------------------QTMINKSS---------
A4RVU2_OSTLU/174-231-TLK-----------------------------------------------------------ERLANATS---------
Q8G426_BIFLO/103-158-RFE-----------------------------------------------------------ERVREAFN---------
A4STE9_AERS4/142-197-QVD-----------------------------------------------------------RELTDRTH---------
A6TQB9_ALKMQ/140-195-DFK-----------------------------------------------------------KQIVEWTS---------
Q1J2A7_DEIGD/140-196-AFA-----------------------------------------------------------QALRDATR---------
A7MQN8_CROS8/141-196-AFS-----------------------------------------------------------AKLADFSR---------
A1WAA0_ACISJ/134-189-AFE-----------------------------------------------------------QRLSDSGQ---------
Q65W79_MANSM/140-195-PFK-----------------------------------------------------------QELTERSA---------
Q5FL79_LACAC/142-197-PVK-----------------------------------------------------------NDLTNLLS---------
Q03SQ4_LACBA/140-195-ATQ-----------------------------------------------------------GAIQNLLS---------
Q826X2_STRAW/140-195-AFR-----------------------------------------------------------SWLADATA---------
Q927X7_LISIN/140-195-TFS-----------------------------------------------------------TWITEVSN---------
Q1R464_ECOUT/142-197-EFS-----------------------------------------------------------AKLADFSR---------
A6VLN9_ACTSZ/140-195-AFN-----------------------------------------------------------QELTERSA---------
A1TPX1_ACIAC/145-200-TFR-----------------------------------------------------------QRIDDAAQ---------
Q5KV49_GEOKA/140-195-PFG-----------------------------------------------------------DWMTELTN---------
A1HN60_9FIRM/139-194-SLC-----------------------------------------------------------QTITNLTS---------
Q7NTX7_CHRVO/133-188-ERL-----------------------------------------------------------ARLADRMA---------
Q03ZJ9_LEUMM/140-195-KFQ-----------------------------------------------------------SDLMNQFS---------
A0PZT9_CLONN/138-193-NIK-----------------------------------------------------------NKITEATS---------
Q83VY2_STRCJ/140-195-GFR-----------------------------------------------------------AWLADTTA---------
A7BDK8_9ACTO/143-198-SID-----------------------------------------------------------ACLAQASS---------
Q2S3C2_SALRD/140-195-AFV-----------------------------------------------------------DAFTNALS---------
A4WFX2_ENT38/141-196-AFS-----------------------------------------------------------AKLADFSR---------
A4E749_9ACTN/101-156-PFC-----------------------------------------------------------AKMRELMA---------
Q1ZHQ0_9GAMM/142-197-SFL-----------------------------------------------------------LKIASLTQ---------
Q4KIR2_PSEF5/132-188-TLQ-----------------------------------------------------------QQLADLSR---------
B2JNM8_BURP8/228-283-GAR-----------------------------------------------------------EALRDMTQ---------
B1JFA8_PSEPW/132-188-ALQ-----------------------------------------------------------QQLADLSR---------
Q042C5_LACGA/143-198-KVE-----------------------------------------------------------DDLINLLS---------
Q9ZNK1_CLOHI/138-193-DVE-----------------------------------------------------------REVMNITS---------
Q48AT4_COLP3/142-197-LMQ-----------------------------------------------------------DKLHTLSS---------
A3KLC0_BACAM/140-195-EFI-----------------------------------------------------------KWMTELTN---------
A4FQ90_SACEN/136-191-EFE-----------------------------------------------------------TWLAEATG---------
Q9ANV5_9LACO/142-197-PFI-----------------------------------------------------------SDLTELLN---------
A8FP65_SHESH/142-197-TLN-----------------------------------------------------------LGLATMSQ---------
A6UWS9_META3/137-190-EIK-----------------------------------------------------------NKLINNTK---------
Q97GS0_CLOAB/138-193-EVR-----------------------------------------------------------KDVTEICH---------
Q5WDD8_BACSK/140-195-TFQ-----------------------------------------------------------QWMTEQTN---------
Q92SD8_RHIME/131-187-DVL-----------------------------------------------------------TLVSDLTR---------
Q1WRU9_LACS1/140-195-SFT-----------------------------------------------------------ATIIDLMN---------
Q8FVG7_BRUSU/165-222-DLS-----------------------------------------------------------RLVSDLTR---------
A9KI52_CLOPH/140-195-SFQ-----------------------------------------------------------KKITEATN---------
Q9K6U5_BACHD/140-195-SYC-----------------------------------------------------------EWMTNLTN---------
Q7WI30_BORBR/132-188-ELA-----------------------------------------------------------RTFANITR---------
A6FJ22_9GAMM/103-158-AFI-----------------------------------------------------------TAVRNKTN---------
B9LQ76_HALLT/151-205-SLV-----------------------------------------------------------ERLNSATS---------
Q3A1N7_PELCD/144-199-DFC-----------------------------------------------------------TWVQDRCR---------
Q1YZP6_PHOPR/144-199-VFS-----------------------------------------------------------AKLKNRSG---------
Q67MH5_SYMTH/155-210-RVT-----------------------------------------------------------AELAEASA---------
Q5M5T5_STRT2/138-193-RLG-----------------------------------------------------------QELTEFYQ---------
Q03H02_PEDPA/139-194-PLK-----------------------------------------------------------QELIGLFS---------
A4AK74_9ACTN/149-205-SLH-----------------------------------------------------------ERVAGITS---------
Q6DAP3_ERWCT/141-196-EAA-----------------------------------------------------------TKLRDLSR---------
A1S1J0_SHEAM/142-197-SLN-----------------------------------------------------------QDLATLSA---------
A0KEL4_AERHH/142-197-RIA-----------------------------------------------------------QELTDRTQ---------
A4XYN2_PSEMY/132-188-ALE-----------------------------------------------------------RLLGDVSR---------
Q1LGN1_RALME/177-235-GAI-----------------------------------------------------------ATLRDATH---------
A3DH56_CLOTH/141-196-AFI-----------------------------------------------------------DMINEATN---------
A1SRE9_PSYIN/141-196-QFI-----------------------------------------------------------EKLDSLTQ---------
Q1ZL43_PHOAS/144-199-EFR-----------------------------------------------------------AKLTNRSG---------
A6NVX0_9FIRM/138-193-AFS-----------------------------------------------------------ARMTELTA---------
Q8TSL2_METAC/140-194-QFL-----------------------------------------------------------EKLAKLTR---------
Q6LYD0_METMP/142-196-EFT-----------------------------------------------------------KKLINSTK---------
A6TGM6_KLEP7/141-196-AFS-----------------------------------------------------------ARLADFSR---------
Q189Y5_CLOD6/139-194-KLS-----------------------------------------------------------EKMIDITS---------
Q0A6M1_ALHEH/143-194-A..-----------------------------------------------------------..LRQFAQ---------
Q12W19_METBU/138-192-GFA-----------------------------------------------------------DKLTNLTK---------
Q47L82_THEFY/136-191-DFT-----------------------------------------------------------AWVAEITA---------
B1KCZ5_SHEWM/142-197-ELN-----------------------------------------------------------RDLATMSQ---------
Q2KZZ6_BORA1/132-188-ELA-----------------------------------------------------------RAAANITR---------
Q5QXI9_IDILO/143-198-ALQ-----------------------------------------------------------KKLQAATR---------
A3CPW4_STRSV/138-193-LLK-----------------------------------------------------------DKLTEFFK---------
A5I6F5_CLOBH/138-193-TIE-----------------------------------------------------------KKVLEITN---------
A9B2B3_HERA2/142-197-ECA-----------------------------------------------------------AAIRELTY---------
Q8ENG2_OCEIH/140-196-SFI-----------------------------------------------------------SWITNLTS---------
A6M153_CLOB8/138-193-DIE-----------------------------------------------------------NEIVEVTN---------
Q6ADS2_LEIXX/134-189-SAK-----------------------------------------------------------EAVADLSR---------
A2RH67_BACME/140-195-AFT-----------------------------------------------------------EWMTELTN---------
Q46BW0_METBF/112-166-EFI-----------------------------------------------------------KKIIDQTK---------
A3WIH7_9GAMM/143-198-QLD-----------------------------------------------------------KQFQAQTQ---------
Q46QX5_CUPPJ/142-200-AAQ-----------------------------------------------------------AALRDATH---------
Q74KA9_LACJO/143-198-QVK-----------------------------------------------------------EDLINLLS---------
A6U5M1_SINMW/131-187-EVS-----------------------------------------------------------ALVSDLSR---------
A6UP69_METVS/142-196-ELI-----------------------------------------------------------KKLVSATK---------
A4XI40_CALS8/138-193-SLI-----------------------------------------------------------KNISDVTA---------
Q4L4H3_STAHJ/140-195-DFI-----------------------------------------------------------AFLNKNTA---------
A6D7Z9_9VIBR/143-198-ALT-----------------------------------------------------------QSIINKSG---------
Q1MS48_LAWIP/146-201-SFQ-----------------------------------------------------------NELTNLTS---------
A1WPG9_VEREI/149-204-RLM-----------------------------------------------------------QRVNDNGQ---------
Q02UR0_PSEAB/132-188-ALQ-----------------------------------------------------------ALLVDLSR---------
A5N211_CLOK5/151-206-KLI-----------------------------------------------------------NEIIEVTS---------
Q834A0_ENTFA/140-195-TFI-----------------------------------------------------------AEMTDLLN---------
A8GYG2_SHEPA/142-197-QLK-----------------------------------------------------------LDLATLSK---------
A4GA80_HERAR/133-188-VFT-----------------------------------------------------------RAAFDLLR---------
Q8PVM6_METMA/50-104-EFH-----------------------------------------------------------EKMAKLTK---------
A5ZXJ4_9FIRM/140-195-SVQ-----------------------------------------------------------KAITEGTN---------
Q3KII0_PSEPF/132-188-LLQ-----------------------------------------------------------NQLADLSR---------
Q24W98_DESHY/138-193-RFR-----------------------------------------------------------EWLADFAD---------
A9CFZ6_AGRT5/94-151-RLT-----------------------------------------------------------RLLSDLTS---------
A6CP46_9BACI/140-195-EFV-----------------------------------------------------------EWMTELTN---------
Q0I5B1_HAES1/140-195-AFQ-----------------------------------------------------------NDLSSYSA---------
Q18DK9_HALWD/167-221-TLC-----------------------------------------------------------DQIQSATS---------
Q891Z4_CLOTE/138-193-NIN-----------------------------------------------------------KEVVQATS---------
A3UZ73_VIBSP/143-198-SFT-----------------------------------------------------------QTMINKSG---------
A1SF98_NOCSJ/148-203-RLA-----------------------------------------------------------ALVAELTA---------

PF09377

SBDS_MOUSE/106-227-KLK...........................................................EKLKPLMK.VV...ESE
SDO1_METJA/103-225-..............................................................KAYNALYQFGAVKQEEW
Q8TYB8_METKA/100-222-..............................................................QAMGVVREFGDIEREEW
Q8ZVM7_PYRAE/96-218-..............................................................RVKGLVAKMAKIVNERY
Q3HWW0_RECAM/98-219-..............................................................VASSILYKWCR..VGNE
A8BTW1_GIAIC/134-259-K.............................................................LQATAVKIGVNFLGDGE
Q5DG22_SCHJA/106-231-PVI...........................................................ERLLQLCSSII..RQGE
Q7Q3H9_ANOGA/107-230-RLK...........................................................ERIAKLSSTVT..EGEE
SBDS_CAEEL/108-230-SVH...........................................................TKLKTLFS.DV..EVDD
SBDS_DICDI/106-229-TLNR..........................................................DKLMVLVS.KI..EEED
Q3HWV4_PORYE/106-229-GVK...........................................................GGLDGLVVGLV...GAE
Q6ZD69_ORYSJ/108-230-SLT...........................................................EKLEEWNA.NV..ISKD
Q2TYA0_ASPOR/107-325-QTVKSAAPAGLNKEKEAPSGGNSKSNKKGGKGSKKSARQQDSDAEGGSDAEPSQPKAPTNVKDKILSFIE.SV..ESQE
Q2H9G7_CHAGB/107-306-QAVKAPKGAAAAAGGKDT..............................EGGDGEPKAPGTVKDKILSFIE.QI..ENQD
SDO1_YEAST/106-233-PELI..........................................................EKISKLIA.SSPGESTK
Q75F96_ASHGO/143-267-..............................................................EAIAQAASLIAATEAAP
Q5AF99_CANAL/107-232-KTFQ..........................................................DEIKPVID.QI..VEED
Q6C0F0_YARLI/107-228-LG............................................................EKLKTDMGATVEEETHD
Q5K9W6_CRYNJ/105-228-RCK...........................................................DKIVAECD.EV...EEE
Q4P379_USTMA/106-229-KIK...........................................................DKILPLTD.KV...DDE
SDO1_SCHPO/106-229-ALR...........................................................ERLRSLAD.EI...EEE
Q583Z1_TRYB2/109-243-KKVTEWCE..................................................SNRATILEEPGETCQ..DETV
Q4Q394_LEIMA/109-243-EKLRGWCR..................................................DNDADVVSDSVTGKT..SDGG
SDO1_ENCCU/102-205-FV............................................................................K
Q5CNW7_CRYHO/106-230-..............................................................NITKKLNEFNVFPISSE
Q4N8W7_THEPA/101-252-QVLSFINNHNASNHLTD...............................SSENFSASSESSSPQQRGGESADDIIIESKN
A8B6U5_GIAIC/107-233-ACI...........................................................AVCVTDYALTIDPESFI

PF14492

A4TWL9_9PROT/422-496-VTL-----------------------------------------------------------DRMRTEFG---------
F2NVW3_TRES6/401-475-VLV-----------------------------------------------------------TRIRDDFK---------
D1Y3B4_9BACT/398-472-IVL-----------------------------------------------------------AKLKDRFG---------
F0T210_SYNGF/365-439-IVS-----------------------------------------------------------EKLLRKFG---------
D8PG84_9BACT/404-478-VAL-----------------------------------------------------------EKLHRKYG---------
A9NEZ0_ACHLI/398-472-YIT-----------------------------------------------------------DRMKNLYK---------
A6DPN1_9BACT/407-481-IIA-----------------------------------------------------------DRLIENSK---------
C6UN06_HODCD/398-472-VAI-----------------------------------------------------------DRIRREHA---------
RRF2M_DANRE/469-543-IIH-----------------------------------------------------------DRIKREYK---------
E6N8V0_9ARCH/385-458-IAL-----------------------------------------------------------TWIQKA.G---------
B0P8B7_9FIRM/401-475-VIV-----------------------------------------------------------SKLKSKFG---------
E8R235_ISOPI/389-463-VLQ-----------------------------------------------------------NRLKHRYK---------
RRF2M_KLULA/449-523-IAR-----------------------------------------------------------DRLLNELN---------
A9E504_9FLAO/404-478-VRI-----------------------------------------------------------EKLKSEYK---------
D3F1B7_CONWI/394-468-IVI-----------------------------------------------------------ARLRERFG---------
C6XHJ4_LIBAP/408-482-IIV-----------------------------------------------------------DRMLREFK---------
D1RMA4_LEGLO/400-474-IKV-----------------------------------------------------------DILKRTYD---------
C4FC14_9ACTN/392-466-VLL-----------------------------------------------------------NRLEDRTK---------
A9V2W3_MONBE/968-1042-IVR-----------------------------------------------------------SRLLEEYK---------
A4X5U8_SALTO/427-500-VVL-----------------------------------------------------------DRLRSG.G---------
D0WJ45_9ACTN/394-468-TIL-----------------------------------------------------------NRLKEQAG---------
B9XK85_9BACT/434-508-VVR-----------------------------------------------------------ERLRTELR---------
C5KH54_PERM5/576-650-IYA-----------------------------------------------------------ERIRREYH---------
D3EPW6_UCYNA/400-474-ILV-----------------------------------------------------------DRMLREYK---------
B1I3X3_DESAP/379-453-IIV-----------------------------------------------------------DRFKRKYG---------
F2JHA0_CELLD/398-472-VVV-----------------------------------------------------------SMLKNKFK---------
B3LCX4_PLAKH/489-563-IYK-----------------------------------------------------------ERLKREYG---------
E4Q3P1_CALOW/397-471-VIV-----------------------------------------------------------SKLKNKFG---------
E6MJ20_9FIRM/398-472-IVS-----------------------------------------------------------HRLKQKFD---------
D5MKJ7_9BACT/401-475-IAV-----------------------------------------------------------DRLKRKYG---------
D3PEH1_DEFDS/400-474-VVV-----------------------------------------------------------EKLKEKFK---------
Q4CXN3_TRYCC/185-259-IYV-----------------------------------------------------------ERLKREHG---------
E3DPX3_HALPG/401-475-VIV-----------------------------------------------------------DRLLREFK---------
E9CJE1_CAPO3/563-637-IIR-----------------------------------------------------------DRIQREYN---------
E4Z2J0_OIKDI/428-502-IYA-----------------------------------------------------------QRMEREYD---------
F0GVR2_9FIRM/397-471-VLM-----------------------------------------------------------DKLKYNYS---------
D7FYU3_ECTSI/447-527-VYV-----------------------------------------------------------ERLRREYD---------
E7NJM7_YEASO/469-543-IAK-----------------------------------------------------------DRLVNDLK---------
C8W6F4_DESAS/377-451-IIV-----------------------------------------------------------DRLKNKYG---------
A9A021_DESOH/403-477-IIV-----------------------------------------------------------SRMTREFN---------
E0VF81_PEDHC/435-509-IYC-----------------------------------------------------------QRMEREYN---------
D1N1L0_9BACT/378-452-IVA-----------------------------------------------------------KRLKDQFK---------
B6K7Y9_SCHJY/432-506-ITF-----------------------------------------------------------DRLVQDFG---------
F0RYS7_SPHGB/397-471-MIL-----------------------------------------------------------DKVREKQK---------
B5RQ33_BORRA/401-475-III-----------------------------------------------------------MRIRDDFK---------
D7VYC2_9FLAO/453-527-VTL-----------------------------------------------------------EKIRLNHG---------
F0Y5M1_AURAN/428-505-VYV-----------------------------------------------------------ERMKREYK---------
C1A5I9_GEMAT/402-476-VAM-----------------------------------------------------------AVLKRKFG---------
A5V1W8_ROSS1/401-475-IIA-----------------------------------------------------------ERMKRKFG---------
E3QA26_COLGM/478-552-IAV-----------------------------------------------------------YNLKQNPK---------
E0TJ49_ZINIC/408-482-III-----------------------------------------------------------DRIKREYN---------
F2UT40_SALS5/495-568-IVL-----------------------------------------------------------SRLRDEYK---------
C7NEM3_LEPBD/374-448-TVI-----------------------------------------------------------EKLKAKFG---------
C9LTI7_9FIRM/398-472-VLQ-----------------------------------------------------------ERMKRKFG---------
D5X9E5_THEPJ/380-454-IVL-----------------------------------------------------------EKMKRKFG---------
D6HPL8_9FIRM/401-475-VVL-----------------------------------------------------------NKLQAKYK---------
B5YJI2_THEYD/400-474-VAL-----------------------------------------------------------EKLKRKFG---------
EFG_CARRP/393-467-III-----------------------------------------------------------DRINNEFN---------
Q4UAY6_THEAN/488-562-IYL-----------------------------------------------------------ERMKREYG---------
EFG_THELT/405-479-IVT-----------------------------------------------------------DRLKREFG---------
F0ST56_PLABD/409-483-IIK-----------------------------------------------------------DRIQRDFG---------
D6TKZ6_9CHLR/387-461-ITV-----------------------------------------------------------ESIKRKYG---------
E5SX34_TRISP/552-626-IIK-----------------------------------------------------------DRLKRDYG---------
Q8KTP5_TREPR/410-484-IMV-----------------------------------------------------------ERVRREFG---------
D8EYC8_9DELT/404-478-ILT-----------------------------------------------------------ERLKREFS---------
EFG1_SYNWW/397-471-IVA-----------------------------------------------------------ERLAREFK---------
Q2YZP5_9DELT/400-474-VNI-----------------------------------------------------------EKMKRKFG---------
E1X373_BACMS/418-492-IYV-----------------------------------------------------------ERLKREFG---------
E1P6D8_GEOBB/413-487-VVI-----------------------------------------------------------DRLRREYG---------
D9X5U2_STRVR/398-472-VAV-----------------------------------------------------------EKLRRELG---------
A7AQL3_BABBO/524-598-IMV-----------------------------------------------------------DRMRREYG---------
D1Y774_9BACT/402-476-IIV-----------------------------------------------------------DRLRREFG---------
E7RAH2_PICAD/489-563-ITK-----------------------------------------------------------DRLISDMK---------
B7KCA7_CYAP7/400-474-IYL-----------------------------------------------------------ERMRREYH---------
A6GCI1_9DELT/430-504-VIV-----------------------------------------------------------NKLLRDYR---------
D7CL94_SYNLT/396-470-IIT-----------------------------------------------------------ERLKREFK---------
B2A2Z5_NATTJ/399-473-III-----------------------------------------------------------EKMKKKYG---------
D1CGA5_THET1/397-471-LMA-----------------------------------------------------------ERMKRKFG---------
RRF2M_YARLI/441-515-IAQ-----------------------------------------------------------NRLIEDFK---------
A1ZR77_9BACT/405-479-VVI-----------------------------------------------------------DRMQNDFE---------
RRF2M_PENMQ/545-619-IAR-----------------------------------------------------------DRLVNDFK---------
A6C5G4_9PLAN/359-433-IVQ-----------------------------------------------------------ERLLHRDK---------
E4RLV1_HALSL/394-468-MIK-----------------------------------------------------------DECKRKYD---------
D2VIA4_NAEGR/392-466-IIK-----------------------------------------------------------DRILTEYG---------
D8K0Z6_DEHLB/390-464-VMA-----------------------------------------------------------EKMARKYS---------
F0VGQ1_NEOCL/414-488-IYL-----------------------------------------------------------ERMSREYR---------
E1K1T2_DESFR/398-472-NAV-----------------------------------------------------------EKARRRFK---------
B1C971_9FIRM/398-472-VVK-----------------------------------------------------------DKLKNKYG---------
B8E030_DICTD/399-473-VVV-----------------------------------------------------------ERMQRKFG---------
B7IDJ1_THEAB/390-464-VMV-----------------------------------------------------------ERLKNIFG---------
A6G6E0_9DELT/388-462-LYA-----------------------------------------------------------ERLGDEHG---------
B2V037_CLOBA/400-474-IIA-----------------------------------------------------------SKIKNKFG---------
A4YUJ6_BRASO/385-459-IAV-----------------------------------------------------------ERLKEDYN---------
E0E580_9FIRM/374-448-TLV-----------------------------------------------------------NKMKDKFG---------
E3NGB7_CAERE/427-501-AIK-----------------------------------------------------------DRLKRNYK---------
C0EB48_9CLOT/384-458-VAV-----------------------------------------------------------AKLKSKFG---------
Q1IH98_KORVE/402-476-VVV-----------------------------------------------------------SKLKKRYH---------
C5SZM6_ACIDE/398-472-VSI-----------------------------------------------------------EKLRARHG---------
EFG_ORITI/417-491-III-----------------------------------------------------------DRMKEEFK---------
A0LUL8_ACIC1/428-502-VVL-----------------------------------------------------------DRLKSRYG---------
E7MLG8_9FIRM/397-471-LIL-----------------------------------------------------------SKLKSKYK---------
B0VHJ0_CLOAI/392-466-LVL-----------------------------------------------------------KKLKNRYK---------
D4G8N6_RIEPU/424-498-ILV-----------------------------------------------------------ERMKREFK---------
D2QZV7_PIRSD/398-472-IYV-----------------------------------------------------------ERIKREYK---------
C7PBW2_CHIPD/404-478-VVL-----------------------------------------------------------EKLTSNYH---------
F2LWG4_HIPMA/375-449-TVV-----------------------------------------------------------SRLKKKYG---------
A9U7W1_PHYPA/98-171-TAK-----------------------------------------------------------ERLA.DYG---------
E0RSW5_SPITD/394-468-MIL-----------------------------------------------------------NKIREKFK---------
D3NS37_AZOS1/404-478-IIV-----------------------------------------------------------DRMKREFR---------
Q4N936_THEPA/512-586-VMV-----------------------------------------------------------DRIKREQN---------
C0K071_9BACT/399-473-IIV-----------------------------------------------------------DRLKEEFK---------
B0TAY7_HELMI/385-459-VCV-----------------------------------------------------------ERLQRKYG---------
E1X0M6_BACMS/403-477-IIA-----------------------------------------------------------DRLEREFK---------
A4A194_9PLAN/368-442-LLQ-----------------------------------------------------------ERLARRDH---------
E1R4A8_SPISS/397-471-IIL-----------------------------------------------------------DKIRNKQK---------
C9RLE0_FIBSS/410-484-VYI-----------------------------------------------------------ERMRREYK---------
D3RWR2_FERPA/385-459-VKV-----------------------------------------------------------EKIRREYG---------
A6NVY7_9FIRM/396-470-VLV-----------------------------------------------------------SRLKSRFG---------
F0SRV0_PLABD/433-507-VYI-----------------------------------------------------------ERIKREYK---------
EFG2_SYNWW/402-476-III-----------------------------------------------------------DRLLKEFK---------
B5JPE3_9BACT/421-495-VLK-----------------------------------------------------------SRLARRFN---------
A0LEB9_SYNFM/399-473-ATV-----------------------------------------------------------DKLKRKFG---------
C3WDZ3_FUSMR/397-471-III-----------------------------------------------------------CKIKNKFG---------
C4R6N4_PICPG/452-526-IAT-----------------------------------------------------------TRLRDDLG---------
C1D0A1_DEIDV/376-449-IAV-----------------------------------------------------------EKLAA.LG---------
EF2_PYRAE/393-467-IAT-----------------------------------------------------------WLLKERTK---------
A3ZLH3_9PLAN/406-480-VIR-----------------------------------------------------------HRLLRDFK---------
E1R4A6_SPISS/399-473-VLV-----------------------------------------------------------TRVIKDFN---------
B0N553_9FIRM/395-469-MML-----------------------------------------------------------NKLKSKFK---------

PF00679

GUF1_SCHPO/451-540--GFATLDYEE..SDYVPADLVRLSIF
Q95Y73_CAEEL/633-723--GFGDISVQF..RGYQQVTEHEKMEI
GUF1_MAGO7/504-593--GYATLDYED..AGWRRSELVKLNLL
C1L1Y4_LISMC/399-487--GYGIINHTF..DSYQPIQKGRVGGR
Q4WCL6_ASPFU/842-931--GQAAVSLVF..DRWSVVPGDPLDRE
Q96WU0_BLAAD/659-746--GKGEFTLEF..KNYAPAPPQLQKEL
RRF2M_HUMAN/684-771--GSATFALEL..STYQAMNPQDQNTL
GUF1_PICGU/463-552--GYASLDYED..AGYKKSDIVKMELC
GUF1_OSTLU/451-540--GYATFDYDD..AGMAKSDIVRMDVL
Q5FDV4_EHRRW/423-511--GTGIINRLF..YSYAPHKGNIPTRN
RRF2M_ANOGA/641-729--GTASVSMEP..NGHSPLNESDEAQA
Q1IH98_KORVE/598-685--GRGSFTMEM..NHYDIVPSAIQEKV
Q83NS0_TROW8/410-497--GTGTANAIF..HSYAPWSGQINQRA
A4ARW7_MARSH/610-697--GRATFKSVF..SSFQSVPSNVQKGL
Q2S5C1_SALRD/429-517--GTGLLTHRF..EEFGAWAGEIPHRT
LEPA_DESRM/402-491--GYASLDYEM..IGYRQSELVKMDIM
LEPA_CAMHC/398-487--GYASFDYEP..IDYKQGDLIKLDIK
A1AR09_PELPD/594-681--GRGSYTMEF..LCFEEAPQEVQQRF
EF2_METTE/620-707--GRAMWSTEF..GGFDIVPTSIQTEV
A5TRL8_FUSNP/592-680--GRGEFEYEF..VRYEEVPENISKKI
TETQ_BACFR/535-622--GLGIFMVKP..CGYQITKDGYSDNI
A4BV85_9GAMM/583-670--GEGNYRLQF..SHYEPVPGHIQQRL
A5Z4P7_9FIRM/513-598--GTGTLSLDY..KGYGPCHNS..EEI
A5Z6T1_9FIRM/598-686--GSGDFEYVV..SKYEQAPADVQNRV
EFG_SALCH/611-698--GRASYTMEF..LKYDDAPNNVAQAV
A8MDB4_CALMQ/627-715--GRVFWSLQF..SRWAPVPESLRESL
A4BRZ1_9GAMM/403-491--GFASFDYEF..RRFQVASLVKLDIL
A6DEJ7_9PROT/393-481--GEGVLNSSF..LDFRPATTKPYTRK
A9KSY1_CLOPH/512-598--GLGKLFCSL..KGYLPCHNTL.EVM
Q7NGS6_GLOVI/576-666--GVGCFAWRP..AHLQEVPEKLAERL
Q94BR7_ARATH/686-774--GRASYTMQL..AKFDVVPQHIQNQL
A7BTE3_9GAMM/109-197--GNGFFTMEF..SHYEPVPGNIQQQL
Q1YUM4_9GAMM/396-484--GSGIMTSIF..DKYAPAKEGEAHSR
A7FZA2_CLOB1/594-682--GMGEFSLSF..ERYDEILDPIEVEK
Q4DGU6_TRYCC/750-839--GASTAQLQM..SLWSIVDADPYFTP
A4BCQ5_9GAMM/578-666--GDGSFTMEL..SHFDPVPAKTQESL
Q825F0_STRAW/553-640--GEGELETAF..DHYAPVAGGTVPNR
EF2_NANEQ/639-726--GRGVWYLVD..QVYEPVPRELFDQI
Q8RMN6_9BACI/534-621--GRSVCLTEL..KGYHVTTGEPVCQP
Q6MC59_PARUW/398-486--GLGILTSVF..ENFSPWKGTIPGRT
EFG2_SYNWW/598-685--GRASFSMKI..KNFAEVPESKSREI
A5G260_ACICJ/565-655--GLGSFVHSF..EHLSEAPPRLAEKV
Q381P2_TRYB2/848-937--GEALPLFAF..DSWDTVPGDPFDTT
A5L3A1_9GAMM/51-139--GTASFHFEE..DGFGNKSSENVGQR
Q1VQ31_9FLAO/545-632--GKLRLKLQF..YGYDTCPKGEGAIR
Q5GBH8_ENTFL/541-628--GKGIFITEP..YGYDIYNDKPIIND
Q21YN7_RHOFD/584-672--GQGSYNITF..SHYAPVPGDTQKQL
Q4N6X5_THEPA/510-600--GYGSYDYEG..VFYRPIELCKMKIL
Q3DTP4_STRAG/598-685--GRGTFMMVF..DHYEDVPKSVQEEI
Q4Y6S3_PLACH/682-769--GQGTYTMEF..SRYEQVSKNDLDDI
Q9AIG7_CARRU/590-678--GRANYNMEF..HNYSETPNYILEKI
Q72IJ8_THET2/563-650--GAGAYTLEF..SHYAEVPPHLAQRI
Q7UQ85_RHOBA/433-520--GTAIIHHRF..ESYRMVEGDVPRRA
Q7YYP3_CRYPV/897-986--GNISFNLSF..SHWELLDEDPFPES
Q4FPA2_PELUB/397-485--GTGVINRIF..HGYGKFEGEMDGRK
A0L3V8_MAGSM/615-702--GRGIYTMRL..ANYQEVPSHIARKV
A6G6E0_9DELT/585-672--GRGTHSMSM..DGYERVPDAILDHV
A4E859_9ACTN/521-606--GRGHLYLEF..AGYAACHDA..ERV
Q0SU42_CLOPS/519-604--GKGGLSLKF..HGYDLCHNE..EEI
A3ZLH3_9PLAN/604-691--GRASSSMEP..LKYAAAPQEIANTF
A7VYF9_9CLOT/584-669--GKGMFSFRF..DGYEPCQNQ..EEL
Q5P806_AROAE/584-672--GESEFVLVA..SGHEPAPQEVQQRL
A5JZM2_PLAVS/561-649--GTSIINSEL..REYKKKQTSYKSDR
A0NK81_OENOE/401-489--GYATLNTAF..LDYEAADLVKIEIN
Q00WM1_OSTTA/464-553--GTGLMQRAF..HSYGAARGKM.DKV
A5K1M2_PLAVS/827-915--GRGNYTMTL..HKYALVPQYIQEQI
GUF1_BABBO/505-595--GFGSFDYEG..TEYREIDLCKLRVL
LEPA_MYCGE/399-488--GYASLNYEF..YNYQHSQLEKVEIM
EFGM_CAEEL/641-728--GKGEFSMEY..SRYAPTTLEAQDRV
EFG_EHRCR/599-686--GRAQYSMYF..SCYEQVPDNIVANE
EFGM_DANRE/638-725--GKGEYTMEY..SRYQPCAASVQEDL
Q729W6_DESVH/400-488--GTGIMNSLL..SGYEPYRGDFPSRF
A9A4F5_NITMS/619-706--GRATWNTSF..KAWTEVPKSMLSAA
A8MHU5_ALKOO/394-482--GYGIFHHLF..DGYDKYKGEIRARN
A7S680_NEMVE/415-504--GYASFDYDD..HGYHATRIVRMDIL
A0YPA8_LYNSP/395-483--GAGIMNHSF..LEYRLLCGDIETRR
Q9RXC2_DEIRA/579-666--DRGAFSVKP..HGYQDVPEPLARKV
A7AQL3_BABBO/720-808--GRGFYTMEM..SHYHPVPALVQEKI
A9CJ73_AGRT5/541-628--GLGGMETSF..SHYAQAESPPSPRR
A9BJK9_PETMO/590-678--GKGYFTMKF..SHYSEVSPDIQNKI
Q97J38_CLOAB/542-629--GKGMFTTKF..YGYKEVSAKFAKAR
Q6F0Z6_MESFL/400-487--GEGIMVRSS..NGFEPYKGEIESRK
A0YMH4_LYNSP/585-675--GVGCFQWKY..DHLQEVPEKLADKV
A3I5Y0_9BACI/519-604--GKGALTLQF..DGYDVCHHA..EEV
LEPA_CHLAB/404-493--GYGSFDYRL..GDYRKGSIIKLEIL
A6C5F4_9PLAN/612-699--GKGGFSMEF..SRYAQVPRNIQEEV
Q0YPH2_9CHLB/398-486--GEGIMSHVF..INYQPFKGKLPSRE
Q3LWJ5_BIGNA/768-857--GQSLIIGFF..KGWYIVPGYPISNQ
A3Q803_MYCSJ/621-709--GAGVFHRSF..ARYEPMPENAAAKV
Q2KBB2_RHIEC/552-642--GIGYFSKTF..DHFEELYGKEADAI
A8F3S7_THELT/400-490--GYASMDYEF..LGYEESDVVKISIL
Q1Q141_9BACT/597-684--GRGTFTMEP..LEYRPAPAKSVGNV
A6DLC3_9BACT/400-489--GYGSMNYTP..NGYQQAPLVKLEMK
A2XK54_ORYSI/887-976--GAASALLVL..SHWEAIPEDPFFIP
EFG1_SYNAS/596-683--GKAQFTMEF..SAYRQVPQSIAEKI
A7AM19_BABBO/644-731--GQGEFTMEF..KLYQPMNAADQEAV
Q25003_9MICR/731-819--GEASVVLTF..SHYSILPGSLKDTS
GUFP_OSTLU/403-492--GYASMEYAI..TGYRQSDLVRLDVL
OTRA_STRRM/555-642--GEGVFLAEH..RGYRPAVGQPPVRP
LEPA_WIGBR/398-486--GYASLDYKF..KCFNKTDSVVIQTY
LEPA_BUCAP/402-490--GYASLEYDF..KYFKTVKMVRIDIL
GUF1_TRYB2/565-655--GYASLEYDE..LVYEEADLVRVDIV
A6G4Z2_9DELT/410-499--GYASLDYDH..GEYRRANLVRLDLM
Q9RV32_DEIRA/392-479--GEGIMSHIF..DGYAPWAGELKTRQ
A0CDU0_PARTE/436-524--GTAIMQQQF..LGYQEYRGVLKKNL
Q3LVZ0_BIGNA/720-809--GQAFSQCIF..DHWALLKSDPMKDN
Q387N2_TRYB2/438-524--GDGVLNHSF..DSYKPMTAA..ETG
A5KT16_9BACT/399-487--GTVIMHSLP..HGYQPVGPKLPKTR
A5FQ33_DEHSB/411-499--GTGVLNSQF..LEFQPWCGEIEQSR
A4S0M6_OSTLU/604-691--GKGEFTMEY..GSHQAVTQDVQAEL
LEPA_CHLTE/406-495--GYASMDYEY..IGYRRSDLVKLDVL
A4EBU6_9ACTN/400-487--GEGVFYHTF..LEYGPYAGEIGNRQ
Q3ADH6_CARHZ/573-660--ARGFYTMTF..SHYQEVPPKLQEEI
Q73P52_TREDE/591-679--GTGSFEMSF..DHYDPISGKIADEI
Q4CXN3_TRYCC/388-475--GQGDFGMQF..KEYRPMQQYKAQIR
Q6AKJ8_DESPS/591-678--GLGSFSLYF..SHYEEVPAQIADKI
EF2_SULTO/628-715--GRAFWGTEF..SRWAPVPDSLLLDV
A4A194_9PLAN/587-675--GQGSYNMRF..SHYDAAPPNLQEMI
A0Q2C8_CLONN/546-631--GKAVFNMQF..SKFEVCHNQ..EEV
Q5JMX4_ORYSJ/461-551--GTGFMHRAF..QAYAKYRGQLGNVR
A7VSS3_9CLOT/592-680--GRGTFTFEF..ARYEDAPAQVAQKV
EFG_PLARO/34-121--GRASFSMQF..DSYAEVPQHIAKKI
A5UPI8_ROSS1/397-485--GEGVMNSLF..IGYEPLAGEIVTRT
A0C124_PARTE/799-888--GQAFCLSVF..DHWSLLPGDPLDKT
A0E802_PARTE/956-1045--GHVSAQLDF..DGWSILQEDPFYQP
A5VM44_LACRD/512-598--GQGQLELVV..AGYYPCHNA..EDV
Q5BXM1_SCHJA/221-327--GRAELSIKL..ANYHPVSSEHLTKL
A0DGW7_PARTE/623-710--GQGEFSLEY..KRHDPVPPNEIETI
A4CM35_ROBBH/393-480--GEAIMAHRF..LEYQPMKGEVPQRQ
Q820H1_NITEU/395-483--GTGIMSHVF..DEYAPMRPDMASRK
B2JWX8_BURP8/582-670--GHGNYNIEL..SHYDPVPPNQQDKL
Q4N072_THEPA/424-514--GRGEFNVTM..IGYSKAGSKIYNAR
A8FY81_SHESH/586-674--GDGQFSMTF..ARYDITPDNVQKSL
GUF1_CAEEL/442-531--GYASFDYEP..DGWQDTRLVKLTIL
A3LU88_PICST/836-924--GQAMCYLTF..SNWQVVPGDPLD.P
LEPA_ARTS2/411-500--GYGSLDWKA..DGDQVADLVKVDIM
EF2_PYRKO/621-708--GKALWTTEH..AGFKRVPNELAQQI
A4YUJ6_BRASO/582-669--GRAVHAMAF..SRYAPAPIGVAEKL
A7ADA9_9PORP/620-707--GRASFTMKF..SSYELVPSDVQDKL
B4SGB3_PELPB/597-684--SRARYSYNF..SHYEEAPPDVAQQL
Q8KTP5_TREPR/606-694--GRATYSMEF..SRYGEVRREVFDRD
LEPA_BDEBA/400-489--GYASLEYEF..VGFEESDLVKLDIL
TYPA_BUCBP/399-488--GSGLFYSTF..SHYQKIESNKIKRH
Q6CXP1_KLULA/782-874--GSGMCQMHFWNKIWRKVPGDVLDEE
Q1NU00_9DELT/397-484--GMGVMNYVF..AEYGPYAGEIRNRS
A0D5J3_PARTE/683-779--GEAYFSMSF..KQYEFVGGQKQSEL
Q4MLL7_BACCE/540-627--GEGIFTTRP..AGFTKLTTPFPTRK
Q87JC6_VIBPA/578-666--GEGSFSMTL..SHYEPAPPAVQKQV
A0C617_PARTE/693-782--NKAYSLSSF..DHWSLLNSDPLEES
EFG1_BDEBA/606-694--GRASFSMEF..LEYAIVPAKVKTDI
EF2_ENCCU/731-819--GKAGASMRF..SHYSILPGNL.EDP
Q55ME0_CRYNB/490-580--GFASFDYEE..AGYEKSNLVKMNIL
D2BIG2_DEHSV/583-670--GRGHFKMDF..AHYQQVPAHIAQKL
A3ZM42_9PLAN/402-491--GYGTMDYEI..RDYVPADLVRLDML
Q2G8V2_NOVAD/588-678--GLASFTATF..DHMTELAGKHADDA
Q74FV3_GEOSL/395-482--GTAVMTHTF..HDYAPYKGDIPGRK
A4QD62_CORGB/423-512--GTGIANSYS..DGMDVWAGEIKGRA
C0A700_9BACT/633-720--GRASASITP..SHFEQVPANLLAKI
A4HGQ1_LEIBR/665-751--GHANMFVKL..HDYRVVEEKAVLAR
Q04U99_LEPBJ/401-489--GEGVMSSRF..LRFDIYKGEIPGRK
EF2_HALMA/620-707--GRASWNTEN..AGFQVLADNLQPDK
LEPA_EHRRG/400-488--GYASLDWEM..DGYMDSEIAKLTIL
Q2S3F5_SALRD/609-696--GRGLHHTKF..SHYEQMPGHVQEEV
B9LLE2_CHLSY/601-689--GRGRFSISF..AGYEEVPPHLVNQI
A5DX67_LODEL/884-973--RNANTWLLF..SHWSIVPGDPFDLV
Q4XSF0_PLACH/117-206--GFGSMSYEN.YIIYKQSDLYKVHIY
A4Z0F0_BRASO/584-674--GAGSFTRTF..DHMAEVTGRAADHI
Q5WBK2_BACSK/540-627--GEGILISKP..GGYERVAGKAPTKE
A4EB71_9ACTN/620-708--GTGDFTMKP..AGYEQVPYDVQAKL
Q7WT01_9BACE/535-622--GLGVFVTRF..SGYRPTNKKVSRSV
A4ES82_9RHOB/546-636--GTAWFETGF..DHYEEARRVEFADA
Q1NJS4_9DELT/398-487--GYGSFDYEM..LEYRPGDLVKLDLL

PF09186

C6BGR5_RALP1/135-190--GR-----------------------
Q1C2C8_YERPA/96-151--GT-----------------------
A4VQI4_PSEU5/132-188--GR-----------------------
Q2G059_STAA8/140-195--GN-----------------------
A6AE70_VIBCL/143-198--AK-----------------------
Q13Q97_BURXL/135-190--GK-----------------------
Q4ZYM8_PSEU2/132-188--GR-----------------------
A0ALK0_LISW6/140-195--GQ-----------------------
A1VBZ9_DESVV/146-201--GA-----------------------
A8FHY7_BACP2/140-195--GK-----------------------
A4FXB8_METM5/145-199--NK-----------------------
A5KKP5_9FIRM/161-216--GQ-----------------------
Y722_HAEIN/141-196--GR-----------------------
Q9L6L3_SALTY/141-196--GS-----------------------
Q5JF15_PYRKO/139-194--GR-----------------------
A6T3Y8_JANMA/133-188--GT-----------------------
Q12TB2_SHEDO/146-201--GS-----------------------
A2RL93_LACLM/137-192--GK-----------------------
A2SM12_METPP/134-189--GR-----------------------
A3IC74_9BACI/140-195--GQ-----------------------
Q49VU7_STAS1/140-195--GN-----------------------
Q0I0T1_SHESR/142-197--GS-----------------------
Q8RAS2_THETN/140-195--SR-----------------------
Q312M8_DESDG/143-198--GT-----------------------
A3Q8U6_SHELP/142-197--GR-----------------------
A1A054_BIFAA/142-197--AT-----------------------
Q5HQY1_STAEQ/140-195--GN-----------------------
A4J830_DESRM/140-195--GK-----------------------
A3N2N7_ACTP2/174-229--GK-----------------------
A0NII2_OENOE/139-194--GR-----------------------
Q0S531_RHOSR/142-195--GT-----------------------
Q8XJ08_CLOPE/138-193--GK-----------------------
Q5H177_XANOR/157-213--NR-----------------------
B1YLL5_EXIS2/141-196--GQ-----------------------
Q38YD6_LACSS/139-194--GQ-----------------------
A1W832_ACISJ/159-214--GR-----------------------
A5VIF6_LACRD/140-195--NQ-----------------------
Q4MM25_BACCE/140-195--GK-----------------------
A7JQV0_PASHA/140-195--GK-----------------------
A0QPN6_MYCS2/140-193--GR-----------------------
Q4JW71_CORJK/159-212--GA-----------------------
Q1BMU3_BURCA/134-189--GR-----------------------
Q2T656_BURTA/142-197--GR-----------------------
A6BHR1_9FIRM/140-195--AQ-----------------------
Q8FNW9_COREF/165-220--AE-----------------------
Q08A37_SHEFN/142-197--GQ-----------------------
Q21FZ6_SACD2/148-203--GS-----------------------
A8MHP1_ALKOO/140-195--GR-----------------------
B8I4L4_CLOCE/140-195--GR-----------------------
A4QFI9_CORGB/146-201--AE-----------------------
A7VIJ4_9CLOT/140-195--AR-----------------------
A6FWP6_9DELT/138-193--GA-----------------------
Q1D8G7_MYXXD/143-198--GQ-----------------------
Q9CGK5_LACLA/137-192--GK-----------------------
A7B7M9_RUMGN/138-193--GQ-----------------------
Q0JYJ3_CUPNH/150-208--GR-----------------------
B8G4C5_CHLAD/143-198--GR-----------------------
Q9CKV8_PASMU/141-196--GQ-----------------------
A6VZC4_MARMS/141-196--GS-----------------------
A5LQV6_STRPN/138-193--GK-----------------------
A1RDW8_SHESW/142-197--GS-----------------------
Q1EM54_BACLI/140-195--GK-----------------------
Q5E8X5_VIBF1/143-198--AK-----------------------
Q1IFE1_PSEE4/132-188--GR-----------------------
B9LFJ9_CHLSY/142-197--GR-----------------------
Q2BF26_9BACI/140-195--GQ-----------------------
Q1JYD9_DESAC/142-197--GR-----------------------
Q6NGE7_CORDI/143-198--GA-----------------------
B0K946_THEP3/140-195--KR-----------------------
Q87TN8_VIBPA/143-198--AK-----------------------
Q03AP8_LACC3/140-195--GQ-----------------------
A7VZA1_9CLOT/138-193--GS-----------------------
A3Y741_9GAMM/141-196--GS-----------------------
Q7MZ94_PHOLL/141-196--GV-----------------------
Q8DDK7_VIBVU/143-198--AK-----------------------
A4RVU2_OSTLU/174-231--GR-----------------------
Q8G426_BIFLO/103-158--AA-----------------------
A4STE9_AERS4/142-197--GR-----------------------
A6TQB9_ALKMQ/140-195--SR-----------------------
Q1J2A7_DEIGD/140-196--GA-----------------------
A7MQN8_CROS8/141-196--GA-----------------------
A1WAA0_ACISJ/134-189--GR-----------------------
Q65W79_MANSM/140-195--GQ-----------------------
Q5FL79_LACAC/142-197--GQ-----------------------
Q03SQ4_LACBA/140-195--DR-----------------------
Q826X2_STRAW/140-195--GT-----------------------
Q927X7_LISIN/140-195--GQ-----------------------
Q1R464_ECOUT/142-197--GS-----------------------
A6VLN9_ACTSZ/140-195--GQ-----------------------
A1TPX1_ACIAC/145-200--GR-----------------------
Q5KV49_GEOKA/140-195--GR-----------------------
A1HN60_9FIRM/139-194--GR-----------------------
Q7NTX7_CHRVO/133-188--GA-----------------------
Q03ZJ9_LEUMM/140-195--GH-----------------------
A0PZT9_CLONN/138-193--GK-----------------------
Q83VY2_STRCJ/140-195--GT-----------------------
A7BDK8_9ACTO/143-198--GV-----------------------
Q2S3C2_SALRD/140-195--DR-----------------------
A4WFX2_ENT38/141-196--GA-----------------------
A4E749_9ACTN/101-156--GR-----------------------
Q1ZHQ0_9GAMM/142-197--GK-----------------------
Q4KIR2_PSEF5/132-188--GR-----------------------
B2JNM8_BURP8/228-283--GR-----------------------
B1JFA8_PSEPW/132-188--GR-----------------------
Q042C5_LACGA/143-198--GK-----------------------
Q9ZNK1_CLOHI/138-193--GN-----------------------
Q48AT4_COLP3/142-197--GQ-----------------------
A3KLC0_BACAM/140-195--GK-----------------------
A4FQ90_SACEN/136-191--GS-----------------------
Q9ANV5_9LACO/142-197--GE-----------------------
A8FP65_SHESH/142-197--GM-----------------------
A6UWS9_META3/137-190--GN-----------------------
Q97GS0_CLOAB/138-193--GN-----------------------
Q5WDD8_BACSK/140-195--GQ-----------------------
Q92SD8_RHIME/131-187--GK-----------------------
Q1WRU9_LACS1/140-195--GQ-----------------------
Q8FVG7_BRUSU/165-222--GK-----------------------
A9KI52_CLOPH/140-195--GR-----------------------
Q9K6U5_BACHD/140-195--GQ-----------------------
Q7WI30_BORBR/132-188--GR-----------------------
A6FJ22_9GAMM/103-158--GQ-----------------------
B9LQ76_HALLT/151-205--GR-----------------------
Q3A1N7_PELCD/144-199--GR-----------------------
Q1YZP6_PHOPR/144-199--GR-----------------------
Q67MH5_SYMTH/155-210--GR-----------------------
Q5M5T5_STRT2/138-193--GK-----------------------
Q03H02_PEDPA/139-194--GN-----------------------
A4AK74_9ACTN/149-205--GA-----------------------
Q6DAP3_ERWCT/141-196--GA-----------------------
A1S1J0_SHEAM/142-197--GQ-----------------------
A0KEL4_AERHH/142-197--GR-----------------------
A4XYN2_PSEMY/132-188--GR-----------------------
Q1LGN1_RALME/177-235--GR-----------------------
A3DH56_CLOTH/141-196--AR-----------------------
A1SRE9_PSYIN/141-196--GQ-----------------------
Q1ZL43_PHOAS/144-199--GR-----------------------
A6NVX0_9FIRM/138-193--GG-----------------------
Q8TSL2_METAC/140-194--NE-----------------------
Q6LYD0_METMP/142-196--NK-----------------------
A6TGM6_KLEP7/141-196--GS-----------------------
Q189Y5_CLOD6/139-194--GT-----------------------
Q0A6M1_ALHEH/143-194--AR-----------------------
Q12W19_METBU/138-192--DR-----------------------
Q47L82_THEFY/136-191--GQ-----------------------
B1KCZ5_SHEWM/142-197--GL-----------------------
Q2KZZ6_BORA1/132-188--GQ-----------------------
Q5QXI9_IDILO/143-198--GR-----------------------
A3CPW4_STRSV/138-193--GK-----------------------
A5I6F5_CLOBH/138-193--GN-----------------------
A9B2B3_HERA2/142-197--AE-----------------------
Q8ENG2_OCEIH/140-196--DQ-----------------------
A6M153_CLOB8/138-193--GK-----------------------
Q6ADS2_LEIXX/134-189--GR-----------------------
A2RH67_BACME/140-195--GQ-----------------------
Q46BW0_METBF/112-166--NK-----------------------
A3WIH7_9GAMM/143-198--GR-----------------------
Q46QX5_CUPPJ/142-200--GR-----------------------
Q74KA9_LACJO/143-198--GK-----------------------
A6U5M1_SINMW/131-187--GK-----------------------
A6UP69_METVS/142-196--NN-----------------------
A4XI40_CALS8/138-193--GN-----------------------
Q4L4H3_STAHJ/140-195--GN-----------------------
A6D7Z9_9VIBR/143-198--AK-----------------------
Q1MS48_LAWIP/146-201--GT-----------------------
A1WPG9_VEREI/149-204--GL-----------------------
Q02UR0_PSEAB/132-188--GQ-----------------------
A5N211_CLOK5/151-206--GK-----------------------
Q834A0_ENTFA/140-195--GQ-----------------------
A8GYG2_SHEPA/142-197--GQ-----------------------
A4GA80_HERAR/133-188--GA-----------------------
Q8PVM6_METMA/50-104--NK-----------------------
A5ZXJ4_9FIRM/140-195--GR-----------------------
Q3KII0_PSEPF/132-188--GR-----------------------
Q24W98_DESHY/138-193--QK-----------------------
A9CFZ6_AGRT5/94-151--GR-----------------------
A6CP46_9BACI/140-195--GQ-----------------------
Q0I5B1_HAES1/140-195--GQ-----------------------
Q18DK9_HALWD/167-221--GR-----------------------
Q891Z4_CLOTE/138-193--GK-----------------------
A3UZ73_VIBSP/143-198--AK-----------------------
A1SF98_NOCSJ/148-203--GA-----------------------

PF09377

SBDS_MOUSE/106-227DYSQQLEIVCLIDPGCFREIDELIKKE
SDO1_METJA/103-225QPDGSLIVLIEIPSGIEAEFYAHLNKI
Q8TYB8_METKA/100-222QYDGAWVAVVRLPAGLQDEFFEKLNEI
Q8ZVM7_PYRAE/96-218KSDGSWEALLELPAGLQDVLIARVNDV
Q3HWW0_RECAM/98-219TYGDGCVYXVALAPADFDAFMVDLTRA
A8BTW1_GIAIC/134-259YTSTGWSVKFSVSPKGVDQLMSLLESL
Q5DG22_SCHJA/106-231SSDGLFELIAVVEPGKYCLIETLLQKE
Q7Q3H9_ANOGA/107-230WEGERLMLTCLIDPGHFREMDEIIRTE
SBDS_CAEEL/108-230WQDGSLEMVGLIEPGSFRALDDLVRNE
SBDS_DICDI/106-229RDGGGLSIVCLVDPGSYRKIDELIKQE
Q3HWV4_PORYE/106-229EWGGGFRASYLVEPKNFNAVQEVVAKE
Q6ZD69_ORYSJ/108-230ESGSQPSVVCEIEPSILRSCEERLKDV
Q2TYA0_ASPOR/107-325IAGDEWEVVGFAEPGAFKGLNEFVGND
Q2H9G7_CHAGB/107-306VIGSEWEIVGFVEPGAFKGLSDFVGGE
SDO1_YEAST/106-233PELDPWTCTGLIDPVNYRDLMTLCDKK
Q75F96_ASHGO/143-267ESATTWMCTGLIDPMNYRELVTLCGKC
Q5AF99_CANAL/107-232NNGKQYEIVGIIDPINYRVLVTLIENT
Q6C0F0_YARLI/107-228......ELVCSIDPGQFRPVNEFVLAE
Q5K9W6_CRYNJ/105-228DMGMEWEAIVQINPSTFRTLTDLVNNE
Q4P379_USTMA/106-229DWSDQWELIASIDPGALKTINELIQSE
SDO1_SCHPO/106-229NIDDEYECIALVIPGNYKLIDELVRNE
Q583Z1_TRYB2/109-243HGAGKYSLLILLQPHLFRDLEIFVKDE
Q4Q394_LEIMA/109-243SGNFGHALLLLMQPNLFRDLDHFVKEA
SDO1_ENCCU/102-205QNGEIHDGYVMIRSDCFPRFKDMCEKE
Q5CNW7_CRYHO/106-230EKHNTYSITFLCEPRYYREIDQLDCKL
Q4N8W7_THEPA/101-252ND....SMTVICFPNLYKNLENFIQNE
A8B6U5_GIAIC/107-233LDEQSCFYTATVGAQQYKFVCKSLKEL

PF14492

A4TWL9_9PROT/422-496--------------------VEGNMGK
F2NVW3_TRES6/401-475--------------------VQCRVGS
D1Y3B4_9BACT/398-472--------------------VNLKTRV
F0T210_SYNGF/365-439--------------------VAVEMDV
D8PG84_9BACT/404-478--------------------ADVIVHA
A9NEZ0_ACHLI/398-472--------------------VSVSFED
A6DPN1_9BACT/407-481--------------------SMQILVI
C6UN06_HODCD/398-472--------------------VDVVASR
RRF2M_DANRE/469-543--------------------IETHLGP
E6N8V0_9ARCH/385-458--------------------LEVVSGR
B0P8B7_9FIRM/401-475--------------------VDIGLTK
E8R235_ISOPI/389-463--------------------LEFLTHV
RRF2M_KLULA/449-523--------------------AQVDVER
A9E504_9FLAO/404-478--------------------IDVNKGN
D3F1B7_CONWI/394-468--------------------AEVTLKP
C6XHJ4_LIBAP/408-482--------------------VDANVGA
D1RMA4_LEGLO/400-474--------------------VELIVGQ
C4FC14_9ACTN/392-466--------------------VAAHIVP
A9V2W3_MONBE/968-1042--------------------VVVEAGK
A4X5U8_SALTO/427-500--------------------VELDTAP
D0WJ45_9ACTN/394-468--------------------IDVRLVD
B9XK85_9BACT/434-508--------------------VETVVGA
C5KH54_PERM5/576-650--------------------ANVTTGE
D3EPW6_UCYNA/400-474--------------------LEASIGK
B1I3X3_DESAP/379-453--------------------LDVVLEP
F2JHA0_CELLD/398-472--------------------VDVYLAQ
B3LCX4_PLAKH/489-563--------------------IGIQLKN
E4Q3P1_CALOW/397-471--------------------VSVVLSD
E6MJ20_9FIRM/398-472--------------------VDVTLEP
D5MKJ7_9BACT/401-475--------------------LEIQMKT
D3PEH1_DEFDS/400-474--------------------VDVELKT
Q4CXN3_TRYCC/185-259--------------------LEVELGK
E3DPX3_HALPG/401-475--------------------VDANIGK
E9CJE1_CAPO3/563-637--------------------VAVSVGP
E4Z2J0_OIKDI/428-502--------------------CPVEVGQ
F0GVR2_9FIRM/397-471--------------------VNTEIVE
D7FYU3_ECTSI/447-527--------------------VETTVGQ
E7NJM7_YEASO/469-543--------------------ADVEFGQ
C8W6F4_DESAS/377-451--------------------VDVTLSD
A9A021_DESOH/403-477--------------------TRVNVGR
E0VF81_PEDHC/435-509--------------------CKVILGK
D1N1L0_9BACT/378-452--------------------VEAVLST
B6K7Y9_SCHJY/432-506--------------------VNAELGK
F0RYS7_SPHGB/397-471--------------------VTIETKL
B5RQ33_BORRA/401-475--------------------LNVYTGK
D7VYC2_9FLAO/453-527--------------------IEINQGK
F0Y5M1_AURAN/428-505--------------------VDVDAGM
C1A5I9_GEMAT/402-476--------------------VQAELSK
A5V1W8_ROSS1/401-475--------------------VEVELDL
E3QA26_COLGM/478-552--------------------VQADFGP
E0TJ49_ZINIC/408-482--------------------INVKIGK
F2UT40_SALS5/495-568--------------------VDLIPGR
C7NEM3_LEPBD/374-448--------------------ISIKTIE
C9LTI7_9FIRM/398-472--------------------IEAIFAE
D5X9E5_THEPJ/380-454--------------------VDVVMKD
D6HPL8_9FIRM/401-475--------------------VEVRLET
B5YJI2_THEYD/400-474--------------------VEVNLMA
EFG_CARRP/393-467--------------------IKTKTSK
Q4UAY6_THEAN/488-562--------------------INIEVGE
EFG_THELT/405-479--------------------VNVRVGR
F0ST56_PLABD/409-483--------------------LNAKVHK
D6TKZ6_9CHLR/387-461--------------------VDLETRD
E5SX34_TRISP/552-626--------------------LDVFLGP
Q8KTP5_TREPR/410-484--------------------VDVRTGR
D8EYC8_9DELT/404-478--------------------VEINQGK
EFG1_SYNWW/397-471--------------------LDFNTGQ
Q2YZP5_9DELT/400-474--------------------VEVNLNT
E1X373_BACMS/418-492--------------------AEVTVGA
E1P6D8_GEOBB/413-487--------------------VQVKTGR
D9X5U2_STRVR/398-472--------------------LEVNVGR
A7AQL3_BABBO/524-598--------------------LSVKTGS
D1Y774_9BACT/402-476--------------------VHVNVGR
E7RAH2_PICAD/489-563--------------------VNAEVGE
B7KCA7_CYAP7/400-474--------------------ADVYVSN
A6GCI1_9DELT/430-504--------------------VEARVGK
D7CL94_SYNLT/396-470--------------------LEVELGR
B2A2Z5_NATTJ/399-473--------------------VDVELKT
D1CGA5_THET1/397-471--------------------VEVEIGI
RRF2M_YARLI/441-515--------------------ANIVIGP
A1ZR77_9BACT/405-479--------------------LSIRKGA
RRF2M_PENMQ/545-619--------------------AKATMGR
A6C5G4_9PLAN/359-433--------------------VEVITHL
E4RLV1_HALSL/394-468--------------------VDFTTTE
D2VIA4_NAEGR/392-466--------------------INVEMGE
D8K0Z6_DEHLB/390-464--------------------VAVDLKS
F0VGQ1_NEOCL/414-488--------------------LTVETGE
E1K1T2_DESFR/398-472--------------------VSPVLKA
B1C971_9FIRM/398-472--------------------IEVVLTP
B8E030_DICTD/399-473--------------------VNVTLGT
B7IDJ1_THEAB/390-464--------------------VDVEVGK
A6G6E0_9DELT/388-462--------------------LDVELGA
B2V037_CLOBA/400-474--------------------VDVILKA
A4YUJ6_BRASO/385-459--------------------VDAVIGA
E0E580_9FIRM/374-448--------------------IEVSLDD
E3NGB7_CAERE/427-501--------------------LDVFIGK
C0EB48_9CLOT/384-458--------------------VDVELTD
Q1IH98_KORVE/402-476--------------------TEVILKA
C5SZM6_ACIDE/398-472--------------------VNVTVGR
EFG_ORITI/417-491--------------------VEANVGA
A0LUL8_ACIC1/428-502--------------------VEVETVP
E7MLG8_9FIRM/397-471--------------------VEVTTEK
B0VHJ0_CLOAI/392-466--------------------VDAILKE
D4G8N6_RIEPU/424-498--------------------VETSTGK
D2QZV7_PIRSD/398-472--------------------VELQVGA
C7PBW2_CHIPD/404-478--------------------VEISKGQ
F2LWG4_HIPMA/375-449--------------------VEAQLKT
A9U7W1_PHYPA/98-171--------------------VEVEFSV
E0RSW5_SPITD/394-468--------------------INVHTKT
D3NS37_AZOS1/404-478--------------------VDAAVGA
Q4N936_THEPA/512-586--------------------LPLKVGS
C0K071_9BACT/399-473--------------------VPVTVGA
B0TAY7_HELMI/385-459--------------------VNVTTSW
E1X0M6_BACMS/403-477--------------------VGIRVGA
A4A194_9PLAN/368-442--------------------VEIETHE
E1R4A8_SPISS/397-471--------------------IEVETKT
C9RLE0_FIBSS/410-484--------------------CDVTTGA
D3RWR2_FERPA/385-459--------------------LEVVTSP
A6NVY7_9FIRM/396-470--------------------VDATLDE
F0SRV0_PLABD/433-507--------------------CECIVGE
EFG2_SYNWW/402-476--------------------VNANIGK
B5JPE3_9BACT/421-495--------------------VEVDIVE
A0LEB9_SYNFM/399-473--------------------VEVNLRI
C3WDZ3_FUSMR/397-471--------------------VHAVLTD
C4R6N4_PICPG/452-526--------------------ARMEIGK
C1D0A1_DEIDV/376-449--------------------VKVSTTP
EF2_PYRAE/393-467--------------------TEFTVSP
A3ZLH3_9PLAN/406-480--------------------LNVKVHK
E1R4A6_SPISS/399-473--------------------VDARIGN
B0N553_9FIRM/395-469--------------------VEATLEN

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window