Sequence alignment for CL0442

PF03953

TBG_EMENI/263-392PRSHFLLTSYTPFTG---DNI..DQAKTVRKTTVLDVMRRLLQPKNRMV...SINPSK.......SSCYISILN.IIQG.
TBA2_EMENI/265-395PRIHYPLISYAPVIS---SN.....RSSHESFKVQDLTLQCAEPNNQMV...VCDPRN........GKYMAVAL.LYRG.
TBA2_SCHPO/263-393PRIHFPLVTYAPIVS---AA.....KAFHESNSVQEITNQCFEPYNQMV...KCDPRA........GRYMATCL.LYRG.
TBA1_YEAST/264-394PRIHFPLVSYSPVLS---KS.....KAFHESNSVSEITNACFEPGNQMV...KCDPRD........GKYMATCL.LYRG.
P91873_CAEEL/269-399PRIHFPLVTYAPLVS---AE.....RASHEQNTVSDMTHACFEPGYQMV...KCDPRR........GKYMAVCL.LYRG.
TBAL3_HUMAN/270-400PRIHFPMTAFAPIVS---AD.....KAYHEQFSVSDITTACFESSNQLV...KCDPRL........GKYMACCL.LYRG.
O18154_CAEEL/260-388PRIHFPLVAYNPLIS---S.......AHHEFLSVDEITKSCFEASNQMV...KCDPKH........GKYMAVCL.LYRG.
TBA4_DROME/274-404PRIHFPLVAYAPLMS---AE.....RSAHEQHAITTLTNACFESSNMMV...KCDPRA........GKFMACCM.LYRG.
TBA_DICDI/270-402PRLHFVLCSYAPVIS---RE.....KAHHETITVDNITSAVFSEKNIMA...KCQPNL........GKYMACCL.MYRG.
TBB_SCHPO/261-383PRLHFFMVGFAPLAA---IG.....SSSFQAVSVPELTQQMFDANNMMV...AADPRH........GRYLTVAA.LFRG.
TBB_DICDI/266-388PRLHFFLVGFAPLTA---KG.....ASSYNRITVPELTQQMFDAKNMMA...ASDPHN........GKYLTASA.LFRG.
TBBP_DROME/260-382PRLHFLIPGFAPLVT---CK.....QQQFSKGTVSELVQQIFYSNNLLC...AIDLRK........GKLLTAAG.IFRG.
TBE_MOUSE/294-414PKLHYLVSSLTPLYT---LA.....DVNIPPRRLDQMFSDAFSKDHQLI...QADPRH........SLYLACAL.IVRG.
TBG_DICDI/261-387PKCHFLITGYTPLSI---DR....QTESVRKTSVLDVMRRLLQPQNIMV...SAPTK........TGKYISILN.IIQG.
TBG2_DROME/264-394PQLHFLMTGYTPLMS---DCE...TKTSVRKTTVLDVMRRLLQPKNMMV...SALTDKQ.....SRQCFVSILN.IIQG.
TBG1_HUMAN/264-393PRLHFLMTGYTPLTT---DQ....SVASVRKTTVLDVMRRLLQPKNVMV...STGRDRQ.....TNHCYIAILN.IIQG.
TBG_SCHPO/264-393PRCHFLLTSYTPFTN---QQV..EEAKAIRKTTVLDVMRRLLLPKNQMV...SVNPSK.......KSCFISILD.IIQG.
TBG_YEAST/263-392PELHFLSPSFTPFTS---DYI..HDDIAHKGHSSYDVMLDLLDPSNSLV...STAMNN........PTYFNVYN.TIIG.
TBG_CAEEL/264-391PPMHFIQSAISPVVD---PN.....ENFTRKTSVADVTRFLLKPTSMMVS.TASRVRP........NDCMLSAYMFLQG.
A8INY3_CHLRE/264-398PRCHFLMTGYTPLTA---ENAAGQVTSNIRKTTVLDVMRRLLQPKNIMV...STHTKSRD...IANAKYISILN.IIQG.
C4LYF7_ENTHI/261-382..SHFLMTSYTPLRQ---VN.....Q.ISSRTSAIDVMKRLIQPQNIMA...RTRLKE........GKYISMCD.FFQG.
C4LYU0_ENTHI/268-398PRDHFAMMSYAPIVT---PE.....KAIRQTLSVQELTSSLFDPNSLMI...QCDDIN.......KGKFMSCCM.MYRG.
D6XD01_TRYB2/266-392PRCHFVCTGYTPTTL---DTS..NIQSSVQKTSVHDVMRRLLMPKNMMV...STSMKS........GCYISLLN.LIQG.
F6HWX4_VITVI/87-217PRIHFMLSSYAPVIS---AE.....KAYHEQLSVAEITNSAFEPSSMMA...KCDPRH........GKYMACCL.MYRG.
K1WWQ1_MARBU/263-392PRIHFPLVAYSPVVS---AA.....KASHEANSVQEISMSCFEPNNQMV...KCDPRN........GKYMATCL.LYRG.
L2G737_COLGN/261-380PRLHFFTVGFAPLTT---A.......AAYQNLGVAELTQQMFDPKNVMS...ASDFRN........GRFLTCSA.IYRG.
TBB_STRPU/106-227PRLHFFMPGFAPLTS---RG.....SQQYRALTVPELTQQMFDAKNMMA...ACDPRH........GRYLTVAA.IFRG.
Q23FR3_TETTS/263-388PKCHFLMTGYTPISI---DR....HIKTIRKTTVLDVMRRLLQTKNIMV...SASTKK........GQYISIMN.VIQG.
Q4FKF8_TRYB2/297-426PRLLFLTSAIAPLSV---AR....HAAASAPRSVDTMIAACLDKNHQFV...DVSNGLSSALTHEAGTCLATAIVARGP.
Q5A471_CANAL/202-320PDLKFLTSSIAPFST---QK....HNYLNEYDMLLELSNDRYKTNRVG........GD........TSYISMLNYLIGY.
Q8IAN7_PLAF7/265-389PKCHFLITSYTPITI---DK....HISNVQKTTVLDVMKRLLHTKNIMV...SAPVRR........GMYISILN.IIRG.
TBA_ENCCU/259-388PRIHFPLVAYSPMLS---KE.....KAAHEKLSVQEITNACFEPQNQMV...RCDTRK........GKYMACCL.LFRG.
TBB_ENCCU/261-382PRLHFFVAGFAPLIA---IG.....TQKFKTYSVSELTQQMFDSKNMMT...ACDPRK........GRYLTVAA.MFRG.
S7XG08_SPRLO/260-389PRIHFPLVAYSPMLS---RE.....RASHEQLSVQEITSACFDPKNQMV...KCDPRN........GKYMACCL.LFRG.
U6HFZ1_ECHMU/261-382PRLHFFVPGFAPLAS---RT.....SQSYQSCTILELTRQMFDAKNMMA...ACDPSH........GRYLTVAA.MYRG.
V5E7D2_PSEBG/262-391PRIHFPLATYAPILS---AA.....KAGHEQNSVAEMTFSSFEKGNQMV...KADPRD........GKFMACCL.LYRG.
X6MDL2_RETFI/83-214PRLHFMTTGMSPIIP---KV.....DVSTAPNDIQKITDDCFKPANWFVKYTEFDPAE........DKYMAISL.NYRG.
X6MFF7_RETFI/189-310PRLHFFMTGFAPLTA---SN.....TAQYSNTTVAELTGQMFDSRNMMC...ACDPKH........GRYLTASA.IFRG.
X6MHB5_RETFI/267-389PRLHFFLIAQSPLFA---PG.....EGAKVKLTIQEITDQMWSSRNFMA...NVVPGD........GKYLSASL.AYRGE

PF12327

FTSZ2_HALSA/239-333---GVAVMLVGETQD...KN-----KTN...EVVKDAMNHPLLD.VDYR-----------------GASGGLVH-ITGGP
FTSZ_HALMT/257-351---GVAMIGLGESDS...ES-----KAQ...ESVKSALRSPLLD.VDIS-----------------GANSALVN-VTGGS
FTSZ_CORGL/219-313---GSALMGVGSARG...DN-----RVV...SATEQAINSPLLE.ATMD-----------------GATGVLLS-FAGGS
Q97IE9_CLOAB/222-316---GLAHMGTGRGAG...DT-----RAS...DAAKQAISSPLLE.TSIV-----------------GATGVLLN-VTGGE
O85785_SYNE7/248-342---GSALMGIGSGSG...KS-----RAR...EAAHAAISSPLLE.SSIE-----------------GARGVVFN-ITGGR
FTSZ_RICPR/225-321---GKAMMGTGEDSG...ED-----RAI...KAAESAISNPLLDHSSMC-----------------GARGVLIN-ITGGP
FTSZ2_RHIME/224-319---GRAMMGTGEATG...EN-----RAM...LAAEAAIANPLLDEVSMR-----------------GAKGVLVS-ISGGM
FTSZ_CAUCR/225-320---GKAMMGTGEGTG...ED-----RAL...MAAQNAIANPLLDEVSLK-----------------GAKAVLVN-VTGGM
FTSZ_BUCAI/221-316---GYAMMGTGISSG...EN-----RAE...EASEIAISSPLLEDIDLS-----------------GARGVLVN-ITAGF
FTSZ_PSEAE/222-317---GMAMMGTGCASG...PN-----RAR...EATEAAIRNPLLEDVNLQ-----------------GARGILVN-ITAGP
Q9CPA6_PASMU/244-342---GQAMIGFGSCKGTAGEG-----RAE...EATRIAVKSDLLERVDLS-----------------GAKGVLVN-ITSGM
FTSZ_HAEIN/246-344---GQAMIGFGSAVGEPGAG-----RAE...EAARLAVRNDLLEKIDLS-----------------NAQGILVN-ITAGM
Q9PF76_XYLFA/226-321---GLAMMGTGSARG...DD-----RAQ...AAAEAAVQNPLLDDVNLA-----------------GANGILVN-ITAGS
FTSZ2_METJA/246-343---GVAMIGVGEVDS...SD-----RGDRVQNVVRETLSCPLLD.VDYR-----------------GAKGALIH-ITGGP
FTSZ2_ARCFU/238-332---GVAVMLVGEAKA...QD-----KAN...AVVRDCLSHPLLD.VDYR-----------------GATGSLVH-ISGGH
FTSZ1_HALSA/261-355---GVAMIGLGEADS...DA-----KAA...DSVQSALRSPLLD.VDIS-----------------SANSALVN-VTGGP
FTSZ1_ARCFU/252-346---GVAMIGLGEASG...ED-----KAA...ESVRKALKSPLLD.VDVS-----------------GAKAALVN-VTGGP
FTSZ_METTH/248-342---GMAMIGMGEAES...GD-----RAL...ESVYEALNSPLLD.LDIS-----------------NARGALIN-ISGSS
A0R012_MYCS2/219-313---GTALMGIGSARG...DG-----RAL...KAAEIAINSPLLE.ASME-----------------GAQGVLLS-VAGGS
A9CIB1_AGRT5/227-320---..AMMGTGEASG...PG-----RAM...QAAEAAIANPLLDETSMK-----------------GAQGLLIS-ITGGR
B8CNL5_SHEPW/222-316---GNAMMGTGVASG...ED-----RAE...EAAEAAVASPLLEDIDLA-----------------GARGVLVN-ITAGM
F2JS98_CELLD/222-316---GVAHMGIGRATG...EN-----RAE...EAVKYAISSPLLD.TSID-----------------GARCVLVN-MCGGE
Q2GLJ5_ANAPZ/50-145---GKAMMGTGEAEG...EH-----RAV...AAAEAAISNPLLDNISMK-----------------GARGILIN-ITGGM
Q5NI93_FRATT/221-316---GLAMMGMGEASG...EN-----RAR...EAAEAAISSPLLEDINLD-----------------GAKGVIVN-ITAGM

PF03953

TBG_EMENI/263-392EADPTDVHKSLLRIRERRL..ASFIPWGPASIQVALTKKSPYIQNTH.....RVSGLMLANHTSVATLFKRIVQ
TBA2_EMENI/265-395DCVPRDCTQAIASLKAKAS..FNLVEWCPTGFKVGINYQKPARVPGSELAPVDRSVSMLSNTTAISEAWSRLDH
TBA2_SCHPO/263-393DVIPRDVQAAVTTIKAKRT..IQFVDWCPTGFKIGICDRPPQHIEGSEIAKVDRAVCMLSNTTSIAEAWSRLDH
TBA1_YEAST/264-394DVVTRDVQRAVEQVKNKKT..VQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDR
P91873_CAEEL/269-399DVVPKDINSAIAAVKTKRT..VQFVEWCPTGFKVGINYQPPTVVPGGDLGKQTRSVCMISNTTAIAEAWARLDH
TBAL3_HUMAN/270-400DVVPKEVNAAIAATKSRHS..VQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDH
O18154_CAEEL/260-388DVVPKDVSAAIKSIKTQRS..VQFVDWCPTGFKVGLNYQPPTVIPGGDMAKVPRAVCMLSNTTAIAEAWQRLDY
TBA4_DROME/274-404DVVPKDVNAAVSAIKSKRH..IQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSY
TBA_DICDI/270-402DIVPKEAQKAVQNIRSEKSRNVSFVDWSPTGFKCGINNQAPVSTKDSEMAEVKKSVCMLSNTTAISQVFSRINH
TBB_SCHPO/261-383KVSMKEVDEQIRSVQTKNS..AYFVEWIPDNVLKAVCSVPPKDLKMS........ATFIGNSTSIQEIFRRLGD
TBB_DICDI/266-388KIFTKEVDEQMHNIQTKNS..SYFVEWIPHNIKSSICDIPPKGTPMA........VTFIGNNTAIQDLFKRISI
TBBP_DROME/260-382RMSPREVDQLMTGVRNKNI..NNFVDWIPNNIKTAICDIPPRGLKMS........ATFIGNTTAIQTLFQRLLD
TBE_MOUSE/294-414NVQISDLRRNIERLKPALQ....FVSWNQEGWKTSLCSVPPVGHSHS........LLALANNTCVKPTFMELRE
TBG_DICDI/261-387DVDPTQIHNSLQRIREKRM..ATFIDWGPASIQIALSKKSPYIKSSH.....KVSGLMLANHTSVNHLFSHIIQ
TBG2_DROME/264-394EVDPSQVHKSLQRIRERKL..ANFIPWGPASIQVALPRSSPYVQSAH.....KVSGLMMANHTGISSLFKRALA
TBG1_HUMAN/264-393EVDPTQVHKSLQRIRERKL..ANFIPWGPASIQVALSRKSPYLPSAH.....RVSGLMMANHTSISSLFERTCR
TBG_SCHPO/264-393EADPADVHKSLLRIRERRY..ASFIPWGPASIQVALSKKSPYIKTNH.....RVSGLMLANHTSIASLFKRTLD
TBG_YEAST/263-392NVEPRQISRAMTKLQQRIK....FPSWSSSAMHVNIGRRSPYLPLQPN..ENEVSGMMLSNMSTVVNVFENACN
TBG_CAEEL/264-391QIEAHTIMTAEQNVDFAIR...RPPFYMLKPLRMMHAPLSPYVRPQY.....KVSGLLLNNSTSVAPLFESLLS
A8INY3_CHLRE/264-398EVDPSQVHKSLQRIRERKQ..ANFIEWGPASIQVALSKKSPYVQTAH.....RVSGLMLANHTSVRHLFNKVL.
C4LYF7_ENTHI/261-382DVSYDEINEALQRFTDRRL..AEFVPWNKEAIKVVHTRVSPLVKRGN.....RMSGMLLANNTSIRYYFQDIL.
C4LYU0_ENTHI/268-398DVSSREVNLAVSGIKKQNT..VPFVGWCPCSFKCGINSQPATAVPGSSYASTARSACMIANHTAMCQVFQKVN.
D6XD01_TRYB2/266-392DVDPAQVHRSLERIRERSP...NFIPWGPASIQVILSKKSPYLDTRH.....RVSGLVMANHTSISSLFQRTL.
F6HWX4_VITVI/87-217DVVPKDVNAAVATIKTKRT..IQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDH
K1WWQ1_MARBU/263-392DVVTKDVHGAVATLKTKRT..IQFVDWCPTGFKIGICYQPPQMVPNGDLAKVNRAVCMLSNTTAIAEAWSALS.
L2G737_COLGN/261-380KVSTKQIEEQIRGVQAKNS..AYFVEWIPNNVQTAHCSIPPVGMNAS........STFIGNSTAIQDIFRRVG.
TBB_STRPU/106-227RMSMKEVDEQMLNVQNKNS..SYFVEWIPNNVKTAVCDIPPRGLKMS........ATFIGNSTAIQELFKRIS.
Q23FR3_TETTS/263-388EVDASQIHKSLQRIRERKL..ANFINWGPASIQVALSKKSPYIETSH.....KVSGLMLANHTSIHTLFEKII.
Q4FKF8_TRYB2/297-426QITVGDLTRNIPRIRERQK....LVYWNEDGCKTALCSVSPLGHRNS........VLMLANHCSIAQKLQSAH.
Q5A471_CANAL/202-320NLDQREIRKGILKSQQRIS....FVPWVARSVLVVHGKKSPYLKNTN......LEGIQVTNNTSMIDVFTKIL.
Q8IAN7_PLAF7/265-389ETDPTQVHKGLQRIRDRKL..VNFIKWNPASIQVTLAKQSPHVVSQH.....KVCGLMMANHTSISTLFERC..
TBA_ENCCU/259-388DVNPKEANNATANVKAKRT..NQFVEWCPTGFKVGINSRKPTVLDGEAMAEVSRAVCALSNTTAISEAWKRLN.
TBB_ENCCU/261-382KISMKDVDEQMSMVQSKNS..SLFVEWIPSNVKTAVCDIAPTGLEMS........ATFVGNTTSIQELFKRIS.
S7XG08_SPRLO/260-389NVNPKDVNQATSLVKSKRA..NQFVEWCPTGFKIGINDRKPYVFKDGAMAPVDRAVCMLSNTTAISEAWKRLN.
U6HFZ1_ECHMU/261-382RVSMKEVEDRILETQTRNS..TYFVEWIPNNVKTAVCDIPPIDFKVA........GTFIGNTTAIQELFTRVS.
V5E7D2_PSEBG/262-391DVVPKDVNSAVATIKTKRT..IQFVDWCPTGFKIGICNEPPTTVPGGDLAKVSRSLCMLANTTAIAGAWGRLD.
X6MDL2_RETFI/83-214DIKSKEANATVQWLKSNNK..IALVEWCPTGFKIGLNEVPAVTLESDDIGAFSKNAVMIANNTGISRVFSKR..
X6MFF7_RETFI/189-310QVSTKEVDDQMFNIQNKNS..TYFVEWIPNNIKSSVVNSPLKGARLS........VTFLANTTAIQDMFKRVG.
X6MHB5_RETFI/267-389NIPSQEVDGIVKSIQEKMA..EDFVNWIPNNIKSSIISVPPEDTPLS........GTFVANTTAIKGVFQRIS.

PF12327

FTSZ2_HALSA/239-333DLTLKEAEGIADNITERLD.ASANVIWGA-------------RIQES-----------YKGKVRVMAIMTGVQ-
FTSZ_HALMT/257-351DMSIEEAEGVVEEIYDRID.PDARIIWGT-------------SVDDE-----------LEGMMRTMIVVTGVE-
FTSZ_CORGL/219-313DLGLMEVNAAASMVRERSD.EDVNLIFGT-------------IIDDN-----------LGDEVRVTVIATGFD-
Q97IE9_CLOAB/222-316DLGLLEINEAARVVQEAAD.PDANIIFGA-------------VIDEN-----------LKDEIRITVIATGFE-
O85785_SYNE7/248-342DMTLHEVNAAADAIYEVVD.PEANIIFGA-------------VIDDR-----------LEGELRITVIATGFS-
FTSZ_RICPR/225-321DMTLFEVDNAANRIREEVDNIDANIIFGS-------------TFNPE-----------LKGIIRVSVVATGID-
FTSZ2_RHIME/224-319DMTLFEVDEAATRIREEVY.DEADIVVGA-------------IFDRS-----------LDGTFRVSVVATGLD-
FTSZ_CAUCR/225-320DMTLLEVDEAANAISDQVD.PEANIIFGA-------------AFDPS-----------LEGVIRVSVVATGMD-
FTSZ_BUCAI/221-316DLKLDEFETVGNTIRSFSS.DHATVVIGT-------------SLDPD-----------MNDTLRVTVVATGIG-
FTSZ_PSEAE/222-317DLSLGEYSDVGNIIEQFAS.EHATVKVGT-------------VIDAD-----------MRDELHVTVVATGLG-
Q9CPA6_PASMU/244-342DLGLDEFNVVGKTVAEFAS.QEATVVIGT-------------TLVPE-----------MVDEIRVTIVATGIG-
FTSZ_HAEIN/246-344DLVFEEFNIIGETIGSFAS.EEATVVVGT-------------SLVPE-----------MSDEIRVTIVATGLG-
Q9PF76_XYLFA/226-321DFTMAEFDEIGRTIDGFAS.EDATVVVGT-------------VLDPE-----------MQDEVRVTVVATGLS-
FTSZ2_METJA/246-343DLTLKEANDIGEGITKELD.PEANVIWGA-------------RIDPE-----------MEGCIRVMAIITGVK-
FTSZ2_ARCFU/238-332DLTLKEAEEIIRNLTFEID.DYANVIWGA-------------RIDKE-----------FEGFVRVVSIMTGIK-
FTSZ1_HALSA/261-355GMSIEEAEGVVEQLYDRID.PDARIIWGT-------------SIDEQ-----------IQEEMRTMVVVTGVD-
FTSZ1_ARCFU/252-346DMTIEEAESVIEEIYSKVD.PDARIIWGA-------------MIDPE-----------LENTMRTLIIVTGVK-
FTSZ_METTH/248-342DLTLQEAERIVEVVAEELD.PDANIIWGA-------------QIQDE-----------LQNVIRTTIVVAGVR-
A0R012_MYCS2/219-313DLGLFEINEAASLVQDAAH.PEANIIFGT-------------VIDDS-----------LGDEVRVTVIAAGFD-
A9CIB1_AGRT5/227-320DLTLFEVDEAATRIREEVD.PDANIILGA-------------TFDEA-----------LEGLIRVSVVATGID-
B8CNL5_SHEPW/222-316DMSIEEFETVGNHVKAYAS.DNATVVVGA-------------VIDPE-----------MSDELRVTVVATGI.-
F2JS98_CELLD/222-316SLGLMEANVGMGLIREAVD.PDAEIIFGT-------------SINEN-----------LGEEIIITVIATDFQ-
Q2GLJ5_ANAPZ/50-145DMTLFEVDAAANRIREEVD.EEANIIFGS-------------TFDEN-----------SAGRIRVSVLATGID-
Q5NI93_FRATT/221-316DMSIGEFEEVGEVIRSFIS.DEAIVIAGT-------------VIDPD-----------MSDSMKVTVVVTGIE-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window