Sequence alignment for CL0442

PF03953

TBG_EMENI/263-392-PRSHFLLTSYTPFTG---DNI..--------------------------------------------------------
TBA2_EMENI/265-395-PRIHYPLISYAPVIS---SN...--------------------------------------------------------
TBA_ENCHE/237-367-PRIHFPLVAYSPMLS---KE...--------------------------------------------------------
P92124_9MICR/238-368-PRIHFPLVAYFPMLS---RE...--------------------------------------------------------
TBA2_SCHPO/263-393-PRIHFPLVTYAPIVS---AA...--------------------------------------------------------
TBA1_YEAST/264-394-PRIHFPLVSYSPVLS---KS...--------------------------------------------------------
O00907_BLEJA/239-369-PRIHFMLSSYAPIIS---AE...--------------------------------------------------------
Q9HDT1_USTMD/262-392-PRIHFPLATYAPILS---AA...--------------------------------------------------------
O01943_GECLA/256-386-PRIHFPLVTYAPVVS---SA...--------------------------------------------------------
O93945_RHYSE/266-396-PRIHFPLVAYAPVVS---AA...--------------------------------------------------------
P91873_CAEEL/269-399-PRIHFPLVTYAPLVS---AE...--------------------------------------------------------
TBAL3_HUMAN/270-400-PRIHFPMTAFAPIVS---AD...--------------------------------------------------------
O18154_CAEEL/260-388-PRIHFPLVAYNPLIS---S....--------------------------------------------------------
TBA4_DROME/274-404-PRIHFPLVAYAPLMS---AE...--------------------------------------------------------
Q9GQC1_9MYCE/168-298-PRIHFLLCSYAPVIT---KE...--------------------------------------------------------
Q9GQB7_9MYCE/169-301-PRLHFVLCSYAPVIS---KE...--------------------------------------------------------
TBA_DICDI/270-402-PRLHFVLCSYAPVIS---RE...--------------------------------------------------------
Q9GQB9_9EUKA/168-298-PRIHFMLSSLAPVNS---KE...--------------------------------------------------------
TBA1_ENTHI/268-399-PRDHFAMMSYAPIVT---PE...--------------------------------------------------------
O44024_RETFI/260-393-PRLHFMTTGMSPIIP---KA...--------------------------------------------------------
Q9GQU7_ANTLO/246-369-PRLHFFIVGFAPLIA---QG...--------------------------------------------------------
TBB_ENCHE/261-383-PRLHFFVVGSAPLIA---IG...--------------------------------------------------------
Q9N6F5_9MICR/246-368-PRLHFFMIGFAPLIA---EN...--------------------------------------------------------
TBB1_COLGL/264-384-PRLHFFTVGFAPLTT---A....--------------------------------------------------------
TBB1_GEOCN/261-383-PRLHFFMVGYAPLSA---PG...--------------------------------------------------------
TBB_SCHPO/261-383-PRLHFFMVGFAPLAA---IG...--------------------------------------------------------
Q9HGW5_9ASCO/245-367-PRLHFFVVGFAPLTA---KG...--------------------------------------------------------
Q9UVQ7_9FUNG/246-368-PRLHFFMVGFAPLTA---KD...--------------------------------------------------------
Q9P8Z1_UMBRA/246-368-PRLHFFMVGFAPLNS---FG...--------------------------------------------------------
Q9P8Z5_SMICU/246-368-PRLHFFMVGFAPLGD---TK...--------------------------------------------------------
O00817_CRYPV/263-385-PRLHFFMIGFAPLTS---RG...--------------------------------------------------------
Q9LD24_BIGNA/246-368-PRLHFFITGFAPLTS---RG...--------------------------------------------------------
Q9ZTL8_9CRYP/246-368-PRLHFFMVGFAPLTS---RA...--------------------------------------------------------
O01676_BOMMO/261-383-PRLHFFMPGFAPLTS---RG...--------------------------------------------------------
Q25165_SPIBA/246-368-PRLHFFVAGFAPLTS---RG...--------------------------------------------------------
TBB1_CHOCR/263-385-PRLHFFAVGHAPLAA---SN...--------------------------------------------------------
TBB2_PHYPO/261-383-PRLHFFLIGYAPLTA---RS...--------------------------------------------------------
TBB_DICDI/266-388-PRLHFFLVGFAPLTA---KG...--------------------------------------------------------
TBBN_GUITH/261-383-PRLHFFMVGFAPLGS---RG...--------------------------------------------------------
TBB_PORPU/261-383-PRLHFFMIGYAPLSA---DG...--------------------------------------------------------
Q26235_RETFI/261-383-PRLHFFMTGFAPLTA---SN...--------------------------------------------------------
TBB3_ECHMU/261-383-PRLHFFVPGFAPLAS---RT...--------------------------------------------------------
Q9UVR1_9FUNG/246-368-PRLHFLMSGFAPLTS---TQ...--------------------------------------------------------
TBBP_DROME/260-382-PRLHFLIPGFAPLVT---CK...--------------------------------------------------------
TBB2_GEOCN/263-385-PRLHFFTTGFAPLFA---KN...--------------------------------------------------------
Q26236_RETFI/267-390-PRLHFFLIAQSPLFA---PG...--------------------------------------------------------
O46334_9EUKA/267-389-PRLHFFTLAHSPLFA---PG...--------------------------------------------------------
TBE_MOUSE/294-414-PKLHYLVSSLTPLYT---LA...--------------------------------------------------------
Q9NI44_9TRYP/297-427-PRLLFLTSAIAPLSV---AR...--------------------------------------------------------
TBG_CHLRE/264-399-PRCHFLMTGYTPLTA---ENAAG--------------------------------------------------------
O00896_PHYPO/261-387-PRCHFLMTGYTPLTV---DR...--------------------------------------------------------
Q9FRU9_TOBAC/264-395-PRCHFLMTGYTPLTV---ER...--------------------------------------------------------
TBG_DICDI/261-387-PKCHFLITGYTPLSI---DR...--------------------------------------------------------
O00849_TETTH/263-389-PKCHFLMTGYTPISI---DR...--------------------------------------------------------
Q9AR10_EUGGR/266-393-TRCHFLMTGYTPITI---DPN..--------------------------------------------------------
TBG2_EUPOC/261-387-PRCHFLMTGYTPLSL---DQ...--------------------------------------------------------
TBG2_DROME/264-394-PQLHFLMTGYTPLMS---DCE..--------------------------------------------------------
TBG1_HUMAN/264-393-PRLHFLMTGYTPLTT---DQ...--------------------------------------------------------
TBG_SCHPO/264-393-PRCHFLLTSYTPFTN---QQV..--------------------------------------------------------
Q94771_9TRYP/266-393-PRCHFVCTGYTPTTL---DTS..--------------------------------------------------------
TBG_PLAFO/265-391-PKCHFLITSYTPITI---DK...--------------------------------------------------------
TBG_RETFI/263-389-PRAHFLMTSFTPLVI---KG...--------------------------------------------------------
TBG_ENTHI/259-383-RFSHFLMTSYTPLRQ---VN...--------------------------------------------------------
TBG_CANAX/299-418-PDLKFLTSSIAPFST---QK...--------------------------------------------------------
TBG_YEAST/263-392-PELHFLSPSFTPFTS---DYI..--------------------------------------------------------
TBG_CAEEL/264-391-PPMHFIQSAISPVVD---PN...--------------------------------------------------------

PF12327

FTSZ2_HALSA/239-333----GVAVMLVGETQD...KN-----------------------------------------------------------
FTSZ_HALME/257-351----GVAMIGLGESDS...ES-----------------------------------------------------------
FTSZ_MYCKA/219-313----GTALMGIGSARG...DG-----------------------------------------------------------
FTSZ_CORGL/219-313----GSALMGVGSARG...DN-----------------------------------------------------------
Q97IE9_CLOAB/222-316----GLAHMGTGRGAG...DT-----------------------------------------------------------
O85474_9FIRM/222-316----GVAHMGIGRATG...EN-----------------------------------------------------------
Q9SCC9_GUITH/260-354----GSALMGIGTGSG...KT-----------------------------------------------------------
O85785_SYNE7/248-342----GSALMGIGSGSG...KS-----------------------------------------------------------
Q9AQ37_ANAPH/225-320----GKAMMGTGEAEG...EH-----------------------------------------------------------
FTSZ_RICPR/225-321----GKAMMGTGEDSG...ED-----------------------------------------------------------
FTSZ2_RHIME/224-319----GRAMMGTGEATG...EN-----------------------------------------------------------
FTSZ_RHIRD/225-320----ARPMMGTGEASG...PA-----------------------------------------------------------
FTSZ_CAUCR/225-320----GKAMMGTGEGTG...ED-----------------------------------------------------------
Q9M7M6_9STRA/290-387----GHAIMGTGQAEG...ED-----------------------------------------------------------
FTSZ_BUCAI/221-316----GYAMMGTGISSG...EN-----------------------------------------------------------
Q9F1M6_SHEVI/222-317----GNAMMGTGVASG...ED-----------------------------------------------------------
FTSZ_FRATH/221-316----GLAMMGMGEASG...EN-----------------------------------------------------------
FTSZ_PSEAE/222-317----GMAMMGTGCASG...PN-----------------------------------------------------------
Q9CPA6_PASMU/244-342----GQAMIGFGSCKGTAGEG-----------------------------------------------------------
FTSZ_HAEIN/246-344----GQAMIGFGSAVGEPGAG-----------------------------------------------------------
Q9PF76_XYLFA/226-321----GLAMMGTGSARG...DD-----------------------------------------------------------
FTSZ2_METJA/246-343----GVAMIGVGEVDS...SD-----------------------------------------------------------
FTSZ2_ARCFU/238-332----GVAVMLVGEAKA...QD-----------------------------------------------------------
FTSZ1_HALSA/261-355----GVAMIGLGEADS...DA-----------------------------------------------------------
FTSZ1_ARCFU/252-346----GVAMIGLGEASG...ED-----------------------------------------------------------
FTSZ_METTH/248-342----GMAMIGMGEAES...GD-----------------------------------------------------------

PF13809

A0ZDE4_NODSP/18-373---ICIGLGGTGRDVL---MRIRRLIVDRYGDL.................---------------NNLPIVSFVHIDTDK
A1VSD1_POLNA/4-348---FIIGLGGTGGKII---RALRKSLYQEFHGGP................---------------PAGVGIGYLYVDSSS
A3IHZ5_9CHRO/13-355---VLVGVGGTGAEIL---SRIRRLVEETYGSL.................---------------EAFPILSFLVVDTDK
A5N8S7_CLOK5/35-392---LIIGLGGTGIDAM---LRLKYQINKRFILEEDIISNTRK........---------------DKPKKVEFLGFETNQ
A6NS46_9FIRM/38-402---IFISSGGNGHKSL---CAVRKELEWRVALQ.................---------------ELKDKVRFLAVDAAY
A6P0V7_9FIRM/16-360---LFIGIGGTGCDIV---KRVAEMCRP......................---------------GETENINFACLDTNV
A7VAW1_9CLOT/34-390---LVIGLGGIGSRTV---CNLKGMMVDDI....................---------------TPEDNIHFLMVDSDI
A8SSW8_9FIRM/34-390---LVIGLGGLGSRAV---CALKGMLVNDI....................---------------TPEDNINFLMIDSDI
B0JIZ1_MICAN/14-373---IIIGLGGTGRDVL---MRIRRFIIDKYGKL.................---------------SNLPVVSFVHIDTDK
B1VR11_STRGG/8-403---LFVGLGGTGGLVG---AELERKLRVDLCGPDGTAL...QHIGGLAPY---------------QLPDCLQFVYADFSE
B2JAM4_NOSP7/13-355---VLVGVGGTGTEVL---SRVRRLIEEAYGSL.................---------------NNFPIISFFSIDTDK
B3DW42_METI4/6-351---FIIGLGGTGGKVI---RAFRKTIFQEFRKVD................---------------PPDIRLSYLYVDSSD
B3QN46_CHLP8/22-399---LFIALGGTGAQVL---WRIRRRIINNLWGSGTGQ....AVRIDNL..---------------TEFPFAEFLQIDLSA
E0UHW6_CYAP2/14-356---IIVGIGGTGHEVL---ARVRRLIEETYGNL.................---------------QNFPIISFLIVDTDK
B8G8G2_CHLAD/22-363---LVIGLGGTGVDVI---RQLKRRIRQSMQ...................---------------PMPGVLEFLVVDTEM
B8HTJ0_CYAP4/11-352---VVIGLGGTGKEIM---IKIRRMIVESYGSL.................---------------EALPIVAFLHVDTEQ
C3B5Y7_BACMY/8-349---ILIGLGGIGSTVT---HQIYEKLPE......................---------------ERRKKVAMHVFDTDV
C7QTL6_CYAP0/18-377---ICIGLGGTGLEIL---MRIRRSIVNKYGDL.................---------------NNLPIVSFVYIDTDK
D3EKE8_GEOS4/35-389---LIIGLGGTGIDAL---LRLKYQINRRFKLPEDPLSKKRM........---------------DKPDNVEFLAFETNE
Q114V2_TRIEI/18-373---ICIGIGGTGRDIL---MRIRRLIVDSYGDL.................---------------EKLPIVSFVHIDTDK
Q7NLY7_GLOVI/13-354---VVVGLGGTGKEIL---IKIRRMIVESYGTL.................---------------DALPIVSFLHLDTEQ
Q8DK50_THEEB/19-361---VIVGVGGTGIEVL---SRVRRLVEETYGSL.................---------------KQFPVISFLAIDTDR
Q9RWX7_DEIRA/11-368---LVIGLGSTGTEIL---ESLADRIDWEVGGL.................---------------SRAPWVEFLAVETDV

PF00091

Q7NB81_MYCGA/75-255-KIKVIGIGGAGNNIV---EDILR........................................................
B9LLN1_CHLSY/15-187-NIKLIGLGGCGGNLV---STL.K........................................................
A9CGZ3_AGRT5/15-187-NIAVVGVGGGGGNAI---NNMIA........................................................
FTSZ_CAUCR/16-188-RIVVFGVGGAGGNAV---NNMIE........................................................
B4SJY0_STRM5/15-187-VIKVVGVGGGGGNAV---AHMVN........................................................
B3E8P4_GEOLS/12-183-TIKVVGIGGAGLNAV---NAMLA........................................................
Q4A669_MYCS5/37-207-KLCVIGVGGGGNNAV---KMIQA........................................................
Q7Q808_ANOGA/3-224-EIVVFHLGQCGNRVA---ENFWEYICDEHCLNTEG..........................QF.E..GQHYLPLQRIN.
FTSZA_DICDI/52-223-NITVCGIGGGGCNSV---NNMIN........................................................
Q0HDQ9_SHESM/15-188-KLTVFGVGGCGCNTI---NQLSQ........................................................
TBG_CAEEL/6-229-ALMTVHVGQCGNQLA---QAFWKSMVDEHGINERG...........................Q.T..THEDDMNDKKD.
Q4QCZ3_LEIMA/2-292-AIVVVLIGQCGNQLG---DELFTQLALCTSSAASS...........................A.G..DKPPARVADPS.
FTSZ_THEMA/23-195-KIKVIGVGGAGNNAI---NRMIE........................................................
O96769_PARTE/4-227-EIITLQVGQCGNQIG---IEFWKQLIKEHGINNEG..........................IL.E..EFALQGDDRKD.
TBG_CANAX/4-262-ETITLQVGQCGNQVG---LQYWQQLATEHGIQSDGSSTPYPKDINDLQLQELNNSGSSPQSYPQQTKPNGKYRNDHPE.
A2EAH1_TRIVA/4-237-KIITIQVGQCGNSIG---LEFWKTLSTEHGIGPDG..........................VL.R..EPENTLEDRKD.
Q24D61_TETTS/3-222-EIINIQIGKGGNQIG---LDFWEALHIEHSLDPYG..........................DL.N..HSSDYQKEKFN.
Q3SEF9_PARTE/3-228-EIISLHIGQAGLQIG---NSLWELFCLEHSIQPDGT........................VPT.D..RILEGLNSNVD.
Q3SEF7_PARTE/3-210-SAIHLHIGGAGVMIG---NELWKLYQKEQ...........................................TETNVK.
Q2S524_SALRD/20-193-KICVVGVGGGGGNAI---NNMVQ........................................................
FTSZB_DICDI/62-236-KISVVGVGGGGGNAV---NHMIS........................................................
TBGN_GUITH/4-222-EILTLQVGKTGILTG---NEFWKSLVREKNLLSDF...........................S.L..GKNSPTNDN...
A1SU24_PSYIN/26-198-IIKVVGIGGGGGNAI---NYMIE........................................................
A4SGZ8_PROVI/19-191-TIRIVGVGGCGGNAV---NNMIE........................................................
Q24D62_TETTS/3-222-EIINLQIGQGGNKIG---QCFWESLCTEHQLDQDG..........................YS.D..KMSDFQREQIG.
FTSZ_BUCBP/12-184-IIKVIGIGGGGGNAV---EYMVQ........................................................
A0EC94_PARTE/3-226-EILQFHVGQAGIQIG---NTAWELLCLEHGIQPDG...........................S....APSSQ...NLQ.
Q22CD2_TETTS/3-223-EIISIHIGQSGIQVG---NSCWELFCLEHQIQPDC...........................K.I..IQNQKNEDLKT.
Q23WP5_TETTS/3-226-QIITICLGQCGIRIG---NQVWKLFCEEHKIELSGI.........................KK.Q..SENTLEQENLL.
Q72N68_LEPIC/14-186-VIKVFGVGGGGMNAV---TRMSN........................................................
Q7YZQ1_PARTE/3-225-EVISIHVGQGGIQLG---DSCWEQLCLEHGIQPNGL.........................MQ.R..EISNQEDSEFY.
Q9NI44_9TRYP/4-260-EVVTVQVGQCGNQLG---LKWWDVLLQEHKA......................................NPQFTDARD.
A0LNZ3_SYNFM/27-199-KISVLGIGGGGGNAI---NNMIN........................................................
A0RW55_CENSY/7-167-PVLLVGAGGAGSRLA---SRA..........................................................
FTSZ_AQUAE/9-181-KIKVIGVGGGGSNAV---NRMYE........................................................
Q9HKT7_THEAC/53-224-RIKVFGFGGSGSNTI---NRLMR........................................................
TBBP_DROME/3-223-EIVTLQIGGAGNAIG---DSFWHVISHEHGVDYASG.........................RF.G..GTSPLQLERIN.
Q8EUT3_MYCPE/17-194-NVKIIGIGGAGNNIV---KYMVN........................................................
Q3SD83_PARTE/3-220-EIIQLSFGDIANNIG---HQYLEKLIDDHCLDD..................................KNNSTKDQYRQK
Q4X7A3_PLACH/4-239-EIIFLHVGQCGNQLG---HEFWSVAIKEHLNNKKINE.......................KKD.V.LGKYCYMNDSES.
Q7VI30_HELHP/38-211-VIAVIGVGGGGSNMV---NHLAN........................................................
A1A2I4_BIFAA/16-188-NIKVVGVGGAGGNAV---NRMIA........................................................
FTSZ2_PYRKO/37-216-RIVIVGVGGSGNNTI---TRLYD........................................................
Q3SEG7_PARTE/3-216-ELIQLNAGWNSNEIS---LKYLEKLIQDHHL......................................SQQQMNNREN
Q5UXI7_HALMA/2-181-KVVLIGVGQAGGKVT---QSLA.........................................................
Q26BB8_FLABB/20-192-VIKVIGVGGGGSNAI---KHMFQ........................................................
Q481F5_COLP3/12-185-LITVVGIGGCGCNTV---NMLHE........................................................
Q7P689_FUSNV/23-195-KIKVIGVGGGGGNAI---NDMLY........................................................
A0B5R2_METTP/3-192-NVLMLGVGQCGNRIL---DAVNR.................................................QAFGGSR
Q7Z1L8_SCHPL/3-225-EIICINIGQAGIQMA---NAIWELFCQEHGITADGK.........................MR.S..GLTDGDSRAFN.
Q0W1F0_UNCMA/28-198-QIRIAGVGSAGCNVL---NYLYS........................................................
TBD_HUMAN/2-226-SIVTVQLGQCGNQIG---FEVFDALLSDSHSSQGLC.........................SM.R..ENEAYQASCKE.
FTSZ2_METJA/39-209-RIVVVGCGGAGNNTI---NRLME........................................................
Q3Z8S1_DEHE1/12-184-KIKVIGCGGAGSNAV---TRMVR........................................................
TBE_HUMAN/4-257-.SVVVQVGQCGNQIG---CCFWDLALREHAAVN...................................QKGIYDEAIS.
A0BWM1_PARTE/3-215-EILVIQLGGFGNKVG---VKFWEEMLKDSDFGNQNE.........................QG.L..QSQDPLLNSIN.
Q227Z6_TETTS/3-224-EILNIQIGQAGNQIG---TAYWEEISKEHGIQPTG..........................VH.K..GDSDLQLEKID.
Q8RT91_MYCHO/13-182-KIIVIGVGGGGNNSV---ETMIN........................................................
Q74M90_NANEQ/26-200-NIKVVGVGGAGCNII---EWLYK........................................................
Q3SEG5_PARTE/3-205-QLITIHIGGAGSNIG---SKLWYNLSQH............................................RQEDLS.
TBG_ENTHI/4-222-EIITLNVGQCGNQLG---SEFFKKICSEHGILPD.................................GSLSTNEFIDDR
Q4N7F3_THEPA/2-226-ELLWLNFGQCGLQIA---DTYWTNLANNFTKNFSE...........................N.G..SHTSFYTTGKD.
Q1CSP5_HELPH/29-202-KIVVIGVGGGGSNMI---KHLVE........................................................
A1ZIZ2_9BACT/17-189-IIKVIGVGGGGSNAV---NHMFD........................................................
A0RNH8_CAMFF/16-194-KIKVVGVGGGGGNMI---NHIVR.....EG........................................IN.......
Q64C34_9ARCH/27-198-RLAIVGVGGAGNNSM---GRLED........................................................
Q3SEH1_PARTE/3-208-SALHIHVGGAGIKMG---DMLWKLYEKEY...........................................NETTQK.
Q70ZZ6_9BRYO/140-312-SIKVFGVGGGGCNAV---DEMVR........................................................
Q76DQ5_CYAME/99-290-RMVALGVGGAGGNTI---NNLVRSLRQQNQQR.....................................SADRNSELH.
Q3SEG3_PARTE/3-219-EIIIIGIGQCGISIG---LEFIKQLNYDHCLNNHQ...........................E.L..INQDRNRQKIN.
FTSZ_BACHD/13-185-QIKVIGVGGGGSNAV---NRMIE........................................................
Q3SEG6_PARTE/3-182-EIIHIGLGNCGVRIG---CKFYEQLIQDYQIE....................................NNRTCEKPAEG
Q8LRU3_CHLRE/4-257-ELVTIQVGQCGNQVG---CRFWELALREHAAYN...................................TKGVYDEALS.
Q12VE8_METBU/3-192-NILIVGNGQCGNRIL---DAINK.................................................EAFGGKS
Q3SEH4_PARTE/3-225-EIITIQVGQGGIQVG---NACWELFCLEHQIQPNGQ.........................MI.N..QQVIEKDDALR.
Q9HHS0_HALSA/2-183-RVVAIGVGGAGGRIV---DALHE........................................................
TBG_YEAST/4-226-EIITLQAGQCGNHVG---KFLWSQLAKEHAIGTDGL........................SQL.P..DSSTERDDDTK.
Q22UN3_TETTS/2-224-SVISIATGKCGISIQ---EKAWITLLKEQGINEEG...........................F....IECQNTHQGIN.
FTSZ_PORGI/18-191-IIKVIGVGGGGGNAV---KNMYH........................................................
Q3SEH5_PARTE/3-210-SAFHIHIGGAGVMMG---DMLWKLYEKEH...........................................NETTLK.
FTSZ1_PYRFU/43-214-RIYVVGVGGAGCNTV---NRMME........................................................
Q16M50_AEDAE/10-229-EIIQLHVGQAGVQIA---SACWELYCLEHGIYPDG...........................R....FCDCTIYDDCS.
Q2SS93_MYCCT/10-181-RIKVLGVGGAGNNAI---RRMFE........................................................
Q9GRI0_PARTE/2-207-SLGFIQLGQCGNQIG---HALFDFMIQETQMSSPGA.........................QA.L..LNEIF.......
Q47AA9_DECAR/14-183-IIKVFGVGGAGGNAI---EHMIR........................................................
O86305_MYCFE/11-183-KLKVIGVGGAGNNAI---NLMLD........................................................
Q9VED6_DROME/6-227-EIIQIHIGQAGVQIA---NACWELFCLEHGILANG...........................R....LTQSPMDDSFL.
Q8T887_CIOIN/3-225-SCVTVQLGQCGTQIG---HELLDILYEDACQTSTTL.........................TT.K..TNNEYKDTSLK.
Q6LXB6_METMP/37-208-RITVVGCGGAGNNAI---NRLIA........................................................
FTSZ_THEAC/44-215-KIKVIGCGGGGSNTV---NRLYD........................................................
Q4UCK3_THEAN/4-241-EIVTLHVGQCGNNIG---NEFWNQICLEHGINKDG..........................FL.L..DKTPIGDD.KD.
O44024_RETFI/3-223-EVLTIEVGQAGIQLG---NAIWEQYCAEHAIDNGG...........................K.R..KETSSKDDSFK.
A1AQ68_PELPD/26-199-VVKVVGVGGVGVLAL---ESMIK........................................................
FTSZ1_HALSA/53-224-NITVVGCGGAGSNTV---DRMAT........................................................

PF10644

MSTO1_DANRE/6-118REVVTLQLGHYSNFIG---THWWN--------------------------------------------------------
Q54F51_DICDI/10-128QELITIQIGNFSNFIG---AHFWN--------------------------------------------------------
DML1_CANAL/2-128SEIITLSYGSICNNTV---THLYN--------------------------------------------------------
Q4SYY1_TETNG/6-118REVITLQLGHYSNFVG---AHWWN--------------------------------------------------------
E2BL93_HARSA/3-123REILTIQLGHYANFIG---THWWN--------------------------------------------------------
E3QQX3_COLGM/2-117HEIITLQLGQLSNYAA---THFWN--------------------------------------------------------
D5G5A5_TUBMM/2-118HEIITLQLGHQANYLG---THFWN--------------------------------------------------------
Q16X91_AEDAE/5-123REILTLQLGNYANYVG---THWWN--------------------------------------------------------
C4JY37_UNCRE/2-115HEIITLQLGQRSNYLA---THFWN--------------------------------------------------------
D2UYR3_NAEGR/2-136REVVTLQFGHYSNFIG---SHYWN--------------------------------------------------------
E0CVU9_VITVI/2-122REIVTIQVGGFANFIG---SHFWN--------------------------------------------------------
C1C113_9MAXI/4-113REVLTLQVGPYSNYIG---AHFWN--------------------------------------------------------
B0DQH6_LACBS/2-120KEILYIQAGQLSNYTG---THFWN--------------------------------------------------------
E2AQP9_CAMFO/4-117REILTIQLGHYSNYIG---THWWN--------------------------------------------------------
E0VQ48_PEDHC/4-114REVVTFQFGNYSNFVG---THWWN--------------------------------------------------------
O23167_ARATH/2-123REIVTIQVGEFANFVG---SHFWN--------------------------------------------------------
E9EUC5_METAR/2-116REIITLQLGNLANYTA---THFWN--------------------------------------------------------
D8RU99_SELML/2-124REIATLQIGAYANFVG---AHFWN--------------------------------------------------------
F2SWU5_TRIRC/2-116HEIITLQLGQRSNYVA---THFWN--------------------------------------------------------
B9S8K8_RICCO/2-124REIVTVQVGGFANFIG---SHFWN--------------------------------------------------------
C8VQ22_EMENI/2-115HEILTLQLGQRANYLA---THFWN--------------------------------------------------------
A9RV51_PHYPA/2-116REVVTVQLGGFANFVG---AHFWN--------------------------------------------------------
Q7QCR8_ANOGA/3-129REILTFQLGNYSNYIG---THWWN--------------------------------------------------------
F2UAU4_SALS5/7-123GEVITLQFGNYANHVG---AHFWN--------------------------------------------------------
E3WNL3_ANODA/3-126REVLTLQLGNYANYVG---THWWN--------------------------------------------------------
A6ZMS3_YEAS7/2-114HEVVTISVSQRANHLT---TQFFN--------------------------------------------------------
Q29JE8_DROPS/5-143REILSFQFGTYANYVG---AHFWN--------------------------------------------------------
Q018N1_OSTTA/3-113SSVVTASFGTHAASVA---AHFWN--------------------------------------------------------
B8P6F2_POSPM/2-128KEVIYIQAGHFANYIG---THFWN--------------------------------------------------------
Q10PA8_ORYSJ/2-123REAVTVQVGGFANYVG---SHFWN--------------------------------------------------------
B1H304_XENTR/16-131GEIVTVQLGPFSNCLG---AHWWN--------------------------------------------------------
B3MRV4_DROAN/5-145REILSLQLGTYANYVG---AHFWN--------------------------------------------------------
C7YZ58_NECH7/2-114REIISLQLGQLSNYTA---THFWN--------------------------------------------------------
F0XAM2_GROCL/2-120HEIITLQLGRQSNYVA---THFWN--------------------------------------------------------
D2A4U9_TRICA/4-109HEILTLQFGHYSNYVG---AHWWN--------------------------------------------------------
MSTO1_PONPY/6-121REVLTLQLGHFAGFVG---AHWWN--------------------------------------------------------
B0WZB0_CULQU/3-122REILTLQLGNYANYVG---THLWN--------------------------------------------------------
F0ZVF4_DICPU/5-118QEIVTIQIGNYSNFIG---SHYWN--------------------------------------------------------
MST_DROME/5-143REILTFQFGTYANYVG---THFWN--------------------------------------------------------
A7SVU0_NEMVE/7-118REVITLQFGHYANFVG---THWWN--------------------------------------------------------
C1BN10_9MAXI/2-112REILTVQCGPYSNFIG---SHFWN--------------------------------------------------------
DML1_NEUCR/2-115HEIITLQLGQQSNYLA---THFWN--------------------------------------------------------
DML1_SCHPO/2-115HEILTVTFGRKSNFCW---THFWN--------------------------------------------------------
B4NDP0_DROWI/5-139REIITFQLGTYANYVG---AHFWN--------------------------------------------------------
B8M2T5_TALSN/2-115HEIITLQLGQRSNYIA---THFWN--------------------------------------------------------
DML1_PHANO/2-117REIVTLQFGERSNYLG---THFWN--------------------------------------------------------
C5JKN9_AJEDS/2-115HEIITLQLGQRSNYLA---THFWN--------------------------------------------------------
A5DLT9_PICGU/1-104MNIITVSLSSPANHVT---AQLFN--------------------------------------------------------
D8Q938_SCHCM/2-119REIVYIQSGNLANYVG---SHFWN--------------------------------------------------------
B6K201_SCHJY/2-136HEILSFAFGGKSNFVS---THFWN--------------------------------------------------------
B4MB04_DROVI/5-140REILTFQFGTYANYVG---AHFWN--------------------------------------------------------

PF14881

DML1_ASPCL/119-303--------APALSSET---VRYWS--------------------------------------------------------
DML1_ASPNC/119-303--------APTLSAET---VRYWS--------------------------------------------------------
A6SSZ2_BOTFB/31-216--------PPKLTSES---VRYWS--------------------------------------------------------
B2AWJ1_PODAN/149-315--------PPRPTPDT---VRCFS--------------------------------------------------------
B2WK69_PYRTR/102-289--------PPQLSTSS---VRYWS--------------------------------------------------------
B6GW17_PENCW/119-303--------APRLTSES---VRYWS--------------------------------------------------------
B6QAT3_PENMQ/119-303--------TPSLTSSS---VRYWS--------------------------------------------------------
C1GUC8_PARBA/119-303--------LPQLKAES---VRYWS--------------------------------------------------------
C4JY37_UNCRE/119-303--------LPKLTSES---VRYWS--------------------------------------------------------
C5FUZ2_ARTOC/120-304--------APELTPET---VRYWS--------------------------------------------------------
C7YZ58_NECH7/118-303--------PPQLTTST---VRYWS--------------------------------------------------------
C8VQ22_EMENI/119-303--------APQLSSET---VRFWS--------------------------------------------------------
E3QQX3_COLGM/121-306--------APKLKPSD---VRYWS--------------------------------------------------------
E9E9D2_METAQ/120-305--------PPPLTTST---VRYWS--------------------------------------------------------
F0XAM2_GROCL/124-310--------AAALTPSM---VRYWS--------------------------------------------------------
F2PVM6_TRIEC/101-285--------VPELTAET---VRYWS--------------------------------------------------------
DML1_ASPOR/119-303--------APKLTTET---VRYWS--------------------------------------------------------
DML1_NEUCR/119-307--------PPPLTTDT---VRYWS--------------------------------------------------------

PF03953

TBG_EMENI/263-392-------------------------DQAKTVRKTTVLDVMR---------------------------------RLLQPK
TBA2_EMENI/265-395-------------------------..RSSHESFKVQDLTL---------------------------------QCAEPN
TBA_ENCHE/237-367-------------------------..KAAHEKLSVQEITN---------------------------------ACFEPQ
P92124_9MICR/238-368-------------------------..RASHEQLSVQEITS---------------------------------ACFDPE
TBA2_SCHPO/263-393-------------------------..KAFHESNSVQEITN---------------------------------QCFEPY
TBA1_YEAST/264-394-------------------------..KAFHESNSVSEITN---------------------------------ACFEPG
O00907_BLEJA/239-369-------------------------..KAYHEQLSVAEITN---------------------------------SAFEPA
Q9HDT1_USTMD/262-392-------------------------..KAGHEQNSVAEMTF---------------------------------SSFEKG
O01943_GECLA/256-386-------------------------..KANHEQLSVAEITS---------------------------------ACFEPA
O93945_RHYSE/266-396-------------------------..KASHEANSVQEISM---------------------------------SCFEPN
P91873_CAEEL/269-399-------------------------..RASHEQNTVSDMTH---------------------------------ACFEPG
TBAL3_HUMAN/270-400-------------------------..KAYHEQFSVSDITT---------------------------------ACFESS
O18154_CAEEL/260-388-------------------------...AHHEFLSVDEITK---------------------------------SCFEAS
TBA4_DROME/274-404-------------------------..RSAHEQHAITTLTN---------------------------------ACFESS
Q9GQC1_9MYCE/168-298-------------------------..KANHEQFTITALTN---------------------------------SVFEQN
Q9GQB7_9MYCE/169-301-------------------------..KVDHETITVDAITN---------------------------------AAFSEN
TBA_DICDI/270-402-------------------------..KAHHETITVDNITS---------------------------------AVFSEK
Q9GQB9_9EUKA/168-298-------------------------..EIHYTQNSVQELTS---------------------------------AAFDRT
TBA1_ENTHI/268-399-------------------------..KAIRQTLSVQELTS---------------------------------SLFDPN
O44024_RETFI/260-393-------------------------..DVSTAPNDVQKITD---------------------------------DCFKPS
Q9GQU7_ANTLO/246-369-------------------------..TSQYRTYSVSELTS---------------------------------QMFDSK
TBB_ENCHE/261-383-------------------------..TQKFKTYSVSELTQ---------------------------------QMFDSK
Q9N6F5_9MICR/246-368-------------------------..TRNYRTYSVSELTQ---------------------------------QMFDSR
TBB1_COLGL/264-384-------------------------...AAYQNLGVAELTQ---------------------------------QMFDPK
TBB1_GEOCN/261-383-------------------------..QQSFRSLTVPELTQ---------------------------------QLFDSK
TBB_SCHPO/261-383-------------------------..SSSFQAVSVPELTQ---------------------------------QMFDAN
Q9HGW5_9ASCO/245-367-------------------------..SYSFRQLSVPELTQ---------------------------------QMFDPK
Q9UVQ7_9FUNG/246-368-------------------------..SKQYQSLTVPELTA---------------------------------QMFDAK
Q9P8Z1_UMBRA/246-368-------------------------..SQQYRNMSVSELTA---------------------------------QMFDAR
Q9P8Z5_SMICU/246-368-------------------------..NASFRNITVPELTQ---------------------------------QLFDSR
O00817_CRYPV/263-385-------------------------..SQQYRSLSVAELTQ---------------------------------QMFDAK
Q9LD24_BIGNA/246-368-------------------------..SMGYRNLTVSELTQ---------------------------------QMFDAK
Q9ZTL8_9CRYP/246-368-------------------------..AMNYRTLSVPELTH---------------------------------QMFEPK
O01676_BOMMO/261-383-------------------------..SRQYRALTVPELTQ---------------------------------QMFDAK
Q25165_SPIBA/246-368-------------------------..SQIYRALTVPELFS---------------------------------QMFDNK
TBB1_CHOCR/263-385-------------------------..SAGYRSLSVPELAG---------------------------------QMFDRN
TBB2_PHYPO/261-383-------------------------..AMGFRALTVPELTQ---------------------------------QIFDSR
TBB_DICDI/266-388-------------------------..ASSYNRITVPELTQ---------------------------------QMFDAK
TBBN_GUITH/261-383-------------------------..SQQYRSMTVNDLTQ---------------------------------QMFDSK
TBB_PORPU/261-383-------------------------..VTAYRAKTVADLTK---------------------------------QMFDPK
Q26235_RETFI/261-383-------------------------..TAQYSNTTVAELTG---------------------------------QMFDSR
TBB3_ECHMU/261-383-------------------------..SQSYQSCTILELTR---------------------------------QMFDAK
Q9UVR1_9FUNG/246-368-------------------------..VQSYRHVTVPDLCQ---------------------------------QIYSTN
TBBP_DROME/260-382-------------------------..QQQFSKGTVSELVQ---------------------------------QIFYSN
TBB2_GEOCN/263-385-------------------------..SRAFHNLTVPELTQ---------------------------------QLFNPA
Q26236_RETFI/267-390-------------------------..EGAKVKLTIQEITD---------------------------------QMWSSR
O46334_9EUKA/267-389-------------------------..EGERIKLTVQELTD---------------------------------QMWSSR
TBE_MOUSE/294-414-------------------------..DVNIPPRRLDQMFS---------------------------------DAFSKD
Q9NI44_9TRYP/297-427-------------------------.HAAASAPRSVDTMIA---------------------------------ACLDKN
TBG_CHLRE/264-399-------------------------QVTSNIRKTTVLDVMR---------------------------------RLLQPK
O00896_PHYPO/261-387-------------------------.QRQNVHKTTVLDVMR---------------------------------RLLQPQ
Q9FRU9_TOBAC/264-395-------------------------.QANVIRKTTVLDVMR---------------------------------RLLQTK
TBG_DICDI/261-387-------------------------.QTESVRKTSVLDVMR---------------------------------RLLQPQ
O00849_TETTH/263-389-------------------------.HIKTIRKTTVLDVMR---------------------------------RLLQTK
Q9AR10_EUGGR/266-393-------------------------.IQMTVRKTSVLDVMR---------------------------------RLLSPK
TBG2_EUPOC/261-387-------------------------.KFTSVRKTTVLDVMR---------------------------------RLLQTK
TBG2_DROME/264-394-------------------------.TKTSVRKTTVLDVMR---------------------------------RLLQPK
TBG1_HUMAN/264-393-------------------------.SVASVRKTTVLDVMR---------------------------------RLLQPK
TBG_SCHPO/264-393-------------------------EEAKAIRKTTVLDVMR---------------------------------RLLLPK
Q94771_9TRYP/266-393-------------------------NIQSSVQKTSVHDVMR---------------------------------RLLMPK
TBG_PLAFO/265-391-------------------------.HISNVQKTTVLDVMK---------------------------------RLLHTK
TBG_RETFI/263-389-------------------------.AQRRIQKTSVLDVMR---------------------------------RLLQPK
TBG_ENTHI/259-383-------------------------...QISSRTSAIDVMK---------------------------------RLIQPQ
TBG_CANAX/299-418-------------------------.HNYLNEYDMLLELSN---------------------------------DRYKTN
TBG_YEAST/263-392-------------------------HDDIAHKGHSSYDVML---------------------------------DLLDPS
TBG_CAEEL/264-391-------------------------..ENFTRKTSVADVTR---------------------------------FLLKPT

PF12327

FTSZ2_HALSA/239-333--------------------------KTN...EVVKDAMNH---------------------------------PLLD..
FTSZ_HALME/257-351--------------------------KAQ...ESVKSALRS---------------------------------PLLD..
FTSZ_MYCKA/219-313--------------------------RAL...KAAEIAINS---------------------------------PLLE..
FTSZ_CORGL/219-313--------------------------RVV...SATEQAINS---------------------------------PLLE..
Q97IE9_CLOAB/222-316--------------------------RAS...DAAKQAISS---------------------------------PLLE..
O85474_9FIRM/222-316--------------------------RAE...EAVKYAISS---------------------------------PLLD..
Q9SCC9_GUITH/260-354--------------------------RAQ...DAAVAAISS---------------------------------PLLD..
O85785_SYNE7/248-342--------------------------RAR...EAAHAAISS---------------------------------PLLE..
Q9AQ37_ANAPH/225-320--------------------------RAV...AAAEAAISN---------------------------------PLLD.N
FTSZ_RICPR/225-321--------------------------RAI...KAAESAISN---------------------------------PLLD.H
FTSZ2_RHIME/224-319--------------------------RAM...LAAEAAIAN---------------------------------PLLD.E
FTSZ_RHIRD/225-320--------------------------RAM...QAAEAAIAN---------------------------------PLLD.E
FTSZ_CAUCR/225-320--------------------------RAL...MAAQNAIAN---------------------------------PLLD.E
Q9M7M6_9STRA/290-387--------------------------RAI...RAANDALNN---------------------------------PLLGGD
FTSZ_BUCAI/221-316--------------------------RAE...EASEIAISS---------------------------------PLLE.D
Q9F1M6_SHEVI/222-317--------------------------RAE...EAAEAAVAS---------------------------------PLLE.D
FTSZ_FRATH/221-316--------------------------RAR...EAAEAAISS---------------------------------PLLE.D
FTSZ_PSEAE/222-317--------------------------RAR...EATEAAIRN---------------------------------PLLE.D
Q9CPA6_PASMU/244-342--------------------------RAE...EATRIAVKS---------------------------------DLLE.R
FTSZ_HAEIN/246-344--------------------------RAE...EAARLAVRN---------------------------------DLLE.K
Q9PF76_XYLFA/226-321--------------------------RAQ...AAAEAAVQN---------------------------------PLLD.D
FTSZ2_METJA/246-343--------------------------RGDRVQNVVRETLSC---------------------------------PLLD..
FTSZ2_ARCFU/238-332--------------------------KAN...AVVRDCLSH---------------------------------PLLD..
FTSZ1_HALSA/261-355--------------------------KAA...DSVQSALRS---------------------------------PLLD..
FTSZ1_ARCFU/252-346--------------------------KAA...ESVRKALKS---------------------------------PLLD..
FTSZ_METTH/248-342--------------------------RAL...ESVYEALNS---------------------------------PLLD..

PF13809

A0ZDE4_NODSP/18-373A....ATQVTGIRTGSTYHGVDLNFKEAEKVSATMSSHEVT-MFVEGLERRSEYSSYGPYDHIGI.......WFPPQLLR
A1VSD1_POLNA/4-348E........MMAMDDPTWKTLGTSVQLSKASQLLITDANLT-SRLDNLD.........SYPGLKH.......WLGSPQEW
A3IHZ5_9CHRO/13-355D....YKISNPEAGGS.......KFKDHEKHWASVSGKQVS-DMVSNME.........QYPWIDR.......WFPRELER
A5N8S7_CLOK5/35-392G..........EKNKRYPGNGGVGLDPQSELVMLSNAEIRS-ILKDRKI.........LDDCIKE.......WLSPEL..
A6NS46_9FIRM/38-402K......................ELDELLEKYGFDSTEVLK-LPFEGAH..ESINPDTISPQMKE.......WVDPELYE
A6P0V7_9FIRM/16-360N..................DLSAVAKSRAHIYYVQTSSTQT-VGDYLDY.........DRDALEH.......WFPKNAVM
A7VAW1_9CLOT/34-390P.......EMEQTIEDSKEHIGFNALEVLSIYRPNIENILA-DGIKKNP.........VHPNLAN.......WMDADFPD
A8SSW8_9FIRM/34-390S.......EMERTIEDSKEGVGFNALEVISIYRPDIENVLE-NGIQNNK.........IHKNLAN.......WMSPEFPE
B0JIZ1_MICAN/14-373N....AFNGSGLPTGNSYHGEEIILSAAERVFINMNAQDVN-NLTYELEHQTLFES..PFSHIES.......WLDPRLKK
B1VR11_STRGG/8-403SDLQRLPQFNVDSSLRA.AYARTSRATHNLLPN.FDSSPEV-TQMLRAS.........LREEVAG.......WLPSRDGE
B2JAM4_NOSP7/13-355D....YKVSNPEVTGS.......PLKDHEKHWASVSGREVN-DIMSNME.........KYPWIES.......WFPRELER
B3DW42_METI4/6-351E........LMRLDDPSWKVLGQSVQIPPTSQLLIKSSNLA-AILDDLP.........SYPGIQP.......WIGDKNVW
B3QN46_CHLP8/22-399F.....ETEQGKAEKNDILSNKIKFKESERLVKKLDLNQYI-KSEEALD.........CYPLIRE.......WFPLSRKT
E0UHW6_CYAP2/14-356D....YKITNPEAGGS.......PFKDIEKHWARVSGKQVR-EMVSEME.........KFPWINS.......WFPNELER
B8G8G2_CHLAD/22-363P.................QNMPGEERILDREIAYIGDFNAG-KVLDHLD.........QHPHIKD.......WWPNGQVV
B8HTJ0_CYAP4/11-352N....AKVSEPQVVLK....QNIALSSREQVWAKV..EDAK-AILNKLS.........AYDYLEE.......WFPPQL.K
C3B5Y7_BACMY/8-349N......................TLSKFEHIRKFKTQTSSS-KTPREYI.........AGDPTIPE......WFPMDPTI
C7QTL6_CYAP0/18-377A....GSQSSILRTGNIHHGVDLNLRESEKVNATMTAIEVE-NFKKGLERRSSYDRQGPYDHINL.......WFPRQLSN
D3EKE8_GEOS4/35-389Q.............DKNKRYKGIGLDPINEFVLLSNAEIGG-LLQNRSI.........LEPYITD.......WLSPEL..
Q114V2_TRIEI/18-373S....ASQISGLRTGSTYHGVDLSFKEAEKVSATMSSRDVD-NFTQELEKHSTSERTGPYDHIRQ.......WFPPQLNR
Q7NLY7_GLOVI/13-354N....AKVSEPQTVLK....QDISLRPVEQVWTKV..EDAK-AILSRIG.........SYPYLAE.......WFPSQL.K
Q8DK50_THEEB/19-361D....YKVSNPLAAGS.......PLKDNEKHWASVSGKNVQ-QIIQNLD.........NYPWIAS.......WFPRELER
Q9RWX7_DEIRA/11-368A......................KPNRFNGTDDFKTLGVPA-TAWRDML.........NRPELYDASIALNTWADLETLG

PF00091

Q7NB81_MYCGA/75-255......Q................YPDLVSENLMFYQLNTDS-KHLNL.L---------ARNRSKA-------.IRYLIDS
B9LLN1_CHLSY/15-187.........................LQNDQ.VDLVVANTDL-QDLAG.R---------TTIPT..-------..RILLGP
A9CGZ3_AGRT5/15-187.........................EGISG.VDFIAANTDA-QALKK.T---------NAPRL..-------...VQLSS
FTSZ_CAUCR/16-188.........................AGLEG.VEFVVANTDA-QQLQF.A---------KTDRR..-------...IQLGV
B4SJY0_STRM5/15-187.........................SAVDG.VEFITANTDS-QAIKN.C---------GAKLQ..-------...LQLGT
B3E8P4_GEOLS/12-183.........................AGLTD.VEYIAVSTSQ-ARLRK.S---------HAAVK..-------...IRIGS
Q4A669_MYCS5/37-207.........................AGFSN.VNFIIANTDD-QALSL.N---------PCENK..-------...ISLGK
Q7Q808_ANOGA/3-224..VYFDE................SPCCNFV.PRSIFADLEP-STLNY.L---------RCSRYG.-------..SLFSPE
FTSZA_DICDI/52-223.........................KELYG.IDFVVANTDA-QALAI.S---------CSRKM..-------...VQLGK
Q0HDQ9_SHESM/15-188.........................VNLPSSVELISVNTDA-QAMAA.T---------SSHYR..-------...IQIGP
TBG_CAEEL/6-229..LLFYQ................ADDDHYV.PRAVLVDLEP-RVINGMM---------QSPNFS.-------..NLFNTD
Q4QCZ3_LEIMA/2-292..PFFAR................DGK.....ARCILVDTEP-KVVLG..---------.VQQRH.-------.PDFIRAE
FTSZ_THEMA/23-195.........................IGIHG.VEFVAVNTDL-QVLEA.S---------NADVK..-------...IQIGE
O96769_PARTE/4-227..VFFYQ................ADDEHYI.PRALLIDMEP-RVIN.YI---------QTSQFS.-------..TLFNPE
TBG_CANAX/4-262..LFFTL................SDSNTYT.PRSILIDMEP-SVIAK..---------STSAL..-------..PMFNPR
A2EAH1_TRIVA/4-237..IFFYS................SDDGRYI.PRAILIDLEP-RVIMG.I---------KNSELK.-------..DFFNAE
Q24D61_TETTS/3-222..VYFLE................TIKGSYC.ARSIQVDSDP-DFINE.I---------QQSYIQ.-------..NLFSQS
Q3SEF9_PARTE/3-228..SLFSL................SQYGRYV.PRAIFFDEDP-TTINA.I---------KNGPSR.-------..GLFNRS
Q3SEF7_PARTE/3-210..SYIYN................ENETNYF.PLTLFMDLDD-RMVNE.V---------KKNKLI.-------..N.YKTN
Q2S524_SALRD/20-193.........................KGIHGSVEFIAVNTDS-QALSE.N---------RAPQK..-------...IQAGQ
FTSZB_DICDI/62-236.........................QSLEG.VEFFVCNTDS-QDLIK.S---------NSINK..-------...IQLGP
TBGN_GUITH/4-222..VFFEE................SNESFFI.PRTIIFDLSE-RDFNY..---------IMKSNY.-------.SKMYDKN
A1SU24_PSYIN/26-198.........................KGLAG.AEFIAMNTDA-QALRS.S---------KADIR..-------...LQLGA
A4SGZ8_PROVI/19-191.........................RKIEG.VEYVVFNTDK-QALLN.S---------KAPLR..-------...VAIGR
Q24D62_TETTS/3-222..VYFDE................QNDKRYK.ARSLLIDGDP-NSIFQ.I---------QQSSFG.-------..NLFNSN
FTSZ_BUCBP/12-184.........................EHIEG.VEFFAINTDA-QALRK.I---------EVEQT..-------...IQIGS
A0EC94_PARTE/3-226..VLFSE................SQTKANV.PRAAFFDDDP-LTINS.L---------NRGPLK.-------..KVLNQN
Q22CD2_TETTS/3-223..NFFSE................TQSGQFV.PRSVYLDLDS-NSIDE.V---------KVGSQK.-------..QLFNHE
Q23WP5_TETTS/3-226..SFFQE................SVSEKIT.PISVFIDLDT-EQIDE.I---------KNGQCR.-------..TLYKPD
Q72N68_LEPIC/14-186.........................SSLKG.VEFAILNTDE-QVLLR.S---------PVENK..-------...IILGT
Q7YZQ1_PARTE/3-225..KFYSE................NSKGNFV.PRSLFIDSES-EAISK.V---------KDGKYR.-------..ELFSQN
Q9NI44_9TRYP/4-260..ALFDVSGSAPL....ASVGDKACRAGSLKARCVAVDMEE-GVLRA.M---------LRGPLG.-------..HLFDAT
A0LNZ3_SYNFM/27-199.........................AGLDG.VQFIAANTDF-QVLAR.N---------QAATK..-------...IQLGT
A0RW55_CENSY/7-167.........................GGILG.LDTLQISSDP-DDLGP..---------.....G.-------..GVLVPT
FTSZ_AQUAE/9-181.........................DGIEG.VELYAINTDV-QHLST.L---------KVPNK..-------...IQIGE
Q9HKT7_THEAC/53-224.........................ENLVG.VKLIACNTDA-AHLLR.I---------RAHAK..-------...ILLGK
TBBP_DROME/3-223..VFFNA................TASKRFY.ARTILIDTEA-STIQR.L---------NAS..S.-------..QLYRPE
Q8EUT3_MYCPE/17-194........................SREWPSFCNIIALNTDY-IALSN.L---------GENMKD.-------..IFILGS
Q3SD83_PARTE/3-220IHVSFEE................LKTQQYQ.FRGIFVNSSD-QSIHKLL---------ISPES..-------...EYINN
Q4X7A3_PLACH/4-239..SFFENVCG..........DLNSSHNENLKARAILIDTET-GVTNE.V---------FKSSIA.-------..GYFDKN
Q7VI30_HELHP/38-211........................NNPHKD.VKLIAANTDV-QALET.T---------NANLK..-------...MKLGE
A1A2I4_BIFAA/16-188.........................EGLQS.VEFIAINTDA-KDLLR.S---------DADVK..-------...ISLND
FTSZ2_PYRKO/37-216.........................LGVQG.AELIAMNTDA-QALKH.A---------KAHKK..-------...LLLGK
Q3SEG7_PARTE/3-216KDQFFERIS...........TCFEEHEKYRSFRGVFLD.EQ-QSMDQIL---------TMQDQ..-------...GFIDP
Q5UXI7_HALMA/2-181..QFDYD..................MGFDAVRGALAVNTAR-ADLQN.L---------DIDT...-------...ALIGQ
Q26BB8_FLABB/20-192.........................QGIKG.VDFVICNTDS-QALDN.S---------PVPNK..-------...IQLGV
Q481F5_COLP3/12-185.........................NNLSSQVNLVAVNTDL-AALNS.I---------NVENK..-------...ILIGE
Q7P689_FUSNV/23-195.........................SGVTG.VEYIAANTDK-QDLEK.S---------LADVK..-------...LQIGE
A0B5R2_METTP/3-192LAKYYSK..................QRFPSRVETIAINTAI-NDLKE.L---------KFTAAK.-------.DRLHVPN
Q7Z1L8_SCHPL/3-225..TFFFQ................SPSDQYV.PRVLSIDLEP-TVVDE.I---------RTGTYR.-------..QLFHPD
Q0W1F0_UNCMA/28-198.........................IGAFG.AHLIAIDTDE-RRLSV.I---------RADEK..-------...FLIGQ
TBD_HUMAN/2-226..RFFSE................EENGVPI.ARAVLVDMEP-KVINQ.M---------LSKAAQS-------GQWKYGQH
FTSZ2_METJA/39-209.........................IGIQG.AETIAINTDK-QHLEV.I---------QADKK..-------...ILIGA
Q3Z8S1_DEHE1/12-184.........................DNIQG.VEFIAVNTDA-QHLAI.T---------EAATR..-------...IQIGE
TBE_HUMAN/4-257..SFFRNVDTRVV...GDGGSISKGKICSLKARAVLIDMEE-GVVNE.I---------LQGPLR.-------..DVFDTK
A0BWM1_PARTE/3-215..NVYFN................LNQNKPL.PRCVQVDLGQ-DLPCTNI---------D......-------....FNPC
Q227Z6_TETTS/3-224..VYYNQ................TKADKYV.PRAILIDLDP-ALLNS.I---------NTSQIG.-------..QLFKPE
Q8RT91_MYCHO/13-182.........................SHLDS.FQIIAANTDK-QVLAK.F---------PQECV..-------...LHLGD
Q74M90_NANEQ/26-200.........................KKIEN.VDLIAMNTDA-VHLKS.M---------KVDPERV-------.KRILLGP
Q3SEG5_PARTE/3-205..SIFQE................NSHQSYK.PRSIFVNTID-DQVPK.Y---------DEPQ...-------....FSPN
TBG_ENTHI/4-222KDVFFYQ................ADDQRYV.PRSINIDLEP-RVLDS.I---------RTSEWR.-------..NFYNPE
Q4N7F3_THEPA/2-226..VGIDV...............KKPKLSSLKPRCLVIDTET-ITSDE..---------ILINSK.-------.HSLLTKD
Q1CSP5_HELPH/29-202.........................YGVHQDVTPIATNTDG-QHLKN.N---------PAPVK..-------...ILLGK
A1ZIZ2_9BACT/17-189.........................RGIKD.VEFFVCNTDI-QALSL.S---------SVPAK..-------...LQIGT
A0RNH8_CAMFF/16-194.......................NQDGMRS.VDLIAANTDA-QALED.S---------SATTR..-------...IQLGE
Q64C34_9ARCH/27-198........................LGGLGG.VDRIAINTDK-LHLDS.I---------ECQRK..-------...ILIGK
Q3SEH1_PARTE/3-208..NYIYD................EFEGNHY.PQAFFVDTDD-RMIHE.V---------QRNQSV.-------..K.FKKH
Q70ZZ6_9BRYO/140-312.........................SELLN.VEFWAVNTDK-QALNK.S---------LAPNK..-------...IQIGQ
Q76DQ5_CYAME/99-290........................LDPFQG.LRLLAANTDA-QALSF.S---------LADRT..-------...FCLGE
Q3SEG3_PARTE/3-219..VFFNE................NSRQQFL.PRCLFLDLEP-KSIDK.L---------FIQKD..-------..VIIDPN
FTSZ_BACHD/13-185.........................NGLQG.VDFISVNTDA-QALHL.S---------KAEVK..-------...LQLGG
Q3SEG6_PARTE/3-182IEVHFSE................IGDKKFV.PRSILCSRDV-EQILA.N---------PQSL...-------...IFNPN
Q8LRU3_CHLRE/4-257..SFFRNVDTRVEPPRNLPVGEGRGAIRTLKARSVIVDMEC-GVINE.M---------LKGPLG.-------..EVLDTR
Q12VE8_METBU/3-192KFAKFYS.................QQKYKSKVETIAINTAI-NDLKE.L---------SFTK.AK-------.DRMHIPH
Q3SEH4_PARTE/3-225..TFFSE................SDHQKLV.PRSVLLDLEP-TLINQ.V---------KTGKFK.-------..EMFKPE
Q9HHS0_HALSA/2-183.......D.............DSTREASYL.AGGSVLETDR-GALAA.L---------DA.....-------...VSEED
TBG_YEAST/4-226..PFFRE................NSRNKFT.PRAIMMDSEP-SVIAD..---------VENTFR.-------..GFFDPR
Q22UN3_TETTS/2-224..VYFEE................VKQDVYK.PRSIIADLDD-QEINR..---------VQNGFL.-------.KRLFQSN
FTSZ_PORGI/18-191.........................GKVRD.VSFLLCNTDV-QALDR.S---------EVPDR..-------...LVLGR
Q3SEH5_PARTE/3-210..NYVYQ................QVDGHSH.PLTLFADLDD-RMISE.V---------QRNKQI.-------..Q.FKKN
FTSZ1_PYRFU/43-214.........................VGVTG.AKIIAVNTDA-QDLLK.V---------KAHQK..-------...ILIGK
Q16M50_AEDAE/10-229..AFFSC................DKKGRCV.PRVVMADLEP-SVIDE.I---------RIGAYR.-------..HLFHPS
Q2SS93_MYCCT/10-181.........................ENVQG.VEFYIINTDA-QILES.S---------PVPNK..-------...IILGE
Q9GRI0_PARTE/2-207...FFER................KNKQI...AKSLLIDMEP-KVVER.Q---------NIHSAF.-------..S.....
Q47AA9_DECAR/14-183.........................EGVSG.VEFIAANTDA-QALGR.N---------AAASK..-------...LSLGK
O86305_MYCFE/11-183.........................ENLPNVGKLLVANSDR-QDLVK.S---------LCPNK..-------...ILLGD
Q9VED6_DROME/6-227..TFFEF................TSHQPCVQPRLVMIDTEP-TVIDE.I---------RTGSYR.-------..NLFHPD
Q8T887_CIOIN/3-225..TFFHE................TGSGYE..ARSVMVDMEP-KAVNC.A---------LSGTSGK-------.GWSYAKR
Q6LXB6_METMP/37-208.........................ESIDG.ARIVAINTDA-QQLVK.T---------HADHK..-------...VLIGK
FTSZ_THEAC/44-215.........................DALKN.ADLIAINTDA-SHLRS.I---------KVKHK..-------...LLIGQ
Q4UCK3_THEAN/4-241..VFFFQ................TGTNRYY.PRALLIDLEP-RVISS.I---------LNSENK.-------..NLFNPE
O44024_RETFI/3-223..VFFEE................TGSGQFV.PRNLAVDLEP-NVIDD.V---------KNGPFA.-------..AMFHPE
A1AQ68_PELPD/26-199.........................AKIRG.VDFIAVDTEA-QALET.S---------SAPIK..-------...IRLGV
FTSZ1_HALSA/53-224.........................EGIHG.ADLVAANTDV-QHLVD.I---------EADTK..-------...ILMGQ

PF10644

MSTO1_DANRE/6-118-------------------------LQDAGL..VYDADVPA-......G-------------------------EL.QSD
Q54F51_DICDI/10-128-------------------------IQEENY..QYSKREQS-Q.....Y-------------------------EI.EPE
DML1_CANAL/2-128-------------------------TQESLI..SYTPSSKP-.......-------------------------...NHD
Q4SYY1_TETNG/6-118-------------------------LQDASL..SYDPDVLP-......G-------------------------DT.QSD
E2BL93_HARSA/3-123-------------------------LQTSNF..TYNPKDL.-......A-------------------------EI.DHG
E3QQX3_COLGM/2-117-------------------------TQESYF..TYSDQDE.-......S-------------------------PV.NHN
D5G5A5_TUBMM/2-118-------------------------TQESYF..TYAEDASP-......S-------------------------PV.DHN
Q16X91_AEDAE/5-123-------------------------IQEASF..NYDPNADP-......S-------------------------EV.DHD
C4JY37_UNCRE/2-115-------------------------VQESYF..TYSENEV.-......S-------------------------PI.DHD
D2UYR3_NAEGR/2-136-------------------------TQKNVLEGYKPLMNNY-HIPNFRP-------------------------EV.ETS
E0CVU9_VITVI/2-122-------------------------FQDELLGLAGDPNGDP-IFKN..Q-------------------------HL.DMD
C1C113_9MAXI/4-113-------------------------IQDKDL..VYEPRPVL-......P-------------------------PS.NPC
B0DQH6_LACBS/2-120-------------------------TQESYF..TYGDGEE.-......P-------------------------LT.NND
E2AQP9_CAMFO/4-117-------------------------LQESNF..TYDPKHP.-......S-------------------------EI.NHD
E0VQ48_PEDHC/4-114-------------------------IQESYF..QYDERNP.-......S-------------------------DI.NHD
O23167_ARATH/2-123-------------------------FQDELLGLASDPESDP-IFRN..H-------------------------NL.DMD
E9EUC5_METAR/2-116-------------------------AQESYF..TYAGQEE.-......S-------------------------LV.DHN
D8RU99_SELML/2-124-------------------------FQDELLGLAADHEADP-VFQR..S-------------------------GL.DMD
F2SWU5_TRIRC/2-116-------------------------AQESYF..TYSENEQ.-......S-------------------------PV.NHD
B9S8K8_RICCO/2-124-------------------------FQDELLGLATDPDSDP-VFKHCAD-------------------------YL.NMD
C8VQ22_EMENI/2-115-------------------------LQESYF..TYNGQEE.-......S-------------------------PV.DHD
A9RV51_PHYPA/2-116-------------------------FQDEVLGSLEDGGQ..-......I-------------------------GL.DMD
Q7QCR8_ANOGA/3-129-------------------------IQESSF..NYDPNAEP-......S-------------------------KI.DHS
F2UAU4_SALS5/7-123-------------------------LQDAMI..DYTGQEPE-SE....D-------------------------PI.SHD
E3WNL3_ANODA/3-126-------------------------IQESSF..NYDPTAEP-......S-------------------------DI.EHT
A6ZMS3_YEAS7/2-114-------------------------IQEGYL..QLSKEQQV-.......-------------------------...NDS
Q29JE8_DROPS/5-143-------------------------QQEANF..VYDGSSS.-..QVAEE-------------------------QLPQND
Q018N1_OSTTA/3-113-------------------------VRED....DSDENDEV-D.....W-------------------------NV.DHA
B8P6F2_POSPM/2-128-------------------------TQESYF..TYEEGEE.-......S-------------------------EV.DHD
Q10PA8_ORYSJ/2-123-------------------------FQDELLGLADDPDADP-VFKN..D-------------------------AL.DMD
B1H304_XENTR/16-131-------------------------LQDAEISRQSHKRQQE-......S-------------------------EI.CSD
B3MRV4_DROAN/5-145-------------------------QQEANF..CYGDGDGD-D.QVAEE-------------------------HLLHND
C7YZ58_NECH7/2-114-------------------------AQESYF..TYSADET.-......S-------------------------PI.DHN
F0XAM2_GROCL/2-120-------------------------AQESYF..TYGKDEP.-......S-------------------------PV.DHD
D2A4U9_TRICA/4-109-------------------------VQEAGF..RYDSP...-......S-------------------------EI.NHD
MSTO1_PONPY/6-121-------------------------QQDAALGQATDSKEPL-......G-------------------------EL.CPD
B0WZB0_CULQU/3-122-------------------------LQESSF..CYDPNAEA-......G-------------------------EV.DHD
F0ZVF4_DICPU/5-118-------------------------IQEENY..QYCKREQI-P.....F-------------------------EI.QPS
MST_DROME/5-143-------------------------QQEANF..RYGDESE.-..QVAEE-------------------------QLPNND
A7SVU0_NEMVE/7-118-------------------------IQESSF..CYDAASPK-......S-------------------------EI.NHD
C1BN10_9MAXI/2-112-------------------------IQDKDL..VYQPRPVL-......P-------------------------PT.NPN
DML1_NEUCR/2-115-------------------------AQESYF..TYSEDQE.-......P-------------------------AV.NHD
DML1_SCHPO/2-115-------------------------TQESYF..VYDPNDH.-......A-------------------------KV.NVN
B4NDP0_DROWI/5-139-------------------------QQEANF..VYTGQNES-KLEAIED-------------------------QLPNND
B8M2T5_TALSN/2-115-------------------------LQESYF..TYGENEE.-......P-------------------------LV.DHD
DML1_PHANO/2-117-------------------------TQESYF..TYPPEAE.-......S-------------------------PV.NHD
C5JKN9_AJEDS/2-115-------------------------FQESYF..TYSADEE.-......S-------------------------PV.DHD
A5DLT9_PICGU/1-104-------------------------AQESHL..PYTKSAPR-.......-------------------------...FHD
D8Q938_SCHCM/2-119-------------------------TQECYL..T..DEDE.-......T-------------------------PY.DRR
B6K201_SCHJY/2-136-------------------------AQEKYL....DQGND.-......A-------------------------QI.DRE
B4MB04_DROVI/5-140-------------------------QQEANF..VYDQENGG-..NVAEE-------------------------QLPHND

PF14881

DML1_ASPCL/119-303-----------------------DYNRVFYHPRSIIQLNDY.EL..NSK---------..IM...P...F...EDWDVGE
DML1_ASPNC/119-303-----------------------DYNRLFYHPRSIVQLNDY.EL..NSK---------..IM...P...F...EDWTIGE
A6SSZ2_BOTFB/31-216-----------------------DFNRVYYHPRSIAQLNEY.EL..NSS---------..LM...P...F...ENWDAGE
B2AWJ1_PODAN/149-315-----------------------DFSRLYYHPRSVVQLNEF.EV..AST---------IQPF..EQ...F...S...TGE
B2WK69_PYRTR/102-289-----------------------DYSRVYYHPKSIVQLSEF.DV..NDK---------..LMPFES...W...D...VGM
B6GW17_PENCW/119-303-----------------------DYNRVYYHPRSIVQLNEY.DL..NSQ---------..TM...P...F...EDWNVGE
B6QAT3_PENMQ/119-303-----------------------DFNRVYYHPRSIVQLNEY.EL..NSS---------..LM...P...F...EDWTVGE
C1GUC8_PARBA/119-303-----------------------DFNKVFYHPRSIVQLNEY.EL..NSQ---------..LM...P...F...EDWGIGE
C4JY37_UNCRE/119-303-----------------------DFNRLFYHPKSIVQLNEY.DL..NSQ---------..LL...P...F...EDWSVGE
C5FUZ2_ARTOC/120-304-----------------------DFNRVFYNPRSIQQINEY.DL..GSQ---------..LV...P...F...EDWSRGQ
C7YZ58_NECH7/118-303-----------------------DFSRVFFHPRSLVQLYDF.EL..NST---------..TM...PFERF...S...MGT
C8VQ22_EMENI/119-303-----------------------DYNRVFYHPRSIVQLNDY.EL..NSA---------..IM...P...F...EDWNLGE
E3QQX3_COLGM/121-306-----------------------DFCRVFYHPKSLNQLYDY.EL..NSS---------..IR...P...FDKWA...LGR
E9E9D2_METAQ/120-305-----------------------DFSRAYFHPKSLVQLYDF.EL..DSA---------IRPF..EK...F...D...MGT
F0XAM2_GROCL/124-310-----------------------DFGRVYYHPRSLVEVGDEPEAADAEP---------..DL...S...W...A...AGD
F2PVM6_TRIEC/101-285-----------------------DFNRVFYSPRSIQQINEY.DL..GSQ---------..LM...P...F...EDWSTGQ
DML1_ASPOR/119-303-----------------------DYNRLFYHPRSIVQLNDY.EL..NSM---------..IM...P...F...EDWSVGE
DML1_NEUCR/119-307-----------------------DFNRVFYHPRSVVQLNEY.EL..NSS---------..IM...P...F...ERYATGE

PF03953

TBG_EMENI/263-392-----------NRMV..-----.SINPSK......---------------------------------------------
TBA2_EMENI/265-395-----------NQMV..-----.VCDPRN......---------------------------------------------
TBA_ENCHE/237-367-----------SQMV..-----.RCDTRK......---------------------------------------------
P92124_9MICR/238-368-----------NQMV..-----.KCDPRN......---------------------------------------------
TBA2_SCHPO/263-393-----------NQMV..-----.KCDPRA......---------------------------------------------
TBA1_YEAST/264-394-----------NQMV..-----.KCDPRD......---------------------------------------------
O00907_BLEJA/239-369-----------SMMA..-----.KCDPRH......---------------------------------------------
Q9HDT1_USTMD/262-392-----------NQMV..-----.KADPRD......---------------------------------------------
O01943_GECLA/256-386-----------NQMV..-----.KCDPRH......---------------------------------------------
O93945_RHYSE/266-396-----------NQMV..-----.KCDPRN......---------------------------------------------
P91873_CAEEL/269-399-----------YQMV..-----.KCDPRR......---------------------------------------------
TBAL3_HUMAN/270-400-----------NQLV..-----.KCDPRL......---------------------------------------------
O18154_CAEEL/260-388-----------NQMV..-----.KCDPKH......---------------------------------------------
TBA4_DROME/274-404-----------NMMV..-----.KCDPRA......---------------------------------------------
Q9GQC1_9MYCE/168-298-----------NMMA..-----.KCEPKQ......---------------------------------------------
Q9GQB7_9MYCE/169-301-----------NIMA..-----.KCDPTL......---------------------------------------------
TBA_DICDI/270-402-----------NIMA..-----.KCQPNL......---------------------------------------------
Q9GQB9_9EUKA/168-298-----------NMMA..-----.RCDPST......---------------------------------------------
TBA1_ENTHI/268-399-----------SLMI..-----.QCDDIN......---------------------------------------------
O44024_RETFI/260-393-----------NWFVKF-----TEFDPAE......---------------------------------------------
Q9GQU7_ANTLO/246-369-----------NMMA..-----.ASDPRH......---------------------------------------------
TBB_ENCHE/261-383-----------NMMT..-----.ACDPRK......---------------------------------------------
Q9N6F5_9MICR/246-368-----------NMMV..-----.ASDPKH......---------------------------------------------
TBB1_COLGL/264-384-----------NVMS..-----.ASDFRN......---------------------------------------------
TBB1_GEOCN/261-383-----------NMMA..-----.ASDPKR......---------------------------------------------
TBB_SCHPO/261-383-----------NMMV..-----.AADPRH......---------------------------------------------
Q9HGW5_9ASCO/245-367-----------NMMA..-----.AADPRH......---------------------------------------------
Q9UVQ7_9FUNG/246-368-----------NMMA..-----.ASDPRH......---------------------------------------------
Q9P8Z1_UMBRA/246-368-----------NMMA..-----.ASDPRH......---------------------------------------------
Q9P8Z5_SMICU/246-368-----------NMMA..-----.ASDPRH......---------------------------------------------
O00817_CRYPV/263-385-----------NMMC..-----.ASDPRH......---------------------------------------------
Q9LD24_BIGNA/246-368-----------NMMC..-----.ASDQRH......---------------------------------------------
Q9ZTL8_9CRYP/246-368-----------NMMC..-----.SANPSH......---------------------------------------------
O01676_BOMMO/261-383-----------NMMA..-----.ACDPRH......---------------------------------------------
Q25165_SPIBA/246-368-----------NMMA..-----.ASDPRH......---------------------------------------------
TBB1_CHOCR/263-385-----------NMMA..-----.EIDPRE......---------------------------------------------
TBB2_PHYPO/261-383-----------NMMA..-----.ASDPRH......---------------------------------------------
TBB_DICDI/266-388-----------NMMA..-----.ASDPHN......---------------------------------------------
TBBN_GUITH/261-383-----------NMMA..-----.ACDPKN......---------------------------------------------
TBB_PORPU/261-383-----------NMMA..-----.DCDPRN......---------------------------------------------
Q26235_RETFI/261-383-----------NMMC..-----.ACDPKH......---------------------------------------------
TBB3_ECHMU/261-383-----------NMMA..-----.ACDPSH......---------------------------------------------
Q9UVR1_9FUNG/246-368-----------NMMV..-----.DVDPRH......---------------------------------------------
TBBP_DROME/260-382-----------NLLC..-----.AIDLRK......---------------------------------------------
TBB2_GEOCN/263-385-----------NVMA..-----.ACNPYH......---------------------------------------------
Q26236_RETFI/267-390-----------NFMA..-----.NVVPGD......---------------------------------------------
O46334_9EUKA/267-389-----------NFLC..-----.NVKPED......---------------------------------------------
TBE_MOUSE/294-414-----------HQLI..-----.QADPRH......---------------------------------------------
Q9NI44_9TRYP/297-427-----------HQFV..-----.DVSNGLSSALTH---------------------------------------------
TBG_CHLRE/264-399-----------NIMV..-----.STHTKSRD...I---------------------------------------------
O00896_PHYPO/261-387-----------NIMV..-----.STSMR.......---------------------------------------------
Q9FRU9_TOBAC/264-395-----------NIMV..-----.SSYARTKE...A---------------------------------------------
TBG_DICDI/261-387-----------NIMV..-----.SAPTK.......---------------------------------------------
O00849_TETTH/263-389-----------NIMV..-----.SASTK.......---------------------------------------------
Q9AR10_EUGGR/266-393-----------NIMV..-----.SASTRR......---------------------------------------------
TBG2_EUPOC/261-387-----------NIMV..-----.TGAVK.......---------------------------------------------
TBG2_DROME/264-394-----------NMMV..-----.SALTDKQ.....---------------------------------------------
TBG1_HUMAN/264-393-----------NVMV..-----.STGRDRQ.....---------------------------------------------
TBG_SCHPO/264-393-----------NQMV..-----.SVNPSK......---------------------------------------------
Q94771_9TRYP/266-393-----------NMMV..-----.STSMK.......---------------------------------------------
TBG_PLAFO/265-391-----------NIMV..-----.SAPVR.......---------------------------------------------
TBG_RETFI/263-389-----------NIMV..-----.SCGTK.......---------------------------------------------
TBG_ENTHI/259-383-----------NIMA..-----.RTRLKE......---------------------------------------------
TBG_CANAX/299-418-----------RVG...-----..GDTS.......---------------------------------------------
TBG_YEAST/263-392-----------NSLV..-----.STAMNN......---------------------------------------------
TBG_CAEEL/264-391-----------SMMVS.-----TASRVRP......---------------------------------------------

PF12327

FTSZ2_HALSA/239-333-----------VDYR--------GAS------------------------------------------------------
FTSZ_HALME/257-351-----------VDIS--------GAN------------------------------------------------------
FTSZ_MYCKA/219-313-----------ASME--------GAQ------------------------------------------------------
FTSZ_CORGL/219-313-----------ATMD--------GAT------------------------------------------------------
Q97IE9_CLOAB/222-316-----------TSIV--------GAT------------------------------------------------------
O85474_9FIRM/222-316-----------TSID--------GAR------------------------------------------------------
Q9SCC9_GUITH/260-354-----------FPIE--------KAR------------------------------------------------------
O85785_SYNE7/248-342-----------SSIE--------GAR------------------------------------------------------
Q9AQ37_ANAPH/225-320-----------ISMK--------GAR------------------------------------------------------
FTSZ_RICPR/225-321-----------SSMC--------GAR------------------------------------------------------
FTSZ2_RHIME/224-319-----------VSMR--------GAK------------------------------------------------------
FTSZ_RHIRD/225-320-----------TSMK--------GAQ------------------------------------------------------
FTSZ_CAUCR/225-320-----------VSLK--------GAK------------------------------------------------------
Q9M7M6_9STRA/290-387-----------FSVR--------SAK------------------------------------------------------
FTSZ_BUCAI/221-316-----------IDLS--------GAR------------------------------------------------------
Q9F1M6_SHEVI/222-317-----------IDLA--------GAR------------------------------------------------------
FTSZ_FRATH/221-316-----------INLD--------GAK------------------------------------------------------
FTSZ_PSEAE/222-317-----------VNLQ--------GAR------------------------------------------------------
Q9CPA6_PASMU/244-342-----------VDLS--------GAK------------------------------------------------------
FTSZ_HAEIN/246-344-----------IDLS--------NAQ------------------------------------------------------
Q9PF76_XYLFA/226-321-----------VNLA--------GAN------------------------------------------------------
FTSZ2_METJA/246-343-----------VDYR--------GAK------------------------------------------------------
FTSZ2_ARCFU/238-332-----------VDYR--------GAT------------------------------------------------------
FTSZ1_HALSA/261-355-----------VDIS--------SAN------------------------------------------------------
FTSZ1_ARCFU/252-346-----------VDVS--------GAK------------------------------------------------------
FTSZ_METTH/248-342-----------LDIS--------NAR------------------------------------------------------

PF13809

A0ZDE4_NODSP/18-373...........NIKAIE-EG--AKGIRP-VGRLAF-----------------------......FHNYQRIKTVI-ETAE
A1VSD1_POLNA/4-348.......RDILNSIVGA-TL--GGQKRR-LGRFLF-----------------------......ACKADKYREQV-QTQV
A3IHZ5_9CHRO/13-355...........NITSLE-AG--AGQIRA-CGRFAL-----------------------......FCNYHDIRDKF-LGAV
A5N8S7_CLOK5/35-392...........SSESGT-DG--AGGVRQ-VGRLLL-----------------------......FTKINEIVDCI-EKKI
A6NS46_9FIRM/38-402VTGGKAITMSSQSGFDS-SG--TAAWRQ-PGRVRL-----------------------SQPNTIAVLTTALTNAI-NSLL
A6P0V7_9FIRM/16-360...........YDKTVS-EG--AGQVRA-ISRLAL-----------------------.NATIKTGRIRPLYDAI-DDLF
A7VAW1_9CLOT/34-390............VTVTK-DG--AHGNRQ-IGRLMF-----------------------......SNAYEDIRMLL-FDRL
A8SSW8_9FIRM/34-390............IIIGR-DG--AKGNRQ-IGRLMF-----------------------......SNAYTDIRMLL-FDKL
B0JIZ1_MICAN/14-373...........QITSIE-NG--AGGIRP-VGRLAF-----------------------......FHNYQKIQEAI-EAAE
B1VR11_STRGG/8-403..........PRVTPLH-NG--AGQLPT-VGRAAL-----------------------..FATLRHSLQPVLEPL-LQAI
B2JAM4_NOSP7/13-355...........NIGALE-AG--AGQIRA-CGRFAF-----------------------......FYNYHKIRQRF-FEAC
B3DW42_METI4/6-351.......KDILNSIVGD-AK--GGQKRR-LGRFLF-----------------------......ASHADEFCSKL-THLV
B3QN46_CHLP8/22-399........INELNIDPE-KG--AGQIRA-LSRLFF-----------------------......FDKYQEIKGAI-RTKC
E0UHW6_CYAP2/14-356...........NITSLE-AG--AGQIRA-CGRFAF-----------------------......FCNYHEIATKF-LDAL
B8G8G2_CHLAD/22-363............TGSIF-RG--ARQRRL-VGRLSL-----------------------......YARWGQFAHRL-DTKL
B8HTJ0_CYAP4/11-352...........GTDSIL-AG--AGQIRA-LGKLAF-----------------------......TLNFQNIKTAF-NNAK
C3B5Y7_BACMY/8-349...........LDKPLT-EG--AGQLRV-ISRLAL-----------------------.RAAMKEDKLTAFWQEI-EKIF
C7QTL6_CYAP0/18-377...........NIKAIE-DG--AKAIRP-VGRLAF-----------------------......FHNYRKIKTSI-DAAE
D3EKE8_GEOS4/35-389...........SITDGM-NG--AAGVRQ-AGRLLL-----------------------......FTKITQVVQAI-DKKI
Q114V2_TRIEI/18-373...........NIKAIE-EG--AKGIRP-VGRLAF-----------------------......FHNYRKIQKAI-EIAE
Q7NLY7_GLOVI/13-354...........GTDSIL-AG--AGQIRA-LGRFAF-----------------------......AVNYQQVKGAF-AAAR
Q8DK50_THEEB/19-361...........NMTSLE-AG--AGQIRA-CGRFAF-----------------------......FCNYHGIQQKF-QAAS
Q9RWX7_DEIRA/11-368.........QLPAQSID-SG--AGHIRM-VGRLAL-----------------------LYPPNYNEIKNAISQRV-ARLR

PF00091

Q7NB81_MYCGA/75-255-----------PYTDGH..G..AGGDVQ.KARL................................AISQYFDKEV.DEIL
B9LLN1_CHLSY/15-187-----------QQTAGK..G..AGGRPD.VGAA.................................ATVESEPML.AKAL
A9CGZ3_AGRT5/15-187-----------ELTGGL..G..AGADPE.VGRQ.................................AAIDSLDEI.MDHL
FTSZ_CAUCR/16-188-----------QITQGL..G..AGAHPE.VGMS.................................AAEESFPEI.GEHL
B4SJY0_STRM5/15-187-----------NVTKGL..G..AGANPE.VGRQ.................................AALEDRERI.MDAL
B3E8P4_GEOLS/12-183-----------D.TRGF..G..TGGNPE.TARA.................................AVEVSQQDI.LNSL
Q4A669_MYCS5/37-207-----------D.TRGL..G..AGSDPE.IGEK.................................SARESVDEI.EEAL
Q7Q808_ANOGA/3-224-----------SFISGK.TS..AGNNWA.RGYHTE............................GAELLDQIEDCT.RRMV
FTSZA_DICDI/52-223-----------TLTRGL..G..AGAVPE.VGKK.................................ATEESIEEL.MNQI
Q0HDQ9_SHESM/15-188-----------QTTKGL..G..AGAKPD.VGCA.................................AAIESAQAL.TEQM
TBG_CAEEL/6-229-----------NIFMSD.HGGGAGNNWA.SGYCQG.............................QEVQEKIMDII.IREA
Q4QCZ3_LEIMA/2-292-----------NVIYGQ.SG..RGNNWG.LGYYGVKTEQSKRTERNAAVQRAFRNIARDQRDEDDNVLAKALQAI.HRET
FTSZ_THEMA/23-195-----------NITRGL..G..AGGRPE.IGEQ.................................AALESEEKI.REVL
O96769_PARTE/4-227-----------NIFISK.DGGGAGNNWA.CGYSQG.............................ERYQEELMEMI.DREA
TBG_CANAX/4-262-----------NVHLSN.QGNGAANNWI.NGYKYG.............................TEEEETLLNLI.DREV
A2EAH1_TRIVA/4-237-----------NMYIGV.EGSGAGNVWG.TGYAEG.............................EAHYEAFSEIV.RREV
Q24D61_TETTS/3-222-----------SFIYGN.SS..SNNNFS.QGYSQ..............................LELLDQVQEEI.RLQA
Q3SEF9_PARTE/3-228-----------YIHQCQ.KE..SGGCWA.RSFGTI...........................MNQEGEEKIADKI.RKQV
Q3SEF7_PARTE/3-210-----------SFVTGK.ED..AANNYC.RAHYTI............................GKEIVDKCLDNI.RKQV
Q2S524_SALRD/20-193-----------DLTSGL..G..AGARPS.VGAE.................................AIEESSEEI.RQAL
FTSZB_DICDI/62-236-----------QLTKGH..G..AGANPE.KGRL.................................AAEESKNKI.IQTF
TBGN_GUITH/4-222-----------RHFILN.KN..TGNSWL.KGYYEG.............................ISNCNLVDNIL.RKRI
A1SU24_PSYIN/26-198-----------SITNGL..G..AGANPE.IGYK.................................SALEDKDRI.REVL
A4SGZ8_PROVI/19-191-----------KATGGL..G..AGADPT.KGRQ.................................AADDDRELI.AEQL
Q24D62_TETTS/3-222-----------CFIQDQ.WS..AANCFG.KGRQF..............................YELIDLVMDQI.RILV
FTSZ_BUCBP/12-184-----------DITKGL..G..AGANPE.IGRR.................................AAEEDSDNL.KSIL
A0EC94_PARTE/3-226-----------LIKLFK.DD..ASSIWASKKITQY...........................DEKDRSSRAADEIVRKML
Q22CD2_TETTS/3-223-----------FLVSKN.DE..KANTFA.RGNYQV............................SSEFIEFCLDKV.RRLT
Q23WP5_TETTS/3-226-----------CLISSK.ED..TGGLFS.RGYYTA............................GRSILDHSIDQI.RKIA
Q72N68_LEPIC/14-186-----------KVTRGM..G..AGGDPE.LGLK.................................AAEEDKERI.QSIV
Q7YZQ1_PARTE/3-225-----------SFIYGK.ED..ASNNFA.RGYYQI............................GKEYIDVSLERV.RKLA
Q9NI44_9TRYP/4-260-----------FFVSDV.SG..AGNNWA.VGHMEY............................GDKYIDSITETV.REQV
A0LNZ3_SYNFM/27-199-----------NLTKGL..G..AGGNPE.IGAK.................................AAQEDIDRI.REAV
A0RW55_CENSY/7-167-----------RGVI....N..PSSRYI.RG...................................CTDSVSGGI.TERI
FTSZ_AQUAE/9-181-----------KVTRGL..G..AGAKPE.VGEE.................................AALEDIDKI.KEIL
Q9HKT7_THEAC/53-224-----------NLTRGL..G..AGADPT.VGEM.................................AAKESESEI.LRHI
TBBP_DROME/3-223-----------NFVAGS.ES..AGNNFA.RGYHTD............................GAAILDQVLENT.RREV
Q8EUT3_MYCPE/17-194-----------EELNGN..G..SGGDPE.TGKR.................................AAEADIEVL.KTML
Q3SD83_PARTE/3-220-----------DLILEN.GNRNKSGTFS.NSQLNF............................RDQIKDKLFEKL.RHQI
Q4X7A3_PLACH/4-239-----------NIFTQQ.SG..AGNNWS.QGYMHY............................GRIYENIIDNII.RKNV
Q7VI30_HELHP/38-211-----------RLTKGL..G..AGGNPD.VGMK.................................AALETYEEI.KLAL
A1A2I4_BIFAA/16-188-----------ASSRGL..G..AGADPE.KGAK.................................AAQDHQSDI.EEAL
FTSZ2_PYRKO/37-216-----------DLTQGK..G..SGGDPE.VGYR.................................AAEASAHEI.AETI
Q3SEG7_PARTE/3-216-----------NYMIGK..NVYLDGTYY.QGKNIF............................AQVYQQEFEDKL.RQIY
Q5UXI7_HALMA/2-181-----------DRVKGH..G..VGGDNE.LGAQ.................................VMQENATEV.LDEL
Q26BB8_FLABB/20-192-----------TLTEGL..G..AGANPE.VGER.................................AAQESIEEL.RGML
Q481F5_COLP3/12-185-----------NLTNGY..G..AGSDPS.IGYQ.................................AAQESEGML.RSAI
Q7P689_FUSNV/23-195-----------KLTKGQ..G..AGASPE.VGRQ.................................AAEEDIEKI.QELL
A0B5R2_METTP/3-192-----------LH......G..VGANRS.KGKQGF.............................WENQEMILEEI.EKRG
Q7Z1L8_SCHPL/3-225-----------SLINGE.ED..AASNFA.RGHFTI............................GKSIIDVAMAQL.RKVV
Q0W1F0_UNCMA/28-198-----------SVIKES..G..AAGDVE.IGRL.................................AAEKSGWKL.DESF
TBD_HUMAN/2-226-----------ACFCQK.QG..SGNNWA.YGYSVH............................GPRHEESIMNII.RKEV
FTSZ2_METJA/39-209-----------TLTRGL..G..AGGYPE.IGRK.................................AAEMAKNIL.EEQL
Q3Z8S1_DEHE1/12-184-----------RCTRGL..G..AGGNHT.MGKA.................................AAEESMSEL.KENV
TBE_HUMAN/4-257-----------QLITDI.SG..SGNNWA.VGHKVF............................GSLYQDQILEKF.RKSA
A0BWM1_PARTE/3-215-----------SQFSFN.YS..SGNNYGFVKNHCA.............................NEIMDIIVDSI.RQET
Q227Z6_TETTS/3-224-----------NLIIGQ.DP..AENNWA.IGHYIL............................GPQYIDQVMETV.RKEA
Q8RT91_MYCHO/13-182-----------E..RGI..G..AGANPE.IGKT.................................AAESSREEI.KSRL
Q74M90_NANEQ/26-200-----------DITKGH..G..AGGKPE.VAEQ.................................AARESAKEI.KQLL
Q3SEG5_PARTE/3-205-----------QFFYTK.ED..TGNIYT.VGHYCV............................AKDLIPKIQDEI.RRQV
TBG_ENTHI/4-222-----------NFIIPTNNG..AGNSWA.NGYYT...............................TEKMSEIEEIIDREV
Q4N7F3_THEPA/2-226-----------NVLTDN.GS..HGGNFM.TVFNNL............................GQKYWKSIQRYV.FNMM
Q1CSP5_HELPH/29-202-----------ESTGGL..G..AGGVPD.IGRK.................................AAEESANEI.REAI
A1ZIZ2_9BACT/17-189-----------ALTEGL..G..AGANPE.KGRE.................................AALESKEDI.RDLL
A0RNH8_CAMFF/16-194-----------KKTRGL..G..AGMVPE.VGKE.................................AALESYEEI.KTTL
Q64C34_9ARCH/27-198-----------SLTHGL..G..SGGAPD.VGRK.................................AAELDREVL.GELF
Q3SEH1_PARTE/3-208-----------SFFHGT.ED..AST.FA.RGLCTI............................GGGIEQQALDCI.QKQI
Q70ZZ6_9BRYO/140-312-----------DTTAGR..G..AGGRSA.TGEE.................................AATESLAEL.SMAL
Q76DQ5_CYAME/99-290-----------RLTAGL..G..AGANPS.VGRE.................................AARACLPLL.MEEI
Q3SEG3_PARTE/3-219-----------CCFSRN.CG..SGNNYA.VGRYTE............................GAELMDKCKHIL.DKYF
FTSZ_BACHD/13-185-----------KLTRGL..G..AGANPE.IGKK.................................AAEESREQI.EEAL
Q3SEG6_PARTE/3-182-----------N......................................................YQLELDESL.RKEM
Q8LRU3_CHLRE/4-257-----------QLVSDV.SG..AGNNWA.HGHHEY............................GPRYHDAILDKI.RLTA
Q12VE8_METBU/3-192-----------LH......G..VGANRT.LGKS.................................VFEENKSHI.MRNI
Q3SEH4_PARTE/3-225-----------QFVSGK.GG..AAHNFG.RGHYSI............................GREYIDICLERI.RKIV
Q9HHS0_HALSA/2-183-----------RHHFGH.SG..FGGDAD.SPRERI.............................EALAEDDHVEM.RRAV
TBG_YEAST/4-226-----------NTWVAS.DGASAGNSWA.NGYDIG.............................TRNQDDILNKI.DKEI
Q22UN3_TETTS/2-224-----------TSFSKQ.ES..SQNIFP.RGYYSH............................GAELKEEIEYEI.QKQV
FTSZ_PORGI/18-191-----------EVTNGL..G..AGSRPE.VARR.................................AAEASEADI.RKIL
Q3SEH5_PARTE/3-210-----------SFLYGK.EE..ASNIYS.RGCYTI............................GKEIIDKGLDQI.RKQI
FTSZ1_PYRFU/43-214-----------ELTRGL..G..AGNDPK.IGEE.................................AAKESEREL.RDAL
Q16M50_AEDAE/10-229-----------TLITGK.ED..ASSNFA.RGHFTL............................GRMMIEGVMERI.RKVA
Q2SS93_MYCCT/10-181-----------KTTKGL..G..AGGNPE.VGKA.................................AAIESEEEI.KKVV
Q9GRI0_PARTE/2-207-----------..LTKQ.EG..SGNNWA.YGFNNH............................GPANKNAILQIM.DTLL
Q47AA9_DECAR/14-183-----------T...GL..G..AGAKPE.AGQA.................................AADAHRDEI.RATL
O86305_MYCFE/11-183-----------S.TRGF..G..AGGTPK.VGRE.................................CALESIKEI.QKSL
Q9VED6_DROME/6-227-----------TLITGK.DD..SGSNFA.RGYNLM............................ASELLDRSMNAI.RRVA
Q8T887_CIOIN/3-225-----------QQFCQK.SG..SGNNWA.YGFKVH............................APRCKDGILDCI.RREV
Q6LXB6_METMP/37-208-----------NLTKGL..G..AGGNPV.KGEE.................................SAKENSEEV.KKAV
FTSZ_THEAC/44-215-----------KTTKGL..G..TGADPK.VGEE.................................AAIEEIVAI.KKIV
Q4UCK3_THEAN/4-241-----------NVFLSK.DSMGAGNNWG.VGYTYG.............................NQFNDELSEIV.DREV
O44024_RETFI/3-223-----------FLVHGK.ED..AANNFA.RGHYTI............................GKQIIDKVNDRL.RKLV
A1AQ68_PELPD/26-199-----------NTTKDG..G..SGSRPE.SDRA.................................DAEESRQEI.GEAL
FTSZ1_HALSA/53-224-----------QKTKGR..G..AGSLPQ.VGEE.................................AAIESQGEI.RDSI

PF10644

MSTO1_DANRE/6-118-----------VLFRE...G--LT..L.------------------------------------------------AGHV
Q54F51_DICDI/10-128-----------MLFRS...N--INSETF------------------------------------------------DKDI
DML1_CANAL/2-128-----------LQVFL....--.TRFK.------------------------------------------------STSV
Q4SYY1_TETNG/6-118-----------VLFRE...G--QT..L.------------------------------------------------GGHV
E2BL93_HARSA/3-123-----------VLYRE...G--EN..L.------------------------------------------------QKQV
E3QQX3_COLGM/2-117-----------VHWRP...G--VA..L.------------------------------------------------DGSE
D5G5A5_TUBMM/2-118-----------VHFRP...G--IG..V.------------------------------------------------DGGE
Q16X91_AEDAE/5-123-----------VLYRE...G--RT..L.------------------------------------------------TRQT
C4JY37_UNCRE/2-115-----------ISFRP...G--IG..A.------------------------------------------------DGSE
D2UYR3_NAEGR/2-136-----------VLFRETRGG--YSIHSE------------------------------------------------DEAL
E0CVU9_VITVI/2-122-----------VLYRT...G--ET..L.------------------------------------------------QGIA
C1C113_9MAXI/4-113-----------VLFRE...G--LS..L.------------------------------------------------NKEV
B0DQH6_LACBS/2-120-----------VSFRE...G--IG..P.------------------------------------------------TGEL
E2AQP9_CAMFO/4-117-----------VLYRE...G--EN..T.------------------------------------------------QKQV
E0VQ48_PEDHC/4-114-----------VLFRE...G--KT..S.------------------------------------------------RGQA
O23167_ARATH/2-123-----------VLYRS...G--ET..Q.------------------------------------------------QGVA
E9EUC5_METAR/2-116-----------VHWRA...G--LG..A.------------------------------------------------DGTE
D8RU99_SELML/2-124-----------VLYRT...G--ET..R.------------------------------------------------QGVA
F2SWU5_TRIRC/2-116-----------IHFRG...G--IG..A.------------------------------------------------DGTE
B9S8K8_RICCO/2-124-----------VLYRN...G--ET..Q.------------------------------------------------QGIH
C8VQ22_EMENI/2-115-----------VHFRP...G--IG..A.------------------------------------------------DGSE
A9RV51_PHYPA/2-116-----------VLYRV...G--ET..R.------------------------------------------------QGIA
Q7QCR8_ANOGA/3-129-----------VLYRE...G--QT..R.------------------------------------------------QRQV
F2UAU4_SALS5/7-123-----------VLFRC...G--ET..P.------------------------------------------------SGAP
E3WNL3_ANODA/3-126-----------VLYRE...G--ET..R.------------------------------------------------QRQP
A6ZMS3_YEAS7/2-114-----------KIFLN...S--VVDKV.------------------------------------------------SKTI
Q29JE8_DROPS/5-143-----------VLYRE...G--LN..D.------------------------------------------------YGQT
Q018N1_OSTTA/3-113-----------ERARV...N--EG....------------------------------------------------STSI
B8P6F2_POSPM/2-128-----------VSFRE...G--LS..L.------------------------------------------------KGDQ
Q10PA8_ORYSJ/2-123-----------VLYRS...G--ET..H.------------------------------------------------QGIP
B1H304_XENTR/16-131-----------VTYRQ...G--VT..L.------------------------------------------------RGRQ
B3MRV4_DROAN/5-145-----------ILYRE...G--LN..S.------------------------------------------------HNRT
C7YZ58_NECH7/2-114-----------VHWRA...G--EG..A.------------------------------------------------DGSE
F0XAM2_GROCL/2-120-----------IHWRA...G--IG..A.------------------------------------------------DKTE
D2A4U9_TRICA/4-109-----------VLFRE...G--VT..L.------------------------------------------------KNEV
MSTO1_PONPY/6-121-----------VLYRT...G--RT..L.------------------------------------------------HGQE
B0WZB0_CULQU/3-122-----------VLYRE...G--RT..A.------------------------------------------------NRQT
F0ZVF4_DICPU/5-118-----------MLFRS...N--DSSN..------------------------------------------------ENGI
MST_DROME/5-143-----------ILYRE...G--RN..D.------------------------------------------------LNRT
A7SVU0_NEMVE/7-118-----------CLFRE...G--LT..V.------------------------------------------------TGQE
C1BN10_9MAXI/2-112-----------VLFRE...G--QS..L.------------------------------------------------NKEV
DML1_NEUCR/2-115-----------IHWRP...G--IG..A.------------------------------------------------DGTE
DML1_SCHPO/2-115-----------TNFRV...L--KK..RD------------------------------------------------PEAI
B4NDP0_DROWI/5-139-----------ILYRE...G--LN..D.------------------------------------------------HHQT
B8M2T5_TALSN/2-115-----------VHFRP...G--LG..A.------------------------------------------------DGTE
DML1_PHANO/2-117-----------ILFRP...G--IA..P.------------------------------------------------DGSD
C5JKN9_AJEDS/2-115-----------VHFRP...G--IG..A.------------------------------------------------DGAE
A5DLT9_PICGU/1-104-----------YSAFL...S--TTKNK.------------------------------------------------NGTT
D8Q938_SCHCM/2-119-----------MSFRE...S--LADSG.------------------------------------------------KGAI
B6K201_SCHJY/2-136-----------VAFFE...R--KTNNI.------------------------------------------------GGDV
B4MB04_DROVI/5-140-----------ILYRE...G--RN..D.------------------------------------------------QKQT

PF14881

DML1_ASPCL/119-303-----------DLFNDLDKE--------------------------------------------HDLLDRDVRPF-AEEC
DML1_ASPNC/119-303-----------ELFNELDKE--------------------------------------------HDLLDRDVRPF-AEEC
A6SSZ2_BOTFB/31-216-----------ELFSSLDKE--------------------------------------------HDLLDRDLRPF-AEEA
B2AWJ1_PODAN/149-315-----------ELFRELDKE--------------------------------------------HDLLDRDLRYF-AEEA
B2WK69_PYRTR/102-289-----------ELFEKLERE--------------------------------------------VDLVDRDLRPF-VEEC
B6GW17_PENCW/119-303-----------ELFKDLDKE--------------------------------------------HDLLDRDLRPL-LEEC
B6QAT3_PENMQ/119-303-----------DLFRDIDKE--------------------------------------------HDLLDRDIRPF-AEEC
C1GUC8_PARBA/119-303-----------DLFRTLDRE--------------------------------------------HDILDRDFRAF-AEEC
C4JY37_UNCRE/119-303-----------SLFNSLDRE--------------------------------------------HDLLDRDFRTF-AEEC
C5FUZ2_ARTOC/120-304-----------SLFSELDGE--------------------------------------------HDLLDRDLRPF-AEEC
C7YZ58_NECH7/118-303-----------ELFSVLDKE--------------------------------------------HELVDRDFRPF-AEEC
C8VQ22_EMENI/119-303-----------DLFNELDKE--------------------------------------------HDLLDRDVRPF-AEEC
E3QQX3_COLGM/121-306-----------ELFDNLDKE--------------------------------------------HDIVDRDFRPF-VEEA
E9E9D2_METAQ/120-305-----------ELFTSLDKE--------------------------------------------QDILDRDWRPF-VEEC
F0XAM2_GROCL/124-310-----------ALFATLDRE--------------------------------------------HDLLDRDLRPF-LEEA
F2PVM6_TRIEC/101-285-----------TLFSDLDRE--------------------------------------------HDLLDRDLRPF-AEEC
DML1_ASPOR/119-303-----------DLFSDLDKE--------------------------------------------HDLLDRDVRPF-AEEC
DML1_NEUCR/119-307-----------DLFASLDKE--------------------------------------------HDLLDRDLRPF-IEEA

PF03953

TBG_EMENI/263-392-----------------------------------.SSCYISILN.IIQGEADPTDVHKS-LLRIRER------------
TBA2_EMENI/265-395-----------------------------------..GKYMAVAL.LYRGDCVPRDCTQA-IASLKAK------------
TBA_ENCHE/237-367-----------------------------------..GKYMACCL.LFRGDVNPKDANTA-TANVKAK------------
P92124_9MICR/238-368-----------------------------------..GKYMACCL.LFRGNVNPKDVNQA-TSLVKSK------------
TBA2_SCHPO/263-393-----------------------------------..GRYMATCL.LYRGDVIPRDVQAA-VTTIKAK------------
TBA1_YEAST/264-394-----------------------------------..GKYMATCL.LYRGDVVTRDVQRA-VEQVKNK------------
O00907_BLEJA/239-369-----------------------------------..GKYMACCM.MYRGDVVPKDVNAA-VATIKTK------------
Q9HDT1_USTMD/262-392-----------------------------------..GKFMACCL.LYRGDVVPKDVNSA-VATIKTK------------
O01943_GECLA/256-386-----------------------------------..GKYMACCL.LYRGDVVPKDVNCL-IATIKTK------------
O93945_RHYSE/266-396-----------------------------------..GKYMATCL.LYRGDVVTKDVHGA-VATLKTK------------
P91873_CAEEL/269-399-----------------------------------..GKYMAVCL.LYRGDVVPKDINSA-IAAVKTK------------
TBAL3_HUMAN/270-400-----------------------------------..GKYMACCL.LYRGDVVPKEVNAA-IAATKSR------------
O18154_CAEEL/260-388-----------------------------------..GKYMAVCL.LYRGDVVPKDVSAA-IKSIKTQ------------
TBA4_DROME/274-404-----------------------------------..GKFMACCM.LYRGDVVPKDVNAA-VSAIKSK------------
Q9GQC1_9MYCE/168-298-----------------------------------..GKYMACCL.MYRGNITPPEVQKA-VNDLKTK------------
Q9GQB7_9MYCE/169-301-----------------------------------..GKYMACCL.MYRGNIVPKEAQKA-VSYIKTE------------
TBA_DICDI/270-402-----------------------------------..GKYMACCL.MYRGDIVPKEAQKA-VQNIRSE------------
Q9GQB9_9EUKA/168-298-----------------------------------..GKYVSCCL.LYRGDVVTKDVNQA-IASVRTK------------
TBA1_ENTHI/268-399-----------------------------------.KGKFMSCCM.MYRGDVSSREVNLA-VSGIKKQ------------
O44024_RETFI/260-393-----------------------------------..DKYMAISL.NYRGDIKSKEANAT-VQWLKSN------------
Q9GQU7_ANTLO/246-369-----------------------------------..GRYLTAGLPVFRGKISMKDVDEQ-MLQVQTR------------
TBB_ENCHE/261-383-----------------------------------..GRYLTVAA.MFRGKISMKDVDEQ-MSMVQSK------------
Q9N6F5_9MICR/246-368-----------------------------------..GRYLTVAA.IFRGIVSTKEVDEQ-LHSIQNK------------
TBB1_COLGL/264-384-----------------------------------..GRFLTCSA.IYRGKVSTKQIEEQ-IRGVQAK------------
TBB1_GEOCN/261-383-----------------------------------..GRYLTVAA.FFRGKVSIKEVEDQ-MRSVQER------------
TBB_SCHPO/261-383-----------------------------------..GRYLTVAA.LFRGKVSMKEVDEQ-IRSVQTK------------
Q9HGW5_9ASCO/245-367-----------------------------------..GRYLTVAA.FFRGKVSMKEVEEQ-MISVQNK------------
Q9UVQ7_9FUNG/246-368-----------------------------------..GRYLTVAA.FFRGRLSMKEVEQQ-MVDVHKK------------
Q9P8Z1_UMBRA/246-368-----------------------------------..GRYLTVAT.IFRGRLSTKEVENQ-MLAVQQK------------
Q9P8Z5_SMICU/246-368-----------------------------------..GRYLAVAA.MFRGRVSTNEVEHQ-MLQVQNK------------
O00817_CRYPV/263-385-----------------------------------..GRYLTASV.MFRGRMSTKEVDEQ-MLLVQNR------------
Q9LD24_BIGNA/246-368-----------------------------------..GRYLTAAA.MFRGKIATKDIDEQ-MLNVQNK------------
Q9ZTL8_9CRYP/246-368-----------------------------------..GRYLTAAV.LFRGKMATKEVDEE-ILNVQSK------------
O01676_BOMMO/261-383-----------------------------------..GRYLTVAA.IFRGRMSMKEVDEQ-MLNIQNK------------
Q25165_SPIBA/246-368-----------------------------------..GRYLTCLT.LIRGRVSTKEVDEQ-DHNIQNK------------
TBB1_CHOCR/263-385-----------------------------------..GRYLTAAV.YFRGKVSTKEVEDE-MTLMQTK------------
TBB2_PHYPO/261-383-----------------------------------..GRYLTASA.TFRGKMSTKEVDEQ-MHAVQTK------------
TBB_DICDI/266-388-----------------------------------..GKYLTASA.LFRGKIFTKEVDEQ-MHNIQTK------------
TBBN_GUITH/261-383-----------------------------------..GRYLTAAA.YFRGKISTKEVDDQ-MIEIQNK------------
TBB_PORPU/261-383-----------------------------------..GRYLTASA.YFRGHVSTKEVEEQ-MDAIQTK------------
Q26235_RETFI/261-383-----------------------------------..GRYLTASA.IFRGQVSTKEVDDQ-MFNIQNK------------
TBB3_ECHMU/261-383-----------------------------------..GRYLTVAA.MYRGRVSMKEVEDR-ILETQTR------------
Q9UVR1_9FUNG/246-368-----------------------------------..GRYLTCAA.MFRGKVSVKECEDT-IWNYAEK------------
TBBP_DROME/260-382-----------------------------------..GKLLTAAG.IFRGRMSPREVDQL-MTGVRNK------------
TBB2_GEOCN/263-385-----------------------------------..GRYLTIST.IFRGQVAMKEVEDA-IHTARTK------------
Q26236_RETFI/267-390-----------------------------------..GKYLSASLAYRGADIPSQEVDGI-VKSIQEK------------
O46334_9EUKA/267-389-----------------------------------..GKYMSASCGYRGP.ISTQEVDDQ-IAQVQGK------------
TBE_MOUSE/294-414-----------------------------------..SLYLACAL.IVRGNVQISDLRRN-IERLKPA------------
Q9NI44_9TRYP/297-427-----------------------------------EAGTCLATAIVARGPQITVGDLTRN-IPRIRER------------
TBG_CHLRE/264-399-----------------------------------ANAKYISILN.IIQGEVDPSQVHKS-LQRIRER------------
O00896_PHYPO/261-387-----------------------------------.NGKYISILN.IIQGEVDPTQVHNS-LQGLRER------------
Q9FRU9_TOBAC/264-395-----------------------------------SQAKYISILN.IIQGEVDPTQVHES-LQRIRER------------
TBG_DICDI/261-387-----------------------------------.TGKYISILN.IIQGDVDPTQIHNS-LQRIREK------------
O00849_TETTH/263-389-----------------------------------.KGQYISIMN.VIQGEVDASQIHKS-LQRIRER------------
Q9AR10_EUGGR/266-393-----------------------------------.G.CYVSILN.IIQGDVDPGQVHKS-LQRIRER------------
TBG2_EUPOC/261-387-----------------------------------.KGAYMSILN.VIQGDVDPTQVHKS-LQRIRER------------
TBG2_DROME/264-394-----------------------------------SRQCFVSILN.IIQGEVDPSQVHKS-LQRIRER------------
TBG1_HUMAN/264-393-----------------------------------TNHCYIAILN.IIQGEVDPTQVHKS-LQRIRER------------
TBG_SCHPO/264-393-----------------------------------.KSCFISILD.IIQGEADPADVHKS-LLRIRER------------
Q94771_9TRYP/266-393-----------------------------------.SGCYISLLN.LIQGDVDPAQVHRS-LERIRER------------
TBG_PLAFO/265-391-----------------------------------.RGMYISILN.IIRGETDPTQVHKG-LQRIRDR------------
TBG_RETFI/263-389-----------------------------------.KGVYVSILD.IIRGDVDPTDIHKS-LQRIREK------------
TBG_ENTHI/259-383-----------------------------------..GKYISMCD.FFQGDVSYDEINEA-LQRFTDR------------
TBG_CANAX/299-418-----------------------------------....YISMLNYLIGYNLDQREIRKG-ILKSQQR------------
TBG_YEAST/263-392-----------------------------------..PTYFNVYN.TIIGNVEPRQISRA-MTKLQQR------------
TBG_CAEEL/264-391-----------------------------------..NDCMLSAYMFLQGQIEAHTIMTA-EQNVDFA------------

PF12327

FTSZ2_HALSA/239-333-------------------------------------GGLVHITG---GPDLTLKEAEGI-ADNITER------------
FTSZ_HALME/257-351-------------------------------------SALVNVTG---GSDMSIEEAEGV-VEEIYDR------------
FTSZ_MYCKA/219-313-------------------------------------GVLLSVAG---GSDLGLFEINEA-ASLVQDA------------
FTSZ_CORGL/219-313-------------------------------------GVLLSFAG---GSDLGLMEVNAA-ASMVRER------------
Q97IE9_CLOAB/222-316-------------------------------------GVLLNVTG---GEDLGLLEINEA-ARVVQEA------------
O85474_9FIRM/222-316-------------------------------------CVLVNMCG---GESLGLMEANVG-MGLIREA------------
Q9SCC9_GUITH/260-354-------------------------------------GIVFNITG---GQDMTLHEINSA-AEVIYEA------------
O85785_SYNE7/248-342-------------------------------------GVVFNITG---GRDMTLHEVNAA-ADAIYEV------------
Q9AQ37_ANAPH/225-320-------------------------------------GILINITG---GMDMTLFEVDAA-ANRIREE------------
FTSZ_RICPR/225-321-------------------------------------GVLINITG---GPDMTLFEVDNA-ANRIREE------------
FTSZ2_RHIME/224-319-------------------------------------GVLVSISG---GMDMTLFEVDEA-ATRIREE------------
FTSZ_RHIRD/225-320-------------------------------------GLLISITG---GRDLTLFEVDEA-ATRIREE------------
FTSZ_CAUCR/225-320-------------------------------------AVLVNVTG---GMDMTLLEVDEA-ANAISDQ------------
Q9M7M6_9STRA/290-387-------------------------------------GMLVNITG---GKDLTLVEVDAA-AQRITSE------------
FTSZ_BUCAI/221-316-------------------------------------GVLVNITA---GFDLKLDEFETV-GNTIRSF------------
Q9F1M6_SHEVI/222-317-------------------------------------GVLVNITA---GMDMSIEEFETV-GNHVKAY------------
FTSZ_FRATH/221-316-------------------------------------GVIVNITA---GMDMSIGEFEEV-GEVIRSF------------
FTSZ_PSEAE/222-317-------------------------------------GILVNITA---GPDLSLGEYSDV-GNIIEQF------------
Q9CPA6_PASMU/244-342-------------------------------------GVLVNITS---GMDLGLDEFNVV-GKTVAEF------------
FTSZ_HAEIN/246-344-------------------------------------GILVNITA---GMDLVFEEFNII-GETIGSF------------
Q9PF76_XYLFA/226-321-------------------------------------GILVNITA---GSDFTMAEFDEI-GRTIDGF------------
FTSZ2_METJA/246-343-------------------------------------GALIHITG---GPDLTLKEANDI-GEGITKE------------
FTSZ2_ARCFU/238-332-------------------------------------GSLVHISG---GHDLTLKEAEEI-IRNLTFE------------
FTSZ1_HALSA/261-355-------------------------------------SALVNVTG---GPGMSIEEAEGV-VEQLYDR------------
FTSZ1_ARCFU/252-346-------------------------------------AALVNVTG---GPDMTIEEAESV-IEEIYSK------------
FTSZ_METTH/248-342-------------------------------------GALINISG---SSDLTLQEAERI-VEVVAEE------------

PF13809

A0ZDE4_NODSP/18-373K........RTRGHESFLLT.....SGLKI.E-P-GLSIFVVGSL---CGGTGSGMFLDV-AYSLRNIY-----------
A1VSD1_POLNA/4-348K........................LLQQSGE-T-DVTFHIVVGL---AGGTGSGSVIDA-VAQLRD..-----------
A3IHZ5_9CHRO/13-355N........RVKGRENFMLD....RYGIKVST-N-AINVFVTGSL---SGGTGSGMLIDI-GYCVRKWL-----------
A5N8S7_CLOK5/35-392R........................LLQEDKE-E-TLHVFILSGL---SGGTGSGTFIDI-AYIVRGIM-----------
A6NS46_9FIRM/38-402K..........................GKPAG-M-RLNIIFLGGL---AGGTSGGTMVDL-PFLTRQIV-----------
A6P0V7_9FIRM/16-360R........................KDGKALK-Q-AMRIVIVSTA---SGGTGSGILLPL-AMLVRNYV-----------
A7VAW1_9CLOT/34-390E.......................EIHDKANG-N-WMDVIIVSSL---SGGTGSGILSDL-AYNIRAYG-----------
A8SSW8_9FIRM/34-390Q.......................AVYDKTEE-G-TVDVLIVSGV---SGGTGSGILSDV-AYNIRAYG-----------
B0JIZ1_MICAN/14-373R........RTSGHESFMFSGKVNGQSFNV.Q-E-GLNVFVVGSL---CGGTGSGIFLDV-AYTLRHIL-----------
B1VR11_STRGG/8-403D..............AIAKSAGELSELGGGRV-T-GCDVFVAFSV---AGGTGAGIFLDY-LHLINQAF-----------
B2JAM4_NOSP7/13-355D........RVKGHESLMLE....KYDIRVSS-G-GLNVFVVGSI---SGGTGSGMLIDI-GYCLRNWL-----------
B3DW42_METI4/6-351N........................EMQKGGQ-Q-NVTFHVCCGL---AGGTGSGTLIDC-ICQIRK..-----------
B3QN46_CHLP8/22-399D..........SLLDNVKSGTAQKRLGLNVQT-G-ALKIVVVAST---AGGTGSGSFLDL-GYLSTIIG-----------
E0UHW6_CYAP2/14-356K........RVKGRENYMLD....RYGIKVAN-N-AVNVFVTGSL---SGGTGSGMLIDI-GYSIRNWL-----------
B8G8G2_CHLAD/22-363D..........KIRQIAENEQVEKQGIRTERT-G-QVRVYIVSSL---CGGTGSGLLLDV-AFRVRSKL-----------
B8HTJ0_CYAP4/11-352A........QIVGHEKFMLD....RWNVQL.D-K-GVNIFVVCSL---SGGTGSGMLLDM-AYNLRDWL-----------
C3B5Y7_BACMY/8-349P........................VTSDQTE-Y-GVRVIIVTSL---AGGTGSGMFLQI-ALYLREML-----------
C7QTL6_CYAP0/18-377R........RTRDHSSKLLK.....SGLRV.D-D-QLNIFVVGSL---SGGTGSGMFLDI-AYNLRRDY-----------
D3EKE8_GEOS4/35-389K........................TLSVGTN-K-KLMVFLLTGL---SGGTGSGCFLDI-AYIVRGII-----------
Q114V2_TRIEI/18-373K........KTRGNEGILLK.....MGLRV.D-G-GVNIFIVGSL---CGGTGSGMFLDV-AYSLRHSY-----------
Q7NLY7_GLOVI/13-354G........RLRGHEKFMLD....TWKVQL.D-Q-GINIFVVGSL---SGGTGSGMLLDL-AYNLRDWV-----------
Q8DK50_THEEB/19-361D........RVKGHESFMQS....RYGLKVNN-S-SLNVFITGSL---SGGTGSGMLIDL-GYCVRHWL-----------
Q9RWX7_DEIRA/11-368NLTEAQAKAALNKDNAGLEMSVQFAVNQASGQ-T-GVRVIVVGTL---CGGTCSGTASDV-GILLRTIL-----------

PF00091

Q7NB81_MYCGA/75-255.-------------------...........N.E.CDICIVIAGL---GKGTGSAGSTYI-INKAATK............
B9LLN1_CHLSY/15-187.-------------------...........S.G.ADLVVIVAGM---GGGTGTGAAPVV-ARLARQL............
A9CGZ3_AGRT5/15-187.-------------------...........S.G.YDMCFITAGM---GGGTGTGAAPVI-AEACRAK............
FTSZ_CAUCR/16-188.-------------------...........D.G.AHMVFITAGM---GGGTGTGAAPII-AKCARER............
B4SJY0_STRM5/15-187.-------------------...........Q.G.ADMVFITAGM---GGGTGTGAAPVV-AQLAKEM............
B3E8P4_GEOLS/12-183.-------------------...........T.G.ADLVFLAAGM---GSGTGTGATPEI-AKLAKEA............
Q4A669_MYCS5/37-207.-------------------...........K.G.ADVVLVTAGL---GGGTGTGAAPVI-AEAAKKM............
Q7Q808_ANOGA/3-224.-------------------......EGC..D.C.LQGFQLVHSI---GGGTGSGLGTLL-LENLKDHF...........
FTSZA_DICDI/52-223.-------------------...........G.D.TQMLFVTAGM---GGGTGTGGAAVI-ASAAKAK............
Q0HDQ9_SHESM/15-188.-------------------...........Q.H.SDIVFLTAGL---GGGTGTGALPQV-AKLAREL............
TBG_CAEEL/6-229.-------------------......ENT..N.N.LDGILFTHSV---SGGTGSGTGSLL-LERLREAF...........
Q4QCZ3_LEIMA/2-292R-------------------RTSDAEDGS..G.G.FESILVLHSL---VGGTGSGLASKL-TARLRLYFTEPPPGQQVDE
FTSZ_THEMA/23-195.-------------------...........Q.D.THMVFITAGF---GGGTGTGASPVI-AKIAKEM............
O96769_PARTE/4-227.-------------------......DGS..D.S.LEGFLMLHSI---AGGTGSGSGSYI-LERLNDRF...........
TBG_CANAX/4-262.-------------------......DKC..D.N.LSNFQLFHSV---AGGTGSGVGSKM-LEVISDRY...........
A2EAH1_TRIVA/4-237.-------------------......EVA..D.A.LEGFIFTHSI---SGGTGSGLGSFL-IEKLSDEY...........
Q24D61_TETTS/3-222.-------------------......EQS..E.C.LQGFQLMRSL---GGGTGSGYGSLI-LQMLNDLY...........
Q3SEF9_PARTE/3-228.-------------------......ESC..D.G.LQGIMLYHSV---GGGFGGGFTSKI-LDLLSSDL...........
Q3SEF7_PARTE/3-210.-------------------......ESV..D.R.IDQFIITSAL---SGGTGSGFTSLL-LERLSVEY...........
Q2S524_SALRD/20-193.-------------------...........D.G.YDMAFITAGM---GGGTGTGGAPVV-AAIARSL............
FTSZB_DICDI/62-236.-------------------...........K.D.TDLLFLAAGM---GGGTGTGSSPII-AKTIKEF............
TBGN_GUITH/4-222.-------------------......EKM..N.S.VKYFNVFNSI---NGGTGAGLSSYL-IEYIRNNY...........
A1SU24_PSYIN/26-198.-------------------...........T.G.ADVVFIAAGM---GGGTGTGASPVV-TEIAKEL............
A4SGZ8_PROVI/19-191.-------------------...........K.G.ADMVFIAAGM---GKGTGTGAAPVI-ASIAKNM............
Q24D62_TETTS/3-222.-------------------......EKS..D.Q.MQGFQVMRSL---GGGTGSGLGDVL-LSKLREEY...........
FTSZ_BUCBP/12-184.-------------------...........K.D.ADMVFIASGM---GGGTGTGAAPII-AKISKKL............
A0EC94_PARTE/3-226.-------------------......EAA..D.A.ASAIIIYHSL---AGGFGSGFTCKL-LQLLNDET...........
Q22CD2_TETTS/3-223.-------------------......ESC..Q.N.LQGFLIYNSA---GGGTGSGFGSLL-TKKIKQNY...........
Q23WP5_TETTS/3-226.-------------------......ESC..S.Y.LHGFIIYSTS---SGGASSGLGNLI-LQRLRVDY...........
Q72N68_LEPIC/14-186.-------------------...........R.G.SDMVFITAGM---GGGTGTGAAPVI-AKIAKEM............
Q7YZQ1_PARTE/3-225.-------------------......EDC..Q.S.PQGILLFNSV---GGGTGSGLGTLL-LERLQEDY...........
Q9NI44_9TRYP/4-260.-------------------......ERC..D.S.IQSFLIMHSL---SGGTGAGLGTRV-LGMLEDEF...........
A0LNZ3_SYNFM/27-199.-------------------...........D.G.SDMVFITAGL---GGGTGTGGAPIA-AQVCKEM............
A0RW55_CENSY/7-167.-------------------...........S.G.CGTAVIFANL---AGRSGSAIAPLV-SRICRQL............
FTSZ_AQUAE/9-181.-------------------...........R.D.TDMVFISAGL---GGGTGTGAAPVI-AKTAKEM............
Q9HKT7_THEAC/53-224.-------------------...........D.E.TSIVFITAGF---GGGTGTGAAPYV-AKLAKDR............
TBBP_DROME/3-223.-------------------......ESV..D.S.LQGFQLLHSI---GGGTGSGLTSLI-MEALVEQY...........
Q8EUT3_MYCPE/17-194.-------------------...........E.G.VDVLILVAGL---GKGTGTGATPVI-AKAAQEL............
Q3SD83_PARTE/3-220.-------------------......EKC..D.K.FFGCQFAHST---YDY.SSGSSSVA-IDSYKEGY...........
Q4X7A3_PLACH/4-239.-------------------......EKC..D.S.LQSFYITSSL---GGGTGSGLGSYV-LEMLSDNY...........
Q7VI30_HELHP/38-211.-------------------...........N.G.VDLVFISAGL---GGGTGTGAAPVV-AKAAKEV............
A1A2I4_BIFAA/16-188.-------------------...........K.G.SDMVFVTCGE---GGGTGTGASPIV-ARAAHQQ............
FTSZ2_PYRKO/37-216.-------------------...........G.D.ADLVFITAGM---GNGTGTGAAPVV-ARVIKER............
Q3SEG7_PARTE/3-216.-------------------......ENS..D.Q.LFGCNLIHSL---SDK.FCGISMQL-MPSLESQL...........
Q5UXI7_HALMA/2-181.-------------------......DGRITT.E.AEAIVVVAGL---GGGTGSGGAPML-ARELKRIY...........
Q26BB8_FLABB/20-192.-------------------...........DTN.TKMVFITAGM---GGGTGTGAAPVI-AQVSRDM............
Q481F5_COLP3/12-185.-------------------...........M.D.SDIVIITAGF---GGGTGTGASPLV-AKIAREL............
Q7P689_FUSNV/23-195.-------------------...........K.G.TDMLFITAGM---GGGTGTGAAPVI-AKAAKEL............
A0B5R2_METTP/3-192.-------------------...........D...FDLIFVMTSV---SGGTGSSFSPLM-IHELKKRY...........
Q7Z1L8_SCHPL/3-225.-------------------......DNC..D.G.LEGFLMISSY---GGGTGSGFQTLM-LEKIGIEY...........
Q0W1F0_UNCMA/28-198.-------------------...........R.A.TKLMFLVAGM---GGGTGTGAAPVV-ARIAKEY............
TBD_HUMAN/2-226.-------------------......EKC..D.S.FSGFFIIMSM---AGGTGSGLGAFV-TQNLEDQY...........
FTSZ2_METJA/39-209.-------------------...........K.G.ADLVFVTAGM---GGGTGTGSAPVV-AEVAKEN............
Q3Z8S1_DEHE1/12-184.-------------------...........I.G.ADMVFVTAGM---GGGTGTGSAPVV-AKIAKES............
TBE_HUMAN/4-257.-------------------......EHC..D.C.LQCFFIIHSM---GGGTGSGLGTFL-LKVLEDEF...........
A0BWM1_PARTE/3-215.-------------------......EKC..D.Q.LQGIQLFSSI---IGGTGSGLIAAL-DDKLGYD............
Q227Z6_TETTS/3-224.-------------------......EIC..D.C.LQGFQMIHSI---GGGTGSGMGTLL-LQKLKEEY...........
Q8RT91_MYCHO/13-182.-------------------...........Q.G.ADLVIITAGM---GGGTGTGAAPVI-AQIAKEC............
Q74M90_NANEQ/26-200.-------------------...........E.G.ADLVWVVAGM---GGGTGTGAAPVV-AEIAQNV............
Q3SEG5_PARTE/3-205.-------------------......ENC..D.H.FSGFLFTHSI---SGGFGSGYTTLL-SSLLKNEY...........
TBG_ENTHI/4-222.-------------------......EHC..D.S.LEGFFFCHSI---CGGTGSGLGSKI-MEMISEKY...........
Q4N7F3_THEPA/2-226.-------------------......EKC..D.H.FEYFNLTLGV---GGSSGSALGAYT-AQMLSQLY...........
Q1CSP5_HELPH/29-202.-------------------...........K.D.AKLVIISTGL---GGGTGTGATPTI-VKIAKEV............
A1ZIZ2_9BACT/17-189.-------------------...........SLS.TRMLFITAGM---GGGTGTGAAPII-AEIAREL............
A0RNH8_CAMFF/16-194.-------------------...........E.Y.SDIVFIASGF---GGGTGTGAAPII-AQAAKEV............
Q64C34_9ARCH/27-198.-------------------...........E.G.KNFVFLTAGM---GGGTGTGAAPVI-AEVAKEA............
Q3SEH1_PARTE/3-208.-------------------......ETM..D.R.LDEFVITSSI---SGGTGSGFLSNL-VSLLKIYY...........
Q70ZZ6_9BRYO/140-312.-------------------...........E.G.ADLVFIASGM---GGGTGSGAAPVV-ARLAKAM............
Q76DQ5_CYAME/99-290.-------------------...........R.N.AHILFLTAGL---GGGTGTGAAPVI-AQAARAA............
Q3SEG3_PARTE/3-219.-------------------......EES..G.K.LQGIMMFFST---GGGSGSGIASNL-IQYFREKD...........
FTSZ_BACHD/13-185.-------------------...........Q.G.ADMVFITAGM---GGGTGTGAAPVI-AEVAKEI............
Q3SEG6_PARTE/3-182.-------------------......EIC..D.N.CQGIQITHHL---STDIS.....ML-QDLLQHY............
Q8LRU3_CHLRE/4-257.-------------------......EDC..D.S.LQSFMVLHSL---GGGTGSGVGTYI-VRMLADEF...........
Q12VE8_METBU/3-192.-------------------......EER..G.N.FDVGFVITSA---SGGTGSSFTPPL-IKEIKENH...........
Q3SEH4_PARTE/3-225.-------------------......DNC..S.S.FQGFMMLNSV---GGGTGSGLGTLL-LEKLSVDY...........
Q9HHS0_HALSA/2-183.-------------------......DSAITS.D.AAAIIVIAGV---GGATGSVIAPKL-TDALQRIY...........
TBG_YEAST/4-226.-------------------......DST..D.N.FEGFQLLHSV---AGGTGSGLGSNL-LEALCDRY...........
Q22UN3_TETTS/2-224.-------------------......EVC..D.K.VDSIQVQRSL---CGGAGSGLGNVI-SDIIMDNY...........
FTSZ_PORGI/18-191.-------------------...........DDGHTRMVFVTAGM---GGGTGTGAAPVI-GRIAREL............
Q3SEH5_PARTE/3-210.-------------------......ETM..D.R.LDQFVITTSI---MGGTGSGFSTLL-LQRLEVDY...........
FTSZ1_PYRFU/43-214.-------------------...........E.G.ADMVFITCGL---GGGTGTGAAPVI-AEIARKM............
Q16M50_AEDAE/10-229.-------------------......EGC..S.T.VQGFMIFHSL---GGGTGSGFGTLA-LEKLFDDY...........
Q2SS93_MYCCT/10-181.-------------------...........E.G.ADLIFIAAGM---GGGTGTGAAPVI-AKIAQES............
Q9GRI0_PARTE/2-207.-------------------......EEC..G.Y.LESLFFISSL---AGGTGSGLGSYI-LELMADRY...........
Q47AA9_DECAR/14-183.-------------------...........E.G.AHMAFITAGM---GGGTGTGAAPVV-AEIAREM............
O86305_MYCFE/11-183.-------------------...........E.N.TDIVIISAGL---GGGTGTGAAPVI-AEAAKKM............
Q9VED6_DROME/6-227.-------------------......DRC..R.N.LRGFLVFRAI---GGGSGSGLGTRI-MERLVEDF...........
Q8T887_CIOIN/3-225.-------------------......EKC..D.Y.FSGFLILMSL---AGGTGSGVGSYI-TGLLREEY...........
Q6LXB6_METMP/37-208.-------------------...........Q.D.SDLVFVTCGL---GGGTGTGSAPVV-AEISKKV............
FTSZ_THEAC/44-215.-------------------...........Q.N.TDITFVTAGL---GGGTGTGCAPVI-ARAAKEA............
Q4UCK3_THEAN/4-241.-------------------......DNA..D.N.LEGFVLSHSI---GGGTGSGLGSYL-LEMINENY...........
O44024_RETFI/3-223.-------------------......DNC..D.N.VMGFVIGHSV---GGGTGSGLGALI-LERLAVDY...........
A1AQ68_PELPD/26-199.-------------------...........K.G.ADVVIIVARM---GGCTGTGAVQVI-ADAAKVS............
FTSZ1_HALSA/53-224.-------------------...........A.G.SDMVFVTAGL---GGGTGTGSAPVV-AKAAREQ............

PF10644

MSTO1_DANRE/6-118---------------------------------T-YTPRLIAIDL---KGSLQTLRKEGS.LYD.....-----------
Q54F51_DICDI/10-128---------------------------------K-YTPRLLLFDF---KSNFGSMNSDGK.VLK.....-----------
DML1_CANAL/2-128---------------------------------S-YSPRALIYDL---RNGLGALNKYEY.HET.....-----------
Q4SYY1_TETNG/6-118---------------------------------T-YTPRLIAMDV---KGSLRTLRQEGS.LYD.....-----------
E2BL93_HARSA/3-123---------------------------------T-FTPRVLMADL---KGGTGSIYEHSI.LYD.....-----------
E3QQX3_COLGM/2-117---------------------------------T-FLPRTVVYDL---KGGFGSLRKINA.LYD.....-----------
D5G5A5_TUBMM/2-118---------------------------------T-FTPRTLIYDL---KGGFGSMKKINA.LYE.....-----------
Q16X91_AEDAE/5-123---------------------------------T-YTPRLLLVDL---KGTLKFMPEEGE.LYQ.....-----------
C4JY37_UNCRE/2-115---------------------------------T-FTPRTIIYDL---KGGFGSLRQYNS.LYE.....-----------
D2UYR3_NAEGR/2-136---------------------------------E-YFPRLLVFDL---KGSRGSLRKNNADPYQ.....-----------
E0CVU9_VITVI/2-122---------------------------------T-YTPRLVSVNF---QGSLGSMSSHGT.LYD.....-----------
C1C113_9MAXI/4-113---------------------------------T-FTPRLISIDL---KGALGSLPRYGE.LYT.....-----------
B0DQH6_LACBS/2-120---------------------------------T-ICPRLVIFDR---KANFGTLAASNA.LGE.....-----------
E2AQP9_CAMFO/4-117---------------------------------T-FTPRLLLVDL---KGALGYLSEQGS.LYN.....-----------
E0VQ48_PEDHC/4-114---------------------------------T-FTPRLILVDK---AENMINIPILSE.APE.....-----------
O23167_ARATH/2-123---------------------------------T-YTPRLVSVNL---KGALGTMSSRGT.LYN.....-----------
E9EUC5_METAR/2-116---------------------------------T-FLPRTVLYDL---KGGFGSLRKINP.LYD.....-----------
D8RU99_SELML/2-124---------------------------------T-YTPRLVAIDL---RGSLGAVRSSGS.LYD.....-----------
F2SWU5_TRIRC/2-116---------------------------------T-FTPRTLIYDL---KGGFGTLRKYNA.LYQ.....-----------
B9S8K8_RICCO/2-124---------------------------------T-YTPRLISING---QGSLGSMSSHGT.LYT.....-----------
C8VQ22_EMENI/2-115---------------------------------T-YTPRTLIYDL---KGAFGTLRKNNA.LYE.....-----------
A9RV51_PHYPA/2-116---------------------------------T-YMPRLLALDL---RGNLGAVRAAGS.LYE.....-----------
Q7QCR8_ANOGA/3-129---------------------------------T-FTPRLLMLDL---SGTLKHVPRTGD.LYE.....-----------
F2UAU4_SALS5/7-123---------------------------------T-YTPRLLLYDL---RDSTSALSQEGV.LYG.....-----------
E3WNL3_ANODA/3-126---------------------------------T-FTPRLLMLDL---GGTLRHLPRTGD.LYE.....-----------
A6ZMS3_YEAS7/2-114---------------------------------S-YAPRALLWDA---RTGNGSLGTYQY.SES.....-----------
Q29JE8_DROPS/5-143---------------------------------T-YTPRLLSVDL---AGNLAHLPIVGE.LYGNYVQR-----------
Q018N1_OSTTA/3-113---------------------------------S-YVPRWVAFDA---RSLRGKTTATGL.SSG.....-----------
B8P6F2_POSPM/2-128---------------------------------T-YCPRLLVFDR---KVNFGTLSAASD.LYG.....-----------
Q10PA8_ORYSJ/2-123---------------------------------T-YCPRLVSVGS---RGSLGSLSSSGN.LGQ.....-----------
B1H304_XENTR/16-131---------------------------------T-YTPRLIAVDL---KGGLSSLREEGF.LYE.....-----------
B3MRV4_DROAN/5-145---------------------------------T-YTPRLVSVDL---AGTLAHLPLGGE.LYGNFVQR-----------
C7YZ58_NECH7/2-114---------------------------------T-FLPRTVIYDL---KGGFGSLRKINA.LYE.....-----------
F0XAM2_GROCL/2-120---------------------------------T-YLPRTVVYDR---KGGFGSLRKINA.LYE.....-----------
D2A4U9_TRICA/4-109---------------------------------T-FTPRLLLVDL---KGSLKTLPQEGE.LYS.....-----------
MSTO1_PONPY/6-121---------------------------------T-YTPRLILMDL---KGSLSSLKEEGG.LYR.....-----------
B0WZB0_CULQU/3-122---------------------------------T-YTPRVLVVDL---KGTLKFMPQEGE.LYG.....-----------
F0ZVF4_DICPU/5-118---------------------------------K-FTPRLLLFDF---KNNFGSMNSEGR.VYK.....-----------
MST_DROME/5-143---------------------------------T-YTPRLLSVDL---SGTLGHLPVTGE.LYGNFVQR-----------
A7SVU0_NEMVE/7-118---------------------------------T-YTPRLLLYDL---KGSLRNLSTEGL.LYE.....-----------
C1BN10_9MAXI/2-112---------------------------------T-FTPRLISVDL---KGGLGALPRYGE.LYS.....-----------
DML1_NEUCR/2-115---------------------------------T-YMPRTVIYDL---KGGFGSMAKTNA.LYN.....-----------
DML1_SCHPO/2-115---------------------------------V-TVPRECIYDT---PIEFGNTRK.NW.LEE.....-----------
B4NDP0_DROWI/5-139---------------------------------T-YTPRLLSVDL---AGTLGHLPLAGE.LYGNYVQR-----------
B8M2T5_TALSN/2-115---------------------------------T-FTPRTIIYDL---KGGFGTLRKYNT.LYE.....-----------
DML1_PHANO/2-117---------------------------------T-FTPRALIYDL---KGAFGSMRKINA.LYE.....-----------
C5JKN9_AJEDS/2-115---------------------------------T-FTPRTVIYDL---KGGFGTLQKYNA.LYG.....-----------
A5DLT9_PICGU/1-104---------------------------------N-YAPRALVYDL---NGGFGGAPKYEV.........-----------
D8Q938_SCHCM/2-119---------------------------------C-YSPRALIFDH---KSNFGTFAKSNI.LSS.....-----------
B6K201_SCHJY/2-136---------------------------------V-FHPRTLIYDD---RDAFGTTIKNSK.LLQPDIVE-----------
B4MB04_DROVI/5-140---------------------------------T-YTPRMLSVDL---AGTLGHLPVVGE.LYGNFLQL-----------

PF14881

DML1_ASPCL/119-303---------------------------------DQLRAFQLFAGS---DDAWG-GFAAKY-LDRIRDEY-----------
DML1_ASPNC/119-303---------------------------------DQLRALQVFTGS---DDAWG-GFAAKY-IDRIRDEY-----------
A6SSZ2_BOTFB/31-216---------------------------------DHMQGIQIMGGI---DDAWG-GFAARY-MDRLRDEY-----------
B2AWJ1_PODAN/149-315---------------------------------DFMQGFQVFMGV---DDAWG-GFGSRY-LERIRDEI-----------
B2WK69_PYRTR/102-289---------------------------------DGIQGLQIFTGV---DDAWG-GWASGW-IERLRDEY-----------
B6GW17_PENCW/119-303---------------------------------DHFRALQLFSGS---DDAWG-GFAAQY-MERLRDEF-----------
B6QAT3_PENMQ/119-303---------------------------------DHLRAFQLFTGS---DDAWG-GFGSRY-VDALRDEY-----------
C1GUC8_PARBA/119-303---------------------------------DQLQGIQIFSST---DDAWG-GFAARY-VDRLRDEF-----------
C4JY37_UNCRE/119-303---------------------------------DQLRGIQLFTGA---DDAWG-GFAARY-IDRLRDEF-----------
C5FUZ2_ARTOC/120-304---------------------------------DQLKGIQIFSGT---DDAWG-GFAASY-VDRLKDEY-----------
C7YZ58_NECH7/118-303---------------------------------DRLQGIQVFTTI---DDAWG-GFSSSY-LESLRDEF-----------
C8VQ22_EMENI/119-303---------------------------------DQLRALQIFTSS---DDAWG-GFTARY-VDRLVDEY-----------
E3QQX3_COLGM/121-306---------------------------------DQMQGLQIVTTI---DDAWG-GFATEY-VERLRDEY-----------
E9E9D2_METAQ/120-305---------------------------------DLMQGMQVFTTI---DDAWG-GFASSY-LEALRDEH-----------
F0XAM2_GROCL/124-310---------------------------------DQMQGLQVLTSI---DDAWG-GFAARY-LERLRDEY-----------
F2PVM6_TRIEC/101-285---------------------------------DQLKGIQIFSGV---NDAWG-GFAASY-VDRLKDEY-----------
DML1_ASPOR/119-303---------------------------------DQLRAIQLFTSS---DDAWG-GFSARY-VDRLRDEF-----------
DML1_NEUCR/119-307---------------------------------DQMQGIQVMTGL---DDAWG-GFAAKY-LERIRDEY-----------

PF03953

TBG_EMENI/263-392------------------------------RL..ASFIPWGPASIQVAL-------------TKKS-PYIQNT-------
TBA2_EMENI/265-395------------------------------AS..FNLVEWCPTGFKVGI-------------NYQK-PARVPG-------
TBA_ENCHE/237-367------------------------------RT..NQFVEWCPTGFKVGI-------------NSRK-PTVLDG-------
P92124_9MICR/238-368------------------------------RA..NQFVEWCPTGFKIGI-------------NDRK-PYVFED-------
TBA2_SCHPO/263-393------------------------------RT..IQFVDWCPTGFKIGI-------------CDRP-PQHIEG-------
TBA1_YEAST/264-394------------------------------KT..VQLVDWCPTGFKIGI-------------CYEP-PTATPN-------
O00907_BLEJA/239-369------------------------------RT..IQFVDWCPTGFKCGI-------------NYQP-PTVVPG-------
Q9HDT1_USTMD/262-392------------------------------RT..IQFVDWCPTGFKIGI-------------CNEP-PTTVPG-------
O01943_GECLA/256-386------------------------------RS..IQFVDWCPTGFKVGI-------------NYQA-PTVVPG-------
O93945_RHYSE/266-396------------------------------RT..IQFVDWCPTGFKIGI-------------CYQP-PEMVPN-------
P91873_CAEEL/269-399------------------------------RT..VQFVEWCPTGFKVGI-------------NYQP-PTVVPG-------
TBAL3_HUMAN/270-400------------------------------HS..VQFVDWCPTGFKVGI-------------NNRP-PTVMPG-------
O18154_CAEEL/260-388------------------------------RS..VQFVDWCPTGFKVGL-------------NYQP-PTVIPG-------
TBA4_DROME/274-404------------------------------RH..IQFVDWCPTGFKIGI-------------NYEK-PAFVPD-------
Q9GQC1_9MYCE/168-298------------------------------KS..ISFVDWSPSGFKCGI-------------NNEP-PTVVPG-------
Q9GQB7_9MYCE/169-301------------------------------KSQTVSFVDWSPTGFKCCI-------------NSNP-PTVVPG-------
TBA_DICDI/270-402------------------------------KSRNVSFVDWSPTGFKCGI-------------NNQA-PVSTKD-------
Q9GQB9_9EUKA/168-298------------------------------AG..IQIVDWSPCPFKIGI-------------NNRL-PSVIKG-------
TBA1_ENTHI/268-399------------------------------NT..VPFVGWCPCSFKCGI-------------NSQP-ATAVPG-------
O44024_RETFI/260-393------------------------------NK..VALVEWCPTGFKIGL-------------NEVP-AVTLES-------
Q9GQU7_ANTLO/246-369------------------------------NS..AHFVEWIPNNVKTAV-------------CDIP-PSGLDM-------
TBB_ENCHE/261-383------------------------------NS..TLFVEWIPSNVKTAV-------------CDIA-PTGLEM-------
Q9N6F5_9MICR/246-368------------------------------NN..ANFVEWIPNNVKTAV-------------CDIP-PSSLEM-------
TBB1_COLGL/264-384------------------------------NS..AYFVEWIPNNVQTAH-------------CSIP-PVGMNA-------
TBB1_GEOCN/261-383------------------------------NS..AYFVEWIPNNVQTAI-------------CSVP-PKDVKM-------
TBB_SCHPO/261-383------------------------------NS..AYFVEWIPDNVLKAV-------------CSVP-PKDLKM-------
Q9HGW5_9ASCO/245-367------------------------------NT..SYFVEWIPNNVNYAV-------------CSIP-PRGLKM-------
Q9UVQ7_9FUNG/246-368------------------------------NS..NYFVEWIPHNIKTSV-------------CNIP-PSGLKM-------
Q9P8Z1_UMBRA/246-368------------------------------NS..SYFVEWIPNSVKTSL-------------CDIP-PVGLKM-------
Q9P8Z5_SMICU/246-368------------------------------NA..SMFVEWIPNNVKTAV-------------CDIP-PVGMSM-------
O00817_CRYPV/263-385------------------------------NS..SYFVEWIPNNIKSSV-------------CDIP-PKGLKM-------
Q9LD24_BIGNA/246-368------------------------------NS..SYFVEWIPNNIKSAV-------------CDIA-PRGLKM-------
Q9ZTL8_9CRYP/246-368------------------------------NS..SYFVEWIPNHIIASI-------------CDVP-PRSLKM-------
O01676_BOMMO/261-383------------------------------NS..SYFVEWIPNNVKTAV-------------CDIP-PRGLKM-------
Q25165_SPIBA/246-368------------------------------NS..SYFVEWIPRNIMVGI-------------CDIP-PRGLKM-------
TBB1_CHOCR/263-385------------------------------NS..AYFVEWIPHNIKTSV-------------CDIP-AAGEKI-------
TBB2_PHYPO/261-383------------------------------NS..SFFVEWIPNNIKSSV-------------CDIP-PKGMKM-------
TBB_DICDI/266-388------------------------------NS..SYFVEWIPHNIKSSI-------------CDIP-PKGTPM-------
TBBN_GUITH/261-383------------------------------QS..EHFVEWIPHNIKSSV-------------CDIP-PKGMKM-------
TBB_PORPU/261-383------------------------------NS..GQFIDWIPNAIKASV-------------CDVA-PTGETM-------
Q26235_RETFI/261-383------------------------------NS..TYFVEWIPNNIKSSV-------------VNSP-LKGVRL-------
TBB3_ECHMU/261-383------------------------------NS..TYFVEWIPNNVKTAV-------------CDIP-PIDFKV-------
Q9UVR1_9FUNG/246-368------------------------------NA..SSFVEWIPNSTQIAV-------------CDIP-AIDSKL-------
TBBP_DROME/260-382------------------------------NI..NNFVDWIPNNIKTAI-------------CDIP-PRGLKM-------
TBB2_GEOCN/263-385------------------------------YS..PYFVEWIPNNVQTSV-------------CNVP-PKGLTT-------
Q26236_RETFI/267-390------------------------------MA..EDFVNWIPNNIKSSI-------------ISVP-PEDTLL-------
O46334_9EUKA/267-389------------------------------MS..EDFVTWIPNNIKSSI-------------INVP-PETTSI-------
TBE_MOUSE/294-414------------------------------LQ....FVSWNQEGWKTSL-------------CSVP-PVGHSH-------
Q9NI44_9TRYP/297-427------------------------------QK..LVYWNE..DGCKTAL-------------CSVS-PLGHRN-------
TBG_CHLRE/264-399------------------------------KQ..ANFIEWGPASIQVAL-------------SKKS-PYVQTA-------
O00896_PHYPO/261-387------------------------------KL..ASFIDWGPASIQVAL-------------SRKS-PYVKTA-------
Q9FRU9_TOBAC/264-395------------------------------KL..VNFIDWGPASIQVAL-------------SRKS-PYVQTA-------
TBG_DICDI/261-387------------------------------RM..ATFIDWGPASIQIAL-------------SKKS-PYIKSS-------
O00849_TETTH/263-389------------------------------KL..ANFINWGPASIQVAL-------------SKKS-PYIETS-------
Q9AR10_EUGGR/266-393------------------------------KM..ATFIPWGPASIQVAL-------------SRKS-PYIETA-------
TBG2_EUPOC/261-387------------------------------KL..ANFIPWGPASIQVAL-------------SKKS-PYIDSG-------
TBG2_DROME/264-394------------------------------KL..ANFIPWGPASIQVAL-------------PRSS-PYVQSA-------
TBG1_HUMAN/264-393------------------------------KL..ANFIPWGPASIQVAL-------------SRKS-PYLPSA-------
TBG_SCHPO/264-393------------------------------RY..ASFIPWGPASIQVAL-------------SKKS-PYIKTN-------
Q94771_9TRYP/266-393------------------------------S...PNFIPWGPASIQVIL-------------SKKS-PYLDTR-------
TBG_PLAFO/265-391------------------------------KL..VNFIKWNPASIQVTL-------------AKQS-PHVVSQ-------
TBG_RETFI/263-389------------------------------KI..VNFIPWGPASIQVAL-------------SKQS-PYANVP-------
TBG_ENTHI/259-383------------------------------RL..AEFVPWNKEAIKVVH-------------TRVS-PLVKRG-------
TBG_CANAX/299-418------------------------------IS....FVPWVARSVLVVH-------------GKKS-PYLKNT-------
TBG_YEAST/263-392------------------------------IK....FPSWSSSAMHVNI-------------GRRS-PYLPLQ-------
TBG_CAEEL/264-391------------------------------IR...RPPFYMLKPLRMMH-------------APLS-PYVRPQ-------

PF12327

FTSZ2_HALSA/239-333------------------------------LD.ASANVIWGARIQESYK-------------GKVR-VMAIMT-------
FTSZ_HALME/257-351------------------------------ID.PDARIIWGTSVDDELE-------------GMMR-TMIVVT-------
FTSZ_MYCKA/219-313------------------------------AH.PEANIIFGTVIDDSLG-------------DEVR-VTVIAA-------
FTSZ_CORGL/219-313------------------------------SD.EDVNLIFGTIIDDNLG-------------DEVR-VTVIAT-------
Q97IE9_CLOAB/222-316------------------------------AD.PDANIIFGAVIDENLK-------------DEIR-ITVIAT-------
O85474_9FIRM/222-316------------------------------VD.PDAEIIFGTSINENLG-------------EEII-ITVIAT-------
Q9SCC9_GUITH/260-354------------------------------VD.SNANIIFGALVDDNME-------------NEIS-ITVVAT-------
O85785_SYNE7/248-342------------------------------VD.PEANIIFGAVIDDRLE-------------GELR-ITVIAT-------
Q9AQ37_ANAPH/225-320------------------------------VD.EEANIIFGSTFDENSA-------------GRIR-VSVLAT-------
FTSZ_RICPR/225-321------------------------------VDNIDANIIFGSTFNPELK-------------GIIR-VSVVAT-------
FTSZ2_RHIME/224-319------------------------------VY.DEADIVVGAIFDRSLD-------------GTFR-VSVVAT-------
FTSZ_RHIRD/225-320------------------------------VD.PDANIILGATFDEALE-------------GLIR-VSVVAT-------
FTSZ_CAUCR/225-320------------------------------VD.PEANIIFGAAFDPSLE-------------GVIR-VSVVAT-------
Q9M7M6_9STRA/290-387------------------------------IEDEDANVIFGSSFDESLQ-------------GSIR-VSIVAT-------
FTSZ_BUCAI/221-316------------------------------SS.DHATVVIGTSLDPDMN-------------DTLR-VTVVAT-------
Q9F1M6_SHEVI/222-317------------------------------AS.DNATVVVGAVIDPEMS-------------DELR-VTVVAT-------
FTSZ_FRATH/221-316------------------------------IS.DEAIVIAGTVIDPDMS-------------DSMK-VTVVVT-------
FTSZ_PSEAE/222-317------------------------------AS.EHATVKVGTVIDADMR-------------DELH-VTVVAT-------
Q9CPA6_PASMU/244-342------------------------------AS.QEATVVIGTTLVPEMV-------------DEIR-VTIVAT-------
FTSZ_HAEIN/246-344------------------------------AS.EEATVVVGTSLVPEMS-------------DEIR-VTIVAT-------
Q9PF76_XYLFA/226-321------------------------------AS.EDATVVVGTVLDPEMQ-------------DEVR-VTVVAT-------
FTSZ2_METJA/246-343------------------------------LD.PEANVIWGARIDPEME-------------GCIR-VMAIIT-------
FTSZ2_ARCFU/238-332------------------------------ID.DYANVIWGARIDKEFE-------------GFVR-VVSIMT-------
FTSZ1_HALSA/261-355------------------------------ID.PDARIIWGTSIDEQIQ-------------EEMR-TMVVVT-------
FTSZ1_ARCFU/252-346------------------------------VD.PDARIIWGAMIDPELE-------------NTMR-TLIIVT-------
FTSZ_METTH/248-342------------------------------LD.PDANIIWGAQIQDELQ-------------NVIR-TTIVVA-------

PF13809

A0ZDE4_NODSP/18-373------------......SEQG--------ARIFGYLVISPE...LYGNT.........SN-MSAN-TYAALK-------
A1VSD1_POLNA/4-348------------....LYPDSK--------RFRILIYALLPD........AYPHPNWDTGN-YHAN-GFAALT-------
A3IHZ5_9CHRO/13-355------------......EAEG--------SPLVTAIVPMPQ...AFAGIKVG......DR-VLAN-GYAAMM-------
A5N8S7_CLOK5/35-392------------NNIYGSKGDD--------KVNIMGYLFTPD...VNLSRSADNQSAQ.SY-IIKN-GFAALK-------
A6NS46_9FIRM/38-402------------RNI.SVARYK--------NTGVSAYLMLPS......ACGSEPDPVRKEK-GNRN-AYAALK-------
A6P0V7_9FIRM/16-360------------N...TKYTNT--------SLIVRSVILLPE...TLDSVIDSTAER..ES-QRRN-AYATIK-------
A7VAW1_9CLOT/34-390------------....KAKKWA--------NLRIGGCLLMPD..VIFGNKSVTQDPELMFR-MMAN-GCAALK-------
A8SSW8_9FIRM/34-390------------....KAKKWN--------NLRIGGCLLMPD..VLFGYKAVYEDTELVSR-LNAN-GCATMK-------
B0JIZ1_MICAN/14-373------------.....QQTAE--------YTSFGYLVISPK...LYGDG.........AI-MRAN-TYAALK-------
B1VR11_STRGG/8-403------------....KMRRFN--------GVKIYPLVVMPS...SFPAATGGG.....RE-AELN-AARSLV-------
B2JAM4_NOSP7/13-355------------......KGQG--------SPLITAIIPMPN...AFASINVG......DR-VLAN-GYAALM-------
B3DW42_METI4/6-351------------....NYPDPL--------GYRIILYTLLPE........EHPKPNWNTGN-YHAN-GYAALV-------
B3QN46_CHLP8/22-399------------....NDVANQ--------GVTTNLVLLLPS...GYKGAGL.......TR-TEAN-TYAALM-------
E0UHW6_CYAP2/14-356------------......RGEG--------SPLITAIVPSPQ...AFANINVG......DR-VLSN-GYAALM-------
B8G8G2_CHLAD/22-363------------........GD--------DGEICGVFVMPS...VFLQEIASYVQR..LR-IQGN-AYAALK-------
B8HTJ0_CYAP4/11-352------------......PPSD--------LPQTSAYLVLPG...AFSGLG........DR-VVAN-AYAALM-------
C3B5Y7_BACMY/8-349------------R...KKLQHH--------NILIRGAFLMPD...ALVKTRTVSAKEF.ET-VQAN-GYASLK-------
C7QTL6_CYAP0/18-377------------......SKQG--------VQIVGYLVVAPN...LYTSPANPN.....PT-IFAN-TYAALK-------
D3EKE8_GEOS4/35-389------------ERDHGSAGID--------RVNTLGYLFTPD...INLANKSLSEHTR.EY-IKKN-GYAALK-------
Q114V2_TRIEI/18-373------------......GQQN--------TKIVGYLVISPE...LYGNN.........TN-MKAN-TYAALK-------
Q7NLY7_GLOVI/13-354------------......PPSD--------LPQSSAYLVLPG...AFSGLG........DR-VIAN-AYAALM-------
Q8DK50_THEEB/19-361------------......RGQS--------SPLVTAIVPMPN...AFAAISVG......DR-VLAN-GYAALM-------
Q9RWX7_DEIRA/11-368------------........SE--------EEKTLGMFTLPHPDLGIAQKPDA......EI-WKTN-AYHALA-------

PF00091

Q7NB81_MYCGA/75-255.....................K........I.ITLAYVVIPP.....NT----------.E-GSLS-YEKATD-------
B9LLN1_CHLSY/15-187.....................G........A.LTLAFVTMPF.....QV----------.E-KGQR-SRIAEQ-------
A9CGZ3_AGRT5/15-187.....................N........I.LTVGVVTLPF.....SF----------.E-GARR-MRAAEY-------
FTSZ_CAUCR/16-188.....................G........I.LTVGVVTKPF.....HF----------.E-GRHR-MRLADS-------
B4SJY0_STRM5/15-187.....................G........I.LTVAVVTKPF.....PF----------.E-GRRR-MQVALK-------
B3E8P4_GEOLS/12-183.....................G........A.LVVAVVTKPF.....AR----------.E-GKRR-TDIAEQ-------
Q4A669_MYCS5/37-207.....................G........A.LTIGIVTTPF.....SY----------.E-GPKR-KRIAKN-------
Q7Q808_ANOGA/3-224....................PG........K.ITNTFSVIPSP...KVS----------.E-VVVE-PYNAVF-------
FTSZA_DICDI/52-223.....................G........I.LTVGIVTKPF.....HF----------.E-GKHR-MKLAEQ-------
Q0HDQ9_SHESM/15-188.....................T........K.PVIAVVTMPF.....SF----------.E-GQHR-KTNAEA-------
TBG_CAEEL/6-229....................PK........K.VIQTYSVFANS...DTS----------TD-VVVH-PYNWVL-------
Q4QCZ3_LEIMA/2-292VYESKMMHYDGFDSSVQGTQRR........ARHLVNITVAPQ.....AL----------GE-VATQ-GLNAAL-------
FTSZ_THEMA/23-195.....................G........I.LTVAIVTTPF.....YF----------.E-GPER-LKKAIE-------
O96769_PARTE/4-227....................PK........K.IIQTYSVFPNQ...NET----------SD-VVVQ-PYNSLL-------
TBG_CANAX/4-262...................GHK........K.LLNTFSIFPSN...EDT----------SD-VVVQ-PYNTIL-------
A2EAH1_TRIVA/4-237....................KK........A.TTISYSVFPGE...EDK----------.D-VVVA-PYNSIL-------
Q24D61_TETTS/3-222....................PK........N.MISNFSIFPTP...GVN----------.D-IIVE-PYNAVL-------
Q3SEF9_PARTE/3-228....................EK........V.TKATVSVLSSN...HSL----------QS-SLIE-PYNSLL-------
Q3SEF7_PARTE/3-210....................GA........KVDKNAFLIYPSK...EIS----------.N-NTVD-AFNAVL-------
Q2S524_SALRD/20-193.....................D........I.LTVAIVTKPF.....DC----------.E-GSRR-MNTAQE-------
FTSZB_DICDI/62-236.....................KK......ET.IIVGVVTVPF.....NF----------.E-GKRK-EIIAKK-------
TBGN_GUITH/4-222....................PK........S.FINCCSIFPDL...YGN----------TQ-VTFQ-PYNSVL-------
A1SU24_PSYIN/26-198.....................G........A.LTIGVVSKPS.....TF----------.E-GKKR-INYANQ-------
A4SGZ8_PROVI/19-191.....................G........I.LTIGVVTRPF.....RF----------.E-GRVK-AEIADA-------
Q24D62_TETTS/3-222....................PN........Q.IITNFCIFPSS...QIS----------.D-CVVE-PYNCVL-------
FTSZ_BUCBP/12-184.....................G........I.LTVAVVTKPF.....NF----------.E-GKKR-MISAEQ-------
A0EC94_PARTE/3-226....................AK........T.TKLTVSVFPSTKQDQLF----------TQ-PIVE-PYNTIL-------
Q22CD2_TETTS/3-223....................NK........K.SVLGFTIYPSD...KTQ----------.T-NEFE-PYNSVL-------
Q23WP5_TETTS/3-226....................GQ........KIPIIFFQQIPCN...LNQ----------.S-SVFS-FYNSTL-------
Q72N68_LEPIC/14-186.....................K........C.LVVGVVTLPF.....SF----------.E-GRRR-MEFARK-------
Q7YZQ1_PARTE/3-225....................LK........Q.IRIGINIYPYP...NND----------.T-AIIE-SYNAIL-------
Q9NI44_9TRYP/4-260....................PH........V.FRICPVVMPSA...ID.----------.D-VVTA-PYNTAF-------
A0LNZ3_SYNFM/27-199.....................G........A.LTVAVVTKPF.....VV----------.E-GRVR-QRNADD-------
A0RW55_CENSY/7-167.....................G........R.PAVSFAMMPF.....GF----------..-EKDR-IANSGT-------
FTSZ_AQUAE/9-181.....................G........I.LTVAVATLPF.....RF----------.E-GPRK-MEKALK-------
Q9HKT7_THEAC/53-224.....................G........A.LTIAFATLPF.....SS----------.E-GYVR-MKNAAE-------
TBBP_DROME/3-223....................PD........N.LLCNYVTIPSP...NMS----------.Q-VVVE-PYNALL-------
Q8EUT3_MYCPE/17-194.....................G........I.LTIGLFNLPS.....IG----------AE-GEKT-YSNALL-------
Q3SD83_PARTE/3-220....................PY........SPFCSSFSILPN.....IV----------SS-NTIE-IYNTCF-------
Q4X7A3_PLACH/4-239.....................K........Q.IKFSNCVFPS.....AC----------DD-VITS-PYNSFF-------
Q7VI30_HELHP/38-211.....................G........A.LTVSVVTKPF.....KF----------.E-MGKR-ARLAEE-------
A1A2I4_BIFAA/16-188.....................G........A.LTIAVVTRPF.....SF----------.E-GPQR-SASAAL-------
FTSZ2_PYRKO/37-216.....................ARHNGRFREP.LVISVVTYPF.....KN----------.E-GKIR-EEKAKA-------
Q3SEG7_PARTE/3-216................................FFSSTSIFPN.....LQ----------SC-SAIE-IYNTIL-------
Q5UXI7_HALMA/2-181.....................E........K.PVYVLGILPG.....RD----------.E-GGLY-QANAGR-------
Q26BB8_FLABB/20-192.....................G........I.LTVGIVTTPF.....NF----------.E-GKVR-NEQAQL-------
Q481F5_COLP3/12-185.....................N........I.SCLAIVTLPF.....ES----------.E-GQIR-MDYALQ-------
Q7P689_FUSNV/23-195.....................D........V.LTVAVVTKPF.....NF----------.E-GERR-KNNAES-------
A0B5R2_METTP/3-192....................KN........A.TIVPIAVLPF.....RE----------.E-GTIY-LQNAAF-------
Q7Z1L8_SCHPL/3-225....................AK........R.LKISVVIYPCP...KLS----------.T-STVE-PYNAVL-------
Q0W1F0_UNCMA/28-198.....................G........A.VVVAIVTLPF.....S.----------.D-EVEA-RKKAVE-------
TBD_HUMAN/2-226....................SN........S.LKMNQIIWPY.....GT----------GE-VIVQ-NYNSIL-------
FTSZ2_METJA/39-209.....................G........A.IVVGVVTYPF.....KI----------.E-.RAR-MKKADE-------
Q3Z8S1_DEHE1/12-184.....................G........A.LTIAVCTKPF.....CF----------.E-GAHR-MQTAEE-------
TBE_HUMAN/4-257....................PE........V.YRFVTSIYPSG...ED.----------.D-VITS-PYNSIL-------
A0BWM1_PARTE/3-215..............................P.LLQYNLLIPSI...KQD----------DV-CVVS-PYNSIL-------
Q227Z6_TETTS/3-224....................PD........R.ITETFSIFPST...KIS----------.D-KIIE-PYNALL-------
Q8RT91_MYCHO/13-182.....................N........A.LVVAVVTTPF.....DF----------.E-GPKR-MRIAKQ-------
Q74M90_NANEQ/26-200.....................G........A.LVTSFAITPF.....RF----------.E-GR.R-LQIAWE-------
Q3SEG5_PARTE/3-205....................QK........S.MSFSFCLMPSP...NYR----------.N-NVIE-SYNSIM-------
TBG_ENTHI/4-222....................PK........N.ILTSFSVMVKE...NP.----------.D-VVVS-PYNSIL-------
Q4N7F3_THEPA/2-226....................PK........IPIITNIVDDEN.......----------.T-SPVA-SYNTLF-------
Q1CSP5_HELPH/29-202.....................G........A.LTIAIVTKPF.....KY----------.E-GNQK-RKRAEE-------
A1ZIZ2_9BACT/17-189.....................G........V.LTVAIVTAPF.....AF----------.E-GKKK-RKHAEN-------
A0RNH8_CAMFF/16-194.....................G........A.LTVAVITTPF.....AF----------.E-GKKR-MRLALE-------
Q64C34_9ARCH/27-198.....................G........A.IVVAMVSFPF.....EV----------.E-.RRR-RDKAAE-------
Q3SEH1_PARTE/3-208....................RK........V.RCNGFIIFPSS...KIS----------.N-NVVA-IYNAVL-------
Q70ZZ6_9BRYO/140-312.....................G........A.LTIGIVTEPF.....TF----------.E-GFTR-ARQARK-------
Q76DQ5_CYAME/99-290.....................G........V.LTIAVVSTPF.....AF----------.E-GRHR-MRLAEQ-------
Q3SEG3_PARTE/3-219....................PT........K.IVHCNPIFSQ....GIT----------.H-NCLE-IYNTAF-------
FTSZ_BACHD/13-185.....................G........A.LTVGVVTRPF.....TF----------.E-GRKR-STQAAA-------
Q3SEG6_PARTE/3-182.....................D........K.VIQTFTIFPN....QEY----------GH-DIVK-SAQSLR-------
Q8LRU3_CHLRE/4-257....................PG........V.FRFTGSVFPSE...DD.----------.D-VVTS-PYNAML-------
Q12VE8_METBU/3-192.....................D........F.PVYAVVVLPF.....RE----------.E-GTLY-LQNAAF-------
Q3SEH4_PARTE/3-225....................CK........K.SRLSITIYPSP...ETS----------.E-AMVE-PYNSIF-------
Q9HHS0_HALSA/2-183.....................D........R.PVYAVSVLPA.....TH----------.E-.EVP-PENPAR-------
TBG_YEAST/4-226....................PK........K.ILTTYSVFPA.....RS----------SE-VVVQ-SYNTIL-------
Q22UN3_TETTS/2-224....................FS........QIIHNTLVQLPDI..KDEN----------SW-NTLE-IYNTIL-------
FTSZ_PORGI/18-191.....................N........I.LTVGIVTIPF.....VF----------.E-GKRK-ILQALE-------
Q3SEH5_PARTE/3-210...................KNK........V.KTNGFIIFPSS...GMS----------.N-NILG-IYNAMF-------
FTSZ1_PYRFU/43-214.....................G........A.LTVSVVTLPF.....TM----------.E-GIRR-AKNAEY-------
Q16M50_AEDAE/10-229....................GK........T.TKIEFNIFPSP...RIS----------.P-VIVE-PYNAVL-------
Q2SS93_MYCCT/10-181.....................G........A.LVIGIVTKPF.....IF----------.E-GRHR-NVNAKE-------
Q9GRI0_PARTE/2-207....................PE........I.ELFNICVMPH.....LT----------GE-VILQ-SLNTVL-------
Q47AA9_DECAR/14-183.....................G........I.LTVGVVTKPF.....SF----------.E-GGKR-MKSAEA-------
O86305_MYCFE/11-183.....................G........I.LTVAVVTTPF.....EL----------IE-GKHK-SLIAQE-------
Q9VED6_DROME/6-227....................GK........KMTVVEFLVYPSP...SIS----------.P-VIVE-PYNALL-------
Q8T887_CIOIN/3-225....................PH........A.TLINPVVCPY.....TA----------GE-VAVQ-NYNAIL-------
Q6LXB6_METMP/37-208.....................G........A.LTVAVVTLPF.....SM----------.E-GKVR-MSNAIE-------
FTSZ_THEAC/44-215.....................G........S.IVISVVTLPF.....ES----------.E-GPLR-MDNAVI-------
Q4UCK3_THEAN/4-241....................PK........K.LIKTFSVFPQL...KKS----------SD-VVVQ-PYNTIL-------
O44024_RETFI/3-223....................RK........K.PKVGFEIYPSP...NLS----------.T-CVVE-PYNALL-------
A1AQ68_PELPD/26-199.....................G........ALMTVGIVTLPF.....NH----------.E-GKIR-METAEE-------
FTSZ1_HALSA/53-224.....................G........A.LTIAIVTTPF.....TA----------.E-GEVR-RTNAEA-------

PF10644

MSTO1_DANRE/6-118------------------------------..................T-----------E-N.EN-SAFTWD.......
Q54F51_DICDI/10-128------------------------------................QTS-----------K-N.ID-NNDILN.......
DML1_CANAL/2-128------------------------------............LPVDLNF-----------S-L.LS-TNTTAPAGAETGA
Q4SYY1_TETNG/6-118------------------------------..................P-----------G-K.DT-SAVTWE.......
E2BL93_HARSA/3-123------------------------------.............TEPTSI-----------E-A.TS-NNQLWN.......
E3QQX3_COLGM/2-117------------------------------..................A-----------S-QEGA-PAHLWS....HRE
D5G5A5_TUBMM/2-118------------------------------..............VERDS-----------D-A.GI-PQGLWD.......
Q16X91_AEDAE/5-123------------------------------.............QRTIDE-----------E-E.LV-AGIGWD.......
C4JY37_UNCRE/2-115------------------------------................AET-----------E-V.GM-PRGLWD.......
D2UYR3_NAEGR/2-136------------------------------............SVDQEFI-----------N-Q.HK-NITRWD.......
E0CVU9_VITVI/2-122------------------------------................HNP-----------P-V.PS-HVVTWP.......
C1C113_9MAXI/4-113------------------------------..................V-----------E-E.DE-DTQLWE.......
B0DQH6_LACBS/2-120------------------------------............VDDVEDE-----------S-GSES-APGPWT.......
E2AQP9_CAMFO/4-117------------------------------.................TA-----------D-D.PD-NHLLWD.......
E0VQ48_PEDHC/4-114------------------------------...................-----------.-E.ST-SAVSND.......
O23167_ARATH/2-123------------------------------................EGS-----------S-SRSD-SSATWF.......
E9EUC5_METAR/2-116------------------------------................AAS-----------D-TTVA-ADSLWT.......
D8RU99_SELML/2-124------------------------------..............EGQGV-----------L-H.GT-QLHTWT.......
F2SWU5_TRIRC/2-116------------------------------................LEE-----------D-QPGL-DSGLWD.......
B9S8K8_RICCO/2-124------------------------------................DGS-----------S-T.SS-EVITWT.......
C8VQ22_EMENI/2-115------------------------------................LAE-----------D-L.AP-GQGLWD.......
A9RV51_PHYPA/2-116------------------------------................YSP-----------Q-LQSS-SVNTCF.......
Q7QCR8_ANOGA/3-129------------------------------.......QPLDPDQIATDN-----------P-A.EL-PDIGWE.......
F2UAU4_SALS5/7-123------------------------------.................DA-----------S-Q.QA-QVASWD.......
E3WNL3_ANODA/3-126------------------------------............EELAPDG-----------D-TPYM-QHTTDE.......
A6ZMS3_YEAS7/2-114------------------------------................QDY-----------H-F.GN-EDKFKE.......
Q29JE8_DROPS/5-143------------------------------NEELLPLTTGNHLQKTRQS-----------A-E.QN-NLSTVD.......
Q018N1_OSTTA/3-113------------------------------..................D-----------A-A.AA-AAAAWS.......
B8P6F2_POSPM/2-128------------------------------......E..D..EEESAAQ-----------S-I.LQ-RKIIWTAHDYPRG
Q10PA8_ORYSJ/2-123------------------------------................TSA-----------S-ADQL-NVATWS.......
B1H304_XENTR/16-131------------------------------.................DR-----------D-T.TC-ATPAWT.......
B3MRV4_DROAN/5-145------------------------------DEELLPFGTGEDLNKTRQR-----------V-E.ES-GVAPTS.......
C7YZ58_NECH7/2-114------------------------------................AES-----------E-..VD-AASLWS.......
F0XAM2_GROCL/2-120------------------------------......A.....AQEGNDG-----------G-T.SS-TSGTWA.......
D2A4U9_TRICA/4-109------------------------------...................-----------.-..LP-SQSAPD.......
MSTO1_PONPY/6-121------------------------------..................D-----------K-Q.LD-AAIAWQ.......
B0WZB0_CULQU/3-122------------------------------............RKIPLDE-----------E-Q.ML-ENVVWE.......
F0ZVF4_DICPU/5-118------------------------------................QTN-----------N-N.NS-NNN..........
MST_DROME/5-143------------------------------DEELLPLSTGEELEQVRKR-----------A-E.ES-GVCSPE.......
A7SVU0_NEMVE/7-118------------------------------...................-----------.-SPSK-KYVDWE.......
C1BN10_9MAXI/2-112------------------------------.................VE-----------E-K.DG-HVQLWE.......
DML1_NEUCR/2-115------------------------------................DLE-----------E-G.QT-PQALWN.......
DML1_SCHPO/2-115------------------------------................LNE-----------S-S.GG-KGTAWD.......
B4NDP0_DROWI/5-139------------------------------NAD.......EDVQKTRQQ-----------V-K.ES-QLCSGD.......
B8M2T5_TALSN/2-115------------------------------................VED-----------P-S.GH-PQGQWE.......
DML1_PHANO/2-117------------------------------......P.....EDD...R-----------S-I.LD-QPGVWP.......
C5JKN9_AJEDS/2-115------------------------------................LEE-----------D-A.GL-PRGLWD.......
A5DLT9_PICGU/1-104------------------------------...................-----------.-....-DPSTIS.......
D8Q938_SCHCM/2-119------------------------------......T.....END.QSP-----------D-T.AA-VASLWK.......
B6K201_SCHJY/2-136------------------------------NNNNIDIFGYAKNDNRKTG-----------E-G.PE-DVNTWS.......
B4MB04_DROVI/5-140------------------------------ADE....QNADEIQKVKEL-----------A-E.QN-KLSTHG.......

PF14881

DML1_ASPCL/119-303------------------------------GKKAVWVWAM.EG....GSKLQRRNQLKRD.......I.NKAR-------
DML1_ASPNC/119-303------------------------------GKKS..VWVW.AI....ENGKKVDRQTQFKR....D.L.NKAR-------
A6SSZ2_BOTFB/31-216------------------------------GKTT..IWFW.GL....EDNIKGI...PREK.RFLK.LSNTAK-------
B2AWJ1_PODAN/149-315------------------------------TTQN.....H.AT......ANKSRSFTELYN.HSSI.L..VPL-------
B2WK69_PYRTR/102-289------------------------------GKMSIWTW...GL....GDQG.ANASTPRER.RLQQ.IANSAR-------
B6GW17_PENCW/119-303------------------------------GKKS..IWVW.AI....EDGTKTQRH....H.QFKKDT.NKAR-------
B6QAT3_PENMQ/119-303------------------------------GKTGI..WVW.GVEDGTRLPRHKKMSKMI.N.TSRT.I.NSIA-------
C1GUC8_PARBA/119-303------------------------------GKKS..IWFW.GL....EDGARFQRHM...Q.AIAT.A.NSAR-------
C4JY37_UNCRE/119-303------------------------------GKKSI..WTF.AS....ESGGKLDRGK...Q.YLRA.K.NSAK-------
C5FUZ2_ARTOC/120-304------------------------------GGKSIWTWAINGS....SDPQRE......KR.RLAS.A.NMAR-------
C7YZ58_NECH7/118-303------------------------------PKSCI..WTW.GL....QSPLLDIPRAKR...QLRL.A.NLAH-------
C8VQ22_EMENI/119-303------------------------------GKKAVLLWA...I....EDGRRIHQTAKLKR.ET.....NKAR-------
E3QQX3_COLGM/121-306------------------------------GK..VTIWVW.GL....QTPMP...AARIDQKRLQM.T.NTAR-------
E9E9D2_METAQ/120-305------------------------------PKS..CIWVW.GI....QSPLADISR...EK.RLLR.LSNTAQ-------
F0XAM2_GROCL/124-310------------------------------GKSTV..WLW.AL....QEPVARMPRAK..R.LVRL.A.NKAR-------
F2PVM6_TRIEC/101-285------------------------------GSKSIWTWAL.ND....SSSLQREK.....R.KLAS.A.NLAR-------
DML1_ASPOR/119-303------------------------------GKKS..IWVW.AI....EGGSRVSRQTQLKR.DM.....NKAR-------
DML1_NEUCR/119-307------------------------------GKTAMFVWGS..E....QESVMRAGGLSREK.RLLR.LANKAR-------

PF03953

TBG_EMENI/263-392----H....---------------------------------------------.RVSGLML------------------
TBA2_EMENI/265-395----SELAP---------------------------------------------VDRSVSML------------------
TBA_ENCHE/237-367----EAMAE---------------------------------------------VSRAVCAL------------------
P92124_9MICR/238-368----GAMAP---------------------------------------------VDRAVCML------------------
TBA2_SCHPO/263-393----SEIAK---------------------------------------------VDRAVCML------------------
TBA1_YEAST/264-394----SQLAT---------------------------------------------VDRAVCML------------------
O00907_BLEJA/239-369----GDLAK---------------------------------------------VMRAVCMI------------------
Q9HDT1_USTMD/262-392----GDLAK---------------------------------------------VSRSLCML------------------
O01943_GECLA/256-386----GDLAK---------------------------------------------VNRAVCML------------------
O93945_RHYSE/266-396----GDLAK---------------------------------------------VNRAVCML------------------
P91873_CAEEL/269-399----GDLGK---------------------------------------------QTRSVCMI------------------
TBAL3_HUMAN/270-400----GDLAK---------------------------------------------VHRSICML------------------
O18154_CAEEL/260-388----GDMAK---------------------------------------------VPRAVCML------------------
TBA4_DROME/274-404----GDLAK---------------------------------------------TSRACCML------------------
Q9GQC1_9MYCE/168-298----GDLAK---------------------------------------------VEKAVCML------------------
Q9GQB7_9MYCE/169-301----GDLSR---------------------------------------------VEKSVCML------------------
TBA_DICDI/270-402----SEMAE---------------------------------------------VKKSVCML------------------
Q9GQB9_9EUKA/168-298----ADMAP---------------------------------------------VDKTVALL------------------
TBA1_ENTHI/268-399----SSYAS---------------------------------------------TARSACMI------------------
O44024_RETFI/260-393----DDIGA---------------------------------------------FSKNAVMI------------------
Q9GQU7_ANTLO/246-369----S....---------------------------------------------....ATFI------------------
TBB_ENCHE/261-383----S....---------------------------------------------....ATFV------------------
Q9N6F5_9MICR/246-368----S....---------------------------------------------....STFI------------------
TBB1_COLGL/264-384----S....---------------------------------------------....STFI------------------
TBB1_GEOCN/261-383----S....---------------------------------------------....ATFI------------------
TBB_SCHPO/261-383----S....---------------------------------------------....ATFI------------------
Q9HGW5_9ASCO/245-367----A....---------------------------------------------....STFI------------------
Q9UVQ7_9FUNG/246-368----S....---------------------------------------------....ATFI------------------
Q9P8Z1_UMBRA/246-368----S....---------------------------------------------....GTFI------------------
Q9P8Z5_SMICU/246-368----A....---------------------------------------------....ATFV------------------
O00817_CRYPV/263-385----A....---------------------------------------------....STFV------------------
Q9LD24_BIGNA/246-368----S....---------------------------------------------....TTFI------------------
Q9ZTL8_9CRYP/246-368----S....---------------------------------------------....ATFI------------------
O01676_BOMMO/261-383----A....---------------------------------------------....ATFI------------------
Q25165_SPIBA/246-368----S....---------------------------------------------....GTFI------------------
TBB1_CHOCR/263-385----S....---------------------------------------------....SAFI------------------
TBB2_PHYPO/261-383----S....---------------------------------------------....ATFI------------------
TBB_DICDI/266-388----A....---------------------------------------------....VTFI------------------
TBBN_GUITH/261-383----S....---------------------------------------------....AAFI------------------
TBB_PORPU/261-383----S....---------------------------------------------....AAFI------------------
Q26235_RETFI/261-383----S....---------------------------------------------....VTFL------------------
TBB3_ECHMU/261-383----A....---------------------------------------------....GTFI------------------
Q9UVR1_9FUNG/246-368----S....---------------------------------------------....ATFL------------------
TBBP_DROME/260-382----S....---------------------------------------------....ATFI------------------
TBB2_GEOCN/263-385----S....---------------------------------------------....ATFI------------------
Q26236_RETFI/267-390----S....---------------------------------------------....GTFV------------------
O46334_9EUKA/267-389----S....---------------------------------------------....GTFV------------------
TBE_MOUSE/294-414----S....---------------------------------------------....LLAL------------------
Q9NI44_9TRYP/297-427----S....---------------------------------------------....VLML------------------
TBG_CHLRE/264-399----H....---------------------------------------------.RVSGLML------------------
O00896_PHYPO/261-387----H....---------------------------------------------.RVSGLML------------------
Q9FRU9_TOBAC/264-395----H....---------------------------------------------.RVSGLML------------------
TBG_DICDI/261-387----H....---------------------------------------------.KVSGLML------------------
O00849_TETTH/263-389----H....---------------------------------------------.KVSGLML------------------
Q9AR10_EUGGR/266-393----H....---------------------------------------------.RVSGLML------------------
TBG2_EUPOC/261-387----H....---------------------------------------------.KVSGLML------------------
TBG2_DROME/264-394----H....---------------------------------------------.KVSGLMM------------------
TBG1_HUMAN/264-393----H....---------------------------------------------.RVSGLMM------------------
TBG_SCHPO/264-393----H....---------------------------------------------.RVSGLML------------------
Q94771_9TRYP/266-393----H....---------------------------------------------.RVSGLVM------------------
TBG_PLAFO/265-391----H....---------------------------------------------.KVCGLMM------------------
TBG_RETFI/263-389----Y....---------------------------------------------.RVSGCMM------------------
TBG_ENTHI/259-383----N....---------------------------------------------.RMSGMLL------------------
TBG_CANAX/299-418----N....---------------------------------------------..LEGIQV------------------
TBG_YEAST/263-392----PNE..---------------------------------------------NEVSGMML------------------
TBG_CAEEL/264-391----Y....---------------------------------------------.KVSGLLL------------------

PF12327

FTSZ2_HALSA/239-333----G---------------------------------------------------------------------------
FTSZ_HALME/257-351----G---------------------------------------------------------------------------
FTSZ_MYCKA/219-313----G---------------------------------------------------------------------------
FTSZ_CORGL/219-313----G---------------------------------------------------------------------------
Q97IE9_CLOAB/222-316----G---------------------------------------------------------------------------
O85474_9FIRM/222-316----D---------------------------------------------------------------------------
Q9SCC9_GUITH/260-354----G---------------------------------------------------------------------------
O85785_SYNE7/248-342----G---------------------------------------------------------------------------
Q9AQ37_ANAPH/225-320----G---------------------------------------------------------------------------
FTSZ_RICPR/225-321----G---------------------------------------------------------------------------
FTSZ2_RHIME/224-319----G---------------------------------------------------------------------------
FTSZ_RHIRD/225-320----G---------------------------------------------------------------------------
FTSZ_CAUCR/225-320----G---------------------------------------------------------------------------
Q9M7M6_9STRA/290-387----G---------------------------------------------------------------------------
FTSZ_BUCAI/221-316----G---------------------------------------------------------------------------
Q9F1M6_SHEVI/222-317----G---------------------------------------------------------------------------
FTSZ_FRATH/221-316----G---------------------------------------------------------------------------
FTSZ_PSEAE/222-317----G---------------------------------------------------------------------------
Q9CPA6_PASMU/244-342----G---------------------------------------------------------------------------
FTSZ_HAEIN/246-344----G---------------------------------------------------------------------------
Q9PF76_XYLFA/226-321----G---------------------------------------------------------------------------
FTSZ2_METJA/246-343----G---------------------------------------------------------------------------
FTSZ2_ARCFU/238-332----G---------------------------------------------------------------------------
FTSZ1_HALSA/261-355----G---------------------------------------------------------------------------
FTSZ1_ARCFU/252-346----G---------------------------------------------------------------------------
FTSZ_METTH/248-342----G---------------------------------------------------------------------------

PF13809

A0ZDE4_NODSP/18-373----ELNHY-SNPGTEFAACYDIENLSIIKEKRP....................PFDYAYLL------------------
A1VSD1_POLNA/4-348----ELNAM-SVGAYQPYDVTGVKQRLT..LSD.....................PFNGCYIF------------------
A3IHZ5_9CHRO/13-355----ELSYF-SDYRTEYNSQFSKNLADEVRSNRA....................PFDFTYLV------------------
A5N8S7_CLOK5/35-392----ELDYL-MGIGDRHERFTQKYRNRLT.VDSPMP..................PFNLCHLI------------------
A6NS46_9FIRM/38-402----EIDYF-MGLQSRGEVFRQQYGTFNV.EISEN...................IFDFCTLV------------------
A6P0V7_9FIRM/16-360----EINAF-MMKGSGFMDVGDSELSRYR.NLNIAFAMPGTDELKFLSLL....PFDFCFLM------------------
A7VAW1_9CLOT/34-390----EVDYY-MKLSEKDDAYIFESTTHKM.VIREN...................LFDACMLV------------------
A8SSW8_9FIRM/34-390----EVDYY-MKLSEKDDNYTFISKDNKM.VIREN...................LFDACMLV------------------
B0JIZ1_MICAN/14-373----ELDHY-TNESNSFQVCYDKQNFVNIDEKRS....................PFDFAYLV------------------
B1VR11_STRGG/8-403----DLFRL-VDGQNAPTAGAELGDLDQE.TGLGIRYPGVTPVRLRTGILPTAFLFSPTAGI------------------
B2JAM4_NOSP7/13-355----ELSYF-SDYRTEYISQFSAGLVDEVRNKLP....................PFDFTYLV------------------
B3DW42_METI4/6-351----ELNAL-SIGKFSPCDIAGDGKKLEG.LKD.....................PFNGCYLF------------------
B3QN46_CHLP8/22-399----ELETC-MRQGSRYIKQWAAGEVPRN.MPNS....................PYSDVYLI------------------
E0UHW6_CYAP2/14-356----ELNYY-SDYRTEYIQQYSAGLVDEVRSKLP....................PFDFTYLV------------------
B8G8G2_CHLAD/22-363----ELNYY-LSGQQQFEATFPDYAYQTP.DGAKQVMYVRR.............PFDTVFLV------------------
B8HTJ0_CYAP4/11-352----ELNHF-SQGDTRFEAQYGSSSSDRISTQSGQDV.................PFNFCYLV------------------
C3B5Y7_BACMY/8-349----ELHAI-TLGSTGELSKRGGVTIELE.YRPDQVDEDGRTNHTIKEHHL...PYNYCFLY------------------
C7QTL6_CYAP0/18-377----ELNYY-STPGTQFKACYDIQNMAIVDEDRP....................PFDYTYLV------------------
D3EKE8_GEOS4/35-389----ELDYW-MNVDARGERFKQQYGNILN.VNSPLP..................PFNLCHLI------------------
Q114V2_TRIEI/18-373----ELNHY-TTPGTKFEACYDIQDLVIVQSERP....................PYDYAYLV------------------
Q7NLY7_GLOVI/13-354----ELDYY-SRTDTRFEAQYSTAASDRISDQSGRDV.................PFNFCYLV------------------
Q8DK50_THEEB/19-361----ELSYF-SDYRTEYLAQFSSSLADEVRYSCP....................PFDFTYLV------------------
Q9RWX7_DEIRA/11-368----ELNQY-HLHNDRERYQSIKYPDKPE.GTAILPGDAM..............PYDLVYLL------------------

PF00091

Q7NB81_MYCGA/75-255----ALYDL.LK------------------------------------------DANAISQL------------------
B9LLN1_CHLSY/15-187----GLASV.SK------------------------------------------EADAVVVV------------------
A9CGZ3_AGRT5/15-187----GFANL.LN------------------------------------------TADTVIVI------------------
FTSZ_CAUCR/16-188----GIQEL.QR------------------------------------------YVDTLIVI------------------
B4SJY0_STRM5/15-187----GIEEL.SQ------------------------------------------HCDSLITI------------------
B3E8P4_GEOLS/12-183----GIKML.LS------------------------------------------LVDSLIVI------------------
Q4A669_MYCS5/37-207----GIQEL.SK------------------------------------------VVDSYIVL------------------
Q7Q808_ANOGA/3-224----ALSSM.IR------------------------------------------SSDETFCL------------------
FTSZA_DICDI/52-223----GLIEL.EK------------------------------------------SVDSLIVI------------------
Q0HDQ9_SHESM/15-188----GLQEL.LE------------------------------------------SANAVIVL------------------
TBG_CAEEL/6-229----SMQRL.IE------------------------------------------NPDHVVVL------------------
Q4QCZ3_LEIMA/2-292----TLQHL.QR------------------------------------------HADAILLL------------------
FTSZ_THEMA/23-195----GLKKL.RK------------------------------------------HVDTLIKI------------------
O96769_PARTE/4-227----TLRRL.AQ------------------------------------------NADAVVVL------------------
TBG_CANAX/4-262----TLKRL.ID------------------------------------------YSDATFVF------------------
A2EAH1_TRIVA/4-237----TLKRL.TN------------------------------------------NCDAVVVL------------------
Q24D61_TETTS/3-222----SIPGL.YS------------------------------------------QSNFCFSF------------------
Q3SEF9_PARTE/3-228----TIKYL.KE------------------------------------------KADMSIML------------------
Q3SEF7_PARTE/3-210----ATHVT.IE------------------------------------------HCDSVVML------------------
Q2S524_SALRD/20-193----GIELL.RE------------------------------------------NVDTLIVI------------------
FTSZB_DICDI/62-236----GLEEL.SK------------------------------------------YVDTLVVI------------------
TBGN_GUITH/4-222----SIAWQ.GL------------------------------------------YCDSNIFF------------------
A1SU24_PSYIN/26-198----GIERL.AE------------------------------------------HIDSLLII------------------
A4SGZ8_PROVI/19-191----GITEL.RK------------------------------------------YIDTLILV------------------
Q24D62_TETTS/3-222----SLPGL.LQ------------------------------------------NQDLCFCY------------------
FTSZ_BUCBP/12-184----GVSEL.SK------------------------------------------YVDSLIII------------------
A0EC94_PARTE/3-226----TLPTL.SE------------------------------------------LSDFNILY------------------
Q22CD2_TETTS/3-223----YSQNL.IE------------------------------------------NGDVNLVF------------------
Q23WP5_TETTS/3-226----NLGSL.LE------------------------------------------ESSLNILF------------------
Q72N68_LEPIC/14-186----GIEQL.RS------------------------------------------HVDTLILI------------------
Q7YZQ1_PARTE/3-225----ATQYL.QK------------------------------------------FADVCILF------------------
Q9NI44_9TRYP/4-260----AVREL.IE------------------------------------------HADAVLPL------------------
A0LNZ3_SYNFM/27-199----GLKSL.QD------------------------------------------VVDTLITI------------------
A0RW55_CENSY/7-167----ALKRL.RE------------------------------------------DSGCTIVI------------------
FTSZ_AQUAE/9-181----GLEKL.KE------------------------------------------SSDAYIVI------------------
Q9HKT7_THEAC/53-224----GIRKL.VK------------------------------------------NSDAAIVI------------------
TBBP_DROME/3-223----STPAL.VN------------------------------------------NSHLTFCL------------------
Q8EUT3_MYCPE/17-194----GLQNL.AL------------------------------------------CCNGLTTV------------------
Q3SD83_PARTE/3-220----SMHKL.IE------------------------------------------YCDVVMLF------------------
Q4X7A3_PLACH/4-239----ALTKI.HE------------------------------------------FSNCVLPV------------------
Q7VI30_HELHP/38-211----GLRNL.KA------------------------------------------ESDCIIVI------------------
A1A2I4_BIFAA/16-188----GIENL.RK------------------------------------------EVDALIVI------------------
FTSZ2_PYRKO/37-216----GIKAL.LY------------------------------------------YSDTVVII------------------
Q3SEG7_PARTE/3-216----SLNQL.IF------------------------------------------NCNYCMVY------------------
Q5UXI7_HALMA/2-181----SLKTA.AR------------------------------------------EADSLLLV------------------
Q26BB8_FLABB/20-192----GIEKF.RS------------------------------------------QVDSLIII------------------
Q481F5_COLP3/12-185----GIGDI.KE------------------------------------------PIHAYITL------------------
Q7P689_FUSNV/23-195----GIELL.RQ------------------------------------------NVDSLVII------------------
A0B5R2_METTP/3-192----CLREMIEV------------------------------------------EADGMILV------------------
Q7Z1L8_SCHPL/3-225----TSHFT.LE------------------------------------------QGELSVFF------------------
Q0W1F0_UNCMA/28-198----GVEKM.LD------------------------------------------IASTTIVI------------------
TBD_HUMAN/2-226----TLSHL.YR------------------------------------------SSDALLLH------------------
FTSZ2_METJA/39-209----GIARM.SE------------------------------------------VCDTVIII------------------
Q3Z8S1_DEHE1/12-184----GINNI.VD------------------------------------------SVDTLIII------------------
TBE_HUMAN/4-257----AMKEL.NE------------------------------------------HADCVLPI------------------
A0BWM1_PARTE/3-215----ALSQI.MN------------------------------------------QREQIVCF------------------
Q227Z6_TETTS/3-224----SINQL.IE------------------------------------------YADQTMVI------------------
Q8RT91_MYCHO/13-182----GLQEI.KK------------------------------------------CVDSYIVI------------------
Q74M90_NANEQ/26-200----GIRRL.TE------------------------------------------FSNTTVIL------------------
Q3SEG5_PARTE/3-205----SLNSM.VE------------------------------------------AFDGVILL------------------
TBG_ENTHI/4-222----TLRRL.IT------------------------------------------ECQSVVVF------------------
Q4N7F3_THEPA/2-226----SLSVL.QE------------------------------------------HSTMIIPF------------------
Q1CSP5_HELPH/29-202----GLKEL.EQ------------------------------------------SSDSILVI------------------
A1ZIZ2_9BACT/17-189----GINQL.KQ------------------------------------------HCDTVLVI------------------
A0RNH8_CAMFF/16-194----GIEEL.KK------------------------------------------ECDSIVVI------------------
Q64C34_9ARCH/27-198----GIKKL.RE------------------------------------------STDTVIVL------------------
Q3SEH1_PARTE/3-208----SMENL.MY------------------------------------------SFNSITMF------------------
Q70ZZ6_9BRYO/140-312----AIEDM.RH------------------------------------------AADTVVVV------------------
Q76DQ5_CYAME/99-290----GLDEL.EP------------------------------------------QVDTIVTI------------------
Q3SEG3_PARTE/3-219----IMNSM.IE------------------------------------------IVDIVTVY------------------
FTSZ_BACHD/13-185----GIAAL.KE------------------------------------------KVDTLIVI------------------
Q3SEG6_PARTE/3-182----FLEGL...------------------------------------------...NVVAF------------------
Q8LRU3_CHLRE/4-257----ALGQL.VE------------------------------------------HADCVLPI------------------
Q12VE8_METBU/3-192----CLKEIRDS------------------------------------------GVDGIILA------------------
Q3SEH4_PARTE/3-225----ATSSL.LE------------------------------------------HSEVCIAM------------------
Q9HHS0_HALSA/2-183----AIAAF.ES------------------------------------------AANAQLVF------------------
TBG_YEAST/4-226----ALRRL.IE------------------------------------------DSDATVVF------------------
Q22UN3_TETTS/2-224----SLHSL.V.------------------------------------------ISDIVIPF------------------
FTSZ_PORGI/18-191----GVEEM.RK------------------------------------------NVDALLVV------------------
Q3SEH5_PARTE/3-210----SIQMT.RN------------------------------------------HFHSITMF------------------
FTSZ1_PYRFU/43-214----GLKRL.VK------------------------------------------YSDTVIVI------------------
Q16M50_AEDAE/10-229----STHVG.MD------------------------------------------YSDCAFLL------------------
Q2SS93_MYCCT/10-181----GLEEL.RK------------------------------------------YVDSVIVV------------------
Q9GRI0_PARTE/2-207----TIGSI.YQ------------------------------------------HSEGIILL------------------
Q47AA9_DECAR/14-183----GIAEF.AK------------------------------------------HVDSLIVI------------------
O86305_MYCFE/11-183----GLKKL.SE------------------------------------------VVDSYIVI------------------
Q9VED6_DROME/6-227----AAHFS.MD------------------------------------------CADVSFIV------------------
Q8T887_CIOIN/3-225----SLSNM.CA------------------------------------------TTDANILL------------------
Q6LXB6_METMP/37-208----GLNKL.KE------------------------------------------VADTIVII------------------
FTSZ_THEAC/44-215----GLEKL.AQ------------------------------------------FSDTLVAI------------------
Q4UCK3_THEAN/4-241----SLKRL.IL------------------------------------------NADLVNVI------------------
O44024_RETFI/3-223----ATHWL.LD------------------------------------------HTEVSLLL------------------
A1AQ68_PELPD/26-199----GVRAL.GK------------------------------------------RVDSLIVI------------------
FTSZ1_HALSA/53-224----GLERL.RD------------------------------------------VADTVIVV------------------

PF10644

MSTO1_DANRE/6-118G...QIMTH---------------------------------------------Q.ES..PP------------------
Q54F51_DICDI/10-128....SGSGG---------------------------------------------SSVN..KI------------------
DML1_CANAL/2-128GSSLESGYN---------------------------------------------LKKS..RV------------------
Q4SYY1_TETNG/6-118G...SLMMH---------------------------------------------K.ES..PP------------------
E2BL93_HARSA/3-123DEQLDIISA---------------------------------------------EIPN..LE------------------
E3QQX3_COLGM/2-117G...SPQVH---------------------------------------------R.QP..QV------------------
D5G5A5_TUBMM/2-118N...GMTIQ---------------------------------------------R.EP..LV------------------
Q16X91_AEDAE/5-123..SGKVEVI---------------------------------------------K.KD..PV------------------
C4JY37_UNCRE/2-115G...NEVIQ---------------------------------------------R.QT..VI------------------
D2UYR3_NAEGR/2-136....KLEVM---------------------------------------------KTFE..NT------------------
E0CVU9_VITVI/2-122G...NVSTH---------------------------------------------L.SE..PH------------------
C1C113_9MAXI/4-113G...NVRKE---------------------------------------------N......R------------------
B0DQH6_LACBS/2-120G...GIVEY---------------------------------------------R.QT..RM------------------
E2AQP9_CAMFO/4-117DTKLEITSA---------------------------------------------E.....LS------------------
E0VQ48_PEDHC/4-114D...QTIAI---------------------------------------------QDQN..LP------------------
O23167_ARATH/2-123G...DVDTQ---------------------------------------------R.SE..PR------------------
E9EUC5_METAR/2-116G...PSTVH---------------------------------------------Q.QK..LV------------------
D8RU99_SELML/2-124G...PVSLH---------------------------------------------K.EE..PP------------------
F2SWU5_TRIRC/2-116T...SGVLQ---------------------------------------------Q.QP..KI------------------
B9S8K8_RICCO/2-124G...NISTH---------------------------------------------A.SG..PS------------------
C8VQ22_EMENI/2-115G...KEIRQ---------------------------------------------E.LV..PI------------------
A9RV51_PHYPA/2-116....SSIEF---------------------------------------------Q.ST..NV------------------
Q7QCR8_ANOGA/3-129..SEKVEVI---------------------------------------------K.QQDKPA------------------
F2UAU4_SALS5/7-123P...ERVER---------------------------------------------LMQP..LD------------------
E3WNL3_ANODA/3-126SDIGAVEVI---------------------------------------------K.QG.ERY------------------
A6ZMS3_YEAS7/2-114....QTVIK---------------------------------------------T.HP..RI------------------
Q29JE8_DROPS/5-143....QLEVR---------------------------------------------E.QP..QV------------------
Q018N1_OSTTA/3-113G...AWTVT---------------------------------------------R.AP..PT------------------
B8P6F2_POSPM/2-128G...GVVEH---------------------------------------------R.QE..RM------------------
Q10PA8_ORYSJ/2-123G...SVTRS---------------------------------------------V.SK..PH------------------
B1H304_XENTR/16-131G...NLSTH---------------------------------------------R.EE..PQ------------------
B3MRV4_DROAN/5-145....QLELQ---------------------------------------------E.EP..PT------------------
C7YZ58_NECH7/2-114G...QSVVH---------------------------------------------K.QT..PI------------------
F0XAM2_GROCL/2-120G...QAVVQ---------------------------------------------R.ET..PI------------------
D2A4U9_TRICA/4-109....QVEII---------------------------------------------A.QP..PE------------------
MSTO1_PONPY/6-121G...KLTTH---------------------------------------------K.EE..LY------------------
B0WZB0_CULQU/3-122..SGRVEVV---------------------------------------------K.EA..KV------------------
F0ZVF4_DICPU/5-118....EFSSN---------------------------------------------QKVT..KI------------------
MST_DROME/5-143....QLEVQ---------------------------------------------E.QS..KA------------------
A7SVU0_NEMVE/7-118G...EITIY---------------------------------------------E.TN..PD------------------
C1BN10_9MAXI/2-112G...DIRKE---------------------------------------------N......R------------------
DML1_NEUCR/2-115G...PTVLQ---------------------------------------------K.QP..AI------------------
DML1_SCHPO/2-115G...KLTQI---------------------------------------------M.QT..PV------------------
B4NDP0_DROWI/5-139....QLDVV---------------------------------------------E.QP..LA------------------
B8M2T5_TALSN/2-115G...NEVVQ---------------------------------------------K.QP..SI------------------
DML1_PHANO/2-117S...KPIVQ---------------------------------------------R.TQ..PI------------------
C5JKN9_AJEDS/2-115G...NKVVH---------------------------------------------R.QP..AI------------------
A5DLT9_PICGU/1-104....NVEVI---------------------------------------------NTAP..RV------------------
D8Q938_SCHCM/2-119G...AVDEQ---------------------------------------------Q.SD..PI------------------
B6K201_SCHJY/2-136G...KTVCV---------------------------------------------E.AP..PL------------------
B4MB04_DROVI/5-140....ELDVR---------------------------------------------K.QP..AA------------------

PF14881

DML1_ASPCL/119-303----SIHAM.AP...---------------------------------------QSSLYVPIKDPPGHVPS........T
DML1_ASPNC/119-303----SVHAI.ST...---------------------------------------QASLYAPI........IDP....PSR
A6SSZ2_BOTFB/31-216----SISEI.IP...---------------------------------------QTSLFIPM........T........I
B2AWJ1_PODAN/149-315----SLPSLLPP...---------------------------------------SLTNFDP...................
B2WK69_PYRTR/102-289----SLQIL.GE...---------------------------------------QSSVYVPM........S........N
B6GW17_PENCW/119-303----SLYAI.AP...---------------------------------------LASLYFPI........I........D
B6QAT3_PENMQ/119-303----PLATL.YCPIV---------------------------------------DVPQHLPK........Y........L
C1GUC8_PARBA/119-303----SVNEI.SP...---------------------------------------QTSAYVPI........L........D
C4JY37_UNCRE/119-303----TLCEL.SS...---------------------------------------QSTAYIPI........S........K
C5FUZ2_ARTOC/120-304----SLSEM.CS...---------------------------------------QVTAFIPI........A........A
C7YZ58_NECH7/118-303----SVEQL.ST...---------------------------------------QASTLVPL........ALP....END
C8VQ22_EMENI/119-303----SVYSM.SP...---------------------------------------EATMYTPI........IDPPSRLPST
E3QQX3_COLGM/121-306----TIKDL.SE...---------------------------------------YASMLVPM........ALP....QTR
E9E9D2_METAQ/120-305----SLQQA.YT...---------------------------------------QASTLVPL........A........L
F0XAM2_GROCL/124-310----TLASA.AG...---------------------------------------QASLVVPI........A........M
F2PVM6_TRIEC/101-285----SVSEI.GS...---------------------------------------QVTAFIPI........A........D
DML1_ASPOR/119-303----TIYSI.SP...---------------------------------------QSSLYTPI........IDP...PSHT
DML1_NEUCR/119-307----TMTEV.YK...---------------------------------------YASVVVPF........TV.....PAT

PF03953

TBG_EMENI/263-392------------------A---------------------NH--TSVATLFKR---------------------------
TBA2_EMENI/265-395------------------S---------------------NT--TAISEAWSR---------------------------
TBA_ENCHE/237-367------------------S---------------------NT--TAISEAWKR---------------------------
P92124_9MICR/238-368------------------S---------------------NT--TAISEAWKR---------------------------
TBA2_SCHPO/263-393------------------S---------------------NT--TSIAEAWSR---------------------------
TBA1_YEAST/264-394------------------S---------------------NT--TSIAEAWKR---------------------------
O00907_BLEJA/239-369------------------S---------------------NS--TAIAEVFSR---------------------------
Q9HDT1_USTMD/262-392------------------A---------------------NT--TAIAGAWGR---------------------------
O01943_GECLA/256-386------------------S---------------------NT--TAIGEAWAR---------------------------
O93945_RHYSE/266-396------------------S---------------------NT--TAIAEAWSA---------------------------
P91873_CAEEL/269-399------------------S---------------------NT--TAIAEAWAR---------------------------
TBAL3_HUMAN/270-400------------------S---------------------NT--TAIVEAWAR---------------------------
O18154_CAEEL/260-388------------------S---------------------NT--TAIAEAWQR---------------------------
TBA4_DROME/274-404------------------S---------------------NT--TAISVAFSN---------------------------
Q9GQC1_9MYCE/168-298------------------S---------------------NT--TAISQVFSR---------------------------
Q9GQB7_9MYCE/169-301------------------S---------------------NT--TAIGQVFSR---------------------------
TBA_DICDI/270-402------------------S---------------------NT--TAISQVFSR---------------------------
Q9GQB9_9EUKA/168-298------------------S---------------------NS--TAIAEVFAR---------------------------
TBA1_ENTHI/268-399------------------A---------------------NH--TAMCQVFQK---------------------------
O44024_RETFI/260-393------------------A---------------------NN--TGISRVFSK---------------------------
Q9GQU7_ANTLO/246-369------------------G---------------------NS--TSIQELFKR---------------------------
TBB_ENCHE/261-383------------------G---------------------NT--TSIQELFKR---------------------------
Q9N6F5_9MICR/246-368------------------G---------------------NT--TAIQELFKR---------------------------
TBB1_COLGL/264-384------------------G---------------------NS--TAIQDIFRR---------------------------
TBB1_GEOCN/261-383------------------A---------------------NS--TSIQELFKR---------------------------
TBB_SCHPO/261-383------------------G---------------------NS--TSIQEIFRR---------------------------
Q9HGW5_9ASCO/245-367------------------G---------------------NS--TSIQELFKR---------------------------
Q9UVQ7_9FUNG/246-368------------------G---------------------NN--TAIQELFKR---------------------------
Q9P8Z1_UMBRA/246-368------------------G---------------------NS--TAIQELFKR---------------------------
Q9P8Z5_SMICU/246-368------------------G---------------------NS--TAIQELFQR---------------------------
O00817_CRYPV/263-385------------------G---------------------NS--TAIQEMFRR---------------------------
Q9LD24_BIGNA/246-368------------------G---------------------NS--TCIQEMFKR---------------------------
Q9ZTL8_9CRYP/246-368------------------G---------------------NS--TAIQEMFKR---------------------------
O01676_BOMMO/261-383------------------G---------------------NS--TAIQELFKR---------------------------
Q25165_SPIBA/246-368------------------G---------------------NT--TAIQELFKR---------------------------
TBB1_CHOCR/263-385------------------G---------------------NT--TAIEATFKR---------------------------
TBB2_PHYPO/261-383------------------G---------------------NN--TCIQELFKR---------------------------
TBB_DICDI/266-388------------------G---------------------NN--TAIQDLFKR---------------------------
TBBN_GUITH/261-383------------------G---------------------NS--TSIQELFKR---------------------------
TBB_PORPU/261-383------------------G---------------------NS--TAIQDIFKR---------------------------
Q26235_RETFI/261-383------------------A---------------------NT--TAIQDMFKR---------------------------
TBB3_ECHMU/261-383------------------G---------------------NT--TAIQELFTR---------------------------
Q9UVR1_9FUNG/246-368------------------G---------------------NN--TAIQETFNR---------------------------
TBBP_DROME/260-382------------------G---------------------NT--TAIQTLFQR---------------------------
TBB2_GEOCN/263-385------------------A---------------------NS--TAVQELFER---------------------------
Q26236_RETFI/267-390------------------A---------------------NT--TAIKGVFQR---------------------------
O46334_9EUKA/267-389------------------A---------------------NT--TAIKAVFQR---------------------------
TBE_MOUSE/294-414------------------A---------------------NN--TCVKPTFME---------------------------
Q9NI44_9TRYP/297-427------------------A---------------------NH--CSIAQKLQS---------------------------
TBG_CHLRE/264-399------------------A---------------------NH--TSVRHLFNK---------------------------
O00896_PHYPO/261-387------------------A---------------------NH--TSIHSLFSQ---------------------------
Q9FRU9_TOBAC/264-395------------------A---------------------SH--TGIRHLFSK---------------------------
TBG_DICDI/261-387------------------A---------------------NH--TSVNHLFSH---------------------------
O00849_TETTH/263-389------------------A---------------------NH--TSIHTLFEK---------------------------
Q9AR10_EUGGR/266-393------------------A---------------------NH--TSIANLFAR---------------------------
TBG2_EUPOC/261-387------------------A---------------------NH--TGIRSIFKV---------------------------
TBG2_DROME/264-394------------------A---------------------NH--TGISSLFKR---------------------------
TBG1_HUMAN/264-393------------------A---------------------NH--TSISSLFER---------------------------
TBG_SCHPO/264-393------------------A---------------------NH--TSIASLFKR---------------------------
Q94771_9TRYP/266-393------------------A---------------------NH--TSISSLFQR---------------------------
TBG_PLAFO/265-391------------------A---------------------NH--TSISTLFER---------------------------
TBG_RETFI/263-389------------------A---------------------NH--SNLGNLFAR---------------------------
TBG_ENTHI/259-383------------------A---------------------NN--TSIRYYFQD---------------------------
TBG_CANAX/299-418------------------T---------------------NN--TSMIDVFTK---------------------------
TBG_YEAST/263-392------------------S---------------------NM--STVVNVFEN---------------------------
TBG_CAEEL/264-391------------------N---------------------NS--TSVAPLFES---------------------------

PF12327

FTSZ2_HALSA/239-333--------------------------------------------------------------------------------
FTSZ_HALME/257-351--------------------------------------------------------------------------------
FTSZ_MYCKA/219-313--------------------------------------------------------------------------------
FTSZ_CORGL/219-313--------------------------------------------------------------------------------
Q97IE9_CLOAB/222-316--------------------------------------------------------------------------------
O85474_9FIRM/222-316--------------------------------------------------------------------------------
Q9SCC9_GUITH/260-354--------------------------------------------------------------------------------
O85785_SYNE7/248-342--------------------------------------------------------------------------------
Q9AQ37_ANAPH/225-320--------------------------------------------------------------------------------
FTSZ_RICPR/225-321--------------------------------------------------------------------------------
FTSZ2_RHIME/224-319--------------------------------------------------------------------------------
FTSZ_RHIRD/225-320--------------------------------------------------------------------------------
FTSZ_CAUCR/225-320--------------------------------------------------------------------------------
Q9M7M6_9STRA/290-387--------------------------------------------------------------------------------
FTSZ_BUCAI/221-316--------------------------------------------------------------------------------
Q9F1M6_SHEVI/222-317--------------------------------------------------------------------------------
FTSZ_FRATH/221-316--------------------------------------------------------------------------------
FTSZ_PSEAE/222-317--------------------------------------------------------------------------------
Q9CPA6_PASMU/244-342--------------------------------------------------------------------------------
FTSZ_HAEIN/246-344--------------------------------------------------------------------------------
Q9PF76_XYLFA/226-321--------------------------------------------------------------------------------
FTSZ2_METJA/246-343--------------------------------------------------------------------------------
FTSZ2_ARCFU/238-332--------------------------------------------------------------------------------
FTSZ1_HALSA/261-355--------------------------------------------------------------------------------
FTSZ1_ARCFU/252-346--------------------------------------------------------------------------------
FTSZ_METTH/248-342--------------------------------------------------------------------------------

PF13809

A0ZDE4_NODSP/18-373------------------S---------------------HQ--T-----GSEYEI.LTQGKLCNVIAHKIA.LEFSGEL
A1VSD1_POLNA/4-348------------------G---------------------NE--N-----ENGLTV.DVDKDLPGIVADFLYQKIVAVNN
A3IHZ5_9CHRO/13-355------------------G---------------------TK--N-----GE.SD..FKLDQIREMIAQNIF.LDLTSDF
A5N8S7_CLOK5/35-392------------------S---------------------AT--N-----IDGRPMSNAYDYCMNVTAENIVNFMSSEVR
A6NS46_9FIRM/38-402------------------E---------------------GV--A-----DGGVFFGDPADTARKVVANSILNMICTTEA
A6P0V7_9FIRM/16-360------------------D---------------------GQ--N-----AEDTTM.ISMDQYKAQAAQALY.EQNIGPM
A7VAW1_9CLOT/34-390------------------S---------------------GK--K-----DSQGY..LPEGTILMDTASFLYKLACNKYI
A8SSW8_9FIRM/34-390------------------S---------------------GR--K-----DSQGY..IPEGFVLKDVASFIYRLASNKYI
B0JIZ1_MICAN/14-373------------------S---------------------NR--T-----AGDYRI.NNKGKLCNVIAYKIF.LDFADEL
B1VR11_STRGG/8-403------------------R---------------------QD--D-----LRRSIVSLVMSLIGTELGDSRAQGRAMAGD
B2JAM4_NOSP7/13-355------------------G---------------------TK--N-----GE.SE..FNLDQIREMIAQNVF.LDLTSDF
B3DW42_METI4/6-351------------------T---------------------NF--N-----ENGLAV.DVAEDIPNILADFLYQKIVTVRN
B3QN46_CHLP8/22-399------------------D---------------------TT--N-----LAGAKT.GEVMDLYDMVADTLFEDYSTSVF
E0UHW6_CYAP2/14-356------------------G---------------------TK--N-----GE.SD..FKLEQIREMIAQNIF.LDMTSDF
B8G8G2_CHLAD/22-363------------------D---------------------RD--N-----GSEGL..SSIDEVKQMIGQVIY.LDTVTPI
B8HTJ0_CYAP4/11-352------------------G---------------------NS--N-----DKVTF..ANLGAVFEMVAQNIF.LDFSSGF
C3B5Y7_BACMY/8-349------------------D---------------------YE--N-----LHGHHL.HNLSDYMEQMTNTIY.LQLFSPM
C7QTL6_CYAP0/18-377------------------S---------------------NG--N-----NTGYQI.LDKRKLCNVIAHKIA.LDFSGEL
D3EKE8_GEOS4/35-389------------------S---------------------AT--N-----TEGKLLENAYDYCMNVTAENITNFMASEEK
Q114V2_TRIEI/18-373------------------S---------------------NE--T-----TGGYKI.LEQRKLCNVIAHKIA.LDFSGEL
Q7NLY7_GLOVI/13-354------------------G---------------------NS--N-----NKVTF..ASLEAVLEMVSQNIF.LDFSSGF
Q8DK50_THEEB/19-361------------------G---------------------TK--N-----GE.SE..FKLDEIREMIAQNIF.LDLTSDF
Q9RWX7_DEIRA/11-368------------------R---------------------PN--S-----TET....MDLLRLSNAIADRMFLNVFVPET

PF00091

Q7NB81_MYCGA/75-255------------------R---------------------MD--D-----INK........NL..............N.Y
B9LLN1_CHLSY/15-187------------------S---------------------NQ--K-----ILN........FV..............DPR
A9CGZ3_AGRT5/15-187------------------P---------------------NQ--N-----LLR........IA..............DAG
FTSZ_CAUCR/16-188------------------P---------------------NQ--N-----LFR........VA..............NER
B4SJY0_STRM5/15-187------------------P---------------------NE--K-----LIT........VL..............GRN
B3E8P4_GEOLS/12-183------------------P---------------------ND--R-----LIG........IS..............GKG
Q4A669_MYCS5/37-207------------------S---------------------ND--K-----LAE........NF..............G.D
Q7Q808_ANOGA/3-224------------------D---------------------NE--A-----LYD........IC..............VNT
FTSZA_DICDI/52-223------------------P---------------------NE--K-----LME........QS..............Q.E
Q0HDQ9_SHESM/15-188------------------P---------------------ND--K-----LAE........VL..............GAK
TBG_CAEEL/6-229------------------D---------------------NA--A-----LHR........LA..............AGK
Q4QCZ3_LEIMA/2-292------------------R---------------------ND--D-----AMAPGEPSGSSAC.............SGAS
FTSZ_THEMA/23-195------------------S---------------------NN--K-----LME........EL..............PRD
O96769_PARTE/4-227------------------D---------------------NT--A-----LNR........IA..............VDR
TBG_CANAX/4-262------------------H---------------------ND--S-----LNRIE....NILF..............NNN
A2EAH1_TRIVA/4-237------------------D---------------------NT--A-----LGA........ITNPV.......TPGGVSK
Q24D61_TETTS/3-222------------------H---------------------NG--T-----LNK........IL..............MKI
Q3SEF9_PARTE/3-228------------------E---------------------NQ--A-----LFK........VA..............NQQ
Q3SEF7_PARTE/3-210------------------D---------------------NE--S-----MYK........SI..............DEQ
Q2S524_SALRD/20-193------------------P---------------------NE--R-----LLD........IA..............DPD
FTSZB_DICDI/62-236------------------S---------------------NQ--N-----LLD........AS..............KSD
TBGN_GUITH/4-222------------------Q---------------------NH--A-----IEN........LL.............TKNQ
A1SU24_PSYIN/26-198------------------P---------------------ND--K-----LQK........SL..............PRG
A4SGZ8_PROVI/19-191------------------E---------------------NE--K-----ILS........IA..............DEG
Q24D62_TETTS/3-222------------------D---------------------NK--S-----LYN........IL..............KNF
FTSZ_BUCBP/12-184------------------P---------------------ND--K-----LIK........VL..............SKG
A0EC94_PARTE/3-226------------------D---------------------NA--A-----MYK........VC..............QNQ
Q22CD2_TETTS/3-223------------------D---------------------NE--A-----IYD........IC..............NMN
Q23WP5_TETTS/3-226------------------Q---------------------NE--S-----LYK........IY..............ENQ
Q72N68_LEPIC/14-186------------------N---------------------ND--S-----IFR........VV..............DKN
Q7YZQ1_PARTE/3-225------------------D---------------------NQ--A-----VYG........IC..............NNA
Q9NI44_9TRYP/4-260------------------D---------------------ND--A-----LAR........MADSALGQKTIGQAAGERK
A0LNZ3_SYNFM/27-199------------------P---------------------NN--R-----LLC........LA..............DRR
A0RW55_CENSY/7-167------------------D---------------------ND--A-----FLG.........A..............NPG
FTSZ_AQUAE/9-181------------------H---------------------ND--K-----IKE........LS..............NRT
Q9HKT7_THEAC/53-224------------------P---------------------ND--K-----LIE........KY..............ND.
TBBP_DROME/3-223------------------D---------------------NE--A-----LFQ........IC..............NRN
Q8EUT3_MYCPE/17-194------------------N---------------------ND--K-----IIN........VD..............KEK
Q3SD83_PARTE/3-220------------------D---------------------YG--A-----LEN........................QLT
Q4X7A3_PLACH/4-239------------------S---------------------ND--A-----LLN........IL.............NSKK
Q7VI30_HELHP/38-211------------------P---------------------ND--R-----LLS........II..............PKN
A1A2I4_BIFAA/16-188------------------P---------------------ND--R-----LLE........LS..............DRT
FTSZ2_PYRKO/37-216------------------E---------------------ND--K-----LLQ........LV..............PK.
Q3SEG7_PARTE/3-216------------------D---------------------YN--S-----LSK........................RVQ
Q5UXI7_HALMA/2-181------------------D---------------------ND--A-----WRG........SG..............D..
Q26BB8_FLABB/20-192------------------N---------------------NN--K-----LRE........VY..............G.N
Q481F5_COLP3/12-185------------------S---------------------ND--L-----LLA........GL..............GET
Q7P689_FUSNV/23-195------------------P---------------------ND--K-----LFD........LP..............DKS
A0B5R2_METTP/3-192------------------D---------------------NQ--Y-----LKR........FS..............G..
Q7Z1L8_SCHPL/3-225------------------D---------------------NE--S-----MYD........IC..............TKT
Q0W1F0_UNCMA/28-198------------------D---------------------FD--R-----LPG.........Y..............DPE
TBD_HUMAN/2-226------------------E---------------------ND--A-----IHK........IC..............AKL
FTSZ2_METJA/39-209------------------D---------------------NN--K-----LLD........LV..............PN.
Q3Z8S1_DEHE1/12-184------------------P---------------------ND--R-----LLD........MV..............DQK
TBE_HUMAN/4-257------------------D---------------------NQ--S-----LFD........IISKID......LMVNSGK
A0BWM1_PARTE/3-215------------------D---------------------NQ--G-----LKQ........NL...............SR
Q227Z6_TETTS/3-224------------------D---------------------NE--A-----LYD........IC..............FRV
Q8RT91_MYCHO/13-182------------------S---------------------NN--K-----LLQ........QY..............G.N
Q74M90_NANEQ/26-200------------------D---------------------NN--K-----LFE........VA...............RG
Q3SEG5_PARTE/3-205------------------Q---------------------NE--A-----IYQ........II..............ENQ
TBG_ENTHI/4-222------------------D---------------------NS--A-----LAD........IT..............HTQ
Q4N7F3_THEPA/2-226------------------S---------------------NN--N-----IIE........SI..............KKT
Q1CSP5_HELPH/29-202------------------P---------------------ND--K-----ILL........TM..............KKN
A1ZIZ2_9BACT/17-189------------------S---------------------ND--K-----LRE........IY..............G.N
A0RNH8_CAMFF/16-194------------------P---------------------NQ--K-----LMG........II..............DKK
Q64C34_9ARCH/27-198------------------E---------------------ND--K-----LIK........YA..............GN.
Q3SEH1_PARTE/3-208------------------D---------------------NE--S-----MYN........FI..............DRQ
Q70ZZ6_9BRYO/140-312------------------P---------------------ND--R-----LLQ........TV..............APD
Q76DQ5_CYAME/99-290------------------P---------------------NQ--N-----LFR........LA..............TNR
Q3SEG3_PARTE/3-219------------------D---------------------NV--A-----LQH........IC................K
FTSZ_BACHD/13-185------------------P---------------------ND--R-----LLE........IV..............DKN
Q3SEG6_PARTE/3-182------------------D---------------------NS--G-----LNE........YY..............ARQ
Q8LRU3_CHLRE/4-257------------------E---------------------NQ--A-----LID........IVNRT........EAARDR
Q12VE8_METBU/3-192------------------D---------------------NQ--F-----LKQ........IG..............G..
Q3SEH4_PARTE/3-225------------------D---------------------NQ--A-----LYD........IC..............KNG
Q9HHS0_HALSA/2-183------------------D---------------------ND--A-----WVD........DR..............N..
TBG_YEAST/4-226------------------D---------------------NA--S-----LLN........IS..............GKV
Q22UN3_TETTS/2-224------------------C---------------------NS--N-----ISN........MN..............QNS
FTSZ_PORGI/18-191------------------N---------------------NE--R-----LRI........IY..............K.D
Q3SEH5_PARTE/3-210------------------D---------------------NQ--S-----MYN........VI..............DQQ
FTSZ1_PYRFU/43-214------------------P---------------------ND--K-----LLE........VA..............PK.
Q16M50_AEDAE/10-229------------------D---------------------NE--A-----IYD........VC..............DRS
Q2SS93_MYCCT/10-181------------------S---------------------ND--K-----LLE........YI..............G.S
Q9GRI0_PARTE/2-207------------------Q---------------------ND--E-----AQA........LC..............NNL
Q47AA9_DECAR/14-183------------------L---------------------ND--K-----LME........VM..............GDD
O86305_MYCFE/11-183------------------S---------------------NQ--K-----LVE........NY...............RN
Q9VED6_DROME/6-227------------------D---------------------NE--A-----LYD........IC..............ANT
Q8T887_CIOIN/3-225------------------H---------------------NN--H-----LHE........VC..............QKL
Q6LXB6_METMP/37-208------------------P---------------------ND--K-----LLE........IV..............QN.
FTSZ_THEAC/44-215------------------P---------------------NQ--K-----LLS........EV..............P.N
Q4UCK3_THEAN/4-241------------------D---------------------NN--V-----VNNHSFTSDNLLSLRS.......HNSNNNS
O44024_RETFI/3-223------------------D---------------------NE--A-----IYG........IC..............QKQ
A1AQ68_PELPD/26-199------------------P---------------------NE--G-----MAA........VG..............STE
FTSZ1_HALSA/53-224------------------P---------------------ND--R-----LLD........SV..............GK.

PF10644

MSTO1_DANRE/6-118------------------S---------------------KN--S-----FLQ---------------------------
Q54F51_DICDI/10-128------------------I---------------------KQ--S-----TGK---------------------------
DML1_CANAL/2-128------------------E---------------------KN--E-----YQQ---------------------------
Q4SYY1_TETNG/6-118------------------A---------------------KN--S-----FLE---------------------------
E2BL93_HARSA/3-123------------------I---------------------ST--H-----TLN---------------------------
E3QQX3_COLGM/2-117------------------E---------------------PT--A-----YQQ---------------------------
D5G5A5_TUBMM/2-118------------------E---------------------PI--E-----YQR---------------------------
Q16X91_AEDAE/5-123------------------G---------------------KS--E-----YQR---------------------------
C4JY37_UNCRE/2-115------------------P---------------------AN--E-----YQK---------------------------
D2UYR3_NAEGR/2-136------------------K---------------------QT--K-----FTK---------------------------
E0CVU9_VITVI/2-122------------------K---------------------KN--L-----FLQ---------------------------
C1C113_9MAXI/4-113------------------G---------------------DH--N-----DEK---------------------------
B0DQH6_LACBS/2-120------------------A---------------------KS--V-----YQN---------------------------
E2AQP9_CAMFO/4-117------------------P---------------------RT--P-----FIE---------------------------
E0VQ48_PEDHC/4-114------------------E---------------------KH--E-----FIK---------------------------
O23167_ARATH/2-123------------------K---------------------RN--L-----FLQ---------------------------
E9EUC5_METAR/2-116------------------T---------------------PS--A-----YQE---------------------------
D8RU99_SELML/2-124------------------E---------------------KS--E-----FLK---------------------------
F2SWU5_TRIRC/2-116------------------P---------------------QI--E-----YQR---------------------------
B9S8K8_RICCO/2-124------------------K---------------------KN--L-----FLQ---------------------------
C8VQ22_EMENI/2-115------------------P---------------------LS--D-----YQK---------------------------
A9RV51_PHYPA/2-116------------------P---------------------ES--S-----RSR---------------------------
Q7QCR8_ANOGA/3-129------------------E---------------------RH--P-----YQK---------------------------
F2UAU4_SALS5/7-123------------------E---------------------PS--P-----YHQ---------------------------
E3WNL3_ANODA/3-126------------------E---------------------PH--P-----FQA---------------------------
A6ZMS3_YEAS7/2-114------------------P---------------------KS--E-----YQS---------------------------
Q29JE8_DROPS/5-143------------------P---------------------IS--E-----YQR---------------------------
Q018N1_OSTTA/3-113------------------R---------------------RS--A-----YAR---------------------------
B8P6F2_POSPM/2-128------------------P---------------------KS--R-----YQQ---------------------------
Q10PA8_ORYSJ/2-123------------------G---------------------RN--L-----FLQ---------------------------
B1H304_XENTR/16-131------------------E---------------------TS--P-----LQA---------------------------
B3MRV4_DROAN/5-145------------------Q---------------------LS--E-----YQR---------------------------
C7YZ58_NECH7/2-114------------------D---------------------PS--A-----YQQ---------------------------
F0XAM2_GROCL/2-120------------------I---------------------PS--A-----YTQ---------------------------
D2A4U9_TRICA/4-109------------------E---------------------KN--E-----FQK---------------------------
MSTO1_PONPY/6-121------------------P---------------------KN--P-----YLQ---------------------------
B0WZB0_CULQU/3-122------------------E---------------------KN--E-----FQK---------------------------
F0ZVF4_DICPU/5-118------------------L---------------------KN--T-----SGK---------------------------
MST_DROME/5-143------------------S---------------------IS--E-----YQR---------------------------
A7SVU0_NEMVE/7-118------------------Q---------------------KN--E-----FQA---------------------------
C1BN10_9MAXI/2-112------------------S---------------------EA--E-----DEK---------------------------
DML1_NEUCR/2-115------------------P---------------------QS--A-----YQQ---------------------------
DML1_SCHPO/2-115------------------D---------------------VH--P-----YQE---------------------------
B4NDP0_DROWI/5-139------------------S---------------------MS--E-----YQK---------------------------
B8M2T5_TALSN/2-115------------------P---------------------LN--E-----YQK---------------------------
DML1_PHANO/2-117------------------P---------------------PS--T-----YQE---------------------------
C5JKN9_AJEDS/2-115------------------P---------------------QT--E-----YQK---------------------------
A5DLT9_PICGU/1-104------------------P---------------------KH--A-----FQS---------------------------
D8Q938_SCHCM/2-119------------------P---------------------KS--D-----YHA---------------------------
B6K201_SCHJY/2-136------------------P---------------------LH--P-----YQA---------------------------
B4MB04_DROVI/5-140------------------T---------------------LS--E-----YQQ---------------------------

PF14881

DML1_ASPCL/119-303........I.........N........LD....A......QS..E.....WQT------------------------SAL
DML1_ASPNC/119-303........I.........P.........Q....S......IY..LDARSEWYT------------------------SAL
A6SSZ2_BOTFB/31-216........P.........STHLPSYVKLD....A......SS..S.....WEV------------------------SGL
B2AWJ1_PODAN/149-315........................................TS..P.....WHT------------------------TAL
B2WK69_PYRTR/102-289SPAKLPSYL.........S........LD....A......TS..L.....WHI------------------------AAL
B6GW17_PENCW/119-303........V.........P.........HK.LPGYLNVDRQS..E.....WQK------------------------SAL
B6QAT3_PENMQ/119-303........N.........I.........D....L......QS..D.....WYK------------------------SAL
C1GUC8_PARBA/119-303........P.........P.........Q....NLPTYVNSD..LR..SEWYS------------------------SAL
C4JY37_UNCRE/119-303P......PV.........KHPH..YVNLN....M......PS..E.....WHL------------------------SAL
C5FUZ2_ARTOC/120-304........LPTRTPHYVRS.........D....L......HH..I.....WYS------------------------SAL
C7YZ58_NECH7/118-303........L.........S.........A....GVS.MDRRS..A.....WHT------------------------SAL
C8VQ22_EMENI/119-303........I.........R........VD....N......NS..E.....WYT------------------------SAL
E3QQX3_COLGM/121-306LR....SNI.........H.........M...DQ......QS..P.....WHA------------------------TAL
E9E9D2_METAQ/120-305PE....SKL.........RPH....IELD....C......NS..S.....WHV------------------------SSL
F0XAM2_GROCL/124-310........P.........SL......PLR....GVE.STLDPRLT.....WHV------------------------SAL
F2PVM6_TRIEC/101-285........L.........P.........S....RLPSYVKPD..LR..HTWLS------------------------SAL
DML1_ASPOR/119-303........L.........S.........KVHFDP......HS..E.....WHT------------------------TAL
DML1_NEUCR/119-307LP...GSVV.........L.........D....A......GS..Q.....WHN------------------------TAL

PF03953

TBG_EMENI/263-392------------------------------------------IVQ-----------------------------
TBA2_EMENI/265-395------------------------------------------LDH-----------------------------
TBA_ENCHE/237-367------------------------------------------LNN-----------------------------
P92124_9MICR/238-368------------------------------------------LNR-----------------------------
TBA2_SCHPO/263-393------------------------------------------LDH-----------------------------
TBA1_YEAST/264-394------------------------------------------IDR-----------------------------
O00907_BLEJA/239-369------------------------------------------IDH-----------------------------
Q9HDT1_USTMD/262-392------------------------------------------LDN-----------------------------
O01943_GECLA/256-386------------------------------------------LDH-----------------------------
O93945_RHYSE/266-396------------------------------------------LSH-----------------------------
P91873_CAEEL/269-399------------------------------------------LDH-----------------------------
TBAL3_HUMAN/270-400------------------------------------------LDH-----------------------------
O18154_CAEEL/260-388------------------------------------------LDY-----------------------------
TBA4_DROME/274-404------------------------------------------LSY-----------------------------
Q9GQC1_9MYCE/168-298------------------------------------------INV-----------------------------
Q9GQB7_9MYCE/169-301------------------------------------------INH-----------------------------
TBA_DICDI/270-402------------------------------------------INH-----------------------------
Q9GQB9_9EUKA/168-298------------------------------------------TNA-----------------------------
TBA1_ENTHI/268-399------------------------------------------VNQ-----------------------------
O44024_RETFI/260-393------------------------------------------RIA-----------------------------
Q9GQU7_ANTLO/246-369------------------------------------------ISD-----------------------------
TBB_ENCHE/261-383------------------------------------------ISD-----------------------------
Q9N6F5_9MICR/246-368------------------------------------------VAE-----------------------------
TBB1_COLGL/264-384------------------------------------------VGD-----------------------------
TBB1_GEOCN/261-383------------------------------------------VGD-----------------------------
TBB_SCHPO/261-383------------------------------------------LGD-----------------------------
Q9HGW5_9ASCO/245-367------------------------------------------VGD-----------------------------
Q9UVQ7_9FUNG/246-368------------------------------------------VNE-----------------------------
Q9P8Z1_UMBRA/246-368------------------------------------------VNE-----------------------------
Q9P8Z5_SMICU/246-368------------------------------------------VNE-----------------------------
O00817_CRYPV/263-385------------------------------------------VAE-----------------------------
Q9LD24_BIGNA/246-368------------------------------------------VSE-----------------------------
Q9ZTL8_9CRYP/246-368------------------------------------------VSE-----------------------------
O01676_BOMMO/261-383------------------------------------------ISE-----------------------------
Q25165_SPIBA/246-368------------------------------------------VGE-----------------------------
TBB1_CHOCR/263-385------------------------------------------FGN-----------------------------
TBB2_PHYPO/261-383------------------------------------------IGL-----------------------------
TBB_DICDI/266-388------------------------------------------ISI-----------------------------
TBBN_GUITH/261-383------------------------------------------VGE-----------------------------
TBB_PORPU/261-383------------------------------------------VGS-----------------------------
Q26235_RETFI/261-383------------------------------------------VGE-----------------------------
TBB3_ECHMU/261-383------------------------------------------VSD-----------------------------
Q9UVR1_9FUNG/246-368------------------------------------------VGE-----------------------------
TBBP_DROME/260-382------------------------------------------LLD-----------------------------
TBB2_GEOCN/263-385------------------------------------------TAN-----------------------------
Q26236_RETFI/267-390------------------------------------------ISS-----------------------------
O46334_9EUKA/267-389------------------------------------------ISA-----------------------------
TBE_MOUSE/294-414------------------------------------------LRE-----------------------------
Q9NI44_9TRYP/297-427------------------------------------------AHE-----------------------------
TBG_CHLRE/264-399------------------------------------------VLR-----------------------------
O00896_PHYPO/261-387------------------------------------------IIK-----------------------------
Q9FRU9_TOBAC/264-395------------------------------------------CLS-----------------------------
TBG_DICDI/261-387------------------------------------------IIQ-----------------------------
O00849_TETTH/263-389------------------------------------------IIS-----------------------------
Q9AR10_EUGGR/266-393------------------------------------------TLS-----------------------------
TBG2_EUPOC/261-387------------------------------------------LYD-----------------------------
TBG2_DROME/264-394------------------------------------------ALA-----------------------------
TBG1_HUMAN/264-393------------------------------------------TCR-----------------------------
TBG_SCHPO/264-393------------------------------------------TLD-----------------------------
Q94771_9TRYP/266-393------------------------------------------TLK-----------------------------
TBG_PLAFO/265-391------------------------------------------CVT-----------------------------
TBG_RETFI/263-389------------------------------------------IIR-----------------------------
TBG_ENTHI/259-383------------------------------------------ILK-----------------------------
TBG_CANAX/299-418------------------------------------------ILK-----------------------------
TBG_YEAST/263-392------------------------------------------ACN-----------------------------
TBG_CAEEL/264-391------------------------------------------LLS-----------------------------

PF12327

FTSZ2_HALSA/239-333-------------------------------------------VQ-----------------------------
FTSZ_HALME/257-351-------------------------------------------VE-----------------------------
FTSZ_MYCKA/219-313-------------------------------------------FD-----------------------------
FTSZ_CORGL/219-313-------------------------------------------FD-----------------------------
Q97IE9_CLOAB/222-316-------------------------------------------FE-----------------------------
O85474_9FIRM/222-316-------------------------------------------FQ-----------------------------
Q9SCC9_GUITH/260-354-------------------------------------------FT-----------------------------
O85785_SYNE7/248-342-------------------------------------------FS-----------------------------
Q9AQ37_ANAPH/225-320-------------------------------------------ID-----------------------------
FTSZ_RICPR/225-321-------------------------------------------ID-----------------------------
FTSZ2_RHIME/224-319-------------------------------------------LD-----------------------------
FTSZ_RHIRD/225-320-------------------------------------------ID-----------------------------
FTSZ_CAUCR/225-320-------------------------------------------MD-----------------------------
Q9M7M6_9STRA/290-387-------------------------------------------IE-----------------------------
FTSZ_BUCAI/221-316-------------------------------------------IG-----------------------------
Q9F1M6_SHEVI/222-317-------------------------------------------IG-----------------------------
FTSZ_FRATH/221-316-------------------------------------------IE-----------------------------
FTSZ_PSEAE/222-317-------------------------------------------LG-----------------------------
Q9CPA6_PASMU/244-342-------------------------------------------IG-----------------------------
FTSZ_HAEIN/246-344-------------------------------------------LG-----------------------------
Q9PF76_XYLFA/226-321-------------------------------------------LS-----------------------------
FTSZ2_METJA/246-343-------------------------------------------VK-----------------------------
FTSZ2_ARCFU/238-332-------------------------------------------IK-----------------------------
FTSZ1_HALSA/261-355-------------------------------------------VD-----------------------------
FTSZ1_ARCFU/252-346-------------------------------------------VK-----------------------------
FTSZ_METTH/248-342-------------------------------------------VR-----------------------------

PF13809

A0ZDE4_NODSP/18-373GSVIKGNRDNFLQHIIQSDKHPRPNNQR..............YLTFGLSAIYFPRDTIIQIALTKVSSELVKFW
A1VSD1_POLNA/4-348VNWAS.LGRMENAENGDGSPETAPQGRMPERSKR........FLAFGIKRLAIPEEEISEYLTYSFARQAALQL
A3IHZ5_9CHRO/13-355SPHKRSIRDNIKSAWAQADPGGRGYPKN..............FMSFGLSTIEIPIFQIRNSLCYRLAKDIVNWW
A5N8S7_CLOK5/35-392ESGGVFAIQDYISNLKQNTDNMA......KPYM..SNYK...YVIIGASSAVLPLEEITTYLAYKLFEKMQYMF
A6NS46_9FIRM/38-402KAGKEPFMVDSFLSNRTAISGVAVSRQSHRVFPRDANYC...YNVIGYSSCVVPIDLMTVYVAKKVFDKVWEQF
A6P0V7_9FIRM/16-360QKNAFSLEDNIIKEMTNPGNFGRNR.................FGGIGAGLIRYPYDEIADYIAYGWAKASIGGE
A7VAW1_9CLOT/34-390GNNDVNDDRKLLRDVFFDNEKYSVTNWKMEHSDSEIATANCYYKVVSEADYKIPIREIENICESDLFNKAYKRL
A8SSW8_9FIRM/34-390GNNDVDNDRKLLRDVFFENEGYAITNWKMEHNDEDIKKSNCYYKVVSEADYHIPIKEIENMCENDIFSQAYKGL
B0JIZ1_MICAN/14-373SPRIKGNRDNYKNSMISPDNHPFQMCQG..............YMSFGLARIYFTRDRIVQIGLNRFTLKLIKFW
B1VR11_STRGG/8-403DDFQTFAASFINRGVQRSALSPTGIGRQG.............VSTSLVASMTAPMDQLADLVAGRLLRVAVTEL
B2JAM4_NOSP7/13-355APHKRSIRDNIKGAWAQADPGGRGYPKN..............FMSFGLSTIEIPIAQIHNSLSNRLSMDLVNWW
B3DW42_METI4/6-351INWES.LGRSENAENGDNSPETLPGLNEPVRSKR........FLTFGVKRIAVPEPEIAEYLTFQFARQAALQL
B3QN46_CHLP8/22-399ANRKRSVSVNQNQYKIIPYEMLLPRETYGDMSITFSRA....YSTFGQAIIDTQLEQKKNVVLYRQVNGMLKAF
E0UHW6_CYAP2/14-356APHKRSIRDNIKGSWAQADPGGRGYPKQ..............FMSFGLSTIEIPIAQIRASLYYRLAQDLVNWW
B8G8G2_CHLAD/22-363GREAASKRENLNDLASEQQNKFALA.................IAGVSTASLVLPVRPVQVHVEMMGMRILQEHI
B8HTJ0_CYAP4/11-352SQYKKLVRDNLRKQWASPDPLGYPQN................FITFGLSSIQFPVERVLNACALRLASQLINWW
C3B5Y7_BACMY/8-349STSHFAQEDNQIQQLAESNGKAR...................YCGAGTAKLIYPYEHVLKYCALKWAVQGLDES
C7QTL6_CYAP0/18-377APVVKGQRDNFAQHLLQLDDYPRPNVQR..............YLSFGLAAIYFPRDLIVRIALTRISLNLVNFW
D3EKE8_GEOS4/35-389QSGEEFAIHDYISNIRTNIAQMN......KAYP..ANYD...YNIIGASSAVLPIEEMTTYLAYRVFGKMQTMF
Q114V2_TRIEI/18-373APIVKGMRDNFLQDLIQYDNHPRPNIQR..............YLTFGMAAIYFPRDKIVQIALNRISLNLVNFW
Q7NLY7_GLOVI/13-354SQFKKLVRDNIRKHWAGPDPLGHPQS................FITFGLSSIQFPIERVINACASRLAGRVVRWW
Q8DK50_THEEB/19-361APHKRSIRDNIKAAWASQDAGGRSYPKS..............FMAFGLSSIEIPIAQIRASLTYRLCQDFIHWW
Q9RWX7_DEIRA/11-368DPMAYMVNAGPVTVQQGRAFA.....................FSTFGLSTIEYPMRRILEALKYRTLVHAVDRW

PF00091

Q7NB81_MYCGA/75-255LSVV...................ER-----------------NQE-----------------------------
B9LLN1_CHLSY/15-187TTLS...................VA-----------------LTY-----------------------------
A9CGZ3_AGRT5/15-187TTFE...................NA-----------------LKT-----------------------------
FTSZ_CAUCR/16-188TTFA...................EA-----------------FGM-----------------------------
B4SJY0_STRM5/15-187ATMI...................QA-----------------FRA-----------------------------
B3E8P4_GEOLS/12-183TALL...................EA-----------------FKP-----------------------------
Q4A669_MYCS5/37-207LPIE...................DS-----------------FQL-----------------------------
Q7Q808_ANOGA/3-224LRLP..................VPD-----------------LDD-----------------------------
FTSZA_DICDI/52-223LYIG...................NA-----------------FQM-----------------------------
Q0HDQ9_SHESM/15-188VTLL...................NA-----------------FKE-----------------------------
TBG_CAEEL/6-229FKTD..................TPT-----------------FDH-----------------------------
Q4QCZ3_LEIMA/2-292LLTR..................CVT-----------------FKE-----------------------------
FTSZ_THEMA/23-195VKIK...................DA-----------------FLK-----------------------------
O96769_PARTE/4-227LKIP..................IPT-----------------VSQ-----------------------------
TBG_CANAX/4-262SNIQH...............DDNDL-----------------FLG-----------------------------
A2EAH1_TRIVA/4-237KRTEGG..............KTENS-----------------FRE-----------------------------
Q24D61_TETTS/3-222IGNN..................TPS-----------------LKD-----------------------------
Q3SEF9_PARTE/3-228LDID..................NPN-----------------FST-----------------------------
Q3SEF7_PARTE/3-210IGLD..................YVD-----------------YTH-----------------------------
Q2S524_SALRD/20-193TSLI...................EA-----------------FEK-----------------------------
FTSZB_DICDI/62-236IQLE...................QA-----------------FLM-----------------------------
TBGN_GUITH/4-222INNE...................LS-----------------FRK-----------------------------
A1SU24_PSYIN/26-198VSFL...................DA-----------------LSA-----------------------------
A4SGZ8_PROVI/19-191VSAT...................EA-----------------YNM-----------------------------
Q24D62_TETTS/3-222IGKN..................TKE-----------------YKD-----------------------------
FTSZ_BUCBP/12-184ISLL...................DA-----------------FNT-----------------------------
A0EC94_PARTE/3-226LDFE..................TPN-----------------FSH-----------------------------
Q22CD2_TETTS/3-223PYIS..................NIA-----------------YTD-----------------------------
Q23WP5_TETTS/3-226FDFE..................YPS-----------------FND-----------------------------
Q72N68_LEPIC/14-186TPID...................LA-----------------FQV-----------------------------
Q7YZQ1_PARTE/3-225LDIQ..................NPS-----------------YTN-----------------------------
Q9NI44_9TRYP/4-260EPQTTLGAPAARGYSVAQPTQTKLP-----------------YDS-----------------------------
A0LNZ3_SYNFM/27-199ATFL...................EM-----------------IKR-----------------------------
A0RW55_CENSY/7-167MSPA...................EC-----------------HGM-----------------------------
FTSZ_AQUAE/9-181LTIK...................DA-----------------FKE-----------------------------
Q9HKT7_THEAC/53-224VPVY...................KA-----------------FKF-----------------------------
TBBP_DROME/3-223LKLK..................MSG-----------------YEH-----------------------------
Q8EUT3_MYCPE/17-194MSIK...................KA-----------------YES-----------------------------
Q3SD83_PARTE/3-220KLRQ..................LST-----------------LEN-----------------------------
Q4X7A3_PLACH/4-239LKEKEH..............NNKND-----------------YSK-----------------------------
Q7VI30_HELHP/38-211CGHK...................EA-----------------FAF-----------------------------
A1A2I4_BIFAA/16-188IGIV...................DA-----------------FKT-----------------------------
FTSZ2_PYRKO/37-216LPIN...................AA-----------------FRF-----------------------------
Q3SEG7_PARTE/3-216EQYK..................YPT-----------------QSN-----------------------------
Q5UXI7_HALMA/2-181.SVA...................AG-----------------FER-----------------------------
Q26BB8_FLABB/20-192LGFK...................AG-----------------FSK-----------------------------
Q481F5_COLP3/12-185VGLF...................SA-----------------FNQ-----------------------------
Q7P689_FUSNV/23-195ITLQ...................NA-----------------FKE-----------------------------
A0B5R2_METTP/3-192.DIA...................SA-----------------YDR-----------------------------
Q7Z1L8_SCHPL/3-225LDIN..................RPT-----------------YSN-----------------------------
Q0W1F0_UNCMA/28-198MPKQ...................NA-----------------YGI-----------------------------
TBD_HUMAN/2-226MNIK..................QIS-----------------FSD-----------------------------
FTSZ2_METJA/39-209LPIN...................DA-----------------FKV-----------------------------
Q3Z8S1_DEHE1/12-184TGVD...................GA-----------------FKL-----------------------------
TBE_HUMAN/4-257LGTTVKPKSLVTSSSGALKKQHKKP-----------------FDA-----------------------------
A0BWM1_PARTE/3-215LGIE...................FN-----------------YDD-----------------------------
Q227Z6_TETTS/3-224AKLY..................NPN-----------------LKD-----------------------------
Q8RT91_MYCHO/13-182ISFS...................DA-----------------FIC-----------------------------
Q74M90_NANEQ/26-200LNVQ...................QA-----------------FAL-----------------------------
Q3SEG5_PARTE/3-205LDIE..................FPS-----------------YNE-----------------------------
TBG_ENTHI/4-222FGVD..................EAT-----------------VFD-----------------------------
Q4N7F3_THEPA/2-226TDITFK.............SGSKDY-----------------FNP-----------------------------
Q1CSP5_HELPH/29-202ASTT...................EC-----------------YRE-----------------------------
A1ZIZ2_9BACT/17-189LKMS...................EA-----------------FAQ-----------------------------
A0RNH8_CAMFF/16-194AGIK...................DS-----------------FKE-----------------------------
Q64C34_9ARCH/27-198LPVN...................EA-----------------FKT-----------------------------
Q3SEH1_PARTE/3-208LDLD..................FVD-----------------YSQ-----------------------------
Q70ZZ6_9BRYO/140-312TSML...................EA-----------------FHL-----------------------------
Q76DQ5_CYAME/99-290TTLQ...................SA-----------------FQL-----------------------------
Q3SEG3_PARTE/3-219INML..................EQN-----------------YDI-----------------------------
FTSZ_BACHD/13-185TPML...................EA-----------------FRE-----------------------------
Q3SEG6_PARTE/3-182YKST...................LT-----------------FND-----------------------------
Q8LRU3_CHLRE/4-257AAAADAAASAVS..GLKGSGGGSKP-----------------FDS-----------------------------
Q12VE8_METBU/3-192.NVQ...................SA-----------------YNT-----------------------------
Q3SEH4_PARTE/3-225LGVE..................TPK-----------------YSN-----------------------------
Q9HHS0_HALSA/2-183.DVE...................DV-----------------TDG-----------------------------
TBG_YEAST/4-226FRNP..................NID-----------------LQH-----------------------------
Q22UN3_TETTS/2-224FQLQ.................KQFN-----------------FDT-----------------------------
FTSZ_PORGI/18-191LKLD...................NA-----------------FAK-----------------------------
Q3SEH5_PARTE/3-210LDLD..................YVD-----------------YSH-----------------------------
FTSZ1_PYRFU/43-214LPIQ...................MA-----------------FKV-----------------------------
Q16M50_AEDAE/10-229LNVR..................EPT-----------------YTN-----------------------------
Q2SS93_MYCCT/10-181IPIA...................ES-----------------FKE-----------------------------
Q9GRI0_PARTE/2-207LNLK..................SPS-----------------LND-----------------------------
Q47AA9_DECAR/14-183ADVD...................DC-----------------FKA-----------------------------
O86305_MYCFE/11-183LPVQ...................EA-----------------FKV-----------------------------
Q9VED6_DROME/6-227LNVP..................APT-----------------YTN-----------------------------
Q8T887_CIOIN/3-225LGLK..................HVT-----------------FTD-----------------------------
Q6LXB6_METMP/37-208VPLR...................TA-----------------FKV-----------------------------
FTSZ_THEAC/44-215AEMK...................VA-----------------FAY-----------------------------
Q4UCK3_THEAN/4-241LKEN..................STS-----------------FEE-----------------------------
O44024_RETFI/3-223LRIA..................KPD-----------------VNN-----------------------------
A1AQ68_PELPD/26-199QNLL...................EV-----------------LTG-----------------------------
FTSZ1_HALSA/53-224LPVR...................EA-----------------FKV-----------------------------

PF10644

MSTO1_DANRE/6-118-----------------------E.-----------------LDN-----------------------------
Q54F51_DICDI/10-128-----------------------P.-----------------IDR-----------------------------
DML1_CANAL/2-128-----------------------K.-----------------LDQ-----------------------------
Q4SYY1_TETNG/6-118-----------------------D.-----------------LDK-----------------------------
E2BL93_HARSA/3-123-----------------------K.-----------------LDK-----------------------------
E3QQX3_COLGM/2-117-----------------------S.-----------------LDS-----------------------------
D5G5A5_TUBMM/2-118-----------------------S.-----------------LDT-----------------------------
Q16X91_AEDAE/5-123-----------------------D.-----------------LGE-----------------------------
C4JY37_UNCRE/2-115-----------------------S.-----------------LEL-----------------------------
D2UYR3_NAEGR/2-136-----------------------QQ-----------------LSK-----------------------------
E0CVU9_VITVI/2-122-----------------------S.-----------------LYE-----------------------------
C1C113_9MAXI/4-113-----------------------D.-----------------IDE-----------------------------
B0DQH6_LACBS/2-120-----------------------R.-----------------MED-----------------------------
E2AQP9_CAMFO/4-117-----------------------S.-----------------LNK-----------------------------
E0VQ48_PEDHC/4-114-----------------------D.-----------------LER-----------------------------
O23167_ARATH/2-123-----------------------S.-----------------LYE-----------------------------
E9EUC5_METAR/2-116-----------------------S.-----------------LDS-----------------------------
D8RU99_SELML/2-124-----------------------R.-----------------LEA-----------------------------
F2SWU5_TRIRC/2-116-----------------------C.-----------------LDM-----------------------------
B9S8K8_RICCO/2-124-----------------------S.-----------------LSE-----------------------------
C8VQ22_EMENI/2-115-----------------------S.-----------------LDA-----------------------------
A9RV51_PHYPA/2-116-----------------------D.-----------------IAP-----------------------------
Q7QCR8_ANOGA/3-129-----------------------D.-----------------LLE-----------------------------
F2UAU4_SALS5/7-123-----------------------H.-----------------LEQ-----------------------------
E3WNL3_ANODA/3-126-----------------------D.-----------------LSA-----------------------------
A6ZMS3_YEAS7/2-114-----------------------S.-----------------LDA-----------------------------
Q29JE8_DROPS/5-143-----------------------D.-----------------LLK-----------------------------
Q018N1_OSTTA/3-113-----------------------A.-----------------LER-----------------------------
B8P6F2_POSPM/2-128-----------------------R.-----------------LDD-----------------------------
Q10PA8_ORYSJ/2-123-----------------------S.-----------------LVE-----------------------------
B1H304_XENTR/16-131-----------------------E.-----------------LRR-----------------------------
B3MRV4_DROAN/5-145-----------------------D.-----------------LMK-----------------------------
C7YZ58_NECH7/2-114-----------------------S.-----------------LDA-----------------------------
F0XAM2_GROCL/2-120-----------------------S.-----------------LDT-----------------------------
D2A4U9_TRICA/4-109-----------------------D.-----------------IET-----------------------------
MSTO1_PONPY/6-121-----------------------DF-----------------LSA-----------------------------
B0WZB0_CULQU/3-122-----------------------D.-----------------LEV-----------------------------
F0ZVF4_DICPU/5-118-----------------------P.-----------------IDR-----------------------------
MST_DROME/5-143-----------------------D.-----------------LLK-----------------------------
A7SVU0_NEMVE/7-118-----------------------D.-----------------IEK-----------------------------
C1BN10_9MAXI/2-112-----------------------D.-----------------VDE-----------------------------
DML1_NEUCR/2-115-----------------------S.-----------------LDA-----------------------------
DML1_SCHPO/2-115-----------------------A.-----------------LWS-----------------------------
B4NDP0_DROWI/5-139-----------------------D.-----------------LLK-----------------------------
B8M2T5_TALSN/2-115-----------------------S.-----------------LEA-----------------------------
DML1_PHANO/2-117-----------------------H.-----------------LDN-----------------------------
C5JKN9_AJEDS/2-115-----------------------N.-----------------LDV-----------------------------
A5DLT9_PICGU/1-104-----------------------N.-----------------LDS-----------------------------
D8Q938_SCHCM/2-119-----------------------K.-----------------LER-----------------------------
B6K201_SCHJY/2-136-----------------------W.-----------------LDQ-----------------------------
B4MB04_DROVI/5-140-----------------------D.-----------------LLK-----------------------------

PF14881

DML1_ASPCL/119-303ISSA--------------------------------------LETVTLPTRL----------------------
DML1_ASPNC/119-303VSAA--------------------------------------MESVSLPTRL----------------------
A6SSZ2_BOTFB/31-216LSSA--------------------------------------MESMTLPSRL----------------------
B2AWJ1_PODAN/149-315FSSA--------------------------------------VESALLPSRL----------------------
B2WK69_PYRTR/102-289QVVG--------------------------------------LESMTMSSRL----------------------
B6GW17_PENCW/119-303VASA--------------------------------------IETVTLPSRL----------------------
B6QAT3_PENMQ/119-303VVSA--------------------------------------IETATLPSQL----------------------
C1GUC8_PARBA/119-303ISTA--------------------------------------LESVTLPTRL----------------------
C4JY37_UNCRE/119-303TSVA--------------------------------------VESVTLPARL----------------------
C5FUZ2_ARTOC/120-304ISLV--------------------------------------LESVSLPARL----------------------
C7YZ58_NECH7/118-303MAAG--------------------------------------IETATLPSRL----------------------
C8VQ22_EMENI/119-303TSIA--------------------------------------MESITLPTRL----------------------
E3QQX3_COLGM/121-306LGTA--------------------------------------METAGLPSRL----------------------
E9E9D2_METAQ/120-305LATV--------------------------------------SESALLPSRL----------------------
F0XAM2_GROCL/124-310LATA--------------------------------------IETATLPSRL----------------------
F2PVM6_TRIEC/101-285ISLA--------------------------------------LESISLPTRL----------------------
DML1_ASPOR/119-303ISSA--------------------------------------MESVTLPTRL----------------------
DML1_NEUCR/119-307SAAA--------------------------------------IESVTLPSRL----------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window