Sequence alignment for CL0446

PF06958

Q51549_PSEAI/488-632--------------------------------------------------------------------------------
PYS2_PSEAE/415-554--------------------------------------------------------------------------------
Q88NA6_PSEPK/490-621--------------------------------------------------------------------------------
Q3K520_PSEPF/519-654--------------------------------------------------------------------------------
Q4ZME2_PSEU2/372-507--------------------------------------------------------------------------------
Q3KHV9_PSEPF/452-588--------------------------------------------------------------------------------
Q4ZZN9_PSEU2/384-518--------------------------------------------------------------------------------
Q51502_PSEAI/502-636--------------------------------------------------------------------------------
Q48N26_PSE14/366-496--------------------------------------------------------------------------------
B0KLG0_PSEPG/298-428--------------------------------------------------------------------------------
A0A0M1V2U4_YERPE/184-326--------------------------------------------------------------------------------
C4SH19_YERMO/257-393--------------------------------------------------------------------------------
CEA3_ECOLX/172-286--------------------------------------------------------------------------------
C4SH22_YERMO/173-298--------------------------------------------------------------------------------
B0KQC9_PSEPG/357-498--------------------------------------------------------------------------------
B4F067_PROMH/227-363--------------------------------------------------------------------------------
Q2C918_9GAMM/172-308--------------------------------------------------------------------------------
A7MTX8_VIBCB/589-723--------------------------------------------------------------------------------
A1TWM1_MARHV/259-395--------------------------------------------------------------------------------
C3K1R5_PSEFS/156-287--------------------------------------------------------------------------------
Q3KGY0_PSEPF/174-305--------------------------------------------------------------------------------
B7VQ54_VIBTL/208-337--------------------------------------------------------------------------------
D7HGP2_VIBCL/565-699--------------------------------------------------------------------------------
Q3K6V8_PSEPF/148-281--------------------------------------------------------------------------------
Q7CGU6_YERPE/269-408--------------------------------------------------------------------------------
Q7N861_PHOLL/282-420--------------------------------------------------------------------------------
Q2V060_PECCC/88-226--------------------------------------------------------------------------------
A6TAS7_KLEP7/151-314--------------------------------------------------------------------------------
A9MMY5_SALAR/912-1053--------------------------------------------------------------------------------
A6TI19_KLEP7/500-639--------------------------------------------------------------------------------
Q9XBT6_KLEPN/492-631--------------------------------------------------------------------------------
CEAD_ECOLX/451-590--------------------------------------------------------------------------------
Q5V9K0_KLEPN/374-517--------------------------------------------------------------------------------
Q5QGN1_KLEOX/466-609--------------------------------------------------------------------------------
A8G950_SERP5/403-545--------------------------------------------------------------------------------
B2VB98_ERWT9/362-505--------------------------------------------------------------------------------

PF03515

A6XA70_XENNE/1-324M......CPIYG........................DGTDWSSEKGGY.......YEKPGDDDRHKNDGNKDRND..SGS
A8ARS8_CITK8/1-223M...............................................................................
A0A0E2A345_ECOLX/1-311MSGGDGRGHNTGAHSTSGNINGGPTGLGVGGGA..SDGSGWSSENNPWGGGSGSGIHWGGGSGHGNG.GGNGNSG..GGS
C3UUF3_ECOLX/1-309MSD..........................NEGSVPTEGIDYGDTMVVWPSTGRIP.............GGDVKPG..GSS
CEA7_ECOLX/1-306MSGGDGRGHNSGAHNTGGNINGGPTGLGGNGGA..SDGSGWSSENNPWGGGSGSGVHWGGGSGHGNG.GGNSNSG..GGS
Q5QGN1_KLEOX/1-314MSDI..................TYNPEDYNNGIPPEPGL.......VWKPGGSFP.............NGSYVPGSWGWP

PF06958

Q51549_PSEAI/488-632--------------------------------------------------------------------------------
PYS2_PSEAE/415-554--------------------------------------------------------------------------------
Q88NA6_PSEPK/490-621--------------------------------------------------------------------------------
Q3K520_PSEPF/519-654--------------------------------------------------------------------------------
Q4ZME2_PSEU2/372-507--------------------------------------------------------------------------------
Q3KHV9_PSEPF/452-588--------------------------------------------------------------------------------
Q4ZZN9_PSEU2/384-518--------------------------------------------------------------------------------
Q51502_PSEAI/502-636--------------------------------------------------------------------------------
Q48N26_PSE14/366-496--------------------------------------------------------------------------------
B0KLG0_PSEPG/298-428--------------------------------------------------------------------------------
A0A0M1V2U4_YERPE/184-326--------------------------------------------------------------------------------
C4SH19_YERMO/257-393--------------------------------------------------------------------------------
CEA3_ECOLX/172-286--------------------------------------------------------------------------------
C4SH22_YERMO/173-298--------------------------------------------------------------------------------
B0KQC9_PSEPG/357-498--------------------------------------------------------------------------------
B4F067_PROMH/227-363--------------------------------------------------------------------------------
Q2C918_9GAMM/172-308--------------------------------------------------------------------------------
A7MTX8_VIBCB/589-723--------------------------------------------------------------------------------
A1TWM1_MARHV/259-395--------------------------------------------------------------------------------
C3K1R5_PSEFS/156-287--------------------------------------------------------------------------------
Q3KGY0_PSEPF/174-305--------------------------------------------------------------------------------
B7VQ54_VIBTL/208-337--------------------------------------------------------------------------------
D7HGP2_VIBCL/565-699--------------------------------------------------------------------------------
Q3K6V8_PSEPF/148-281--------------------------------------------------------------------------------
Q7CGU6_YERPE/269-408--------------------------------------------------------------------------------
Q7N861_PHOLL/282-420--------------------------------------------------------------------------------
Q2V060_PECCC/88-226--------------------------------------------------------------------------------
A6TAS7_KLEP7/151-314--------------------------------------------------------------------------------
A9MMY5_SALAR/912-1053--------------------------------------------------------------------------------
A6TI19_KLEP7/500-639--------------------------------------------------------------------------------
Q9XBT6_KLEPN/492-631--------------------------------------------------------------------------------
CEAD_ECOLX/451-590--------------------------------------------------------------------------------
Q5V9K0_KLEPN/374-517--------------------------------------------------------------------------------
Q5QGN1_KLEOX/466-609--------------------------------------------------------------------------------
A8G950_SERP5/403-545--------------------------------------------------------------------------------
B2VB98_ERWT9/362-505--------------------------------------------------------------------------------

PF03515

A6XA70_XENNE/1-324SSGGSS......SVDLSQYPEAMAI.IFPYFAAVPSPIFPI.......NG........VLGVTINTG....FIDTGLINL
A8ARS8_CITK8/1-223.......................AF.......GLPALATPG.......AE........GLALSVSGD....ALSAAVADV
A0A0E2A345_ECOLX/1-311GTGGNL..........SAVAAPVAF.......GFPALSTPG.......AG........GLAVSISAG....ALSAAIADI
C3UUF3_ECOLX/1-309GLAPSMPPGWGD.....YSPQGIAL........VQGVLFPGIIRRIILDKELEEGDWSGWSVSVHSPWGNEKVSAARTVL
CEA7_ECOLX/1-306N...............SSVAAPMAF.......GFPALAAPG.......AG........TLGISVSGE....ALSAAIADI
Q5QGN1_KLEOX/1-314TRGYDVPPLPGDTEMLTVTPKGTPADTWPKRPDIKEWYVPGEKPFDPSTGNGWVPDVDGYAESLPAGI.PAVVQAAISKV

PF06958

Q51549_PSEAI/488-632--------------------------------------------LQSVAKAGGTVDMPVR--------------------
PYS2_PSEAE/415-554--------------------------------------------LNAVAKASGTVDLPMR--------------------
Q88NA6_PSEPK/490-621--------------------------------------------LAALAASSTSIDLPYL--------------------
Q3K520_PSEPF/519-654--------------------------------------------LHAIAAAGGTVDMPFR--------------------
Q4ZME2_PSEU2/372-507--------------------------------------------LPAIAASGGTVDLPFR--------------------
Q3KHV9_PSEPF/452-588--------------------------------------------LYELATTGGEVDLPVR--------------------
Q4ZZN9_PSEU2/384-518--------------------------------------------LHYLASVKGTLDVPHR--------------------
Q51502_PSEAI/502-636--------------------------------------------WQAIAAAKGTVDLPYR--------------------
Q48N26_PSE14/366-496--------------------------------------------LNDVAATGGTIDMPYR--------------------
B0KLG0_PSEPG/298-428--------------------------------------------LYEKALSHGVAESTYR--------------------
A0A0M1V2U4_YERPE/184-326--------------------------------------------ATESLASQGEMALPVR--------------------
C4SH19_YERMO/257-393--------------------------------------------PATGSAKQDDIELPIR--------------------
CEA3_ECOLX/172-286--------------------------------------------LP...LDKATVNVNVR--------------------
C4SH22_YERMO/173-298--------------------------------------------PKETLKTVDEVAVNVR--------------------
B0KQC9_PSEPG/357-498--------------------------------------------WADLAAERAEVDLPMR--------------------
B4F067_PROMH/227-363--------------------------------------------LNEIAKNNGTINVNAR--------------------
Q2C918_9GAMM/172-308--------------------------------------------TEEELRQMREVKSRIR--------------------
A7MTX8_VIBCB/589-723--------------------------------------------TDQDLRQVTTAQSRVR--------------------
A1TWM1_MARHV/259-395--------------------------------------------TEEELREMTEAAIRVR--------------------
C3K1R5_PSEFS/156-287--------------------------------------------SEEQLRSMQRARSQMR--------------------
Q3KGY0_PSEPF/174-305--------------------------------------------TEDQLLALKQARTRVR--------------------
B7VQ54_VIBTL/208-337--------------------------------------------NREEFNQLSDVNTELK--------------------
D7HGP2_VIBCL/565-699--------------------------------------------GNSDFAANDTTTMRVR--------------------
Q3K6V8_PSEPF/148-281--------------------------------------------TDEQLRSMSRATTRVR--------------------
Q7CGU6_YERPE/269-408--------------------------------------------LENIAKNGGSAPTRVR--------------------
Q7N861_PHOLL/282-420--------------------------------------------LRQIAEQYGKAPTRVR--------------------
Q2V060_PECCC/88-226--------------------------------------------LLEAANKQGTVPSRVR--------------------
A6TAS7_KLEP7/151-314--------------------------------------------LREIARQNGTVHTRVR--------------------
A9MMY5_SALAR/912-1053--------------------------------------------LRQKSLTGAKATTRVR--------------------
A6TI19_KLEP7/500-639--------------------------------------------LNKAADQKTSVSMPVR--------------------
Q9XBT6_KLEPN/492-631--------------------------------------------LIKAADSKTGVSMPVR--------------------
CEAD_ECOLX/451-590--------------------------------------------V..IEPGATSVNLPVR--------------------
Q5V9K0_KLEPN/374-517--------------------------------------------KLSIEPGMKSVNLPVR--------------------
Q5QGN1_KLEOX/466-609--------------------------------------------KTNIQPGMKTVDLPVR--------------------
A8G950_SERP5/403-545--------------------------------------------KVSISPEMHSVDLPVR--------------------
B2VB98_ERWT9/362-505--------------------------------------------RTSIQPGMTSIDMPVR--------------------

PF03515

A6XA70_XENNE/1-324.....GNFINKAKPMANRLAQQAAANISGIARVGVFANPIVGIGIGSLWPGSIATDQEVRDALEKKLKENGGIIKLEHGY
A8ARS8_CITK8/1-223LAALKG.......P.....................FKFGLWGIAIYGVLPSEIAKDDPKM.................MSK
A0A0E2A345_ECOLX/1-311MAALKG.......P.....................FKFGLWGVALYGVLPSQIAKDDPNM.................MSK
C3UUF3_ECOLX/1-309ENGLRGGLPEPSRP..........................AAVSFARLEPASGNEQKIIR....................
CEA7_ECOLX/1-306FAALKG.......P.....................FKFSAWGIALYGILPSEIAKDDPNM.................MSK
Q5QGN1_KLEOX/1-314..........KGAP.....................LKGGMSAVDIWKLKPATEYPGRFNS.................TDP

PF06958

Q51549_PSEAI/488-632LTSAAQESPSGKS..Q........IAAMLT..NGATVPKGVPVPRR.TLNTATGRYEVTVPAKSTVPNTPP---------
PYS2_PSEAE/415-554LTN...EARGNTT..T........LSVVST..DGVSVPKAVPVRMA.AYNATTGLYEVTVP..STTAEAPP---------
Q88NA6_PSEPK/490-621LAG...VENENEL..D........LYVVPS.......GKPVAVRAA.TFDSERQVYS.......LALDNPQ---------
Q3K520_PSEPF/519-654VSS..KTDAYGQS..E........VFVVKT..DGRNIPSAVRVVAA.SYDTERNVYT......ATTFDVPP---------
Q4ZME2_PSEU2/372-507LSS..KTAADGQS..E........VFVVKT..DALTASSKVRVVSA.VLDVEQNTYS......VTTGDVPP---------
Q3KHV9_PSEPF/452-588LGS...RTFGNTV..E........VVVVST..DGVTVPSKVPVVLA.RFDVQKNTYIST....ANASDSKG---------
Q4ZZN9_PSEU2/384-518LTS...DEAGTSG..A........ARWVAT..DGVEVGTKVRVRTF.TYNAQNNSYE......FIRDGEST---------
Q51502_PSEAI/502-636LKT...LNVDGSI..Q........IIAVPT....EPGSAAVPVRAL.TLDSASGTYK......YTTTGPGG---------
Q48N26_PSE14/366-496IYG.......DRS..K........YSVVAT.QAEGGFSPRVPVRAL.TLDPVANAYT......FTTSDTPP---------
B0KLG0_PSEPG/298-428IYT........RN..D........IYTLIKNQQTASLESRVPLRPL.YFDEATNSYI......SVPSQKFP---------
A0A0M1V2U4_YERPE/184-326MRIIDAKDWIGCT..E........IYAVKT..GVAGVLPKVKVGAA.QYDESTGVYT......FTTDSTPP---------
C4SH19_YERMO/257-393MLI...ADADGFM..E........IHAVKT..GVAGISAKVKVVAA.QYDAHQETYT......FTTDHRLP---------
CEA3_ECOLX/172-286VVD...DVKDERQ..N........ISVVSG......VPMSVPVVDA.KPTERPGVFT..............---------
C4SH22_YERMO/173-298ISD...VTQEGVQ..Q........AVLIKN....PTVTQRVPVVKA.VPTATPNVYT..............---------
B0KQC9_PSEPG/357-498LCSMVRGARSGST..KGVKPFTRYCHVLMTSTQGPIVPSRVRVREA.GWDAGRRAFA......FTSETGAP---------
B4F067_PROMH/227-363MAI...IKENNKA..N........AALVGT..DGVLVTKEVPVYKV...NYAANSYH.......VDIKNLG---------
Q2C918_9GAMM/172-308VQI..IDPDDDDVYPT........VRAFHV....GDGHDRIQVRYV.DKNAKGQYSV........ILEEGG---------
A7MTX8_VIBCB/589-723VHI..TEPQDGEFYPH........VQGYHV......DDTRIPIKYV.KQGNNGQLSV........AIEDNG---------
A1TWM1_MARHV/259-395FHL..HVDATGNL..R........VAGYHV.NDSTGYKDRVPVAHA...ELKGENFE........VVVDDD---------
C3K1R5_PSEFS/156-287LHI..EQREDGTL..K........GYGFYT..GNHADWQMIDVVQ...FQSRGDQFV........ADLDEG---------
Q3KGY0_PSEPF/174-305LRV..EQQADGNL..K........GYGFYT..GKNRDWEMVDVVQ...FAARGNRFV........ADLGEG---------
B7VQ54_VIBTL/208-337LRL..QNDESGKE..D........LIAFHR......YGEKLPVIQA.EPNPESGSKA......FQATLPSG---------
D7HGP2_VIBCL/565-699FNM..YTDENGKQ..Q........VLGIKT.GEGSVYGERVAKREA...VRQGQHFV........AELENG---------
Q3K6V8_PSEPF/148-281FQF..RRDAEGVM..Q........VYGIHT...GASGDDSVRTVKV.EWNNDKSAME.........AKLND---------
Q7CGU6_YERPE/269-408FRW..VDSGNGRL..K........AEGYHM..SAEGGLDRVPVRKM.TLNVFTGNYE......FWEDGAAG---------
Q7N861_PHOLL/282-420FRW.IRDEKSGRM..T........VQGYHV..SPEGGLDKVPVRMM.TLNRTTGNYE......FWEPGEYR---------
Q2V060_PECCC/88-226YQW.MEDEETGRL..K........AVGYHT..SMESGRDQVRVRLL.KYDFPNNRYA......FWEEGATG---------
A6TAS7_KLEP7/151-314FRI.EEDPESGEL..V........SRSYEV..GEKSGLDRVRVRFAKQLNKETWGFE.........DPSIK---------
A9MMY5_SALAR/912-1053FFW..RQDEQGNM..R........VYGVHT..GEGTPYEGVRTAEM.KWVEKNSRYE.....FKPAHGADV---------
A6TI19_KLEP7/500-639GRL..VMNDSGIL..D........VQLVKT.....NTAGAVKVARA.VLDKETGYWGYTL...PAVADVPA---------
Q9XBT6_KLEPN/492-631GRI..IVREGDYL..E........SQFVRT.....PVAGSVPVVRA.ALDKATGYWGYTL...PAIQGVPG---------
CEAD_ECOLX/451-590GQL...INSNGQL..A........LDLLKT..GNESIPAAVPVLNA.VRDTATGLDKITL...PAVVGAPS---------
Q5V9K0_KLEPN/374-517GFI..SSETDGRQ..S........LMLVKT..GSDGVPSTVPVLDA.VRDSTTGLDKITV...PAMSGAPS---------
Q5QGN1_KLEOX/466-609GYI..SYDGNGRQ..S........VNLVRT..GTGGVSATVPVLSA.VRDKTTGLDKITV...PAVAGAPS---------
A8G950_SERP5/403-545GSL...VMENGQQ..Q........VRLVKT..GIGGVPASVPILKA.VRDEKTGLDRITL...PSVGGAPS---------
B2VB98_ERWT9/362-505GFI..STDETGRQ..S........VNFVRT..GVGGVSPSVPVFRP.VRDEQTGLDKITL...PAMEGVPA---------

PF03515

A6XA70_XENNE/1-324IVSTLPVDQVSSV--P--------AKKIRENKKIVAETVVTPVIDEKEQKRKAAITK..SRTQIPVIKAEP........T
A8ARS8_CITK8/1-223IVTSLPADTVTET--P--------VSSLPLDQATVSVTKRVADIVKDERQHIAVVTG..RPMSVPVVDAKP........T
A0A0E2A345_ECOLX/1-311IVTSLPADDITES--P--------VSSLPLDKATVNVNVRVVDDVKDERQNISVVSG..VPMSVPVVDAKP........T
C3UUF3_ECOLX/1-309LMVTQQLEQVTDI--P--------ASQLPAAGNNVPVKYRLTDLMQNGTQYMAIIGG..IPMTVPVVDAVPVPDRSRPGT
CEA7_ECOLX/1-306IVTSLPAETVTNV--Q--------VSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAG..VPMSVPVVNAKP........T
Q5QGN1_KLEOX/1-314AFSWFPVRALTDT--D--------ISAMPVAPETVPVHTRILDNVHDGVQFVSAVFAGSMQYNLPVVKAQA........T

PF06958

Q51549_PSEAI/488-632--LILTWTPATPP....GSQNPSSTTP........................VVPQPAPVYEGATITPVQAE...PESYPG
PYS2_PSEAE/415-554--LILTWTPASPP....GNQNPSSTTP........................VVPKPVPVYEGATLTPVKAT...PETYPG
Q88NA6_PSEPK/490-621--RILTWTPASAP...GGDEGNSTSLP........................LVPPGTVVYTGSSLNPVVTE...QEGYPA
Q3K520_PSEPF/519-654--RTLTWTPIVNP......GNSSTTSP........................AGQPDVPAYTGATVVPVEGR...LDSFPG
Q4ZME2_PSEU2/372-507--RILTWTPIVSP......GNSSTTSP........................AEQPAPPVYTGAAVTPVEGR...IDAFPA
Q3KHV9_PSEPF/452-588--PVVTWTPLVKP......LNPSTDLP........................VADTDLPNYEGADVTPDSGR...IDPFPQ
Q4ZZN9_PSEU2/384-518--PALIWTPIARP......ADSSTSSP........................AGPPALPVDPGNVVTPFVPE...LEAYPA
Q51502_PSEAI/502-636--GTILVTPDTPP....GQIDPSSSTP........................AVPRGPLIMPGTLLIPKEPQ...IESYPE
Q48N26_PSE14/366-496--ITLTL.PIAAP......GNSSTTTV........................AQPVETPAYAGITLEPIEVK...GEPLPG
B0KLG0_PSEPG/298-428--IKLTL.PAHTP......GDTSTTKP........................GAQIPSYPYRGVTLNPLHIE...ASPLPA
A0A0M1V2U4_YERPE/184-326--RTLIFTPAQPP...GAETRPILAPP........................GSTPATLQHTGEMIIKPVITPT.ILPLPQ
C4SH19_YERMO/257-393--RTFTFTSS......GADISMGVPAA........................ASTAPASRHTGGVVIRHAVIHT.VLPQPT
CEA3_ECOLX/172-286--...ASIPGAPV....LNISVNNSTP........................AVQTLSPGVTNNTDKD.......VRPAGF
C4SH22_YERMO/173-298--...APVPGVTP....IHINVVESIE........................PSHQTQPTVAGKPTATPVENAP.IKAVTS
B0KQC9_PSEPG/357-498--VTVLWQKGSAP...........YPP........................IDISRPPSISYLHMPNVPI....IERFMD
B4F067_PROMH/227-363--IEYLLRPTSSPSGLGLQGNIIQKHS........................NENKKFSYPEKIELPNKVENKRIDVPYP.
Q2C918_9GAMM/172-308--PTIYWSPDETG....NQVPYTTPSQ........................NDGVSFGDIWVNPLSDAVSNS..STVLPM
A7MTX8_VIBCB/589-723--PTIYWTPEENG....EASWQTTPDH........................SDDFEKEDILVTPIHSDGDAN..VTVTPA
A1TWM1_MARHV/259-395--FTLVWYPDDSG...HRPVVSTEYPA........................DSGIDPYSILVTPIQEDG.....QEHSPP
C3K1R5_PSEFS/156-287--VELIWTPAADP.....SDTLGIPAL........................EAAPQAPVIWIYPPTEKAAQILVNPIYP.
Q3KGY0_PSEPF/174-305--VELVWTPAVDG.....SDILGIPAL........................EAAPQAPHIWVYPPTKAADGILVNPVYP.
B7VQ54_VIBTL/208-337--VVIEWNGVSKQ...GPLFHNGAKRR........................FGSLRQEKVLPNDGK........TQDIEG
D7HGP2_VIBCL/565-699--ITITWTPDGST...DVLTPDTVLPE........................NDQLDVHNIWVRPIEEHEQEIG.TALYP.
Q3K6V8_PSEPF/148-281--ITILWTPQRGP....LGSMPPLVHP........................EHGEALSTILVHPIAANTDSQ..IEILPG
Q7CGU6_YERPE/269-408--PTILWTPNDPG....FKAPSNTGNN........................DGPIIRTTITVLPMPEADETGEHSTTLPM
Q7N861_PHOLL/282-420--PTILWTPNEQE....FKVPAHTGNE........................EQPFIPSQITVLPIPEKVGSD..IESLPM
Q2V060_PECCC/88-226--PTILWTPDNPG....MELPTDTAHG........................EQPVIPSAVPGFEIPEMDDVS..ILATPM
A6TAS7_KLEP7/151-314--GTFVWSRSAGQGKFEWGSSQTTVHDGGAGGSTTPPTPIPEPRSVWGLPNPAPASLPPVPGTPIPEEQGPN..IETLP.
A9MMY5_SALAR/912-1053--PLITWTPERPE...GGDLPAHTGSD........................IKPIDQATILVTPIPDGKDEYT.TPPFPM
A6TI19_KLEP7/500-639--QTIFVSPADAL...GANGPLTLSGP........................VPLPERILHTGDQISAPQATD..KTVTPV
Q9XBT6_KLEPN/492-631--QTILVSPSDAP...GVNGPLGLAGP........................VPLPETIIHTGGQTTVPQGGT..VTVSPA
CEAD_ECOLX/451-590--RTILVNPVPQP.....SVPTDTGNH........................QPVPVTPVHTGTEVKSVEMPV..TTITPV
Q5V9K0_KLEPN/374-517--RTILVNPVPIG....PAAPWHTGNS........................GPVPVTPVHTGTEVKQADSIV..TTTLPI
Q5QGN1_KLEOX/466-609--RTILINPVPVG....PATPSHTGSS........................TPVPVTPVHTGTDVKQADSIV..TTTLPA
A8G950_SERP5/403-545--RTILINPAPVG....PTAPPHTGNS........................SPAPVTPVHTGTTVKQADSIV..TTSFPA
B2VB98_ERWT9/362-505--RTILINPMPTG....PAAPAHTGND........................SPVPNSPVHTGTNVRQADSIV..VTTFPA

PF03515

A6XA70_XENNE/1-324NRPNVYSASVVPG.MKPMQIKVDNT..------------------------.NQAVPKNISKANPIPNVEIFT-SAPV..
A8ARS8_CITK8/1-223KRPGVFSVSI.PG.LPSLQVSVPKGVP------------------------AAKAPPKGIIAE......KG.D-SRPAGF
A0A0E2A345_ECOLX/1-311ERPGVFTASI.PG.APVLNISVNNSTP------------------------AVQTLSPGVTNN......TDKD-VRPAGF
C3UUF3_ECOLX/1-309NIKDVYSAPVSPN.LPDLVLSVGQMNT------------------------PVRSNPEIQEDG...VITETGN-YVEAGY
CEA7_ECOLX/1-306RTPGVFHASF.PG.VPSLTVSTVKGLP------------------------VSTTLPRGITED......KGRT-AVPAGF
Q5QGN1_KLEOX/1-314AGSDYYTIGRLPGIMSAFTFSFYTKGT------------------------PQDSRFFRDTVK......AGGD-LREAGF

PF06958

Q51549_PSEAI/488-632V.PLDLDD...LIVIFP..AGSDVPPLYLV-------------------------
PYS2_PSEAE/415-554V.ITLPED...LIIGFP..ADSGIKPIYVM-------------------------
Q88NA6_PSEPK/490-621LDLLDQER...LIITFP..MDSGLPPILVV-------------------------
Q3K520_PSEPF/519-654VFEAGFDD...YVLVFP..QDSGLPPNYTM-------------------------
Q4ZME2_PSEU2/372-507VSEASFDD...FITVFP..ADSGLPPIYTM-------------------------
Q3KHV9_PSEPF/452-588LDQYGFDG...WVTVFP..IDSGIPPIFTM-------------------------
Q4ZZN9_PSEU2/384-518IDRDDPDD...YILISP..IDSGLPNSYLL-------------------------
Q51502_PSEAI/502-636LDQREFND...GIYVYP..EDSGIPPLYIV-------------------------
Q48N26_PSE14/366-496TSQMDIRD...AIYVYP..LNSGLPPVYVV-------------------------
B0KLG0_PSEPG/298-428LEPEDFKD...CIYCFP..PESGLPPLYVV-------------------------
A0A0M1V2U4_YERPE/184-326LYARDFHD...YIIWFP..ADSGLEPVYVY-------------------------
C4SH19_YERMO/257-393WEDRDFHD...YIIGFP..ANSGLEPVYVY-------------------------
CEA3_ECOLX/172-286TQGGNTRD...AVIRFP..KDSGHNAVYVS-------------------------
C4SH22_YERMO/173-298PSGRHTHD...AIIVFP..ETSGIEPLYIS-------------------------
B0KQC9_PSEPG/357-498LTQVQFDD...YIVVFP..PQAGLAPVYVM-------------------------
B4F067_PROMH/227-363...HQFND...AIIVFP..KNSNLPPLYVY-------------------------
Q2C918_9GAMM/172-308PAESDWQD...RILVFP..EDSGVEPLYLV-------------------------
A7MTX8_VIBCB/589-723PEEKDWRD...AILVFP..ESSGIAPLYVV-------------------------
A1TWM1_MARHV/259-395GYQQPFEDQVELIVSFP..ADSGIEPLYLV-------------------------
C3K1R5_PSEFS/156-287...PEYRD...FILVFP..AESGVRPLYVV-------------------------
Q3KGY0_PSEPF/174-305...PEYWD...FILVFP..AESGVRPLYIV-------------------------
B7VQ54_VIBTL/208-337VPDDAVEE...VIIAFP..KQKFLEPLYLV-------------------------
D7HGP2_VIBCL/565-699..EEELAE...YIVTFP..ADSGVSPLYLV-------------------------
Q3K6V8_PSEPF/148-281.EDITAED...CILVFP..AETGLKSLYVV-------------------------
Q7CGU6_YERPE/269-408PEEKDFRD...YILIHP...LLDLPPLYIY-------------------------
Q7N861_PHOLL/282-420PEEKDFRD...YILILP...VPNMPPVYVY-------------------------
Q2V060_PECCC/88-226PEEKDFRD...YILVFP...ENSFPPIYIY-------------------------
A6TAS7_KLEP7/151-314IEDRDFND...FIIVDP...MGGVPAIYVY-------------------------
A9MMY5_SALAR/912-1053PEERDLND...YILVFP..AGSGIKPVYVY-------------------------
A6TI19_KLEP7/500-639ADDLDFDD...IILVFP..PESGLKPLYVM-------------------------
Q9XBT6_KLEPN/492-631EDDIDFND...LILVFP..PESGLKPLYVM-------------------------
CEAD_ECOLX/451-590SDVGGLRD...FIYWRPDAAGTGVEAVYVM-------------------------
Q5V9K0_KLEPN/374-517ADIPPLQD...FIYWQPDASGTGVEPIYVM-------------------------
Q5QGN1_KLEOX/466-609ADIPALQD...FIYWQPDATGTGVEPIYVM-------------------------
A8G950_SERP5/403-545DDLKELQD...FIYWQPDATGSGVEPIYVM-------------------------
B2VB98_ERWT9/362-505DVVQDLQD...FILWQPDATEVGVEAIYVM-------------------------

PF03515

A6XA70_XENNE/1-324...NDTHH---AFIDFG--EK..HDLIYISVSKIPTVAEEKEQIEESKKNKQKWL
A8ARS8_CITK8/1-223TAGGNSRE---AVIRFP--KESGQKPVYVSVTDVLTPAQVKQRLEEEKRRQQAWD
A0A0E2A345_ECOLX/1-311TQGGNTRD---AVIRFP--KDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWD
C3UUF3_ECOLX/1-309TMSSNNHD---VIVRFP--EGSGVSPLYISAVEILDSNSLSQRQEAENNAKDNFR
CEA7_ECOLX/1-306TFGGGSHE---AVIRFP--KESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWN
Q5QGN1_KLEOX/1-314TVGANTSD---FIIWFP--QGSGLEPLYFSMTMNMPAGPLQRRQEAENKARAEAD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window