Sequence alignment for CL0446

PF06958

Q51549_PSEAI/488-632LQ------------------------------------------------------------------------------
PYS2_PSEAE/415-554LN------------------------------------------------------------------------------
Q88NA6_PSEPK/490-621LA------------------------------------------------------------------------------
Q3K520_PSEPF/519-654LH------------------------------------------------------------------------------
Q4ZME2_PSEU2/372-507LP------------------------------------------------------------------------------
Q3KHV9_PSEPF/452-588LY------------------------------------------------------------------------------
Q4ZZN9_PSEU2/384-518LH------------------------------------------------------------------------------
Q51502_PSEAI/502-636WQ------------------------------------------------------------------------------
Q48N26_PSE14/366-496LN------------------------------------------------------------------------------
B0KLG0_PSEPG/298-428LY------------------------------------------------------------------------------
B0H8F2_YERPE/184-326AT------------------------------------------------------------------------------
C4SH19_YERMO/257-393PA------------------------------------------------------------------------------
C4T554_YERIN/658-796PA------------------------------------------------------------------------------
CEA3_ECOLX/172-286LP------------------------------------------------------------------------------
C4T554_YERIN/176-297PL------------------------------------------------------------------------------
C4SH22_YERMO/173-298PK------------------------------------------------------------------------------
B0KQC9_PSEPG/357-498WA------------------------------------------------------------------------------
B4F067_PROMH/227-363LN------------------------------------------------------------------------------
Q2C918_9GAMM/172-308TE------------------------------------------------------------------------------
A7MTX8_VIBHB/589-723TD------------------------------------------------------------------------------
A1TWM1_MARAV/259-395TE------------------------------------------------------------------------------
C3K1R5_PSEFS/156-287SE------------------------------------------------------------------------------
Q3KGY0_PSEPF/174-305TE------------------------------------------------------------------------------
B7VQ54_VIBSL/208-337NR------------------------------------------------------------------------------
D7HGP2_VIBCL/565-699GN------------------------------------------------------------------------------
Q3K6V8_PSEPF/148-281TD------------------------------------------------------------------------------
Q1CF31_YERPN/269-408LE------------------------------------------------------------------------------
Q7N861_PHOLL/282-420LR------------------------------------------------------------------------------
Q2V060_PECCC/88-226LL------------------------------------------------------------------------------
A6TAS7_KLEP7/151-314LR------------------------------------------------------------------------------
Q0TLM8_ECOL5/309-450LR------------------------------------------------------------------------------
A9MMY5_SALAR/912-1053LR------------------------------------------------------------------------------
A6TI19_KLEP7/500-639LN------------------------------------------------------------------------------
Q9XBT6_KLEPN/492-631LI------------------------------------------------------------------------------
CEAD_ECOLX/451-590V.------------------------------------------------------------------------------
Q5V9K0_KLEPN/374-517KL------------------------------------------------------------------------------
Q5QGN1_KLEOX/466-609KT------------------------------------------------------------------------------
A8G950_SERP5/403-545KV------------------------------------------------------------------------------
B2VB98_ERWT9/362-505RT------------------------------------------------------------------------------

PF03515

A3L5Y3_PSEAI/1-271MA.......................................................................VNDYEPG
A6XA70_XENNE/1-324M...........CPIYG........................DGTDWSSEKGGY.......YEKPGDDDRHKNDGNKDRND
A8ARS8_CITK8/1-223M...............................................................................
B3ISX9_ECOLX/1-311MSGGDGR.....GHNTGAHSTSGNINGGPTGLGVGGGA..SDGSGWSSENNPWGGGSGSGIHWGGGSGHGNG.GGNGNSG
C3UUF3_ECOLX/1-309MSD...............................NEGSVPTEGIDYGDTMVVWPSTGRIP.............GGDVKPG
C4T554_YERIN/1-322M......GHGRHGPTGG....................RNPNSGRGWGVSQTPYGPLRHYSPSLF..DGRGPTSGGNPNSG
CEA7_ECOLX/1-306MSGGDGR.....GHNSGAHNTGGNINGGPTGLGGNGGA..SDGSGWSSENNPWGGGSGSGVHWGGGSGHGNG.GGNSNSG
Q5QGN1_KLEOX/1-314MSDI.......................TYNPEDYNNGIPPEPGL.......VWKPGGSFP.............NGSYVPG

PF06958

Q51549_PSEAI/488-632--------------------------------------------------------------------------------
PYS2_PSEAE/415-554--------------------------------------------------------------------------------
Q88NA6_PSEPK/490-621--------------------------------------------------------------------------------
Q3K520_PSEPF/519-654--------------------------------------------------------------------------------
Q4ZME2_PSEU2/372-507--------------------------------------------------------------------------------
Q3KHV9_PSEPF/452-588--------------------------------------------------------------------------------
Q4ZZN9_PSEU2/384-518--------------------------------------------------------------------------------
Q51502_PSEAI/502-636--------------------------------------------------------------------------------
Q48N26_PSE14/366-496--------------------------------------------------------------------------------
B0KLG0_PSEPG/298-428--------------------------------------------------------------------------------
B0H8F2_YERPE/184-326--------------------------------------------------------------------------------
C4SH19_YERMO/257-393--------------------------------------------------------------------------------
C4T554_YERIN/658-796--------------------------------------------------------------------------------
CEA3_ECOLX/172-286--------------------------------------------------------------------------------
C4T554_YERIN/176-297--------------------------------------------------------------------------------
C4SH22_YERMO/173-298--------------------------------------------------------------------------------
B0KQC9_PSEPG/357-498--------------------------------------------------------------------------------
B4F067_PROMH/227-363--------------------------------------------------------------------------------
Q2C918_9GAMM/172-308--------------------------------------------------------------------------------
A7MTX8_VIBHB/589-723--------------------------------------------------------------------------------
A1TWM1_MARAV/259-395--------------------------------------------------------------------------------
C3K1R5_PSEFS/156-287--------------------------------------------------------------------------------
Q3KGY0_PSEPF/174-305--------------------------------------------------------------------------------
B7VQ54_VIBSL/208-337--------------------------------------------------------------------------------
D7HGP2_VIBCL/565-699--------------------------------------------------------------------------------
Q3K6V8_PSEPF/148-281--------------------------------------------------------------------------------
Q1CF31_YERPN/269-408--------------------------------------------------------------------------------
Q7N861_PHOLL/282-420--------------------------------------------------------------------------------
Q2V060_PECCC/88-226--------------------------------------------------------------------------------
A6TAS7_KLEP7/151-314--------------------------------------------------------------------------------
Q0TLM8_ECOL5/309-450--------------------------------------------------------------------------------
A9MMY5_SALAR/912-1053--------------------------------------------------------------------------------
A6TI19_KLEP7/500-639--------------------------------------------------------------------------------
Q9XBT6_KLEPN/492-631--------------------------------------------------------------------------------
CEAD_ECOLX/451-590--------------------------------------------------------------------------------
Q5V9K0_KLEPN/374-517--------------------------------------------------------------------------------
Q5QGN1_KLEOX/466-609--------------------------------------------------------------------------------
A8G950_SERP5/403-545--------------------------------------------------------------------------------
B2VB98_ERWT9/362-505--------------------------------------------------------------------------------

PF03515

A3L5Y3_PSEAI/1-271SMVITHVQGGG..............RDIIQYIPARSSY.......GTPPFVPPG.PSPYVGTG........MQEYRKLRS
A6XA70_XENNE/1-324..SGSSSGGSS..............SVDLSQYPEAMAI.IFPYFAAVPSPIFPI.......NG........VLGVTINTG
A8ARS8_CITK8/1-223....................................AF.......GLPALATPG.......AE........GLALSVSGD
B3ISX9_ECOLX/1-311..GGSGTGGNL..................SAVAAPVAF.......GFPALSTPG.......AG........GLAVSISAG
C3UUF3_ECOLX/1-309..GSSGLAPSM........PPGWGD.....YSPQGIAL........VQGVLFPGIIRRIILDKELEEGDWSGWSVSVHSP
C4T554_YERIN/1-322..MGWGVSQTPYGPLRHYSPSLFDGNDNLAQRPELQVA.I.VP..GVAVPLSLV.......AG........EWGFTLLKP
CEA7_ECOLX/1-306..GGSN.......................SSVAAPMAF.......GFPALAAPG.......AG........TLGISVSGE
Q5QGN1_KLEOX/1-314SWGWPTRGYDV........PPLPGDTEMLTVTPKGTPADTWPKRPDIKEWYVPGEKPFDPSTGNGWVPDVDGYAESLPAG

PF06958

Q51549_PSEAI/488-632----SVAKAGGTVDMPVRLTSAAQESP--------------------------SGKS..Q........IAAMLT..NGAT
PYS2_PSEAE/415-554----AVAKASGTVDLPMRLTN...EAR--------------------------GNTT..T........LSVVST..DGVS
Q88NA6_PSEPK/490-621----ALAASSTSIDLPYLLAG...VEN--------------------------ENEL..D........LYVVPS......
Q3K520_PSEPF/519-654----AIAAAGGTVDMPFRVSS..KTDA--------------------------YGQS..E........VFVVKT..DGRN
Q4ZME2_PSEU2/372-507----AIAASGGTVDLPFRLSS..KTAA--------------------------DGQS..E........VFVVKT..DALT
Q3KHV9_PSEPF/452-588----ELATTGGEVDLPVRLGS...RTF--------------------------GNTV..E........VVVVST..DGVT
Q4ZZN9_PSEU2/384-518----YLASVKGTLDVPHRLTS...DEA--------------------------GTSG..A........ARWVAT..DGVE
Q51502_PSEAI/502-636----AIAAAKGTVDLPYRLKT...LNV--------------------------DGSI..Q........IIAVPT....EP
Q48N26_PSE14/366-496----DVAATGGTIDMPYRIYG......--------------------------.DRS..K........YSVVAT.QAEGG
B0KLG0_PSEPG/298-428----EKALSHGVAESTYRIYT......--------------------------..RN..D........IYTLIKNQQTAS
B0H8F2_YERPE/184-326----ESLASQGEMALPVRMRIIDAKDW--------------------------IGCT..E........IYAVKT..GVAG
C4SH19_YERMO/257-393----TGSAKQDDIELPIRMLI...ADA--------------------------DGFM..E........IHAVKT..GVAG
C4T554_YERIN/658-796----TPLPQQGEIDLPVRMLM...TGQ--------------------------DDWT..D........VYAVKT..GAAN
CEA3_ECOLX/172-286----...LDKATVNVNVRVVD...DVK--------------------------DERQ..N........ISVVSG......
C4T554_YERIN/176-297----AQLPTQPAVVADVRLHD...VVQ--------------------------DGVQ..K........IAIVKS....KH
C4SH22_YERMO/173-298----ETLKTVDEVAVNVRISD...VTQ--------------------------EGVQ..Q........AVLIKN....PT
B0KQC9_PSEPG/357-498----DLAAERAEVDLPMRLCSMVRGAR--------------------------SGST..KGVKPFTRYCHVLMTSTQGPI
B4F067_PROMH/227-363----EIAKNNGTINVNARMAI...IKE--------------------------NNKA..N........AALVGT..DGVL
Q2C918_9GAMM/172-308----EELRQMREVKSRIRVQI..IDPD--------------------------DDDVYPT........VRAFHV....GD
A7MTX8_VIBHB/589-723----QDLRQVTTAQSRVRVHI..TEPQ--------------------------DGEFYPH........VQGYHV......
A1TWM1_MARAV/259-395----EELREMTEAAIRVRFHL..HVDA--------------------------TGNL..R........VAGYHV.NDSTG
C3K1R5_PSEFS/156-287----EQLRSMQRARSQMRLHI..EQRE--------------------------DGTL..K........GYGFYT..GNHA
Q3KGY0_PSEPF/174-305----DQLLALKQARTRVRLRV..EQQA--------------------------DGNL..K........GYGFYT..GKNR
B7VQ54_VIBSL/208-337----EEFNQLSDVNTELKLRL..QNDE--------------------------SGKE..D........LIAFHR......
D7HGP2_VIBCL/565-699----SDFAANDTTTMRVRFNM..YTDE--------------------------NGKQ..Q........VLGIKT.GEGSV
Q3K6V8_PSEPF/148-281----EQLRSMSRATTRVRFQF..RRDA--------------------------EGVM..Q........VYGIHT...GAS
Q1CF31_YERPN/269-408----NIAKNGGSAPTRVRFRW..VDSG--------------------------NGRL..K........AEGYHM..SAEG
Q7N861_PHOLL/282-420----QIAEQYGKAPTRVRFRW.IRDEK--------------------------SGRM..T........VQGYHV..SPEG
Q2V060_PECCC/88-226----EAANKQGTVPSRVRYQW.MEDEE--------------------------TGRL..K........AVGYHT..SMES
A6TAS7_KLEP7/151-314----EIARQNGTVHTRVRFRI.EEDPE--------------------------SGEL..V........SRSYEV..GEKS
Q0TLM8_ECOL5/309-450----QKALAGSTATTRVRFFW..GTDI--------------------------HSKP..Q........VYGVHT..GEGT
A9MMY5_SALAR/912-1053----QKSLTGAKATTRVRFFW..RQDE--------------------------QGNM..R........VYGVHT..GEGT
A6TI19_KLEP7/500-639----KAADQKTSVSMPVRGRL..VMND--------------------------SGIL..D........VQLVKT.....N
Q9XBT6_KLEPN/492-631----KAADSKTGVSMPVRGRI..IVRE--------------------------GDYL..E........SQFVRT.....P
CEAD_ECOLX/451-590----.IEPGATSVNLPVRGQL...INS--------------------------NGQL..A........LDLLKT..GNES
Q5V9K0_KLEPN/374-517----SIEPGMKSVNLPVRGFI..SSET--------------------------DGRQ..S........LMLVKT..GSDG
Q5QGN1_KLEOX/466-609----NIQPGMKTVDLPVRGYI..SYDG--------------------------NGRQ..S........VNLVRT..GTGG
A8G950_SERP5/403-545----SISPEMHSVDLPVRGSL...VME--------------------------NGQQ..Q........VRLVKT..GIGG
B2VB98_ERWT9/362-505----SIQPGMTSIDMPVRGFI..STDE--------------------------TGRQ..S........VNFVRT..GVGG

PF03515

A3L5Y3_PSEAI/1-271....TLDKSHSELKKNLKNETLKEVDE.....................IKSE.AGLPGKA--------VSANDIRDEKSI
A6XA70_XENNE/1-324....FIDTGLINL.....GNFINKAKPMANRLAQQAAANISGIARVGVFANPIVGIGIGS--------LWPGSIATDQEV
A8ARS8_CITK8/1-223....ALSAAVADVLAALKG.......P.....................FKFGLWGIAIYG--------VLPSEIAKDDPK
B3ISX9_ECOLX/1-311....ALSAAIADIMAALKG.......P.....................FKFGLWGVALYG--------VLPSQIAKDDPN
C3UUF3_ECOLX/1-309WGNEKVSAARTVLENGLRGGLPEPSRP..........................AAVSFAR--------LEPASGNEQKII
C4T554_YERIN/1-322....KVVAAALDLALTRMAMFAVDAAP.....................YAGRFAGVVGML--------LAPSEIAKDDMS
CEA7_ECOLX/1-306....ALSAAIADIFAALKG.......P.....................FKFSAWGIALYG--------ILPSEIAKDDPN
Q5QGN1_KLEOX/1-314I.PAVVQAAISKV..........KGAP.....................LKGGMSAVDIWK--------LKPATEYPGRFN

PF06958

Q51549_PSEAI/488-632V-----------------------------------------PKGVPVPRR.TLNTATGRYEVTVPAKSTVPNTPPLILT
PYS2_PSEAE/415-554V-----------------------------------------PKAVPVRMA.AYNATTGLYEVTVP..STTAEAPPLILT
Q88NA6_PSEPK/490-621.-----------------------------------------GKPVAVRAA.TFDSERQVYS.......LALDNPQRILT
Q3K520_PSEPF/519-654I-----------------------------------------PSAVRVVAA.SYDTERNVYT......ATTFDVPPRTLT
Q4ZME2_PSEU2/372-507A-----------------------------------------SSKVRVVSA.VLDVEQNTYS......VTTGDVPPRILT
Q3KHV9_PSEPF/452-588V-----------------------------------------PSKVPVVLA.RFDVQKNTYIST....ANASDSKGPVVT
Q4ZZN9_PSEU2/384-518V-----------------------------------------GTKVRVRTF.TYNAQNNSYE......FIRDGESTPALI
Q51502_PSEAI/502-636G-----------------------------------------SAAVPVRAL.TLDSASGTYK......YTTTGPGGGTIL
Q48N26_PSE14/366-496F-----------------------------------------SPRVPVRAL.TLDPVANAYT......FTTSDTPPITLT
B0KLG0_PSEPG/298-428L-----------------------------------------ESRVPLRPL.YFDEATNSYI......SVPSQKFPIKLT
B0H8F2_YERPE/184-326V-----------------------------------------LPKVKVGAA.QYDESTGVYT......FTTDSTPPRTLI
C4SH19_YERMO/257-393I-----------------------------------------SAKVKVVAA.QYDAHQETYT......FTTDHRLPRTFT
C4T554_YERIN/658-796I-----------------------------------------AAKVKVTTA.QFDQSKGVYT......FTTDSQPPRTFI
CEA3_ECOLX/172-286V-----------------------------------------PMSVPVVDA.KPTERPGVFT.................A
C4T554_YERIN/176-297V-----------------------------------------PIAVPVVQA.KPTDRTGVFT................AQ
C4SH22_YERMO/173-298V-----------------------------------------TQRVPVVKA.VPTATPNVYT.................A
B0KQC9_PSEPG/357-498V-----------------------------------------PSRVRVREA.GWDAGRRAFA......FTSETGAPVTVL
B4F067_PROMH/227-363V-----------------------------------------TKEVPVYKV...NYAANSYH.......VDIKNLGIEYL
Q2C918_9GAMM/172-308G-----------------------------------------HDRIQVRYV.DKNAKGQYSV........ILEEGGPTIY
A7MTX8_VIBHB/589-723D-----------------------------------------DTRIPIKYV.KQGNNGQLSV........AIEDNGPTIY
A1TWM1_MARAV/259-395Y-----------------------------------------KDRVPVAHA...ELKGENFE........VVVDDDFTLV
C3K1R5_PSEFS/156-287D-----------------------------------------WQMIDVVQ...FQSRGDQFV........ADLDEGVELI
Q3KGY0_PSEPF/174-305D-----------------------------------------WEMVDVVQ...FAARGNRFV........ADLGEGVELV
B7VQ54_VIBSL/208-337Y-----------------------------------------GEKLPVIQA.EPNPESGSKA......FQATLPSGVVIE
D7HGP2_VIBCL/565-699Y-----------------------------------------GERVAKREA...VRQGQHFV........AELENGITIT
Q3K6V8_PSEPF/148-281G-----------------------------------------DDSVRTVKV.EWNNDKSAME.........AKLNDITIL
Q1CF31_YERPN/269-408G-----------------------------------------LDRVPVRKM.TLNVFTGNYE......FWEDGAAGPTIL
Q7N861_PHOLL/282-420G-----------------------------------------LDKVPVRMM.TLNRTTGNYE......FWEPGEYRPTIL
Q2V060_PECCC/88-226G-----------------------------------------RDQVRVRLL.KYDFPNNRYA......FWEEGATGPTIL
A6TAS7_KLEP7/151-314G-----------------------------------------LDRVRVRFAKQLNKETWGFE.........DPSIKGTFV
Q0TLM8_ECOL5/309-450P-----------------------------------------YENVRVANM.QWNEQTQRYE.....FTPAHDVDGPLIT
A9MMY5_SALAR/912-1053P-----------------------------------------YEGVRTAEM.KWVEKNSRYE.....FKPAHGADVPLIT
A6TI19_KLEP7/500-639T-----------------------------------------AGAVKVARA.VLDKETGYWGYTL...PAVADVPAQTIF
Q9XBT6_KLEPN/492-631V-----------------------------------------AGSVPVVRA.ALDKATGYWGYTL...PAIQGVPGQTIL
CEAD_ECOLX/451-590I-----------------------------------------PAAVPVLNA.VRDTATGLDKITL...PAVVGAPSRTIL
Q5V9K0_KLEPN/374-517V-----------------------------------------PSTVPVLDA.VRDSTTGLDKITV...PAMSGAPSRTIL
Q5QGN1_KLEOX/466-609V-----------------------------------------SATVPVLSA.VRDKTTGLDKITV...PAVAGAPSRTIL
A8G950_SERP5/403-545V-----------------------------------------PASVPILKA.VRDEKTGLDRITL...PSVGGAPSRTIL
B2VB98_ERWT9/362-505V-----------------------------------------SPSVPVFRP.VRDEQTGLDKITL...PAMEGVPARTIL

PF03515

A3L5Y3_PSEAI/1-271V...........................DALMDAKAKSLKAIEDRPANLYT-ASDFPQKSESMYQSQLLASRKFYGEFLD
A6XA70_XENNE/1-324RDALEKKLKENGGIIKLEHGYIVSTLPVDQVSSVPAKKIRENKKIVAETVV-TPVIDEKEQKRKAAITK..SRTQIPVIK
A8ARS8_CITK8/1-223M.................MSKIVTSLPADTVTETPVSSLPLDQATVSVTKR-VADIVKDERQHIAVVTG..RPMSVPVVD
B3ISX9_ECOLX/1-311M.................MSKIVTSLPADDITESPVSSLPLDKATVNVNVR-VVDDVKDERQNISVVSG..VPMSVPVVD
C3UUF3_ECOLX/1-309R....................LMVTQQLEQVTDIPASQLPAAGNNVPVKYR-LTDLMQNGTQYMAIIGG..IPMTVPVVD
C4T554_YERIN/1-322V.................IRRTVVTLPADKITTMPLAQLP.TQPAVVADVR-LHDVVQDGVQKIAIVKSKHVPIAVPVVQ
CEA7_ECOLX/1-306M.................MSKIVTSLPAETVTNVQVSTLPLDQATVSVTKR-VTDVVKDTRQHIAVVAG..VPMSVPVVN
Q5QGN1_KLEOX/1-314S.................TDPAFSWFPVRALTDTDISAMPVAPETVPVHTR-ILDNVHDGVQFVSAVFAGSMQYNLPVVK

PF06958

Q51549_PSEAI/488-632WTP--------ATPP....GSQNPS-----------STTP........................VVPQPAPVYEGATITP
PYS2_PSEAE/415-554WTP--------ASPP....GNQNPS-----------STTP........................VVPKPVPVYEGATLTP
Q88NA6_PSEPK/490-621WTP--------ASAP...GGDEGNS-----------TSLP........................LVPPGTVVYTGSSLNP
Q3K520_PSEPF/519-654WTP--------IVNP......GNSS-----------TTSP........................AGQPDVPAYTGATVVP
Q4ZME2_PSEU2/372-507WTP--------IVSP......GNSS-----------TTSP........................AEQPAPPVYTGAAVTP
Q3KHV9_PSEPF/452-588WTP--------LVKP......LNPS-----------TDLP........................VADTDLPNYEGADVTP
Q4ZZN9_PSEU2/384-518WTP--------IARP......ADSS-----------TSSP........................AGPPALPVDPGNVVTP
Q51502_PSEAI/502-636VTP--------DTPP....GQIDPS-----------SSTP........................AVPRGPLIMPGTLLIP
Q48N26_PSE14/366-496L.P--------IAAP......GNSS-----------TTTV........................AQPVETPAYAGITLEP
B0KLG0_PSEPG/298-428L.P--------AHTP......GDTS-----------TTKP........................GAQIPSYPYRGVTLNP
B0H8F2_YERPE/184-326FTP--------AQPP...GAETRPI-----------LAPP........................GSTPATLQHTGEMIIK
C4SH19_YERMO/257-393FTS--------S......GADISMG-----------VPAA........................ASTAPASRHTGGVVIR
C4T554_YERIN/658-796FTP--------AQPP...GMDISSV-----------LPQP........................PSAPVVPSHTGADITF
CEA3_ECOLX/172-286SIP--------GAPV....LNISVN-----------NSTP........................AVQTLSPGVTNNTDKD
C4T554_YERIN/176-297ILN--------GMPP....IHIHVD-----------TSSS..............................PPTAMQPSGI
C4SH22_YERMO/173-298PVP--------GVTP....IHINVV-----------ESIE........................PSHQTQPTVAGKPTAT
B0KQC9_PSEPG/357-498WQK--------GSAP..........-----------.YPP........................IDISRPPSISYLHMPN
B4F067_PROMH/227-363LRP--------TSSPSGLGLQGNII-----------QKHS........................NENKKFSYPEKIELPN
Q2C918_9GAMM/172-308WSP--------DETG....NQVPYT-----------TPSQ........................NDGVSFGDIWVNPLSD
A7MTX8_VIBHB/589-723WTP--------EENG....EASWQT-----------TPDH........................SDDFEKEDILVTPIHS
A1TWM1_MARAV/259-395WYP--------DDSG...HRPVVST-----------EYPA........................DSGIDPYSILVTPIQE
C3K1R5_PSEFS/156-287WTP--------AADP.....SDTLG-----------IPAL........................EAAPQAPVIWIYPPTE
Q3KGY0_PSEPF/174-305WTP--------AVDG.....SDILG-----------IPAL........................EAAPQAPHIWVYPPTK
B7VQ54_VIBSL/208-337WNG--------VSKQ...GPLFHNG-----------AKRR........................FGSLRQEKVLPNDGK.
D7HGP2_VIBCL/565-699WTP--------DGST...DVLTPDT-----------VLPE........................NDQLDVHNIWVRPIEE
Q3K6V8_PSEPF/148-281WTP--------QRGP....LGSMPP-----------LVHP........................EHGEALSTILVHPIAA
Q1CF31_YERPN/269-408WTP--------NDPG....FKAPSN-----------TGNN........................DGPIIRTTITVLPMPE
Q7N861_PHOLL/282-420WTP--------NEQE....FKVPAH-----------TGNE........................EQPFIPSQITVLPIPE
Q2V060_PECCC/88-226WTP--------DNPG....MELPTD-----------TAHG........................EQPVIPSAVPGFEIPE
A6TAS7_KLEP7/151-314WSR--------SAGQGKFEWGSSQT-----------TVHDGGAGGSTTPPTPIPEPRSVWGLPNPAPASLPPVPGTPIPE
Q0TLM8_ECOL5/309-450WTP--------ENPE...HGNVPGH-----------TGND........................RPPLDQPTILVTPIPD
A9MMY5_SALAR/912-1053WTP--------ERPE...GGDLPAH-----------TGSD........................IKPIDQATILVTPIPD
A6TI19_KLEP7/500-639VSP--------ADAL...GANGPLT-----------LSGP........................VPLPERILHTGDQISA
Q9XBT6_KLEPN/492-631VSP--------SDAP...GVNGPLG-----------LAGP........................VPLPETIIHTGGQTTV
CEAD_ECOLX/451-590VNP--------VPQP.....SVPTD-----------TGNH........................QPVPVTPVHTGTEVKS
Q5V9K0_KLEPN/374-517VNP--------VPIG....PAAPWH-----------TGNS........................GPVPVTPVHTGTEVKQ
Q5QGN1_KLEOX/466-609INP--------VPVG....PATPSH-----------TGSS........................TPVPVTPVHTGTDVKQ
A8G950_SERP5/403-545INP--------APVG....PTAPPH-----------TGNS........................SPAPVTPVHTGTTVKQ
B2VB98_ERWT9/362-505INP--------MPTG....PAAPAH-----------TGND........................SPVPNSPVHTGTNVRQ

PF03515

A3L5Y3_PSEAI/1-271RHM........SELAKAYSADIYKA.QIAILKQTSQELEN------------------------KARSLEAEAQRAAAEV
A6XA70_XENNE/1-324AEP........TNRPNVYSASVVPG.MKPMQIKVDNT...------------------------NQAVPKNISKANPIPN
A8ARS8_CITK8/1-223AKP........TKRPGVFSVSI.PG.LPSLQVSVPKGVPA------------------------AKAPPKGIIAE.....
B3ISX9_ECOLX/1-311AKP........TERPGVFTASI.PG.APVLNISVNNSTPA------------------------VQTLSPGVTNN.....
C3UUF3_ECOLX/1-309AVPVPDRSRPGTNIKDVYSAPVSPN.LPDLVLSVGQMNTP------------------------VRSNPEIQEDG...VI
C4T554_YERIN/1-322AKP........TDRTGVFTAQILNG.MPPIHIHVDTSSSP------------------------PTAMQPSGISE.....
CEA7_ECOLX/1-306AKP........TRTPGVFHASF.PG.VPSLTVSTVKGLPV------------------------STTLPRGITED.....
Q5QGN1_KLEOX/1-314AQA........TAGSDYYTIGRLPGIMSAFTFSFYTKGTP------------------------QDSRFFRDTVK.....

PF06958

Q51549_PSEAI/488-632VQAE...PESYPGV.PLDLDD...LIVIFP..AGSDVPP-LYLV----------------------------
PYS2_PSEAE/415-554VKAT...PETYPGV.ITLPED...LIIGFP..ADSGIKP-IYVM----------------------------
Q88NA6_PSEPK/490-621VVTE...QEGYPALDLLDQER...LIITFP..MDSGLPP-ILVV----------------------------
Q3K520_PSEPF/519-654VEGR...LDSFPGVFEAGFDD...YVLVFP..QDSGLPP-NYTM----------------------------
Q4ZME2_PSEU2/372-507VEGR...IDAFPAVSEASFDD...FITVFP..ADSGLPP-IYTM----------------------------
Q3KHV9_PSEPF/452-588DSGR...IDPFPQLDQYGFDG...WVTVFP..IDSGIPP-IFTM----------------------------
Q4ZZN9_PSEU2/384-518FVPE...LEAYPAIDRDDPDD...YILISP..IDSGLPN-SYLL----------------------------
Q51502_PSEAI/502-636KEPQ...IESYPELDQREFND...GIYVYP..EDSGIPP-LYIV----------------------------
Q48N26_PSE14/366-496IEVK...GEPLPGTSQMDIRD...AIYVYP..LNSGLPP-VYVV----------------------------
B0KLG0_PSEPG/298-428LHIE...ASPLPALEPEDFKD...CIYCFP..PESGLPP-LYVV----------------------------
B0H8F2_YERPE/184-326PVITPT.ILPLPQLYARDFHD...YIIWFP..ADSGLEP-VYVY----------------------------
C4SH19_YERMO/257-393HAVIHT.VLPQPTWEDRDFHD...YIIGFP..ANSGLEP-VYVY----------------------------
C4T554_YERIN/658-796LATKP..SLIFLALEEGDFHD...YIIWFP..AASGLEP-VYIY----------------------------
CEA3_ECOLX/172-286.......VRPAGFTQGGNTRD...AVIRFP..KDSGHNA-VYVS----------------------------
C4T554_YERIN/176-297SEVRDSPVTPVFSPLGSHSHD...AIVYFP..VETNTDP-VYIS----------------------------
C4SH22_YERMO/173-298PVENAP.IKAVTSPSGRHTHD...AIIVFP..ETSGIEP-LYIS----------------------------
B0KQC9_PSEPG/357-498VPI....IERFMDLTQVQFDD...YIVVFP..PQAGLAP-VYVM----------------------------
B4F067_PROMH/227-363KVENKRIDVPYP....HQFND...AIIVFP..KNSNLPP-LYVY----------------------------
Q2C918_9GAMM/172-308AVSNS..STVLPMPAESDWQD...RILVFP..EDSGVEP-LYLV----------------------------
A7MTX8_VIBHB/589-723DGDAN..VTVTPAPEEKDWRD...AILVFP..ESSGIAP-LYVV----------------------------
A1TWM1_MARAV/259-395DG.....QEHSPPGYQQPFEDQVELIVSFP..ADSGIEP-LYLV----------------------------
C3K1R5_PSEFS/156-287KAAQILVNPIYP....PEYRD...FILVFP..AESGVRP-LYVV----------------------------
Q3KGY0_PSEPF/174-305AADGILVNPVYP....PEYWD...FILVFP..AESGVRP-LYIV----------------------------
B7VQ54_VIBSL/208-337.......TQDIEGVPDDAVEE...VIIAFP..KQKFLEP-LYLV----------------------------
D7HGP2_VIBCL/565-699HEQEIG.TALYP...EEELAE...YIVTFP..ADSGVSP-LYLV----------------------------
Q3K6V8_PSEPF/148-281NTDSQ..IEILPG.EDITAED...CILVFP..AETGLKS-LYVV----------------------------
Q1CF31_YERPN/269-408ADETGEHSTTLPMPEEKDFRD...YILIHP...LLDLPP-LYIY----------------------------
Q7N861_PHOLL/282-420KVGSD..IESLPMPEEKDFRD...YILILP...VPNMPP-VYVY----------------------------
Q2V060_PECCC/88-226MDDVS..ILATPMPEEKDFRD...YILVFP...ENSFPP-IYIY----------------------------
A6TAS7_KLEP7/151-314EQGPN..IETLP.IEDRDFND...FIIVDP...MGGVPA-IYVY----------------------------
Q0TLM8_ECOL5/309-450GTDTYT.TPPFPVPDPKEFND...YILVFP..AGSGIKP-IYVY----------------------------
A9MMY5_SALAR/912-1053GKDEYT.TPPFPMPEERDLND...YILVFP..AGSGIKP-VYVY----------------------------
A6TI19_KLEP7/500-639PQATD..KTVTPVADDLDFDD...IILVFP..PESGLKP-LYVM----------------------------
Q9XBT6_KLEPN/492-631PQGGT..VTVSPAEDDIDFND...LILVFP..PESGLKP-LYVM----------------------------
CEAD_ECOLX/451-590VEMPV..TTITPVSDVGGLRD...FIYWRPDAAGTGVEA-VYVM----------------------------
Q5V9K0_KLEPN/374-517ADSIV..TTTLPIADIPPLQD...FIYWQPDASGTGVEP-IYVM----------------------------
Q5QGN1_KLEOX/466-609ADSIV..TTTLPAADIPALQD...FIYWQPDATGTGVEP-IYVM----------------------------
A8G950_SERP5/403-545ADSIV..TTSFPADDLKELQD...FIYWQPDATGSGVEP-IYVM----------------------------
B2VB98_ERWT9/362-505ADSIV..VTTFPADVVQDLQD...FILWQPDATEVGVEA-IYVM----------------------------

PF03515

A3L5Y3_PSEAI/1-271EADYKARKANVEKKVQSELDQ---AGNALP--QLTNPTPEQWLERATQLVTQAIANKKKLQTANNALIAKAP
A6XA70_XENNE/1-324VEIFTSAPV.....NDTH..H---AFIDFG--EK..HDL.IYISVSKIPTVAEE...KEQIEESKKNKQKWL
A8ARS8_CITK8/1-223.KG.DSRPAGFTAGGNSR..E---AVIRFP--KESGQKP.VYVSVTDVLTPAQV...KQRLEEEKRRQQAWD
B3ISX9_ECOLX/1-311.TDKDVRPAGFTQGGNTR..D---AVIRFP--KDSGHNA.VYVSVSDVLSPDQV...KQRQDEENRRQQEWD
C3UUF3_ECOLX/1-309TETGNYVEAGYTMSSNNH..D---VIVRFP--EGSGVSP.LYISAVEILDSNSL...SQRQEAENNAKDNFR
C4T554_YERIN/1-322VRDSPVTPVFSPLGSHSH..D---AIVYFP--VETNTDP.VYISVTTVLTPEQI...TQVEAENRQKQAQWD
CEA7_ECOLX/1-306.KGRTAVPAGFTFGGGSH..E---AVIRFP--KESGQKP.VYVSVTDVLTPAQV...KQRQDEEKRLQQEWN
Q5QGN1_KLEOX/1-314.AGGDLREAGFTVGANTS..D---FIIWFP--QGSGLEP.LYFSMTMNMPAGPL...QRRQEAENKARAEAD

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window