Sequence alignment for CL0447

PF12650

Q73KP8_TREDE/5-104YIIAAV-....LAVFGIL..IHKFKFYFLIA-GYNMMSKEEKEEYNASSIGKHVGFYLYFISV..LSLAVGLFFQ.FFQI
A8RFN3_9FIRM/15-110VVLVIP-....FGTMGILFALFKDKAAKYVS-GFNSFSKEEQALYDKYQISRDMRNQCFTWTA..ILFIGAL....LSYF
A5KJ31_9FIRM/8-115WGIVGV-....AIIATII..LLTGKGSMLVT-GFNTKNAEELTKYDVKKVSRQAGIFMTLIDFGLIGLVSYIQFRAVPAI
C8W845_ATOPD/8-101WSLTAI-....LGICSLI..LLSGHGAALIA-GYNTMTEDEKKTIDEKKLCFVMGISTSVCAL..TMLYMAV....LNPN
A6ESR6_9BACT/2-97IGIALF-....FILLGVL..IKYGKMYFLIA-GYNTMPKAEREKVDIDGIATVFRNVMFAMAL..VMILGYF....LADW
C6W003_DYAFD/6-100LIFSTI-....SFLLAFV..VTPGNARYLLS-GYNMMSEADRAKFDIEAYLKFFSRFHIFLAI..SLITGVLV...LNVF
C0CMW9_9FIRM/8-103LPMGLI-....SLLLGLYFFRSNGKAASLLS-GYNTKSVKEREKFDEKEMCRCYGKKMIIMGI..VFLFAVV....IDLI
B0MTY7_9BACT/8-105YPTQLL-GGGLLVLLGIL....VRFFPNLIA-GYNTMSAEQKKNVDVKGLSRFMCLSLAAIGI..GWIALGM....LAGN
B7C8I4_9FIRM/44-137TILALL-....FLILSIIFALLKEKGANYVS-GFNTLNHPEK..YDKAYISRDMRNQCFIYFV..ILCIGSV....LSYY
C0GCH3_9FIRM/5-98FALAAI-....FFLIGLA..IHVFKWYFLIA-GYNTMSKEQQAQVDTEALGRLMGYYSYANGF..VLFVTGI....LYAS
D6XXF8_BACIE/5-106HVIQLV-MGLTLSGIGYL..LLQGKMHSLVS-GFASRSEQEQKDMLEAGYMTVTGRGLFLSGA..VLLIGLV.FGLMGLF
B1RMR9_CLOPF/6-101LMIAL.-....FILLGIM..LSLGKWSFLIA-GFNTMTKEEKAKYDVMSLCKFMGKLMFIIAF..CITLFTL....SDIF
C4GBG2_9FIRM/25-121WCVLVY-....LVVISIL..LYTGKGGLFIP-IYNALSRQEQDKYNKKVFYKGIARFYAVCAM..ATLIGFL....GDFF
Q180M1_CLOD6/6-101IFFGIL-....FTLAGFW..LAFGKGYRHLS-LWKNMPQEEKDKINIVPLCRNVGEMIALNGI..IFLMKGF....LPGF
B5CPM6_9FIRM/14-109IILVIP-....FLIIGVLFAIFKEKATKFVS-GFNSFSKEEQALYDKAHISRDIRNQCFMWAI..IMLAGAL....LSCF
B5CWI2_9BACE/6-100PIFSAF-....FILLGFL....VWRFPKLIA-GYNTMTPEQQKKVDVKGLKAFMCRVFCAIGV..LVFVSYL....LLRL
B2UM80_AKKM8/7-105IPVAMM-AG..FMILGAI..LSMGKCSFLIA-GYSMMNRGQKKQYDEQALCRFMGKIMYCLAF..AMLLWLS....SIIL
B6GCJ7_9ACTN/14-116SIGALL-....FLALSIP..LLAGRGAWLVA-GYNTMAPNQRERYDERKLCRATGCMLLGVSIACGLMACATVFETERVG
B1C0V8_9FIRM/9-104ICCCLL-....FLIFALIFTILKDKAAILIS-GFNSMSKDQREMYDQKKMSKDQRNAFLIWGL..IFAVGAI....LANF
F1T535_9ACTN/19-115FSFSIS-....FLIISIQ..LFRNKWLMLIS-GYNTMLKEERDKIDVRPYAIADAKAMAAGSL..LMCVYGI....NSLG
B0A9H2_9FIRM/8-110LKISLF-MSCALLFVSCMFFLLKDKASILIT-GYYFISKNERELYDEFKLSKDYGIIMLKLAL..ILLVGAI....GYVL
C3FDV0_BACTU/4-102YIIGTL-....FLVIAIL..FYKKKALFLIA-GFD...KNEFSEVQINRLTKTMGDFMLNIAI..LIIANRL....SDQF
B1C2P2_9FIRM/6-94LICALF-....LFILAIL..LYIGKLSNMIA-GYNTLSAKEKEQYDEAKLCKILAITLFFTSI..VLILGAM........
C0EFA4_9CLOT/6-101IFFGVL-....FTIAGFV..FACGKGHIYLS-AWKNMPQEEKEKIKIVPLCRNIGEVIALNGI..IFLIKGF....WAGF
A5ZV52_9FIRM/8-115WGIVTI-....SIIATII..LMTGKGSKFVT-GFNTKSTEERAQYDSKKVSKQAGIFMILIDVGLIALVSYIQFRAVPAI
A3DHH5_CLOTH/5-98IIMGVF-....LIVMGLT..IHVFKWYFLIS-GYNTMPEEKKANVDVKGLGRLIGIYFYVNGA..VSIAAGV....FYAL
C0BXF3_9CLOT/2-95WILTGL-....FAVLSIV..LLSGRGSFLIA-GYNTADKEEKAKYDEKKLCRVMGAGMAVITA..ILLLCTL....YEFD
A5ZPA4_9FIRM/7-95FILAGI-....ALIVGIM..LLTGHGDIFLK-GGNT..KLRKEKYDEKKMTKGSGVTLILFGI..VTFIDSY....TTSL
C9LC36_RUMHA/6-101IFFGFL-....FTFAGLW..FAFGKGYLHLS-LWKNMPQKEKDKLRIIPLCRNIGGIITLNGV..IFLVKGF....LPLF
B0NJR7_EUBSP/9-104GISCLL-....FLLLALLFAILKGKAAILIS-GFNTIPKYQRELYDQDRMSRDQRNAFLIWAG..IMGIGAI....LSYF
Q187U4_CLOD6/8-110VIIALA-....FFILSVL..LFNGKASMLLA-GYNSMSKKEKARYDKKKLCRSSSIVTFIVSI..MLFIMAFLGYRIESG
C2MNE7_BACCE/10-94FILAII-....SFALAYF..IGVKQYTWLLS-GFN.....ERRVPEKDKLSKIVGLYNLTAGV..IATIGSV....FLTP
A3IBC9_9BACI/7-103LIIMLP-....FLIFALV..LSQGKGTFLIA-GFNTMSQDEKDTYDEIALAKFMGKMMYGYCF..CVLLWVL....NELF
B1RMP4_CLOPF/9-104LTLGIF-....FLVFSICFAILKEKGAILVS-GFNSFSKAEREKYDQKRISLDMRNSFFLWAM..ILFIGAL....FSYF
C0B515_9FIRM/15-108WIVFVI-....FAVLSIV..LLSGHGSWFIS-GYNTASKEEKKKYDEKKLCRTMGVGMSIIAI..LALIMGL....LENI
A6UNJ9_METVS/10-109FINALI-....LAALGFA..IRIKKASFLIS-GYNTSSKEEKAKYDEVKLCNFVGNLLFVLSG..ILFSIGI....FKLI
A6CHY6_9BACI/7-104NIIGFI-A...FFILASF..LSKGKGAFLIA-GYNTMSDSEKAEFDEMALCKFTGKIMYGISF..SILLWAL....SEIL
A7VFG3_9CLOT/28-123FAMAVI-....MLLFGIWFYRSKGQASNFLS-GYNMKSAEERKKYDENAMCKAYGKRMMFMSI..PFIAGMI....IDIW
Q5WBP2_BACSK/4-102LLLLMV-....ILFFGISTLLFIGKGDFLIA-GLNAMNEEEKEKIDTFKLNRFMGKMMYVISG..GMLLLFL....YRFY
C0CSM0_9FIRM/9-104AASSIV-....FLLLALLFTLLKGKAAILIS-GFSTMPKEQRRLYDTKWMSKDHRNMFLIWTA..ILGVGAL....LSLL
A5Z7U9_9FIRM/8-103FMMAVI-....MFLFGMWFYKSEGKATKFLS-GYNMKSADERKKYDENAMCKAYGKRMMFMSV..PFIIGII....IDIQ
A6M026_CLOB8/7-106MIIGFI-MSAIFGLLGMVFMIFKDKACILIS-GYNLKTKKEREKYDKVRLSKDERNFCFTCSI..IYLIGAI....ASIF
C4L708_EXISA/5-98ILAAVI-....VIALGFA..VDRLGWHDLIS-GYNTMSREKRERVNIQKVARLVAWMCYGIGA..IFILIAL....IEEF
C1I5P0_9CLOT/8-100SIICLI-....FIVLGVA..ISKYKCYWLIS-GYNTQSKEEKARVDIEKVAKHMGRMCYLIAF..IIFIGAI........
C3JAB0_9PORP/5-95FILGLI-....VLILSPV....IYRFPMLLA-GYNTMSKKERAKIDEKRLKTYAAGGLAIWGI..VTMLFGL........
Q97G56_CLOAB/8-107ILIGGF-VL..FMIFGII..LRTGKANWLVS-GYSILPEDEKAKLDILKLYKRTGNLLIFIGI..AFLADYL........
Q2BCD0_9BACI/5-105AGIQVF-VIVLFSILGWA..IRYKKNYWLIS-GFAGRPAAEQEELIQNKMPQKTGGLLLATAI..GMLILLP....LAFT
Q2B5A3_9BACI/6-90IIFGTI-....FLVLGFL..VGVKKMTWLLS-GFN.....EKRVRDKNKLAHLVGGTEAVLGI..VLIIGGI....LGVG

PF06993

C6BN16_RALP1/10-119YLLVLL.IH--VYIVVLE--MVLWK.TRGPK.VFRITP.EKAAETAA..MASNQGLYNGFLVA--ALVIGLI------AP
Q03I47_PEDPA/9-120VALVAI.EH--IGIMGIE--LLGSS.AFLAK.TFEIPL.VEVQRPHLRTALANQGLYNGFVAL--ALFLALF------IP
Q5M256_STRT2/9-117AGIVAL.EH--LYIMYLE--TFATHSDTTSR.VFNMRK.EELQRDSVTNLFKNQGIYNGLIAV--FLLYGIF------TN
A1RC42_ARTAT/11-125G..TAL.AL--ISVGLLE--IFRHGDQRLHR.IFLI...EPDDVLAVRMWAMNVGAYNMAFGL--GIATGLW------MV
A1R1G6_ARTAT/9-125ATIAAL.LH--VYIFTME--SITWTKPATWK.RFSLT..SQADAETTKPLAYNQGFYNLFLAI--GALIGII------AV
Q0S476_RHOSR/8-133ATLVAAGVH--LLAFVWE--SVLFRAPSVHEGIFRI...PGRDVPAAHLWAFNVGFYNLFLGS--GAIAGVV------LW
A1IQD0_NEIMA/9-122VLFVAV.EH--FYIAWLE--MTQIPSEKAAE.TFKLPY.EFMEQNRVQTLFGNQGLYNGFLGI--GLVWSRF------AA
Q1WTS9_LACS1/9-121ASLVAL.EA--LYIMQLE--MFASK.EKLEN.VFGLSK.EYLSMEEARVSMKNQGLYNGFIGV--GLLFSRF------FF
A3CM41_STRSV/9-118ASLVAL.EF--FYILYLE--TFATTSAATAR.VFGMSQ.EELGQQSVNTLFKNQGVYNGLIAV--LVLIAAF------VQ
A5LRC3_STRPN/9-118TTIVAL.EH--FYIFYLE--SIATQSDATSR.VFNMEK.EELAHPSVSSLFKNQGIYKALLGV--FLLYVIY------FS
A5CNJ0_CLAM3/12-128VGLAAL.LH--VFFFLLE--SVWFEKPFAWK.RFGVA..DQEKALIIKPWAYNQGFYNLFLAL--GAGLGLI------LY
A5IPX5_STAA9/9-119IIFVAL.EF--FYIMYLE--TIATTSKKTSE.TFNISV.DKLKDKNINLLLKNQGVYNGLIGV--LLIYGLF------IS
A0PPD5_MYCUA/10-125AALAGL.LH--VYIFTME--SLTWTSPRTRA.TFGT...TAEEAETTKLLAFNQGFYNLFLAI--VGGLGIA------GV
Q0U573_PHANO/9-119VFLLAV.LH--IYIMALE--VFFWTSPAGLK.AFALKP.DFAAKTKT..MAANQGLYNGFLAA--GLLWSLV------HP
A0AFW0_LISW6/9-121TFIVMI.EH--IYIMILE--MFFANTKLASR.TFGVEK.ELLANKKVQTLFANQGLYNGFLAA--GLVWGLF------FA
Q3XZS6_ENTFC/9-119VTLVAI.EF--FYIMYIE--TVRTDSDTTSR.VFKMSK.EELSRKSVQTLFKNQGVYNGLLGV--GLLYGAY------LS
Q8PI43_XANAC/9-115GVCIAL.LH--VYILVLE--MVLWTHPLGLK.TFRNSL.ERAQATRV..LAANQGLYNGFLAA--GLLWGAL------AA
Q02YF6_LACLS/7-115IIIVAL.EH--LLFGYIE--MFGAT.GLQAK.AFGFEE.AELKNKTLQVALSNQGIYNVGLGL--.LIIALT------IA
A4AF16_9ACTN/13-130VFLAAL.VH--LMIFFME--SVLWHTPRVRQ.IFGVR..NQTDADIIKPWAYNQGFYNAFLAL--GAGTGLV------LM
A6LV45_CLOB8/9-120VIAVAI.EH--IFIMLLE--MFFIKSSVAKR.TFNIDS.KLLDKKEVRVMFANQGLYNGFLAA--GLFWSFF------IP
Q8DUJ8_STRMU/9-116IILVAL.EF--FYIMYLE--TLATQSTKTSQ.VFGMTQ.ETLGEKEIDVLFKNQGIYNGLLGL--GLLYGLA------FN
Q89VY1_BRAJA/1-111MALVAA.LH--AYFLILE--MFLWDKPQGLK.VFRNTS.EKAAITKV..MAANQGLYNGFLAA--GLIWGLL------HG
Q28R35_JANSC/9-119IAVIAA.VH--LYIAWFE--IFAWT.TRGPA.VFSSFPRDLFEETTA..IAANQGLYNAFLSA--GLIWSLL------IR
Q81U31_BACAN/9-121VGIVAL.EH--LFIMILE--MFFMNSKVAKR.AFKLPE.HLEGDRNVAIMFANQGLYNGFLAV--GLIWGLI------LG
A2TZH9_9FLAO/9-117IAQVIL.IH--IYIVLLE--MVWWTSKRGMK.AFGLKDLHFANETKV..MAANQGLYNGFLAA--GLFWSVL------IT
Q0SCW7_RHOSR/9-124AALASA.LH--VYIFVLE--SVLWTSPRTRA.TFGT...SAEEAGATKELAFNQGFYNLFLAI--VTAVGIV------AV
Q5FIJ6_LACAC/9-120TFIVGI.EH--IGICFLE--IFGKP.ATQAK.AFDMDI.NFVKQRAAKISMANQGIYNGMLGL--LLILVYF------VF
A4TBQ4_MYCGI/9-124AVLAAV.LH--GYIFVME--SLTWTSPRTRA.VFGL...TAEEAEATRMLAFNQGFYNLFLGI--VTVVGVV------FA
Q2J461_RHOP2/9-119IALVAA.LH--VYFLILE--MFLWTRPLGLK.TFRNTP.EKAASSAV..LAANQGLYNGFLAA--GLIWSLL------HP
Q26FE6_FLABB/9-119IGFIAL.IH--VYILWFE--MFAWE.TKGKR.VFKKFPKELFAPTKS..MAANQGLYNGFLAA--GLIWSLL------IT
A8FJ05_BACP2/9-121VGIVAL.EH--LVIMLLE--MFFMESKMAKR.SFKLPE.HLQKDPNVKVMFANQGLYNGFLAA--GLIWGLI------LG
A8GFP5_SERP5/9-115VLLIAA.IH--LYILILE--MFLWQKPIGRR.VFATTA.EFAAATRV..LAANQGLYNGFLAA--GLAWGVW------RD
Q1GBD7_LACDA/9-117ACLVAV.EF--FYIMYLE--TFATTSKKTAE.VFQMDQ.EELSRPSVNTLFKNQGIYNGLLAV--LTLIAAF------AL
Q8E2N0_STRA3/9-118ATLTAL.EH--FYIMYLE--TLATQSNMTGK.IFSMSK.EELSYLPVIKLFKNQGVYNGLIGL--FLLYGLY------IS
A6SYN9_JANMA/48-156TGLVAL.LH--VYILYLE--MFLWDTPKGRK.AFGLTP.EFSAQSKV..LAANQGLYNGFLAA--GLIWGIW------LG
Q6MK99_BDEBA/6-122ALVPAL.IH--VYIFALE--SLLWGRKSTNK.TFGVT..EA.EAATTKLMAFNQGFYNLFLAV--AILLGLH------LR
Q03XL7_LEUMM/7-118VTLVSL.EA--IGIMFVE--MFGTA.SQQAK.AFDLKE.SFVQIPEVKTLLANQGIYNGLFGA--LVIGTML------FL
A1T885_MYCVP/9-124ATLAAV.LH--AYIFVME--SLTWTSPRTRA.VFGT...TEQEAQATRQLAFNQGFYNLFLGV--VTLIGVV------AV
A0QWH7_MYCS2/9-124AALAAV.LH--VYIFVME--SLTWTSARTRA.TFGT...TAEEAEATKELAYNQGFYNLFLAI--VTAVGIG------SI
A6ELU3_9BACT/9-119IGFIAF.LH--LFFLYFE--MFAWN.TLGKK.IFKTLPKEIFEPTKS..MAANQGLYNGFLAA--GLIWTFF------IE
A3HU68_9BACT/9-119IGLIAA.LH--LYFLYFE--MFAWE.TIGKK.TFKSLPPELFPKTKG..LAANQGLYNGFLVA--GLVWSLL------IE
Q825J9_STRAW/9-118VGLVAA.LH--AYILVME--MFLWEKKPGRG.LHGFDP.EMARATAP..LAANQGLYNGFLAA--GLVWGLI------AG
Q02YA5_LACLS/9-119TLLVAL.EF--LYIMYLE--TVATSSKTTGR.VFKMEK.KELERKSVQTLFKNQGVYNGLIAI--GLFYGLF------FA
A3TNP7_9MICO/9-124AGIAAL.IH--VYIFRLE--SLAWTDPKTRA.AFGT...TAETAEVTKPLAYNQGFYNLFLAV--IAVIGIV------LA
Q74HX9_LACJO/11-122TIIVGI.EH--IGIMWLE--IFGKP.DLQAK.SFDMDV.DFVKQPAAKTALANQGIYNGMLGL--LILIVFF------FF
A6T8L7_KLEP7/7-115VALVAI.IH--LAILVLE--MFLWEGSAGRR.AFNLSA.DFARQTRV..LAANQGLYNGFLAA--GLAWGLW------LG
Q8U4U8_AGRT5/27-135IAVVAA.IH--IYIVILE--MLLWEKPAGRK.AFGLSA.DFARQTKV..LAANQGLYNGFLAA--GLIYGLT------QG
B1YKF7_EXIS2/9-117VLIVAV.EH--FYILALE--MFFLSSKSARR.TFGLTE.EAVSNPQIRTLFANQGLYNGFLAA--GLIFGLI------LD
A9BT48_DELAS/6-114IGIVAA.IH--VYILVLE--MFLWDKPAGRR.AFGLTP.EFAQQTRT..LAANQGLYNGFLAA--GLIWGLA------QG
Q08TL8_STIAD/9-118VGLVAA.IH--VYILVLE--AFLWRAPLGRK.VFKTDA.DFAAKSAT..LAANQGLYNGFLAA--GLVWGLV------AS
Q3ZV36_ENTSA/7-115IALVAI.IH--VYIVVLE--MFLWDTKTGHK.AFNLSA.DFARDSRV..LAANQGLYNGFLAA--GLFCGLW------LG
A2SLL4_METPP/9-117VALVAL.LH--VYILVLE--MFLWDKPAGLR.AFGQTP.EAAAASKV..LAANQGLYNGFLAA--GLFWGLS------LG
B4SSD3_STRM5/9-115TLLVAL.LH--AYFLVLE--MFLWTRPLGLK.TFRNTP.EKAQATRV..LAANQGLYNGFLAA--GIVVGLV------ID
A5ETK0_BRASB/7-117VGLIGL.LH--VYILVLE--MFLWTKPAGLK.AFNNTP.ERAEATKV..LGANQGLYNGFLAA--GLFWGLA------HP
Q03CQ9_LACC3/9-120VGLLGL.LH--LTIMALE--MFGKP.ESQAE.NFSMPL.AFVKQPNAQIALKNQGIYNGALAV--VMLLSLV------LL
Q8NL72_CORGL/9-124AILAVL.LH--VFIFYME--SFAWTSEKARG.VFGT...TEIDAENTKEMAYNQGFYNFFLAV--IAGVGVA------FL
A5VM31_LACRD/7-118TMFVAI.EH--LGIMALE--IFGNP.AQQAK.AFDLPL.KFTQQHEARVSFANQGIYNGALGA--AIIASYW------LF
A8AXQ4_STRGC/9-117AILVSL.EF--FYIMYLE--TFATASKTTAR.VFNMTQ.EELERESVNTLFKNQGVYNGLIAV--LVLLAAF------TQ
A9B305_HERA2/9-119VGLVAV.EH--IYILYLE--MFAWTQPRTMK.SFGLTP.EFAQQSKS..LAANQGLYNGFLAA--GLIWGLV------HP
A4W1R6_STRS2/24-132ASIVAI.EH--LYIMYLE--TFATHSDSTSR.VFNMEK.EELQRKSVTALFKNQGIYNGLLAV--FLFYGIF------TG
Q6FCD0_ACIAD/7-116VALIGS.LH--IYILVLE--MFLWDQPRGLK.AFGNSV.EKARMTKT..LAQNQGLYNGFLAA--GLFWSLW------VD
A1TNB7_ACIAC/9-118AALIAL.LH--IYILILE--MFLWDKPAGLK.AFRNTP.ERAADTKV..MAANQGLYNGFLAA--GLLWGLW------LG
A4APQ9_MARSH/9-119IALVAI.LH--LYFMWFE--MFAWT.TKGRK.IFRNFPPELFEPTKP..LAANQGLYNGFLAA--GLIWTFF------IE
Q38W50_LACSS/9-120TSLIAI.EH--LGIMGLE--MFAND.QTKAK.AFDMPL.DFVRLPNTKVALANQGIYNGMLGV--LIIAVNC------LL
A6W4X5_KINRD/9-124TGLAAL.VH--VYVFVLE--SLLWTGPRAAR.VFGL...DAATARATAPLAFNQGFYNLFLAL--EIAAGTV------VI
Q03SG7_LACBA/9-120IYLIAI.EH--LGIMALE--MWGRP.EQQAR.AFGMPI.TFVRQVPAQKALANQGIYNGMLAV--ILILAQW------LL
A6VV17_MARMS/9-117TSFVAL.LH--VYIMYIE--MFLWDKPKGIK.IFGLKP.DFAKASKV..MAANQGLYNGFLAA--GLLWGVW------LG
Q21N19_SACD2/9-117CGVVAL.LH--IYFLVLE--MFLWDKPIGLK.TFRLTP.EKAQATKV..LAANQGLYNGFLAA--GLLWGII------LA
Q837C5_ENTFA/9-119VTLVAV.EF--FYIMYLE--TIVPTSETTSR.VFKMDR.QELQRKSVTTLFKNQGIYNGLIGA--GLIYSVY------FA
A7JSQ2_PASHA/9-121VLVVIL.EH--FFIMILE--MFMIPSRLAKK.SFGLSD.DFMAQKQVQTLFSNQGLYNGFLAT--GLLWAYF------IA
Q6AHE4_LEIXX/9-125VTLAAA.LH--IAIFFME--SVAWTRPTVWR.RFGVA..DQAAAETTRPLAYNQGYYNLFLAI--GAIVGLI------LY
Q98F54_RHILO/7-115VGLVAL.IH--VYIVYLE--MVLWDTPRGHK.AFRLTP.EFAKASKV..LAANQGLYNGFLAA--GLIWGLY------LG
Q7NY41_CHRVO/9-117IALVAL.LH--VYFLILE--MFLWDKPLGMK.TFRLTP.ERARDTKV..LAANQGLYNGFLAA--GLLWGLW------LG

PF12650

Q73KP8_TREDE/5-104SKQT.....EKLVIAVYVIFTMIAVSILLVKENK-KR-------------------------
A8RFN3_9FIRM/15-110LTSY........MAIPTYIVWLILFFKEVHFDNY-KA-------------------------
A5KJ31_9FIRM/8-115QDNTISNYGTEITVVSLGICIYILFVAIIATTRG-FK-------------------------
C8W845_ATOPD/8-101ITIT........TTIIASSIITIDLVVSIYIANT-KC-------------------------
A6ESR6_9BACT/2-97LNNP......DIENVAFFGALLIGVPYLLMKTNS-DA-------------------------
C6W003_DYAFD/6-100SPNW........ATVFLIMYPLLSYGYMMAMGNR-FY-------------------------
C0CMW9_9FIRM/8-103QPGL........GCTLAWCIWTVLFILLLRDRAR-RE-------------------------
B0MTY7_9BACT/8-105LGGE......KWVLAVDFLWLPAGCVFLLVKAQK-YD-------------------------
B7C8I4_9FIRM/44-137LSAY........VAIVAILVWLILLFRNFNLDVE-KA-------------------------
C0GCH3_9FIRM/5-98GADI........GIAPSIVFLVISTVYLLIKAQQ-YN-------------------------
D6XXF8_BACIE/5-106QANF.......FMWGVFLLVLFVTAYRGIAREPE-RT-------------------------
B1RMR9_CLOPF/6-101MMKI.....LFNIGTVILIVSIIFTIIYLNTGNH-FE-------------------------
C4GBG2_9FIRM/25-121KYTF.....LLYLTLVIVLLAVVVLNLWMAFSKN-LK-------------------------
Q180M1_CLOD6/6-101SNHW......FVFAIIAWLIVAGFDVWYIEKSVR-YR-------------------------
B5CPM6_9FIRM/14-109LTPY........IAIPTYIIWLVLFFREVHFDNH-KA-------------------------
B5CWI2_9BACE/6-100FMDE.....ASAINISSIVVPIIGVIYLLAGGQR-YD-------------------------
B2UM80_AKKM8/7-105QNSV.....LLSASLYFLVGSIAFAVIYAGAGSR-FK-------------------------
B6GCJ7_9ACTN/14-116AREV.....ADWLYLLAAVVLIADVVVGVWYAST-RC-------------------------
B1C0V8_9FIRM/9-104ISQF........FAIIAFIVWLIIFFKDVHLDEE-KA-------------------------
F1T535_9ACTN/19-115LTIS.....SEYILVAFIISWILFIWSLISMFAL-VF-------------------------
B0A9H2_9FIRM/8-110ISKL.....VLWISIVIWIVYFVKFTVTFRFDKY-KI-------------------------
C3FDV0_BACTU/4-102VSNTVTKNFVDKVILVEFAISLIVLTYKLFSLKK-VT-------------------------
B1C2P2_9FIRM/6-94.........KILSFTDMIIISIFILIIGVILGNI-IP-------------------------
C0EFA4_9CLOT/6-101SNHW......FVGAMIAWLIVAGLDVWYIGKSDR-YR-------------------------
A5ZV52_9FIRM/8-115QNNTISNYGTEITIVSLGICAYTILVAMIAVIRG-FK-------------------------
A3DHH5_CLOTH/5-98EPGK........ILISVIAFFMLSTFYVMIRAQK-YD-------------------------
C0BXF3_9CLOT/2-95LPRG........LRWILPAGIFGVVIFLVIATNT-IC-------------------------
A5ZPA4_9FIRM/7-95TAKF...........IYILAILAILVGFVVYLKK-KC-------------------------
C9LC36_RUMHA/6-101SSHW......FVYAMIAWMILAGLDVWYIEKSNR-YR-------------------------
B0NJR7_EUBSP/9-104ISQY........MAVIAFIVWLIVFFKDVHLDEE-KA-------------------------
Q187U4_CLOD6/8-110QMDE...KKMVPFSIIFIIVILSSVFFNILYSNK-KC-------------------------
C2MNE7_BACCE/10-94NVKI............LFPIIIIGHFIIAAYVNT-RM-------------------------
A3IBC9_9BACI/7-103HTQW.....LFIVGLVLFVVLTIFLMIYMNTGNR-FK-------------------------
B1RMP4_CLOPF/9-104VSQY........CAIIAFIIWLILFFKDVHISAT-KA-------------------------
C0B515_9FIRM/15-108LPAF........FVYIALGIIVVDVVVIIILENT-LC-------------------------
A6UNJ9_METVS/10-109NIAY..FRHILDFGMILFVIVIMASLIYLNTGKR-FK-------------------------
A6CHY6_9BACI/7-104EIQA.....MYFIGLVLFFCFILFGLVYFNTGNR-FK-------------------------
A7VFG3_9CLOT/28-123HIGI........GCLIAWVIWFVMFILLLMDRHK-RE-------------------------
Q5WBP2_BACSK/4-102NSSL.....VLALALLLLVVPTIFIAIFTFNFDR-FR-------------------------
C0CSM0_9FIRM/9-104ISTY........MAIPAFIVWIIMFFKDVHLDEE-KA-------------------------
A5Z7U9_9FIRM/8-103YQGI........GCWIAWGIWLIMFVLLLIDRHK-RE-------------------------
A6M026_CLOB8/7-106WGKL........CFWITFLVWLIYLFKNIHFNPE-KA-------------------------
C4L708_EXISA/5-98ELDV........PLEPFFLVLMVFIVGMLWRMQR-YD-------------------------
C1I5P0_9CLOT/8-100VSDY.....FEISIIPFVIILIIIIFGYLIYLQR-FD-------------------------
C3JAB0_9PORP/5-95LPEG.....AKWVDISYVCFILVFLVVFLVATNS-NR-------------------------
Q97G56_CLOAB/8-107CSKYIHFPYEHLILVAVILIAVFGNLIYINTGNR-FT-------------------------
Q2BCD0_9BACI/5-105GFTY.....AMEVQIGFMLLFLLGGSIYLSKFEI-PR-------------------------
Q2B5A3_9BACI/6-90SPKF............LIMLCIAIMMGLVFYVNS-RM-------------------------

PF06993

C6BN16_RALP1/10-119DP....AINAAFALFGLICVAVAGIWGAVTV.NK.RI........FFVQTVPAATALALGWF
Q03I47_PEDPA/9-120TG....TIMKMMLIFFLASIFILAAYGALTV.AK.KI........LLVQGLPALITLILVLF
Q5M256_STRT2/9-117SQ........LLVTVFVLNVFFAAVYGAVTA.NK.KI........IFTQGEPAILTLFSLII
A1RC42_ARTAT/11-125NVGGQTAGGSAIVIFCCASHIFLGFWLWVTEKRLLIS........AVGQALFPGLAVIFYML
A1R1G6_ARTAT/9-125WAG.APQVGWTLVFSSCGSMLLAALVLAASGKKYLRA........ATLQGTTPLLAVVLGVL
Q0S476_RHOSR/8-133WAG.HDTPGRTLVVYTCLFMFLAGIALAVSDRMALSRQRGDGVVGALSQSVPPLVALIALTI
A1IQD0_NEIMA/9-122PD....NAVYGATVLFLGFVLIAAAWGAFSSGNK.GI........LVKQGLPAFLAAAAVLA
Q1WTS9_LACS1/9-121PV....NSQFIGTTMFVIFVIIAAIYGWLSA.KNIKI........LLLQGTPAILALLSLII
A3CM41_STRSV/9-118PS.......PVWLGIFMVYIILVAAYGAVTS.DP.KI........LLKQGGLAMLTLLSLFF
A5LRC3_STRPN/9-118QN.......LEIVTIFVLFVIGAATYGSLTA.DK.KI........ILKQGGSAILALISILL
A5CNJ0_CLAM3/12-128FVG.NAPAGLTLVLFTTACMVLASIIIASTGKKYLVP........ALIQGVPPLLGLVFFAA
A5IPX5_STAA9/9-119SN......PKEICTAILVYIIGVAIYGGLSS.NI.SI........FFKQGTLPVLALISMLW
A0PPD5_MYCUA/10-125AMG.HNGIGAALIFAGVGSMAAAAVVLFISAPDKARA........AVTQGLFPVISLVLLGL
Q0U573_PHANO/9-119SA....VFAPQIALFFAGCVFVAGVYGGLTA.NT.KI........FFVQGLPGALCLAAVVF
A0AFW0_LISW6/9-121GA....EMAETVQIFFLSCVVVAALFGGATS.SK.GI........LVKQGLPAVLALVAVLL
Q3XZS6_ENTFC/9-119SA......SKEITSMLLISIFFVALYGSLTS.DR.WI........LLKQGGLALLALLSIFL
Q8PI43_XANAC/9-115RP........DVLSFFLVCVVVAGCYGAYSV.NR.RI........FFVQALPALIALALVWL
Q02YF6_LACLS/7-115NA......SIPVLSLTMIFVVLVGIYGALTV.TK.KI........FIVQALPALISLILLFL
A4AF16_9ACTN/13-130GSTNLWPAGIALAMFATLSMLLAAIVLITSQPKMARA........AAIQGVPPLLGIISLVL
A6LV45_CLOB8/9-120EL.....MSTQLRFFFLGCVIIAAIYGAITS.NK.NI........FIKQGGLAILAIILLIY
Q8DUJ8_STRMU/9-116TA.........IILPILIYIILVAAYGAYSS.NP.KI........LLTQGGLAIIAALLYLF
Q89VY1_BRAJA/1-111NP....AFAFQIKAFFLLCVIVAGAYGAATV.ST.RI........LLVQALPAAIALVALFL
Q28R35_JANSC/9-119EQ....KWRINVGICFLLFVIVAGVFGAVTV.SS.RI........MLVQTAPATLGLVLLML
Q81U31_BACAN/9-121LN....SIGYMVQLFFVICVVVAALFGGFTS.NK.SI........IVKQGLPAILALIALLI
A2TZH9_9FLAO/9-117KT........DVALFFLACVTVAGIYGAYST.QKIKI........LYIQTIPALLAVISLLF
Q0SCW7_RHOSR/9-124IIG.ATAVGAALVFAGAGSMLLAALVLLLSSPDKARA........AITQGTLPLLAVILLAL
Q5FIJ6_LACAC/9-120KA....PVVFTVWELLLALIVVVAIFGGFTA.TK.KI........FVVQMLPALLALIFLLS
A4TBQ4_MYCGI/9-124LTG.DTAVGRALVFAGVGSMLAAAVVLLASSPEKARA........AVTQGALPLVAIVLLVV
Q2J461_RHOP2/9-119DP....VVALQLATFFLGCVIVAGLYGGWSV.SK.RI........LYVQAAPAALALILVWL
Q26FE6_FLABB/9-119NE....IWQSYVALFFLTCVAIAGIYGALTV.ER.KI........LFVQTIPATITILLILV
A8FJ05_BACP2/9-121SN....TVGYMIQLFFILCVIIAAVFGGVTS.NK.SI........IVKQGVPALLALIALIL
A8GFP5_SERP5/9-115EP........AIQLFFLGCVLVAGVFGGLTA.SR.KI........LRVQALPALIGLVAVLW
Q1GBD7_LACDA/9-117GK........IVLQLVLAYMILVAAYGAVTS.QP.KI........LLMQGGLPILTLIVSFF
Q8E2N0_STRA3/9-118QN.......QEIVAVFLINVLLVAIYGALTV.DK.KI........LLKQGGLPILALLTFLF
A6SYN9_JANMA/48-156TA......GDPVKIFFLCCVVAAGIFGGMTA.NR.KI........LFVQALPGVIALVLLSL
Q6MK99_BDEBA/6-122TGEVTRAAGTTLVIYGLVSIIAAGLVLILSSRRLWRA........ALVQIVPAAIALGPFLI
Q03XL7_LEUMM/7-118SG....PQQVLMLQMEMLFIFLAAVYGALTA.TK.KI........ILVQGLPAFIAIILLFL
A1T885_MYCVP/9-124FAG.FTAVGAALVFAGVGPMLAAAVVLLVSARDKARA........AITQGLFPAVAVVLLVA
A0QWH7_MYCS2/9-124VLG.HNAVGVALVLAGVGSMLAAALVLLVSSPDKARA........ALTQGAFPLLAVVFVVL
A6ELU3_9BACT/9-119DP....MWRVYIAIFFLACVVIAGIYGGLTV.SK.KI........FIVQAMPALITLILLHL
A3HU68_9BACT/9-119DP....KWSFYVAVFFLSCVLVAGVFGALTA.SK.KI........FWVQGLPALIALVLLHL
Q825J9_STRAW/9-118DP.....TGFRVQVFFLVCVVIAGVYGGLTA.NR.RI........LFAQALPGALALAAVLI
Q02YA5_LACLS/9-119SA......SLEIVRLLLIYIILVAIYGSLTS.NK.KI........ILTQGGLAILALISSFF
A3TNP7_9MICO/9-124AGD.SDSAGKALIYAACGSMVAAALVLVTSDGSKLRA........ALIQGLAPVLAVIALLL
Q74HX9_LACJO/11-122RM....PTLITVWQLLLAFVVVVAIFGGFTA.SK.KI........FVVQMLPALIAFILLFF
A6T8L7_KLEP7/7-115AP......GVQVVIFFLACVLAAGIFGALTA.SR.KI........LYIQALPALLALVAVLT
Q8U4U8_AGRT5/27-135DE......GLSFKVFFLLCVLVAGIFGAVTA.NM.KI........LFIQALPALFALGFLWI
B1YKF7_EXIS2/9-117SS........AVQLYFLGCVIVAALYGAATA.NT.SI........LFKQGLPAIIAFLLVLF
A9BT48_DELAS/6-114AD......GLGFKYFFLICVLVAGVYGAATA.SR.KI........LWVQAVPAAVSLIALYL
Q08TL8_STIAD/9-118DP.....IGFQVKLFFLACVAVAGIVGALTV.SS.RI........FFVQTVPALIAGSLVLL
Q3ZV36_ENTSA/7-115DS......GLPFKFFFLVCVLIAGIFGAITA.SR.KI........LYVQALPALLALIALWM
A2SLL4_METPP/9-117AA......GSGVKVFFLLCVLVAGLYGAATA.SR.KI........LYVQALPAAAGLALLWL
B4SSD3_STRM5/9-115QP........VLVTFSLACVVVAGCYGAYSV.SR.RI........FMIQAVPAILALVFRAL
A5ETK0_BRASB/7-117AP....AFAFQIKVFFLLCVLVAGLYGAATA.SR.KI........LFIQSVPATIGLVLVWL
Q03CQ9_LACC3/9-120HG....IDQLITLRLLTGFVTVVGLYGGATV.SK.KI........YFVQAIPGALTCLTLFF
Q8NL72_CORGL/9-124FAG.STGIGAALALAGTGSMLAAAAVLALSSPDKRGA........AFKQGTFPLLAVVFLVI
A5VM31_LACRD/7-118SG....ATLVLVWQMLLVFVMVVALFGALTA.TK.KI........ILIQFLPALIAFLLTFL
A8AXQ4_STRGC/9-117DS........FWMAIFMIYIILVAAYGALTS.DP.KI........LLKQGGLAILTLLSIFF
A9B305_HERA2/9-119DA....EFGLQIQLFFVLCVVVAAIYGGLTA.KR.SI........LFIQGGPAIVALVALLI
A4W1R6_STRS2/24-132NL........EITSIFVLCVIAAAAYGAITA.SP.KI........ILTQGGPAILALISILL
Q6FCD0_ACIAD/7-116AP.....LFAMLANFFLGCVLIAGIFGAYTA.SR.KI........LFIQAIPALIALIFVNM
A1TNB7_ACIAC/9-118GP.....HGRAVLTFFLLCVLVAGLYGAATA.AR.KI........LFIQAVPAALGLALLWI
A4APQ9_MARSH/9-119DP....IWKMNISLFFLGCVAVAGIYGALTA.SK.KI........FFVQAFPALLAIILILI
Q38W50_LACSS/9-120TG....AALKTVLALLMLYIFIVALYGTFTA.TK.KI........FFLQGLPALITLLLILI
A6W4X5_KINRD/9-124ATG.HRAVGATLVLVGALSMVGAGLVLVLSDRTKARA........ALVQLVPALLGSLLLIA
Q03SG7_LACBA/9-120PM....PTSLITTALLLGFIVIVALYGSLTV.KR.QI........FWLQGFPALVTLIILLS
A6VV17_MARMS/9-117VA......GSQVMVFFLLCVVIAGVYGAITS.SK.KI........LYVQALPGLIALIAVLA
Q21N19_SACD2/9-117DA......GAHIRIFFLLCVVVAGLYGAATV.GK.KI........LYIQAAPAALALALTIL
Q837C5_ENTFA/9-119QA......TMEMTKFLLIYIILVAAYGSLTS.DK.KI........ILTQGGLAIVALISLLV
A7JSQ2_PASHA/9-121PQ....IVQFQASILFLSFVLIAGLWGAYTS.NK.AI........LIKQGLPALLAILILCL
Q6AHE4_LEIXX/9-125GAG.TLGAGLALILFTMGSMLAAAVVLVTTGRGHLRS........ALIQGTLPLAGIVLMLL
Q98F54_RHILO/7-115AT......GFQVKVFFLLCVAIAGLYGAATV.GR.KI........LFIQTVPAVVALIAVWL
Q7NY41_CHRVO/9-117TA......GFQIKLFFLACVLAAGVFGAATA.NR.RI........LLVQGLPAALGIALLLL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window