Sequence alignment for CL0448

PF10291

A1CP98_ASPCL/575-865----------------PGLNASIIETVSAWFT--EG--AVTK..SFVV-GELALAYNASTGPS.......I.........
A2QRN6_ASPNC/573-862----------------PGLNASIIDTVSAWFT--EG--AVSK..SYVV-GELALAYNATPDVT.......P.........
A3LSR1_PICST/570-810----------------KGLNASIADVVNANFK--DG--QLVK..SQLI-GEVAFTYIPEDATAS......L.........
A6R8P5_AJECN/544-857----------------PGLNASIVETVSAWFS--DG--VVTR..SFVV-GELAMTYNSTVNAP.......S.........
A7TFH3_VANPO/588-843----------------FGLNASVAEVINATFK--DG--VLSD..SHLI-GEIALNYVKDPNSSTGL....P.........
A7TGS6_VANPO/411-664----------------FGLNASVAEVINATYK--DG--LPIE..ANLV-GEVALTYIGNQAVSATP....P.........
Q0D0G4_ASPTN/527-810----------------PGLNASIIETVNAWFT--EG--EVTK..SFVV-GELALAYNGTPGAP.......L.........
Q0UZZ0_PHANO/559-837----------------PGLNASLVETVSAWFE--QG--KVTK..AMVI-GQVALAYNPIDLSSGPF..............
Q2H205_CHAGB/584-884----------------PGLHSSIIETVSATFQ--DG--EPNS..VKVT-GEIALAYVPDPDAPFAGNTPPPAGNWRKLTV
Q2UCN4_ASPOR/109-411----------------PGLNASIIETVNAWFS--DG--VVTK..SSVI-GELALAYNGTPNA..................
Q4PC05_USTMA/657-926----------------SPIKASLSERVNAIFV--GR--EIAK..VMVV-GELSIAVGSSLAGTV................
Q5K9S2_CRYNJ/609-876----------------PGLRAHVNESINVIFR--NK--QVQR..IHIT-GEIHLSLRAKDASSSSPSALPG.........
Q6AWD5_DROME/927-1194----------------IPLAVAFHEIIHAYFR--GS--DESRCQVKVS-GDMMLSFPAGIAGLLANN.PNP.........
Q6FJX2_CANGA/552-812----------------FGLNASIAEVLNATFK--DG--VLTS..SQLV-GEVALNYVKNTVMNTPL....P.........
Q6FKW7_CANGA/557-810----------------YGLNASVAEVINASFK--DG--VVAD..SQLV-GEVALNYTAANPAQA.L....P.........
Q758D3_ASHGO/561-818----------------LGLNASIGEVINAKFK--DG--ILSS..SQLI-GEIALNYISSDSTGNSL....P.........
Q7PUP4_ANOGA/1034-1301----------------IPLAVAFHEIIHAYFK--GA--DESRCQVKMS-GDMMISFPAGIVNVLTNN.PNP.........
FCHO1_MOUSE/610-872----------------LPVATAFTEYVHAYFR--GH--SPS.CLARVT-GELTMTFPAGIVRVFSGT.PPP.........
SGIP1_MOUSE/538-805----------------LPVAAAFTETVNAYFK--GA--DPSKCIVKIT-GEMVLSFPAGITRHFANN.PSP.........
Q9TXS0_CAEEL/688-963----------------IPLAMAINEHVHVWFK--KG--AEEF.IQRTF-GTVMISFPTSSITLLTSIQHEI.........
C8VRP5_EMENI/561-833----------------.GLNASIIETVNAWFS--EG--AVTK..SFVV-GELALAFNAAPDVL.......S.........
G6D639_DANPL/599-866----------------IPLAVAFHEIIHSYFR--GT--EESRCQVKMS-GDMMLSFPTGIVGVLANN.PNP.........
H3CMI9_TETNG/540-801----------------LPIAVAFTESVNAYFK--GA--DPTKCIVKIT-GEMTLSFPMGIIKVFTNN.PSP.........
SYP1_YEAST/610-867----------------FGLNASIAEVLNASFK--DG--MLQN..SQLI-GEIALNYLPNSVMNSPL....P.........
FCHO2_MOUSE/542-807----------------LPVAIALTESVNAYFK--GA--DPTKCIVKIT-GDVTISFPSGIIKVFTSN.PSP.........
Q7RZ47_NEUCR/602-884----------------PGLHSSIIETVSALFQ--DG--EAKS..VKVT-GEIALSYKSDPHNLQ......T.........

PF00928

Q8SSH2_ENCCU/103-336LES...KKSIIPSIVSNNVYLDVCEALSAIIDG.E...RVVL--NRTD.GRCHLNASFGE.E------------------
AP5M_ARATH/299-593PAW.....KPYLYKGKQRLLFTIHETVSAAMYDRDE..IPDN--VSVA.GQINCRAELEG.L------------------
A0A024R654_HUMAN/196-475PAW.....KTGTYKGKPQVSISITEKVKSMQYDKQG..IADT--WQVV.GTVTCKCDLEGIM------------------
Q7RLG1_PLAYO/231-564IYW...R.PSNIYYSTNEIYVDVIENVSCIMNK.FN..KIIH--YSIQ.GNVIINCTISG.T------------------
Q94IK3_SCHDU/275-496......V.SAAPASSTDPVYIVVEEKLQVLLNK.DG..GVEN--MEVQ.GTISLEVKTDD..------------------
Q9M640_MAIZE/272-513VST.....RSSALPPSDPVTVNIEEKLNVVVKR.DG..GISN--FDVQ.GTLALQVLNDT.D------------------
B7EGT8_ORYSJ/272-508..........SYIPPSDPITVTIEEKLNVTVKR.DG..GVSN--FDIQ.GTLALQILNDT.D------------------
COPD_CAEEL/272-505...........PRVKREVVHVRTEEKINTRVSR.DG..GLES--GEVQ.ATVTLSIGSPE.F------------------
Q7T0U9_XENLA/265-505......K.VLAPPVNMESVHLRVEEKISLTCSR.DG..GLQN--MEVH.GLIMLRVSDDK.F------------------
Q7ZU89_DANRE/262-508......K.VLQPPVNMESVHLRVEEKISLTCGR.DG..GLQN--MEVL.GMITLKVADEK.N------------------
Q7ZW27_DANRE/261-505......K.SLPPPTHTESVHLRVEERITLTCGR.DG..GLQN--MEIL.GMITLRVSDEK.N------------------
E2RU50_GIAIC/163-444PVWSRERPAPLTSYDENEIEFTISERADVVVDL.TG..NKVE--SCVVLGAVNATVHLVN.S------------------
A0A023Z961_YEASX/199-483VPW...RTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLT--GSIH.GIVDVRSYLND.N------------------
STNB_CAEEL/1276-1603KIT...R.TAKPVYKQDEVQIHCYDEYSAFVDK.EG..ILSD--QKAR.VRLFCLAFLTG.S------------------
STON2_MOUSE/554-871MDL...S.TVGLNYLEEEITVDVRDEFSGTVGKGDN..QILQ--HHVL.TRIHILSFLSG.L------------------
Q7TNJ9_RAT/394-706ATA...K.PKNKIYEEQEIHLDILDSFWGKVTKEEG..KLVE--SAVL.TQVCCLCFLNG.P------------------
STON1_HUMAN/401-714PAV...S.KPKKNYEEQEISLEIVDNFWGKVTK.EG..KFVE--SAVI.TQIYCLCFVNG.N------------------
AP3M_SCHPO/164-424VPW...R.TAKAKYATNEFFIHVLERVSAVYQP.NG..KLAF--GTVK.SDMECKCQISG.M------------------
Q7RZK0_NEUCR/176-568LPW...R.RNNVRHTQNELYADVIETLSVTLAP.SG..RPLA--AFAN.GTIAFTSKVSG.V------------------
AP4M_DICDI/216-528GSG...S.GVTDADGDNEIYIDLCERLTVLYSS.NG..TILR--NEIT.GKIQMKSYLRG.N------------------
Q7SZZ7_DANRE/172-442PIM...S.SRGEQGGKNEIFVDVIERLSVVIGS.NG..VLMK--SDIQ.GEIRIKCFLPT.C------------------
AP4M1_HUMAN/173-453PVL...S.SRSDQSQKNEVFLDVVERLSVLIAS.NG..SLLK--VDVQ.GEIRLKSFLPS.G------------------
O12969_CHICK/172-441PVL...P.PRGEQGGRREVFVDVVERLTVVIAA.NG..TPLK--VDVQ.GEIRLKSFVPG.A------------------
Q8MU99_9TRYP/164-425VPW...R.DPATKHSSNEIFFDIVENLDCIVDC.EG..NVVQ--SAVR.GAVEVNCRLSG.L------------------
Q8LPJ0_ARATH/51-299VPW...R.PTDPKYSSNEVYVDLVEEMDAIVNR.DG..ELVK--CEIY.GEVQMNSQLTG.F------------------
AP3M_DICDI/167-421IQW...R.KTGIKYTQNKIFFDIIEEIDCIIDS.NG..YIVS--SEIN.GEILCHCNLSG.M------------------
Q20736_CAEEL/165-414IPW...R.RQGVKYTNNEAYFDVIEEIDVIVDK.QG..STVF--AEIQ.GYVDVCCKLSG.M------------------
H2QW32_PANTR/165-418VPW...R.RTGVKYTNNEAYFDVIEEIDAIIDK.SG..STIT--AEIQ.GVIDACVKLTG.M------------------
AP1M_DIPOM/165-418IPW...R.RVGVKYTNNEAYFDVTEEIDAIIDK.SG..STVF--AEIQ.GVIDACIKLTG.M------------------
Q7PXM8_ANOGA/163-414IPW...R.RTGVKYTNNEAYFDVVEEVDAIIDK.NG..QTIF--AEIQ.GYIDCCIKLSG.M------------------
O76928_DROME/163-415VRW...R.RSGVRYTNNEAYFDVIEEVDAIIDK.SG..STVF--AEIQ.GHIDCCIKLSG.M------------------
I1QC96_ORYGL/171-451KSV...VATEPGGKKREEIFVDIIERISVTFSS.SG..YILT--SEID.GTIQMKSYLTG.N------------------
Q7RCE5_PLAYO/258-469......K.PIQADNKKNEIFIDIIEKINLIMNK.KG..EIIY--SYID.GVIQIKSYLLG.N------------------
A0A024WP15_PLAFA/168-435......K.PIQINDKKNEIFIDIVEKINLIMNS.NG..EIVY--SYID.GVIQIKSYLLG.N------------------
N1P4X3_YEASC/258-605ISW...R.TKGIHYAKNEFFLDVIERVQYLMDFEKG..VIRK--NLIH.GEIVCRCYLSG.M------------------
N1NXP4_YEASC/198-491ITW...R.PKGIIHKKDEVFLYVNERINILVSR.DG..SILK--SYVD.GTIDITTHLSG.T------------------
E2RTN5_GIAIC/156-434LSH...R.RQGIIYKRNEIFIDVVESVNAMFNN.VG..QSLH--ADVS.GKIIIKNSLTG.M------------------
AP2M_SCHPO/166-446VPW...R.RAGIKYRKNSIYIDIVERMNLLISS.TG..NVLR--SDVS.GVVKMRAMLSG.M------------------
AP2MB_DANRE/159-436IGW...R.REGIKYRRNELFLDVLESVNLLMSP.QG..QVLS--AHVS.GRVVMKSYLSG.M------------------
D7MRC0_ARALL/166-438VGW...R.REGLAYKKNEVFLDIVESVNLLMSS.KG..NVLR--CDVT.GKVLMKCFLSG.M------------------
AP2M_DICDI/161-439TPW...R.TPDIKYKRNELYIDVVESVNLLMSA.EG..NILR--ADVS.GQVMMKCFLSG.M------------------
B5VSS8_YEAS6/164-474VSW...R.PEGITHKKNEAFLDIVESINMLMTQ.KG..QVLR--SEII.GDVKVNSKLSG.M------------------
AP1M1_ARATH/159-427VSW...R.SEGLKFKKNEVFLDVIESVNILVNS.NG..QIVR--SDVV.GALKMRTYLSG.M------------------
AP1M1_SCHPO/156-426ISW...R.SEGIHYRKNEVFLDVIESVNLIAAA.DG..TVIQ--SEIL.GKVRLKCYLSG.M------------------
E9AVU6_LEIMU/165-432TPW...RLPRNYKYSNNQVFLDVIEQVDMLANQ.AG..ETLS--SEIV.GTVKMQSRLSG.M------------------
Q8T6C3_9TRYP/164-431TPW...RQPGKYKYRKNEVFLDVIESVNILLSP.GG..ETLS--SEIC.GQIKMRVRLSG.M------------------

PF10291

A1CP98_ASPCL/575-865.DHMRVRLDNFQEL-----------------------------------------EKVAANPHFVKE........ER---
A2QRN6_ASPNC/573-862.GSTRVRLDNFQIL-----------------------------------------EKVAANPHFVTE........DK---
A3LSR1_PICST/570-810.PVEPILVRIPNSF-----------------------------------------DKVILNNSFV..........DK---
A6R8P5_AJECN/544-857.DSTLVRLNNFHIL-----------------------------------------EKVAANPVLATEVGNSLKGKEK---
A7TFH3_VANPO/588-843.IGLNLRIDNGKSF-----------------------------------------DKVILNNAFM..........EQ---
A7TGS6_VANPO/411-664.ISINLKVNNASKF-----------------------------------------EKVILNHSFL..........ER---
Q0D0G4_ASPTN/527-810.ENTRVQLDNFQVL-----------------------------------------EKVAANPHFVSE........EK---
Q0UZZ0_PHANO/559-837.GTESVRLENFPVL-----------------------------------------EKVAPNPAFIEQ........AH---
Q2H205_CHAGB/584-884ADHETIRLNKFPLL-----------------------------------------ESIGPNRVFVT.........NT---
Q2UCN4_ASPOR/109-411..NTTVRLENFQVL-----------------------------------------EKVAANPHFVSE........EK---
Q4PC05_USTMA/657-926.KPVHIRIEAFEQL-----------------------------------------EKAAPNPAFLQAV......PGG---
Q5K9S2_CRYNJ/609-876.GPIHIRLAAFEHL-----------------------------------------EKIAPNPAYLAQ........VP---
Q6AWD5_DROME/927-1194.AKLGFRIKHVQNL-----------------------------------------ENLVPNGKLVQI.......DRQ---
Q6FJX2_CANGA/552-812.IGLNLQVTNASTF-----------------------------------------NKVILNQAFM..........EK---
Q6FKW7_CANGA/557-810.IGINLKVNNGSQF-----------------------------------------EKVILNQAFM..........ER---
Q758D3_ASHGO/561-818.LDIILKIESAEQF-----------------------------------------DKIIVNHTIL..........ER---
Q7PUP4_ANOGA/1034-1301.AKLGFRIKNLQNL-----------------------------------------DNVLPNKQLITI.......DRL---
FCHO1_MOUSE/610-872.PVLSFRLVNTAPV-----------------------------------------EHFQPNADLIFS.......DPS---
SGIP1_MOUSE/538-805.AALTFRVVNSSRL-----------------------------------------EHVLPNPQLLCC.......DNT---
Q9TXS0_CAEEL/688-963.EPLAFRLSNAKFI-----------------------------------------KSVLPNKQLIDE.......NVS---
C8VRP5_EMENI/561-833.DKIRVRLNNFPVL-----------------------------------------EKVAANPNFIRE.......VQD---
G6D639_DANPL/599-866.AKLCFRLKNIHRL-----------------------------------------DNVLPNKQLISIN.....AMMS---
H3CMI9_TETNG/540-801.AVLTFRLKNTSRL-----------------------------------------EQVLPNQQLLYS.......DPS---
SYP1_YEAST/610-867.IGINLRINNGAKF-----------------------------------------EKVILNQAFI..........ER---
FCHO2_MOUSE/542-807.AVLCFRVKNISRL-----------------------------------------EQILPNSQLVFS.......DPS---
Q7RZ47_NEUCR/602-884.DNQIIRLNNFARL-----------------------------------------ESIGPNRLFVTS........DA---

PF00928

Q8SSH2_ENCCU/103-336-KMVRFSISKMRTS..............................................GVVYKND--------LQ...
AP5M_ARATH/299-593-PDVSFPLAGLSTA...........................................HIEAISFHPC--------AQ...
A0A024R654_HUMAN/196-475-PNVTISLSLPTNG..........................................SPLQDILVHPC--------VTSLD
Q7RLG1_PLAYO/231-564-PIVKLFFNHKIDL.............................................KKCHLHFT--------VN...
Q94IK3_SCHDU/275-496-ACLRVTVTSNAGK..............................................EFQFKTH--------PN...
Q9M640_MAIZE/272-513-GFIHLQIESQDMP..............................................GLSFKTH--------PN...
B7EGT8_ORYSJ/272-508-GFIQLQIENQDVP..............................................GLNFKTH--------PN...
COPD_CAEEL/272-505-IPISIKMNNGSAA..............................................GTQLQVH--------PN...
Q7T0U9_XENLA/265-505-GRIRVHIDNEDKK..............................................GVQLQTH--------PN...
Q7ZU89_DANRE/262-508-GRIIIVVNNNDKK..............................................GAQLQTH--------PH...
Q7ZW27_DANRE/261-505-GRIRLNINNNDKR..............................................GVQLQTH--------PN...
E2RU50_GIAIC/163-444-PEITVTLSDNVNI...............SQVPSSKQAKGVAAQSQAS........IELCDVQLHRS--------VD...
A0A023Z961_YEASX/199-483-PLVAVKLNTMGND............................................IGIPSLHDC--------VE...
STNB_CAEEL/1276-1603-PVLEVGLNDRRRQ................GKEIVRRKDILPMYTERW........IRFEALEFHSI--------VN...
STON2_MOUSE/554-871-AECRLGLNDILIK................GNEIVSRQDIMPTTTTKW........IKLHECRFHGC--------VD...
Q7TNJ9_RAT/394-706-AECFLALNDLELQ...................KRDERYFEKEPEKRG........IDILNYHFHTC--------VN...
STON1_HUMAN/401-714-LECFLTLNDLELP...................KRDESYYEKDSEKKG........IDILDYHFHKC--------VN...
AP3M_SCHPO/164-424-PLLLLSLRPGTKL.............................................GNVRFHQS--------VN...
Q7RZK0_NEUCR/176-568-PDIIVTLTGPTGK..............................HNLG........SIIDLPVFHPC--------VR...
AP4M_DICDI/216-528-PALSLGLSPEFTFKTIANRDESNENEIDNNNIGGVSNLSAPSSNTTS........FIVDDCSFHEC--------AG...
Q7SZZ7_DANRE/172-442-SEMRIGLNEELNI.......................GKSQLKGYSSA........VRVDECRFHQA--------VK...
AP4M1_HUMAN/173-453-SEMRIGLTEEFCV.......................GKSELRGYGPG........IRVDEVSFHSS--------VN...
O12969_CHICK/172-441-CELRMGLTEELSV.......................GTEEQRGYGR.........LPLAAVAFHSS--------VD...
Q8MU99_9TRYP/164-425-PEVIMRLTGIDCI.............................................EDIAMHRC--------VR...
Q8LPJ0_ARATH/51-299-PDLTLSFANPSIL.............................................EDMRFHPC--------VR...
AP3M_DICDI/167-421-PDLTMTFNNPRML.............................................DDVSFHPC--------VR...
Q20736_CAEEL/165-414-PDLTMTLINPRLL.............................................DDVSFHPC--------VR...
H2QW32_PANTR/165-418-PDLTLSFMNPRLL.............................................DDVSFHPC--------VR...
AP1M_DIPOM/165-418-PDLTLSFLNPRLL.............................................DDVSFHPC--------VR...
Q7PXM8_ANOGA/163-414-PDLSLSFMNPRLF.............................................DDVSFHPC--------VR...
O76928_DROME/163-415-PDLTLSFMNPRLF.............................................DDVSFHPC--------VR...
I1QC96_ORYGL/171-451-PEIRLALNEDLSI................GRTGSSSYDYRSSSGGGA........VILDDCNFHES--------VH...
Q7RCE5_PLAYO/258-469-PYIKIALNDDLYI........................KNIHKDNTNN........IIIDDCNFNHL--------VN...
A0A024WP15_PLAFA/168-435-PFIKIALNDDLYI........................KNIHHDNSNN........IIIDDCNFNHL--------VN...
N1P4X3_YEASC/258-605-PKLKISINKILNR........................................DPQFMSNSSFHQC--------VS...
N1NXP4_YEASC/198-491-PICRFGLNDSLGM.QSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGS........VLLEDCKFHEC--------VS...
E2RTN5_GIAIC/156-434-PDCSFGFNDRVVG.............AGANGPRTEVAQQVAGVSQAG........VVMDDLSFHHC--------VR...
AP2M_SCHPO/166-446-PECQFGLNDKLDF..........KLKQSESKSKSNNSRNPSSVNGGF........VILEDCQFHQC--------VR...
AP2MB_DANRE/159-436-PECKFGMNDKIVI...............DKQGKGGTTDDTGKSGKQS........IAIDDCTFHQC--------VR...
D7MRC0_ARALL/166-438-PDLKLGLNDKIGL..................EKESEMKSRPAKSGKT........IELDDVTFHQC--------VN...
AP2M_DICDI/161-439-PECKFGMNDKVIM.............DREKSTNGGSAARSGARRANG........IEIDDITFHQC--------VR...
B5VSS8_YEAS6/164-474-PDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQC--------VR...
AP1M1_ARATH/159-427-PECKLGLNDRILL.......................EAQGRAIKGKA........IDLEDIKFHQC--------VR...
AP1M1_SCHPO/156-426-PELRLGLNDKVLF.......................EAAGRTIKGNT........VEMEDVKFHQC--------VR...
E9AVU6_LEIMU/165-432-PTCTVGVNDKILF.........................DRTGRSGNT........VEMEDITFHQC--------VK...
Q8T6C3_9TRYP/164-431-PVLKLGLNDKATF.........................EMLASRGRA........VEMEGVKLHQC--------VK...

PF10291

A1CP98_ASPCL/575-865-----------EQGDE...NRGE...YDVLL--------------------ANIARPSPTV-------A...........
A2QRN6_ASPNC/573-862-----------GKDQSD.EKRGE...YDVNL--------------------ASIARSSPTV-------A...........
A3LSR1_PICST/570-810-----------LED.......EV...FKISP--------------------ALVSSKT.LG-------G...........
A6R8P5_AJECN/544-857-----------EKELGDEERKGE...YLISL--------------------PTIARPTPTV-------A...........
A7TFH3_VANPO/588-843-----------VSP.......EE...FKVNP--------------------QFIDSRT.LG-------A...........
A7TGS6_VANPO/411-664-----------VSA.......EE...FKLNP--------------------QFINSRT.LG-------A...........
Q0D0G4_ASPTN/527-810-----------D..DD...KRGQ...YSIQL--------------------SSIARPSPTV-------A...........
Q0UZZ0_PHANO/559-837-----------DSP.......GN...YTVDL--------------------SKIMKTS..V-------A...........
Q2H205_CHAGB/584-884-----------TAP.......DE...FSIDL--------------------SHLNTTT..S-------A...........
Q2UCN4_ASPOR/109-411-----------DKDLSD.EKRGQ...YSIHI--------------------PTIARPSPIV-------A...........
Q4PC05_USTMA/657-926-----------STP.......GE...YLLDV--------------------KSLLEQGVTS-------GLPSSG...SQA
Q5K9S2_CRYNJ/609-876-----------DKP.......GE...YFLNS--------------------DVLAAATTAR-------GSAA......GP
Q6AWD5_DROME/927-1194-----------QSS.......SVSTMLEFNM--------------------GALTALLRRQ-------AENNPTASYFNV
Q6FJX2_CANGA/552-812-----------VAD.......TE...YKVNP--------------------QFIDGRT.LG-------A...........
Q6FKW7_CANGA/557-810-----------VNS.......EE...FKVNP--------------------VFIASRT.LG-------A...........
Q758D3_ASHGO/561-818-----------TAD.......ENNIIYKLAP--------------------QFIFGKT.LG-------A...........
Q7PUP4_ANOGA/1034-1301-----------QST.......SFSTTLEFNM--------------------PVLTATLRRQ-------SEQNPNAPHINV
FCHO1_MOUSE/610-872-----------QSD.......PETKDFWLNM--------------------AALTEALQHQ-------AEQNPTASYYNL
SGIP1_MOUSE/538-805-----------QND.......ANTKEFWVNM--------------------PNLMTHLKKV-------SEQKPQATYYNV
Q9TXS0_CAEEL/688-963-----------KKD.......DEMCIFYFNK--------------------THLATWLQAQ-------KLAKPDAAFVNA
C8VRP5_EMENI/561-833-----------QSED....KRGE...YDVSL--------------------ASITRSAPTV-------A...........
G6D639_DANPL/599-866-----------TR.........DTTVVEFNM--------------------SALTSLLKRQ-------SEKNPTAQYFNV
H3CMI9_TETNG/540-801-----------QSD.......SNSKDFWFNM--------------------QALTSYLRKA-------SDQNPSASYYNV
SYP1_YEAST/610-867-----------VAP.......EE...FKVNP--------------------SFIDSRT.LG-------A...........
FCHO2_MOUSE/542-807-----------QCD.......SNTKDFWMNM--------------------QAVTIYLKKL-------SEQNPAASYYNV
Q7RZ47_NEUCR/602-884-----------TSP.......DE...FTINT--------------------SHLTTIS.TP-------A...........

PF00928

Q8SSH2_ENCCU/103-336...........VSE------------GLSEA....................RVDVKVH..........G--------CRT
AP5M_ARATH/299-593...........VPA------------HGID.....................KQNIVFQPPL.......G--------.NF
A0A024R654_HUMAN/196-475SAILTSSSIDAMDD------------SAFSG....................PYKFPFTPPL.......E--------.SF
Q7RLG1_PLAYO/231-564...........WSK------------.LFKK..............NKSTNEKNVIYFVPLD.......E--------.EY
Q94IK3_SCHDU/275-496...........IDK------------GLYGS....................DSVLGLKDPTRPFPT..G--------SPL
Q9M640_MAIZE/272-513...........INK------------DLFNS....................QQILGAKDPNRPFPSGQN--------.ET
B7EGT8_ORYSJ/272-508...........INK------------ELFNS....................QQIVGAKDPNRPFPSGQN--------.ET
COPD_CAEEL/272-505...........LDK------------KEWQS....................SSTLKIKPNGKPYPVN.S--------.DV
Q7T0U9_XENLA/265-505...........VDK------------KLFTS....................DSVIGLKNPEKSFPVN.S--------.DV
Q7ZU89_DANRE/262-508...........VDK------------KLFTN....................ESLIGLKNQEKSFPLN.S--------.DL
Q7ZW27_DANRE/261-505...........VDK------------KLFTL....................DSVIGLKNPDKSFPLK.S--------.DV
E2RU50_GIAIC/163-444...........IAK------------..FHI....................AKKLVFVPVE.......E--------.EF
A0A023Z961_YEASX/199-483...........IND------------GVFS.....................PSNITFIPPD.......G--------.KF
STNB_CAEEL/1276-1603...........KPE------------..FDK....................EQVIAFSPPD.......G--------CFF
STON2_MOUSE/554-871...........EDV------------..FNS....................SRVILFNPLD.......A--------CRF
Q7TNJ9_RAT/394-706...........AEE------------..FER....................SRSLKFVPPD.......A--------CRF
STON1_HUMAN/401-714...........VQE------------..FEQ....................SRIIKFVPLD.......A--------CRF
AP3M_SCHPO/164-424...........LKR------------..WKQ...................HPDQIEFIPPD.......G--------.KF
Q7RZK0_NEUCR/176-568...........LAK------------..WRE...................QPGVLSFIPPD.......G--------.RF
AP4M_DICDI/216-528............SG------------..FQP....................NNTINFKPPQ.......G--------.DF
Q7SZZ7_DANRE/172-442...........LDE------------..FDT....................FRILKVCPSQ.......G--------.EQ
AP4M1_HUMAN/173-453...........LDE------------..FES....................HRILRLQPPQ.......G--------.EL
O12969_CHICK/172-441...........LEE------------..FEQ....................ERVLRVTPGP.......G--------.EV
Q8MU99_9TRYP/164-425...........RSR------------..YEV....................DRMISFIPVD.......G--------.KF
Q8LPJ0_ARATH/51-299...........YRP------------..WES....................HQVLSFVPPD.......G--------.EF
AP3M_DICDI/167-421...........YSR------------..WEN....................DRVLSFIPPD.......G--------.NF
Q20736_CAEEL/165-414...........YKR------------..WEN....................EKVLSFVPPD.......G--------.NF
H2QW32_PANTR/165-418...........FKR------------..WES....................ERILSFIPPD.......G--------.NF
AP1M_DIPOM/165-418...........FKR------------..WES....................ERVLSFIPPV.......G--------.NF
Q7PXM8_ANOGA/163-414...........FKR------------..WES....................ERILSFIPPD.......G--------.NF
O76928_DROME/163-415...........YKR------------..WEA....................ERLLSFIPPD.......G--------.NF
I1QC96_ORYGL/171-451...........LDS------------..FDI....................DRTLHLIPPD.......G--------.EF
Q7RCE5_PLAYO/258-469...........TSN------------..FET....................DRILSLYQPD.......G--------.EC
A0A024WP15_PLAFA/168-435...........LSQ------------..FEK....................DKILSLYQPD.......G--------.EC
N1P4X3_YEASC/258-605...........LDS------------..INTIEKDEEKNSDDDAGLQAATDAREIEFIPPD.......G--------.EF
N1NXP4_YEASC/198-491...........LDK------------..FNR....................NHIIEFVPPD.......G--------.SM
E2RTN5_GIAIC/156-434...........LGN------------..FAV....................DRSIAFVPPD.......G--------.EF
AP2M_SCHPO/166-446...........LPE------------..FEN....................EHRITFIPPD.......G--------.EV
AP2MB_DANRE/159-436...........LSK------------..FDS....................ERSISFIPPD.......G--------.EY
D7MRC0_ARALL/166-438...........LTR------------..FNS....................EKTVSFVPPD.......G--------.EF
AP2M_DICDI/161-439...........LGK------------..FDS....................DRTVSFIPPD.......G--------.EF
B5VSS8_YEAS6/164-474...........LSK------------..FEN....................EKIITFIPPD.......G--------.KF
AP1M1_ARATH/159-427...........LAR------------..FEN....................DRTISFIPPD.......G--------.SF
AP1M1_SCHPO/156-426...........LAR------------..FEN....................DRTISFIPPD.......G--------.EF
E9AVU6_LEIMU/165-432...........LNQ------------..FES....................ERVISFVPPD.......G--------.EF
Q8T6C3_9TRYP/164-431...........LSQ------------..FES....................HRVISFVPPD.......G--------.EF

PF10291

A1CP98_ASPCL/575-865..FKY-----------------------------QV---------HIDPLDL..SAYCP-------VIFKPAWNL---EE
A2QRN6_ASPNC/573-862..FKY-----------------------------QI---------HMEPSVA..AAYCP-------VIFRPVWNL---EE
A3LSR1_PICST/570-810..IKY-----------------------------LL---------KLNE......TQVP-------IIVQQVWRY---ED
A6R8P5_AJECN/544-857..FKY-----------------------------QV---------HLDPSNL..SAYSP-------VIFNPVWNL---EE
A7TFH3_VANPO/588-843..IKY-----------------------------SV---------KH........PNAP-------IVVHPVWKF---EP
A7TGS6_VANPO/411-664..LKY-----------------------------SM---------KT........MVTP-------VTILPVWNY---EP
Q0D0G4_ASPTN/527-810..FKY-----------------------------QL---------HIDPSDT..SAYCP-------VIFKPAWNL---EE
Q0UZZ0_PHANO/559-837..FHY-----------------------------QL---------HIENENV..AALAP-------LILAPLWKT---EA
Q2H205_CHAGB/584-884..FTY-----------------------------RV---------HADSDTAL.VSQCP-------IAIHPVWKP---QA
Q2UCN4_ASPOR/109-411..FKY-----------------------------QL---------HVDASDS..SAYCP-------VIFKPVWNI---EE
Q4PC05_USTMA/657-926VVLKY-----------------------------QV---------HISESRK..SEYVP-------LSLHAQWRC---EP
Q5K9S2_CRYNJ/609-876LLFKY-----------------------------VV---------HVQPGKE..LATAP-------LILDPVFQC---KS
Q6AWD5_DROME/927-1194DILKY-----------------------------QV---------RTKPGA....SSCP-------FQLVSYWKC---ES
Q6FJX2_CANGA/552-812..MKY-----------------------------SI---------DN........TTVP-------VVIHPIWKF---EP
Q6FKW7_CANGA/557-810..IKY-----------------------------SI---------SH........VTPP-------VVVHPVWRF---EP
Q758D3_ASHGO/561-818..LKY-----------------------------SL---------KS........PLVP-------IAIHPVWRF---EQ
Q7PUP4_ANOGA/1034-1301DILKY-----------------------------QI---------KAKPGA....ASCP-------FQLVSYWKC---EQ
FCHO1_MOUSE/610-872VLLRY-----------------------------QF---------SRPGP.....ESVP-------LQMSAHWQC---GP
SGIP1_MOUSE/538-805DMLKY-----------------------------QV---------SAQGI.....QSTP-------LNLAVNWRC---EP
Q9TXS0_CAEEL/688-963EVARF-----------------------------EM---------EPTAPCN...MVPP-------LFLTSYWKF---EP
C8VRP5_EMENI/561-833..FKY-----------------------------QV---------HINPEDL..STFCP-------VIFRPAWNL---EE
G6D639_DANPL/599-866DILKY-----------------------------QV---------RPKAGA....ASCP-------LQMVSYWKC---EK
H3CMI9_TETNG/540-801DILKY-----------------------------QV---------QSDGI.....HSTP-------LNLTVYWKC---AP
SYP1_YEAST/610-867..IKY-----------------------------SI---------KE........PIAP-------IVIHPVWRF---ES
FCHO2_MOUSE/542-807DVLKY-----------------------------QV---------SSNGI.....QSTP-------LNLATYWKC---SA
Q7RZ47_NEUCR/602-884..FTY-----------------------------RV---------HAENDTALVSSHCP-------ISINPVWKP---QG

PF00928

Q8SSH2_ENCCU/103-336ETVRY.............................WI.................SSLEEP.......LVMICR......AG
AP5M_ARATH/299-593VLMRY.............................QA................GCGLGPP.........VKGFYQLSMVSE
A0A024R654_HUMAN/196-475NLCFY...............................................TSQVPVP...........PILGFYQMKE
Q7RLG1_PLAYO/231-564TVMQYFEHDSLINNNKNGSTKYDASINRFNSSHDQLTDVLNLKTGSMDSIDFAKPENSPKNKSKNSNCDESEKNTKDNND
Q94IK3_SCHDU/275-496GILEW.............................RM..............ATKDESRVP.......LTINCWPSV...SG
Q9M640_MAIZE/272-513PLVKW.............................RI..............QGMDESSLP.......LSVNCWPSV...SG
B7EGT8_ORYSJ/272-508PLVKW.............................RI..............QELNESSLP.......LAVNCWPSV...SG
COPD_CAEEL/272-505GILKW.............................KM..............ALSEEEQLP.......ISFNCWPQE...SS
Q7T0U9_XENLA/265-505GVLKW.............................RL..............QSTEESFIP.......LTINCWPSE...SG
Q7ZU89_DANRE/262-508GVLKW.............................RL..............QSTDESLIP.......LTINCWPSESG.SG
Q7ZW27_DANRE/261-505GVLKW.............................RL..............QTTDESLIP.......LTINCWPSE...SG
E2RU50_GIAIC/163-444RLFSY.............................RL................NKVDSAP.........ILCIVTNRSNPQ
A0A023Z961_YEASX/199-483RLLEY.............................SV..............DLSSQVKQS.GVRMNSIGLMSLHFQNGLGK
STNB_CAEEL/1276-1603EIMRF.............................RV..............RPPRNREKA.......MTVKSIMKI...AG
STON2_MOUSE/554-871ELMRF.............................RT...............VFAEKTLP.......FTLRTAASI...NG
Q7TNJ9_RAT/394-706ELMRF.............................RT...............SREGDELP.......FSVKSIVTV...QG
STON1_HUMAN/401-714ELMRF.............................KT...............LYNGDNLP.......FSLKSVVVV...QG
AP3M_SCHPO/164-424TLASF.............................QT..............DFATQKSLP.......VVVEAKNKL.....
Q7RZK0_NEUCR/176-568TLAGY.............................EVDLLPLGARNLGNMSASANNLKLP.......VSLEIKTCL...GP
AP4M_DICDI/216-528TLLKY.............................RI................SNNNYTP.......FLVKTNLES...TI
Q7SZZ7_DANRE/172-442TIMQY.............................QL..............CDELPCAPP.......FQLFPSVE....KD
AP4M1_HUMAN/173-453TVMRY.............................QL..............SDDLPSPLP.......FRLFPSVQW...DR
O12969_CHICK/172-441TLMRY.............................QL..............AEDVAVPLP.......FRLLPSVEW...EP
Q8MU99_9TRYP/164-425TLLQY.............................RC..............KMPNSVQVP.......FYVTPQITF...NA
Q8LPJ0_ARATH/51-299KLMSY.............................RV................KKLKNTP.......VYVKPQITS...DS
AP3M_DICDI/167-421KLLSY.............................RV................KGINQFP.......VYVKPQISYSEGSS
Q20736_CAEEL/165-414RLLSY.............................HI..............AAQNMVAIP.......IYVRQVISL...KP
H2QW32_PANTR/165-418RLLSY.............................HV..............SAQNLVAIP.......VYVKHNISFRD.SS
AP1M_DIPOM/165-418RLMSY.............................HV..............NSQNLVAIP.......VYVKHNINFRD.DG
Q7PXM8_ANOGA/163-414RLMSY.............................HV..............GSQSIVAIP.......IYVRHNLVLR..SG
O76928_DROME/163-415RLMSY.............................HI..............SSQSVVAIP.......IYIRHNFSIK..TG
I1QC96_ORYGL/171-451AVMNY.............................RI................TQEFKPP.......FRVTALIEE...AG
Q7RCE5_PLAYO/258-469VLMNY.............................RI................NNNFKAP.......FHLFANVLY...NP
A0A024WP15_PLAFA/168-435VLMNY.............................RI................NNNFKAP.......FKIYANVIY...NQ
N1P4X3_YEASC/258-605VLCQY.............................EL................KRHVKDAPMVRLKDFEIKPKLKK.....
N1NXP4_YEASC/198-491ELMKY.............................HV................RDNINLP.......FKVTPIVTH...ST
E2RTN5_GIAIC/156-434QLMAF.............................RV................TEEVKEP.......FSIKPIVTV...HG
AP2M_SCHPO/166-446ELMSY.............................RS................HENINIP.......FRIVPIVEQ...LS
AP2MB_DANRE/159-436ELMRY.............................RT................TKDIILP.......FRVIPLVRE...VG
D7MRC0_ARALL/166-438ELMKY.............................RI................TEGVNLP.......FRVLPTIKE...LG
AP2M_DICDI/161-439ELMRY.............................RT................TEHINLP.......FKVIPIVRE...MG
B5VSS8_YEAS6/164-474DLMNY.............................RL................STTIKPL.......IWCDVNVQV...HS
AP1M1_ARATH/159-427DLMTY.............................RL................STQVKPL.......IWVEAHIER...HS
AP1M1_SCHPO/156-426DLMSY.............................RM................SSNVRPL.......IWVECESIV...HS
E9AVU6_LEIMU/165-432TLLSY.............................RL................NDRIQQP.......VKVSCTFTH...HG
Q8T6C3_9TRYP/164-431ELMSY.............................RT................SKKVAPM.......VTVECTTVS...KS

PF10291

A1CP98_ASPCL/575-865FQASVIIFYSMNP....SF--------------------------------ASSVPRQSITLKNLTLTVNLDTSPEDG..
A2QRN6_ASPNC/573-862HQASAIIYYSINS....SF--------------------------------TSAPG.GTVTLRNLVLTVNLDTSPVEG..
A3LSR1_PICST/570-810HQASLVVKLRVNP....AI--------------------------------REE.....VVVENLFVSVALKSN......
A6R8P5_AJECN/544-857FQASVIITYSINP....NF--------------------------------VSAMPSTRITLQNLVLTVNLDLSPQEDET
A7TFH3_VANPO/588-843HQASVVLTVKLSPTLPESV--------------------------------QR......LVLHDFAVYVAIDGA......
A7TGS6_VANPO/411-664HQASVILTIKMSPTVPTNI--------------------------------QH......LVLEDFIVYVSIDNA......
Q0D0G4_ASPTN/527-810HQASAIIFYSLNP....SF--------------------------------TTTSSKDSVTLRNLVLTVNLDTSPEEG..
Q0UZZ0_PHANO/559-837SQASAILHYSLNPKFNLGG--------------------------------ATS.....VTIRNLVLVVRLEPG......
Q2H205_CHAGB/584-884DKLGLLLQYRLNPS..CAF--------------------------------PRP.....VTLSNVVFVATYEGA......
Q2UCN4_ASPOR/109-411HQASVIVFYSLNP....SF--------------------------------TSSVPRESVTLKNLILTVNLDTSPEEG..
Q4PC05_USTMA/657-926HQTSLLMTYTPNSACRFST--------------------------------VDAGESSATVLQDLQFAVQIQPS......
Q5K9S2_CRYNJ/609-876GETRMILHYSANPSSPLAT--------------------------------TG......TQLGSATVVAAFTPGG.....
Q6AWD5_DROME/927-1194SYTALKVDYKYNNH...AM--------------------------------ASA.....SPLLNVTLSVPVNGS......
Q6FJX2_CANGA/552-812HQASVVLTVGLSNQIPESI--------------------------------NE......LTLSDFTVMVNIAGT......
Q6FKW7_CANGA/557-810HQASVVLNVKMSPMLPDNV--------------------------------NQ......IVLNDFAVFISIDGA......
Q758D3_ASHGO/561-818TQASVMLTLKIFSGLPPAV--------------------------------QE......LVLEDLIVSVAIDNT......
Q7PUP4_ANOGA/1034-1301RHTDIKIDYKYNCH...AM--------------------------------AQP.....SPLLNVSISVPVDGG......
FCHO1_MOUSE/610-872TLTRVSVEYSYRAG...AT--------------------------------AVS.....TPLTNVQILLPVGEP......
SGIP1_MOUSE/538-805ASTDLRIDYKYNTD...AM--------------------------------STA.....VALNNVQFLVPIDGG......
Q9TXS0_CAEEL/688-963GHTDLRVDYRLNSE..SSI--------------------------------SAP.......LLNVNFSTNLTGS......
C8VRP5_EMENI/561-833FQASVIIFYSLNPS....F--------------------------------ASAASKDSITLTNLVLTVNLDISPQED..
G6D639_DANPL/599-866DHTDLKVDYKFNLH...AM--------------------------------SPP.....SPLLNVSVFVPMNGS......
H3CMI9_TETNG/540-801STSDLRIDYRYNPD...SM--------------------------------ANP.....GMLTNVQILVPVDGG......
SYP1_YEAST/610-867HQASVVLTVKMSPSLPDEI--------------------------------SQ......IVIEDLVVFVNIDGA......
FCHO2_MOUSE/542-807STTDLRVDYKYNPE...AM--------------------------------VAP.....SVLSNIQVVVPVDGG......
Q7RZ47_NEUCR/602-884DKLGLLLQYRLNPS..VTL--------------------------------QRP.....IVLHNVTFVATYEGA......

PF00928

Q8SSH2_ENCCU/103-336GGYVVSCPSPTR.................................................FDWLEICFPIPKM......
AP5M_ARATH/299-593DEGAFLFKVHLM...EGY.................................KAPL.....SMEFCTITMPFPRR......
A0A024R654_HUMAN/196-475EEVQLRITINLKLHESVKN.........................................NFEFCEAHIPFYNRGP....
Q7RLG1_PLAYO/231-564DDMDKDYSYIND...ENYD................................K........EDNKVLISGEMSSE....ND
Q94IK3_SCHDU/275-496GESYVNIEYESQ...AEF..........................................DLCNVVIAIPV.........
Q9M640_MAIZE/272-513NETYVNIEYEAS...EMF..........................................DLHNVVISIPLPAL......
B7EGT8_ORYSJ/272-508NETYVNIEYEAS...EMF..........................................DLHNVVISIPLPAL......
COPD_CAEEL/272-505DGVQVNIEYTLQ.......................................REDI.....TLNNVRIIVPLPT.......
Q7T0U9_XENLA/265-505NGCDVNIEYELQ.......................................EERL.....ELNDVVITIPLPAG......
Q7ZU89_DANRE/262-508SGCDVNIEYELQ.......................................DEGL.....ELNDVVITIPVPSG......
Q7ZW27_DANRE/261-505TGCDVNIEYELQ.......................................DDSL.....ELNDVVISIPVPSG......
E2RU50_GIAIC/163-444KPLEREYHLKLE...TLYP................................S.RI.....ISKQIVISVPVMMN......
A0A023Z961_YEASX/199-483DSDEFELSLNIE....NFK................................K.VS.....QVDDLKIDLQFNVENADPNE
STNB_CAEEL/1276-1603SKVEIRIEAMAA...AQIQRTRGSDE.........................RRNI.....PCEDIAIRFPIPEAWIYLFR
STON2_MOUSE/554-871AEVEVQSWLRMS...PGFS................................SNRDPLTQVPCENVMVRYPVPSEWVKNFR
Q7TNJ9_RAT/394-706AYVELQAFVNMT...PAVQ................................RSPHAGSLRSCNNIMIHFPVPAQWIKALW
STON1_HUMAN/401-714AYVELQAFVNMA...SLAQ................................RSSYAGSLRSCDNIRIHFPVPSQWIKALW
AP3M_SCHPO/164-424.DGRFEVRIRNT.......................................G.KK.....SVENLKILITIPQA......
Q7RZK0_NEUCR/176-568TGSDFEVRLTVNRIPGTSGGGGGGSGSSSNYPLSSASGVGRGMGGGPQPGTPASP.....TLQDLKVTVPLPAD......
AP4M_DICDI/216-528R.NRFDLVVTIR...SNFS................................N.KV.....VPNFIFVSIPVPKS......
Q7SZZ7_DANRE/172-442YVNRVLIFLKLR...CDLP................................P.KS.....TALNVSITVPVPKG......
AP4M1_HUMAN/173-453GSGRLQVYLKLR...CDLL................................S.KS.....QALNVRLHLPLPRG......
O12969_CHICK/172-441.AGRLRIHLKLR...CDLP................................P.KN.....HAINVVLQLPLPRE......
Q8MU99_9TRYP/164-425SVGRFNCMVGFRGSGLAAR................................SREY.....EIQKLIIHLPLPPQ......
Q8LPJ0_ARATH/51-299GTCRISVLVGIR...SDPG................................K........TIESITLSFQLPHC......
AP3M_DICDI/167-421SVGRVNVTVGAK...GYNV................................QNKL.....SIEDVVATIPFSKT......
Q20736_CAEEL/165-414NAGKLDLTVGPK...LSMG................................K........VLEDVVLEITMPKC......
H2QW32_PANTR/165-418SLGRFEITVGPK...QTMG................................K........TIEGVTVTSQMPKG......
AP1M_DIPOM/165-418STGWFDITIGPK...QTMG................................K........VVENILVIIHMPKV......
Q7PXM8_ANOGA/163-414EQSRLDITVGPK...TTMG................................R........TVEGVKLDICMPKA......
O76928_DROME/163-415EQGRLDLTIGPR...NTLG................................R........TVDKVKLELTMPRC......
I1QC96_ORYGL/171-451P.SRAEVLLKIR...ADFS................................A.NV.....TANTIVVQMPVPSY......
Q7RCE5_PLAYO/258-469N.HTVELFIRIK...LDIP................................S.RY.....SCTNVLVNCNLCKH......
A0A024WP15_PLAFA/168-435N.HTVELCIRIR...LDIP................................S.QY.....TCTNVFVYCNLCKH......
N1P4X3_YEASC/258-605..FKIQIVTKIQ...TNFK................................P.TN.....STSKLNVRIPLTKVFQEYKI
N1NXP4_YEASC/198-491RDNEIDYRITLK...SLFP................................G.KL.....SAKDVVLHIPVPPS......
E2RTN5_GIAIC/156-434R.NRMEIVLNLR...CGIP................................S.NN.....VAEHVIVSVPMPSN......
AP2M_SCHPO/166-446K.QKIIYRISIR...ADYP................................H.KL......SSSLNFRIPVPTN......
AP2MB_DANRE/159-436R.TKLEVKVVIK...SNFK................................P.SL.....LAQKIEVRIPTPLN......
D7MRC0_ARALL/166-438R.TRMEVNVKVK...SVFG................................A.KM.....FALGVVVKIPVPKQ......
AP2M_DICDI/161-439R.TRLECSVTVK...SNFS................................S.KM.....FGANVKVIIPTPKN......
B5VSS8_YEAS6/164-474N.SRIEIHCKAK...AQIK................................R.KS.....TATNVEILIPVPDD......
AP1M1_ARATH/159-427R.SRVEMLVKAR...SQFK................................D.RS.....YATSVEIELPVPTD......
AP1M1_SCHPO/156-426G.SRIEFMVKAK...AQFK................................K.RC.....IANNVQIIIPVPED......
E9AVU6_LEIMU/165-432T.TRVKVLCTLQ...TKYR................................T.SL.....TANEMEVYIPIPSD......
Q8T6C3_9TRYP/164-431A.TQVEMALVAR...TTFR................................R.TL.....TASFLDILVPVPSD......

PF10291

A1CP98_ASPCL/575-865....RQVAH-----------------------ATSAVM.YPNAG-----AAFRRKQ---SAVTWKIPE------------
A2QRN6_ASPNC/573-862....REVAH-----------------------ATAAVM.YPNTG-----ATFRRKQ---SAVTWKIPE------------
A3LSR1_PICST/570-810.......VQ-----------------------ATSASS.KPQ..-----GAFNKEK---NRITWRYTQ------------
A6R8P5_AJECN/544-857TKQPREVAR-----------------------ATGAVM.YPNTG-----ATFRRKI---SAVTWKLPE------------
A7TFH3_VANPO/588-843........E-----------------------TTNALS.KPQ..-----GSFSKER---KRITWKFSE------------
A7TGS6_VANPO/411-664........N-----------------------ATSALS.KPQ..-----GTFSKEK---RRITWRFNE------------
Q0D0G4_ASPTN/527-810....REVAH-----------------------ATNAVM.YPNTG-----AAFRRKQ---SAVTWKLPE------------
Q0UZZ0_PHANO/559-837.......SK-----------------------ATSCQS.KPS..-----GTFSREK---GLIYWRLGD------------
Q2H205_CHAGB/584-884........R-----------------------ASGVQT.KPS..-----GTHLKDK---HIVYWRLGD------------
Q2UCN4_ASPOR/109-411....REVAH-----------------------ATSAVM.YPNTG-----ASFRRKH---SAVTWKLPE------------
Q4PC05_USTMA/657-926........T-----------------------VNNIMS.KPT..-----ATFVSET---KSLFWKLND------------
Q5K9S2_CRYNJ/609-876.......PS-----------------------VSNVQA.KPA.G-----GVWSPST---RRMTWKMDS------------
Q6AWD5_DROME/927-1194.........-----------------------VRNVQS.KPH..-----SAWLGES---NRLVWNFTD------------
Q6FJX2_CANGA/552-812........E-----------------------STSALS.KPQ..-----GTFNREK---NRITWKFKE------------
Q6FKW7_CANGA/557-810........N-----------------------TTSALS.KPQ..-----GSFNKEK---NRISWRYTQ------------
Q758D3_ASHGO/561-818........V-----------------------AKSALS.KPQ..-----GSFSKEK---RRITWRFKE------------
Q7PUP4_ANOGA/1034-1301.........-----------------------VKNVQS.KPH..-----SAWQGES---NRLVWNFTD------------
FCHO1_MOUSE/610-872.........-----------------------VTSVRL.QPA..-----ATWNTEE---KRFTWKLPD------------
SGIP1_MOUSE/538-805.........-----------------------VTKLQAVLPP..-----AVWNAEQ---QRILWKIPD------------
Q9TXS0_CAEEL/688-963.........-----------------------VDSVMC.EPE..-----AKWVAGN---PSLGWNL..------------
C8VRP5_EMENI/561-833....REVAH-----------------------ATNAVM.YPNTG-----AVFRRKQ---SAVIWKIPE------------
G6D639_DANPL/599-866.........-----------------------VKNVIA.MPK..-----NTWNSEI---EQALWRFTE------------
H3CMI9_TETNG/540-801.........-----------------------VTSMQS.LPP..-----SIWNSEQ---SKCLWKLSD------------
SYP1_YEAST/610-867........N-----------------------ATSALS.KPQ..-----GSFSKEK---KRITWRFKE------------
FCHO2_MOUSE/542-807.........-----------------------VTNMQS.LPP..-----AIWNAEQ---MKAFWKLSG------------
Q7RZ47_NEUCR/602-884........R-----------------------ASGVQT.KPS..-----GTHLKEK---HLVYWRIPE------------

PF00928

Q8SSH2_ENCCU/103-336................................ASKVVK.SHRLG....RSAYDPED...NLLRWTFTK............
AP5M_ARATH/299-593................................RIVAFDGTPSAG......TVLTTE...HSVEWRILG............
A0A024R654_HUMAN/196-475................................ITHLEY.KTSFG....QLEVFREK...SLLIWIIGQ............
Q7RLG1_PLAYO/231-564D...............................IQNNDIMKNENIESRFLLDYNNER...CRLPINVKG............
Q94IK3_SCHDU/275-496................................NTAPSV.TQVDG....DYRYDSRK...GMLLWNIDI............
Q9M640_MAIZE/272-513................................REAPSV.RQIDG....EWKFDSRN...SVLEWSILL............
B7EGT8_ORYSJ/272-508................................REAPGV.RQIDG....EWRYDSRN...SVLEWSIIL............
COPD_CAEEL/272-505................................ATAPSV.GECDG....EYEYHKTK...NVIVWSLAV............
Q7T0U9_XENLA/265-505................................VGSPVI.GDIDG....DYHHDSRR...NTLEWTLPV............
Q7ZU89_DANRE/262-508................................VGAPVV.GDLDG....QYNHDSRK...NILEWSLPV............
Q7ZW27_DANRE/261-505................................VGAPVI.GDLDG....EYRHDSRR...NVLEWCLPV............
E2RU50_GIAIC/163-444................................IDSPKL.QTRRG....IMKYCPHE...QVVKWILES............
A0A023Z961_YEASX/199-483I...............................AYKIKILRNTHG....RFENSIIM...GQGQWIFDK............
STNB_CAEEL/1276-1603EERHWGVGSIHSKKLRPGKVKNLKDRLLGAVQASEPNLIECAIG....EAKYEHVY...RSLVWRIPR............
STON2_MOUSE/554-871RDSVLGEKSLKAKVNRGASFGSAGAS......GSEPVM.RVTLG....TAKYEHAF...NSIVWRINR............
Q7TNJ9_RAT/394-706TRNLQRQKSLKAKMNRRACLGSLQGP......ELEPVI.QVTVG....SAKYESAY...RAVVWKIDR............
STON1_HUMAN/401-714TMNLQRQKSLKAKMNRRACLGSLQEL......ESEPVI.QVTVG....SAKYESAY...QAVVWKIDR............
AP3M_SCHPO/164-424................................LKSVTVTEGNYIFRASKYTHMEE....GILEWSVKK............
Q7RZK0_NEUCR/176-568................................VRNLAEIRTAKG....DATYNPGD...RFLEWTIPNKDVAAGFASHFA
AP4M_DICDI/216-528................................TKSLTH.SLDYGSQNQKVEYKQSTQAGNLVFWSIKK............
Q7SZZ7_DANRE/172-442................................SVSMSQ.ELSSPDQ..TAELQPKN...KALLWEIPR............
AP4M1_HUMAN/173-453................................VVSLSQ.ELSSP....EQKAELAE...GALRWDLPR............
O12969_CHICK/172-441................................ASSLAQ.ELSSPEQ..TAELQGGG...RSLRWAIPR............
Q8MU99_9TRYP/164-425................................TEAVQVHSISHG....NTNFKKAR...NMLVWNAGS............
Q8LPJ0_ARATH/51-299................................VSSADL.SSNHG....TVTILSN....KTCTWTIGR............
AP3M_DICDI/167-421................................TSSTNL.TANIG....SFGMDEQS...KILRWNIGK............
Q20736_CAEEL/165-414................................VQNCNL.VASHG....RIAFDPTT...KLLQWTIGK............
H2QW32_PANTR/165-418................................VLNMSL.TPSQG....THTFDPVT...KMLSWDVGK............
AP1M_DIPOM/165-418................................VLNMTL.TAAQG....NFTFDPVT...KVLIWDIGK............
Q7PXM8_ANOGA/163-414................................VTNCSL.VVNQG....KYTYDTVN...KVLHWDIGR............
O76928_DROME/163-415................................VLNCLL.TPNQG....KYTFDSVT...KTLSWDVGR............
I1QC96_ORYGL/171-451................................TMRASF.ELEAGAVGQTTDFKEGS...RRIEWNLKK............
Q7RCE5_PLAYO/258-469................................ISSVHL.DPNINSDLFSAHYIPNE...NKLLWTIKK............
A0A024WP15_PLAFA/168-435................................ITNVHL.DLNTNSDLFSAQYISNE...NKLLWTIKK............
N1P4X3_YEASC/258-605DL..............................SKQIRF.KANIG....KVVFNLSD...DFLLWEIQT............
N1NXP4_YEASC/198-491................................TVDCKI.SVSNG....HCKFVPEE...NAMIWRFNK............
E2RTN5_GIAIC/156-434................................VSDVTA.IESLG....KCRLRKDG...QAAEWRIKS............
AP2M_SCHPO/166-446................................VVKANP.RVNRG....KAGYEPSE...NIINWKIPR............
AP2MB_DANRE/159-436................................TSGVQV.ICMKG....KAKYKASE...NAIVWKIKR............
D7MRC0_ARALL/166-438................................TAKTNF.QVTTG....RAKYNPSI...DCLVWKIRK............
AP2M_DICDI/161-439................................TAVCKI.VVAAG....KAKYMPEQ...DAIIWRIRR............
B5VSS8_YEAS6/164-474................................ADTPTF.KYSHG....SLKYVPEK...SAILWKIRS............
AP1M1_ARATH/159-427................................AYNPDV.RTSLG....SAAYAPEK...DALVWKIQY............
AP1M1_SCHPO/156-426................................ADSPRF.QTSNG....HVQYAPEQ...AAMVWNIKK............
E9AVU6_LEIMU/165-432................................ADHPQS.NSQTG....HLQYAPQV...NALVWNLGK............
Q8T6C3_9TRYP/164-431................................AFKPEG.RCSAG....KVRHAPES...NLLMWSLRE............

PF10291

A1CP98_ASPCL/575-865--------------------------.LDVQAGTD.---------------.GKL-LVRFATSASWP.........RKGK
A2QRN6_ASPNC/573-862--------------------------.LEVKAGSD.---------------.AKL-LVRFSTTASWP.........RQGK
A3LSR1_PICST/570-810--------------------------PLKLGGDVVE---------------.EKL-IARFMTNGKGV........EDEAG
A6R8P5_AJECN/544-857--------------------------.LEIGSEGD.---------------.QRF-LARFSTTVSGP.........RKGK
A7TFH3_VANPO/588-843--------------------------PLVLDKNG.S---------------.ERL-IARFVTSGLAH........ETEKG
A7TGS6_VANPO/411-664--------------------------PLVLPRNG.E---------------.QRL-IARFMTDGIAK........EAHNG
Q0D0G4_ASPTN/527-810--------------------------.FEVKAGSD.---------------.GKF-LVRFATSNSWP.........RKGK
Q0UZZ0_PHANO/559-837--------------------------.VTFSKDEPT---------------.QTI-RVRFITEGEA..........KPGN
Q2H205_CHAGB/584-884--------------------------.VTLTDDW..---------------.AKI-ICRVIGEQNAE........PMPGK
Q2UCN4_ASPOR/109-411--------------------------.FEVTAGSD.---------------.GKL-LVRFSTATSWP.........RKGK
Q4PC05_USTMA/657-926--------------------------KISLTSPSSE---------------VHKL-LARCQIEGAQT.........VPTP
Q5K9S2_CRYNJ/609-876--------------------------LLGTTG....---------------.GKV-IAKFTSEPGQEA.......LVPQV
Q6AWD5_DROME/927-1194--------------------------.ISQNSQDGG---------------VGTL-RARLELNDGPS.........TPAL
Q6FJX2_CANGA/552-812--------------------------PLTISRDGEN---------------.VKL-IGRFMTNGQGF........EPSDG
Q6FKW7_CANGA/557-810--------------------------PLVLNRDSDG---------------.ERI-IARFMTDQIAH........ESPNG
Q758D3_ASHGO/561-818--------------------------PLVLRRDN.E---------------.ERL-VARFLTEGVAQ........ESQKG
Q7PUP4_ANOGA/1034-1301--------------------------.ISQHSESGG---------------VDTL-RARLEVGTGPS.........TPAI
FCHO1_MOUSE/610-872--------------------------....VCEAGG---------------SGHL-SASWQPQSGPS.........TPSP
SGIP1_MOUSE/538-805--------------------------.ISQKSENGG---------------VGSL-LARFQLSEGPS.........KPSP
Q9TXS0_CAEEL/688-963--------------------------.LEISRNGDV---------------HGSL-KARIFMKNSGDEVSLEMLDRKPAQ
C8VRP5_EMENI/561-833--------------------------.FEVNSKSD.---------------.GKL-LVRFSTANSWP.........QKGK
G6D639_DANPL/599-866--------------------------.LSQHSEDRG---------------VGSL-RARFELLNGPS.........SKTT
H3CMI9_TETNG/540-801--------------------------.ISEKSENEG---------------AGTL-RAKFELSNGPS.........NPST
SYP1_YEAST/610-867--------------------------PVVLTRNGEG---------------.QRL-IARFITDGLAH........ESAKG
FCHO2_MOUSE/542-807--------------------------.ISEKSDSGG---------------SGSL-RAKFDLSEGPS.........KPTT
Q7RZ47_NEUCR/602-884--------------------------.LTLTDDW..---------------.AKI-ICRVIGEQNGE........PQPGH

PF00928

Q8SSH2_ENCCU/103-336.............................EVVKRER.....................IDYRVEEFEK--------SEDL.
AP5M_ARATH/299-593................SGRSLSGKSLEATFPGTIKFSPLQSRR........KGDGDDEESEDESAEN--------VVNVE
A0A024R654_HUMAN/196-475............................KFPKSMEI...............SLSG.TVTFGAKSHEK--------QPFDP
Q7RLG1_PLAYO/231-564.........................NVIYVPXENMY...............KMKI.NVTLNNIKRKK--------NSNLL
Q94IK3_SCHDU/275-496.............................IDSANNS...............................--------.....
Q9M640_MAIZE/272-513.............................IDQSNRS..................G.SMEFVVPPADP--------SSFFP
B7EGT8_ORYSJ/272-508.............................VDQSNRS..................G.SLEFTVPAADP--------STFFP
COPD_CAEEL/272-505.............................IDSSNSS..................G.TLEFSVPNGHC--------DHFFP
Q7T0U9_XENLA/265-505.............................IDSKNKT..................G.SLEFSIAGHPN--------DFFP.
Q7ZU89_DANRE/262-508.............................IDEKNKS..................G.SLEFSIDGKPN--------DFFP.
Q7ZW27_DANRE/261-505.............................IDLKNKT..................G.SLEFSISGQPN--------DFFP.
E2RU50_GIAIC/163-444.............................LPGKQ.................IFKA.LLNFGVPSRHK--------DQLGC
A0A023Z961_YEASX/199-483............................STATGTVP...............VLRG.CIEYENTGPNF--------TKKVD
STNB_CAEEL/1276-1603.............................LPEKHHA...............AYKSHLLKCRFELSSF--------DLMPE
STON2_MOUSE/554-871.............................LPDKNSA...............SGHPHCFFCHLELGSD--------REVPS
Q7TNJ9_RAT/394-706.............................LPDKNTS...............PDQPHCLSYKLELGSD--------QEVPS
STON1_HUMAN/401-714.............................LPDKNSS...............LDHPHCLSYKLELGSD--------QEIPS
AP3M_SCHPO/164-424.............................LAWTSPAL..............VLTGFLAPLKKDANST--------EESSS
Q7RZK0_NEUCR/176-568LRCTVVGQSISGEYEDDNDDPTGFGFNTSSAGGRDWSYDAGEPAPYQSASDLLSGGDKKLTAEQEKE--------EKERR
AP4M_DICDI/216-528.............................LRGGMET...............ILRI.QIHVDGATSSS--------SNNNQ
Q7SZZ7_DANRE/172-442.............................FPGGAQL...............SALF.NVEVPGLSSAS--------LLEV.
AP4M1_HUMAN/173-453.............................VQGGSQL.................SG.LFQMDVPGPPG--------PPSHG
O12969_CHICK/172-441.............................CQGGAQL..................GAVFRVQLPPTPP--------LGLGP
Q8MU99_9TRYP/164-425.............................LHRGTCS................LSG.EFTFGTEREKE--------GLAP.
Q8LPJ0_ARATH/51-299.............................IPKDKTP...............CLSG.TLALEPGLERL--------HVFPT
AP3M_DICDI/167-421.............................IPKEKTP...............FLNG.TVSLIAGSMTP--------ESTPS
Q20736_CAEEL/165-414.............................IEVGKPS...............TLKG...SVAVSGTTV--------AENPP
H2QW32_PANTR/165-418.............................INPQKLP...............SLKG.TMSLQAGASKP--------DENPT
AP1M_DIPOM/165-418.............................IILPKLP...............TLKG.LINLQSGEAKP--------EENPT
Q7PXM8_ANOGA/163-414.............................IDAAKLP...............NIRG.TVSVAATNSTL--------ETTI.
O76928_DROME/163-415.............................IDVSKLP...............NIRG.SVSITPGTTNI--------DANPS
I1QC96_ORYGL/171-451.............................IVGGSEH...............TLRA.KLTFSQESHGN--------LTKE.
Q7RCE5_PLAYO/258-469...................................................................--------.....
A0A024WP15_PLAFA/168-435.............................FKGEHEY...............SIRS.KITLSPHYAFS--------KRDF.
N1P4X3_YEASC/258-605.............................MKGHREHSTNKSSQYNSDEDDPNTCA.SMVAEFPLFNQ--------EEYDR
N1NXP4_YEASC/198-491.............................YNGLTEN...............TLSAVTVSTSDTTQLN--------LQQWT
E2RTN5_GIAIC/156-434.............................ITGGTTA...............TLSM.EVQCVSSSSID--------LREWR
AP2M_SCHPO/166-446.............................FLGETEL...............IFYA.EVELSNTT..N--------QQIWA
AP2MB_DANRE/159-436.............................MVGMKES...............QISA.EIELLPTN..D--------KKKWA
D7MRC0_ARALL/166-438.............................FPGQTES...............TLSA.EIELISTMG.E--------KKSWT
AP2M_DICDI/161-439.............................FPGDTEF...............TLRA.EVELMASVNLD--------KKAWS
B5VSS8_YEAS6/164-474.............................FPGGKEY...............SMSA.ELGLPSISNNE--------DGNRT
AP1M1_ARATH/159-427.............................FYGNKEH...............TLKA.DFHLPSIAAEE--------ATPER
AP1M1_SCHPO/156-426.............................FAGGKEF...............FMRA.EMGLPSVKNED--------IQVQK
E9AVU6_LEIMU/165-432.............................IAGNRHC...............SCSA.EFHLPSIRSSD--------IKDLS
Q8T6C3_9TRYP/164-431.............................VSGGKQF...............TCSF.KFSLPSVRSSD--------PSVFA

PF10291

A1CP98_ASPCL/575-865-----------------------------------------VDAKFELHTADAG-----SR.......LGISTVSP....
A2QRN6_ASPNC/573-862-----------------------------------------VDAKFEVHTLDDG-----SR.......LGISTASP....
A3LSR1_PICST/570-810-----------------------------------------VQLKFLIHDHP..-----.........IKFATI......
A6R8P5_AJECN/544-857-----------------------------------------VDAKFDVTNANNG-----ER.......LGISVQNS....
A7TFH3_VANPO/588-843-----------------------------------------VIAKFSIQGSDT.-----..ELA.TSNVPIALH......
A7TGS6_VANPO/411-664-----------------------------------------VQVKFSVKDSSS.-----..IQ...LGSGILLQ......
Q0D0G4_ASPTN/527-810-----------------------------------------VDAKFEIYSSDAG-----SR.......LGVSAASD....
Q0UZZ0_PHANO/559-837-----------------------------------------VEARWEISGDQTL-----TLG....SGLGVSMSAP....
Q2H205_CHAGB/584-884-----------------------------------------VEVRWEWAPPANS-----SADA..GSGISVARLLPEGKG
Q2UCN4_ASPOR/109-411-----------------------------------------VEAKFEVHTLDAG-----SR.......LGISAASP....
Q4PC05_USTMA/657-926-----------------------------------------VHLKWKII.GKTI-----SS.......LGVVTL......
Q5K9S2_CRYNJ/609-876-----------------------------------------VQVSWAAE.GSLI-----SG.......LGLDVV......
Q6AWD5_DROME/927-1194-----------------------------------------LATQFNCE.GTTL-----SG.......IEFELQ......
Q6FJX2_CANGA/552-812-----------------------------------------VMLKFVIREQQGQ-----QDASINIIGSKITLS......
Q6FKW7_CANGA/557-810-----------------------------------------VLVRFTTNPQLN.-----..SD...IGSGMSII......
Q758D3_ASHGO/561-818-----------------------------------------VQAKFTIRGLQ..-----..L.....GGGLVLR......
Q7PUP4_ANOGA/1034-1301-----------------------------------------ISTQFNCE.GTTL-----SG.......IEFELA......
FCHO1_MOUSE/610-872-----------------------------------------VAAQFTSE.GATL-----SG.......LDLELL......
SGIP1_MOUSE/538-805-----------------------------------------LVVQFTSE.GSTL-----SG.......CDIELV......
Q9TXS0_CAEEL/688-963-----------------------------------------VFVQFQCL.EANL-----SG.......VDISLV......
C8VRP5_EMENI/561-833-----------------------------------------VEAKFEVRTPDAG-----SR.......LGISSA......
G6D639_DANPL/599-866-----------------------------------------ISAQFNCE.GATL-----SG.......IEFELI......
H3CMI9_TETNG/540-801-----------------------------------------LAVQFFNE.GTTL-----SG.......IDMELQ......
SYP1_YEAST/610-867-----------------------------------------VITKFTISETDNV-----ALPHS.GAGSGITLT......
FCHO2_MOUSE/542-807-----------------------------------------LAVQFLSE.GNTL-----SG.......VDIELV......
Q7RZ47_NEUCR/602-884-----------------------------------------IEVRWEYTAPPAG-----EVG....SGISVSRLVEGKGK

PF00928

Q8SSH2_ENCCU/103-336..............................RP.........IVVNFHIK-EWGD.....PK-------IRIEKA------
AP5M_ARATH/299-593.........DFLVQKMNKDL.........PAAELEEPFCW.QAYDYAKV-SFKI.....VG-------ASVSRM------
A0A024R654_HUMAN/196-475.........ICTGETAY........................LKLHFRIL-DYTL.....TG-------CYADQH------
Q7RLG1_PLAYO/231-564.........LNSY............................ENILIKIP-VHNIISSVNSN-------ITIGKL------
Q94IK3_SCHDU/275-496.........................................GAMEFKLP-AVDS.......-------......------
Q9M640_MAIZE/272-513.........................................ISVGFSAS-STF......SD-------LKVTGI------
B7EGT8_ORYSJ/272-508.........................................ISVGFSAS-NTF......SD-------LKVTAI------
COPD_CAEEL/272-505.........................................VSVGFTSE-NLFV......P-------ITVQKV------
Q7T0U9_XENLA/265-505.........................................VTVSFVSK-KNYC......S-------LHVTKV------
Q7ZU89_DANRE/262-508.........................................INVSFVSK-RNFC......D-------IQVAKV------
Q7ZW27_DANRE/261-505.........................................VNVSFVSK-GSYC......D-------IQVAKV------
E2RU50_GIAIC/163-444.........DATSLR.....................P....IVIEYTIP-YHHI.....SG-------LNIDKC------
A0A023Z961_YEASX/199-483.........LQT.............................VSLEYSYI-GQSA.....SG-------IYVEAI------
STNB_CAEEL/1276-1603.........EFLPR...........................CDVDFTMP-LATV.....SN-------TVVRSV------
STON2_MOUSE/554-871.........RFANY...........................VNVEFSMP-TTSA.....SK-------AAVRSV------
Q7TNJ9_RAT/394-706.........DWDPF...........................ATVQFSMS-EACA.....SR-------TEVRSL------
STON1_HUMAN/401-714.........DWYPF...........................ATVQFSVP-DTCA.....SR-------TEVRSL------
AP3M_SCHPO/164-424.........YSKLEH..........................LDLQYKLQ-GSTL.....HN-------FKVESL------
Q7RZK0_NEUCR/176-568.........DGKLAQQNKIL.........MPS....S....ASVSFAVK-GWTA.....SG-------IKVESI------
AP4M_DICDI/216-528.........QQQQPQIDVGS.........TLRKEIGP....IGLEFSIP-QFSC.....ST-------LQIKFL------
Q7SZZ7_DANRE/172-442...................................GP....VSMSFELP-KQTC.....TG-------LQIRFL------
AP4M1_HUMAN/173-453LSTSASPLGLGP.............................ASLSFELP-RHTC.....SG-------LQVRFL------
O12969_CHICK/172-441.........................................AALTFELP-ALTV.....SG-------LRLRWL------
Q8MU99_9TRYP/164-425................................CTGGS....ALVEFSIP-NYLL.....SS-------IRVDSV------
Q8LPJ0_ARATH/51-299.........................................FKLGFKIM-GIAL.....SG-------LRIEKL------
AP3M_DICDI/167-421.........................................IMLQFKIP-QYAI.....SG-------LTIDSL------
Q20736_CAEEL/165-414.........................................ISLKFKIN-QLVL.....SG-------LKVNRL------
H2QW32_PANTR/165-418.........................................INLQFKIQ-QLAI.....SG-------LKVNRL------
AP1M_DIPOM/165-418.........................................LNIQFRIQ-QLAV.....SG-------LKVNRL------
Q7PXM8_ANOGA/163-414.........................................DRVHFTIS-QMAV.....SG-------LKVNRL------
O76928_DROME/163-415.........................................VNVQFQIS-QLAV.....SG-------LKVNRL------
I1QC96_ORYGL/171-451..................................AGP....VNMNFTIP-MYNT.....SK-------LQVRYL------
Q7RCE5_PLAYO/258-469.............................................FKVA-LIYP.......-------......------
A0A024WP15_PLAFA/168-435...................................GP....IYILFEIP-MFNL.....SK-------LRIKYL------
N1P4X3_YEASC/258-605LQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIP-YCTC.....SG-------LKVEYL------
N1NXP4_YEASC/198-491.........RPP.............................ISLEFEVM-MFSN.....SG-------LVVRYF------
E2RTN5_GIAIC/156-434.........RPP.............................LAMNFDIP-MYTA.....SG-------IEVRYI------
AP2M_SCHPO/166-446.........KPP.............................ISLDFNIL-MFTS.....SG-------LHVQYL------
AP2MB_DANRE/159-436.........RPP.............................ISMNFEVP-.FAP.....SG-------LKVRYL------
D7MRC0_ARALL/166-438.........RPP.............................IQMEFQVP-MFTA.....SG-------LRVRFL------
AP2M_DICDI/161-439.........RPP.............................ISMEFQVT-MFTA.....SG-------FSVRFL------
B5VSS8_YEAS6/164-474MPKSNAEILKGP.............................VQIKFQIP-YFTT.....SG-------IQVRYL------
AP1M1_ARATH/159-427.........KAP.............................IRVKFEIP-KFIV.....SG-------IQVRYL------
AP1M1_SCHPO/156-426.........KRP.............................VQLKFAIP-YFTT.....SG-------IQVRYL------
E9AVU6_LEIMU/165-432.........KMP.............................VKVRFVIP-YFAA.....SG-------FQVRYV------
Q8T6C3_9TRYP/164-431.........KAP.............................VQVKFEVP-YLTA.....SG-------IQVRYL------

PF10291

A1CP98_ASPCL/575-865..SEYASQNDSDPFADEGAA.....THAPESQPLAVWKGLPTTRKLVAGK..............YVSH-
A2QRN6_ASPNC/573-862..INQV..KGSDPFADEEAG.....SQTPELQPSFEWKNVPTARKLLGGK..............YVSS-
A3LSR1_PICST/570-810....YSYEDKT..........................KEIASVRNITSGN..............YSGH-
A6R8P5_AJECN/544-857.TSEQKEKKADDPFADESLVMSNGATSPEHLPTSKTWEEVPTRRKLAAGR..............YTSV-
A7TFH3_VANPO/588-843....SQESSEEDPFG...............GS....WKLIQTNKTLTAGN..............YFGL-
A7TGS6_VANPO/411-664....DQEMDENNPFG...............GA....WKPVNSTRILNAGT..............YCNS-
Q0D0G4_ASPTN/527-810..SAQ...KEYDPFADDGP.......GASGSQPSLSWAEVPTVRKLVGGK..............YISS-
Q0UZZ0_PHANO/559-837.LNETKQDGEADPFADIDE.......NAPPASPATGWKPVATVKRITSGT..............YLGV-
Q2H205_CHAGB/584-884KGKAVE.VEDEDPFADATSPP...ASPDLAAEQGRAWAEVPVVRRLVGGK..............YESK-
Q2UCN4_ASPOR/109-411..TEEITPKGSDPFADEDS......GAPDDAQPSLTWKEVPTTRKLVGARRTVPVSRYHRNCLCRISL-
Q4PC05_USTMA/657-926.............G.................EAVDALKIDEVVRTCVAGK..............FIAS-
Q5K9S2_CRYNJ/609-876.............DG...............ELEGNQWVFEEIRKSTTTGK..............YLAE-
Q6AWD5_DROME/927-1194.................................GSGYRLSLVKRRFVSGK..............YVCE-
Q6FJX2_CANGA/552-812....VQEYDVENPFG...............GE....WQPMRTNRTLASGN..............YIAT-
Q6FKW7_CANGA/557-810....CQELDEENPFG...............AD....WKPIALKKTLATGK..............YSGL-
Q758D3_ASHGO/561-818....SQEVTLEDPFG...............SETADIWNDVTTSRTLVAGA..............YYGL-
Q7PUP4_ANOGA/1034-1301.................................GSGYRLSLVKRRFVSGK..............YICE-
FCHO1_MOUSE/610-872.................................GGGYRMSLVKRRFATGM..............YLVS-
SGIP1_MOUSE/538-805.................................GAGYRFSLIKKRFAAGK..............YLAD-
Q9TXS0_CAEEL/688-963................................QSDIYHLSMIRKKVLAGK..............YFCD-
C8VRP5_EMENI/561-833....SR.PAGSDPFAD.............EDNAQAQWSHVPTTRKLAVGK..................-
G6D639_DANPL/599-866.................................GSGYRLSLVKRRFVSGK..............YICD-
H3CMI9_TETNG/540-801.................................GSGYRLSLNKKRFATG...................-
SYP1_YEAST/610-867....CQELDENNP...................FGGEWLDVNTKRTLTTGN..............YH..-
FCHO2_MOUSE/542-807.................................GTGYRLSLVKKRFATGR..............YLA.-
Q7RZ47_NEUCR/602-884EKAEEQ.SEEEDPFADDKGP.....ISPALGKDGRTWAEVPLSRKLIGGK..............YEA.-

PF00928

Q8SSH2_ENCCU/103-336------------------ECI........GSPGVCFWV...RYSMSSG.R--------------YEIRR
AP5M_ARATH/299-593------------------SIDT.......KSVNIYPTT...KSPV....E--------------FSAQV
A0A024R654_HUMAN/196-475------------------SVQVF......ASGKPKISA...HRKLISS.D--------------YYIW.
Q7RLG1_PLAYO/231-564------------------NYND.......KNNCIYWYI...ENVVGTNTT--------------ISASI
Q94IK3_SCHDU/275-496------------------...........DSFFPWRSTSRSKHSATSKSD--------------SSARR
Q9M640_MAIZE/272-513------------------LPLK.......EGNPP...............K--------------FSQRA
B7EGT8_ORYSJ/272-508------------------RPLR.......EGSPP...............K--------------FSQRN
COPD_CAEEL/272-505------------------VK.........NDGSPV..............T--------------YSVET
Q7T0U9_XENLA/265-505------------------NQV........DGNSP...V...RYSTET..S--------------F....
Q7ZU89_DANRE/262-508------------------TYV........EGGSP...V...KFSSET..S--------------FVVDK
Q7ZW27_DANRE/261-505------------------SQV........DGDSP...V...RYSTET..S--------------FVVDK
E2RU50_GIAIC/163-444------------------VVD........ADYSPEVTV...TKSLT...G--------------MVVIK
A0A023Z961_YEASX/199-483------------------DIVSGLTIG..KNTKLYKGA...KYKTQTG.N--------------FQVRL
STNB_CAEEL/1276-1603------------------SVEQHE.....DSDRVEKFV...RYVA....K--------------YQYKV
STON2_MOUSE/554-871------------------SVE........DKPDVRKWV...NYSAHY..S--------------YKVEI
Q7TNJ9_RAT/394-706------------------GVE........SDAQPQ......KHVCQRA.C--------------YNIQV
STON1_HUMAN/401-714------------------GVE........SDVQPQKHV...QQRACY..N--------------IQVEI
AP3M_SCHPO/164-424------------------KMLNH......PDKKSYKGV...KHTIIAQ.N--------------VSFRF
Q7RZK0_NEUCR/176-568------------------MLDPRRSKGLAETVRPFKGV...KYLTVSKGG--------------VEIRC
AP4M_DICDI/216-528------------------KMLG.......SNISPIRWI...RYITDSK.S--------------FVSRI
Q7SZZ7_DANRE/172-442------------------RLSPT......QTGLSQRWV...RYVTHSD.S--------------YTIRI
AP4M1_HUMAN/173-453------------------RLAFRPC....GNANPHKWV...RHLSHSD.A--------------YVIRI
O12969_CHICK/172-441------------------RLSAPPGA...PPGPPQRWV...RHLTHSD.S--------------YVVRL
Q8MU99_9TRYP/164-425------------------QVLN.......DLTKPYKGV...KYVTTAG.R--------------FAVRT
Q8LPJ0_ARATH/51-299------------------DLQT.......IPPRLYKGF...RAQTRAG.E--------------FDVRL
AP3M_DICDI/167-421------------------ACS........ERYKPFKGV...KCTTKAG.K--------------FQVRS
Q20736_CAEEL/165-414------------------DMYG.......EKYKPFKGV...KYITKAG.K--------------FTIRT
H2QW32_PANTR/165-418------------------DMYG.......EKYKPFKGI...KYMTKAG.K--------------FQVRT
AP1M_DIPOM/165-418------------------DMYG.......ERYKPFKGV...KYVTKAG.K--------------FQVRT
Q7PXM8_ANOGA/163-414------------------DMYG.......EKYKPFKGV...KYVTKAG.K--------------FQIRM
O76928_DROME/163-415------------------DMYG.......EKYKPFKGV...KYLTKAG.K--------------FQVRM
I1QC96_ORYGL/171-451------------------QIAKKS.....KTYNPYRWV...RYVTQAN.S--------------YVARL
Q7RCE5_PLAYO/258-469------------------........................YIIHHD.I--------------YLFTH
A0A024WP15_PLAFA/168-435------------------RIIENY.....KTSNTHRWV...RYITQSS.S--------------YVYRL
N1P4X3_YEASC/258-605------------------KVEEPQ.....LQYQSFPWV...RYKTVSDEE--------------YAYIV
N1NXP4_YEASC/198-491------------------TISGKD.....SKHRAVKWI...KYISKAG.S--------------YEVRY
E2RTN5_GIAIC/156-434------------------RIIAQ......EGYETEKWL...TYKTSAG.T--------------YQIRW
AP2M_SCHPO/166-446------------------RVSEPSN....SKYKSIKWV...RYSTRAG.T--------------CEIRI
AP2MB_DANRE/159-436------------------KVFEPKLNY..SDHDVIKWV...RYIGRSG.I--------------YETRC
D7MRC0_ARALL/166-438------------------KVWEK......SGYNTVEWV...RYITKAG.S--------------YEIRC
AP2M_DICDI/161-439------------------KVVEK......SNYTPIKWV...RYLTKAG.T--------------YQNRI
B5VSS8_YEAS6/164-474------------------KINEPK.....LQYKSYPWV...RYITQSGDD--------------YTIRL
AP1M1_ARATH/159-427------------------KIIEK......SGYQAHPWV...RYITMAG.E--------------YELRL
AP1M1_SCHPO/156-426------------------KITEPK.....LNYHAMPWV...RYVTQNGTE--------------YSIRQ
E9AVU6_LEIMU/165-432------------------KVSEK......SNYVATPWV...RYVTQSG.V--------------YEIRT
Q8T6C3_9TRYP/164-431------------------KVEEE......PNYQALSWV...RYVTQSG.D--------------YQIRT

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window