Sequence alignment for CL0452

PF00261

TPM3_HUMAN/49-285KKLKGTEDELDKYSEALKDAQEKLELAEKK-----AADAE---AEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
Q294A9_DROPS/48-284KKFVQVEVDLVTAKEQLEKANAELEEKEKL-----LTSTE---SEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQS
Q17H78_AEDAE/17-253KKMRQTKEEMEKYKDECEEFHKKLQGEVMR-----REEAE---SEVAALNRRIQLLEEDLERSEERLASATAKLSEASAA
TPM1_DROME/102-338KKMRQTKEEMEKYKDECEEFHKRLQLEVVR-----REEAE---SEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQA
Q6NN28_DROME/48-284KKIQTVENELDQTQEALTLVTGKLEEKNKA-----LQNAE---SEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQA
Q05705_CHICK/12-248KKIQSLQQVADEAEERAEHLQREADAERQA-----RERAE---AEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
TPM1_CIOIN/48-284KRLKATEDELDTSQEKLRTAIENLENAEKK-----AADAE---QEVASLNRRITLVEEELDRAQERLTISLSKLEEAEKA
Q676A8_OIKDI/48-282KKQKATEEELNSAKERLQKVQDELKAAEKK-----AADAE---NEVTHCNKKIMTMEEELDSVQEKLNTSIVKLDEAEKN
A7SC63_NEMVE/12-247AKLQAIKEKIDETEDRELAAMEKLREAEER-----FEKAE---GEAESFKRRIQLIEAESRRVKELSQKKDHELEEMHKR
Q6S5G5_NEMVE/6-242KKMATLRQTLEDAEARAAKAEDELKNANDR-----ADSAE---TEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQ
TPM_CAEBR/20-256KKMRQAREEAEAAKDEADEVKRQLEEERKK-----REDAE---AEVAALNRRIVLVEEDLERTEDRLKVATSKLEQATKA
A7RKG4_NEMVE/14-241........KIEEFEEREKAAMKKIARLEEV-----IAKDK---NESATLRRSCSLTEHQLDKTEDILDQKLERLVMLHKK
A7S0B9_NEMVE/9-244EKMQQIKDQTDDAEERELGAKSLLKEAEAK-----EEQLL---SEASGIQRRITLLNSELEKTNERVEE.QEKLLQNLVH
B7ZNL3_MOUSE/50-284..LRASEDERDRVLEELHKAEDSLLAADET-----AAKAE---ADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
C3YBA4_BRAFL/48-283KKIRMVEDELDKAQESLKDATEQLEAATKK-----AADAE---AEVASLNRRIQLVEEELDRAQERLNSTVEKLTDSEKA
E5SUX9_TRISP/48-284KKMMQVENELDKAQEELTGANAQLEEKEKK-----VQEAE---AEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQT
G4VN73_SCHMA/48-283KKIQQVDTDKETAQTQLAETNTKLEETDKR-----ATEAE---AEVASLQKRIRQLEDELESTETRLQEATVKLEEASKA
H2KV99_CLOSI/48-283.RMKQAQTELDEIQEALQDSLNKMEETDKR-----ATNAE---AEVAAMTRRIRLLEEDLEVSSSRLTETLAKLDEASKT
H3CKQ9_TETNG/12-249KKIKVLQEQAEEAVERAERLQKEVEKERKA-----KEEAE---MEVCTLCNRLQNQEDVLERTQQDLEKACRQQLEFEKV
I3J233_ORENI/12-247RKIQCLQQQADDAEDRAQVLQRELDSEREL-----REKAE---GEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKA
U6I146_ECHMU/49-283.KVKNIQTEVDTVQESLQEAISKLEETEKR-----ATNAE---AEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKA

PF12718

A1CDA8_ASPCL/16-158-RMSALRLEADEAQNKVEELKSKVKTLEQE-----NLAKE---QEITSLNHRNQLLEGEVEKLETTLKEAKESANQSAQH
A3LSG6_PICST/7-149-KINNLKADAEKWQEKSDELADRIKELEQE-----NLEKD---HQIQSLTRKNQVLEEQVEKLETDLEEIKHTADESHSL
A6R7T4_AJECN/7-149-KMNTLRLEADDAHAKVEELQNKVKALEQE-----NLAKE---QEIKSLTHRNQLLEADVEKLEADLKDAKASASENAQH
A7TEE8_VANPO/7-149-KLNNLKLEAESWQEKYEELKEQYKQLEQD-----NTDKE---NEIKSLSTKNQQLEEDVENLETKLTDSKQIAEDSHNL
A8PRF4_MALGO/7-149-KLNSLRAEADAALERAEVAEARNKELEQD-----NLSKE---QEISSLQHKLSVLESDLENAEAKLSEAKVGKEEGESH
B0CUA0_LACBS/10-152-KLNSLRTEADNAVLRAEEAEAKNKKYEQL-----LLEKE---QEITSLQHKLSQLDAELEKAEEKVAEYKTANVDGEQT
B2B5X9_PODAN/7-149-KMTQLRLESEESAAKVEELQAKVKALEQE-----NLQKE---QEIISLTHKNSVLESEVEKYETQVKDLKSAASEGAQH
B2VZI7_PYRTR/7-149-RMEALRVEADESSARAEELKAKVKQLESE-----TTQKE---QEITSLSHKNQVLESEVEKLETQVKTYKDEAGAGAQA
B4UN77_KLULA/7-149-KLSNLKLEAESWQDKYEELKEQVKVLEQE-----KTDNE---NLIKSLTTKNQTLEEEVETLEGQVSEHKQLAEDSTNL
B6HMN3_PENCW/7-149-RMVSLRAEADEAHELVDELKAKVKTLEQE-----NLSKE---QEITSLNHRNQLLEEEVEKAEAALKEAKDAASQSLQH
B6K811_SCHJY/7-148-KLNSIRAEAEEALARAEAAEESLKEKEHE-----LARKD---QELASLHKKNEDLEEQVDQLEQELKDVKEQAESESNQ
C3ZKT3_BRAFL/7-153-KMLMLKNDKENALDRAEQAEQAMKDAQEK-----NVKLE---DEINDLNKKIRMVEDELDKAQESLKDATEQLEAATKK
C4R6W6_PICPG/7-149-KINKLKLDAETWQEKHDDVNSKIKVLEQE-----ALEKD---HQIQALTRKNDVLEEQVEKLEEQLSTSKETVNESHSL
C5DMG5_LACTC/7-149-KLSNLKLEAESWQEKYEEVKEQMKQLEQE-----NTEKE---NQIKSLTTKNQQLEDEVEKLEGELSEHKQLSEDSHNL
C5DUA1_ZYGRC/7-149-KLNNLKLESESWQEKYEELKEQYKQLEQD-----NTEKE---NHIKSLTTKNQHLEEEVEKLETDLTDSKQLADESHNL
C5FYF1_ARTOC/7-149-KIESMRLEIDDGQTKLSEQKARIKELEQE-----NLAKE---QEVTSLTHRNQLLEERVENLEATLKEAKAKASEAAQD
E7QFZ0_YEASZ/7-149-KLNSLKLESESWQEKYEELREQLKELEQS-----NTEKE---NEIKSLSAKNEQLDSEVEKLESQLSDTKQLAEDSNNL
E9Q454_MOUSE/7-152-KMQMLKLDKENALDRAEQAEADKKAAEDR-----SKQLE---DELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKK
G4VD36_SCHMA/7-152-KMIAMKLEKENAMERAVQYEELLKKKEEE-----REKRE---SEIAELNNKMKQAQIDCDEAQETLQEQMNKLEETDKR
J0DYI5_LOALO/7-152-KMQAMKIEKDNALDRADAAEEKVRQMTDK-----LERIE---EELRDTQKKMMQTENDLDKAQEDLSVANTNLEEKEKK
J8LIP8_SACAR/7-151-KLSTLKLEAESWQEKYEELKEKNKDLEQD-----TVEKE---NQVKSLTVKNQQLEEEIEKLESGLSGSKQTEQDNVEK
Q17H75_AEDAE/7-153-KMQAMKLEKDNALDRALLCEQQARDANLR-----AEKAE---EEARQLQKKIQAIENDLDQTQEALMAVNAKLEEKEKA
Q4P5V6_USTMA/7-149-KLHTLRVEADAASERADELAEKNKQLEQE-----LLTKD---QEIASLQHKLSLAESDLDKLESKLHEHKSAREEHESN
Q5KF76_CRYNJ/10-149-ILGQ.KIEAAEA..RAEAAESENKKLNQT-----LLERD---QELASLQHKLQLAEEELEASESKVKELKAASDEGETH
Q6C081_YARLI/7-149-KMNSLRLETDAAQEKADEALEKVKAQEQE-----LLQKD---HEIQALTHKNSLLEEEVEKLEQQLSESKDAAEEGATH
Q6FKV5_CANGA/7-149-KLTNLKLEAESWQEKYEELKEQMKQLEQD-----NIQKE---NEIKSLTVKNQQLDQEVEKLEDQIKETKELAEESTTL
Q6FPA3_CANGA/7-152-KLNNLKLEAESWQEKYEELKEKNKELEQE-----KTDLE---NQAKALTVKNQSLEEEVEKLESGADQSRGLEQEKTDL
Q755U4_ASHGO/7-149-KLATLKAESEQWQDKYEELKEEKKQLEDK-----NIEME---NQIKSLTVKNEHLEEELEKLESQLNEHKQLAEDSTNL

PF16526

H9GQC1_ANOCA/497-572------------LEERGRELLLKEGLFDQEAAAEDGEVGG...SEGLSVDQKLDRLQGSLETMDTRLGRLLEEHQTAQR-
F6Z6F8_ORNAN/494-563------------LEERGREILIKEGLLDES.....KATAG...TE.VTVEEKLERLESNLETLHVRFGRLLSEYTGAQQ-
F6XLL2_XENTR/582-652------------LEERGREILIKEGLLDET.....KEKIS...VKGKSSEERLELVESNLDILHTRFARLLREYSNAQQ-
H3B226_LATCH/649-719------------LEERGKEILVKEGLLDES.....AAEVG...IGEKDVEEKIERLESNLDTLQTRFARLLTEYTSTQQ-
H2LZM8_ORYLA/617-687------------LEERGREILKKEGLLDEN.....ADSGG...LQKEDTEEKVERLEMSLDTLQTRFARLLNDYTHTQQ-
Q0GFG2_DANRE/574-643------------LEEKGRQILIKEGLLEE......VEADG...IGVEDIEKRVERMEDTIEILQTRFARLLAQYTATQQ-
H0WC86_CAVPO/589-659------------LEEKGRQILMKDGLLDLD.....IANAG...SDPKDLDEKVTQMEGSLDRLQVRFARILAEYESMQQ-
F7HA92_CALJA/14-84------------LEENGKQILIKDGLLDIN.....TANAR...SEPKDFEERAIQIEGSVDLLKASSAWTLTGYESVQQ-
H0ZCV5_TAEGU/517-587------------LEEKGKQILMKDGLLDIE.....IANLG...SDPKDLEEKVAYMERAMDRLQTKFARLLAEYEGAQQ-
H3A9A8_LATCH/444-514------------LEEKGKQILMKDGLLDLE.....LASAG...ADPKDLEEKVVRMEGAIDNLQTKFARLLAGYDAAQQ-
F6SPJ8_ORNAN/520-590------------LEEKGKQILLKDGLLDLT.....VANAG...SHPKDLGEKVSRVEAAVDVLQTRFARMLAEYESMQQ-
H2MXQ7_ORYLA/551-621------------LEEKGRQILMKDGLLDLE.....VAAQG...PDPKEIEEKVDRMTSTLDALQTRYARLLAENEATQS-
E7FE78_DANRE/551-621------------LEEKGRQILMKDNLLDLE.....LAKQG...PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQG-
G3Q1A1_GASAC/543-613------------LEDKGREILMRDNLIDLD.....PANIM...PETKELEENVNKLYNTMELMHFKVKKILGNNKIAEK-
I3KB24_ORENI/561-631------------LEDKGRQILMKDGLIDLD.....PANIK...PEQKELEEKVNKLYGTMELMQVKLKKILRNYENADK-
B8JHY6_DANRE/569-639------------LEEKGRQILLKDGLLELD.....PSKLK...PDERDLEDRVNRMYSTLQLMQTKVNKLLAQQEETRK-
E7F485_DANRE/629-699------------LEEKGRAILMKDNLIDEA.....AANAG...ADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQS-
F8W5H0_DANRE/612-682------------LEEKGKAILRKDNLLDEA.....VAAAG...ADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQG-
H2N2B8_ORYLA/444-513------------LEDKGRAILMKDNLIDES.....LVAA....CDAKDLENKVNQIEASVEVMTNKFKKLTAQHQSSQR-
M4A5N4_XIPMA/513-582------------LEDKGRAILMKDNLIDES.....LVAA....VDAKDLEDKVNRIEGSVDVMTIKLRKLTNQYESSQR-
H2SR83_TAKRU/514-583------------LEEKGRSILMKDNLIDES.....LVNA....TDAKDMEVKVNQVETTLEVMTTKFRKMLNQYESSQR-
F6TBQ4_XENTR/639-709------------LEEKGRQILMKDGLIDEE.....AAKAG...ADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQL-
C3XXJ5_BRAFL/1611-1683------------LEDRGRKILMKDGLLDET.....VPNAGK.LATPRDAEDKIEKMEQSLDTLQTRFARLLAEYASTQQ-
E3LSL5_CAERE/609-676------------LLAKGREILKKDNLLDENA...P........EEQKTVEEIADHLNNAVRVLQTRMARLIVEHASTEG-
H3DY90_PRIPA/482-549------------LLLKGRELLRKDNLLDDDA...P........DEQASPEEIVDDLLQSINVLQTRVARLMAEKTSTEA-
E5SDC0_TRISP/249-316------------LINKGKEILRKDNLLDETV...E........DEQEQADRLADSFQARLQALKDRYETVIGRYEEMHR-
H2YPA8_CIOSA/10-74------------ML...K..LDKENAIDRA......EQAE...TDKKCAEDKVTEFEEELQALQKRLKATEDELDTSQE-
D6WFN2_TRICA/193-264------------LTERGCQLLRKDGLLDED....VFKKAK...ETQDSVLDSIKKLENTVEILQTRLARLLAEFSASQA-
H9ITJ7_BOMMO/375-446------------LTERGCQLLRKDGLLDEA....LFESAQ...TTQQSIEETVHKLETTVEMLNNRLQGLLADVGEEQA-
G6DLS9_DANPL/606-677------------LTERGCQLLRKDGLLDET....VFQNAQ...TTQQSLEETVHQLEATVEMLHNRLQGLLSNFGEQQA-
B4HSU3_DROSE/545-616------------LTQRGCQLLRKDGLLDEQ....IFADSQ...RVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQA-
Q7PW88_ANOGA/540-611------------LTERGCQLLRKDGLLDEA....VFANAQ...QTQDSLESGVARLEQTVENLNLRLARLLAEYSASQA-
E0VED8_PEDHC/433-504------------LMERGCQLLRKDGLLDEN....AFKKSQ...VEHETLKDKVDRLESSIENLEDKLTQLIGDVTVFHN-
G4VGD7_SCHMA/543-614------------LMQRGQDILRKDNLLDED....ILRKAQ...EQQESIEQCVQRIDNTMNQLTTRLARLIGEFGASQA-
G7YKA2_CLOSI/489-560------------LMKRGEEILRKDNLIDEE....VLRKAK...EQKESLDEYVRRLEGTVNNLSTRLARLIGEYGASQA-
K1QAP2_CRAGI/631-702------------LMDRGKLILRKDNLLDED....LMKKLE...AQQETTEQKLERIDSNLDTLQTRFARLLGDYNSTQQ-
B7QLT8_IXOSC/384-455------------LIERGRNILRRDGLLDEE....AIKVAE...EEQETLKGKCERLEKSLDHLQTRFARLLAEYMAFQV-
E9FQW8_DAPPU/491-562------------LLERGRQLLLKDGLLDEE....VNRRHQ...DESDSAKDRIEKLEMALDTLQTRFARLLAEYTSSQQ-
H2ULR0_TAKRU/439-509------------LEEKGRQILTKMGMLEEN......GDGG..EGEAATVETKIKKLESSLESLHTKLARLMAELESSNA-
G3NBT3_GASAC/462-532------------LEEKGRQILTKMGMLEES......GEHV..DEEADKLENKIGSLESKLEILQTKLARLMSELESSHR-
I3KK99_ORENI/440-510------------LEEKGRQILTKMGMLEES......GEKE..EGEGEKVEIKIKRLESNLEVLQTKLARLMMELESSNR-
H2M3C0_ORYLA/440-510------------LEEKGRQILVKMGMLDES......AEEG..DGDADQIETKLTKLEDHLELMQTKLARLMVELESSNS-
M3ZGA2_XIPMA/438-508------------LEEKGRQILIKMGMLEER......AEVE..EVEAEKVETKIERLESSLEVLRTKLARLMVELESSNR-
F1QQP5_DANRE/414-483------------LEEKGRQILTKMGMLEEA......VEGE...GEVEKTEDKVNRLEGILEMLQTKLARLIAELESSAR-
H3A5H8_LATCH/443-514------------LEEKGKAILLKMKMLDEA......AALEV.GNQEAGLEAKVQRIEKSLGSLYTSLARLVGELQSSTL-
G5BBR5_HETGA/464-535------------MEEKGREILLKMNKLDVN......AEAAE.IALQEATESRLRGLDEQLDDLQTKFARLLAELESSAL-
H9GHD3_ANOCA/465-536------------LEAKGREILLQMGQLDTQ......VEARE.EAQRREEQRRTQALQLRLDALQTRLARMLAGLESGAL-
F1N9W7_CHICK/371-442------------LEAKGREILLRMDKLDVR......AEAAA.AAAREEAEHRAQVLEAALEALQTRTARLLAQLESSAL-
F6VIY1_XENTR/441-512------------LEQKGREILLKMNKLDEQ......LADEL.AAKEQELEMKVGRLESNLDSLQTKLARLLAELESSAV-
I3KFU9_ORENI/585-652------------LEQRGRDILMKEGLLEEV.....NVSAG......EELETKVERLETSLDRFQTCLARLQSEFNSSQL-
H2SEP8_TAKRU/550-617------------LEQRGQDILQKEGLLENV.....NLSAG......DNLEEKLEKLESNLDQLQTHVARLQSEFASSQL-
A8NMI1_BRUMA/571-638------------LIAKGREILRKDGLLDED........AP...EEQMTAEEMAKNLQNTLKIMQTKMARFAAEFSSVKT-
F1LR88_RAT/519-589------------LEEKGRQILMKDNLIDDD.....LVTAR...ADARNIEEKVEYLESSLDGLQTRFARLLAEYSASQM-
F7CHT3_MACMU/570-639------------LEERGREILMKEGLLDEN......EVAT...SMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQ-
F7HCR1_MACMU/548-618------------LEEKGRQILMKDNLIDEE.....LARAG...ADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQM-
G1KLY2_ANOCA/618-688------------LEEKGRQILMKDNLIDEE.....AAKAG...ADPRDLEEKIGKLESALDILQTRFARLLAEYTAGQA-
H3CYZ1_TETNG/446-516------------LEEKGRQILMKDGLLDLD.....PANIK...PEAKELEEKVSKLYSTMELMQIKLKKILGKHKDADK-
H3DJU6_TETNG/534-604------------LEEKGKAILMKDNLIDEA.....VANAG...ADPKDTEEKIAKLQSNLDDMQNKLAKLMAEMTSNHT-
U3INN8_ANAPL/574-644------------LEERGREILTKEGLLDES.....AAEAS...MEGKSVEEKLDRLALNLDTLHTRFGRLLTEYNDAQM-
W4XAC0_STRPU/472-545------------LEERGRTILMKDGLIDEE.....AAKRGGRTAEQVEQLEKLDRLDGNLNHLQTRFSRLLQEYSNSQM-

PF00261

TPM3_HUMAN/49-285ADES...ERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEE
Q294A9_DROPS/48-284ADEN...NRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGEAKIMELEEE
Q17H78_AEDAE/17-253ADES...ERIRKALENRTNMEDDRVAILEAQLSQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVEMNESKIVELEEE
TPM1_DROME/102-338ADES...ERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEE
Q6NN28_DROME/48-284ADES...ERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVELSESKIVELEEE
Q05705_CHICK/12-248ADES...ERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVVLEGELERSEERAEVAESRVRQLEEE
TPM1_CIOIN/48-284ADES...ERGRKVIENRSLKDEERLEVQEIQLTEAKNIAEDADRKYVEVARKLVMVEAELERGEERAELAESKAIELEEE
Q676A8_OIKDI/48-282ADES...ERGRKVIEARAAKDEERLKDQETALKEAKSVAEEADKKYEEVARKLVLVETDVEKAEERAELAETRANELEEE
A7SC63_NEMVE/12-247SKEE...ENLCKTLEVTDRESDEKMRELEDALEEAIELDKSTADKLAEVELKIKVVQGELEKAVERGDRAEMMCEHLMND
Q6S5G5_NEMVE/6-242ADES...ERARKVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEE
TPM_CAEBR/20-256ADEA...DRARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEE
A7RKG4_NEMVE/14-241TEQD...IQMLKVLEDRELEVDNSLDRLEPSAKAAIQRQHDAEMRCMEVQRRLTLTTSELHKIRARQREKEEEVRELENR
A7S0B9_NEMVE/9-244NSEM..NEEARKGLEESEMKGDEKIMDLEAKLKEMERVEKETLETLTEAERKEVVVTRDLERAIEKGRTLENRIQSLEST
B7ZNL3_MOUSE/50-284ADES...ERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEE
C3YBA4_BRAFL/48-283ADES...ERARKVLENRGAADEDRMELLDMQLREAKMIAEEADRKYEEVARKLVITEGDLERAEERADLAETKAAELEEE
E5SUX9_TRISP/48-284ADES...ERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEE
G4VN73_SCHMA/48-283ADES...DRGRKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEATRKLAVAEVALSHAEDRIEAAESKITELEEE
H2KV99_CLOSI/48-283AEES...ERGRKELEIRSIADDERLSQLEDQQKEAKYIAEDADRKYDEAARKLAIVEVDFERAESRLEAAESKIVELEEE
H3CKQ9_TETNG/12-249ADERQRPHRGMKVIENRAQKDEEKLEFLEAQLNEAKGIADEADRKYEESARRVKCLEDDLERAEDKAAKSLSKCCVLEEE
I3J233_ORENI/12-247ADES...ERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAELSECKASDLEEE
U6I146_ECHMU/49-283AEES...ERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEE

PF12718

A1CDA8_ASPCL/16-158DTQN--------------------------------------E....ALQRRVQLLEEEAEEADRN--------------
A3LSG6_PICST/7-149KTSN--------------------------------------D....NYTKKNQVLEEELEEADKN--------------
A6R7T4_AJECN/7-149GTQN--------------------------------------E....SLQRRLQLLEEEAEETDKT--------------
A7TEE8_VANPO/7-149RSNN--------------------------------------E....NFTKKNQQLEEELEETDLK--------------
A8PRF4_MALGO/7-149KSNV--------------------------------------D....ILQRRIDMLEEQLDQSERS--------------
B0CUA0_LACBS/10-152KMTS--------------------------------------E....GLQRKVQLLEEELDVAEKN--------------
B2B5X9_PODAN/7-149GTQN--------------------------------------E....TLTRRLQLLEEEAEQADKT--------------
B2VZI7_PYRTR/7-149GTQA--------------------------------------E....SLQRKIQVLEEEAEESDRT--------------
B4UN77_KLULA/7-149KSHN--------------------------------------E....NFSKKNQQLEEELEENDSK--------------
B6HMN3_PENCW/7-149DTQN--------------------------------------E....ALQRRVQLLEEEAEENDKT--------------
B6K811_SCHJY/7-148QSLI--------------------------------------D....SLNRKIESLEEELENSDKS--------------
C3ZKT3_BRAFL/7-153AADA--------------------------------------EAEVASLNRRIQLVEEELDRAQER--------------
C4R6W6_PICPG/7-149KTNN--------------------------------------E....NITKKNQLLEEELEAADKN--------------
C5DMG5_LACTC/7-149RSHN--------------------------------------E....NFTKKNQQLEEELEESDTK--------------
C5DUA1_ZYGRC/7-149RSNN--------------------------------------D....NYTKKNQQLEEELEESDAK--------------
C5FYF1_ARTOC/7-149SSQN--------------------------------------E....ALQRRIQLMEEEAEQTDKT--------------
E7QFZ0_YEASZ/7-149RSNN--------------------------------------E....NYTKKNQDLEQQLEDSEAK--------------
E9Q454_MOUSE/7-152ATDA--------------------------------------EADVASLNRRIQLVEEELDRAQER--------------
G4VD36_SCHMA/7-152ATNA--------------------------------------EAEVAAMTRRIRLLEEDLEVSSSR--------------
J0DYI5_LOALO/7-152VQEA--------------------------------------EAEVAALNRRMTLLEEELERAEER--------------
J8LIP8_SACAR/7-151ENQI--------------------------------------K....SLTVKNQQLEDEIEKLEAE--------------
Q17H75_AEDAE/7-153LQNA--------------------------------------ESEVAALNRRIQLLEEDLERSEER--------------
Q4P5V6_USTMA/7-149ATNS--------------------------------------E....SLQRKVELLEGELDTAEKN--------------
Q5KF76_CRYNJ/10-149RTTG--------------------------------------E....NLARKVQLLEEELDKAEKD--------------
Q6C081_YARLI/7-149GAAN--------------------------------------E....GLSKKLAILEEDLENSDRN--------------
Q6FKV5_CANGA/7-149KSHN--------------------------------------E....NFNKKNQMLEEELEETDRK--------------
Q6FPA3_CANGA/7-152ENQV--------------------------------------K....ALTVKNQTLEEEVEKLESE--------------
Q755U4_ASHGO/7-149RSHN--------------------------------------E....NFTKKNQQLEEELEESDTK--------------

PF16526

H9GQC1_ANOCA/497-572-----------------------------------------------KLKRRVAALEAR---------------------
F6Z6F8_ORNAN/494-563-----------------------------------------------RLKQRITVLENR---------------------
F6XLL2_XENTR/582-652-----------------------------------------------TLKQRVTLLELK---------------------
H3B226_LATCH/649-719-----------------------------------------------KLKQRITNLEAK---------------------
H2LZM8_ORYLA/617-687-----------------------------------------------RLKQRVTLLEQQ---------------------
Q0GFG2_DANRE/574-643-----------------------------------------------HLKQRLTTLECR---------------------
H0WC86_CAVPO/589-659-----------------------------------------------KLKQRLTKVEKF---------------------
F7HA92_CALJA/14-84-----------------------------------------------KLKQRFTKAEKY---------------------
H0ZCV5_TAEGU/517-587-----------------------------------------------KVKKRLTQIEKI---------------------
H3A9A8_LATCH/444-514-----------------------------------------------KLKQRVTKIEKK---------------------
F6SPJ8_ORNAN/520-590-----------------------------------------------KLKRRLAKVEES---------------------
H2MXQ7_ORYLA/551-621-----------------------------------------------KIKHRVTRLERK---------------------
E7FE78_DANRE/551-621-----------------------------------------------KLKKRVTKLEKK---------------------
G3Q1A1_GASAC/543-613-----------------------------------------------ALRRRIADLEHL---------------------
I3KB24_ORENI/561-631-----------------------------------------------TLKHRIIDLERF---------------------
B8JHY6_DANRE/569-639-----------------------------------------------SIRRRIIEIERF---------------------
E7F485_DANRE/629-699-----------------------------------------------RIKQRLTNMEAR---------------------
F8W5H0_DANRE/612-682-----------------------------------------------KIKQRITNMENK---------------------
H2N2B8_ORYLA/444-513-----------------------------------------------KLKQRLSNLSNQ---------------------
M4A5N4_XIPMA/513-582-----------------------------------------------KLNQRLANLSNE---------------------
H2SR83_TAKRU/514-583-----------------------------------------------KLKQRLSNLSNE---------------------
F6TBQ4_XENTR/639-709-----------------------------------------------KLKQRVTKLESQ---------------------
C3XXJ5_BRAFL/1611-1683-----------------------------------------------KLKKRLTKLEQG---------------------
E3LSL5_CAERE/609-676-----------------------------------------------KLMKRIEQLEKN---------------------
H3DY90_PRIPA/482-549-----------------------------------------------KLNTRIEILERE---------------------
E5SDC0_TRISP/249-316-----------------------------------------------RMNRRIAFLESK---------------------
H2YPA8_CIOSA/10-74-----------------------------------------------KLRSAIEDLEKA---------------------
D6WFN2_TRICA/193-264-----------------------------------------------KLKQRLTRLELS---------------------
H9ITJ7_BOMMO/375-446-----------------------------------------------EMKQRMNNIEVR---------------------
G6DLS9_DANPL/606-677-----------------------------------------------KLKQRLNKVELR---------------------
B4HSU3_DROSE/545-616-----------------------------------------------KIKQRLAKLEMN---------------------
Q7PW88_ANOGA/540-611-----------------------------------------------KLKQRISKLEDR---------------------
E0VED8_PEDHC/433-504-----------------------------------------------RMKRRASKIEQK---------------------
G4VGD7_SCHMA/543-614-----------------------------------------------KLKRRLTRLEQE---------------------
G7YKA2_CLOSI/489-560-----------------------------------------------KLKRRITQLEEY---------------------
K1QAP2_CRAGI/631-702-----------------------------------------------KLKQRITKLEKL---------------------
B7QLT8_IXOSC/384-455-----------------------------------------------KMKQRITKLEGN---------------------
E9FQW8_DAPPU/491-562-----------------------------------------------TMKQRLSRVEQH---------------------
H2ULR0_TAKRU/439-509-----------------------------------------------KMQVRVEQLEWE---------------------
G3NBT3_GASAC/462-532-----------------------------------------------KMQARVEQLEWE---------------------
I3KK99_ORENI/440-510-----------------------------------------------KMQARVAQLELE---------------------
H2M3C0_ORYLA/440-510-----------------------------------------------KMQARVERLEWE---------------------
M3ZGA2_XIPMA/438-508-----------------------------------------------KMRARVEQLEMR---------------------
F1QQP5_DANRE/414-483-----------------------------------------------KMMQRVDQLELQ---------------------
H3A5H8_LATCH/443-514-----------------------------------------------KLRYRIKLLEEE---------------------
G5BBR5_HETGA/464-535-----------------------------------------------KIAYRIERLEWQ---------------------
H9GHD3_ANOCA/465-536-----------------------------------------------KLTLRLERLEGG---------------------
F1N9W7_CHICK/371-442-----------------------------------------------KLALRIGSLESR---------------------
F6VIY1_XENTR/441-512-----------------------------------------------KMTQRIRQLEWE---------------------
I3KFU9_ORENI/585-652-----------------------------------------------RLKQRITALESN---------------------
H2SEP8_TAKRU/550-617-----------------------------------------------QLKQRITILENP---------------------
A8NMI1_BRUMA/571-638-----------------------------------------------KLLARIEYLETQ---------------------
F1LR88_RAT/519-589-----------------------------------------------KLKQRLSQLESQ---------------------
F7CHT3_MACMU/570-639-----------------------------------------------KLKQRITILETK---------------------
F7HCR1_MACMU/548-618-----------------------------------------------KMKQRLSQLESQ---------------------
G1KLY2_ANOCA/618-688-----------------------------------------------KVKQRLVKVETK---------------------
H3CYZ1_TETNG/446-516-----------------------------------------------VLKQRIADLERR---------------------
H3DJU6_TETNG/534-604-----------------------------------------------RIKQRVTQMEAK---------------------
U3INN8_ANAPL/574-644-----------------------------------------------KLKQRITVLESQ---------------------
W4XAC0_STRPU/472-545-----------------------------------------------KLKQRLTRLEKK---------------------

PF00261

TPM3_HUMAN/49-285LKNVTNNLKSLEAQAEKYSQKEDKYEEEI---KILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEE
Q294A9_DROPS/48-284LKVVGNSLKSLEVSEEKANQRVEEFKREM---KTLAIKLKEAEQRAEHAEKQVKRLQKEVDRLEDRLFNEKEKYKAICDD
Q17H78_AEDAE/17-253LRVVGNNLKSLEVSEEKAMASRDSVEDKI---HQLNDKLTNAEARAEFAERSVQKLQKEVDRLEEEVTKEKSKYKAIAAE
TPM1_DROME/102-338LRVVGNNLKSLEVSEEKANQREEEYKNQI---KTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDD
Q6NN28_DROME/48-284LRVVGNNLKSLEVSEEKANQREEEYKNQI---KTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDD
Q05705_CHICK/12-248LRTMDQSLKSLIASEEEYSTKEDKYEEEI---KLLGEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEE
TPM1_CIOIN/48-284LKIVANNLKSLEASAEKYAAKEGIFEEEI---KTLSDKLKDSETRAEFAEKSVVKLEKNIDELEDSLYAEKCKIKAISED
Q676A8_OIKDI/48-282LKAVANNLKSLEAAAEKYTTKEAQYIEEV---RSLEEKLKDAGERADHAEKSVTELESTIDELEDKLYAEKLKIKQTVED
A7SC63_NEMVE/12-247FTGTSEVLRDLEVKDAAASEREIDNEDKI---EFIQENLKQMVYRYEEAERKAPPLEMLLDQLVEDLELYRLKRKQVDEE
Q6S5G5_NEMVE/6-242VTLVGNNLRSLEISEGKASEREDTYENQI---RELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEE
TPM_CAEBR/20-256LRVVGNNLKSLEVSEEKALQREDSYEEQI---RTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELLLEKERVRNLTEE
A7RKG4_NEMVE/14-241LKVGGRSIQQLVISEEKYCDKEDEFRHRI---RLLKANLAATILRAEESERRCMRLERENDMVEEETRAYKKNYDMMQKE
A7S0B9_NEMVE/9-244MGNALTNIQKLEASGDEAYEREELKEEKL---KFFQEQLKQYEQRYEDAEREALKLERINDTIIIEIDSYKKKKEEILRE
B7ZNL3_MOUSE/50-284LKTVTNNLKSLEAQAEKYSQKEDKYEEEI---KVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQM
C3YBA4_BRAFL/48-283LKNVTNQLKSLEAAADKASEKEEAYEEQV---RDLSAKLKEAETRAEFAERTVAKLEKNVDDLEDELYAEKLKFKGISEE
E5SUX9_TRISP/48-284LRVVGNNLKSLEVSEEKALQREDSYEEQI---RLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEE
G4VN73_SCHMA/48-283LRIVGNNVKSLEISEQEAAQREEAYEENI---RDLTERLKAAEDRAQESERLVNTLQADADRLEDELVTEKEKYKALSEE
H2KV99_CLOSI/48-283LRVVGNNMKALEISEQESAQREESYEETI---RDLTERLKAAEQRAAEAERQVSKLQNEVDHLEDDLLAEKIRYKDLSGE
H3CKQ9_TETNG/12-249LKTIIATSRSLEAQVEKYSVKEDKYELAI---RNLTDKLKEAENRAEAAERTLSTCERTISSLEDALGEAREENTKITAT
I3J233_ORENI/12-247LKNVTNNLKSLEAQSEKYSEKEDKYEEEI---KVLTDKLKEAETRAEFAERTVAKLEKSIDDLEEKLSHAKEENLGMHQV
U6I146_ECHMU/49-283LRIVGNNMKSLEVSEQESLQREESYEETI---RDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGE

PF12718

A1CDA8_ASPCL/16-158----------------------------L...RETNEKLRQTDVKAGHYERKVQALEASRDQWESKYEEMAKKYAELQK-
A3LSG6_PICST/7-149----------------------------L...KETTEKLRETDIKAEQLERKVASLEQEKEEWERKYEELTEQHLAAKS-
A6R7T4_AJECN/7-149----------------------------L...RETNEKLRQTDVKAGHYERKVQALETSRDQWEAKYEQMSKKYEDLQK-
A7TEE8_VANPO/7-149----------------------------L...KETIEKLRESDLKSETLERKVNALEDERNDWEKKYEDLSVQYETAKK-
A8PRF4_MALGO/7-149----------------------------L...KETTEQLRHTDVRAEQLERQIQGAEQERDQWEHKYEEAQERYQASKR-
B0CUA0_LACBS/10-152----------------------------V...KETVERLRQVDVKAEHFERQVQRLEQERDLWEKKYEESEAKYKKSQA-
B2B5X9_PODAN/7-149----------------------------L...REANEKLRQTDVKAGHFERKVQALEQERDQWESKYEEMAKKYATVQK-
B2VZI7_PYRTR/7-149----------------------------I...RELNEKLRQTDVKSGHYERKVQALEQSRDQWETKYEEMAKKYADTKK-
B4UN77_KLULA/7-149----------------------------L...KETTEKLREADLKVEQLERKVTSLEQERDDLEKKYDDLQTKYDAAKA-
B6HMN3_PENCW/7-149----------------------------L...RETNEKLRQTDIKAGHYERKVQALEDQHAKLEQRYEDAIKEHSAVKK-
B6K811_SCHJY/7-148----------------------------L...RETTEKLRQIDINTEHTERKIQALEHERDDLEVRLEDTTDKYNKVK.-
C3ZKT3_BRAFL/7-153----------------------------L...NSTVEKLTDSEKAADESERARKVLENRGAADEDRMELLDMQLREAKM-
C4R6W6_PICPG/7-149----------------------------L...KETTEKLRDTDIKAEALEKKVTSLENEREEWERKFEELQEKYNATRE-
C5DMG5_LACTC/7-149----------------------------L...KETTDKLRETDLKAEGLERKVVSLEQERDDWEKKYEELTAKYDEAKK-
C5DUA1_ZYGRC/7-149----------------------------L...KETTEKLRETDLKAEQLERKVVALEEERDEWERKHEELTSKYEEAKK-
C5FYF1_ARTOC/7-149----------------------------L...RETNEKLRQTDVKAGHFERKVQALEATREQWETKYEEMSKQYAAVKE-
E7QFZ0_YEASZ/7-149----------------------------L...KEAMDKLKEADLNSEQMGRRIVALEEERDEWEKKCEEFQSKYEEAQK-
E9Q454_MOUSE/7-152----------------------------L...ATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAK.-
G4VD36_SCHMA/7-152----------------------------L...TETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAK.-
J0DYI5_LOALO/7-152----------------------------L...KIATDKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQ.-
J8LIP8_SACAR/7-151----------------------------LAESKQLSEDSHHLQSNNDNYTKKNQQLEEDLEESDTKLKETTEKLRESD.-
Q17H75_AEDAE/7-153----------------------------L...ASATAKLSEASAAADESERARKVLENRALADEERMDALENQLKEARF-
Q4P5V6_USTMA/7-149----------------------------L...RETTDKLRQVDVKAEHFERQVATLEREVATWEKKYEAAEERYRASKA-
Q5KF76_CRYNJ/10-149----------------------------L...KETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSKR-
Q6C081_YARLI/7-149----------------------------L...RETTEKLRQTDVKAEHFERKVTSLEQERDDWEKKHEELLEKYNAAKK-
Q6FKV5_CANGA/7-149----------------------------L...KETSDRLKEIELNSETLERKTAALQEERDEWEKKYEEVAAKYEDAKK-
Q6FPA3_CANGA/7-152----------------------------LSELKQTSEESTTLRSNNENFTKKNQQLEEELEESDAKLKETTEKLRESDL-
Q755U4_ASHGO/7-149----------------------------L...KETLELLRETDLKSEQLERKVASLENEVQDWESKYEELQTKYSSAKG-

PF16526

H9GQC1_ANOCA/497-572--------------------------------------------------------------------------------
F6Z6F8_ORNAN/494-563--------------------------------------------------------------------------------
F6XLL2_XENTR/582-652--------------------------------------------------------------------------------
H3B226_LATCH/649-719--------------------------------------------------------------------------------
H2LZM8_ORYLA/617-687--------------------------------------------------------------------------------
Q0GFG2_DANRE/574-643--------------------------------------------------------------------------------
H0WC86_CAVPO/589-659--------------------------------------------------------------------------------
F7HA92_CALJA/14-84--------------------------------------------------------------------------------
H0ZCV5_TAEGU/517-587--------------------------------------------------------------------------------
H3A9A8_LATCH/444-514--------------------------------------------------------------------------------
F6SPJ8_ORNAN/520-590--------------------------------------------------------------------------------
H2MXQ7_ORYLA/551-621--------------------------------------------------------------------------------
E7FE78_DANRE/551-621--------------------------------------------------------------------------------
G3Q1A1_GASAC/543-613--------------------------------------------------------------------------------
I3KB24_ORENI/561-631--------------------------------------------------------------------------------
B8JHY6_DANRE/569-639--------------------------------------------------------------------------------
E7F485_DANRE/629-699--------------------------------------------------------------------------------
F8W5H0_DANRE/612-682--------------------------------------------------------------------------------
H2N2B8_ORYLA/444-513--------------------------------------------------------------------------------
M4A5N4_XIPMA/513-582--------------------------------------------------------------------------------
H2SR83_TAKRU/514-583--------------------------------------------------------------------------------
F6TBQ4_XENTR/639-709--------------------------------------------------------------------------------
C3XXJ5_BRAFL/1611-1683--------------------------------------------------------------------------------
E3LSL5_CAERE/609-676--------------------------------------------------------------------------------
H3DY90_PRIPA/482-549--------------------------------------------------------------------------------
E5SDC0_TRISP/249-316--------------------------------------------------------------------------------
H2YPA8_CIOSA/10-74--------------------------------------------------------------------------------
D6WFN2_TRICA/193-264--------------------------------------------------------------------------------
H9ITJ7_BOMMO/375-446--------------------------------------------------------------------------------
G6DLS9_DANPL/606-677--------------------------------------------------------------------------------
B4HSU3_DROSE/545-616--------------------------------------------------------------------------------
Q7PW88_ANOGA/540-611--------------------------------------------------------------------------------
E0VED8_PEDHC/433-504--------------------------------------------------------------------------------
G4VGD7_SCHMA/543-614--------------------------------------------------------------------------------
G7YKA2_CLOSI/489-560--------------------------------------------------------------------------------
K1QAP2_CRAGI/631-702--------------------------------------------------------------------------------
B7QLT8_IXOSC/384-455--------------------------------------------------------------------------------
E9FQW8_DAPPU/491-562--------------------------------------------------------------------------------
H2ULR0_TAKRU/439-509--------------------------------------------------------------------------------
G3NBT3_GASAC/462-532--------------------------------------------------------------------------------
I3KK99_ORENI/440-510--------------------------------------------------------------------------------
H2M3C0_ORYLA/440-510--------------------------------------------------------------------------------
M3ZGA2_XIPMA/438-508--------------------------------------------------------------------------------
F1QQP5_DANRE/414-483--------------------------------------------------------------------------------
H3A5H8_LATCH/443-514--------------------------------------------------------------------------------
G5BBR5_HETGA/464-535--------------------------------------------------------------------------------
H9GHD3_ANOCA/465-536--------------------------------------------------------------------------------
F1N9W7_CHICK/371-442--------------------------------------------------------------------------------
F6VIY1_XENTR/441-512--------------------------------------------------------------------------------
I3KFU9_ORENI/585-652--------------------------------------------------------------------------------
H2SEP8_TAKRU/550-617--------------------------------------------------------------------------------
A8NMI1_BRUMA/571-638--------------------------------------------------------------------------------
F1LR88_RAT/519-589--------------------------------------------------------------------------------
F7CHT3_MACMU/570-639--------------------------------------------------------------------------------
F7HCR1_MACMU/548-618--------------------------------------------------------------------------------
G1KLY2_ANOCA/618-688--------------------------------------------------------------------------------
H3CYZ1_TETNG/446-516--------------------------------------------------------------------------------
H3DJU6_TETNG/534-604--------------------------------------------------------------------------------
U3INN8_ANAPL/574-644--------------------------------------------------------------------------------
W4XAC0_STRPU/472-545--------------------------------------------------------------------------------

PF00261

TPM3_HUMAN/49-285LDHALNDMTSI
Q294A9_DROPS/48-284LDQTFAELTGY
Q17H78_AEDAE/17-253LDLTFADLSGY
TPM1_DROME/102-338LDTAFVELILK
Q6NN28_DROME/48-284LDTAFVELILK
Q05705_CHICK/12-248LDNALNDITSL
TPM1_CIOIN/48-284MDVTLQGIGDL
Q676A8_OIKDI/48-282MDNTIH..ASA
A7SC63_NEMVE/12-247M.KAMGELVEQ
Q6S5G5_NEMVE/6-242LDSTLAELSEM
TPM_CAEBR/20-256IEQTVQEIQGS
A7RKG4_NEMVE/14-241LHDTLNDIEC.
A7S0B9_NEMVE/9-244MDLELVDLNR.
B7ZNL3_MOUSE/50-284LDQTLLELNNM
C3YBA4_BRAFL/48-283LDHTLNDLST.
E5SUX9_TRISP/48-284LDQTFQELSGY
G4VN73_SCHMA/48-283LDSTFAELTG.
H2KV99_CLOSI/48-283LDQTFAELTGY
H3CKQ9_TETNG/12-249LDQTLHDLN..
I3J233_ORENI/12-247LDQTLQELNS.
U6I146_ECHMU/49-283LDTTFAELTS.

PF12718

A1CDA8_ASPCL/16-158-----------
A3LSG6_PICST/7-149-----------
A6R7T4_AJECN/7-149-----------
A7TEE8_VANPO/7-149-----------
A8PRF4_MALGO/7-149-----------
B0CUA0_LACBS/10-152-----------
B2B5X9_PODAN/7-149-----------
B2VZI7_PYRTR/7-149-----------
B4UN77_KLULA/7-149-----------
B6HMN3_PENCW/7-149-----------
B6K811_SCHJY/7-148-----------
C3ZKT3_BRAFL/7-153-----------
C4R6W6_PICPG/7-149-----------
C5DMG5_LACTC/7-149-----------
C5DUA1_ZYGRC/7-149-----------
C5FYF1_ARTOC/7-149-----------
E7QFZ0_YEASZ/7-149-----------
E9Q454_MOUSE/7-152-----------
G4VD36_SCHMA/7-152-----------
J0DYI5_LOALO/7-152-----------
J8LIP8_SACAR/7-151-----------
Q17H75_AEDAE/7-153-----------
Q4P5V6_USTMA/7-149-----------
Q5KF76_CRYNJ/10-149-----------
Q6C081_YARLI/7-149-----------
Q6FKV5_CANGA/7-149-----------
Q6FPA3_CANGA/7-152-----------
Q755U4_ASHGO/7-149-----------

PF16526

H9GQC1_ANOCA/497-572-----------
F6Z6F8_ORNAN/494-563-----------
F6XLL2_XENTR/582-652-----------
H3B226_LATCH/649-719-----------
H2LZM8_ORYLA/617-687-----------
Q0GFG2_DANRE/574-643-----------
H0WC86_CAVPO/589-659-----------
F7HA92_CALJA/14-84-----------
H0ZCV5_TAEGU/517-587-----------
H3A9A8_LATCH/444-514-----------
F6SPJ8_ORNAN/520-590-----------
H2MXQ7_ORYLA/551-621-----------
E7FE78_DANRE/551-621-----------
G3Q1A1_GASAC/543-613-----------
I3KB24_ORENI/561-631-----------
B8JHY6_DANRE/569-639-----------
E7F485_DANRE/629-699-----------
F8W5H0_DANRE/612-682-----------
H2N2B8_ORYLA/444-513-----------
M4A5N4_XIPMA/513-582-----------
H2SR83_TAKRU/514-583-----------
F6TBQ4_XENTR/639-709-----------
C3XXJ5_BRAFL/1611-1683-----------
E3LSL5_CAERE/609-676-----------
H3DY90_PRIPA/482-549-----------
E5SDC0_TRISP/249-316-----------
H2YPA8_CIOSA/10-74-----------
D6WFN2_TRICA/193-264-----------
H9ITJ7_BOMMO/375-446-----------
G6DLS9_DANPL/606-677-----------
B4HSU3_DROSE/545-616-----------
Q7PW88_ANOGA/540-611-----------
E0VED8_PEDHC/433-504-----------
G4VGD7_SCHMA/543-614-----------
G7YKA2_CLOSI/489-560-----------
K1QAP2_CRAGI/631-702-----------
B7QLT8_IXOSC/384-455-----------
E9FQW8_DAPPU/491-562-----------
H2ULR0_TAKRU/439-509-----------
G3NBT3_GASAC/462-532-----------
I3KK99_ORENI/440-510-----------
H2M3C0_ORYLA/440-510-----------
M3ZGA2_XIPMA/438-508-----------
F1QQP5_DANRE/414-483-----------
H3A5H8_LATCH/443-514-----------
G5BBR5_HETGA/464-535-----------
H9GHD3_ANOCA/465-536-----------
F1N9W7_CHICK/371-442-----------
F6VIY1_XENTR/441-512-----------
I3KFU9_ORENI/585-652-----------
H2SEP8_TAKRU/550-617-----------
A8NMI1_BRUMA/571-638-----------
F1LR88_RAT/519-589-----------
F7CHT3_MACMU/570-639-----------
F7HCR1_MACMU/548-618-----------
G1KLY2_ANOCA/618-688-----------
H3CYZ1_TETNG/446-516-----------
H3DJU6_TETNG/534-604-----------
U3INN8_ANAPL/574-644-----------
W4XAC0_STRPU/472-545-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window