Sequence alignment for CL0453

PF12811

C7NEU4_KYTSD/18-275QPRYGQY........ADFNTAGQAGAQYQQHAQLEQAYQAPSMDTGRTGR..............................
F4EZD3_SELS3/14-236DAVFSGE........A................................................................
R5G4T6_9FIRM/7-239NYVFKKI........LNDDQISE.NYES....................................................
B1GZ32_UNCTG/3-236NPLLKDS........VFQSTESYSEV......................................................
D7WE18_9CORY/5-299NPVM.AR........L.......PQSAQQAG.FGQPQGGHG.......YNPQG.GSYGY....DQQGG.YQDPYGASQN.
C6WKQ5_ACTMD/6-268NPAF.RN........L.......PQG.....GG...HAGFGQQQYGQAQPY.GQQYGG......GYPQ.QQAS.......
K4QW36_9ACTN/5-282NPIFSRW........S.AARGAGPAGTY.......QREPVRATVGA............Q....P........TDD.YP.T
M4NLN8_9GAMM/5-249NPALNKN........TFLDASSGAVFTRGDEA................................................
F8A7A7_CELGA/3-266NPVFSNS........PVFGERTRGGGTLV..................................APSTIDAASLDRMYG..
V6JXB5_STRNV/5-292NPVFSRR........G.FSRDNGQAGFNA......APQAGGPAVGT...........QN....PYA......TNP.YA.T
U5Q5X0_9BACT/3-248NPVLSEK........IFKTNQATSASTGT...................................................
D1A7P0_THECD/5-261NPAFRRV........S................................FGQHMGQGH.A....PSPQL.LHEMYNRPAY.
D2PP90_KRIFD/5-279NPVLNRS........SAFAPGQGQAYPGAAPYGQPGPYGQPGQQGYGGPGMPPQQYQGA.....................
J9SCB5_9ACTN/32-313NPVM.RG........V.................VRDNQS.G.......Y........AG....FGAGM...AGAGAAAN.
Q6NI55_CORDI/5-275NPVL.NS........L.......T....GTR...QNYAQAG.......YQQQA.................FNP.M...S.
A9NEU4_ACHLI/5-242NPVFTNL........EKQAFTDNLEV......................................................
R5EEE2_9GAMM/5-247NPAISVI........RKNAGVYNFGGTEAG..................................................
A5WFW8_PSYWF/5-242NPIVSRT........ELAVGGKT.........................................................
R7XUD5_9ACTN/14-304NPVFARS........EEFNGRANAYGNQTYAGGGQPYPGYGQAPSAPEYGDPSAYGTGTPGQVDQGR.............
K0FCH0_9NOCA/6-286NPVF.RN........L.................PRQEGG.G.......Y........AN....FGSGV...AGAGQMGQQ
D8UI29_VOLCA/59-300NPAFTFG........KVDDAIAESGRGGPP..................................................
W8KJ18_HALHR/28-265SVAVNRQ........REA..............................................................
Q0S4B9_RHOJR/28-305NPVF.RN........L.................PKQEGSGG.......Y........AS....FGSTT...AGAAQVTQ.
D6YTM1_WADCW/5-246NPTLQPE........TFRRSGVAAQGEE....................................................
C4L1D1_EXISA/6-242NPLLRKS........MQSTAYSAEP.......................................................
F1TJZ5_RHOHA/9-283NPVF.KN........L.................PKQEGT.G.......Y........AT....FGSAQ...AGGAQVAQ.
Q6LYY5_METMP/5-242NPTLSSD........TFTGFNTYEQNQQ....................................................
B2KC47_ELUMP/5-240NPIFNEE........GFKKAAEMQAAS.....TQP.............................................
F4F5D9_VERMA/5-290NPVL.AR........L........................GQAAERERAAGYA..PTG......PYGQ.PGYPQQYPQAG
F5YTZ5_MYCSD/6-286NPVF.RS........L.................PK..QG.G.......Y........AQ....FGTGV.GQATAG...A.
Q9KZ65_STRCO/5-305NPVFSRR........G.FSRDNGYAGFNA......APQAGGPAVAT.QANPYAQGAQGN....PYA.Q.PPAGNP.YA.Q
E1VTL5_ARTAR/3-266NPIFGSS........SRSDAWGTKPGSPVGFR...............................DTANMSADQLQQMYQ..
F8E0H2_CORRG/12-305NPFM.GS........L.......AKNTSQHP.FAQQ.............GQQGQRGFDP......NNP.YATS.AYGAT.
M1P5T4_9CORY/5-275NPVM.NS........L.......SGAKGGAQ...RGAYQAG.......YPQQG................YQDP.......
F6GI76_LACS5/9-242NPIFSNY........FWNDRKTANAK......................................................
C9YY45_STRSW/5-291NPVFSRR........G.FSRDNGYAGFNT......APQAGGAAVGT..........QGS....PYA...QQGGNP.YA.T
G8TNU9_NIAKG/8-251NPVLNEK........TFSGSYTYLDSDAEV..................................................
A6W6X9_KINRD/11-281NPVFARS........QEWKGNGYASFDAPSSAQRQAAPADASARTLQDWYQKPSATPAQSRR..................
D7BXA1_STRBB/5-298NPVFSRR........G.FSRDGGYAGFGA......APQAGGPAAVQ...........GN....PYAGG.NPHAQT.QAPT
D6Z909_SEGRD/6-274NPVF.RS........L.......SR........PGAQAG.A.......Y...............................
D5UKL3_CELFN/3-271NPVFNNS........PVFGDPRGKGRGGPATTQAPAW..........................GTATTDAATLEQMYD..
E3EBZ5_PAEPS/5-244NPVLRDD........IFLREDEREASEQR...................................................
I4A1A9_ORNRL/7-250NPVLQTK........AFDMTRTTDLGGI....................................................
F5XTM3_MICPN/6-278NPILSKQ........DAFTPAAPQYGQQQYGQNPYAQTDPYAQQPGYAPYGQPPVSAEPR....................
X5DKM9_9CORY/5-292NPFM.SS........L.......TKAEGAQQ...GQRGPSA.......AYQQG................YQSA.G...E.
H6RSJ3_BLASD/5-276NPAFSRG........F...GNAGP..GQ.QSAGWGNAP..........Q..YGTPQYGA....PA....PQQD.......
A5FKK6_FLAJ1/12-255NKRFSSN........AVSRAEEVHEAKIIDYNQE..............................................
Q47SU4_THEFY/8-319NPVIKRA..........LASAPGGAGYYAQPGY.GQPYASQGYGQPYAQPGYGQPGYGQ....PGYGQ.PGYGQP.YP.P
F4GYG7_CELFA/3-268NPVFSNS........PVFGDPNDRRARARAQAGGA............................ATATVDAATLDRMYE..
D6ZKK1_MOBCV/18-273APQVSYA........PERPQQFPTPQGQEQYGTTSASRP.........................................
E8NDS9_MICTS/10-292TPAFQDP........RAGAQTRYSPPAAPAAG...............................AAAAAEAANLEGMYT..
Q8XKZ0_CLOPE/6-239NPALAAG........FEKAVSDGTT.......................................................
F6FSN3_ISOV2/3-284NPVFSNS........DVFGEPRRTA......RGGGAATAPS.PYGQPQYGQY....GTA....GAQAADAASLENMYN..
M4ZW38_9ACTN/48-277NKEV............................................................................
D3EHX0_GEOS4/7-244NPTLNEE........TFEKSGYYNNQET....................................................
Q11SC4_CYTH3/5-241NPALNES........TFDTYAVAGEER.....................................................
A0R2Y3_MYCS2/6-277NPVF.RS........L.................PKT.QG.G.......Y........AT....FGTGA...AGYG...A.
C2WZP8_BACCE/5-241NPMLKKE........AFRKEGASASA......................................................
C5C0C8_BEUC1/28-297YPGAAGQ........QGYPGVPQAGQSAAGA................................TGTMAPAYDLEQAYN..
D9TB20_MICAI/19-252RQVLGVG........TADT.............................................................
H2JL64_STRHJ/50-293ND...............WERA...........................................................
U3GYX0_9CORY/5-290NPVF.KD........L.......TANGGAPQ...QYGNPYG.......NPYGAGAGFGQ...........QNP.......
R6SY18_9FIRM/13-260NPRVKKL........RSFAQSTY.GMEA....................................................
Q4JU62_CORJK/5-300NPFM.GS........L.......AKNQGQHP.FAQQGNQGG.......YGQQG..GYGQ....QGMNP.YATS.AHGGV.
F8JW88_STREN/75-299GPALT...........................................................................
F8AVU2_FRADG/8-276NPVF.SR........R...GFAGRSTPSSGYYGPGAPGG...........YAPPGGGAP....P.TPT.PEQL.......
R4T3W7_AMYOR/6-277NPAF.RN........L.......PRGA....AQYGPNVGFN.......QPQ.....GGV....PGYGP.PQTS.......
D9TB19_MICAI/5-283NPVL.AR........L........................GQAAERERAAGYA..QPG......PYGQ.PGYPQQYPQQQ
D6Y882_THEBD/39-278APPYGAE........P................................YGAHP....................YGAQPY.
I0GZ05_ACTM4/5-279NPVLSRL.................................GQAAERERAAGYGQAPGQPGYGQPGYGQ.PAYGEP.....
G0HFP4_CORVD/5-290NPYM.SS........L.......TKATAESQRAQAMAHQGG.......YSQPG...........................
F6EQM2_AMYSD/6-278NPVF.KN........L.................PKGPG..G.......Y........AT....FGSGA...AGASQAAY.
A4F854_SACEN/6-264NPAF.KN........L.......PTT........GGYANFN...HGQGQGGYGTPFGQA....PA.AP.PQTA.......
K7RRB1_PROA4/23-286GQQFAAQ........GGYYQPGYGQPQPAPAGYGPQGFQQPEQARQERV...............................
R7J8A1_9FUSO/3-241NPILNEN........RFSSQERILDGEP....................................................
B1MKI6_MYCA9/6-280NPIL.RT........L.................PGKEGG.G.......Y........AQ....FGAGA...AGAGAMAA.
D7GFC1_PROFC/5-270NPVLTRP........DAFVPAGQAGQQYVDAAYQEASYPPGGYPGPSRPAAR............................
E3H5K2_ROTDC/58-316QPQPNQY........AQYEQPYAQPQQANYDQYQQAQYDPYAQPGYA.................................
V5XGM6_MYCNE/6-283NPVF.RS........L.................PKGQQG.G.......Y........AQ....FGTGA...ASFG...A.
E2SBJ7_9ACTN/5-279NPVFARS........DGFNGRGGAPTTTTSNDPSQWRIDLDAQPGASLGGGTSTGR........................
F8KWJ3_PARAV/5-245NPTLQDN........TFRSERYYSIDEQ....................................................
H5XAT9_9PSEU/6-270NPAF.RN........L.......PTA.....AARAPYAGFN.......QPH.....GGV....PGYGA.PQTA.......
A1SF75_NOCSJ/5-293NPVFRRS........EEFHASGSNAYGNQTYAGNGSAYQGYGQTGYTDPATWGTGTPGQPGVSQPGTAIDRGP.......
E4NG71_KITSK/6-291NPVFSRE........GSFTRDNQYAGFGTQ....TAAQPGQGAYG............................NP.YAGT
E8R4F5_ISOPI/10-246GDLFQNA........AVGGYEGVAAST.....................................................
W5W111_9PSEU/6-255NPAF.RN........L.......PGGGQ......GGYAGFG.......QQQ......TA....PGYPA.PPTA.......
Q9CB64_MYCLE/6-284NPVF.RS........L.................PKQ.RG.G.......Y........AR....FGTDA...APMQ...Q.
A9WUA8_RENSM/12-288NKNFSNK........PPVPQAPQGYAQQGYGQPGFGQTGYAS.....................PPPVCTPEQLQGMYN..
H2JJR6_STRHJ/5-286NPVFSRW........G.AARDAAPADAH.......TRHPVGATAGG............R....P........ADD.YP.T
L0HDS4_METFS/6-241NPALRDE........LFGPGEDRAGAKP....................................................
B1V9N1_PHYAS/18-261DNFLSSS........DTTDYKLK.........................................................
B1YES9_EXIS2/8-243NPALRRG........FETARAGERP.......................................................
D7BKM9_ARCHD/9-266NPYFTGQ........TQRPNQFNQAAYGQPEMTSQPSYSTFDAKPADGR...............................
L0D6N3_SINAD/5-254NPAFSKE........TFAGFEQVYGANRAAA.................................................
W5XU43_9CORY/5-268NPVM.NS........L.......SNSSS............................................P.......
C5C991_MICLC/36-290SPYGQQQ........SPYGQAQAFGAGQA..................................AQQHAHQQSMEDAFR..
Q6AD52_LEIXX/5-268NPAFSNN........PAFSTNGTAAATA...................................TAGGANAENLEQLYQ..
E6SCQ6_INTC7/5-292NPVFDRI........DKQLQRERYAGFGTPQRGQQGPTGPTQAATTGYAVQDTGTADQLNDLYARQAAGPVDTGR.....
R5L7T8_9SPIR/3-242NPALSNK........AFDYAIKNSNEDT....................................................
C1F3Q6_ACIC5/5-243NPALNER........VFRGQPMAFGET.....................................................
D7B6X7_NOCDD/7-306NPVLKRA..........LQQAGPAGH..AQQGFNGQP....GYGYGQQQGPYGQPGYGQ....P.YPQ.QGYGQP.YP.Q
Q6F806_ACIAD/5-242NPILTRV........ETYSDFNQS........................................................
W5Y0J1_9CORY/5-268NPVL.SS........L.......T....DSR...RN....A.......YRGAA.................QDP.......
C8XKQ4_NAKMY/6-258NPAF.RN........MEKVIGSQQQA......................................................
Q6AAB4_PROAC/3-276NPVFSRA........EAFQPRGNPYGQPAYAGQGYRAQYGVSGQPGGESGSLLDGPQGQSAERA................
G8SIP5_ACTS5/5-282NPVL.SR........L........................GQAAERERTAGYG..PAGH....AGYGQ.PGYGYGQPGYG
D5UV23_TSUPD/6-297NPIL.RG........M.......TRGNQQPAGVPQQGYPQG.......YNQQGFNQAAG....FGMGA...AGAAQGM..
D5VB45_MORCR/3-239NPIISRT........TLATSAVA.........................................................
C0R118_BRAHW/3-242NPVLSNK........AFNYASSYENDNT....................................................
F8EFI0_RUNSL/3-242NPTLSEK........TFIKSAQEGIGQGK...................................................
C3PFB1_CORA7/5-266NPVM.SS........L.......SSSQSQTQ.......................................VNP.......
B2HT80_MYCMM/6-279NPVF.RS........L.................PKQ.RG.G.......Y........AQ....FGTGA...G........
I2EWG6_EMTOG/3-238NPAFSEK........TFTNIDYSFDRQEV...................................................
X4QYH9_9ACTO/9-284NPYFSST........QQRPNQFGAQRTEYGYGDQYAPDNYGYQTESEQVWDDNDGAFVT....ER...............
L0J173_MYCSM/6-280NPVF.RS........L.................PKT.QG.G.......Y........AQ....FGTGA...AGYG...T.
C7QZY5_JONDD/3-275NPYFSNS........AVFGGKADKDVQRTNAQMDPRFAATTSA....................QYGATDAASLDSMYN..
D5SQ37_PLAL2/5-247NPVLNES........AFDRWAHEGGLSSSSV.................................................
W5TW08_9NOCA/6-283NPIF.KN........L.................PKQQGG.G.......Y........AG....FGSAA...AGAGQFA..
J7L8F6_NOCAA/7-307NPVLKRA..........LQQ...QSG..ARQGY.GQP....GHG...PQG.YGQPGYGQ....P.YPQ.QGYGQPGYP.Q
B3R032_PHYMT/12-261NSVNTKK........SISISKNN.........................................................
A8L155_FRASN/44-265TPVHDR..........................................................................
G0FRN5_AMYMS/6-277NPAF.RN........L.......PGGGTQTYGQYGPPVGFN.......QPQ.....GGV....PGYDP.GRAT.......
A8J2B1_CHLRE/71-312NPAFTFG........KVEEAVGESYGRSGPP.................................................
A0JU33_ARTS2/31-306NPYGQAQ........YGQNPYGQAPGRAPGQVMDAQGGWMA......................QQQNMTHDQLQQMYN..
C4LHM7_CORK4/5-292NPYF.SS........L.......TEERKREARSSQGEYVFG.......QGQDA.................QQFGQRGAS.
R6P635_9CLOT/22-243AP..............................................................................
F4CVB9_PSEUX/6-269NPAF.RN........L.......PQQ........GGYADFD.......RQA.......G....AFGAG.AAAA.......
C7M9W4_BRAFD/40-305SSGFAPQ........GHAPTATGQPGAEQLEAMYARPSATGHDT....................................
E3ITH9_FRASU/8-268NPVF.TH........L...R.............SGPPASDQ.......LTWPPSAQGTP....PGTPT.PEEL.......
I6XVQ8_PROPF/3-275NPVFSRS........SAFNQPSAYQQPYGYQQQGYGYQQQGYGYQQQPGYMQPQPQTTAGV...................
Q8NRR2_CORGL/5-271NPVF.SS........L.......K....ETQ...RP...............QG.................QNP.......
I0II89_PHYMF/20-264RPGGIRE........EAEAQPDA.........................................................
Q4FRP4_PSYA2/3-240NPIVSRA........ELAVGGAP.........................................................
I0GPK4_SELRL/3-236NPMLSKV........EDLSRGQYISEA.....................................................
I5B600_9DELT/19-256KPIPLGT........AER..............................................................
X5DVG1_9BACT/9-254NPVLKEK........AFSRDYTIQSDV.....................................................
D2B2I8_STRRD/5-259NPVFSRQ........S................................SGNQQAWGAPT....PTPDQ.LQGMYDRPAY.
D2NP91_ROTMD/12-332NPLLNSMTKNVTQGDSRFGRFGAQPQQTSQQAQYGQQAQYGQQQTYGQYGQQYDQQGYGQNTYGQQPYGQQYGQPQYGQQ
G4SY51_META2/29-260QPVFR...........................................................................
C7PNV4_CHIPD/9-246NPILSDK........TLQKAGSQSTEGT....................................................
I4ESR8_MODMB/7-273NPAFSRG........F.......PGAGQTQSGGWGAGP..........QQTYG....GA....PT.....QYD.......
D7DQS6_METV3/5-250NPVFGNQ........VMERYRQLAGSTSSMPITEQ.............................................

PF01027

B6KHI7_TOXGO/120-329FAFVRKV-------------------------------------------------------------------------
A8N382_COPC7/125-339REYLNSS-------------------------------------------------------------------------
A0CUW2_PARTE/56-286LFFI.KV-------------------------------------------------------------------------
A0DUN3_PARTE/28-241LSFIRKV-------------------------------------------------------------------------
A0LGQ6_SYNFM/17-228SDFVRRV-------------------------------------------------------------------------
A0RRR6_CAMFF/25-219ATFVKQT-------------------------------------------------------------------------
A1A283_BIFAA/75-289HASVTRA-------------------------------------------------------------------------
A1AQX9_PELPD/20-227NTLVRQV-------------------------------------------------------------------------
A1AX37_RUTMC/15-212NSILKNT-------------------------------------------------------------------------
A1B1U7_PARDP/24-252RAYMNKV-------------------------------------------------------------------------
A1S6I1_SHEAM/16-212NKLIKNT-------------------------------------------------------------------------
A1SWS6_PSYIN/18-214NKVLRNT-------------------------------------------------------------------------
A1TSD8_ACIAC/21-222QRVLRNT-------------------------------------------------------------------------
A1WWU6_HALHL/25-221NRLIRNT-------------------------------------------------------------------------
A2SF80_METPP/20-223NRVLRNT-------------------------------------------------------------------------
A2SGJ7_METPP/35-231SRVLRNT-------------------------------------------------------------------------
A3LXU5_PICST/45-247QLFIRKV-------------------------------------------------------------------------
E0TG86_PARBH/24-234RRYMLGV-------------------------------------------------------------------------
A4G4J7_HERAR/19-221HRVLRNT-------------------------------------------------------------------------
A4I0V7_LEIIN/109-308RQHLARV-------------------------------------------------------------------------
A4VX37_STRSY/17-227NRFFGKI-------------------------------------------------------------------------
A5CDM3_ORITB/21-240RAYMLRI-------------------------------------------------------------------------
A5DPA1_PICGU/50-252QMFIRKV-------------------------------------------------------------------------
A5E0Y3_LODEL/45-246QLFIRKV-------------------------------------------------------------------------
A5EVN6_DICNV/21-215NKVLRQT-------------------------------------------------------------------------
A5FVN6_ACICJ/27-251RAYMLRV-------------------------------------------------------------------------
A5GUQ5_SYNR3/22-233PNVVNKA-------------------------------------------------------------------------
A5K3F8_PLAVS/30-237RKHLIKI-------------------------------------------------------------------------
A5V4K0_SPHWW/30-238RSYMLSI-------------------------------------------------------------------------
A5VGS7_SPHWW/27-236RNHMIGI-------------------------------------------------------------------------
A6Q632_NITSB/34-232ATFIKKT-------------------------------------------------------------------------
A6Q691_SULNB/22-221VSFMKKT-------------------------------------------------------------------------
A6QA51_SULNB/16-228NVLLNSV-------------------------------------------------------------------------
A6VN26_ACTSZ/21-216HKVLRNT-------------------------------------------------------------------------
A6W0C3_MARMS/16-212NKTLRNT-------------------------------------------------------------------------
A7AX64_BABBO/30-235KKHLTLV-------------------------------------------------------------------------
A7EDC6_SCLS1/72-273MQFVRKV-------------------------------------------------------------------------
A7HSY2_PARL1/27-247RSYMLRV-------------------------------------------------------------------------
A7I0C4_CAMHC/30-228SSLIKQT-------------------------------------------------------------------------
A7RRN6_NEMVE/26-227RHHLKNV-------------------------------------------------------------------------
A7SUK2_NEMVE/41-257RDRIHAT-------------------------------------------------------------------------
A8AVN1_STRGC/14-224NTFYAKI-------------------------------------------------------------------------
A8EX08_ARCB4/24-224MSFLKAT-------------------------------------------------------------------------
A8HUL0_AZOC5/27-255RAYMLRV-------------------------------------------------------------------------
A8JCT0_CHLRE/35-234QAYLQRV-------------------------------------------------------------------------
A8LJ17_DINSH/24-236RAHFNKV-------------------------------------------------------------------------
A8LT34_DINSH/23-238RKYLTGV-------------------------------------------------------------------------
A8PJB5_BRUMA/34-232QKHLQAV-------------------------------------------------------------------------
A8PUB6_MALGO/132-346SNYLNST-------------------------------------------------------------------------
A9A0M8_DESOH/17-230NTFIRSV-------------------------------------------------------------------------
A9CHH9_AGRFC/27-255RAYMLKV-------------------------------------------------------------------------
A9PF37_POPTR/39-243WGLIRKV-------------------------------------------------------------------------
A9RSA6_PHYPA/38-242WGFIRKV-------------------------------------------------------------------------
A9SK21_PHYPA/31-231QHHLQRV-------------------------------------------------------------------------
A9SQ31_PHYPA/40-244WGLIRKV-------------------------------------------------------------------------
A9SQP2_PHYPA/39-243WGFIRKV-------------------------------------------------------------------------
A9V0R4_MONBE/102-310RQRISST-------------------------------------------------------------------------
B0C2E0_ACAM1/22-236PNVIPNA-------------------------------------------------------------------------
B0CFK9_ACAM1/23-233AIFIQKT-------------------------------------------------------------------------
B0JG20_MICAN/22-235PNVIPKA-------------------------------------------------------------------------
B0T6B0_CAUSK/26-244RSFMLGV-------------------------------------------------------------------------
B0U8X3_METS4/34-269RAFMLGV-------------------------------------------------------------------------
B0X729_CULQU/29-229CQHLFRV-------------------------------------------------------------------------
B1XK65_SYNP2/22-235PEVIKNA-------------------------------------------------------------------------
B1XXH0_LEPCP/22-223NRVLRNT-------------------------------------------------------------------------
B2A999_PODAN/119-335RQYLNQT-------------------------------------------------------------------------
B2IH64_BEII9/29-251RAYMLGV-------------------------------------------------------------------------
B2IYG6_NOSP7/22-235PNVIANA-------------------------------------------------------------------------
B2VV36_PYRTR/71-272MAFVRKV-------------------------------------------------------------------------
B2WKA4_PYRTR/117-332REYLNDT-------------------------------------------------------------------------
B3PEU1_CELJU/19-221NKVLRNT-------------------------------------------------------------------------
B3RRU1_TRIAD/26-228KKHLKSV-------------------------------------------------------------------------
B4ESV4_PROMH/20-232QTFMAQV-------------------------------------------------------------------------
B4FSR2_MAIZE/33-233QSHLKHV-------------------------------------------------------------------------
B4H3P5_DROPE/29-229RHHLCKV-------------------------------------------------------------------------
B4I4U6_DROSE/141-357RDRIHAT-------------------------------------------------------------------------
B4JF90_DROGR/142-358RDRIHAT-------------------------------------------------------------------------
B4JP44_DROGR/20-227KLFIRKV-------------------------------------------------------------------------
B4MSJ1_DROWI/113-329KDRIQST-------------------------------------------------------------------------
B4QLM1_DROSI/28-228REHLYKV-------------------------------------------------------------------------
B4RCG0_PHEZH/51-271RSFMLGV-------------------------------------------------------------------------
B4RI09_PHEZH/26-246RSFMIGV-------------------------------------------------------------------------
B4RIG5_PHEZH/26-246RSFMVGV-------------------------------------------------------------------------
B4U9U8_HYDS0/12-216YGLLSKV-------------------------------------------------------------------------
B5EDF2_GEOBB/16-220GGVMRGV-------------------------------------------------------------------------
B6AIB7_CRYMR/30-232QSHLLKM-------------------------------------------------------------------------
B6AIN7_CRYMR/31-243MGFIRRV-------------------------------------------------------------------------
B6HLQ8_PENCW/65-266MQFVRKV-------------------------------------------------------------------------
B6IUM4_RHOCS/26-235RQHMLRV-------------------------------------------------------------------------
B6TIY8_MAIZE/53-257WGFVRKV-------------------------------------------------------------------------
B7JBM1_ACIF2/26-225GTLMGKT-------------------------------------------------------------------------
B8DP50_DESVM/18-230NAFMRGV-------------------------------------------------------------------------
B8FKM7_DESAA/17-230NAFVASV-------------------------------------------------------------------------
B8GQ93_THISH/19-215NKVIRNT-------------------------------------------------------------------------
B8HNP6_CYAP4/13-223AEFIRKT-------------------------------------------------------------------------
B8IBU6_METNO/23-232RQHMLRV-------------------------------------------------------------------------
B8IYR9_DESDA/17-229SLYMRQV-------------------------------------------------------------------------
B8MED6_TALSN/117-332RQYLNET-------------------------------------------------------------------------
B9DTR6_STRU0/15-225NRFFAKI-------------------------------------------------------------------------
B9JUA5_AGRVS/24-252RSYMLKV-------------------------------------------------------------------------
B9L7A8_NAUPA/35-240NAFVKRT-------------------------------------------------------------------------
B9M4V9_GEODF/20-227NTLIRQV-------------------------------------------------------------------------
B9PLK6_TOXGO/30-235QEHLTRV-------------------------------------------------------------------------
B9SFF8_RICCO/30-237QEFICKV-------------------------------------------------------------------------
B9SFF9_RICCO/27-234CFFIAKV-------------------------------------------------------------------------
B9T0M2_RICCO/34-232QTHLKQV-------------------------------------------------------------------------
C0NU02_AJECG/69-270MQFIRKV-------------------------------------------------------------------------
C0QH09_DESAH/17-230NSFIRSV-------------------------------------------------------------------------
C1D533_LARHH/19-221NKVLRNT-------------------------------------------------------------------------
C1H044_PARBA/68-269MQFVRKV-------------------------------------------------------------------------
E3D723_GARV3/35-248RVSVRRV-------------------------------------------------------------------------
C3YF20_BRAFL/26-227KEHLKKV-------------------------------------------------------------------------
C3ZWB9_BRAFL/110-326KARIRDT-------------------------------------------------------------------------
C4K3R8_HAMD5/20-232QVYMSQV-------------------------------------------------------------------------
C4KCP9_THASP/19-215NKVIRNT-------------------------------------------------------------------------
C4R8R2_PICPG/45-246QGFIRKV-------------------------------------------------------------------------
C4WRJ7_ACYPI/45-246QVFLRKV-------------------------------------------------------------------------
C4XFK5_MYCFP/39-263RNSF.LG-------------------------------------------------------------------------
C4XRR5_DESMR/21-233NAFMRGV-------------------------------------------------------------------------
C4Y6K1_CLAL4/45-247QMFLRKV-------------------------------------------------------------------------
C5B7G7_EDWI9/20-232QAYMAQV-------------------------------------------------------------------------
C5BTY5_TERTT/18-220SKVLRNT-------------------------------------------------------------------------
C5D2L3_GEOSW/9-205SSPIAKL-------------------------------------------------------------------------
C5DSS8_ZYGRC/34-256QRFMAKV-------------------------------------------------------------------------
C5FIJ8_ARTOC/68-269MQFIRKV-------------------------------------------------------------------------
C5J7D0_MYCCR/10-247TDKL.LA-------------------------------------------------------------------------
C5LBE2_PERM5/65-267RRHLQKI-------------------------------------------------------------------------
C5M3P9_CANTT/53-255QLFIRKV-------------------------------------------------------------------------
C6C1J2_DESAD/18-239NAFMRGI-------------------------------------------------------------------------
C7LXK1_DESBD/17-229NLFLRGV-------------------------------------------------------------------------
C7Q6T3_CATAD/16-211NTLFART-------------------------------------------------------------------------
C7R764_KANKD/20-229AKFITKT-------------------------------------------------------------------------
C8X4E4_DESRD/18-230NAFMRGV-------------------------------------------------------------------------
D0KXZ9_HALNC/19-216NQLIRNT-------------------------------------------------------------------------
D1ARJ6_SEBTE/26-237AQKMTGC-------------------------------------------------------------------------
D1AX50_STRM9/12-223EMGILGS-------------------------------------------------------------------------
D1B5B2_SULD5/29-227GIFIKQT-------------------------------------------------------------------------
D3SG31_THISK/26-222NKVIRQT-------------------------------------------------------------------------
Y819_CHLTR/11-231DSRLPGT-------------------------------------------------------------------------
BI1_RAT/24-225QQHLKKV-------------------------------------------------------------------------
P73793_SYNY3/32-245PNVIKNA-------------------------------------------------------------------------
Q03GC4_PEDPA/15-227NRFLTKM-------------------------------------------------------------------------
Q03RJ4_LACBA/19-226NSFLTKM-------------------------------------------------------------------------
Q04EI1_OENOB/23-235AAFFQRT-------------------------------------------------------------------------
Q0A861_ALKEH/21-217NKVIRNT-------------------------------------------------------------------------
Q0AKK1_MARMM/23-250RKFMLGV-------------------------------------------------------------------------
Q0BV78_GRABC/37-260RAYMLRV-------------------------------------------------------------------------
Q0BX99_HYPNA/25-254RTFMLGV-------------------------------------------------------------------------
Q0K957_CUPNH/24-226NRVLRNT-------------------------------------------------------------------------
Q0VQ00_ALCBS/24-220AQVLKNT-------------------------------------------------------------------------
Q113G8_TRIEI/22-235PNVIVNA-------------------------------------------------------------------------
Q11D01_CHESB/26-243RAYMIRV-------------------------------------------------------------------------
Q12N83_SHEDO/17-213NKMLKNT-------------------------------------------------------------------------
Q15T21_PSEA6/19-215NKVLRNT-------------------------------------------------------------------------
Q168I7_ROSDO/23-241RAHMNKV-------------------------------------------------------------------------
Q17KY2_AEDAE/25-225RRYLFKV-------------------------------------------------------------------------
Q1GUZ0_SPHAL/30-238RSYMLSV-------------------------------------------------------------------------
Q1HR31_AEDAE/26-226RYHLSKV-------------------------------------------------------------------------
Q1J0Z4_DEIGD/13-220RTFMART-------------------------------------------------------------------------
Q1MQ63_LAWIP/21-233SIFMRYV-------------------------------------------------------------------------
Q1QW79_CHRSD/19-216NKVLRNT-------------------------------------------------------------------------
Q1WUN9_LACS1/18-229NSFMTKM-------------------------------------------------------------------------
Q21K99_SACD2/18-212SKVLRNT-------------------------------------------------------------------------
Q22AT9_TETTS/66-293NAFITRV-------------------------------------------------------------------------
Q28T17_JANSC/24-248RAHMNKV-------------------------------------------------------------------------
Q2G985_NOVAD/35-243RRHMLSI-------------------------------------------------------------------------
Q2GEZ5_NEOSM/36-247RMYMVKV-------------------------------------------------------------------------
Q2GI89_EHRCR/18-229RNYLVKV-------------------------------------------------------------------------
Q2GIF3_ANAPZ/18-229RSYLVRV-------------------------------------------------------------------------
Q2H3P6_CHAGB/69-270NQFIRKV-------------------------------------------------------------------------
Q2KWX5_BORA1/25-228NQVLRNT-------------------------------------------------------------------------
Q2NCY0_ERYLH/35-243RKYMLSI-------------------------------------------------------------------------
Q2NU64_SODGM/18-213HKVLCNT-------------------------------------------------------------------------
Q2NUJ0_SODGM/20-232QPFMAQV-------------------------------------------------------------------------
Q2RNE3_RHORT/28-246RTYMLRV-------------------------------------------------------------------------
Q2SJ24_HAHCH/29-224ANVLKNT-------------------------------------------------------------------------
Q2VZ47_MAGSA/31-240RQYMLSV-------------------------------------------------------------------------
Q2Y6W4_NITMU/21-223NKVLRNT-------------------------------------------------------------------------
Q30NV3_SULDN/27-225VSFVKET-------------------------------------------------------------------------
Q30Y49_DESAG/16-228NAFMRGV-------------------------------------------------------------------------
Q31M69_SYNE7/22-233PSVVRRA-------------------------------------------------------------------------
Q385I6_TRYB2/98-297REHLFKV-------------------------------------------------------------------------
Q38XY7_LACSS/13-227SRFFSKV-------------------------------------------------------------------------
Q3A7T2_PELCD/19-230EAFFPKV-------------------------------------------------------------------------
Q3J598_RHOS4/24-242RAHMNKV-------------------------------------------------------------------------
Q46JI7_PROMT/22-235PNVVNKA-------------------------------------------------------------------------
Q47HS3_DECAR/20-222NRVLRNT-------------------------------------------------------------------------
Q482E8_COLP3/19-215NKVLRNT-------------------------------------------------------------------------
Q4FNX7_PELUB/6-228RAYMLKV-------------------------------------------------------------------------
Q4N8D7_THEPA/80-287HQFIRKV-------------------------------------------------------------------------
A0A0D1DT09_USTMA/150-364AEYLHKT-------------------------------------------------------------------------
Q4UFQ1_THEAN/30-231KVHLTKV-------------------------------------------------------------------------
Q4UH80_THEAN/67-274HQFLRKV-------------------------------------------------------------------------
BI1_DICDI/37-241KQTLTKV-------------------------------------------------------------------------
Q5CX10_CRYPI/29-231QTHLLKM-------------------------------------------------------------------------
Q5FPP8_GLUOX/24-248RAYMCRV-------------------------------------------------------------------------
Q5KDG7_CRYNJ/77-277MLFIRKV-------------------------------------------------------------------------
Q5R0A7_IDILO/19-215NKVLRNT-------------------------------------------------------------------------
Q5TP14_ANOGA/117-333KQRIQDT-------------------------------------------------------------------------
Q609C7_METCA/20-218HKVLTNT-------------------------------------------------------------------------
Q6AMM4_DESPS/24-235SIFLAKV-------------------------------------------------------------------------
Q6BV67_DEBHA/47-249QLFIRKV-------------------------------------------------------------------------
Q6CP52_KLULA/27-244LGFLKNV-------------------------------------------------------------------------
Q6NDB1_RHOPA/29-259RAYMLRI-------------------------------------------------------------------------
Q728Y2_DESVH/16-228NAYMRGV-------------------------------------------------------------------------
Q7MSL1_WOLSU/32-230VGFVKQT-------------------------------------------------------------------------
Q7N6P2_PHOLL/20-232QTYMAQV-------------------------------------------------------------------------
Q7NPB6_GLOVI/18-221ASNLPGA-------------------------------------------------------------------------
Q7NUQ5_CHRVO/19-221NKVLRNT-------------------------------------------------------------------------
Q7Q6L7_ANOGA/26-226RQHLSKV-------------------------------------------------------------------------
Q7SG99_NEUCR/80-281HQFIRKV-------------------------------------------------------------------------
Q7UU92_RHOBA/29-242IGFIRRT-------------------------------------------------------------------------
Q7V0H4_PROMP/22-235PNVVQKA-------------------------------------------------------------------------
Q7V8J4_PROMM/22-236PNVVNKA-------------------------------------------------------------------------
Q7VHQ2_HELHP/27-224VNFVKTT-------------------------------------------------------------------------
Q82VP8_NITEU/21-223NKVLKNT-------------------------------------------------------------------------
Q89DW5_BRADU/21-228RGYMLRI-------------------------------------------------------------------------
Q8D225_WIGBR/18-213NKVLRNT-------------------------------------------------------------------------
Q8DLM2_THEEB/69-280PNVIRNA-------------------------------------------------------------------------
Q8DSQ2_STRMU/15-225SSFFAKI-------------------------------------------------------------------------
BI1L_ARATH/47-251WGFIRKV-------------------------------------------------------------------------
Q97FA9_CLOAB/14-227RSFIQQV-------------------------------------------------------------------------
Q98E98_RHILO/25-253RAYMIKV-------------------------------------------------------------------------
Q98MW5_RHILO/25-234RQHMLRV-------------------------------------------------------------------------
Y3663_CAUCR/26-245RKFMLGV-------------------------------------------------------------------------
Y402_PASMU/18-213HKVLRNT-------------------------------------------------------------------------
A1U0T3_MARHV/34-226.KVLRNT-------------------------------------------------------------------------
A3MYZ6_ACTP2/20-214.KVLRNT-------------------------------------------------------------------------
A4SYE4_POLSQ/23-225.RVLRNT-------------------------------------------------------------------------
A5VKY2_LACRD/20-231NSFLTRM-------------------------------------------------------------------------
A5VLC3_LACRD/18-228NKFLTKM-------------------------------------------------------------------------
A6WV27_OCHA4/28-256RSYMLGV-------------------------------------------------------------------------
A8QEE8_BRUMA/112-349RDRIKAT-------------------------------------------------------------------------
B0UVR0_HISS2/19-213.KVLRNT-------------------------------------------------------------------------
B1VUQ0_STRGG/78-285......T-------------------------------------------------------------------------
B1X0P3_CYAA5/23-235.NVIANA-------------------------------------------------------------------------
B2GDC3_LACF3/20-230.TFLTRM-------------------------------------------------------------------------
B7JXJ9_CYAP8/23-235.NVIANA-------------------------------------------------------------------------
B8DT88_BIFA0/45-255...VTRA-------------------------------------------------------------------------
B8MD34_TALSN/62-262.QFIRKV-------------------------------------------------------------------------
B9H8C6_POPTR/29-232..FIRKV-------------------------------------------------------------------------
B9KH79_ANAMF/18-229RSYLVKV-------------------------------------------------------------------------
C5AQF7_METEA/29-251RSFMLGV-------------------------------------------------------------------------
C5XB01_SORBI/38-244.ALIRKI-------------------------------------------------------------------------
C5ZYY2_9HELI/29-227.SFVKQT-------------------------------------------------------------------------
C8WS49_ALIAD/11-207.KILSRV-------------------------------------------------------------------------
D1BNX5_VEIPT/23-243.QRLKGS-------------------------------------------------------------------------
D2YW23_ZYMMO/30-238RSYMLSV-------------------------------------------------------------------------
D4KAL4_9FIRM/19-226.DYMTRT-------------------------------------------------------------------------
D4Z0E6_SPHJU/30-240RSYMLSV-------------------------------------------------------------------------
D4Z6C9_SPHJU/23-231RAHMLGV-------------------------------------------------------------------------
D6DJ22_CLOSC/23-231..YTAKT-------------------------------------------------------------------------
E9DBQ0_COCPS/66-266.QFIRKV-------------------------------------------------------------------------
F3ZIX9_9ACTN/83-294..VVTRT-------------------------------------------------------------------------
F4B2Y9_DOKS4/21-229.AFYRKT-------------------------------------------------------------------------
F4KL14_PORAD/29-237..VMRKT-------------------------------------------------------------------------
US17_HCMVM/41-246....MRV-------------------------------------------------------------------------
US12_HCMVM/52-254...MVRL-------------------------------------------------------------------------
US15_HCMVM/42-247....LHT-------------------------------------------------------------------------
US20_HCMVM/27-225....LRV-------------------------------------------------------------------------
US21_HCMVM/14-213..FLLRI-------------------------------------------------------------------------
F9UNP4_LACPL/20-232RSFLTKM-------------------------------------------------------------------------
G2LFD7_CHLTF/34-232.AFIRKV-------------------------------------------------------------------------
G2SP46_LACRR/20-227..FFMKM-------------------------------------------------------------------------
G8PGI6_PSEUV/16-232RAYMLRV-------------------------------------------------------------------------
H0Z6Q0_TAEGU/121-335.DRIQST-------------------------------------------------------------------------
H2Q6E8_PANTR/80-279.TFLRKV-------------------------------------------------------------------------
H3G6E5_PHYRM/28-229..ILNGI-------------------------------------------------------------------------
H9J0X8_BOMMO/52-266..RIKTT-------------------------------------------------------------------------
H9JB99_BOMMO/22-222RQHLKNV-------------------------------------------------------------------------
I0DXE2_PROSM/20-231QTFMSQV-------------------------------------------------------------------------
I3U2E9_ENTFC/13-223.RFYAKV-------------------------------------------------------------------------
J9Z9N1_LEPFM/27-227.QYMMKV-------------------------------------------------------------------------
K4AEB8_SETIT/31-237.AFVRKI-------------------------------------------------------------------------
M1BP72_SOLTU/31-237.SFIRKV-------------------------------------------------------------------------
M1FFW7_9ALTE/31-232.KVLRNT-------------------------------------------------------------------------
M4E009_BRARP/33-231QNHLKRV-------------------------------------------------------------------------
C6XEX3_LIBAP/26-254RAYMIRV-------------------------------------------------------------------------
Y920_HELPY/26-221.SFVKTT-------------------------------------------------------------------------
YBHL_ECOLI/19-230.TYMAQV-------------------------------------------------------------------------
Y044_HAEIN/19-213.KVLRNT-------------------------------------------------------------------------
Y2604_PSEAE/21-215..VLRNT-------------------------------------------------------------------------
Q037Y9_LACC3/14-229.QFFSRI-------------------------------------------------------------------------
Q03YA2_LEUMM/20-231RAFFKQT-------------------------------------------------------------------------
Q1GBC8_LACDA/21-230.GFLTKM-------------------------------------------------------------------------
Q28GN8_XENTR/24-225QQHLKRV-------------------------------------------------------------------------
Q2G0D3_STAA8/18-207..SISKV-------------------------------------------------------------------------
Q2IGP2_ANADE/25-232RRFMSAV-------------------------------------------------------------------------
Q3IXM5_RHOS4/24-232RAHMLRI-------------------------------------------------------------------------
Q3JAM0_NITOC/20-215.KLVRNT-------------------------------------------------------------------------
Q4A983_MYCHJ/32-262.......-------------------------------------------------------------------------
Q5F552_NEIG1/17-220.TVLQKT-------------------------------------------------------------------------
Q5M633_STRT2/16-225.RFFGKI-------------------------------------------------------------------------
Q5NH29_FRATT/24-220.KVLRNT-------------------------------------------------------------------------
Q5ZWY5_LEGPH/21-217.KVLRNT-------------------------------------------------------------------------
Q63UT7_BURPS/27-229.RVLRNT-------------------------------------------------------------------------
Q6F386_ORYSJ/35-240.AFIRKV-------------------------------------------------------------------------
Q6ZEY7_ORYSJ/10-215.AFIRKV-------------------------------------------------------------------------
Q74I60_LACJO/20-231NRFLSRM-------------------------------------------------------------------------
Q7CH71_YERPE/20-232QAYMAQV-------------------------------------------------------------------------
Q7MW50_PORGI/22-232..TMRHV-------------------------------------------------------------------------
Q833N8_ENTFA/14-224NKFYAKI-------------------------------------------------------------------------
Q83EU5_COXBU/22-236.QFMSKV-------------------------------------------------------------------------
Q8DNE4_STRR6/21-231NQFYAKV-------------------------------------------------------------------------
Q8DY88_STRA5/15-225NQFFAKI-------------------------------------------------------------------------
Q8EKF7_SHEON/22-217......L-------------------------------------------------------------------------
Q8RF52_FUSNN/10-220NNFLRKV-------------------------------------------------------------------------
Q8Y034_RALSO/24-225.RVLRNT-------------------------------------------------------------------------
Q8Y569_LISMO/22-221..IMQKI-------------------------------------------------------------------------
Q8ZKW9_SALTY/20-228.TFIRRA-------------------------------------------------------------------------
Q8ZQ61_SALTY/19-213.KVLRNT-------------------------------------------------------------------------
Q8ZQP8_SALTY/19-218..MLSLT-------------------------------------------------------------------------
Q94GN3_ORYSJ/18-224.AFVRKV-------------------------------------------------------------------------
Y358_STRP1/15-225NQFFAKI-------------------------------------------------------------------------
YRJE_LACLA/17-226.AFFSKI-------------------------------------------------------------------------
Y1358_VIBCH/20-216.KVLKNT-------------------------------------------------------------------------
BI1_ORYSJ/35-232.SHLKLV-------------------------------------------------------------------------
Y236_CAMJE/25-225..FIKQT-------------------------------------------------------------------------
Y147_RICPR/22-231RRYMLKV-------------------------------------------------------------------------
R4G5C7_RHOPR/23-222..HLKNV-------------------------------------------------------------------------
R5F0I7_9CLOT/22-230..YTAKT-------------------------------------------------------------------------
R5X7M8_9CLOT/13-219...MEAV-------------------------------------------------------------------------
R6BXE5_9BACT/36-246.ALMRKV-------------------------------------------------------------------------
R6MUP2_9BACE/18-220.ALMRSV-------------------------------------------------------------------------
R7G836_9FIRM/17-227RRHVAHT-------------------------------------------------------------------------
S5QYX2_9STRE/16-226NRFFAKI-------------------------------------------------------------------------
U5L5J4_9BACI/11-205...LPSV-------------------------------------------------------------------------
V6F839_9PROT/25-234RQYMLRV-------------------------------------------------------------------------
W5PL52_SHEEP/122-337.DRIHST-------------------------------------------------------------------------

PF12811

C7NEU4_KYTSD/18-275....................................................LSLDDVFVKTAIL-IGLMLVTAVGTWFV
F4EZD3_SELS3/14-236....................................................ASYSGIAIKSTGL-VLIVAASAVITWLT
R5G4T6_9FIRM/7-239....................................................CTYKGISLKVIYF-LLMTVLGAGLGIFL
B1GZ32_UNCTG/3-236....................................................MTMSGTINKSIIL-WILLVGSAFYSWTH
D7WE18_9CORY/5-299...PYGQAGYAQDP...YAGA.........TGERP.................ITVDDIVTKTGIT-LAVIVAFALINFGI
C6WKQ5_ACTMD/6-268...............................GERP.................ITIDDVVTKTAVT-LGLTLVTGLVSA.W
K4QW36_9ACTN/5-282NPYGSPADTD.............KP..AG..........S..........TTVTMDDVVVRTATT-LGAVALTAVLSWLL
M4NLN8_9GAMM/5-249....................................................MTINGTVNKTGLL-LLLVLVGAMVSWSR
F8A7A7_CELGA/3-266............................APA.......ATTRET......GRMTYDDVIMKTGGL-LALLVVVAAGSWAL
V6JXB5_STRNV/5-292NPYA.QTDPQ.............YGGAGP.........QAPARS......GVMTIDDVVTRTAST-LGTVVLTAVLAWVL
U5Q5X0_9BACT/3-248....................................................MTVKGTATKSLVL-ILMILAGAMYTWKI
D1A7P0_THECD/5-261............................TPPAQRT.................MTYDDVVVKGFLA-LGTLVLTGALTWTL
D2PP90_KRIFD/5-279.............................PAGSRP.................MTLDDVIVKTSIT-LAVVVVAAALAWWR
J9SCB5_9ACTN/32-313...QYGQ...ATDP...Y.......TQPAPPTTRQ.................LTIDDVVTKTAIT-LGVLTLAAVATYFA
Q6NI55_CORDI/5-275...QYDQYG.........QSV....TS.AGAAERP.................MTVDDVVTKTGIT-VGVIIAFAVVNFAL
A9NEU4_ACHLI/5-242....................................................ATKSGITLKTITL-VVISLITGFASIFL
R5EEE2_9GAMM/5-247....................................................ATISGTTTKSIVL-VALTLIIGYFAMNY
A5WFW8_PSYWF/5-242....................................................MTVQGVVQKTSFL-LGLSAIAALGFFFF
R7XUD5_9ACTN/14-304....................................................MTIDSVVQKTSIS-LAIVIAFAALTWFW
K0FCH0_9NOCA/6-286FGNQYGQ.QYQ.QP.......QPYQQ..APAGTRA.................MTIDDVVTKTAIT-LGVLALSAIVSYGL
D8UI29_VOLCA/59-300....................................................MTVDGAVQKTGLL-LVVAVASAMATWVQ
W8KJ18_HALHR/28-265....................................................PLSRASVVRATGL-LFSLSLLAILLMLV
Q0S4B9_RHOJR/28-305...QFGQPQYT.QA.......EPYRT..GPD.YRS.................MTIDDVVTKTGVT-LGVLTVSAIISYFL
D6YTM1_WADCW/5-246....................................................MTIQGVVNKTGLL-LLCLLISAGWTWMQ
C4L1D1_EXISA/6-242....................................................MTKAGTWSKVFTL-LLLVTAAAGTTWLV
F1TJZ5_RHOHA/9-283...EYGQ.QYG.AP.......EQFQQ..TTQ..RA.................MTIDDVVTKTAIT-LGVLTISAIVSYFL
Q6LYY5_METMP/5-242....................................................MTVNGTVNKTIIS-LGIVSISAYFSWDV
B2KC47_ELUMP/5-240....................................................MTISGAVNKSFTL-LFICFIGALLSW..
F4F5D9_VERMA/5-290YPQQPGYPQQYPPQ...AGYPGAPGFPAAPQAVTP.................MSIDDVVVKTVML-LAIVGVSAAAAWIL
F5YTZ5_MYCSD/6-286...TQQM...S.QG...YPGLQSPQTDYQREVSRP.................LTIDDVVTKTGMT-LGVLSIAAIVSFFL
Q9KZ65_STRCO/5-305NPYA.QPDQQ.............FG..APP........QAPATT......GRMTMDDVVIRTAST-LGVLVVTAALAWAL
E1VTL5_ARTAR/3-266............................QPT.......ATSADT......GRMTIGGTINKTAIC-LALVVIGAAIGWTI
F8E0H2_CORRG/12-305...QTATVHQGMEN...MQHAPNF.GA.AGASDRP.................MTVDDVVAKTSIT-LGVIIAFAVAEYFL
M1P5T4_9CORY/5-275....YAGYG.........RPV....AP.TD..DRP.................MTVDDVVSKTGMT-LGVIILLALVNFGI
F6GI76_LACS5/9-242....................................................MTVSGILIKTFLM-LTITTTIVVGVWKL
C9YY45_STRSW/5-291NPYA.QQDVQ.............HG..VPP........QAPART......GAMTMDDVVMRSAMT-LGTVVVGAVLAWAL
G8TNU9_NIAKG/8-251....................................................MTVKGTLNKFGIL-FLLTMASAGYAWKM
A6W6X9_KINRD/11-281....................................................MTLDDVVVRTASL-FAVLLVGAAGGYLG
D7BXA1_STRBB/5-298NPYA.TGDQQNLTP...EQLQQMYG..APP........AGPLQT......GRMTMDDVVMRTGMT-LGTVIVAAAAAWIM
D6Z909_SEGRD/6-274...QYGQQSHAVYQ...QAPLNYQYQ..APAASRT.................LSVDDVVAKTATS-LAVLAVTAVASYVL
D5UKL3_CELFN/3-271............................APT.......ATTRET......GRLTYDDVIVKTGGL-LALLVVVGAATWVV
E3EBZ5_PAEPS/5-244....................................................MTIGGTVNKTLLL-LVLLIVSASITWYM
I4A1A9_ORNRL/7-250....................................................MTLNGVIGKSFLL-ILITAVTAYFSWQY
F5XTM3_MICPN/6-278....................................................MTFDDVITKTAVV-MGVLVISAALAWMF
X5DKM9_9CORY/5-292...QWGQQDQQGMA...YQQSPNYGAP.TTASDRP.................MTIDDVVTKTGIT-LAVIVVLAAVNFMI
H6RSJ3_BLASD/5-276............................AYTAPSPYG..TTADM......RYMTMDDVVTKTGLS-FLVTVLAAAAT..W
A5FKK6_FLAJ1/12-255....................................................MTLSGTINKTAIL-FLILCGSAMVTWWM
Q47SU4_THEFY/8-319QGYG.......................PAPYPAQPGYGPAVPGT......RPVTIDDVVMRTGFT-LGTVVLGAVLTYFM
F4GYG7_CELFA/3-268............................APA.......ATARQT......GRLTYDDVIMKTAGV-FAVLVVSAAVTWTL
D6ZKK1_MOBCV/18-273....................................................VTMDDVLIKTVVT-FGTLLLFGAGSWAL
E8NDS9_MICTS/10-292............................APA.......AGAVET......DRMTIEDTVFKTLAL-FGVLVVGAVVGWIW
Q8XKZ0_CLOPE/6-239....................................................MTVGGTIVKILIM-TAILGVAFVYSWIA
F6FSN3_ISOV2/3-284............................APS.......ATTADT......KRLTYDDVIIKTGGL-LALLVVVAAATWTF
M4ZW38_9ACTN/48-277....................................................MTLNGTITATASL-FILLLISAAFGWMA
D3EHX0_GEOS4/7-244....................................................MTIGGTVNKSFML-LALLIGAAVISWVM
Q11SC4_CYTH3/5-241....................................................MTIRGTVNKSFIL-IALVFSTALLSWDF
A0R2Y3_MYCS2/6-277...QQVH...A.QQ...Y.APEYLDKQ.QPGVARP.................LTIDDVVTRTGIS-LAIVSLVGVVSYFL
C2WZP8_BACCE/5-241....................................................MTIGGTVGKTFIM-LILLLATSVYSYIQ
C5C0C8_BEUC1/28-297............................MPA.......AGPAQT......GRMTYDDVIIRTGSL-LGIIVVTGALAWFG
D9TB20_MICAI/19-252....................................................MTVADVISRTVGL-LLITGVTAAVSWVV
H2JL64_STRHJ/50-293.....DADEA.................AP.........LPVLVG......DLMTMDGVLPRAAAA-LAVTALTAVLSWTL
U3GYX0_9CORY/5-290....YQQSPFGAGV...GQQ.PGFPGA.VAPAERA.................MTVDDVISKTGIT-LGVIIAVAIVNFFI
R6SY18_9FIRM/13-260....................................................ASYKGIAMKTLYF-VAVFAAGMGAYFYI
Q4JU62_CORJK/5-300...QTAAMGYG......MQDAANY.GQ.AGSADRP.................MTVDDVVTKTGIT-LAVIIALAVVNFII
F8JW88_STREN/75-299..................................................GRMTIDDVVVRTALT-LGTAILGAVLAWFV
F8AVU2_FRADG/8-276............................AGLYRAPSG...............LTVDDVVVHTLGL-FAVMAVTGAVGWAI
R4T3W7_AMYOR/6-277............................AGAGDRP.................MTVDDVVIKTALS-LGTALVTGVLTAIW
D9TB19_MICAI/5-283YPQQP.YAQP.........YPGGYGQPVAPPTVTP.................MTLDDVVVKTVLM-LAILGASAAAAWVL
D6Y882_THEBD/39-278............................APPAARP.................MTIDDVVVRGLTM-LGTLVLSAALAWYF
I0GZ05_ACTM4/5-279...................YPTATGYPASPPAVRP.................MTVDDVVVKTVTL-LGITGISAVAAWNL
G0HFP4_CORVD/5-290....YAQNPYATQAQPGYQQSPNYGVP.TKDADRP.................MTVDDVVTKTGIT-LAVIVVFAAITMVI
F6EQM2_AMYSD/6-278...QYGQ.Q.T.AP.......QYTPS..APE..RA.................MTVDDVVTKTGTT-LGVLTVTAILSYYL
A4F854_SACEN/6-264.................................RP.................MTIDDVVTKTAIT-LALAVVTGAATY..
K7RRB1_PROA4/23-286....................................................MTFDDVVGKTGLV-LLLIAAVGVLTFIG
R7J8A1_9FUSO/3-241....................................................MTIEGTVSKIFML-FACLLAGAAISVYS
B1MKI6_MYCA9/6-280...QQMR...Q.DP...Y..TAYPEA..QAGVSRP.................LTIDDVVTKTGIT-LGVIVAVAVASFFL
D7GFC1_PROFC/5-270....................................................MTMNDVIAKTATL-FVILVAVAAAAWMF
E3H5K2_ROTDC/58-316.............................................PVAEGDRLTMNDVIMKTGLN-LALVVLGAAVSWYL
V5XGM6_MYCNE/6-283...QQVH...A.DP...YAATQYPDQQ.QAGVSRP.................MTIDDVVTKTGIS-LAILTAVAVVSYYL
E2SBJ7_9ACTN/5-279....................................................MTLDTVVEKTAIS-LGLLVATAAVAWFL
F8KWJ3_PARAV/5-245....................................................MTVSGVVNKTGIL-LSCVLLTAGWTWIK
H5XAT9_9PSEU/6-270............................EGAADRP.................MTVDDVVLKTGAS-LGVTLLVGVITAIW
A1SF75_NOCSJ/5-293....................................................MTIDSVVQKTAIS-LGLVIVAALATWVL
E4NG71_KITSK/6-291NPYAAGAQQPPLTD...EQLVTMYN..SPS........AGPAQT......GRMTMDDVVARTAMT-LLTLVAFGAVAWFT
E8R4F5_ISOPI/10-246....................................................MSIQGTTVKTGLL-LAITVATALISWEK
W5W111_9PSEU/6-255...............................ADRP.................MTIDDVVTKTAVT-LITAVVTGGLAVVL
Q9CB64_MYCLE/6-284...GYYQ...P.DP...YAATPYQETR.AYQVSRP.................LTIDDVVTRTGMT-LAVLVVSAIVSFFL
A9WUA8_RENSM/12-288............................QPP.......ASNAQM......GRMTYDDVLIKTLVS-FGLVVIGAAIGWAF
H2JJR6_STRHJ/5-286NPYAPAAGAG.............PD..AG..........ARTTR......TAITMDDVVVRTATT-LGTVALTAVLSWLL
L0HDS4_METFS/6-241....................................................MTIRGTIDKTLVL-LAIAMVSAVAAWKF
B1V9N1_PHYAS/18-261....................................................ASRKGVAFKTILL-LLITSFTAGTFFSL
B1YES9_EXIS2/8-243....................................................MTKAGTMSKIFLL-LALVTAAAGGTWFF
D7BKM9_ARCHD/9-266....................................................MTYTDAMNKTALL-LGVTVVAGVLAAML
L0D6N3_SINAD/5-254....................................................MTVQGTIGKTFAL-LGILSATGLWAWNA
W5XU43_9CORY/5-268....Y.QSDYGHAQ....TSTADYSGE.QAKTTRP.................MTVDDVVTKTGIT-LAIIIAFAVANFGV
C5C991_MICLC/36-290............................APS.......AGPGET......GRMTFNDIVGKTGLM-LVLVVVAGAVGWFS
Q6AD52_LEIXX/5-268............................APS.......ATALDT......DRMTVEDTIHKTAAS-FGLLVVGAVVGWLV
E6SCQ6_INTC7/5-292....................................................VTLDDVIVKSLVL-FALTLVGAGVSWFM
R5L7T8_9SPIR/3-242....................................................MTINGAINKAIML-SLILMLSALVSVYF
C1F3Q6_ACIC5/5-243....................................................MTLQGTVNKTGIL-LLCAMATAAFSWHV
D7B6X7_NOCDD/7-306QGYP.......................GG........PVQSTDN......QPMTIDDVVVRTGMT-LGVVAAFAVVNYFL
Q6F806_ACIAD/5-242....................................................MTVAGAVQKSVGL-TLIAAITGLALFFY
W5Y0J1_9CORY/5-268....YAGY..........YNQ....VP.VTTSERP.................MTVDDVVSKTGIT-LGVIIAFAVLNFSI
C8XKQ4_NAKMY/6-258............................APSAQYLDQMYNQPAYEAPARERFLTVDDVVTKTAMI-LVLAVVAGFATAWF
Q6AAB4_PROAC/3-276....................................................MTFDDVLGRTGLV-LLIIAAIGAVSFAL
G8SIP5_ACTS5/5-282YGQQP..............YPTAEGY.AAPPAVQP.................MTIDDVVVKTVTL-LGITGISAVVAWSV
D5UV23_TSUPD/6-297...QYGQ...PQAP...YE.........TTTGGRT.................MTVDDVVTKTAAT-LGVLIVFAAASYFL
D5VB45_MORCR/3-239....................................................MSVRGVVSKTAFL-LSLAAVSGFGVFFY
C0R118_BRAHW/3-242....................................................MTLNGAINKSIIL-TLVLILSAMVSVFF
F8EFI0_RUNSL/3-242....................................................MTVQGTVNKIILL-GGIVIATAVASWFL
C3PFB1_CORA7/5-266....YGQNDNPFNQ...GNRSAD..........RP.................LTVDDVVTKTGIT-LGVIIVMAVLNFAI
B2HT80_MYCMM/6-279...AGYA...G.DP...YMA.PYQETR.DAGTTRP.................LTIDDVVTKTGLT-LAMLSATAVVSYFL
I2EWG6_EMTOG/3-238....................................................MTVESTLTKVGIL-LAILGASSAVSWIG
X4QYH9_9ACTO/9-284....................................................MTYNDALNKVAIL-LGIALVTGTATATL
L0J173_MYCSM/6-280...QAVQ...A.DP...Y.AGAYPEQR.QAGVARP.................LTIDDVVTKTGIT-LGVLAAVAVAAYFL
C7QZY5_JONDD/3-275............................SPA.......ATTADT......GRMTYDDVIMKTGGM-LAVLVLSGAATWIV
D5SQ37_PLAL2/5-247....................................................MTVSGAVNKSMVL-IGLTASLGLLSFSY
W5TW08_9NOCA/6-283...QYGQ.Q.Q.NP...YGVQQGYQE..APA.TRP.................MTIDDVVTKTGIT-LGVVTVAAIIAYGA
J7L8F6_NOCAA/7-307QGYP.......................EQGYPQQ.TYPQQAAGD......QPMTIDDVVVRTGMT-LGVVALFGVLNYFL
B3R032_PHYMT/12-261....................................................VSRKSIALKTITL-LLVTIATTIITFFL
A8L155_FRASN/44-265....................................................LTFDDVVMHTLGV-FAVMLVGAGFGWYL
G0FRN5_AMYMS/6-277............................AGEGDRP.................MTVDDVVVKTGMS-LGVALLVGVITGIW
A8J2B1_CHLRE/71-312....................................................MSVDGAVQKTSLM-LAVTMACAAATWTQ
A0JU33_ARTS2/31-306............................QPA.......AGPAET......GRMTFDDVIIKTAAC-LGVLIAGAAVTLFV
C4LHM7_CORK4/5-292...MAGAQQFGQQT...MQQQ....AQ.GTTAERG.................MTIDDVIVKTSIT-LGVIIVGAVINYML
R6P635_9CLOT/22-243....................................................MTVSGTITKTFIL-LLIAAVSAAAVVYE
F4CVB9_PSEUX/6-269............................DARASQSGFGPAATSD......RRLTTDDVVIKTAIT-GGVALAAGIATALS
C7M9W4_BRAFD/40-305..................................................GRMTFKDALNAITAS-LGVIVVVGFVVATS
E3ITH9_FRASU/8-268............................ARAYRQPSS...............LTIDDVVMHTLGL-FAIAGVGGAVGWYL
I6XVQ8_PROPF/3-275....................................................MTMDDVLAKTSIT-LLVVFAAAAATFTL
Q8NRR2_CORGL/5-271....YGGYDNFGGV...YQQN....VA.PQKAERP.................MTVDDVITKTGIT-LAVIIVFALVTFGV
I0II89_PHYMF/20-264....................................................MTVQGTVYKTAIL-LGLAICTGVFTWNQ
Q4FRP4_PSYA2/3-240....................................................MTVKGVIQKTSLL-LGLSAITGIGFFFY
I0GPK4_SELRL/3-236....................................................ASYSGIAFKEILM-VVLVAASALVTIFS
I5B600_9DELT/19-256....................................................IMDRRHVIQVAVI-LFTLTLLSVAGMVT
X5DVG1_9BACT/9-254....................................................MTVNGTVNKTALM-LLLVIAGAVFTWNK
D2B2I8_STRRD/5-259............................APPAQRT.................MTIDDVVVRGFIT-LGTLVVSAAVAWAL
D2NP91_ROTMD/12-332AQYG........................QPYGEADYGVAAPTYSEPIPAGERLTMNDVLVKTGIN-LGLVAVGAAVAWNA
G4SY51_META2/29-260....................................................LSLRQQMF.SLGL-LFTLSLLAALAMAA
C7PNV4_CHIPD/9-246....................................................MTINGTIGKMAFL-LALVVAAAVYAWGV
I4ESR8_MODMB/7-273............................PYSAPSPYA..ATGR.......AYMTMDDVVTKTGLT-FVVTVLAAAAT..W
D7DQS6_METV3/5-250....................................................MTINGTINKIFIL-TIFLIGSAIVSWTI

PF01027

B6KHI7_TOXGO/120-329----------------------------------------------------FGIISFQ....LA.VT..FAVSVLFTAH
A8N382_COPC7/125-339----------------------------------------------------FKYTGAG....VL.LT..AAAARAMFRG
A0CUW2_PARTE/56-286----------------------------------------------------YALL.AG....ML.VS.FYLMTFILLFT
A0DUN3_PARTE/28-241----------------------------------------------------FLIILFQ....IG.FT..FITTLIAYSQ
A0LGQ6_SYNFM/17-228----------------------------------------------------YNWMGIG....LA.TT..AVVAMLTFSS
A0RRR6_CAMFF/25-219----------------------------------------------------YQLLTAS....LV.AA..TAGAYIGVDY
A1A283_BIFAA/75-289----------------------------------------------------YGEMTIG....LL.VT..AAVAILTQAT
A1AQX9_PELPD/20-227----------------------------------------------------YAWMGLG....LT.LT..ALVALVTISS
A1AX37_RUTMC/15-212----------------------------------------------------YQLLSTT....LL.FS..GLMAYLAMSL
A1B1U7_PARDP/24-252----------------------------------------------------YGLMAVG....ML.VT..AGAAWGMAGL
A1S6I1_SHEAM/16-212----------------------------------------------------YMLLSMT....LA.FS..ALCAWIATAM
A1SWS6_PSYIN/18-214----------------------------------------------------YMLLAMT....LA.FS..ALTATLATMM
A1TSD8_ACIAC/21-222----------------------------------------------------YWLLALS....MV.PT..VLGAWLGVAT
A1WWU6_HALHL/25-221----------------------------------------------------YILLSMT....LA.FS..AVTAGMAVLT
A2SF80_METPP/20-223----------------------------------------------------YWLLALS....LV.PT..VLGAWVGVAT
A2SGJ7_METPP/35-231----------------------------------------------------YALLSMT....LL.FS..AAIAAASVTF
A3LXU5_PICST/45-247----------------------------------------------------YSLLAIQ....IL.GT..VLVGFIIRSS
E0TG86_PARBH/24-234----------------------------------------------------YNYMSMG....VA.VT..ALVG...LFF
A4G4J7_HERAR/19-221----------------------------------------------------YWLLALS....MI.PT..VLGAWLGVQF
A4I0V7_LEIIN/109-308----------------------------------------------------YTLLGCA....CL.TA..GLGSFLMVAT
A4VX37_STRSY/17-227----------------------------------------------------YGVVAMG....IG.LS..ALVSFLAVTV
A5CDM3_ORITB/21-240----------------------------------------------------YNLMAMA....LF.IT..AVAGTATFSL
A5DPA1_PICGU/50-252----------------------------------------------------YSLLTLQ....II.AT..VIVGLIIRSN
A5E0Y3_LODEL/45-246----------------------------------------------------YSLLSIQ....LM.AS..VVVGYIIRSS
A5EVN6_DICNV/21-215----------------------------------------------------YTLLGMN....VL.FS..AFCAYIGMLL
A5FVN6_ACICJ/27-251----------------------------------------------------YNWMASG....LL.LT..AIVSYAISHT
A5GUQ5_SYNR3/22-233----------------------------------------------------LPYVGGG....MV.LT..AAGTLGGLSM
A5K3F8_PLAVS/30-237----------------------------------------------------YGLLAVG....T..ML..TALSCYV...
A5V4K0_SPHWW/30-238----------------------------------------------------YNYMASG....VL.LT..GIVALLFAES
A5VGS7_SPHWW/27-236----------------------------------------------------YRNMALG....LA.LT..GLVAFGVAST
A6Q632_NITSB/34-232----------------------------------------------------YQLFAAS....LM.AA..TTGAYIGMQM
A6Q691_SULNB/22-221----------------------------------------------------YQLLAVS....MI.AA..AAGAYVTMPY
A6QA51_SULNB/16-228----------------------------------------------------YHWMMIG....LL.IS..GLSAFMVIHS
A6VN26_ACTSZ/21-216----------------------------------------------------YFLLGLT....LA.FS..ALVAYISMSF
A6W0C3_MARMS/16-212----------------------------------------------------YGLLSLT....LL.FS..AFTAGLSMAF
A7AX64_BABBO/30-235----------------------------------------------------YATLAAS....A..LV..TAAGAAL...
A7EDC6_SCLS1/72-273----------------------------------------------------YAILSVQ....LI.AT..AALSSVSFFS
A7HSY2_PARL1/27-247----------------------------------------------------YNYMAGA....LA.LT..GLVAYFAYTA
A7I0C4_CAMHC/30-228----------------------------------------------------YQLLTAS....LI.AA..TAGAFVGMNF
A7RRN6_NEMVE/26-227----------------------------------------------------YSCLAAS....M..MA..AAVGSSV...
A7SUK2_NEMVE/41-257----------------------------------------------------YAYFAGS....LA.VT..AGAAYSISRS
A8AVN1_STRGC/14-224----------------------------------------------------YSLVGVG....LG.IS..AIVSALMLSM
A8EX08_ARCB4/24-224----------------------------------------------------YQLFAGS....LL.AA..TAGAYVGLGI
A8HUL0_AZOC5/27-255----------------------------------------------------YNYMALG....LA.IT..GAAALGIFML
A8JCT0_CHLRE/35-234----------------------------------------------------YLTLSVA....V..AI..SALGCFL...
A8LJ17_DINSH/24-236----------------------------------------------------YGLMSVA....MV.LT..GAVAWAVGTN
A8LT34_DINSH/23-238----------------------------------------------------FAYMGGG....LV.LS..ALVAFAVANV
A8PJB5_BRUMA/34-232----------------------------------------------------YGTLALG....L..MA..ATVGALL...
A8PUB6_MALGO/132-346----------------------------------------------------FTYLGTG....LT.IT..GLTAYGLHRY
A9A0M8_DESOH/17-230----------------------------------------------------YNWMAVG....LA.LT..GFLAYYVAHN
A9CHH9_AGRFC/27-255----------------------------------------------------YNLMALA....LV.IT..GVAAFGFAML
A9PF37_POPTR/39-243----------------------------------------------------YGILAAQ....LV.LT..TIVSAVTILY
A9RSA6_PHYPA/38-242----------------------------------------------------YGILSVQ....VL.LT..TVISAFVVST
A9SK21_PHYPA/31-231----------------------------------------------------YMTLAAT....V..LL..SAVGVYI...
A9SQ31_PHYPA/40-244----------------------------------------------------YNILSIQ....VL.LT..AAVSAFVVFT
A9SQP2_PHYPA/39-243----------------------------------------------------YGILSVQ....IL.LT..TIVAGSVVYF
A9V0R4_MONBE/102-310----------------------------------------------------FTAFGAG....VV.FT..GVATVALFRG
B0C2E0_ACAM1/22-236----------------------------------------------------LPYLGAG....LV.LT..AVGAWGGLGV
B0CFK9_ACAM1/23-233----------------------------------------------------YLHLAGAIGAFIV.VE.FLLFQLGI...
B0JG20_MICAN/22-235----------------------------------------------------LPYLGGG....LI.LT..AVGTYGGLGV
B0T6B0_CAUSK/26-244----------------------------------------------------YNKVALG....LL.LS..AALAWLTSSY
B0U8X3_METS4/34-269----------------------------------------------------YNNMVLG....LA.VS..ALVALGVNKL
B0X729_CULQU/29-229----------------------------------------------------YACMTLA....C..AA..AAAGSIV...
B1XK65_SYNP2/22-235----------------------------------------------------LPYLGGG....LL.LT..ALGTYGGLGV
B1XXH0_LEPCP/22-223----------------------------------------------------YGLLALS....ML.PT..VLGAWIGVST
B2A999_PODAN/119-335----------------------------------------------------FLHTGLG....VG.II..GMTAYQMLQS
B2IH64_BEII9/29-251----------------------------------------------------YNHMVIG....LA.IT..GLVALGTNML
B2IYG6_NOSP7/22-235----------------------------------------------------LPYVGGG....LV.LT..ALGTYGGLGV
B2VV36_PYRTR/71-272----------------------------------------------------YAILTVQ....LL.AT..AAVSFISMTS
B2WKA4_PYRTR/117-332----------------------------------------------------FMHTGLG....IG.MI..GIAARALHMN
B3PEU1_CELJU/19-221----------------------------------------------------YMLLGLT....LA.FS..ALMAGLSMAL
B3RRU1_TRIAD/26-228----------------------------------------------------YSCLIIS....M..IA..AGAGSMV...
B4ESV4_PROMH/20-232----------------------------------------------------YGWMTVG....LL.LT..AFVALYVASS
B4FSR2_MAIZE/33-233----------------------------------------------------YLTLCSA....L..AF..SALGAYL...
B4H3P5_DROPE/29-229----------------------------------------------------YMIIGST....A..AA..TAVGSVL...
B4I4U6_DROSE/141-357----------------------------------------------------YAYFGAS....CG.VT..AASAVAFFQS
B4JF90_DROGR/142-358----------------------------------------------------YAYFGAS....CA.LT..AASAASVFQS
B4JP44_DROGR/20-227----------------------------------------------------YLY.AIS....FI.LT.TSCIWLIISIT
B4MSJ1_DROWI/113-329----------------------------------------------------YGFFGGS....CI.LT..AASAAAVFRS
B4QLM1_DROSI/28-228----------------------------------------------------YMVLGST....A..AA..TTMGALL...
B4RCG0_PHEZH/51-271----------------------------------------------------YNKVALG....LV.VS..AALAFLTGQY
B4RI09_PHEZH/26-246----------------------------------------------------YNKVALG....LL.VS..AALAYLTSSV
B4RIG5_PHEZH/26-246----------------------------------------------------YNKVALG....LV.LS..AVLAYLTSMV
B4U9U8_HYDS0/12-216----------------------------------------------------YGLLAFS....IA.SA..VVGSVVGLSH
B5EDF2_GEOBB/16-220----------------------------------------------------YGWMGGG....LA.LT..ALVSLMTASS
B6AIB7_CRYMR/30-232----------------------------------------------------YTTILIG....T..II..TTLGAVI...
B6AIN7_CRYMR/31-243----------------------------------------------------YGLLSVQ....FI.LT..CLVTT..IMF
B6HLQ8_PENCW/65-266----------------------------------------------------YSILTAQ....LL.LT..TILSSISFFN
B6IUM4_RHOCS/26-235----------------------------------------------------YNYMTVG....LV.IT..GLVAFLGAST
B6TIY8_MAIZE/53-257----------------------------------------------------YGILAAQ....LL.LT..TAVSALTVLH
B7JBM1_ACIF2/26-225----------------------------------------------------YALLAAT....LV.VS..TIASIYGMHS
B8DP50_DESVM/18-230----------------------------------------------------YNWMFVG....LA.VT..AGAAWFTASS
B8FKM7_DESAA/17-230----------------------------------------------------YNWMFIG....LT.LT..GVLAYATFQV
B8GQ93_THISH/19-215----------------------------------------------------YMLLSMT....LA.FS..AVMAFVAMAT
B8HNP6_CYAP4/13-223----------------------------------------------------YLHLAGAIAAFIG.VE.FLLFSSGI...
B8IBU6_METNO/23-232----------------------------------------------------YNYMGLG....LA.LT..GLVAFAVAST
B8IYR9_DESDA/17-229----------------------------------------------------YQWMTLG....LG.IT..TVMAWFVAST
B8MED6_TALSN/117-332----------------------------------------------------FMHTGLG....LG.II..AIAARALHTN
B9DTR6_STRU0/15-225----------------------------------------------------YSLVGMG....VG.LS..AFVSYLMLFP
B9JUA5_AGRVS/24-252----------------------------------------------------YNLMGLG....LA.IT..GVAAYVIAML
B9L7A8_NAUPA/35-240----------------------------------------------------YQLLAGS....LI.AG..AVGAYVGMGF
B9M4V9_GEODF/20-227----------------------------------------------------YAWMGGG....LL.VT..AILAMVTISS
B9PLK6_TOXGO/30-235----------------------------------------------------YGALMTN....I..IL..TAVGVYV...
B9SFF8_RICCO/30-237----------------------------------------------------YLIIAIQ....LL.LT.MIGVVAVVILI
B9SFF9_RICCO/27-234----------------------------------------------------YTIISIQ....LL.VT..VAVAATVNFV
B9T0M2_RICCO/34-232----------------------------------------------------YLTLCCA....L..VA..AAAGAYL...
C0NU02_AJECG/69-270----------------------------------------------------YFILSLQ....IL.FT..TVVSCVSFVS
C0QH09_DESAH/17-230----------------------------------------------------YNWMAIG....LA.LT..GFTAFYVSGN
C1D533_LARHH/19-221----------------------------------------------------YMLLALS....LI.PT..IAGALMGINM
C1H044_PARBA/68-269----------------------------------------------------YFILTVQ....LL.LT..TALSSISFFS
E3D723_GARV3/35-248----------------------------------------------------YAEMTVG....LI.VT..TLVAMFTQST
C3YF20_BRAFL/26-227----------------------------------------------------YSSLAIA....M..LA..AAAGAYV...
C3ZWB9_BRAFL/110-326----------------------------------------------------YMYFGGG....II.VT..AATAAAVFRS
C4K3R8_HAMD5/20-232----------------------------------------------------YGWMTCG....LL.LT..AFVAWYAANN
C4KCP9_THASP/19-215----------------------------------------------------YMLLSLT....LA.FS..ALTAGLSMAM
C4R8R2_PICPG/45-246----------------------------------------------------YTLLSIQ....LF.TT..FLTGFIIYNN
C4WRJ7_ACYPI/45-246----------------------------------------------------FSLLILQ....L..FA.FNFMGFFCLFT
C4XFK5_MYCFP/39-263----------------------------------------------------YTLLWFA....FC.MA.ISFGTAFVCTL
C4XRR5_DESMR/21-233----------------------------------------------------YGWMCLG....LL.VT..AAASVFVVSS
C4Y6K1_CLAL4/45-247----------------------------------------------------YALLSIQ....VL.LT..VIVGYVIRSN
C5B7G7_EDWI9/20-232----------------------------------------------------YGWMCCG....LL.LT..ALVAWYAART
C5BTY5_TERTT/18-220----------------------------------------------------YALLAMT....LA.WS..AVTAFVSMAA
C5D2L3_GEOSW/9-205----------------------------------------------------TTTFFLA....LA.VA..TGGLYIGQ..
C5DSS8_ZYGRC/34-256----------------------------------------------------YSILSSQ....LL.LS.LCFIGAVYRFP
C5FIJ8_ARTOC/68-269----------------------------------------------------YSILTVQ....LI.LT..TALSSVSFFN
C5J7D0_MYCCR/10-247----------------------------------------------------YSLMWLG....SA.IA.LIAILSFAIIS
C5LBE2_PERM5/65-267----------------------------------------------------YGILTIG....V..AC..TAAGCWF...
C5M3P9_CANTT/53-255----------------------------------------------------YSLLTMQ....LM.GT..VVMGLIIRSS
C6C1J2_DESAD/18-239----------------------------------------------------YSWMSAG....LL.AT..AAVAWVTLST
C7LXK1_DESBD/17-229----------------------------------------------------YNWMSLG....LG.LT..AVVAYAVATT
C7Q6T3_CATAD/16-211----------------------------------------------------MAFVAGT....AA.LF..ALGAYTGRNL
C7R764_KANKD/20-229----------------------------------------------------YNHLLGAIFAFVL.LS.VYFYQSGI...
C8X4E4_DESRD/18-230----------------------------------------------------YTWMSGG....LL.LT..AVVAFGVINT
D0KXZ9_HALNC/19-216----------------------------------------------------YLMLSMT....LV.FS..AVMAGVSMWM
D1ARJ6_SEBTE/26-237----------------------------------------------------ILWMVVG....LL.VS..GISGFLVMTN
D1AX50_STRM9/12-223----------------------------------------------------YLWMGLG....LL.IT..FGIMYSSLYS
D1B5B2_SULD5/29-227----------------------------------------------------YQLFAAS....LL.AA..SAGAYIGIGM
D3SG31_THISK/26-222----------------------------------------------------YMLLSVT....LA.FS..AVMAFVAMAV
Y819_CHLTR/11-231----------------------------------------------------FSSRVYG....W..MT..AGLAVTALTS
BI1_RAT/24-225----------------------------------------------------YASFALC....M..FV..AAAGAYV...
P73793_SYNY3/32-245----------------------------------------------------LPYLGGG....LV.LT..AAGTFGGLSV
Q03GC4_PEDPA/15-227----------------------------------------------------YGWMAAA....VA.FS..GVIAYLGTTI
Q03RJ4_LACBA/19-226----------------------------------------------------FGWMGAA....VL.VS..AVVAYWMSTQ
Q04EI1_OENOB/23-235----------------------------------------------------YAYMGAA....LL.IT..FGLAYALAYP
Q0A861_ALKEH/21-217----------------------------------------------------YMLLSMT....LL.FS..AAMAGVSMVL
Q0AKK1_MARMM/23-250----------------------------------------------------YNKMGLG....LL.LS..AAIAYAVGTY
Q0BV78_GRABC/37-260----------------------------------------------------FNWMASG....VA.LT..GIVAYAIAHT
Q0BX99_HYPNA/25-254----------------------------------------------------YQKLALG....IA.LS..GGIAFLVGSG
Q0K957_CUPNH/24-226----------------------------------------------------YWLLALS....MI.PT..VLGAWIGVAT
Q0VQ00_ALCBS/24-220----------------------------------------------------YMLLGLS....LV.VA..TSASWFAMAS
Q113G8_TRIEI/22-235----------------------------------------------------LPFVGGG....LV.LT..AVGIFGGLGV
Q11D01_CHESB/26-243----------------------------------------------------YNLMALG....LA.IT..GLAAWGAFNF
Q12N83_SHEDO/17-213----------------------------------------------------YMLLSMT....LA.FS..ALCAGFAMML
Q15T21_PSEA6/19-215----------------------------------------------------YLLLAMT....LT.FS..AVCAGIAAAM
Q168I7_ROSDO/23-241----------------------------------------------------YATMSVG....ML.IT..FAVAWAVGTA
Q17KY2_AEDAE/25-225----------------------------------------------------YSCMALT....C..AA..AATGSIV...
Q1GUZ0_SPHAL/30-238----------------------------------------------------YNYMASG....VL.LT..GIVALLAFQS
Q1HR31_AEDAE/26-226----------------------------------------------------YACLTAT....C..AM..ATVGSII...
Q1J0Z4_DEIGD/13-220----------------------------------------------------YSWMAAG....LA.LT..AGVAYLTAQN
Q1MQ63_LAWIP/21-233----------------------------------------------------YWWMTIG....LL.VT..AGSAFYVANS
Q1QW79_CHRSD/19-216----------------------------------------------------YMLLAMT....LL.FS..AVTAGTAMAM
Q1WUN9_LACS1/18-229----------------------------------------------------YGFMAGA....VA.IS..AVTAYLISNV
Q21K99_SACD2/18-212----------------------------------------------------YALLAMT....IA.FS..AAMAVTSMAL
Q22AT9_TETTS/66-293----------------------------------------------------YKTTGLG....IM.GA..LSTSTLAVSS
Q28T17_JANSC/24-248----------------------------------------------------YGTMSIG....LL.IT..FAAAWAVGAN
Q2G985_NOVAD/35-243----------------------------------------------------YNYMASG....VL.LS..GIVALLFATS
Q2GEZ5_NEOSM/36-247----------------------------------------------------FNYMAAA....LG.IT..GLTAFFVASS
Q2GI89_EHRCR/18-229----------------------------------------------------YNYMAMA....LG.LT..GIVAFFVASS
Q2GIF3_ANAPZ/18-229----------------------------------------------------YNYMALA....LG.IT..GAVAFIASLS
Q2H3P6_CHAGB/69-270----------------------------------------------------YTILTVQ....LI.AT..GAVSALSFMS
Q2KWX5_BORA1/25-228----------------------------------------------------YWLLALS....LI.PT..VLGAAVGLYT
Q2NCY0_ERYLH/35-243----------------------------------------------------YNYMASG....IL.LT..GIIAMLTANS
Q2NU64_SODGM/18-213----------------------------------------------------YFLLSLT....LA.FS..ALTATASTLL
Q2NUJ0_SODGM/20-232----------------------------------------------------YGWMTCG....LL.LT..AFVAWYAART
Q2RNE3_RHORT/28-246----------------------------------------------------YNYLASG....LA.LS..GVIAMSVVYT
Q2SJ24_HAHCH/29-224----------------------------------------------------YWLLGMT....LA.FS..AFTAFLSSSM
Q2VZ47_MAGSA/31-240----------------------------------------------------YNYMASA....LA.LT..GIVAWVIASV
Q2Y6W4_NITMU/21-223----------------------------------------------------YWMLGLT....MI.PT..VIGAMIGMST
Q30NV3_SULDN/27-225----------------------------------------------------YKLFAAS....MM.AG..AVGAYVGVPM
Q30Y49_DESAG/16-228----------------------------------------------------YQWMAAG....LA.VT..AVSAFAVASS
Q31M69_SYNE7/22-233----------------------------------------------------LPFVGGG....LV.LT..SVGVYGGLGV
Q385I6_TRYB2/98-297----------------------------------------------------YGLLAAG....CV.AA..GFGSVLMFAT
Q38XY7_LACSS/13-227----------------------------------------------------YGLMALG....VG.IS..ALVAVLLVTV
Q3A7T2_PELCD/19-230----------------------------------------------------YNWMAAG....LA.VS..AIVALLTVYS
Q3J598_RHOS4/24-242----------------------------------------------------YGLMSVG....ML.LT..GGVAWAFGTS
Q46JI7_PROMT/22-235----------------------------------------------------LPYVGGG....MA.LT..GLGVLGGLSL
Q47HS3_DECAR/20-222----------------------------------------------------YMLLGLS....MV.PT..VIGALVGIQM
Q482E8_COLP3/19-215----------------------------------------------------YMLLSMT....LA.FS..AVTAGVSMAM
Q4FNX7_PELUB/6-228----------------------------------------------------YNYMASG....IL.LT..GLISLIFFKL
Q4N8D7_THEPA/80-287----------------------------------------------------FLIVVLQ....LL.FT..LAVTALV...
A0A0D1DT09_USTMA/150-364----------------------------------------------------FMYLAGG....LT.LT..GAAAVGLHRY
Q4UFQ1_THEAN/30-231----------------------------------------------------YTTLALS....A..LI..TFLSVVI...
Q4UH80_THEAN/67-274----------------------------------------------------FFILVLQ....IL.TT..FGFTALA...
BI1_DICDI/37-241----------------------------------------------------YCALAIG....I..LT..ATVGVLF...
Q5CX10_CRYPI/29-231----------------------------------------------------YSSIIAG....S..FM..TVFGVTA...
Q5FPP8_GLUOX/24-248----------------------------------------------------FNWMALG....LV.IT..GLVAYGVAQT
Q5KDG7_CRYNJ/77-277----------------------------------------------------YSILLIQ....LL.AT..AGVS.ILLSL
Q5R0A7_IDILO/19-215----------------------------------------------------YTLLAMT....LA.FS..AIVATISTMM
Q5TP14_ANOGA/117-333----------------------------------------------------YLYFGGS....LA.IS..AASAVAVFRS
Q609C7_METCA/20-218----------------------------------------------------YALLSLT....LL.FS..AFTAGVSMVL
Q6AMM4_DESPS/24-235----------------------------------------------------FNWMALG....LG.LT..GLVAFFAAGS
Q6BV67_DEBHA/47-249----------------------------------------------------YTLLSIQ....IF.GT..VLVGLIIRSN
Q6CP52_KLULA/27-244----------------------------------------------------YSILLFQ....LT.LT.FAFGLYVYNTP
Q6NDB1_RHOPA/29-259----------------------------------------------------YNYMTIG....LA.IT..GLAALGVYMG
Q728Y2_DESVH/16-228----------------------------------------------------YSWMTLG....LA.VT..AAAAWGVASS
Q7MSL1_WOLSU/32-230----------------------------------------------------YQLFAGS....LL.AA..TVGAYVGLGM
Q7N6P2_PHOLL/20-232----------------------------------------------------YGWMTCG....LL.LT..AFVAWYVSQN
Q7NPB6_GLOVI/18-221----------------------------------------------------FAAMGIS....LA.LT..GAVSWWASAL
Q7NUQ5_CHRVO/19-221----------------------------------------------------YGLLGLS....MI.PT..VMGAIVGTHM
Q7Q6L7_ANOGA/26-226----------------------------------------------------YGCLAAT....C..ST..ATVGSLI...
Q7SG99_NEUCR/80-281----------------------------------------------------YTILTVQ....LI.AT..GAVSALSFLS
Q7UU92_RHOBA/29-242----------------------------------------------------YAHLSGAVFAFLA.LE.VVLFTLVP...
Q7V0H4_PROMP/22-235----------------------------------------------------LPYVGGG....MV.LT..SLGVLAGVSL
Q7V8J4_PROMM/22-236----------------------------------------------------LPYVGGG....MV.LT..AGGVLGGIAT
Q7VHQ2_HELHP/27-224----------------------------------------------------YKFFGAS....LF.FA..FIGAMIGFMY
Q82VP8_NITEU/21-223----------------------------------------------------YLMLSLT....MI.PT..IVGSVIGTGT
Q89DW5_BRADU/21-228----------------------------------------------------YNYMAAG....VG.LT..AVVAWLTYQL
Q8D225_WIGBR/18-213----------------------------------------------------YLLLSMT....VA.FS..AIVATISSIF
Q8DLM2_THEEB/69-280----------------------------------------------------LPFLGGG....LI.LT..AIGSWGGLGV
Q8DSQ2_STRMU/15-225----------------------------------------------------YGLVGMG....IG.LS..AVVSYLMLYV
BI1L_ARATH/47-251----------------------------------------------------YGILSAQ....LL.LT..TLISAVVVLN
Q97FA9_CLOAB/14-227----------------------------------------------------YMWMTLA....LL.TT..AGVALAVSTS
Q98E98_RHILO/25-253----------------------------------------------------YNLMGLG....LL.IT..GLAAVGTIML
Q98MW5_RHILO/25-234----------------------------------------------------YNYMGLG....LV.VT..GLVAFLVSST
Y3663_CAUCR/26-245----------------------------------------------------YNKVALG....LV.VS..GALAYATSSV
Y402_PASMU/18-213----------------------------------------------------YFLLGLT....LA.FS..AVVAYISMSL
A1U0T3_MARHV/34-226----------------------------------------------------YMLLGMT....LA.FS..AVTAFLN...
A3MYZ6_ACTP2/20-214----------------------------------------------------YLLLSMT....LA.FS..AVIAFAAMSM
A4SYE4_POLSQ/23-225----------------------------------------------------YALLALS....MV.PT..VIGAWLGVAM
A5VKY2_LACRD/20-231----------------------------------------------------YGNMTLA....VL.VS..AFSAYLTMGV
A5VLC3_LACRD/18-228----------------------------------------------------YGLMTLA....VL.LS..ALTAWLVMTV
A6WV27_OCHA4/28-256----------------------------------------------------YNMMAIG....LA.VT..GLAAFAVAAL
A8QEE8_BRUMA/112-349----------------------------------------------------YGYLFTS....LG.IT..AASAVVASRS
B0UVR0_HISS2/19-213----------------------------------------------------YFLLALT....LA.FS..SVVAFSAMQL
B1VUQ0_STRGG/78-285----------------------------------------------------A..MTLG....TV.IV..AATAAWWLLP
B1X0P3_CYAA5/23-235----------------------------------------------------LPFVGGG....LV.LT..AVGTYGGLGV
B2GDC3_LACF3/20-230----------------------------------------------------YGLMSLA....VF.VS..AITAYLTMTV
B7JXJ9_CYAP8/23-235----------------------------------------------------LPYLGGG....LV.LT..AVGTYGGLGV
B8DT88_BIFA0/45-255----------------------------------------------------YGEMCLG....LL.VT..AAMAIFTQMS
B8MD34_TALSN/62-262----------------------------------------------------YSILTVQ....IL.LT..TVLSSVSFFS
B9H8C6_POPTR/29-232----------------------------------------------------YTIIAIQ....LL.VT..VAVATAVVSV
B9KH79_ANAMF/18-229----------------------------------------------------YNYMAAA....LG.LT..GVVALMTSFS
C5AQF7_METEA/29-251----------------------------------------------------YNNMVVG....LG.IS..GLVALALNMA
C5XB01_SORBI/38-244----------------------------------------------------YVILSLQ....LL.LT..AVVAAVVVKV
C5ZYY2_9HELI/29-227----------------------------------------------------YQLFAGS....LL.AA..TIGAYIGISA
C8WS49_ALIAD/11-207----------------------------------------------------FLGLCAS....LV.TA..GAGVVVG...
D1BNX5_VEIPT/23-243----------------------------------------------------FLWMVVG....LL.TT..IGVGFAALVN
D2YW23_ZYMMO/30-238----------------------------------------------------YNYMAGG....VL.LT..GIVAYLVAHS
D4KAL4_9FIRM/19-226----------------------------------------------------YRWMALG....LL.IT..FAAAFVTATT
D4Z0E6_SPHJU/30-240----------------------------------------------------YNYMASG....VL.LT..GVVAMLFASS
D4Z6C9_SPHJU/23-231----------------------------------------------------FRNMGIG....LV.IT..GLVAAFIGNT
D6DJ22_CLOSC/23-231----------------------------------------------------FLWMFAG....LL.VT..FAMAYTGYAT
E9DBQ0_COCPS/66-266----------------------------------------------------YSILTVQ....LL.VT..AGLSAVSFFN
F3ZIX9_9ACTN/83-294----------------------------------------------------AGTLGT.....LI.VF..AALAWAVLPV
F4B2Y9_DOKS4/21-229----------------------------------------------------YTYVALA....VL.LF..IITEYLFFQS
F4KL14_PORAD/29-237----------------------------------------------------FGWMAMC....LL.IT..ALTAMGVVNS
US17_HCMVM/41-246----------------------------------------------------YSTVAVQ....GT.CT.FLLCLGLVLAF
US12_HCMVM/52-254----------------------------------------------------YGTVVFQ....TS.AT..IATTILFMLI
US15_HCMVM/42-247----------------------------------------------------YGAVGWQ....LAGLT..ALLSAFCYAA
US20_HCMVM/27-225----------------------------------------------------YAIFIFQ....LA.FS.FGLGSVFWLGF
US21_HCMVM/14-213----------------------------------------------------YILIWVQ....CL.IL.MSVCAFCWLVL
F9UNP4_LACPL/20-232----------------------------------------------------YGFMTIA....VL.VS..AFTVYLAMTT
G2LFD7_CHLTF/34-232----------------------------------------------------YALFLGG....IF.CA..MAGVAVSIVT
G2SP46_LACRR/20-227----------------------------------------------------YGYMAAA....VG.IS..AVTAFMAANV
G8PGI6_PSEUV/16-232----------------------------------------------------YNYMAIG....IA.IT..GVVAYAAFQM
H0Z6Q0_TAEGU/121-335----------------------------------------------------YMYFAGS....IG.MT..ALSAAAVSRS
H2Q6E8_PANTR/80-279----------------------------------------------------YSILSLQ....VL.LT..TVTSTVFLYF
H3G6E5_PHYRM/28-229----------------------------------------------------WLITALG....LV.AT..AGLAWGAKYI
H9J0X8_BOMMO/52-266----------------------------------------------------YGYIAGS....LV.LT..AGSAVAVFRT
H9JB99_BOMMO/22-222----------------------------------------------------YATLMMT....C..VS..ASAGVYV...
I0DXE2_PROSM/20-231----------------------------------------------------YGWMTVG....LL.LT..AFVAWSTLNS
I3U2E9_ENTFC/13-223----------------------------------------------------YGFLGMG....LA.LS..AVTSYLALWV
J9Z9N1_LEPFM/27-227----------------------------------------------------YGLLAVT....LA.VS..AASAVWGMGA
K4AEB8_SETIT/31-237----------------------------------------------------YVILSVQ....LA.MT..ALVSAFVVKV
M1BP72_SOLTU/31-237----------------------------------------------------YSIISIQ....LL.LT..IAVASVVVTV
M1FFW7_9ALTE/31-232----------------------------------------------------YTLLAMT....LA.FS..AVMAAVAMSV
M4E009_BRARP/33-231----------------------------------------------------YLTLCCA....LV.AS..AFGAYL....
C6XEX3_LIBAP/26-254----------------------------------------------------YNLMALG....LG.VT..GIMSFLVNIL
Y920_HELPY/26-221----------------------------------------------------YKFFAGS....LL.LA..TIGALLGLMN
YBHL_ECOLI/19-230----------------------------------------------------YGWMTVG....LL.LT..AFVAWYAANS
Y044_HAEIN/19-213----------------------------------------------------YFLLGLT....MA.FS..AVVAFISMSL
Y2604_PSEAE/21-215----------------------------------------------------YGLLALT....LA.FS..GLVAYVS...
Q037Y9_LACC3/14-229----------------------------------------------------YTLMGSG....LV.VT..ALVSYLLGFP
Q03YA2_LEUMM/20-231----------------------------------------------------YSFMGIA....VL.LT..AVTGFIVQNF
Q1GBC8_LACDA/21-230----------------------------------------------------YSIMGLA....VL.VS..SLTAYLTLTV
Q28GN8_XENTR/24-225----------------------------------------------------YSSFAIC....ML.VA..AAGAYVNVVL
Q2G0D3_STAA8/18-207----------------------------------------------------WLYFMYY....WI.IF..GIGCYLG...
Q2IGP2_ANADE/25-232----------------------------------------------------YRWMTLG....LG.VT..ALVATAVASS
Q3IXM5_RHOS4/24-232----------------------------------------------------YNYMGLG....LA.LT..GLVAVLVAAT
Q3JAM0_NITOC/20-215----------------------------------------------------YTLLAAT....LL.FS..AVTAGVAMAV
Q4A983_MYCHJ/32-262----------------------------------------------------YSLFWLG....IA.ILFIGLLTFAILSI
Q5F552_NEIG1/17-220----------------------------------------------------YRLLGFS....FI.PA..AAGAALAANA
Q5M633_STRT2/16-225----------------------------------------------------YGLVGIG....VG.IS..AVISYLMLFP
Q5NH29_FRATT/24-220----------------------------------------------------YWLLSMT....LL.FS..AFTAFIAMST
Q5ZWY5_LEGPH/21-217----------------------------------------------------YLLLSLT....FI.FS..ALTAYVAFIS
Q63UT7_BURPS/27-229----------------------------------------------------YWLLALS....MV.PT..VLGAWVGVAT
Q6F386_ORYSJ/35-240----------------------------------------------------YVIVSVQ....LL.VT..VAVAGAVNLV
Q6ZEY7_ORYSJ/10-215----------------------------------------------------YAIVATQ....LV.VT..VAIAAAVYSV
Q74I60_LACJO/20-231----------------------------------------------------YGMMTIA....VL.VS..ALSAYLTMTV
Q7CH71_YERPE/20-232----------------------------------------------------YGWMTCG....LL.LT..AVVAWYAANT
Q7MW50_PORGI/22-232----------------------------------------------------FTWMFGA....LG.IT..ALTAMLVAKS
Q833N8_ENTFA/14-224----------------------------------------------------YGFLALG....IG.IS..AIMAYAMTTV
Q83EU5_COXBU/22-236----------------------------------------------------YLWMVLG....LA.LS..AGTGYYIFSH
Q8DNE4_STRR6/21-231----------------------------------------------------YAFVGLG....IG.LS..ALVSGLMLTV
Q8DY88_STRA5/15-225----------------------------------------------------YGLVGIG....VG.LS.AAVSAIMLYMF
Q8EKF7_SHEON/22-217----------------------------------------------------YNLV.IG....LT.LV..WGFAVNYAMV
Q8RF52_FUSNN/10-220----------------------------------------------------FLYMILG....IA.IS.FGTGAYLLYFN
Q8Y034_RALSO/24-225----------------------------------------------------YWLLALS....MI.PT..ILGAWIGVAT
Q8Y569_LISMO/22-221----------------------------------------------------LNWFVFS....LL.LA..SIGAAIGSKL
Q8ZKW9_SALTY/20-228----------------------------------------------------YLHLAVA....IV.GF..IVLSAAWSFI
Q8ZQ61_SALTY/19-213----------------------------------------------------YFLLSLT....LA.LS..AITATAST.V
Q8ZQP8_SALTY/19-218----------------------------------------------------YWYTALG....LW.CT..AGIIWLTLY.
Q94GN3_ORYSJ/18-224----------------------------------------------------YAILSIQ....ML.LT..IAVASVVVFV
Y358_STRP1/15-225----------------------------------------------------YSLVGMG....VG.LS..AFVSYLMLYP
YRJE_LACLA/17-226----------------------------------------------------YALMGAG....VL.VS..ALVSWIMITF
Y1358_VIBCH/20-216----------------------------------------------------YFLLSMT....LV.TS..AIAAMATMAI
BI1_ORYSJ/35-232----------------------------------------------------YLTLCVA....LA.AS..AVGAYL....
Y236_CAMJE/25-225----------------------------------------------------YQLFAAS....LL.AA..TVGAYVGIFA
Y147_RICPR/22-231----------------------------------------------------YNYMALA....LL.LT..GVAAITTISV
R4G5C7_RHOPR/23-222----------------------------------------------------YACLTLA....T..LA..AATGAYI...
R5F0I7_9CLOT/22-230----------------------------------------------------FGWMFAG....LL.VT..FIVAVGFAMT
R5X7M8_9CLOT/13-219----------------------------------------------------FKYLSIS....IV.FM..FVGFLFG...
R6BXE5_9BACT/36-246----------------------------------------------------YTWMTLA....LL.IT..GVTAYGVASS
R6MUP2_9BACE/18-220----------------------------------------------------YTWMTLA....LV.IT..GFVSMYVAKS
R7G836_9FIRM/17-227----------------------------------------------------FLWMTIG....LL.TS..ALVALLVSLT
S5QYX2_9STRE/16-226----------------------------------------------------YGLVGMG....IG.LS..AFVSFLMLYV
U5L5J4_9BACI/11-205----------------------------------------------------LRAFALS....LA.FA..FLGTMAGV..
V6F839_9PROT/25-234----------------------------------------------------YNMMALG....LA.LT..GGVALLVASS
W5PL52_SHEEP/122-337----------------------------------------------------YMYLAGS....IG.LT..ALSAMAVSRT

PF12811

C7NEU4_KYTSD/18-275VEELPAAASP....................IWLVG..MFG....S.....LA...----LSFAIG-------F.SKK---
F4EZD3_SELS3/14-236GYATPT........................TTMVT..AVM....G.....LI...----TALIVS-------F.KPG---
R5G4T6_9FIRM/7-239ALTYPSMFVILA....................VSS..GMV....T.....LI...----SSIVAL-------L.SIR---
B1GZ32_UNCTG/3-236PGVIAP........................LLFPI..SIG....A.....FV...----LAFVSI-------F.KKT---
D7WE18_9CORY/5-299GI.............AV......DPSISMILTFVG..AIG....G.....LI...----TVLIHS-------FGGKY---
C6WKQ5_ACTMD/6-268LV.............LT......GAVNPIALTLPG..MII....G.....LV...----VSLIII-------F.KKT---
K4QW36_9ACTN/5-282.LPVDEA................NLGRSYGVALGG..GLA....A.....VV...----LSLVQA-------F.RRA---
M4NLN8_9GAMM/5-249FAGPDSLPAMLP..................LVLGG..ALG....G.....LV...----LGLVTA-------F.KKT---
F8A7A7_CELGA/3-266VETLPW........................LWIAG..AVV....G.....LV...----LGLVNA-------F.KRE---
V6JXB5_STRNV/5-292.LPVDQD................NLGKSYGIAIGA..ALV....G.....LV...----LALVQS-------F.KRK---
U5Q5X0_9BACT/3-248AYEAINPASLQP..................WMWGG..VIG....G.....FV...----VAMIIS-------F.KPI---
D1A7P0_THECD/5-261VP.........................LPTAMAVA..VVA....F.....LLQLG----LGLFIS-------F.TQK---
D2PP90_KRIFD/5-279IPTDLVTP......................AFLGG..ALV....A.....FA...----LGMVLS-------F.SRK---
J9SCB5_9ACTN/32-313IS..............SRATESAQAALATPLMLVG..AIA....G.....LV...----LVLVAS-------FGRKQ---
Q6NI55_CORDI/5-275AT..............V......NPGLALILTGVG..AIG....G.....LI...----TVLIST-------FGRKY---
A9NEU4_ACHLI/5-242AQVMPEGLLFG...................ILISS..GIF....A.....FI...----SVLLAM-------F.VPK---
R5EEE2_9GAMM/5-247TINSVYTTGQVPNG................LMLGS..VIL....G.....FI...----VALVTI-------F.KPT---
A5WFW8_PSYWF/5-242IIRGGISGGMAQM.................ITFGS..MFA....A.....FG...----LALFIT-------F.RPQ---
R7XUD5_9ACTN/14-304TGDSITEAGTTNPDAVGKLYL.........ALMVG..SFG....A.....FA...----LSMVNS-------F.KKV---
K0FCH0_9NOCA/6-286TN..............A......NTSLAPLFVIGG..GLI....G.....LV...----LVLIAS-------FANKM---
D8UI29_VOLCA/59-300IASGNASVM.....................LAASKGAGVV....A.....LL...----SAMVTM-------F.KPQ---
W8KJ18_HALHR/28-265QFYPGVAAGNEQAANLARN...........IGFGG..GVF....G.....LS...----LVMLTA-------F.YRH---
Q0S4B9_RHOJR/28-305VS..............N......NANLASPLVIGG..GLV....G.....LV...----LVLVAT-------FGRKM---
D6YTM1_WADCW/5-246FFQSGGNPAAVQT.................WMWVG..LLG....G.....LG...----LAIATV-------F.KKE---
C4L1D1_EXISA/6-242VPTIGEGLLFP...................LMIGS..LIL....G.....FI...----FALLIT-------F.KPN---
F1TJZ5_RHOHA/9-283VD..............G......NTNLAAPFVIGG..GLI....G.....FV...----LVMVAS-------FGRKM---
Q6LYY5_METMP/5-242LFFSPYSTI.....................FLIAA..PIL....G.....FL...----VALATI-------F.KKE---
B2KC47_ELUMP/5-240.....................SRPEPLLP.WIWPI..SIG....A.....FV...----IAMIVI-------F.NKR---
F4F5D9_VERMA/5-290V......................PDALLGVAWIGA..AIV....G.....LV...----LGLVIS-------F.SKM---
F5YTZ5_MYCSD/6-286VS..............A......NQALAAPLTFIG..AFG....G.....LA...----LVMVAM-------FTRRQ---
Q9KZ65_STRCO/5-305.LPVDDA................NISRSYGIGIGA..ALI....G.....MV...----LALVQS-------F.KRK---
E1VTL5_ARTAR/3-266PA............................LMLPG..ALV....G.....FV...----LGLVNA-------F.KKR---
F8E0H2_CORRG/12-305FS..............S......DSALAMPLFFLG..LIG....G.....FI...----TVLISA-------FTKNY---
M1P5T4_9CORY/5-275SL..............F......NPGLAMLLTVVG..AIG....G.....LI...----TVLVGT-------FGKKY---
F6GI76_LACS5/9-242HTSGTNIKW.....................FGTGG..MIA....A.....IV...----ISIVLS-------V.RQH---
C9YY45_STRSW/5-291.LPVSPT....................SYGLAIGA..ALI....A.....FV...----LAMVQS-------F.KRK---
G8TNU9_NIAKG/8-251VYSNVDVMT.....................YMWVS..IFG....A.....FI...----LALIAN-------F.KKE---
A6W6X9_KINRD/11-281VRSGQMGFG.....................LVIGA..ALV....G.....MV...----LGLWAQ-------L.SKK---
D7BXA1_STRBB/5-298ELPV.........................AVGFGA..ALV....A.....MV...----LGLVQS-------F.KRK---
D6Z909_SEGRD/6-274TL..............Q......TPALGGPIAMIA..GLV....G.....LG...----LVLFAT-------FGRQQ---
D5UKL3_CELFN/3-271APQ...........................LWIVG..MLV....G.....LV...----LGLVNA-------F.KKN---
E3EBZ5_PAEPS/5-244TYQGTIEVLS....................LMTAG..FIG....M.....AG...----IALSIS-------F.FPK---
I4A1A9_ORNRL/7-250IDEKLLLDNEFNFMP...............YLWGS..VIG....G.....FI...----LALVIT-------F.KPN---
F5XTM3_MICPN/6-278VPPSLYMPA.....................LILSG...............LVGFG----VVLLVS-------F.RRN---
X5DKM9_9CORY/5-292GT..............S......SPNLAMGLTFVG..AIG....G.....LV...----AVLVSA-------FGKKY---
H6RSJ3_BLASD/5-276A..............MP......GQA.ALGLALPA..VLI....A.....FV...----LGLVIA-------F.KQI---
A5FKK6_FLAJ1/12-255AFNGMNIMI.....................PAIGG..AIV....G.....FV...----LVLISA-------F.KPH---
Q47SU4_THEFY/8-319AMLVNP...................ALSVVMLVIG..AIG....S.....LI...----LGLVIS-------F.TRS---
F4GYG7_CELFA/3-268VPG...........................LWIVG..AVV....G.....LV...----LGLVNA-------F.KRE---
D6ZKK1_MOBCV/18-273TATNPGLGMS....................VAFVS..MLV....A.....LV...----LGLVNS-------F.KRR---
E8NDS9_MICTS/10-292SMAGVSVANPSPSAA...............PMIVG..GLV....G.....FV...----LAMVAI-------F.KKK---
Q8XKZ0_CLOPE/6-239FQNPDVNYKSALV.................VSLGG.........S.....LI...----LGLLTS-------F.IPK---
F6FSN3_ISOV2/3-284APG...........................LWPVG..MIA....G.....LV...----LGLVNA-------F.KKK---
M4ZW38_9ACTN/48-277SSGPTLENGQETYQFPA.............IATIG..IVV....G.....FV...----AVIASS-------F.KPM---
D3EHX0_GEOS4/7-244FFNGYEVFP.....................FMIGG..AIG....G.....FV...----LALIIS-------F.VPK---
Q11SC4_CYTH3/5-241MTAGGNGVI.....................YVIAS..AIL....A.....LI...----VGLATS-------F.KPT---
A0R2Y3_MYCS2/6-277VA..............G......NPGLMMPTFFLG..SIG....G.....LV...----LVLIAT-------FGRKQ---
C2WZP8_BACCE/5-241MMQGTMKMP.....................VLIGA..LVI....A.....AI...----IAFASI-------F.FPR---
C5C0C8_BEUC1/28-297PQALGAPQLVWP..................LMLVG..AIG....G.....LV...----LGLVNS-------F.KRE---
D9TB20_MICAI/19-252VPQA..........................AWISA..ALA....GSALASLA...----LVLVIS-------L.KQI---
H2JL64_STRHJ/50-293.LPLAAP................GAAASYGVAAGA..GLL....A.....AA...----LVVVQR-------R.RNP---
U3GYX0_9CORY/5-290GT..............V......APGLAMGLALIG..AIG....G.....LI...----TVLVST-------FGKKY---
R6SY18_9FIRM/13-260HNFFGGGAQAFSTEYT..............IFVGA..IIA....T.....AI...----AGLVAS-------F.APK---
Q4JU62_CORJK/5-300GL..............S......YSGIAMGLTFVG..MIG....G.....LI...----AVLVSA-------FGKKY---
F8JW88_STREN/75-299.LPVDAK....................GYTMATGS..ALV....A.....FV...----LAMVQS-------F.KRT---
F8AVU2_FRADG/8-276AP........................TTPAVGFTA..MFA....A.....LA...----LSLVIS-------F.GRR---
R4T3W7_AMYOR/6-277AISQLPVDAAGRITGIS......GGV..IGALVGG..MIV....G.....LV...----ISLVII-------F.KQK---
D9TB19_MICAI/5-283V......................PDSLVGVAWIGA..AVV....G.....LV...----LGLIIS-------F.SRM---
D6Y882_THEBD/39-278NL.........................GPGVAGLA..ALV....G.....LV...----LGLIVS-------F.RQS---
I0GZ05_ACTM4/5-279I......................PASATGAAWIGA..ALV....G.....LV...----LGLVIS-------F.MRV---
G0HFP4_CORVD/5-290GQ..............S......NASLAMGMTFVG..AIG....G.....FI...----AVLVSS-------FGKKY---
F6EQM2_AMYSD/6-278TN..............T......NPGLAPILVFGG..MIV....G.....LV...----LVLVAV-------FGKKM---
A4F854_SACEN/6-264...............LM......GPA.ALGLALPA..AII....G.....LV...----LAMVVI-------F.KKK---
K7RRB1_PROA4/23-286VRDN..........................IALIGGAAVLSSLVG.....FV...----TVLIVS-------T.RAK---
R7J8A1_9FUSO/3-241LFTTPSLVPA....................MMIGG..GLI....G.....FI...----LVIVTC-------F.NVK---
B1MKI6_MYCA9/6-280VS..............T......NPGLALPFLLVG..GFG....G.....LI...----MVAIAS-------FGRKQ---
D7GFC1_PROFC/5-270TAVNPAMALP....................LALGS..SVI....A.....LV...----AAILVT-------V.RRS---
E3H5K2_ROTDC/58-316PY............................LMFVG..LIA....G.....LI...----LGIVNA-------V.KRK---
V5XGM6_MYCNE/6-283VS..............T......NLSLATPFTLVG..ALG....G.....LA...----LVLIAT-------FGRKQ---
E2SBJ7_9ACTN/5-279IGDLATEGALATAFA...............FAMGG..AIV....G.....LV...----LSLVNS-------F.KKV---
F8KWJ3_PARAV/5-245FYQTGDVQVVYP..................WMMLG..AIG....G.....LV...----LALVTA-------F.KKE---
H5XAT9_9PSEU/6-270AQSQVAANSM.............GAV..TGAMIAG..MLV....G.....LV...----LALVIT-------F.KQM---
A1SF75_NOCSJ/5-293TPDIENGQISGGLVA...............AVTLG..SLG....A.....FV...----LSMVNS-------F.KRV---
E4NG71_KITSK/6-291.LPVD......................NFGPAIGA..ALV....A.....MV...----IGLVVS-------F.KRS---
E8R4F5_ISOPI/10-246IPQGEMAFG.....................WLIGG..AIV....G.....LI...----VGLITS-------F.KPT---
W5W111_9PSEU/6-255NF.........................PMWTAFAA..MLV....G.....FV...----LSLVII-------F.KQV---
Q9CB64_MYCLE/6-284VA..............S......NFALATPLTLAG..VFG....G.....LA...----MVLVAT-------FGGKQ---
A9WUA8_RENSM/12-288PI............................LMLPG..VIV....G.....LV...----LGLVNS-------F.KRE---
H2JJR6_STRHJ/5-286.LPVDEA................NIGRSYGLAVGA..ALI....A.....FV...----LSMIQA-------F.KRA---
L0HDS4_METFS/6-241LPADAIP.......................VILVS..VVA....A.....FV...----IGFVTS-------F.YTA---
B1V9N1_PHYAS/18-261FKMTQLK.......................FPYLWMIKVIFLTSS.....FATSI----FYIAAM-------L.RVE---
B1YES9_EXIS2/8-243LAANPQFLVP....................ALIGG..VVL....G.....LI...----LALIIT-------F.KPR---
D7BKM9_ARCHD/9-266VPVPSMYA......................IALIS..SLA....A.....LG...----VGFFAA-------F.KPM---
L0D6N3_SINAD/5-254TQNQHLSMA.....................VLPAA..GIG....G.....MI...----LALITI-------F.KPT---
W5XU43_9CORY/5-268AV.............FV......DRGIAMILTLVG..GIG....G.....FI...----TVLVAT-------FAKKW---
C5C991_MICLC/36-290PG............................LMIIG..AIA....G.....LV...----LGLVNA-------F.KRE---
Q6AD52_LEIXX/5-268PA............................LALPA..ALI....G.....FV...----LALVNI-------F.KKK---
E6SCQ6_INTC7/5-292VDANPGLISP....................LWLGG..MFG....T.....LI...----LGFAMM-------F.MKN---
R5L7T8_9SPIR/3-242VLARNIELLYP...................AVMVS..SIG....A.....LL...----LAIIMI-------F.KKE---
C1F3Q6_ACIC5/5-243FFSAGPAAVNG...................LMILG..LIG....G.....LI...----FALVTS-------F.KAE---
D7B6X7_NOCDD/7-306FSS.AP...................GIAVVLTLVG..ALG....G.....LV...----LGLVIS-------F.KQI---
Q6F806_ACIAD/5-242CAFTANVGIAYA..................AMWVG..AIG....G.....LI...----LALVAT-------F.KSS---
W5Y0J1_9CORY/5-268AA.............FV......SPGMSMMLSMVG..AIG....G.....FV...----MVLVSS-------FGKKY---
C8XKQ4_NAKMY/6-258Q..........................AYYLALPG..ALI....G.....FV...----LAMVVI-------F.KRK---
Q6AAB4_PROAC/3-276IGPNVVASGP....................ALVVG..SIA....A.....FI...----TAMVVS-------T.RRT---
G8SIP5_ACTS5/5-282V......................PISMTMVAWIGA..AMV....G.....FV...----LGMVLS-------F.MRM---
D5UV23_TSUPD/6-297VG..............A......NPGLATPLTIVG..AIG....G.....LV...----LVLIGT-------FGRKM---
D5VB45_MORCR/3-239ALSINVSSSLLYA.................MALVS..VFA....G.....MG...----VGLASA-------M.KPH---
C0R118_BRAHW/3-242LLAANPGLLYP...................AALVS..SMA....A.....FV...----LALIMI-------F.KKE---
F8EFI0_RUNSL/3-242FASNPALIMP....................LAIGG..AVA....G.....LV...----IALILA-------F.KQH---
C3PFB1_CORA7/5-266GE.............LV......NPGIAMILTLVG..ALG....G.....FV...----TVLVST-------FGKKF---
B2HT80_MYCMM/6-279VA..............Q......NIALAMPLTLVG..ALG....G.....LA...----LVLVAT-------FGRKQ---
I2EWG6_EMTOG/3-238LMQGWSIAPM....................LIPAG..CIG....G.....LL...----CAIVLA-------F.KKE---
X4QYH9_9ACTO/9-284LPPATWVS......................AATVS..VIG....A.....FI...----VGMILA-------F.QRM---
L0J173_MYCSM/6-280VA..............Q......NLALATPLLMVG..MIG....G.....LV...----LILVAI-------FGRKQ---
C7QZY5_JONDD/3-275APQ...........................LFFVG..AIV....G.....LV...----LGLVNA-------F.KKE---
D5SQ37_PLAL2/5-247LQNNPQLLMP....................SLIGS..AIG....G.....LI...----ASLCVC-------F.WLR---
W5TW08_9NOCA/6-283TA..............A......NHSLAPLFVIVG..GLV....G.....FV...----LVMVAT-------FGRKQ---
J7L8F6_NOCAA/7-307FDPFSP...................GLSLGLMVLG..ALG....G.....LV...----LGLVIS-------F.KQI---
B3R032_PHYMT/12-261FNGGLTVQPAKIT........................ALNDRKVSIILILFVLPI----ISFILI-------I.GSR---
A8L155_FRASN/44-265SP........................DSPGIALGA..GVA....A.....LA...----LSFVIS-------L.RSR---
G0FRN5_AMYMS/6-277AQVQLA..ETGR...LS......GAL..IGAMLGG..LIV....G.....FV...----ISLVII-------F.RRK---
A8J2B1_CHLRE/71-312ILTGNVAL......................LAASKGAGLV....A.....AL...----AALVTM-------F.KPQ---
A0JU33_ARTS2/31-306SMPLASL.......................LMIVG..ALG....G.....FV...----LALVNT-------F.KKQ---
C4LHM7_CORK4/5-292SL..............S......NPQVSSLLTMVG..AIG....G.....LI...----MVMVST-------FGKKF---
R6P635_9CLOT/22-243AFMGYADKV.....................MMIMGIALFA....G.....LG...----TGLVTA-------F.VPK---
F4CVB9_PSEUX/6-269G..........................AFVLTLPA..FIV....G.....FV...----VSLIVI-------F.KQS---
C7M9W4_BRAFD/40-305PYALSFVAGDAGAQAG..............LALTGLATLVGVIGG.....LV...----AALVNI-------F.KKQ---
E3ITH9_FRASU/8-268VD........................SAPGLVFGA..GIA....A.....FV...----LSLVIR-------F.TGR---
I6XVQ8_PROPF/3-275LPLS..........................LVFPA..MIVGGLGA.....FV...----VSLLVV-------T.RHK---
Q8NRR2_CORGL/5-271WL..............V......SPGLGMILTLVG..AIG....G.....FI...----TVLVST-------FGKKY---
I0II89_PHYMF/20-264TMAAGSPPAM....................YLLVG..GIG....G.....FI...----AALVTI-------F.KQT---
Q4FRP4_PSYA2/3-240ALMAGLSQGFITM.................AAFGS..MFA....A.....FG...----LAIFIT-------F.KPQ---
I0GPK4_SELRL/3-236GYAT..........................MVTTAVACVG....C.....LI...----MTFIVS-------F.KPS---
I5B600_9DELT/19-256IFYSAIALGDHATAELARN...........IGFGG..GVL....G.....LS...----LAFLTM-------L.YRQ---
X5DVG1_9BACT/9-254FFDAGATTIEGGLAAVGP............WLAIG..GIG....G.....FI...----TVLVTV-------F.RPQ---
D2B2I8_STRRD/5-259NL.........................GTAALLVG..VIA....G.....LV...----LGLIVS-------F.KQS---
D2NP91_ROTMD/12-332PV............................LLLLG..MVG....G.....LV...----LGLVNS-------F.KKK---
G4SY51_META2/29-260YFYPSIASNDKVVANIVRN...........IGFGG..GVF....G.....FS...----LVLLTA-------F.YRH---
C7PNV4_CHIPD/9-246PGRNQNPLP.....................FLYGG..MIA....G.....VI...----ITLIIM-------F.KNE---
I4ESR8_MODMB/7-273A..............MP......GNS.GIALALPA..ILI....G.....LV...----LGLVIS-------F.KQI---
D7DQS6_METV3/5-250YSSSAGFASL....................LGIGG..IIV....G.....FI...----LALVIS-------F.KNT---

PF01027

B6KHI7_TOXGO/120-329HAT.........................RQWVQTNGDSLLLLG.......GLSGI....AVLL.AMTCN...PGITR...
A8N382_COPC7/125-339G..............................FTFRLMAANPWV.......VLGVS....LVGS.IGTMM...GVYYT...
A0CUW2_PARTE/56-286KSQK.......................LKENETFNFHFALYYG.......SFAIT....IALGIAGYVL...DKTRQ...
A0DUN3_PARTE/28-241IP............................IIDSLCSRPLLFW........IFIV....VLILVIFLLMRFQ.KLAK...
A0LGQ6_SYNFM/17-228STT..........................SRLLAQY.PGLMLG.......LVLAE....LGLV.I.AIS...A.GIN...
A0RRR6_CAMFF/25-219I...............................KTFS.....WM.......LLIVE....FALL.F...G...LM.FS...
A1A283_BIFAA/75-289GAY.........................IALIQSLG.VIGAWA.......PFVVE....IVIA.I.YLG...A.RIE...
A1AQX9_PELPD/20-227PGL..........................LGAVAGN.RLIFFG.......LMIGE....LAMV.A.VLS...A.AIN...
A1AX37_RUTMC/15-212N...............................LPHFGLLITFG.......GYF.......GLL.Y...L...TNKL....
A1B1U7_PARDP/24-252ALSDTPTQWALG........NGHYLTEFGKTLYLSP...LKWV.......VMFAP....LVMV.F.AFG...A.ALN...
A1S6I1_SHEAM/16-212G...............................ISPLMSLGFAI.......GGF.......ILL.F...V...TLRK....
A1SWS6_PSYIN/18-214Q...............................IGPTASLVLML.......VGF.......GTL.F...I...VSKN....
A1TSD8_ACIAC/21-222GIT..........................QSLRGGVGLIVFLG.......GAF.......GFM.F...A...IEKT....
A1WWU6_HALHL/25-221D...............................APRLNIFVVLG.......GFF.......GLL.F...L...TQYL....
A2SF80_METPP/20-223GFS.........................FFAGSPFIGFLLFMG.......IAF.......GFF.F...A...IEKF....
A2SGJ7_METPP/35-231Q...............................LPAPGILLTLG.......GYF.......GLL.F...A...VYKF....
A3LXU5_PICST/45-247PS...........................IKEWCFSNMWLFAI.......TMIGS....IGFL.V...A...THFKA...
E0TG86_PARBH/24-234MTNRA......................AFEFASGLSF.IPFIG.......VLALG...........FFA...PKMIF...
A4G4J7_HERAR/19-221KFA.........................FFAASPFMGMMVFLA.......IAF.......GFF.Y...A...IEKF....
A4I0V7_LEIIN/109-308P..............................MGRAIPYWLPMV.......GGFVP....LLWLSF..........AP...
A4VX37_STRSY/17-227FQS.........................LLLSLLSAGSIIMML.......IMIGQ....IALV.V.SAS...A.MAA...
A5CDM3_ORITB/21-240EPLARLM..................FNFSPNGYVIGQTPIGLL.......VNVAP....IGIA.L.YFF...W.GIG...
A5DPA1_PICGU/50-252EK...........................ITQWCLSNMWLFFI.......SMVGS....IGFL.I...A...THFKA...
A5E0Y3_LODEL/45-246DS...........................IKMWTLQNPWVLII.......SLVGA....IGFM.I...G...AFFKA...
A5EVN6_DICNV/21-215K...............................VNVP.FIVSLL.......VIL.......GLP.M...A...ISAK....
A5FVN6_ACICJ/27-251GLINAFYP................LVATPGGAMIREPGILAYI.......SIFAP....LAFM.L.VMS...F.GVN...
A5GUQ5_SYNR3/22-233I...............................ASPAFMPLFWV.......ALIGN....LVLF.FVAQN...IALKG...
A5K3F8_PLAVS/30-237....................................DI.YFLKI.....PRFIAS....MVSLFCSF.A...LAGSC...
A5V4K0_SPHWW/30-238GLA..........................AQLFVTP...LRWL.......IVLAP....LAFI.M.VLS...F.GIN...
A5VGS7_SPHWW/27-236PA...........................LYEPIFG.TPLKWV.......AIFAP....LAFV.L.LLS...F.GLH...
A6Q632_NITSB/34-232A..............................PSIAT...WYWG.......LVILE....FIML.F...G...VY.LT...
A6Q691_SULNB/22-221A..............................EAIMQ.....FK.......WFIFG....AELL.VLFFG...LS.MT...
A6QA51_SULNB/16-228APLL........................HLLFGNPY...MIWV.......LFLIE....LGLV.I.AIS...A.GIN...
A6VN26_ACTSZ/21-216N...............................LPRPGILITLV.......GFY.......GLL.F...L...THSL....
A6W0C3_MARMS/16-212N...............................LPHPGLIITLV.......GFY.......GLL.F...L...THKF....
A7AX64_BABBO/30-235....................................PI.QYLNI.....HTTILL....VVCLGTML.Y...VRHAP...
A7EDC6_SCLS1/72-273QS...........................YKTWIQSNTWLLWT.......SMFGA....IGFM.L...L...TYWKR...
A7HSY2_PARL1/27-247AVQETAGGP..............VLTSLGETLYASP...LKWV.......VMLAP....LAFV.M.VLS...F.GIQ...
A7I0C4_CAMHC/30-228F..............................SISSP.....IL.......FLVVE....IALI.F...G...MQFAT...
A7RRN6_NEMVE/26-227....................................HLFTSILK.....GGFLSG....IASLGLLI.A...LAVTP...
A7SUK2_NEMVE/41-257R..............................AVYTMMRASPLL.......FVGGG....MLAT.IASSM...ICMSL...
A8AVN1_STRGC/14-224FQS.........................VIVSVLMGSTWIFYV.......AIAAE....LILV.F.AAS...G.MAV...
A8EX08_ARCB4/24-224V.............................SLLMGP...MKWV.......LFAIE....LALI.F...F...VIPRV...
A8HUL0_AZOC5/27-255SVTTNPGAAAGQV......AGGIMLTQFGYALFVSP...LKWV.......VMLAP....LAAV.F.FLS...F.RIQ...
A8JCT0_CHLRE/35-234....................................DIQYSIG.......GWLTG....LMGFGCML.G...LAFTS...
A8LJ17_DINSH/24-236EAM.........................LAAIFATP...MKWV.......VMFAP....LIMV.F.AFS...A.MIN...
A8LT34_DINSH/23-238APV.........................TALIFGTP...LKWV.......AIFAP....LALV.M.FAS...F.RFE...
A8PJB5_BRUMA/34-232....................................HLFVDFLR.....DNFFTL....FGSILLMI.A...LLKTP...
A8PUB6_MALGO/132-346G..............................YSARIMMANPWL.......VLGVG....LVAS.IGGMM...GAQAL...
A9A0M8_DESOH/17-230ETM..........................LRIVFGN.QALFFG.......LIIAE....LGLV.F.YLS...A.RIQ...
A9CHH9_AGRFC/27-255ATTTDPAAAVATL......PNGKMLTSLGALVYASP...LRWV.......VMLAP....LGLV.F.FLS...F.RIQ...
A9PF37_POPTR/39-243TPM.........................TDLLKGSF..GFVLF.......LSIVP....FILL.W...P...LHVYH...
A9RSA6_PHYPA/38-242PPV.........................VEFFLSNI..WVLLL.......TSFAP....LILM.C...P...LYYYH...
A9SK21_PHYPA/31-231....................................HTLWNIG.......GIITS....LLFIGAST.W...LAVTP...
A9SQ31_PHYPA/40-244PAA.........................LSFFAVHP..WILFF.......ASITP....LILM.C...P...LYYYR...
A9SQP2_PHYPA/39-243EGL.........................KTFFQQTP..GLVLF.......LAFVP....LIVM.C...P...LYAYH...
A9V0R4_MONBE/102-310G...............................AHMLMMGRPIL.......SLFVG....VGSM.FATSM...LVHSL...
B0C2E0_ACAM1/22-236IS............................SFGPQTYRATSLP.......AMILF....FVLF.FVSQR...AATKV...
B0CFK9_ACAM1/23-233.....................................AEAMFQFVAGGRFSWLLI....LGAFSLLGWM...SRGLV...
B0JG20_MICAN/22-235I.............................QSYPQIFFPTFFV.......ALVAE....IILF.FVARN...TAERG...
B0T6B0_CAUSK/26-244PPVRDL....................MFQVTGNRVGYTMLGTI.......IAFAP....LGIL.L.FSG...F.LMK...
B0U8X3_METS4/34-269ATTAVPAEAARNGAGQMVRIGGQYLTQFGITLYTTP...LMWV.......VALAP....LAFI.F.FFS...F.RMD...
B0X729_CULQU/29-229....................................HL.VGLWS.....AGLLSW....LLQLATCV.A...LFQIP...
B1XK65_SYNP2/22-235I.............................QTNPSIFMPTFWV.......ALIAE....LALF.FVARG...VAEKG...
B1XXH0_LEPCP/22-223GIM..........................AALGTGASLAVFLI.......GAF.......GFM.F...A...IEKT....
B2A999_PODAN/119-335G..............................FVYRLMQTNPWV.......VGIGG....LALS.IGSMI...ATRSV...
B2IH64_BEII9/29-251AVVHDANGHI............AGLTAFGQALYLSP...LKWV.......AMLAP....LGFV.L.FIS...L.RIE...
B2IYG6_NOSP7/22-235I.............................RANPEIFFPTFIG.......AVILE....LVLF.FVAQN...VAQKG...
B2VV36_PYRTR/71-272ES...........................YKHFVQTHQWPLWV.......SLFGS....FAFL.G...L...TFWKR...
B2WKA4_PYRTR/117-332G..............................WSFRLMAANPWL.......VLGVG....LVGS.IGTMY...GTMAT...
B3PEU1_CELJU/19-221G...............................IGRGFGLIMSL.......AAM.......ALIWF...V...LPKT....
B3RRU1_TRIAD/26-228....................................HLYFNFIK.....GGLLSC....ILSLGFLL.L...LGITP...
B4ESV4_PROMH/20-232ATL..........................IEMIFTN.KIFFFG.......LIIAQ....LALV.F.ILS...G.MVH...
B4FSR2_MAIZE/33-233....................................HILLNVG.......GALTT....VGCVASIA.F...LISLP...
B4H3P5_DROPE/29-229....................................QI.EGVLD.....FGLLAA....VLTLLLVL.G...LHFYK...
B4I4U6_DROSE/141-357D..............................AMMALMTRSGWV.......ASLVT....LGLV.MLSGS...VAQGI...
B4JF90_DROGR/142-358E..............................QLLQLIMRSGWI.......ATLVT....MGLV.MGTGA...LTQAI...
B4JP44_DROGR/20-227E.............................YNFNRDVPVPFFV.......WLMLA....FSFMVILQCC...PNTRY...
B4MSJ1_DROWI/113-329P..............................RLLALASRGGFL.......WSIAS....LALV.IGSGA...VARSI...
B4QLM1_DROSI/28-228....................................QM.RDFLD.....LGVLAA....VATLVLVL.G...LHFYK...
B4RCG0_PHEZH/51-271PPVRDLM..................YAVTPDGRLAGMTMLGTI.......VAFAP....LAVM.L.FGM...F.ALR...
B4RI09_PHEZH/26-246PPVRDLM..................FVTSADGHLAGMTPIGWI.......VAIAP....LGIL.L.VSG...F.AMR...
B4RIG5_PHEZH/26-246PPVRDLM..................FRLTPDGRFAGYTLIGMV.......VAFAP....LVVL.L.GSM...F.AMR...
B4U9U8_HYDS0/12-216V..............................VMVASHFWLFAI.......LEFV.....LVFATS..........IV...
B5EDF2_GEOBB/16-220PAL..........................LQAILGN.RILFYA.......LVFGE....LGLV.I.AIS...G.AIN...
B6AIB7_CRYMR/30-232....................................YINRLLQI.....PTLVGL....ITGFGCMF.Y...IIRSS...
B6AIN7_CRYMR/31-243TKTI........................KEYIIYNYTTTVWIV.......CISSL....LSLAIILICRFTNTDYMR...
B6HLQ8_PENCW/65-266DS...........................YRTWIQSNFWLMII.......SVFGA....LGFM.L...A...TFWKR...
B6IUM4_RHOCS/26-235PAV.........................VGAVYGTP...LQWV.......VMLAP....LAFI.F.ILS...W.NFH...
B6TIY8_MAIZE/53-257PTL.........................NATLSDSP..GLALV.......LAVLP....FILM.I...P...LYHYQ...
B7JBM1_ACIF2/26-225P...............................FAYEHPFILMI.......GSF.......ALL.F...A...VQYTG...
B8DP50_DESVM/18-230PAM..........................LQLVFGN.SFVLIG.......LILAE....LGLV.M.GIS...A.GIA...
B8FKM7_DESAA/17-230PAL..........................TKLIFNT.PGVFIG.......LIIAE....LALV.F.ILS...S.RIT...
B8GQ93_THISH/19-215G...............................ARPINWILMIA.......VFI.......GGP.F...L...IHAV....
B8HNP6_CYAP4/13-223.....................................ARLLTEFVASSRFSWLAI....LGGFALLGWL...SQNLT...
B8IBU6_METNO/23-232PAI.........................AQPLFGTP...LKYV.......VMLAP....LAFI.L.FLS...F.RIE...
B8IYR9_DESDA/17-229PAV..........................QQVIFGN.SLIMIG.......LIVAQ....FGLV.I.AIS...A.AVH...
B8MED6_TALSN/117-332G..............................WSVRLMASNPWA.......VVGLG....LVAS.IGTMY...GTMYT...
B9DTR6_STRU0/15-225FRE.........................NLISIISQHPFVYYG.......AAAVE....LILV.F.IAS...S.AAQ...
B9JUA5_AGRVS/24-252ATTTDTSQAVGQF......GNGIMLTSLGAAIYGSP...LKWV.......IMLAP....IGLV.F.FLS...F.KIQ...
B9L7A8_NAUPA/35-240VGN.........................MINYATGSLTFTYWG.......AVILE....FILL.F...G...VY.AA...
B9M4V9_GEODF/20-227PVM..........................LNAIFGN.RLVFYA.......LILGE....LGLV.F.AIS...G.AIN...
B9PLK6_TOXGO/30-235....................................QQ.RILAL.....PIFLLL....GVQVFCVW.G...LGASS...
B9SFF8_RICCO/30-237QPLAY......................SLRSSSVGLPFYLVIC.......IVGIL....VMCLSYCYHF...ASYM....
B9SFF9_RICCO/27-234HPIT........................NFILHTKAGLALYIV.......IIIIP....FIVI.C...P...LYYYY...
B9T0M2_RICCO/34-232....................................HILWNIG.......GLLTT....FACIGCMA.W...LLSLP...
C0NU02_AJECG/69-270DS...........................YRSWIQSHSWLVLV.......SAVSA....LVFM.G...L...TYWKR...
C0QH09_DESAH/17-230ETL..........................MRAIFGN.PVLLFG.......LIFGE....LGLV.F.YLS...A.RVQ...
C1D533_LARHH/19-221NFG.........................FMRASPIVSSLLMIG.......GIY.......GMF.F...L...IEKN....
C1H044_PARBA/68-269EN...........................YRTWIQTHPWLMLI.......SVISS....LVFM.G...L...TYWKR...
E3D723_GARV3/35-248GAL.........................YSYLYATG.RFGFFG.......IIIAQ....VVLA.V.VLG...M.RVM...
C3YF20_BRAFL/26-227....................................HLMTGFIQ.....GGFLSA....IASIGLLI.W...LGVTE...
C3ZWB9_BRAFL/110-326P..............................AMLNLVAKNSWL.......AIGAT....FAAI.IGTNM...ITHSI...
C4K3R8_HAMD5/20-232PAI..........................LNLIFSS.QIVFFG.......LIIVQ....LGLV.F.VIS...G.MIH...
C4KCP9_THASP/19-215G...............................APRLGILITLA.......GYF.......GLL.F...A...TTKF....
C4R8R2_PICPG/45-246DS...........................IKIWCLTNIWLFYV.......SLVGS....IAFL.G...F...AYWKS...
C4WRJ7_ACYPI/45-246PK...........................IRFFIYNFEYMLSI.......TLILN....VVVLIFLHMK......RK...
C4XFK5_MYCFP/39-263.................................YMEKIAGYFAN.....NVIGWIIGGILTIILLFVY.....MFLG...
C4XRR5_DESMR/21-233PAL..........................MQAVFGN.QILFFG.......LIIAE....LALV.V.GLS...A.AIN...
C4Y6K1_CLAL4/45-247SA...........................IQNWCMNNMWLYIV.......SIVGV....FGFM.I...A...TYWKA...
C5B7G7_EDWI9/20-232PAV..........................LNLIFAN.KMVFFG.......LIIVQ....LGVV.F.VLS...G.MVN...
C5BTY5_TERTT/18-220G...............................VGHGMALVMDL.......VAL.......GLLWF...V...LPRT....
C5D2L3_GEOSW/9-205..................................WIPIGMYLP.......LTILE....IILLMV...M...VFARS...
C5DSS8_ZYGRC/34-256SF............................QSFLINHVFIWVL.......AMIFT....FVSCIWVSIA...PSPEEYEE
C5FIJ8_ARTOC/68-269TR...........................YKSWVQSHSWLMIG.......SLIGA....IVFM.L...L...TYWKR...
C5J7D0_MYCCR/10-247SP...........................RLFKLYLDIVGIGGKKLDIRLIIIFIVTIVLNIGIFFFIS...KTALK...
C5LBE2_PERM5/65-267....................................HIHVAHI......GSFITA....IMSIALLMGS...MYTTD...
C5M3P9_CANTT/53-255DS...........................FKVWALTNVWLLIL.......SFVGA....IGFM.I...G...AFYKA...
C6C1J2_DESAD/18-239PAVLNLV..................LAQNPETGAIAPTMLFWV.......AAIGE....IGLV.F.YLS...M.RIS...
C7LXK1_DESBD/17-229PAI..........................AQAIFAN.PIIFWG.......LIIAQ....FGLV.L.AIS...G.AVH...
C7Q6T3_CATAD/16-211.................................NHGAGFIGFI.......AAFAC....LIAM...........RFT...
C7R764_KANKD/20-229.....................................SLAIAQWVFSFGAGWLVL....MGGFIAVSWA...ATHIA...
C8X4E4_DESRD/18-230PAL..........................IQTVASN.PTILLV.......LILAE....LGLV.L.TIS...A.GIS...
D0KXZ9_HALNC/19-216N...............................LPPMISLIAMF.......GSM.......ALIWF...V...LPRT....
D1ARJ6_SEBTE/26-237VEI.........................MSLIFGTN...LYYV.......LFFVE....LGLV.F.MFS...M.MLM...
D1AX50_STRM9/12-223VKLV........................NISIMIQR...FSII.......LMIAI....AVLIRY.........IVV...
D1B5B2_SULD5/29-227A..............................NTIAS...WFWG.......FVILE....FVFL.F...G...LY.AA...
D3SG31_THISK/26-222G...............................APAVHWLVLLA.......VLI.......GGP.F...A...IHAA....
Y819_CHLTR/11-231LG............................LYATGAYRALFPM.......WWIWC....FATLGVSFYI...QAQIQ...
BI1_RAT/24-225....................................HVVTRFIQ.....AGLLSA....LGALALMI.C...LMATP...
P73793_SYNY3/32-245M.............................QGNPGLFMTTFWV.......ALIGN....FILF.FVAMR...VAQSG...
Q03GC4_PEDPA/15-227WRPAV......................MTFLSQGRM...SIWV.......IFVAL....FLFM...IFG...Q.KAA...
Q03RJ4_LACBA/19-226M.............................AFLQTLKGGGLLI.......PIIVW....FILP.F.VIS...G.QSM...
Q04EI1_OENOB/23-235FYAE........................FVRFYASNGALTWIV.......LAIAQ....LAVV...FLI...G.RNA...
Q0A861_ALKEH/21-217Q...............................VPHPGVIITLV.......GYF.......GLL.F...L...VSYL....
Q0AKK1_MARMM/23-250PP...........................LTQLVFG.TPLLFV.......VQWGP....LALL.F.GSM...F.FMR...
Q0BV78_GRABC/37-260SLMNAFY.................HPVMTEQGVSIQPTALAFI.......SMISP....LAFV.L.VLS...F.GIN...
Q0BX99_HYPNA/25-254LVP..........................GLTQLLLGTPLFYL.......FQFGP....LVLI.L...G...SAFLM...
Q0K957_CUPNH/24-226GFS.........................FMAGNPFLSLILFLG.......IAF.......GFF.Y...G...IEKT....
Q0VQ00_ALCBS/24-220N...............................IGFVNVWLTIG.......VYF.......GLL.L...A...TNAL....
Q113G8_TRIEI/22-235L.............................KSNPGLFQTTFWI.......ALVAE....LALF.FVART...IAEKG...
Q11D01_CHESB/26-243AVAADGQ.................LTAFGQLLFVSP...LKWV.......IIFAP....LALV.F.FIS...F.RIH...
Q12N83_SHEDO/17-213D...............................IGPMMSIGLSI.......GGL.......VLL.F...V...TLRK....
Q15T21_PSEA6/19-215N...............................IGPGAALGMNL.......AAL.......VMI.F...F...LNKA....
Q168I7_ROSDO/23-241PQLMAV...................FRDPVTLSPNI...LGWI.......IMFAP....LGMV.F.AFS...A.MIN...
Q17KY2_AEDAE/25-225....................................HL.THLWT.....AGFLSV....FLEITSVV.T...MILIP...
Q1GUZ0_SPHAL/30-238GFT..........................ASLIGSP...LMWV.......VMLAP....LAFV.L.VLS...F.GIN...
Q1HR31_AEDAE/26-226....................................HL.QGIWE.....AGILSA....LISLGLVL.G...LVFTP...
Q1J0Z4_DEIGD/13-220EA...........................LAAQVMG...LRMP.......LVLAQ....LAIV.F.VLS...L.AAQ...
Q1MQ63_LAWIP/21-233PAL..........................LQTLFSN.TLSLVI.......LAIAV....IALP.L.VLS...T.MIS...
Q1QW79_CHRSD/19-216G...............................IGQMNIFVFLI.......GAY.......GLM.F...L...VHKT....
Q1WUN9_LACS1/18-229YQV.........................QALTFFSNNRWAVWG.......ILILQ....VVLV.M.SMS...F.KAD...
Q21K99_SACD2/18-212G...............................VPYLGLW.MLL.......PYI.......GLL.F...L...VEKT....
Q22AT9_TETTS/66-293GLAY.......................TSPLFCGLGGFVMALG.......GILGS....SYMS.PNYYS...EVIKG...
Q28T17_JANSC/24-248PAILQ......................YLFSFETGGPTILGWI.......AMFAP....LGMI.F.AFG...A.VIT...
Q2G985_NOVAD/35-243GAA..........................LAVFGTP...LRWV.......VALAP....LAFV.M.IMS...F.GVN...
Q2GEZ5_NEOSM/36-247PAM.........................LSLLYQTP...LQWV.......VMFAP....VVFV.I.VFS...T.RIS...
Q2GI89_EHRCR/18-229PAV.........................ISMVYNTP...LHWV.......IVFAP....MGLV.F.LMS...Y.KLN...
Q2GIF3_ANAPZ/18-229GGL.........................MAAIYGTP...LHWV.......VSLAP....VITV.F.VMS...A.RVH...
Q2H3P6_CHAGB/69-270DS...........................YKSWIQSHPAIVWV.......SLFGS....MACM.M...L...TYWKR...
Q2KWX5_BORA1/25-228GINR........................VMGGSPGLSAIVFLI.......GAF.......GMM.F...A...IEKN....
Q2NCY0_ERYLH/35-243GLA..........................YSFASGP...MMWI.......VALSP....LAIV.F.AMS...F.GMN...
Q2NU64_SODGM/18-213R...............................LPAPGLILMLA.......GFY.......GLL.F...L...THRL....
Q2NUJ0_SODGM/20-232PAL..........................LQFIFSS.QLTFFG.......LIIAQ....LALV.F.VIS...G.MVN...
Q2RNE3_RHORT/28-246PLSAAF...................YQVSPEGQLMGLNMLGMI.......AVFAP....LGLL.F.LAM...F.AAQ...
Q2SJ24_HAHCH/29-224Q...............................FNPIMHYGAFF.......GAL.......AIS.F...L...IHKV....
Q2VZ47_MAGSA/31-240PAL.........................TAIAVYSP...LKWV.......FMLAP....LGLV.F.FMG...A.KID...
Q2Y6W4_NITMU/21-223NFA.........................FLAQAPIMGPLVMLA.......IMM.......GLL.F...G...VSAT....
Q30NV3_SULDN/27-225A..............................GTIAA...NFFP.......LLILE....IGLL.I...G...LH.FV...
Q30Y49_DESAG/16-228PAL..........................LQLIFGT.PMLPLV.......LMIGL....VGLV.F.YMS...A.RIG...
Q31M69_SYNE7/22-233L.............................GSNPSLFMPLWIG.......SIVLQ....LVLF.FVAQG...IASRG...
Q385I6_TRYB2/98-297P..............................LCKTVPFWLPMA.......AGFVP....LLWLSF..........AP...
Q38XY7_LACSS/13-227FASQ........................TVAILSNSNTWMVWG.......LMIVE....MILV.V.QIS.....RKA...
Q3A7T2_PELCD/19-230RTM..........................MQLVFGN.RLVFYG.......LLIAE....LLLV.V.TLS...G.AIR...
Q3J598_RHOS4/24-242EQLFSL...................LRDPVTMSPNI...LGWI.......VMFAP....LIMV.F.AFG...A.VLN...
Q46JI7_PROMT/22-235Q.............................ATNNPLFGPLFIV.......AFIAE....IVLF.FMASS...AANNA...
Q47HS3_DECAR/20-222GFS.........................FLAGSPLMSFLLFMG.......IAM.......GFM.W...G...IEKN....
Q482E8_COLP3/19-215N...............................LSHGVALVMML.......VAF.......GLM.F...V...VNKK....
Q4FNX7_PELUB/6-228SVVTDANGSI............TALTSLGNTIFLSG...FKWI.......VMLAP....LGVV.F.YMS...A.RIN...
Q4N8D7_THEPA/80-287....................................YFVPVIRDFLTRHPYISVGSATVYCVMTIVFII...FPKLL...
A0A0D1DT09_USTMA/150-364G..............................VSQRVMMANPWL.......VLGVG....LVAS.IGGML...GATSL...
Q4UFQ1_THEAN/30-231....................................NG.PWALL.....HPLFGV....LSVLGSLF.Y...IIF.....
Q4UH80_THEAN/67-274....................................YFIPQINDLFSQCPYISIGCGAVYCIMIIVCII...FPKTL...
BI1_DICDI/37-241....................................SMFIYRP......GFLMTL....LLVIGSAI.L...FATTP...
Q5CX10_CRYPI/29-231....................................FINGMLRI.....NSFVGL....LAGIGVTF.Y...LTASS...
Q5FPP8_GLUOX/24-248SLRALFFH................LAEMPNGAIVLRPTLLGGI.......SIFAP....LVFV.M.VLS...F.GVN...
Q5KDG7_CRYNJ/77-277PS...........................AKDFTHTNPWIMWI.......PLIGS....FTSL.F...F...VYWKR...
Q5R0A7_IDILO/19-215N...............................LPYPGFIITLV.......AYF.......GLL.F...G...IHKT....
Q5TP14_ANOGA/117-333P..............................RLLSLVSRNGWM.......SVLAT....FALM.IGSGM...VAQSI...
Q609C7_METCA/20-218A...............................LPHPGIIVTLV.......GYF.......GLL.W...L...TNKY....
Q6AMM4_DESPS/24-235GIT..........................AAIVASP...LFMM.......LIIAE....LGMV.F.FLS...A.RID...
Q6BV67_DEBHA/47-249SS...........................IQAWCFNNMWLFFV.......SLIGS....IGFM.I...A...THIKA...
Q6CP52_KLULA/27-244GL............................QLFIITKPWLSFI.......AIFIG....LVTCIWLSFA...PSSTDEEN
Q6NDB1_RHOPA/29-259AVTTDAGAAAAR.......VGNTMLTSFGVAMFVSP...LKWV.......FILAP....LAMV.F.VIS...F.GIN...
Q728Y2_DESVH/16-228EAL..........................IAFIFGN.TFVFFG.......LIIAE....FALV.I.GIS...A.GIA...
Q7MSL1_WOLSU/32-230A..............................PVIAS...WYWG.......LVILE....FALL.F...G...MF.FL...
Q7N6P2_PHOLL/20-232QNV..........................VLYIFSN.SILFYG.......LIIAQ....FGLV.F.VLS...G.MIN...
Q7NPB6_GLOVI/18-221P...............................GIDA...WFWP.......LLIVQ....LGLL.L.AIG...TVRSW...
Q7NUQ5_CHRVO/19-221SFA.........................FLAGSPIIGMLLIMA.......VFY.......GLV.F...A...IEKN....
Q7Q6L7_ANOGA/26-226....................................HL.SGIWE.....AGLLSA....FASLGLIL.G...MVFTP...
Q7SG99_NEUCR/80-281DG...........................YRNWIQSHPAMIWV.......SFAGA....LVFM.L...L...TFWKR...
Q7UU92_RHOBA/29-242...................................ADTMTMLVQRMTGGYGWLLV....LGAFMAVSWM...ARSWA...
Q7V0H4_PROMP/22-235I.............................ATNPSLFQPLSIV.......ALIAE....LVLF.FIATS...AANNA...
Q7V8J4_PROMM/22-236VQ............................SMGWQAFQPLSLI.......AIIPW....FILF.FVAQN...AAKKG...
Q7VHQ2_HELHP/27-224L..............................EFVVE...YRFF.......IFIAE....IAAL.F...G...VM.FS...
Q82VP8_NITEU/21-223NFS.........................FLAQSPIVGSLVMLA.......VMI.......GLM.F...A...VSAT....
Q89DW5_BRADU/21-228TG...........................PALLQSP...LMWV.......FILAP....LALV.F.FIS...A.RIN...
Q8D225_WIGBR/18-213N...............................FTYLGAIPTLI.......GFY.......GLL.F...L...VHRL....
Q8DLM2_THEEB/69-280L.............................SAAPQLFMPTFIG.......AMIAE....LVLF.FVAQG...AASKG...
Q8DSQ2_STRMU/15-225FRN.........................NMIAIMVNAPWVYYV.......AIFAE....LALV.L.IAS...N.AAR...
BI1L_ARATH/47-251PPV.........................NDLLTGSP..GILLF.......LCIVP....FILI.W...P...LHIYH...
Q97FA9_CLOAB/14-227PSLI........................ETLFINRS...LFFV.......LILAE....VLIV.A.FLS...R.RIN...
Q98E98_RHILO/25-253ATTTDPASAVATL......PSGEMLTSFGYAIFGSP...LRWV.......VMLAP....LAAV.F.FLS...F.RIQ...
Q98MW5_RHILO/25-234PAL.........................YVPIFSSP...LKYV.......VMLAP....LAFV.L.LFS...F.RMQ...
Y3663_CAUCR/26-245PAVRDL...................LFVVQGGRLAGVTPLYMV.......VAFAP....LVLM.L.IAG...F.AMR...
Y402_PASMU/18-213N...............................LPRPGLILMLA.......GFY.......GLL.F...L...TYKL....
A1U0T3_MARHV/34-226.................................MNGTHPGFLI.......TIVGY....IGLL.F...A...TYKLK...
A3MYZ6_ACTP2/20-214N...................................APALPWW.......GLLIG...FYGLL.F...L...TNATA...
A4SYE4_POLSQ/23-225GL............................NLFA....GSPFM.......GFIVF....MAVA.FGFFW...AIEKN...
A5VKY2_LACRD/20-231FRS.........................AVFGFFSAHPGMVWV.......ILLLP....IALS.M.GVS...FSATR...
A5VLC3_LACRD/18-228FAQ.........................QFTAFMVNNRWGMWL.......IILLP....IILT.L.GIN...FNATR...
A6WV27_OCHA4/28-256ATTTDPSAAVAQL......ANGKMLTGLGVALY...TSPLRWV.......VMLAP....LAAVFF...L...SFRIE...
A8QEE8_BRUMA/112-349Y..............................HISRLIMG...........SPFIS....MAAV.MASSI...AVSLI...
B0UVR0_HISS2/19-213N...................................LPPLHFG.......VMLIG....FYGLLF...L...NNMLA...
B1VUQ0_STRGG/78-285VD............................QANVGTAIGVA.........VVAAI....IGFV.L.SLV...NSFKR...
B1X0P3_CYAA5/23-235I.............................QSFPNLFFPTFFV.......AIVLE....LALF.FVARN...I..AE...
B2GDC3_LACF3/20-230FKA.........................AVFTFVAGHAGLVWI.......ILLLP....IALS.M.GIS...FSATR...
B7JXJ9_CYAP8/23-235I.............................QSHPNLFFPTFIG.......AMIAQ....LVLF.FVARN...V..AE...
B8DT88_BIFA0/45-255GFY..........................MRFLQATGGMGMWI.......LAIVE....IGLAIY..LG....MRVM...
B8MD34_TALSN/62-262DS...........................YRQWIQSHFWLMIV.......SLVGA....IAFM.LLTYW...K..RK...
B9H8C6_POPTR/29-232HSIS........................NFIVHTKVGLAVYIA.......IIVIP....FIVL.CPLYY...FYQLR...
B9KH79_ANAMF/18-229HG............................LMSVLYGTPLHWV.......VSLAP....IVMVFF...L...SSRVH...
C5AQF7_METEA/29-251AVAQTGAG...............RLALTPFGQFLYT.SPFKWV.......LMLAP....LAFI.F.VFS...F.RMD...
C5XB01_SORBI/38-244RAIP........................HFFTTTNAGLGLYIF.......LIILP....FIVLCPLYFY......HE...
C5ZYY2_9HELI/29-227L.............................GGVVAQ...YYIG.......FVILE....FALL.FGLFF.....TKA...
C8WS49_ALIAD/11-207.................................TRLPYGLTPI.......LWLVE....LGMIVY..AM...F...R...
D1BNX5_VEIPT/23-243P..............................NWLRFAYQNFNI.......ILLVE....LGVV.FLF.S...A.RAY...
D2YW23_ZYMMO/30-238A.............................LGAAIIFSPLRWL.......VILAP....LAFV.F.ALS...A.GVN...
D4KAL4_9FIRM/19-226P..............................LFYVVN.SLYLL.......FTIAE....LALVIV..LS....ARVQ...
D4Z0E6_SPHJU/30-240GL...........................AYQILAGPGILKYV.......IMFAP....LLFVMTMSFG......IN...
D4Z6C9_SPHJU/23-231PV............................LAAAIFGTPLKWV.......AIFAP....LAFVFF..FS...F.RIE...
D6DJ22_CLOSC/23-231GI...........................TMLVFSN.PYGIFV.......ITGIE....LFVV.I.S.M...SARIH...
E9DBQ0_COCPS/66-266DT...........................YRTWVQSNAWMMFV.......SIIGA....LVFM.LLTYW.....KRK...
F3ZIX9_9ACTN/83-294D.............................EANLGKSYG...I.......AIGAG....LVAMVLGL.V...QSFKR...
F4B2Y9_DOKS4/21-229PVI..........................VNFAYSLTGGWSWL.......LLLGA....FMFI.TNYAE...GLALK...
F4KL14_PORAD/29-237G.............................LFYQIASSGAMWL.......LIIAE....LVLV.F.VLS...A.RIN...
US17_HCMVM/41-246PHLK.......................GTVFL..........CCT..GFMPPLSL....MVPTICLALL...HGKRDE..
US12_HCMVM/52-254PW...........................RVTTPYLRDTLPFW.......STLLP....CALR.CHAYW...LERQR...
US15_HCMVM/42-247PATWF......................HHSRLCL........TESS.PSLVFVIP....VTSVIF...I...HCYET...
US20_HCMVM/27-225PQN..........................RNFCVEN..YSFFL.......TVLVP....IVCMFITY.T...L..GN...
US21_HCMVM/14-213PHR.........................LEQL..FSSVRLTLS.......CLMIS....IVCLGL...L...RWAEP...
F9UNP4_LACPL/20-232FQA.........................QINAAFSQHPFIFLM.......IFIVS....MFVM.IGGIQ...VNATR...
G2LFD7_CHLTF/34-232G..............................LYIAV.VQYYWL.......ALILL....IGAV.IGVGA...LRRV....
G2SP46_LACRR/20-227PS...........................VVSLLSN.GLVMSI.......LFIVQ....LVLV.FRMSS...LKAIR...
G8PGI6_PSEUV/16-232AVSNGAL..................TEFGVLLFTS...PLRWV.......VMLAP....LGFVFF...L...SARIH...
H0Z6Q0_TAEGU/121-335P..............................ALMNLMTKSSWL.......AIGAT....FAAM.IGAGM...LVRTI...
H2Q6E8_PANTR/80-279ES...........................IRTFVHESPALILL.......FALGS....LGLI.FALTL.....NRH...
H3G6E5_PHYRM/28-229E.............................ITATKYDSPPMYV.......AIG......LLLL.CMYGL...SKDIN...
H9J0X8_BOMMO/52-266P..............................ALLNLVARNGWM.......SIIVT....LGLM.IGSGM...VVRGM...
H9JB99_BOMMO/22-222D...............................MFTRFQAG.FL.......SAIVG....AGLM.LMLIA...T.PDN...
I0DXE2_PROSM/20-231GL............................FYTIATNNVLFFG.......LIIVE....FGLV.L.GLS...F.LLP...
I3U2E9_ENTFC/13-223FPL.........................QLATFINN.FPLGFV......GLWIVE....LILV.M.VLG...V.KAQ...
J9Z9N1_LEPFM/27-227GL............................PLFVG.HPILFAV.......AMFGT....LFLL.M...A...VQRIP...
K4AEB8_SETIT/31-237PAIS........................LFFVSSNAGIALYIF.......LLILP....FIVLCP...L...HYYHQ...
M1BP72_SOLTU/31-237HPIS........................HFFAATNAGLALYIV.......LIITP....FITLCPLYYY......HQ...
M1FFW7_9ALTE/31-232G..................................MGRGTSLM.......CSLGA....IALV.W.FVL...P.RTA...
M4E009_BRARP/33-231....................................HVLWNIG.......GILTT....IGCFGSMIWL...L.SSP...
C6XEX3_LIBAP/26-254ATTVDPDAASI.........IINRGVMLTGFGALMYTSPLRWI.......FIFAP....LGVFIF...L...NVRLH...
Y920_HELPY/26-221F..............................QAVVQ...YKWV.......FFIAE....IAAF.F.GLM...FS.KS...
YBHL_ECOLI/19-230AAV..........................MELLFTN.RVFLIG.......LIIAQ....LALVIVLS.....A.MIQ...
Y044_HAEIN/19-213N...................................LPYPNII.......VLLVG....FYGLLF...L...TNKLA...
Y2604_PSEAE/21-215...............................QQMRLPYPNVFV.......VLIGF....YGLF....FL...TVKLR...
Q037Y9_LACC3/14-229FRA.........................EYTSFVSGHPIVFWI.......MAFMP....IILSFF...V...TGRRA...
Q03YA2_LEUMM/20-231FL............................EQ.VAKLLVGNVI.......GLLAL....LGIQMLIITM...IGRAT...
Q1GBC8_LACDA/21-230FSG..........................SLLPLLTNRVFLWV.......LLLLP....LILS.V.GIS...FKATR...
Q28GN8_XENTR/24-225...................................KFLQGSFL.......SFAGS....LGMMIWLMST...PHTYE...
Q2G0D3_STAA8/18-207...................................QFLPLSWR.......QPLSF...GLLIIILATLV...FERAR...
Q2IGP2_ANADE/25-232ET...........................LLLAIVGNRILFYG.......LVIAE....LALVIW...I...SAAVN...
Q3IXM5_RHOS4/24-232PA............................IYVPIFSTPLKWV.......VMLAP....LAFVLF..LS....FRIE...
Q3JAM0_NITOC/20-215N...................................APPVHWV.......ITLIG...YFGLL.F...L...TNALR...
Q4A983_MYCHJ/32-262DALFDLY..................QIFVFSLFSSIATIILIT.......LLILG....LNFWISWYIG...KNALA...
Q5F552_NEIG1/17-220G..............................FNFYAAFGSRWI.......GFAVV....LAFF.YGMIH...FIEKN...
Q5M633_STRT2/16-225LSH.........................LFVNILMNYSWIYMA.......AIFVE....LALV.FLASG...AARRN...
Q5NH29_FRATT/24-220G..............................ATIMN.PLLMLV.......VYI.......GLL.F.GIN...A..TK...
Q5ZWY5_LEGPH/21-217G...................................ARPMNPL.......LMIVG....VYGLMF...L...TQALR...
Q63UT7_BURPS/27-229GF............................SLFAATSPMMSLL.......AFF.A....IAFG.FMF.A...IERTK...
Q6F386_ORYSJ/35-240EP...........................IKTFFQARTPEVLVAY...VIIIISP....LIMM.LPM.....IYFRN...
Q6ZEY7_ORYSJ/10-215PAIR.......................RFFLA....RTPASLAAF...VLVIVAP....LIVM.LPTMF...L..RK...
Q74I60_LACJO/20-231FRT.........................QVMTLFASNPAMTWI.......LLLVP....LALT.F.GIS...F.RAT...
Q7CH71_YERPE/20-232PS...........................IIFALQSNQILFFG.......LIIAQ....LGLV.FVI.S....GMVN...
Q7MW50_PORGI/22-232SL............................IYTMIMNPGLLWG.......LIIAE....LALVFI...L...SARIG...
Q833N8_ENTFA/14-224FLP..........................VLATLFQSSLAFWM.......IWLVE....IGLV.L.YLG...A.KAQ...
Q83EU5_COXBU/22-236SYL..........................FNKIVHT.PGLFFG.......LIIAQ....FAAVIGLTWL...NQ......
Q8DNE4_STRR6/21-231FQSQ........................LVYLLMQG.RLWLTI.......ATFAE....LALV.FVASS...MASR....
Q8DY88_STRA5/15-225PQN..........................MIAIMQKMPGLYFG.......AIILE....LVLV.FVASG...AARRN...
Q8EKF7_SHEON/22-217SHI.........................DPEAIASVNPWIFFI.......GYF.......ASCFLGIYL...FQSS....
Q8RF52_FUSNN/10-220Q.............................GLLSTLFNY.YQF.......LVIAE....LAMV.F.SIS...L.FIN...
Q8Y034_RALSO/24-225G..............................FNLMAGRPLMGF.......LIFMG....VAFG.F.FYA...IERFK...
Q8Y569_LISMO/22-221....................................SPELYLP.......LVVLE....VALLIT.AMV...VRRSK...
Q8ZKW9_SALTY/20-228GVGE.......................YALDV..........LLAG.GRYSWLVV....LGAFMLVGML...ATRLA...
Q8ZQ61_SALTY/19-213....................................LMLPSP........GLILT....LVGMYGLMFL...TYKTA...
Q8ZQP8_SALTY/19-218S..............................HFLITHVQPVVV.......LWISA....LLLG.LGYGA...ITCLS...
Q94GN3_ORYSJ/18-224RPVA........................LFFVSTPAGFALYIF.......LIILP....FIVLCPLYY......YYQ...
Y358_STRP1/15-225FRE.........................NLISILVNQPMIYYG.......AAIIE....LILV.FVASS...AARKN...
YRJE_LACLA/17-226FLD.........................NMTAILQSGSLFFLV.......LWIIP....LVMVVSLQGL.......A...
Y1358_VIBCH/20-216G..................................ISPIVALV.......MQLAA....IGIL.F.FVM...P.KAI...
BI1_ORYSJ/35-232....................................HVALNIG.......GMLTM....LGCVGSIAWL...F.SVP...
Y236_CAMJE/25-225L.............................ASFFIQSQVTFWI.......LFAVE....IGLL.FALQW.....KKR...
Y147_RICPR/22-231EP...........................IYHLMFQ.TGFGTI.......IMFAP....LGIALYFFMG......FG...
R4G5C7_RHOPR/23-222...............................DLYTNFLSNSFI.......TVIFA....IGFL.CALHG.....TKD...
R5F0I7_9CLOT/22-230GT............................IFYIYSFRYWPLA.......LLAAE....LGVV.I.YLS...A.RIE...
R5X7M8_9CLOT/13-219..................................KLFVPASLVY....AANIFVGI.LIVGL..LLFSL...LSRKN...
R6BXE5_9BACT/36-246PT...........................LLMTLMTSRGLLFG.......LIIAE....LALVFI...I...TGALQ...
R6MUP2_9BACE/18-220YT...........................LLSMIMQNSMAFWV.......LIIAE....LGLV.W.YLS...A.RIN...
R7G836_9FIRM/17-227DL............................VWVIYSSSWTPWI.......LLIAQ....FGVVIA...L...AARIT...
S5QYX2_9STRE/16-226FTD.........................NMINIMTNHPFIYYG.......AVFLE....LALV.FLASG...AARKN...
U5L5J4_9BACI/11-205..................................YIPPALFLP.......LVILE....LAML.IGAFF...LRKK....
V6F839_9PROT/25-234PS............................ALQMIFGTPLKWV.......VMLAP....VGLAFF...L...SMRIH...
W5PL52_SHEEP/122-337P..............................ALMNFMMRGSWI.......TIGAT....FAAMIGAGML...V.QSI...

PF12811

C7NEU4_KYTSD/18-275-----------VNVP--------.....LIL---VHAVLQGGFVG....A---ISKAFET..........SM........
F4EZD3_SELS3/14-236-----------TAGL--------.....LAP---LYAILEGMCLA..CLS---VTLAFIS....................
R5G4T6_9FIRM/7-239-----------LSKV--------.....FGT---IYCLFEGLTLG....V---LSYIVTQ............LV......
B1GZ32_UNCTG/3-236-----------ATPF--------.....LSP---LYAMCEGFVLG....T---VSLYFEK..SY................
D7WE18_9CORY/5-299-----------GSAA--------.....VTL---IYAAFEGLFVG....G---FSMAVS.................GWML
C6WKQ5_ACTMD/6-268-----------PSAP--------.....LVL---TYAAAEGVFLG....G---ITGVFE...................AF
K4QW36_9ACTN/5-282-----------PAPA--------.....LIL---GYAAFEGVFLG....V---LSSTVSS................YLA.
M4NLN8_9GAMM/5-249-----------WAPF--------.....TAP---LYAVAEGLFIG....A---LSAIFEL..RY................
F8A7A7_CELGA/3-266-----------PSPV--------.....LIT---LYTVAQGVFLG....G---ISAFYEA............AW......
V6JXB5_STRNV/5-292-----------PVPA--------.....LIL---AYAAFEGVFLG....V---ISSAVST................YLS.
U5Q5X0_9BACT/3-248-----------WAQY--------.....LAP---IYAVLEGLFLG....A---ISAVFSQ..AFAATA............
D1A7P0_THECD/5-261-----------ANAP--------.....LVL---AFSALYGVGIG....A---ISHFFE.....................
D2PP90_KRIFD/5-279-----------INPA--------.....LVM---AYAVAEGVFLGIGSKF---IAGYVDD....................
J9SCB5_9ACTN/32-313-----------DNPA--------.....IVL---AYAAFEGLFVG....A---ISFVFA.................NWAV
Q6NI55_CORDI/5-275-----------GSAA--------.....VTL---TYAAFEGLFVG....G---ISLVLS.................GAMV
A9NEU4_ACHLI/5-242-----------LAAP--------.....MSI---LYAVLQGFTYGLLTWV---LEMYF......................
R5EEE2_9GAMM/5-247-----------AAPI--------.....TAP---IYAVLEGGALG....S---LSGIFEI..KY................
A5WFW8_PSYWF/5-242-----------KAKA--------.....LAA---PYAILEGLFLG....G---VSIMFMGID..................
R7XUD5_9ACTN/14-304-----------VSPA--------.....LVI---AFAALEGVALG....A---FSKVIPA..VAGVSTD...........
K0FCH0_9NOCA/6-286-----------DNPV--------.....LVL---SYAVFEGLFVG....A---LSFMFT.................SVEF
D8UI29_VOLCA/59-300-----------WAMG--------.....TSL---VFSAAQGVAMA....G---FSVMLEM..MY................
W8KJ18_HALHR/28-265-----------WAPY--------.....TAP---VYGFSGGLFMS....G---LALAMEQ............RF......
Q0S4B9_RHOJR/28-305-----------DNPG--------.....IVL---AYAVAEGLFLG....A---LSFMFT.................DITF
D6YTM1_WADCW/5-246-----------WAPV--------.....TAP---LYAFAEGLFIG....G---ISSIFEA..SY................
C4L1D1_EXISA/6-242-----------TAPV--------.....VAP---LYGIIEGVFVG....S---ISYFFEA..MV................
F1TJZ5_RHOHA/9-283-----------DNPA--------.....IVL---AYAACEGVFLG....A---LSFMFT.................NVEF
Q6LYY5_METMP/5-242-----------WSPA--------.....TVP---VYCILEGLFLG....L---ISGFFEL..MY................
B2KC47_ELUMP/5-240-----------TAPM--------.....LAP---IYAFGQGIAVG....L---ISLAYAQ..QY................
F4F5D9_VERMA/5-290-----------ANPA--------.....LVV---AYAVVEGVLVG....A---ISKFFE.....................
F5YTZ5_MYCSD/6-286-----------DSKA--------.....LVL---SYAVLEGLFLG....A---ISFVLT.................AVTV
Q9KZ65_STRCO/5-305-----------PTPA--------.....LIL---SYAAFEGVFLG....V---VSSVVDN................RIA.
E1VTL5_ARTAR/3-266-----------PSPV--------.....LIL---LYAAAQGLFLG....G---LSGFLES..QPNL..............
F8E0H2_CORRG/12-305-----------GSAA--------.....VTL---IYAGFEGLFVG....G---FSWMVA.................NISA
M1P5T4_9CORY/5-275-----------GSAA--------.....VTL---IYAAFEGLFVG....G---ISVIFS.................GAVV
F6GI76_LACS5/9-242-----------WAHF--------.....LVP---LYAVAKGFFLG....G---FTAFVKV............HY......
C9YY45_STRSW/5-291-----------ASPA--------.....LIL---TYAAFEGVFLG....V---LSEMFNT................QW..
G8TNU9_NIAKG/8-251-----------WSAF--------.....LAP---AYALLKGFAVG....A---ISAIYDN..VFAKVA............
A6W6X9_KINRD/11-281-----------VRPG--------.....VMF---AYAVVEGAFVG....G---ISALYAS..........LY........
D7BXA1_STRBB/5-298-----------ASPA--------.....LIM---SYALFEGVFLG....V---ISQVYNE................RW..
D6Z909_SEGRD/6-274-----------DNPA--------.....VVL---GYSVVEGLFVG....A---VTNALT..................LQF
D5UKL3_CELFN/3-271-----------PSPV--------.....LIT---LYAAAEGVFLG....G---ISAIYET............MW......
E3EBZ5_PAEPS/5-244-----------TAPL--------.....LSP---VYAILSGFALG....G---VSAFMEY..EY................
I4A1A9_ORNRL/7-250-----------IAPF--------.....ASP---VYAVLEGLFLG....I---ISLFFEA..NY................
F5XTM3_MICPN/6-278-----------ISPP--------.....LVF---VYAAIEGVFIG....M---FSNIFNQ..IY................
X5DKM9_9CORY/5-292-----------GSPV--------.....VTL---VYAAFEGLFVG....G---FTWIFAG................GVEI
H6RSJ3_BLASD/5-276-----------ANPV--------.....ATL---SYGALYGVALG....A---ISEVFA...................AQ
A5FKK6_FLAJ1/12-255-----------LSPY--------.....LAP---GYALFEGLFIG....G---ISAIFEA..MY................
Q47SU4_THEFY/8-319-----------TNPA--------.....LIL---IYAGLEGLFVG....G---FSFVLEA................SLA.
F4GYG7_CELFA/3-268-----------PSPA--------.....LIL---AYAVAQGMFLG....G---ISLFFEQ............EL......
D6ZKK1_MOBCV/18-273-----------PSPA--------.....LIL---GYAAFEGVMLG....G---ISSLFAA..LY................
E8NDS9_MICTS/10-292-----------PSVP--------.....VFL---AYAAFEGLFVG....G---ISAFFEF............IY......
Q8XKZ0_CLOPE/6-239-----------IAQF--------.....TAV---FYAAFEGVLLG....S---ISRYFES..MF................
F6FSN3_ISOV2/3-284-----------PSPV--------.....LIT---LYAVAEGVFLG....G---VSLLFGS..IAGENA............
M4ZW38_9ACTN/48-277-----------WAKF--------.....LGP---VYALAYGFAVG....A---ISHGYET..FY................
D3EHX0_GEOS4/7-244-----------AAPY--------.....LAP---IYAILEGFFLG....A---LSAHYEY..LY................
Q11SC4_CYTH3/5-241-----------WAPY--------.....TAP---AYALFEGVFLG....A---LSGFVDA..MY................
A0R2Y3_MYCS2/6-277-----------DNPA--------.....IVL---SYAAFEGLFVG....S---ASFLFA.................N..L
C2WZP8_BACCE/5-241-----------MAPI--------.....GAP---IYAAVEGVVLG....S---ISAVYTM..KF................
C5C0C8_BEUC1/28-297-----------PSPA--------.....LIV---GYAALEGLFLG....G---ISGIFET............MY......
D9TB20_MICAI/19-252-----------TSPP--------.....IIV---GYAVLQGLLLG....V---ASRAFEM..........VY........
H2JL64_STRHJ/50-293-----------PSAS--------.....PAL---AFAALQGVFLG....V---FSTTASS................HLS.
U3GYX0_9CORY/5-290-----------GSAA--------.....VTL---TYAVFEGLLVG....G---ISYMFA.................SMTV
R6SY18_9FIRM/13-260-----------TTAV--------.....TGS---IYSAGMGYALT....F---MSMIYAM............QW......
Q4JU62_CORJK/5-300-----------DSAP--------.....VTL---TYAAFEGLFVG....G---FTFLVS.................GAAV
F8JW88_STREN/75-299-----------PAPA--------.....LIL---GYALFEGVFLG....V---ISRMFNQ................AWA.
F8AVU2_FRADG/8-276-----------LRPA--------.....LIV---LFAALEGLFVG....A---VSRFYE.....................
R4T3W7_AMYOR/6-277-----------PSGP--------.....LTL---AYSAAEGVFLG....A---ISGLFE...................AL
D9TB19_MICAI/5-283-----------ANPA--------.....LVV---AYSVIEGVFVG....M---VSKAFE.....................
D6Y882_THEBD/39-278-----------TNPA--------.....LIL---GYAVAYGVAIG....V---ISRVAD.....................
I0GZ05_ACTM4/5-279-----------ANPA--------.....LVV---TYAVVEGVFVG....M---VSKFFE.....................
G0HFP4_CORVD/5-290-----------GSPV--------.....VTL---VYAVFEGLFVG....G---FSWLLS.................GMAV
F6EQM2_AMYSD/6-278-----------DNPA--------.....IVL---SYAAAQGLFVG....G---LSWLFG.................NVMV
A4F854_SACEN/6-264-----------VSPA--------.....LII---AYSAVEGVFLG....G---ISYLFA...................ML
K7RRB1_PROA4/23-286-----------VPAA--------.....GVI---AYSVIEGVFLG....A---FSKLFEM..LY................
R7J8A1_9FUSO/3-241-----------LAKY--------.....TAA---PYALMEGLVLG....A---FSAFFEA..QW................
B1MKI6_MYCA9/6-280-----------DNPA--------.....IVL---SYAALEGLFVG....A---ISFALT..................FQV
D7GFC1_PROFC/5-270-----------TSVP--------.....AIM---AYTVFEGILIG....A---FSQVMES..IY................
E3H5K2_ROTDC/58-316-----------VSPA--------.....LVM---LYSVSEGLLLG....G---ISGLLNK............SY......
V5XGM6_MYCNE/6-283-----------DNPA--------.....IVL---SYAALEGLFLG....A---VSFIIA.................N..L
E2SBJ7_9ACTN/5-279-----------VSPA--------.....LVL---AFAAVEGVFVG....A---FSKIISS............YVGD....
F8KWJ3_PARAV/5-245-----------WAPV--------.....TSV---GYALLEGLFIG....G---ISSIFEK..QF................
H5XAT9_9PSEU/6-270-----------ASGP--------.....MTL---AYSAAEGVFLG....A---ITGVFE...................LL
A1SF75_NOCSJ/5-293-----------ISPA--------.....LVM---AFAVLEGIALG....G---LSKLFDV..QFG...............
E4NG71_KITSK/6-291-----------VNPG--------.....LIL---AYAALEGFFLG....A---ISKAFEA................IL..
E8R4F5_ISOPI/10-246-----------LAPF--------.....TAP---LYAAAQGLFLG....G---LSVIAEM..KF................
W5W111_9PSEU/6-255-----------VNPA--------.....LVL---AYSAAEGVFLG....A---ITQLFN...................RW
Q9CB64_MYCLE/6-284-----------NSPA--------.....IVL---SYAVLEGLFLG....A---VSFLFA.................NFQV
A9WUA8_RENSM/12-288-----------PSKI--------.....LIL---GYALFEGFFLG....G---LSGLLES............RF......
H2JJR6_STRHJ/5-286-----------PSPA--------.....LIL---GYAAFEGVFLG....V---VSSATST................YIA.
L0HDS4_METFS/6-241-----------WSPV--------.....TGP---VFAVFEGIFLG....A---FSGAAEA..LY................
B1V9N1_PHYAS/18-261-----------MSRL--------.....CSC---LFAVLEGLTIGIFFHF---INCIYSN............LL......
B1YES9_EXIS2/8-243-----------TAPV--------.....LSP---VYAIVEGVAVG....A---ISLMFES..MY................
D7BKM9_ARCHD/9-266-----------VSPA--------.....LAL---GYAVLEGVALG....T---ITRAFDL............LY......
L0D6N3_SINAD/5-254-----------VAPW--------.....TAP---VYAAFEGVFLG....S---LSCLIEASVQQKFGPQQY.........
W5XU43_9CORY/5-268-----------GSAT--------.....VTL---IYAALEGLFVG....G---FSLLLS.................GFFD
C5C991_MICLC/36-290-----------PSPA--------.....LIM---AYAVAQGLFLG....G---ISAFFEG............AY......
Q6AD52_LEIXX/5-268-----------PSPA--------.....LIL---SYAGVQGVFVG....A---ISMIFET............AL......
E6SCQ6_INTC7/5-292-----------IPTP--------.....LYF---VYSALQGVFLG....A---FSYFLAS..........AY........
R5L7T8_9SPIR/3-242-----------MSKT--------.....FSI---LYAILEGVAIG....G---VSFIFNA..VY................
C1F3Q6_ACIC5/5-243-----------WSPV--------.....TAP---IYALFEGLALG....G---ISAMFEL..RF................
D7B6X7_NOCDD/7-306-----------TNPV--------.....AIL---SYAALEGLLVG....G---ISAILAN................SLSV
Q6F806_ACIAD/5-242-----------TAPV--------.....LAI---PYALFEGAFLG....G---ISFIFQA..KF................
W5Y0J1_9CORY/5-268-----------GSAP--------.....VTI---AYAAFEGLFVG....G---ISLLLS.................GFMV
C8XKQ4_NAKMY/6-258-----------ISPP--------.....LII---GYALAEGVFLG....A---ITGVFNQYY..................
Q6AAB4_PROAC/3-276-----------VPVG--------.....GVI---FYCICEGLVLG....S---MSAMFET..AY................
G8SIP5_ACTS5/5-282-----------ANPA--------.....LVV---AYAVVEGVFVG....M---ISKAYQ.....................
D5UV23_TSUPD/6-297-----------DNPA--------.....IVL---SYAAFEGLFVG....S---ISYVFA.................NWVI
D5VB45_MORCR/3-239-----------LAKS--------.....LAI---PYALIEGVLLG....A---FSLIMYR..YY................
C0R118_BRAHW/3-242-----------LSQV--------.....FSI---LYAILEGVAIG....A---VSYIFNA..AY................
F8EFI0_RUNSL/3-242-----------LAPT--------.....LAP---IYAVVEGVFVG....A---TTLVFES..MY................
C3PFB1_CORA7/5-266-----------GSAA--------.....VTL---IYAVFEGLFVG....G---FSLMFA.................GVSF
B2HT80_MYCMM/6-279-----------DNPA--------.....IVL---SYAALEGLFLG....A---VSFVLA.................AYTV
I2EWG6_EMTOG/3-238-----------WAPQ--------.....LAP---TYALLEGLAIG....A---ISAIFQE....................
X4QYH9_9ACTO/9-284-----------VKPG--------.....MAI---AYAVLEGVALG....A---LTAAFEL............IV......
L0J173_MYCSM/6-280-----------DNPA--------.....IVL---SYAACEGLVVG....A---FSFVVA.................NLMV
C7QZY5_JONDD/3-275-----------PSPV--------.....LIT---LYSIAQGVFLG....G---ISKFYEA............AY......
D5SQ37_PLAL2/5-247-----------SAPV--------.....AAP---IYALLEGVFLG....G---ITTIFEA..RF................
W5TW08_9NOCA/6-283-----------DNKA--------.....IVL---SYAAAEGLFLG....A---LSFMFT.................NVEF
J7L8F6_NOCAA/7-307-----------TNPV--------.....AIL---IYAALEGLFVG....G---LSALLAT................QLEM
B3R032_PHYMT/12-261-----------FLPV--------QMVKYVAM---TYSIFEGMFFGVLFCL---LNIVYDNVLM.................
A8L155_FRASN/44-265-----------ISPP--------.....LVV---VFAVLEGLLVG....G---VSRFYES............AF......
G0FRN5_AMYMS/6-277-----------PSGA--------.....LTL---TYSAAEGLFLG....A---LSGVFE...................AI
A8J2B1_CHLRE/71-312-----------WAAA--------.....TGL---VFSASQGVAMA....G---YSLMLEM..VY................
A0JU33_ARTS2/31-306-----------PSPA--------.....LIL---AYAGLEGLFLG....G---LTRVLDG............MY......
C4LHM7_CORK4/5-292-----------GSPV--------.....VTL---LYAAFEGLFVG....G---LTSVFA.................NVMV
R6P635_9CLOT/22-243-----------LAKF--------.....LAP---VYAFAQGALLA....A---LSLIMET..QF................
F4CVB9_PSEUX/6-269-----------TNPA--------.....LVL---IYSAAMGVALG....G---ITGALEL................SGTQ
C7M9W4_BRAFD/40-305-----------PSPV--------.....AVL---AYAVFEGLFLG....G---ISGTMEF..........FY........
E3ITH9_FRASU/8-268-----------INPA--------.....LVV---VFGVLSGLMAG....G---VSRLYA.....................
I6XVQ8_PROPF/3-275-----------VPVA--------.....GVL---VYSALEGLFIG....G---ISKYFEV..AW................
Q8NRR2_CORGL/5-271-----------GSAA--------.....VTL---IYAVFEGLFVG....G---ISLLLS.................GFTV
I0II89_PHYMF/20-264-----------WAPV--------.....TAP---IYALLTGLMLG....G---VSAIYQL..NFGGQHVNGFSL......
Q4FRP4_PSYA2/3-240-----------KAKT--------.....FAV---PYALLEGIFLG....G---ISLFFMR..MY................
I0GPK4_SELRL/3-236-----------TAGF--------.....ISP---LFAIFEGASIA....M---LSLIAESFL..................
I5B600_9DELT/19-256-----------YAHL--------.....TAP---LYALAGGIFMT....G---IALHFEI............RF......
X5DVG1_9BACT/9-254-----------SSGI--------.....SAP---IYAVFEGMFLG....G---ISAIFEA..QY................
D2B2I8_STRRD/5-259-----------TNPV--------.....LIL---GYAVSYGVAIG....V---ISHMYN.....................
D2NP91_ROTMD/12-332-----------VSPI--------.....LVM---TYALMEGLLLG....G---LSAVVDM............RY......
G4SY51_META2/29-260-----------WASV--------.....TAP---LYALAGGVFMS....G---LALSLEQ............RF......
C7PNV4_CHIPD/9-246-----------WAQY--------.....LAP---AYALAEGLTLG....V---LSVLFHN..LY................
I4ESR8_MODMB/7-273-----------ANPA--------.....ATL---AYAALQGIAVG....G---ISEIFA...................AQ
D7DQS6_METV3/5-250-----------TAPI--------.....LSP---VYAICEGLAMG....F---ISAVFET..MY................

PF01027

B6KHI7_TOXGO/120-329.........R.YPHN...........YFLLF...FFTLCESVCVG----A...VCTFYD................-----
A8N382_COPC7/125-339.........P.PEKT........VQKHLLWL...AFNGFQAATLS----P...LFFFS.................-----
A0CUW2_PARTE/56-286...........FPLN...........LIFYF...TFTIGAAYSFG----YPLSLLLQYGYY............SG-----
A0DUN3_PARTE/28-241.........Q.HPYN...........YICYS...SFTLSISYLFF----Y...TIHHYPTY...........SNH-----
A0LGQ6_SYNFM/17-228.........R.FRAS........SA.TLMFF...IYSALNGVTLS----V...IFLVYA................-----
A0RRR6_CAMFF/25-219.........K..KNP.......SLA.LVMLF...GFTFVSGLTLG----P...VLNTYIGA............GM-----
A1A283_BIFAA/75-289.........K.IKPS........TA.RVMFY...VYAAIMGFSLS----T...IFMAYD................-----
A1AQX9_PELPD/20-227.........R.LSGS........AA.TLLFL...GYSALNGLTLS----V...IFLVYT................-----
A1AX37_RUTMC/15-212.........K..NSS........YG.ILAVF...ALTGFMGLTLG----P...IINAYTDTF..........SNG-----
A1B1U7_PARDP/24-252.........R.LSVQ........GA.TTLFY...AFAAVMGISIS----W...IFAAYT................-----
A1S6I1_SHEAM/16-212.........A..DTA........AG.LFWVF...AFTGMEGASLG----F...ILNHYAGM...........ANG-----
A1SWS6_PSYIN/18-214.........A..NSS........KG.IFWVF...IFTGVMGASLG----N...MLNHYLAM...........ENG-----
A1TSD8_ACIAC/21-222.........K..NSA........AG.VPVLL...GFTFFMGLMLS----R...LIGMVLGF...........KNG-----
A1WWU6_HALHL/25-221.........R..NSV........WG.LASIF...ALTGFMGYTLG----P...IINLYLGL...........PNG-----
A2SF80_METPP/20-223.........K..NSG........IG.VALLL...GFTFFMGLMLS----R...LIGGVLGNY..........SNG-----
A2SGJ7_METPP/35-231.........K..NSG........WA.LPAVF...ALTGFMGYSLG----P...VLAKSLAL...........PGG-----
A3LXU5_PICST/45-247.........R..SYP........TN.LFLLG...GFTLCEAYLIG----L...CCAFVE................-----
E0TG86_PARBH/24-234.........N.GSTA........MAH.GAYW...AYVGLWGLLIG----P...VVAAYAGA............GL-----
A4G4J7_HERAR/19-221.........K..NSG........LG.VALLL...GFTFFMGLMLS----R...LIGHILGF...........ANG-----
A4I0V7_LEIIN/109-308.........P.ANPS........LK.LCLFF...SFALLEGMAIA----P...LVLMTS...............M-----
A4VX37_STRSY/17-227.........K..NSP........MA.LPMFL...AYSVTNGITIS----M...ILMFYT................-----
A5CDM3_ORITB/21-240.........R.LDIS........TA.QTLFW...VYAVLVGMSLS----A...LGYIYT................-----
A5DPA1_PICGU/50-252.........R..SYP........IN.LVLLS...GFTLLEAYTLG----V...VCSLVE................-----
A5E0Y3_LODEL/45-246.........R..SYP........VN.LILLG...GFTLFEAFSLG----F...ACAFIE................-----
A5EVN6_DICNV/21-215.........R..NSG........VG.IVLLF...VLTGFLGFYVS----N...LLSMLIAV............GR-----
A5FVN6_ACICJ/27-251.........K.LSTT........QA.QALFW...AFCGLMGASLT----N...IFLVYT................-----
A5GUQ5_SYNR3/22-233.........N.NATA...........LPLLA...IYSLITGFTLS----G...LVAMA.................-----
A5K3F8_PLAVS/30-237.........S.YSHYGNILPAASKKRLLYFA...GISSAIGILMS----D...YIAYVNY.............LN-----
A5V4K0_SPHWW/30-238.........K.LSTT........AA.QGLFW...AFAAVMGLSMS----S...LFLAYT................-----
A5VGS7_SPHWW/27-236.........Q.MSAA........MA.QTAYF...VFAGVMGISMA----S...IFLMFT................-----
A6Q632_NITSB/34-232.........K..SKP.......GLN.LFMLF...GFTFMTGLTLT----P...LLSAVLAL...........PAG-----
A6Q691_SULNB/22-221.........R..NKP.......GLN.LAMLF...LFTFLTGVSLV----P...LLASLIGM............GN-----
A6QA51_SULNB/16-228.........K.MDIS........TA.RILFI...LFSVVDGMTLA----S...IFLIYT................-----
A6VN26_ACTSZ/21-216.........A..NSA........AG.ILAAF...AFTGFLGYTIG----P...ILNMYVGA............GL-----
A6W0C3_MARMS/16-212.........K..NSS........AG.ILCVF...ALTGFMGLTLG----P...ILSAYMNM...........ANG-----
A7AX64_BABBO/30-235.........H.DTGSYEK..TSSVDRMIALG...IMAFAQGLLLR----E...TVYFMML.............VK-----
A7EDC6_SCLS1/72-273.........K..SYP........TN.LLFLG...GFTALEAYTIS----V...IVSTFD................-----
A7HSY2_PARL1/27-247.........R.LSLS........AT.QLLFW...AFAGVMGLSLS----S...IFLVFT................-----
A7I0C4_CAMHC/30-228.........K..SGSN......TIA.LVLLF...AFTFITGLSLG----P...ILNFYIGA............GA-----
A7RRN6_NEMVE/26-227...........NNGKN......QSKRFGILM...GFALCCGLSLG----P...LMDLVIE.............VD-----
A7SUK2_NEMVE/41-257.........P.YEAG.......LNGKHFAWL...AHSSLVGTILA----P...IMLLG.................-----
A8AVN1_STRGC/14-224.........K..NSP........AA.LPLFL...LYSALNGFTLS----I...VLALYT................-----
A8EX08_ARCB4/24-224.........K..HTP.......GVN.LAVLF...VFTFITGLTIA----P...LLAAIFAM...........PSG-----
A8HUL0_AZOC5/27-255.........S.MSVG........AA.QAVFW...GYAALVGISLS----S...IFLVYT................-----
A8JCT0_CHLRE/35-234...........ATPQT......LNKRYALLG...GFAFCQGAALG----P...LVGLAAA.............VS-----
A8LJ17_DINSH/24-236.........K.MSAA........AA.QVFFY...TFAAAMGLSIS----F...IFAVYT................-----
A8LT34_DINSH/23-238.........R.LSVG........AL.QGLFW...GFAALMGVSLA----S...ALLVFT................-----
A8PJB5_BRUMA/34-232...........HNHHN......ERKRLGYFI...AFCALSGVSSG----P...VIEKALM.............ID-----
A8PUB6_MALGO/132-346.........P.PNHP.........AKIPCWL...LFNASQAAVLS----P...LLFLN.................-----
A9A0M8_DESOH/17-230.........K.IEAT........TA.TALFI...IYAMLNGVTLS----F...IFIAYT................-----
A9CHH9_AGRFC/27-255.........N.MSVS........AA.QSTFW...VYAALMGVSLS----S...IFLRYT................-----
A9PF37_POPTR/39-243.........Q..KHP........VN.LIILG...LFTVSLSLLVG----A...SCANIE................-----
A9RSA6_PHYPA/38-242.........Q..QHP........VN.LVLLG...LFTATISLTVG----I...SSALTK................-----
A9SK21_PHYPA/31-231...........STAEN......ENKRLQLLG...AAALCEGASLG----T...LVGQVLQ.............FN-----
A9SQ31_PHYPA/40-244.........Q..QHP........VN.LVLLG...LFTATISLSVG----I...SCALTN................-----
A9SQP2_PHYPA/39-243.........Q..SHP........LN.LILLG...LFTVTMSLSVG----I...SSSMAP................-----
A9V0R4_MONBE/102-310.........P.AENT........VAKYGALA...LFNTAVAFSLC----P...LMLLG.................-----
B0C2E0_ACAM1/22-236.........N.NNVA...........LPLLA...TFSLVTGYTLS----L...LVDIA.................-----
B0CFK9_ACAM1/23-233.........A.KADQ.......VGTQYAGLG...VYVVAQALIFA----P...MLYMAAAF............SD-----
B0JG20_MICAN/22-235.........N.TGTA...........LPLLT...LYSLLSGYTLS----G...IVYVA.................-----
B0T6B0_CAUSK/26-244.........S.ITAR........TA.GVIYW...SIVSLIGASLG----T...VVLLYT................-----
B0U8X3_METS4/34-269.........R.MSAA........SA.RTTFL...AFAAVMGASLS----T...LLLRYT................-----
B0X729_CULQU/29-229...........PSGDN......RALRLGLLL...ATGALTGHLLG----L...TVEYALV.............VD-----
B1XK65_SYNP2/22-235.........N.NSVA...........LPLLA...GYSLLSGYTLT----G...IVALA.................-----
B1XXH0_LEPCP/22-223.........K..ESA........TG.VAVLL...AFTFFMGLMLS----R...MLAAVLGF...........KNG-----
B2A999_PODAN/119-335.........D.PDNY........VPKYAFWA...VFNATQAAFVA----P...LMVMAP................-----
B2IH64_BEII9/29-251.........Q.MAAS........TA.RTLFF...AFAATMGLSLS----T...LLLVYT................-----
B2IYG6_NOSP7/22-235.........N.KGLA...........LPLLA...TYSLLSGYTLS----G...LVFVA.................-----
B2VV36_PYRTR/71-272.........K..SYP........TN.LLFLG...GFTAMEAYSIS----V...IVSFTE................-----
B2WKA4_PYRTR/117-332.........H.PSNY........VQKYALWS...AFNGTQALLLS----P...LFFMH.................-----
B3PEU1_CELJU/19-221.........A..NSS........AG.LGVVF...AFTGLIGAGLG----P...VINHYLSF...........TNG-----
B3RRU1_TRIAD/26-228..........HDGGKT......QLRRLGYLC...GFSLTAGLGLG----P...LLEIVLE.............ID-----
B4ESV4_PROMH/20-232.........K.MSGA........LA.TTLFM...LYSALTGVTIS----S...VLIVYT................-----
B4FSR2_MAIZE/33-233...........ASRDQ......ERNRLALLM...SAALLQGASVG----P...LVDLVID.............LD-----
B4H3P5_DROPE/29-229...........DDGNN......YQLRLAMLY...GFGFFAGQTIG----P...LLGCVGR.............ID-----
B4I4U6_DROSE/141-357.........E.YQPG.......FGAKQLAWL...VHCAVLGAVLA----P...MCLLG.................-----
B4JF90_DROGR/142-358.........E.YEPG.......LGLKQLAWA...LHCGVMGAVIA----P...ICFMG.................-----
B4JP44_DROGR/20-227.........I.FPIN...........WTLAIGIIVFITLAGAC..----....IMHVY.................-----
B4MSJ1_DROWI/113-329.........E.YQPG.......LGPKHLAWA...LHCAILGGVIA----P...LCFIG.................-----
B4QLM1_DROSI/28-228...........DDGKN......YYTRLSMLY...AFGFCSGQTLG----P...LLGYICS.............IN-----
B4RCG0_PHEZH/51-271.........N.ATPR........SS.GILYW...TIVALIGAGLG----V...WTLIYT................-----
B4RI09_PHEZH/26-246.........N.PTSG........AA.SALYW...TIVALIGASLG----V...VGLVYT................-----
B4RIG5_PHEZH/26-246.........Q.PTAR........GA.SALYW...TVCALIGASLG----V...LGLVYT................-----
B4U9U8_HYDS0/12-216.........G.QNKD........MA.LPGFILLNVFTFITGFTLA----P...ILSFALA.............VN-----
B5EDF2_GEOBB/16-220.........R.ISAT........TA.SALFL...LYAAVNGLTMS----S...IFVAYT................-----
B6AIB7_CRYMR/30-232.........S.NTVII......SFWRVLAFL...IFCFTLGNSLG----P...LIIYGNF.............IN-----
B6AIN7_CRYMR/31-243.........Q.YPIN...........LVILF...TITFLESLPIG----C...LCVVLP...............G-----
B6HLQ8_PENCW/65-266.........K..SYP........AN.LLFLS...GFTILEAYSIS----V...ATSFYD................-----
B6IUM4_RHOCS/26-235.........K.MSAA........TL.QTLFY...VFSGLMGLSLM----Y...IFLVYT................-----
B6TIY8_MAIZE/53-257.........H..KHP........HN.FVFLG...LFTLCLSFSIG----V...ACANTQ................-----
B7JBM1_ACIF2/26-225.........A.HRSP........FA.VPLVF...LFAGGMGMMMG----P...AIEMYLRM...........PGG-----
B8DP50_DESVM/18-230.........R.LSGG........AA.TGLFV...LYSALNGITLS----A...VLLAYT................-----
B8FKM7_DESAA/17-230.........T.MKAG........TA.TGMFV...VYSALNGLTMS----F...IFAVYA................-----
B8GQ93_THISH/19-215.........R..NSI........WS.LPLTF...VFTGFMGYVLG----P...IVTLYLSQ...........PNG-----
B8HNP6_CYAP4/13-223.........A.RADN.......TQTQYIGLG...IYVVAEAIIFA----P...LLYMAAYF............TD-----
B8IBU6_METNO/23-232.........H.ISAA........TA.QTLFW...SFCGVMGLSLA----S...IFLVFT................-----
B8IYR9_DESDA/17-229.........K.MSGS........TA.TGLFL...LYSALTGATLS----S...IFVVYP................-----
B8MED6_TALSN/117-332.........P.PENY........MLKYALWT...GFNVTQAALLS----P...LMFLS.................-----
B9DTR6_STRU0/15-225.........R..NTP........MA.LPLFL...IYSALNGFTLS----F...IIAAYT................-----
B9JUA5_AGRVS/24-252.........S.MSVS........AA.RTTFL...VYAGLVGLSLS----S...ILLIYT................-----
B9L7A8_NAUPA/35-240.........K..NKT.......PLN.LVLLF...AFTFMTGFTLA----P...TLAMFIAA............NM-----
B9M4V9_GEODF/20-227.........R.LSAT........AA.SSLFI...LYAALNGVTMS----A...IFAVYT................-----
B9PLK6_TOXGO/30-235.........T.EAVYSGK..VTTPLRAAYFG...GFGFTTGMMLG----D...YLYFVNV.............LN-----
B9SFF8_RICCO/30-237............................LLG...VLTAALTLLVG----L...SCVV.A...............T-----
B9SFF9_RICCO/27-234.........R..LRP........VN.YLLLG...VFTTALGFLVG----L...TCAFTS................-----
B9T0M2_RICCO/34-232...........PY..Q......EQKRVAILM...AAALFQGASVG----P...LIDLAID.............ID-----
C0NU02_AJECG/69-270.........K..SYP........TN.LIFLS...IFTALEAYAIS----V...VTSFYD................-----
C0QH09_DESAH/17-230.........K.IQAS........TA.TALFV...VYSILNGVTLS----S...IFMVYT................-----
C1D533_LARHH/19-221.........R..DSG........VG.VALLL...ALTFLLGLLLG----P...LLQVALSV...........PNG-----
C1H044_PARBA/68-269.........K..SYP........TN.LIFLC...GFTILEAYAIS----V...TTSFYD................-----
E3D723_GARV3/35-248.........K.MSVF........AA.RAMFY...AYAALTGFTLS----T...IFTVFS................-----
C3YF20_BRAFL/26-227...........NAPAN......QLKRLGIMG...GFAFCVGLGLG----P...LMDQVIQ.............ID-----
C3ZWB9_BRAFL/110-326.........P.YSPG.......FGTKQLAWL...THAAVMGAVVA----P...LCFIG.................-----
C4K3R8_HAMD5/20-232.........K.LSGA........MA.TSLFM...LYSALTGLTIS----S...IFVVYT................-----
C4KCP9_THASP/19-215.........R..DSS........LG.IVFVF...ALTGFMGFTLG----P...IISSYLAL...........PNG-----
C4R8R2_PICPG/45-246.........K..SYP........YN.LFLLL...GFTICESYGIG----M...VTSLYD................-----
C4WRJ7_ACYPI/45-246.........H.YPAN...........LIILI...VFTVIEACTVG----I...VVTSFD................-----
C4XFK5_MYCFP/39-263.........P.RMHI........GVSIPMVM...IIMMGFGLFAL----S...IP...LYYAK........ETMV-----
C4XRR5_DESMR/21-233.........R.LSAG........TA.SGLFM...LYSALNGVTLS----A...IFVVYA................-----
C4Y6K1_CLAL4/45-247.........R..SYP........TN.LILLT...GFTVCEAYGLG----L...ACSFVK................-----
C5B7G7_EDWI9/20-232.........R.LSGA........AA.TSLFM...LYSLLTGLTLS----S...IFVVYT................-----
C5BTY5_TERTT/18-220.........A..NSS........SG.ILVVF...AFTGLLGAGLG----P...MLNHYLAM...........ANG-----
C5D2L3_GEOSW/9-205.........K.KA..........VG.YPLMY...SFMLVSGATLY----P...LIGHYVAV............IG-----
C5DSS8_ZYGRC/34-256NERVPWYALT.SRGQ...........KSLLF...LFTLCESYCLA----G...TVMFEA................-----
C5FIJ8_ARTOC/68-269.........K..SYP........TN.LLFLS...GFTLLEGYAIS----V...ITSFYD................-----
C5J7D0_MYCCR/10-247.........Q.KPHT........AV.LATLY...FILILSNSIFL----P...FVFAQYIA...........RGQ-----
C5LBE2_PERM5/65-267.........P.YNDRI......DPKRLAMFA...GFAFLKGTSLG----P...LIHYSVM.............ID-----
C5M3P9_CANTT/53-255.........R..SYP........VN.LVLLS...GFTICESYSLG----V...ACAFVD................-----
C6C1J2_DESAD/18-239.........K.LSSG........AA.TGLFM...AYSALNGLTLS----T...ILIAYT................-----
C7LXK1_DESBD/17-229.........R.MSAF........TA.TGLFL...LYSALNGATLS----S...ILMVYT................-----
C7Q6T3_CATAD/16-211.........A.ARSP........QATVLLLG...AFGLLMGIAMA----P...TLVYYAT.............TN-----
C7R764_KANKD/20-229.........H.TSQS.......KVTQYSSLA...GLIIAEAIIFA----P...LLLMAAQ.............MA-----
C8X4E4_DESRD/18-230.........K.LSGT........MA.TSLFM...LYSGLNGVTLA----P...ILLLYT................-----
D0KXZ9_HALNC/19-216.........A..RSG........AG.LVTVF...AITGLMGLGLG----P...TINYYLHL...........EGG-----
D1ARJ6_SEBTE/26-237.........K.ASVG........AL.RGMFL...LYAVLNGITLS----I...IGYIYT................-----
D1AX50_STRM9/12-223.........N.SSAS........VL.KLVFI...GYSAFLGILLI----P...IMYAYQ................-----
D1B5B2_SULD5/29-227.........K..RKA.......GLN.LLLLF...GFTFLSGLTLA----P...LLSSIIGL...........KGG-----
D3SG31_THISK/26-222.........R..NSA........LG.LVLTF...AFTGVLGFFLG----P...ILSMYLGL...........PNG-----
Y819_CHLTR/11-231.........K.LSVP........AV.MGLFL...AYSILEGMFFG----T...LVPVYAAQ............FG-----
BI1_RAT/24-225...........HSHET......EQKRLGLLA...GFAFLTGVGLG----P...ALELCIA.............IN-----
P73793_SYNY3/32-245.........N.NATA...........LPLLT...LYSLLSGYTLS----G...IIYLA.................-----
Q03GC4_PEDPA/15-227.........L.QNPT........VS.FLMLF...AFSAFFGITLS----S...VFMLYS................-----
Q03RJ4_LACBA/19-226.........K..RPT........VA.LVGLF...VYAVITGGVIS----L...YSLVYT................-----
Q04EI1_OENOB/23-235.........L.KNPA........LA.FGGLL...AFAVVEGIFFG----A...IFAMYD................-----
Q0A861_ALKEH/21-217.........R..NSI........WA.LPAVF...ALTGFMGFTLG----P...IVSAYLAL...........PNG-----
Q0AKK1_MARMM/23-250.........N.PSPA........GS.AILYW...AIVVLIGASLS----F...WVIIASQNQVVQSVGGRSLAID-----
Q0BV78_GRABC/37-260.........R.LSLG........TV.QALFW...LLCVAMGASLT----N...IFLVYT................-----
Q0BX99_HYPNA/25-254.........K.NPSP........LATGILYW...TIVVMLGVCLS----I...WVAMAAAQTGVTTRGGAALNVT-----
Q0K957_CUPNH/24-226.........K..NSS........MG.VVLLL...AFTFFMGLMLS----R...LIGVTLQF...........SNG-----
Q0VQ00_ALCBS/24-220.........R..NSA........WG.ILAVF...GLTGWLGFTTG----P...IINMYTQI...........PGG-----
Q113G8_TRIEI/22-235.........N.NNVA...........LPLLA...TYSLLSGYTLA----G...LVYIA.................-----
Q11D01_CHESB/26-243.........T.LSVS........AA.QSIFW...VYAALVGLSLS----T...IFLVYT................-----
Q12N83_SHEDO/17-213.........A..DSA........AG.IFWVF...AFTGIEGASLG----Y...ILNHYAGM...........ANG-----
Q15T21_PSEA6/19-215.........S..QSS........MG.ILFVF...AFTGLLGGSLG----Y...TLNYYAGF...........QNG-----
Q168I7_ROSDO/23-241.........K.LSAA........AA.QLFFY...SFAGVMGLSIS----W...IFVAFT................-----
Q17KY2_AEDAE/25-225...........QRKTN......RRFRLALLM...LVGALSGHTMG----L...MIEQVMV.............VN-----
Q1GUZ0_SPHAL/30-238.........K.LSTP........AA.QAIFW...VYAAVMGLSMS----T...IFLAFT................-----
Q1HR31_AEDAE/26-226...........DNGKN......FNLRLGLLL...GFGAFSGHSLG----L...LLEQVIF.............IN-----
Q1J0Z4_DEIGD/13-220.........R.LSSA........VA.GILFI...AYAALTGLTFS----S...LLLAYS................-----
Q1MQ63_LAWIP/21-233.........R.LSST........AA.TLLFI...LYSLLMGAFLS----S...VLVVYT................-----
Q1QW79_CHRSD/19-216.........A..NSA........AG.LLSIF...AFTGFMGFTLG----P...MLSLYLSL...........PNG-----
Q1WUN9_LACS1/18-229.........R..SPA........MS.LTGLG...LYSVLEGLFFG----L...IVQVYS................-----
Q21K99_SACD2/18-212.........K..NSA........MG.IVSVF...ALTGWLGFSIG----P...IISYYIGV............SG-----
Q22AT9_TETTS/66-293.........Q.VHQK........TSNTPMRLGLYSLG.MAGLGLS----S...SVLFGS................-----
Q28T17_JANSC/24-248.........K.ASAA........AA.QTFFY...AFAAVMGISIA----Y...IFAVYT................-----
Q2G985_NOVAD/35-243.........R.LSTF........AM.QAMFW...GFSVAMGLSLS----A...IFFIYT................-----
Q2GEZ5_NEOSM/36-247.........G.MTSE........RA.KVLFW...CFSVLMGLSLS----W...VFIAYT................-----
Q2GI89_EHRCR/18-229.........V.LSFQ........AI.LMIFF...SFAALVGVSIS----Y...VFLVYT................-----
Q2GIF3_ANAPZ/18-229.........Q.MSYQ........TM.MMVFL...GFSAMMGLSLS----Y...VFMVYT................-----
Q2H3P6_CHAGB/69-270.........H..SYP........TN.LLFLS...AFTLLEAYTIS----V...IVSFYS................-----
Q2KWX5_BORA1/25-228.........K..NNS........LG.VVLLL...AFTFFMGIMLS----R...LLGFVLGM...........SNG-----
Q2NCY0_ERYLH/35-243.........K.FSKG........TL.QAMYW...GFAVLMGLSLS----T...IFLVYT................-----
Q2NU64_SODGM/18-213.........A..NSP........AG.ILATF...ALTGFMGYTLG----P...LLSMLLAS............GA-----
Q2NUJ0_SODGM/20-232.........R.LSGA........VA.TSLFM...LYSVLTGLTLA----S...IFIVYT................-----
Q2RNE3_RHORT/28-246.........K.MSAA........AS.QMFYW...AFVALQGVSLS----T...LLLVYT................-----
Q2SJ24_HAHCH/29-224.........A..NSV........WG.LVLAF...TFTGLLGLTIG----P...IVGQLIAG............GA-----
Q2VZ47_MAGSA/31-240.........S.MRAS........TA.STLFW...VYAGLMGASLA----S...VFLVFT................-----
Q2Y6W4_NITMU/21-223.........R..NSV........VG.IGLLF...LFTFVAGWWLG----P...MLQYALHF...........KNG-----
Q30NV3_SULDN/27-225.........K..HKQ.......GIN.LMVMF...GFVFMTGLMLA----P...LLSHTLGM...........SGG-----
Q30Y49_DESAG/16-228.........T.MSAG........TA.TTLFM...VYSALNGVVLS----S...VLIVYA................-----
Q31M69_SYNE7/22-233.........S.NSTA...........LPLLA...LYGLLTGFSLT----G...LISVA.................-----
Q385I6_TRYB2/98-297.........P.QNPN........LK.MGLFF...AFTVLEGMALA----P...LIASSM...............A-----
Q38XY7_LACSS/13-227.........T.KNPS........AS.MMMFI...AYALLNGLTFT----V...ILLAYN................-----
Q3A7T2_PELCD/19-230.........R.LSAA........AA.TGFFL...LYSALSGVTLA----A...IFVLYT................-----
Q3J598_RHOS4/24-242.........R.LSQA........AA.QLFFY...AYAAVMGLSLS----W...IFVAFT................-----
Q46JI7_PROMT/22-235.........N.NSKA...........LPLLT...GFSLLTGFTLS----G...IVGLA.................-----
Q47HS3_DECAR/20-222.........K..DSG........LG.VALLL...GFTFFMGLMLS----R...ILQVALGF...........SNG-----
Q482E8_COLP3/19-215.........A..DSA........SG.VYWIF...AFTGLMGASLG----P...MLSAYAAM...........DGG-----
Q4FNX7_PELUB/6-228.........K.MTAS........TA.QTTFW...VFASLMGLSLS----S...IFLVYT................-----
Q4N8D7_THEPA/80-287.........E.NRTV.............CIC...FLSAETTLLTL----V...VATV.TCF............YE-----
A0A0D1DT09_USTMA/150-364.........P.PGHP.........LKVPSWL...LFNASQAAVLS----P...LLFLN.................-----
Q4UFQ1_THEAN/30-231............TKTSRN..DSNYKRLVALL...FFSLGLGITYR----N...YVLQAFA.............FN-----
Q4UH80_THEAN/67-274.........E.NTIC.............CII...FLATTTGLLSL----L...VAST.CCF............FD-----
BI1_DICDI/37-241.........R.TQDYK.....TQVKRFTLFN...LVTFVTGMSSS----G...LIELYMD.............IN-----
Q5CX10_CRYPI/29-231.........S.NKSSI......SIKRLAAYL...LLCFVIGNGLG----P...LILFSNF.............VN-----
Q5FPP8_GLUOX/24-248.........R.LSRP........AV.QGIFL...LFSAAMGASMA----S...LLLSYT................-----
Q5KDG7_CRYNJ/77-277.........H..QHP........AN.LILLG...LFTLFEATMIG----L...AVSYYE................-----
Q5R0A7_IDILO/19-215.........K..DSG........MG.IVLTF...ALTGFLGYTLG----P...ILNMALSM...........PGG-----
Q5TP14_ANOGA/117-333.........P.YSPG.......LGAKQLAWA...THSAILGAVIA----P...MCFVG.................-----
Q609C7_METCA/20-218.........A..NSA........LG.LLWVF...ALTGFMGYTLG----P...VLNAYVTHF..........ANG-----
Q6AMM4_DESPS/24-235.........K.IQAS........TA.SGLFL...GYSFLNGLTLS----A...IFLAYT................-----
Q6BV67_DEBHA/47-249.........R..SYP........SN.LLLLG...GFTLCEAYGVG----V...ACSAIE................-----
Q6CP52_KLULA/27-244E...PWYVLS.FPQQ...........LALLI...LFTMAEAYSLS----I...VVVIYK................-----
Q6NDB1_RHOPA/29-259.........R.LKPA........TA.QLLFW...AFSALMGISLS----S...IFLVYT................-----
Q728Y2_DESVH/16-228.........R.LSAG........MA.SGLFL...LYSALNGLTLS----S...ILLVYA................-----
Q7MSL1_WOLSU/32-230.........K..DKP.......GIN.LVVLF...AFTFMTGLTLT----P...LLSRIFNM...........PGG-----
Q7N6P2_PHOLL/20-232.........R.IGAS........LA.TGLFM...LYSALTGLTLS----S...IFVIYT................-----
Q7NPB6_GLOVI/18-221.........S.KNAD........NLSLILLF...VFAVVEGLVLA----P...ITAIYLAS...........SVG-----
Q7NUQ5_CHRVO/19-221.........R..YSS........LG.VFLML...GFTFMMGVLLG----P...LLQFALKF...........SNG-----
Q7Q6L7_ANOGA/26-226...........DNGKN......FVQRFSMLM...GIGLFTGHSLG----L...LLEQVIY.............MN-----
Q7SG99_NEUCR/80-281.........Q..SYP........TN.LLFLS...GFTLLEAYTIS----V...CVSFFD................-----
Q7UU92_RHOBA/29-242.........S.SGQS.......RGLQYAGLG...LYVVAQAVIML----P...LMYIAIRV...........MNQ-----
Q7V0H4_PROMP/22-235.........N.NAKA...........LPLLT...GFSLLTGFTLS----G...IVALA.................-----
Q7V8J4_PROMM/22-236.........N.NATA...........LPLLA...TFSLLTGFTLT----G...LVLQA.................-----
Q7VHQ2_HELHP/27-224.........R..SKP.......GLN.IAMLF...IFTTLTGVTIT----P...LVAMVAFK............AG-----
Q82VP8_NITEU/21-223.........R..NSM........WG.IILLF...LFTFVAGWWLG----P...LLQYALHF...........KNG-----
Q89DW5_BRADU/21-228.........T.LSAA........TA.RLLFF...IYAALVGVSLS----I...LLHIYT................-----
Q8D225_WIGBR/18-213.........S..NKK........SG.IIAIF...LLTGFMGYTIS----P...LINMSINY............NS-----
Q8DLM2_THEEB/69-280.........N.NGLA...........LPLLA...TYSLLSGYTLS----G...LIAVA.................-----
Q8DSQ2_STRMU/15-225.........K..NSP........TA.LPLFL...VYSALNGFTLS----F...IIALYT................-----
BI1L_ARATH/47-251.........Q..KHP........VN.LILLA...LFTVSLSFTVG----V...SCAMTE................-----
Q97FA9_CLOAB/14-227.........K.MSSQ........VA.TAIFF...VYSVVNGFTLS----W...IFLVYD................-----
Q98E98_RHILO/25-253.........S.MSVA........AA.QTTFW...VYAGLVGLSLS----S...IFLVYT................-----
Q98MW5_RHILO/25-234.........T.MSAA........SA.QAMFW...AFCAVMGLSLA----S...VFLVFT................-----
Y3663_CAUCR/26-245.........N.PKPE........TA.GALYW...TIVSLIGASLG----S...VMLRYT................-----
Y402_PASMU/18-213.........S..NSG........LG.ILSTF...AFTGFLGYTLG----P...ILNVYVSH............GA-----
A1U0T3_MARHV/34-226.........N.SPWG...........IVTTF...ALTGFMGYTLG----P...IIGAFVAA............GA-----
A3MYZ6_ACTP2/20-214.........N.SSAG...........ILSVF...ALTGFLGYTLG----P...ILNRYIGA............GL-----
A4SYE4_POLSQ/23-225...........KNTG........VG.VLLLL...GFTFFMGIMMS----R...LIGFTLNSY..........SNG-----
A5VKY2_LACRD/20-231...........NP.V........GA.FVMLM...LTAIIYGVEFA----I...IAGVYS................-----
A5VLC3_LACRD/18-228............SPG........LC.LFLLI...LTAIVYGITFA----F...IAGAYA................-----
A6WV27_OCHA4/28-256.........R.LSVS........TA.NAVFW...GYAALVGLSLS----S...IFLVFT................-----
A8QEE8_BRUMA/112-349.........D.YDNT........LLKHAAWI...LHAGLMGTFIG----P...ICLMG.................-----
B0UVR0_HISS2/19-213............NSA........WG.LLSTF...ALTGLLGYSLG----P...ILSYYVGS............GL-----
B1VUQ0_STRGG/78-285.........R.PSPP.............LIL...TYAAFEGVFLG----V...ISNIVSVY............WA-----
B1X0P3_CYAA5/23-235.........K.GNNT........TA.LPLLA...LYSLLSGYTLS----G...LVYVALG..............T-----
B2GDC3_LACF3/20-230.........N.PVG..........S.FIMLM...LVSIIYGVEFS----L...ISAMYT................-----
B7JXJ9_CYAP8/23-235.........N.GNNT........TA.FPLLA...LYSLLSGYTLS----G...LVFVALG..............T-----
B8DT88_BIFA0/45-255.........K.MSTT........AA.RVCFY...VYAALMGVTLS----T...IFLAYD................-----
B8MD34_TALSN/62-262.........S.YPTN...........LLFLS...GFTALEAYSIS----V...VTSFYD................-----
B9H8C6_POPTR/29-232............PLN...........YLLLG...VFTTALGFLVG----L...TCAFTS................-----
B9KH79_ANAMF/18-229.........S.MSVQ........AV.FAVFF...GFAATMGLSLS----Y...MFMVYT................-----
C5AQF7_METEA/29-251.........R.MSAS........SA.RMMFW...AFAAVMGASMS----T...LLLVFT................-----
C5XB01_SORBI/38-244.........K.HPVN...........LILLG...LFTVAISFSVG----L...TCAFTS................-----
C5ZYY2_9HELI/29-227.........K.PGIN...........LLMLF...AFTFVSGLTLT----P...ILSRVLGM...........PGG-----
C8WS49_ALIAD/11-207.........Q.YTRA........IG.YPFVF...TFTFISGMTLS----Y...ALLSYASV............FG-----
D1BNX5_VEIPT/23-243.........S.ANVM........TL.RGMFF...LYSALNGLTLT----L...VSLRYN...............V-----
D2YW23_ZYMMO/30-238.........R.FKLS........TL.KTLFW...SYAAVMGLSMA----V...IFFVYT................-----
D4KAL4_9FIRM/19-226.........N.MSVG........AA.RGVFL...GYALLNGMVLS----Y...YFLAFD................-----
D4Z0E6_SPHJU/30-240.........R.LSTF........AM.QAMFW...AYAAVMGLSLS----S...ILLVYT................-----
D4Z6C9_SPHJU/23-231.........K.MTTA........GA.RMAFY...AFSAVMGVSLA----S...IFLVFT................-----
D6DJ22_CLOSC/23-231.........K.ISVS........AA.RAMFL...FYAALNGIVFS----A...YFLLIG................-----
E9DBQ0_COCPS/66-266.........S.YPSN...........LLFLS...IFTLLEGYAVS----V...VTSFYN................-----
F3ZIX9_9ACTN/83-294.........K.ASPA.............LIL...TYAALEGVFLG----V...VSNVVDTH............IA-----
F4B2Y9_DOKS4/21-229.........S.RDKN........QH.YLALG...IYVVAEAFIFI----P...LLLMAFSM...........IDG-----
F4KL14_PORAD/29-237.........K.MSVT........TA.TIMLI...VYSALNGATLS----F...IFLAYS................-----
US17_HCMVM/41-246........GS.FTSP........PS.PGLLT...IYSVLTTLSVI----V...ASACSS................-----
US12_HCMVM/52-254...........RPGT...........LMLVM...VYTTLTTISVS----T...IGLCFD................-----
US15_HCMVM/42-247.........S.HPSN...........IGVLL...FYTLLHVPPLI----V...ICLCLD................-----
US20_HCMVM/27-225.........E.HPSN...........ATVLF...IYLLANSLTAA----I...FQMCSE................-----
US21_HCMVM/14-213.........N.FPKN...........VWILL...TYTLLTSVAVT----A...SGFHFS................-----
F9UNP4_LACPL/20-232............NPA........MS.FTLLM...LFAIIFGVEMS----V...TLSLYT................-----
G2LFD7_CHLTF/34-232...........KGV..........N.LVALF...AFTFLE