Sequence alignment for CL0456

PF12722

C4XYD9_CLAL4/17-927MKTAE---EKIA------------FKNSFFKLGQGRLM..DHGDVAFWSIFW....NTP-QSASDIYDL----LTPFDLQ
A3LX71_PICST/1-905MKTAD---DKLR------------YKNHFFKLGQGRVI..AGNDSDYWKVLW....TEP-DNSDDIFEL----LTSYDIR
Q6BSE0_DEBHA/1-924MKTAE---ERLR------------FKNHFFKLGQGRLI..PSSDSTYWDAFW....KEP-ETTSDIYEL----ITPYDIR
C3Z701_BRAFL/1-784MGNSD---TKLN------------FRKAVIQLTTKTQPVEAQDEA.FWDQFWT...DSV-TSVQDVFAL----VPAAEIR
Q0E9B5_DROME/1-834MGNTD---SKLN------------FRKAIVQLTQKNQKIDPSDEQ.FWEQFWQ...GHQ-TTLEDVFAL----VTSSEIR
B0WUT2_CULQU/1-851MGNAD---TKLN------------FRKAIVQLTSKSQPIDASDDA.FWEQFWC...EHS-TTVQDVFAL----IPSNEVR
A7RKV1_NEMVE/1-693MGGTE---SKLN------------FRKAVVQLTTKKSAAEPNDDA.FWDQFWS...ESA-ATISDVFTL----IPAAEIR
A8WRZ4_CAEBR/1-727MGAQG---SRVD------------FKQAVLDLTSKPGKDDEQ....FWDQAW.....WP-DTVNDIFAM----IPGEDIR
A0A0H5SQP5_BRUMA/1-721MGNSG---SKIN------------FRKAVVELTTKKSKVE..EDA.FWEELCA...SNI-NSAADIFSL----ITADDVR
C5K8E7_PERM5/1-865MGNSE---SRAL------------VSDYLDELGQCDLAVDAEAAP.MKEEFWTTIFDTP-LSIEEIFEI----ITPEWVR
B6JW01_SCHJY/1-778MGAQE---SKLC------------FRRAVLRL..............YEERFW....RFS-NTAKDVFNL----LPLKDIR
YIOC_SCHPO/1-796MGSQQ---SKLD------------FRNAVLRLHEERNI..PKFDL.IWERLW....TLP-ETTEDVFHL----MSIDDLT
Q2GWB4_CHAGB/1-825MGASD---SKLV------------FKKGIFRLSEERHI..PAGDA.YWSSFW....ELP-ESPEDIFSL----FTPADVR
Q0UAJ2_PHANO/1-733MGASD---SKLT------------FKQGIFRLSEPKQI..PADDV.YWTGFW....ELP-ESTEDVFSL----FSPADIR
B8M9N3_TALSN/1-838MGASE---SKLV------------FKQGIFRLYEDQNI..SADDP.FWIKFW....ELP-ESTEDVFSL----FTPTDIR
C5FVH3_ARTOC/1-827MGASE---SKLV------------FKQGIFRLSEQANI..PPDDQ.YWTGFW....ELP-ESVEDVFSL----FSPVDIR
C0NTS7_AJECG/1-843MGGSE---SKLA------------FRQGIFRLSEESNI..AADDP.YWTGFW....ELP-ESPEDVFSL----FSPADIR
B6HUK2_PENRW/1-841MGASE---SKLV------------FKQGIFRLSEEQEI..PADDP.YWTRFW....ELP-ESTEDVFSL----FTPADIR
Q5ASC1_EMENI/1-732MGASE---SKLV------------FKQGIFRLSEEKEI..PPDDP.YWARFW....ELP-ESTEDVFSL----FTPADIR

PF09742

F4WRP0_ACREC/1-730MGNAD...TKLN............FRKAVVQLTSKTQVIDASDDI-FWDQFWS...ENV.TNVQDIFTL....IPAPEIR
E9H938_DAPPU/1-832MGNAD...TKLN............FRKAVVQLTSKTQPIDPSDNT-FWSQFWS...ESI.TNIQDVFTL....IPATEIR
T1JUN4_TETUR/1-644MGITN...SALN.NL.........KSNEHLNKFASNQHIPV.GDS-FWNEMLSFSFTKSIRTLEETRVLEDSVSPLLNSL
J9F5Y0_WUCBA/1-661MGAKI...SSET.LI.........EENAYLRRFVGLQPISD.NDP-FWNHFLSFNFLIDSNNRKEVEQFDISLSDSLQSL
B4JW54_DROGR/1-859MGNTD...SKLN............FRKAIVQLTQKNQKIDNNDDQ-FWEQFWQ...AHQ.TTLEDVFAL....VTASEIR
I1EYR3_AMPQE/506-1206MGIAS...STSLKEL.........GRNELLEKFVGESPIAD.SEE-YWDKLLTFSFKPP.TLPGDNKVLYEATAPIIEKL
E0VAE1_PEDHC/1-723MGASN...SK...DL.........SSNEYLLKFSGKDHISC.SDQ-FWNVFLSFSFKPP.SSKSENEVINDKLSKIFENL
C1FEV8_MICSR/1-964MGAGS...STAAAAY....ARCKDDVDANLARLSDPDPTTP.DDP-TWDELLRFPAAITSASDADLDVVLGRVD......
G1MRD7_MELGA/1-648MGANS...SSIS.EL.........PDNEYLKKLSGAEPISE.NDP-FWNQLLSFSFTAP.TNSADLKLLEEATISVCKSL
D6WWB7_TRICA/1-769MGNVD...TKLN............FRKAVVQLTSKSEPIDANDDS-FWEQFWS...ENV.TNVQDIFTL....VPAAEIR
H3BX91_TETNG/1-768MGGGD...SKLH............FRKAVIQLTTKTQPVEASDDA-FWDQFWA...NAS.TTVQDIFAL....VPAAEIR
F7D5K7_XENTR/1-770MGNTD...TKLN............FRKAVIQLTTKTQPVEATDDV-FWDQFWT...DSS.TSVQDVFAL....IPAAEIR
H2SJN1_TAKRU/1-774MGSGD...SKLH............FRKAVIQLTTKTQPVEASDDA-FWDQFWS...DAS.TTVQDIFAL....VPAAEIR
B3RQA8_TRIAD/1-734MGGTD...SKLY............FRKAIVQLTTKTMPIDANDDA-FWDQFWS...ESI.ASVQDIFTL....VTAQEIR
I3JLL2_ORENI/1-646MGANT...SQVS.DL.........SDNPSLKALVGTESISE.NDP-FWNQLISFTFISP.TSSGESKLLEEAVIPLAKIL
U1M0X7_ASCSU/1-660MGAVI...SSET.IL.........DENIYLRRFTGLQPITD.NDP-FWNQLLSFNLKINTDDRREVKQFNESQLDLLQSL
H2XV68_CIOIN/1-762MGNTE...TKLS............FRKAVIQLTTRMQPVEANDDA-FWDQFWT...EPI.NNVQDVFAL....VPAAEVR
Q5ZBZ3_ORYSJ/1-682MGAAP...STPRLGAVAGAAASPGAAEQMFAALVGGKAYPI.SSE-FWRQLLELPLTQQ........WPRDRVLQACHAF
D0NH97_PHYIT/1-769MGASSSTPSSATGSAAIEQIFRSAQEKAAFEKIVSETPAPR.EDV-AYHALLGTPKPLPQLTQAQVELL...TREYGETL
T1FYR2_HELRO/1-642MGANN...STLSKDL.........SNNEYLLKLSGPDYISP.NEP-FWNQLLSFAFSVP.KTSADQRHLEDITSNLCKNF
Q4DJF1_TRYCC/1-725MGTSS...STLE............VGKA.IRLLLVDTPVD.....-..DGIFNLLLNTA.LSKSELERA....LPFSTLR
I3KNU8_ORENI/1-782MGNAD...SKLN............FRKAVVQLTTKTQPVEASDDV-FWDQFWV...DSS.TTVQDVFAL....VPAAEIR
I3JCX3_ORENI/1-776MGSTD...SKLN............FRKAVIQLTTKTQPVEATDDA-FWDQFWA...DTT.TTVQDVFAL....VPAAEIR
Q01H67_OSTTA/38-724.RESA...SELRRGLKAMCEATRETPDA..............MDV-FWYELGNAS.SEP.LTAMSERTLDEMLRPYGRSL
Q38FE7_TRYB2/1-706MGGTS...TKES................LLYFMDVARGVSPPDEK-DFSSHLGRCRKELCSGAELYRTL....LPIMQTL
Q8RWV1_ARATH/1-679MGGVP...STPRK....TGGDDVSVAEYLIATFVGEKSFPL.ASD-FWNKLLELPLSSR........WPSDRVQQACELF
I1MHZ5_SOYBN/1-671MGSAL...STPD............TAEHLVGSFVGDESIPL.SSD-FWQKLLELPFDAE........LPSQRLHQTCQLL
B0WBZ3_CULQU/1-681MGMNV...SRQV.DL.........AENEYLKRFVGRDHVPAYNDD-FWNSFLQYHINLP.TNSQEQLSLDSRLESLCQSF
F0Y4A0_AURAN/723-1436MGGGN...SKAD............LADILVMLSQSD..VSPDAHD-FWDELW....KLS.TTPEDVFEL....ISPDDVR
D7T740_VITVI/12-678..................SARPVDTAEYLIGTFVGEKSFPL.TSD-FWQKLLELPLSLQ........WPSHRVRQACELF
E1ZEP5_CHLVA/1-748MGNAGSAHAQLQ................AVAAVSGATLLPM.DAP-EWQILLG..VSQP.LSRFDPGEVEREIRPHCAEL
M4BPB3_HYAAE/1-729MGNSD...SKSK............FRESVYKLNNEV..ISSKNLE-FWDKLW....RIP.TVAEEIFTL....IQPDDVR
Q5CRW2_CRYPI/1-755MGSSI...SKDKDNSLPQNCLR......FIEPFLQKENIRT.NLS-LLNELQKLIITPI...EDNSFADQFIFEHISSKL
DYM_DROME/1-676MGINV...SRTA.DL.........GSNQWLQRFVGRQHIAHDDEA-FWNGLLNYNIVLP.ENSQDQLNLDSRLEALCQSF
H0VNU2_CAVPO/1-646MGSNS...SRIS.DL.........PKNEYLQKLSGTESVSE.NDP-FWNQLLSFSFPAP.TSSTELKLLEEATISVCKCL
E9ICM4_SOLIN/1-654MGATP...SRYE.DL.........SKNVHLGRFCGKQSIPA.NDP-FWSTFLSYNIRPP.ITRNDQIELDSRLDSSCQQL
L9KZV5_TUPCH/1-826MGSAD...SKLN............FRKAVIQLTTKTQPVEATDDA-FWDQFWA...DTA.TSVQDVFAL....VPAAEIR
E9G1Z8_DAPPU/1-633MGAQC...SSVA.NL.........NSNEHLFQLCGSTPMTA.NDP-TWNQLFSFNLQIP.LSSLENHEVIEGTAQLFQLL
D7FT96_ECTSI/1-808MGTGA...SKVA............FRDVLAQLKNED..IATNDAA-FWSKLW....KTE.TNPHDVFEV....ISPTAVR
H2MFX7_ORYLA/1-772MGNSD...TKLH............FRKAVIQLTTKTQPVEATDDA-FWDQFWT....SA.ISVQDVFAL....VPAAEIR
B7S488_PHATC/1-694MGQSA...SKEK............FRESVTALIQVD..VSADDAD-FWDELW....KIP.SSAEEVFEL....LPARSAR
W1NV48_AMBTC/1-680MGGVP...STPSK.....SSRPRDQAEYLLATFVGEKSFPI.SSD-FWQKLLASPLTLQ........WPQDKVSEACESL
B6A9V3_CRYMR/1-794MGSSI...SKEGPVFLLENSFR......LINGLLGQNTVDD.EDP-IWEKMKSEFILPP...IAPNILDNYIYEHISTTL
H2KSV6_CLOSI/110-1035MGGDN...SKLT............YRNVVIQLTTKTQPIDSNDNA-FWERFWT...DIS.ISVQDMFVL....IPAAEIR
M4AQZ4_XIPMA/1-781MGNAD...TKLH............FRKAVIQLTTKTQPVEATDNV-FWDQFWA...ECS.IAVQDVFAL....VPAAEIR
E0VG76_PEDHC/1-766MGNTD...TKLN............FRKAVVQLTSKTQPIDASDDN-FWNQFWA...ENN.TSVQDIFTL....VPAAEIR
B4MQL1_DROWI/1-832MGNTD...SKLN............FRKAIVQLTQKNQKVDPNDEQ-FWEQFWQ...GHQ.TTMEDVFAL....VTSNEIR
HID1_DICDI/1-880MGTGS...SREQ............HLNSFNTLQKETVP.......-FSSDLWKTILSQN.LEDDSLYL........ENLK
W4XTN1_STRPU/1-721MGSSD...SKLN............FRKAVVQLTTKTQPVEAGDDA-FWDQFWA...DSV.TSVTDVFAL....IPAAEIR
T1K251_TETUR/1-842MGNSD...SKLN............FRKAVVQLSSKTHPIDAKEDS-FWDQFWC...ESI.NNIQDVFTL....IPSPEIR
T1I7V2_RHOPR/1-802MGNVD...TKLN............FRKAVIQLTSKTQPIDAADNT-FWDQFWS...ENV.TNVQDVFTL....VPATEIR
Q7QGJ8_ANOGA/1-825MGNTD...TKLN............FRKAIVQLTSKSQPIDASDDA-FWEQFWC...EHN.TPVQDVFAL....VPANEIR
A0A068YEV3_ECHMU/1-732MGSSV...SNLA.DL.........ATNPYLIKLVGQESVNC.SNE-YWNRLLPFDIQTP.LTNEASFYLEAAVSSLQQRF
J9KB63_ACYPI/1-736MGNAD...TKLV............FRKAVVQLTSKTQTISAEDND-FWDQFWS...ETV.TNVQDVFTL....VPAAEIR
Q17L03_AEDAE/1-819MGNTD...TKLN............FRKAIVQLTSKSQPIDAGDDV-FWEQFWI...EHS.TSVQDVFAL....IPSNEIR
W4Z6Q3_STRPU/1-667MGGTG...SSLS.EL.........GENEFLRRFVGKESIDD.TDP-FWEQLLSFSFNIP.HSSADARLIEESSQNLCKTL
W5JW75_ANODA/1-876MGNTD...TKLN............FRKAIVQLTSKSQPIDASDDA-FWEQFWC...EHN.TPVQDVFAL....VPANEIR
DYM_XENTR/1-646MGANS...STIK.EL.........SENEFLKKLSGTDSISE.NEP-FWNQLLSFSFSTP.TNSADSKLLEEGTLSICKSL
A8WTE9_CAEBR/1-690MGSVI...TKET.IL.........QDNVYLKKLSGLEPVDD.YDP-FWNKLLSFSLKFDDDDEKTRIALESALDDHLQCL
M4C137_HYAAE/1-768MGATSS..SSATSTASIESLFCSTQEKGAFEKIVSKVPIPH.TDA-AYDTVLAAPKVLPQLIQTQVELL...TQEYGEAF
B9HUR0_POPTR/1-672MGAVP...STPRL....SGARPQDTADYLIGSFVGEKTFPI.GSD-FWQKLLELPLNLH........WPTHRVQEACKLF
F6TGV4_CIOIN/1-683MGIGC...SSFA.HL.........EDNEYLKRLSSNVSISE.NDP-FWNQLFSFTLSAP.RDRNEAILLEEATETFCKML
H3AL71_LATCH/1-849MGNVD...SKLN............FRKAVIQLTTKTQPVEATDDA-FWDQFWA...DTA.TSVQDVFAL....VPAAEIR

PF12722

C4XYD9_CLAL4/17-927TVRDQNLPNFLLLVHIVAC------RVVELAR------------------------------------------------
A3LX71_PICST/1-905TIRDQNRVNYLVMIHVLCN------QIIATAR------------------------------------------------
Q6BSE0_DEBHA/1-924TIREQNRANFVLMIRVLIL------RLTYLAQ------------------------------------------------
C3Z701_BRAFL/1-784ALREESPSNLATLCYKAVE------KLVMAAE------------------------------------------------
Q0E9B5_DROME/1-834QIRNENPANLATLCYKAVE------KLAQAVD------------------------------------------------
B0WUT2_CULQU/1-851KVRDVMPTNLATLCYKATE------RLVRAVD------------------------------------------------
A7RKV1_NEMVE/1-693NLRDENPSNLATL......------.......------------------------------------------------
A8WRZ4_CAEBR/1-727KLRDESPKNLATLVYKAVE------KIQFSRH------------------------------------------------
A0A0H5SQP5_BRUMA/1-721SLRDNSPSNLAALCYKTVD------QITTACN------------------------------------------------
C5K8E7_PERM5/1-865NLRDEKPYNMQFLLRRIIE------KLEEVCA------------------------------------------------
B6JW01_SCHJY/1-778KTRDLAFENLQTLIILLCH------RIIACSS------------------------------------------------
YIOC_SCHPO/1-796KVKDNAPENLQTIIAVLWD------KLEDLQK------------------------------------------------
Q2GWB4_CHAGB/1-825RTRDNALENLESLIQAVTN------RLFMLRH------------------------------------------------
Q0UAJ2_PHANO/1-733RTRDNNLANLETLILAVTS------RLNVLRN------------------------------------------------
B8M9N3_TALSN/1-838RVRDSSLANLETLLLAICS------RLIVLKN------------------------------------------------
C5FVH3_ARTOC/1-827RTRDTSLSNLETLLLAICS------RLVALRH------------------------------------------------
C0NTS7_AJECG/1-843RTRDASIANLETLILAVTS------RLIVLKN------------------------------------------------
B6HUK2_PENRW/1-841RTRDHALHNFQTLLLAVTS------RLTVLKN------------------------------------------------
Q5ASC1_EMENI/1-732RTRDHALGNFETLLLSITS------RLTTLKN------------------------------------------------

PF09742

F4WRP0_ACREC/1-730VLREEAPSNLATLCYKAVE......KLVKAVD.......................SSC......................
E9H938_DAPPU/1-832VLREECPSNLATLCYKAVE......RLVSAAD.......................SSC......................
T1JUN4_TETUR/1-644LSHNLNSNNLGSLVKIFIS......KSAALKDELN.............................................
J9F5Y0_WUCBA/1-661MYNTPTTCNFASFIHVLLR......RTAELKA................................................
B4JW54_DROGR/1-859QIRNDNPANLATLCYKAVE......KLAQAVD.......................SSC......................
I1EYR3_AMPQE/506-1206VAHNPKSGNVLSLVKVCMR......KASKLRD................................................
E0VAE1_PEDHC/1-723LKNNLESGNFVSLIRVFIN......KSTDVLS................................................
C1FEV8_MICSR/1-964.FGSIAPGTLDALLER.........AAAALRR........................CS......................
G1MRD7_MELGA/1-648VEKNPRTGNLGSLIKVFLS......RTKELKI................................................
D6WWB7_TRICA/1-769ALREDAPSNLATLCYKAVE......KLVKAVD.......................SSC......................
H3BX91_TETNG/1-768AVREESPSNLATLCYKAVE......KLVQVAD.......................SGC......................
F7D5K7_XENTR/1-770AVREESPSNLATLCYKAVE......KLVAGAD.......................NGC......................
H2SJN1_TAKRU/1-774AVREESPSNLATLCYKAVE......KLVQGAD.......................SGC......................
B3RQA8_TRIAD/1-734TLRDEAPSNLATLSIKAVE......KLVAASM.......................TAC......................
I3JLL2_ORENI/1-646IENNPRTGNFGALVRIFLG......RTKELKI................................................
U1M0X7_ASCSU/1-660MYNTQTTGNFAAFIRVFLR......RAAEVKA................................................
H2XV68_CIOIN/1-762ALREESPSNLATLCYKAVE......KLVQASD.......................SGC......................
Q5ZBZ3_ORYSJ/1-682AQNNYHTKHLAKILIHLVW......CLQECMA................................................
D0NH97_PHYIT/1-769AQNSLQSGNFRVLLRFVIHELPFSCRVAKMTE........................SE......................
T1FYR2_HELRO/1-642AINNCRTGNFGSLIRVFLM......RANELST................................................
Q4DJF1_TRYCC/1-725VMRHYYTRNFALLLFKCIE......VVSQIRN.......................ASL......................
I3KNU8_ORENI/1-782AVREESPSNLATLCYKAVE......RLVRGAD.......................SGC......................
I3JCX3_ORENI/1-776AVREESPSNLATLCYKAVE......KLVQGAE.......................SGC......................
Q01H67_OSTTA/38-724YAKNARSGGLYKLVRH.........AATQIGA........................AG......................
Q38FE7_TRYB2/1-706MPANAQASQVQWVVRFCLK......QVEHASC................................................
Q8RWV1_ARATH/1-679AQSNGYTRHLAKLLIHLSW......CLQELLQ................................................
I1MHZ5_SOYBN/1-671VENNHNTRHLAKILFHLAC......YLQESMS................................................
B0WBZ3_CULQU/1-681IAHNLSSGNFGSLFNVFLV......KVSELLA................................................
F0Y4A0_AURAN/723-1436QLKRERPENVVTLFTQAVA......QLCQIVH.......................TPV......................
D7T740_VITVI/12-678AQNNYYTRHLAKILIHLGQ......CLQECIS................................................
E1ZEP5_CHLVA/1-748VYNNAHTLNLQRFIYLVVQ......QLRRTRHHPGGG...........................................
M4BPB3_HYAAE/1-729MLRHQQPTNLATMLSQAVA......QLVQLVE.......................TPV......................
Q5CRW2_CRYPI/1-755FVRNATSGNFRSLTLFFIE......ILLEKERELYISIESNRFQYDRLITSINHLIGLGIVIKFIIIHYLKNFGIDELIK
DYM_DROME/1-676IGNNLKTGNFGSLVTVFLE......KTSELLS................................................
H0VNU2_CAVPO/1-646VENNPRTGNLAALIKVFLA......RTKELKL................................................
E9ICM4_SOLIN/1-654LVNNLVTGNFGTLIQIALI......RINELLA................................................
L9KZV5_TUPCH/1-826AVREESPSNLATLCYKAVE......KLVQGAD.......................SGC......................
E9G1Z8_DAPPU/1-633ESNNQATRNTSALLRVFLS......RATELKA................................................
D7FT96_ECTSI/1-808KLKVARPGNVEALLRMAVS......HLEKVVD.......................DPD......................
H2MFX7_ORYLA/1-772AVREESPSNLATLCFKAVE......RLVQAAD.......................SGC......................
B7S488_PHATC/1-694KLRDDRFENLATLFTQAVA......QLCQIVE.......................TPY......................
W1NV48_AMBTC/1-680AQNNYYTRHLAKILIHLVW......CLQELAS................................................
B6A9V3_CRYMR/1-794FETNKSSGNLRRLTLFFTK......LLSSSRKDILMNLEKDMSSLLPCPSTYSTLISTALLLRSIIRHYTQKFSLSNLLL
H2KSV6_CLOSI/110-1035ALREESPNNLATLSYKAVE......KLSRIAE.......................ASF......................
M4AQZ4_XIPMA/1-781AVREESPSNLATLCYKAVE......RLVQCAD.......................SGC......................
E0VG76_PEDHC/1-766AVREEAPANLATLCYKAVE......KLVKAVD.......................SSC......................
B4MQL1_DROWI/1-832QIRNENPANLATLCYKAVE......KLAQAVD.......................SSC......................
HID1_DICDI/1-880KLKNERPENLATFIKKLVN......QLVLVKG................................................
W4XTN1_STRPU/1-721ALREESPSNLATLCYKAVE......KLVSAAE.......................SGC......................
T1K251_TETUR/1-842ALREESPSNLATLVYKGVE......KLVSSTD.......................TLC......................
T1I7V2_RHOPR/1-802ALREEAPSNLATLCYKAVE......KMVRAVD.......................NSC......................
Q7QGJ8_ANOGA/1-825KVRDVMPTNLATLCYKATE......RMVRAVD.......................NSC......................
A0A068YEV3_ECHMU/1-732YRNDLRTHNLATLLQQFIV......KGTSVL..........................G......................
J9KB63_ACYPI/1-736LLREDVPANLATLCYKAVE......KFVKAVE.......................NSC......................
Q17L03_AEDAE/1-819KVRDVMPANLATLCYKATE......RLVRAVD.......................NSC......................
W4Z6Q3_STRPU/1-667AHSNLHSGNLCALVRVFNK......RAMQLKV................................................
W5JW75_ANODA/1-876KVRDVMPSNLATLCYKATE......RMVRAVD.......................NSC......................
DYM_XENTR/1-646IENNPRTGNLGALIRVFLS......RTKELKI................................................
A8WTE9_CAEBR/1-690MYNTQTTGNFAAFIRLFLR......RATELKT................................................
M4C137_HYAAE/1-768ARNSVYSGNFHVLVRDVIHTLPLSCRVATMTE........................SE......................
B9HUR0_POPTR/1-672AQNNCNTRHLTKILIHLSW......CLQECVS................................................
F6TGV4_CIOIN/1-683VDHNQHTGNFTSLLKVFLS......RFSELKS................................................
H3AL71_LATCH/1-849AVREESPSNLATLCYKAVE......KLVQGAE.......................SGC......................

PF12722

C4XYD9_CLAL4/17-927-----------------D...............LSPTQHMPLLNCLRL--L--------AKVLPYLFE------------
A3LX71_PICST/1-905-----------------DSEFPS.........SKSPLSIRQLLTCIRL--L--------VKLIPFLYE------------
Q6BSE0_DEBHA/1-924-----------------HENFPS.........KDAPVS..ELLNCIRF--L--------TKLLPFVFE------------
C3Z701_BRAFL/1-784-----------------SSCA...........TAKEQQ..TVLNCVRL--L--------TRILPYIFE------------
Q0E9B5_DROME/1-834-----------------SSCR...........TQAEQQ..CVLNCVRL--L--------VRCLPYIFE------------
B0WUT2_CULQU/1-851-----------------NSCR...........TQGEQQ..TVLNCVRL--L--------NRVLPYIFE------------
A7RKV1_NEMVE/1-693-----------------.......................SRVFCVRL--L--------TRFIPYIFE------------
A8WRZ4_CAEBR/1-727-----------------HP.............ANIDQK..KVINAIRL--L--------TRITPYMLE------------
A0A0H5SQP5_BRUMA/1-721-----------------SP.............SAISST..KVLNCIRL--L--------TRVCPYLFE------------
C5K8E7_PERM5/1-865-----------------TGLVQSEEDEGSHELTQGQRS..EALQCVRL--L--------TRIAPFLLE------------
B6JW01_SCHJY/1-778-----------------DPNLVEP........SNVLVT..QLLNAVRI--L--------TRVLPVVFE------------
YIOC_SCHPO/1-796-----------------ETLFDDP........AAPTTK..CALNCMRL--L--------TRLMPIIFE------------
Q2GWB4_CHAGB/1-825-----------------HPSFPDP........EIAPDR..EALNCLRV--L--------TRVLPFIYE------------
Q0UAJ2_PHANO/1-733-----------------HPSFPDP........ELAPER..DALNCIRV--L--------TRLLPFLYE------------
B8M9N3_TALSN/1-838-----------------HPSFPDP........EFAPDT..NALNCIRI--L--------TRILPFVYE------------
C5FVH3_ARTOC/1-827-----------------HPSFPDP........EIAPAK..DALNCIRI--L--------TRLLPYIYE------------
C0NTS7_AJECG/1-843-----------------HPSFPDP........DLAPDR..DALNCIRV--L--------TRILPFIYE------------
B6HUK2_PENRW/1-841-----------------HPSFPDP........DLAPER..DVLNCIRI--L--------TRLLPYVYE------------
Q5ASC1_EMENI/1-732-----------------HPSFPDP........DLAPDR..DALNCIRI--L--------TRLLPYIYE------------

PF09742

F4WRP0_ACREC/1-730..............RTQREHQI...................VLNCCRL..L........TRLLPYIFE..........DP
E9H938_DAPPU/1-832..............ATQQEHST...................VINCVRI..L........TRLLPYIFE..........DP
T1JUN4_TETUR/1-644..............KEASQ................NIIICQTFNSMFV..I........RCCAKHL..............
J9F5Y0_WUCBA/1-661..............SEIYN.........N......TIFLWQTGNALIV..L........RYICKFL..............
B4JW54_DROGR/1-859..............RTQADQQC...................VLNCVRL..L........VRILPYIFE..........DD
I1EYR3_AMPQE/506-1206..............ESKCE...............SNMATLQLRNSLFI..L........RCISHHV..............
E0VAE1_PEDHC/1-723..............ASSTG.........N......EILVWQTYNALFI..I........RCFTRYL..............
C1FEV8_MICSR/1-964..............RSDVAGSNPSRGDVANEDRA.DDAWTAAINATTL..ATRALRRCSRDTLRFL..............
G1MRD7_MELGA/1-648..............SAECQ.........N......HLFIWQAHNALFI..I........CCLLKVF..............
D6WWB7_TRICA/1-769..............RTQHEQQT...................VLNCARL..L........TRILPYIFE..........DP
H3BX91_TETNG/1-768..............STEKQCHM...................VLNCTRL..L........TRILPYIFE..........DA
F7D5K7_XENTR/1-770..............HSDKQKQV...................VLNCARL..L........TRVLPYIFE..........DP
H2SJN1_TAKRU/1-774..............SSEKQRQT...................VLNCTRL..L........TRILPYIFE..........DA
B3RQA8_TRIAD/1-734..............STPKEQTTGKKYITKALSILIHRLLIYILNCCRL..L........TRILPYIFE..........DS
I3JLL2_ORENI/1-646..............STECQ.........D......QLFIWQAHNALFM..I........RCLLKVF..............
U1M0X7_ASCSU/1-660..............SEICQ.........N......TIFLWQTANALII..L........RYICKFL..............
H2XV68_CIOIN/1-762..............HTDREQHI...................VLNCCRL..L........TRILPYIFE..........DP
Q5ZBZ3_ORYSJ/1-682..............ESS..................HAAYRKAINAAYI..S........SIFLKFI..............
D0NH97_PHYIT/1-769..............LAAYAPGVVGLDPLNGKPQTVDTHLHRALNALFL..V........RQFAMRF..............
T1FYR2_HELRO/1-642..............SALCK.........D......DLFTWQTCNALFI..I........RIVCKYF..............
Q4DJF1_TRYCC/1-725..............ESASDVQSASQG...............LQNALCL..M........RRIIPIAMEGGDTPCAAE.EP
I3KNU8_ORENI/1-782..............PSEKERQT...................VLNCTRL..L........TRILPYIFE..........DA
I3JCX3_ORENI/1-776..............PSEKEKQV...................VLNCCRI..L........TRILPYIFE..........DQ
Q01H67_OSTTA/38-724..............AHATP....................VSAINVTVL..A........GTFIKYF..............
Q38FE7_TRYB2/1-706.....................................NYSQGVSDIFLTTV.........RAVQFV..............
Q8RWV1_ARATH/1-679..............ASDDQ................SSLYKKAVNATYI..S........SVFLKYL..............
I1MHZ5_SOYBN/1-671..............TSGVP................QLVYEKAVNAVYF..T........SVFLKHL..............
B0WBZ3_CULQU/1-681..............LSDAE.........S......TVHIWQAFNALFI..I........RCLVKYM..............
F0Y4A0_AURAN/723-1436..............PMYFGQ.....................ASNCLRI..L........TRLLPFLLEDGG.......DD
D7T740_VITVI/12-678..............TSGVP................STVYTKAVNAVYI..S........SVFLKYL..............
E1ZEP5_CHLVA/1-748..............STATA........................NAVYC..L........RTIVKDL..............
M4BPB3_HYAAE/1-729..............PKYYQQ.....................ALNCVRV..L........TRLVPFILEEGG.......DD
Q5CRW2_CRYPI/1-755SAEHTQYINFVNDSNFTSEQLSELEKFILFKYNEVEGNNSSKLNLIKY..V........SKSSKFL..............
DYM_DROME/1-676..............LSDQE.........S......NMHVWQTFNALFI..I........RSLVKYI..............
H0VNU2_CAVPO/1-646..............SAECQ.........N......HLFIWQTHNALFI..I........CCLLKIF..............
E9ICM4_SOLIN/1-654..............PVQNQ.........N......IISAWQTYNALFA..V........RCILKYL..............
L9KZV5_TUPCH/1-826..............HSEKERQM...................VLNCSRL..L........TRVLPYIFE..........DP
E9G1Z8_DAPPU/1-633..............SAQCD................KIFIWQTCNALFI..V........RVIFSHW..............
D7FT96_ECTSI/1-808..............PFVLKS.....................AMTAVSV..L........TRVLPFILEAYTDPETGEVDP
H2MFX7_ORYLA/1-772..............PSEKERRI...................VVNCTRL..L........TRILPYIFE..........DA
B7S488_PHATC/1-694..............NIYFDQ.....................ALNCVRV..L........TRMLPFLLEKGTQSNIYIGLV
W1NV48_AMBTC/1-680..............AAAVP................SILYAKAVNAAHL..S........SIFLKYL..............
B6A9V3_CRYMR/1-794QIEHDYLNFDNESLDTGSINSQGTCPISKYLDKDFFDIYRTELKTLDLNYY........KRFILFI..............
H2KSV6_CLOSI/110-1035..............PTAKDQQT...................ALNCIRL..L........TRLFPYIFE..........DP
M4AQZ4_XIPMA/1-781..............PSEKERQI...................VLNCTRL..L........TRILPYIFE..........DA
E0VG76_PEDHC/1-766..............RTQHEQQT...................VLNCVRL..L........TRILPYIFE..........DP
B4MQL1_DROWI/1-832..............RTQTEQQS...................VLNCVRL..L........TRCLPYIFE..........DE
HID1_DICDI/1-880...............LQRETNTPGDF...............QLTSISLSYL........SRILPIVFESG........DD
W4XTN1_STRPU/1-721..............SAPRDQQV...................VLNAARL..L........TRILPYIFE..........DP
T1K251_TETUR/1-842..............NSTNQQTL...................VLNSTRL..L........TRILPYIFE..........DP
T1I7V2_RHOPR/1-802..............RTQQEQQT...................VLNCARL..L........TRVLPYIFE..........DP
Q7QGJ8_ANOGA/1-825..............RTQGEQQT...................VLNCVRL..L........TRILPYVFE..........DV
A0A068YEV3_ECHMU/1-732..............SIKMG.........QEIN...ALDIKMARNALLI..F........RIFTKYI..............
J9KB63_ACYPI/1-736..............RTQQDQNT...................VLNCSRL..L........TRVLPYVFE..........EP
Q17L03_AEDAE/1-819..............RTQGEQQT...................VLNCVRL..L........NRILPYIFE..........DP
W4Z6Q3_STRPU/1-667..............SAQNE.........D......HVFTWQTYNALFI..I........RRSMKYF..............
W5JW75_ANODA/1-876..............RTQAEQQT...................VLNCVRL..L........TRILPYIFE..........DA
DYM_XENTR/1-646..............SAECQ.........N......QLFIWQAHNALFI..I........CRLIKVF..............
A8WTE9_CAEBR/1-690..............SEQCE.........NENSCFSKIYLWQTSNALLI..L........RYIARFL..............
M4C137_HYAAE/1-768..............VAALGLETAGLDPVDSKLQTVEKDLYRAVNTLFL..V........RQFTMRF..............
B9HUR0_POPTR/1-672..............NSGAP................SEVYEKAVNAVYI..S........SVFLKYL..............
F6TGV4_CIOIN/1-683..............SAECD.........D......QLFIWQSRNAMFV..I........QHLCKFL..............
H3AL71_LATCH/1-849..............PTEKEKQI...................VLNCTRL..L........TRILPYIFE..........DA

PF12722

C4XYD9_CLAL4/17-927--------------------------------------LPDYAET-----------------IEN..PLFWERNFNPRDF
A3LX71_PICST/1-905--------------------------------------IPEYTQE-----------------IEP..RLFWVENFDPLVF
Q6BSE0_DEBHA/1-924--------------------------------------LPEYCSE-----------------LDD..ILFWSETFDPMTV
C3Z701_BRAFL/1-784--------------------------------------....DAD-----------------WRG...FFWSTLPG....
Q0E9B5_DROME/1-834--------------------------------------....DEK-----------------WRD...FFWSSLPS....
B0WUT2_CULQU/1-851--------------------------------------....DAQ-----------------WKD...FFWSSLPAGN..
A7RKV1_NEMVE/1-693--------------------------------------....DPD-----------------WRG...FFWSTIP.....
A8WRZ4_CAEBR/1-727--------------------------------------....DAE-----------------WRG...YFWSPIPH....
A0A0H5SQP5_BRUMA/1-721--------------------------------------....DSD-----------------WKC...FFWS.LPSAE..
C5K8E7_PERM5/1-865--------------------------------------....DVD-----------------AENCLALLWHSGGLVVRN
B6JW01_SCHJY/1-778--------------------------------------.TEIGSS-----------------WIE..SVFWTINDKNKR.
YIOC_SCHPO/1-796--------------------------------------.DKSMLE-----------------WFD..YFAWTVPKDPNIN
Q2GWB4_CHAGB/1-825--------------------------------------.KESLQQ-----------------WED..QLFWSPRRKPTRK
Q0UAJ2_PHANO/1-733--------------------------------------.EDRLEQ-----------------WED..DFFWATRRKRSRR
B8M9N3_TALSN/1-838--------------------------------------.ADHLEE-----------------WEE..QFFWAPRKKKTRQ
C5FVH3_ARTOC/1-827--------------------------------------.TDNLEE-----------------WED..EFFWRRRRKLSRK
C0NTS7_AJECG/1-843--------------------------------------.SENLEA-----------------WEE..KFFWGRRRKKHRH
B6HUK2_PENRW/1-841--------------------------------------.AEHLEQ-----------------WED..NFFWARRKRRTRQ
Q5ASC1_EMENI/1-732--------------------------------------.AEHLEQ-----------------WEE..KFFWTRRKKKTRE

PF09742

F4WRP0_ACREC/1-730DWKGFFW...............SS..............LPGKDDEE..................................
E9H938_DAPPU/1-832DWRSFFW...............SS..............LPSSSKQQFKDDG.............................
T1JUN4_TETUR/1-644......................................VQTLTEE...................NVLKHFLARKDGKE..
J9F5Y0_WUCBA/1-661......................................VQRLSET...................EFIKVFHMDKTYLE..
B4JW54_DROGR/1-859KWRDFFW...............SS..............LPA.......................................
I1EYR3_AMPQE/506-1206......................................LQSHSEE...................ALLNMFDPPPPQSS..
E0VAE1_PEDHC/1-723......................................VETVKEA...................EYIRHFNVKPMMVS..
C1FEV8_MICSR/1-964......................................CRRRRQ....................................
G1MRD7_MELGA/1-648......................................ISRMSEE...................ELQLHFTYEDKTPG..
D6WWB7_TRICA/1-769EWRGFFW...............SS..............LPSQGEDE..................................
H3BX91_TETNG/1-768DWRGFFW...............ST..............VPGAGRAR..................................
F7D5K7_XENTR/1-770DWRGFFW...............SS..............VPGAGRSQ..................................
H2SJN1_TAKRU/1-774DWRGFFW...............ST..............VPGAGRAG..................................
B3RQA8_TRIAD/1-734DWRGFFW...............SS..............VPANTDG...................................
I3JLL2_ORENI/1-646......................................IREMSEA...................ELHQQFSYQERAPG..
U1M0X7_ASCSU/1-660......................................TQRLSEA...................EFVKVFDKKLLTNS..
H2XV68_CIOIN/1-762DWQGFFW...............TS..............LPTNS.....................................
Q5ZBZ3_ORYSJ/1-682......................................IENAKTD...................................
D0NH97_PHYIT/1-769......................................VERTDEC...................PLLAHFNHKPTTEPRR
T1FYR2_HELRO/1-642......................................IENLTEE...................VVVQQFETINYTEG..
Q4DJF1_TRYCC/1-725EKRG..................................APASNPPVEGANLPAGEAKDEKKRTLFTATFVRSFFEENLAC
I3KNU8_ORENI/1-782DWRGFFW...............ST..............IPG..RAG..................................
I3JCX3_ORENI/1-776DWRGFFW...............ST..............VPGAGRAG..................................
Q01H67_OSTTA/38-724......................................IEFASESGGTTVGVQALGGARSESLRNLAKTFEYDARWES..
Q38FE7_TRYB2/1-706......................................VRHACET.................................SR
Q8RWV1_ARATH/1-679......................................IENGKSD...................................
I1MHZ5_SOYBN/1-671......................................IESAPDG...................................
B0WBZ3_CULQU/1-681......................................IETGSEY...................QLLQHFEALPVQQD..
F0Y4A0_AURAN/723-1436FCEQLCWGVE............................EPEEGRG...................................
D7T740_VITVI/12-678......................................IENAKSE...................................
E1ZEP5_CHLVA/1-748......................................MEQLNSE...................QLLAFVEVPPDVAAAA
M4BPB3_HYAAE/1-729FVQELFWHVKEDGEKG......................EEKEEEAEEV................................
Q5CRW2_CRYPI/1-755................................................................................
DYM_DROME/1-676......................................NETGSEF...................QLLQHFEAMPNAEL..
H0VNU2_CAVPO/1-646......................................ICEMSEE...................ELQLHFTYEDKSPG..
E9ICM4_SOLIN/1-654......................................IEIVGEE...................QMLNHIEAPQTTNE..
L9KZV5_TUPCH/1-826DWRGFFW...............ST..............VPGAGRGGGSGPGRGWRVAGASVAGTGTLWSRPHPSRPLLGF
E9G1Z8_DAPPU/1-633......................................IRLEKEA...................VLIKKFSFQEENSC..
D7FT96_ECTSI/1-808ALHSMFWSAEE...........................EPPSTAATATRDGAGAGAGTGE....................
H2MFX7_ORYLA/1-772DWRGFFW...............ST..............IPGASRGG..................................
B7S488_PHATC/1-694TSDE............................................................................
W1NV48_AMBTC/1-680......................................IENAKSD...................................
B6A9V3_CRYMR/1-794......................................LSNISDR...................................
H2KSV6_CLOSI/110-1035EWRSFFW...............SA..............LPLEPDSAVD................................
M4AQZ4_XIPMA/1-781DWRGFFW...............ST..............IPGTKKSG..................................
E0VG76_PEDHC/1-766DWRGFFW...............SS..............LPTGSSQDD.................................
B4MQL1_DROWI/1-832KWREFFW...............SS..............LPSTQEK...................................
HID1_DICDI/1-880FADKVFWLNEGIEPLSHPSAKISTPPSITTTKTTEIIEEQEKKDQENKQVEENKENEEKKDEEKKDEEKKDEEKKDEDKK
W4XTN1_STRPU/1-721DWRGFFW...............ST..............LPGQSSD...................................
T1K251_TETUR/1-842EWKGFFW...............YT..............FSFASR....................................
T1I7V2_RHOPR/1-802EWRGFFW...............TS..............LPDNSGERN.................................
Q7QGJ8_ANOGA/1-825QWKDFFW...............SS..............LPSGSGGSSEK...............................
A0A068YEV3_ECHMU/1-732......................................LEHRSSH...................SMNLHFADITSKAS..
J9KB63_ACYPI/1-736DWENIFW...............SS..............LPAGKGDP..................................
Q17L03_AEDAE/1-819QWKDFFW...............SS..............LPSGNEKE..................................
W4Z6Q3_STRPU/1-667......................................LEMLSEG...................RILQQLSVLVRTKP..
W5JW75_ANODA/1-876QWKDFFW...............SS..............LPSNSAGEKE................................
DYM_XENTR/1-646......................................TSQISEE...................ELLLHFTYRPADPG..
A8WTE9_CAEBR/1-690......................................TQRMTEK...................EFVRIFAKNQENER..
M4C137_HYAAE/1-768......................................VERTDKS...................PLLDHF......IPRL
B9HUR0_POPTR/1-672......................................IENAQSN...................................
F6TGV4_CIOIN/1-683......................................AENTTEM...................KMMEQFGARSLVER..
H3AL71_LATCH/1-849DWRGFFW...............ST..............VPGAGRGG..................................

PF12722

C4XYD9_CLAL4/17-927FNQPAAPALVLPRNS.................SFADVSENVLGAD-----LVLALVRLLV-AQGFTVAEP..........
A3LX71_PICST/1-905IKPSTFASLSSSTSQPC...............LTKESIHNVTAVQ-----LMRALVDLLF-IRTFTIDAP..........
Q6BSE0_DEBHA/1-924ATGSSLNNIQTPVSVLGGEKENEKT..........VNKENILGVN-----IVKCLVDLLF-IRSFTMDVPI......GDE
C3Z701_BRAFL/1-784................................QAEDGGSMPLAQS-----LLNALSDLLF-CPDFTVAPNKKAGPETHED
Q0E9B5_DROME/1-834...................................QDKTMPLAQS-----LLNATCDLLF-CPDFTVTATRRAGPEKAEE
B0WUT2_CULQU/1-851................................EKEEPTAAPLAQS-----LLNAICDLLF-CPDFTVVGLRKSGPEKAEE
A7RKV1_NEMVE/1-693................................SQEPEGQTPLAQT-----LLDALADLCF-CPEFTVHPNKKAGPEQHED
A8WRZ4_CAEBR/1-727...................................GDSTKPLAAV-----LLENLSDLLF-CPEFTISHSN...GLKVND
A0A0H5SQP5_BRUMA/1-721................................ENEQFPHQPLAYT-----LISALTDLLF-CPEFTVSSLR.NHPGGSDD
C5K8E7_PERM5/1-865RG..ESVVVEPASPSVEEAAGDDGSSVTSSVEDVADLGRAPLMYR-----MLRALQWSLF-LKDFTVLIPQ....GASLP
B6JW01_SCHJY/1-778........................................ALGEQ-----VMDSLLYLLF-YVGFTIPAVD.........
YIOC_SCHPO/1-796T.......................................PRGAS-----FLNTVVDYLF-LINFTIPAHN.........
Q2GWB4_CHAGB/1-825SS.IANEVLFDGGQDVQPKPP...........VEEFEDAKPLAEE-----LIDTLLDLLF-FSDLTVPKAP.........
Q0UAJ2_PHANO/1-733GQ.VRSEVIFDEADPEQTPTQQ..........EPEFETAKPLAEE-----VIDTLIDLLF-FSEFTLPKVP.........
B8M9N3_TALSN/1-838AQ.VASEVLFDEAQGETDNAQTQPR.......VDGREDAKPLAEE-----LIDTLTDLLF-YTGFTIPKLA.........
C5FVH3_ARTOC/1-827AQ.LSSRVLFDESRHEDDEEEGNGQTGRRGVAREDYEDVKPLAEE-----LLDTLLDLLF-FSGFTIPQVP.........
C0NTS7_AJECG/1-843AQ.IASQVLFDGASEDDEMRRSNPQD.....HQNDYYDAKPLAEE-----LIDTLVDLLF-YSGFTIPTIP.........
B6HUK2_PENRW/1-841SQ.IAGEVLFDEAQPEDNQEATSPR.......AEDYEDVKPLAEE-----LIDTLVDLLF-FADFTIPRLP.........
Q5ASC1_EMENI/1-732AQ.LAADVLFDESQVEEVRDRASPR.......VNEYEDVKPLAEE-----LIDTLMDLLF-YTGFTIPKLP.........

PF09742

F4WRP0_ACREC/1-730.....................................SLP.LAHS.....LLNALCDLLF.CPDFTVA....AN.RKSGP
E9H938_DAPPU/1-832............................ENPEGHAEESVP.LAQS.....LLNALCDLLF.CPDFTVY....SS.KKFGP
T1JUN4_TETUR/1-644..................................GNETGVEVMES.....LINNLVSVLV.....DIPL...........
J9F5Y0_WUCBA/1-661......................KKDAYDSDFEEEFDGLCENKAEE.....LLDTLVDILV.....DLPS...........
B4JW54_DROGR/1-859............................QEHATNPGQTVP.LAQS.....LLNAICDLLF.CPDFTVQ.....GTRRAGP
I1EYR3_AMPQE/506-1206............................RGSNSTEADDKEGVAIRSGLKILLHGTVMLIG.....GVPLVFITATTKFII
E0VAE1_PEDHC/1-723......................QTVAEQQLDNLSNKKIHENPLES.....LLESLLEILI.....DVPL...........
C1FEV8_MICSR/1-964.....................IANDDDDAPDESGGVATAEPAVCD.....FMAAVVDVVAGCADERAPR...........
G1MRD7_MELGA/1-648...............................SYGSAMEERDVVQS.....LLCCLC..IS.....VISL...........
D6WWB7_TRICA/1-769............................DE.......SVP.LAQS.....LLNAVCDLLF.CPDFTVV....AS.RKSGP
H3BX91_TETNG/1-768............SFGEDEGE........DE.......ARP.LAES.....LLLAIADLLF.CLDFTVH....ST.KKSGP
F7D5K7_XENTR/1-770............................EDEEEEEDGSRP.LAES.....LLLAIADLLF.CPEFTVQ....SH.RKSGT
H2SJN1_TAKRU/1-774................DDGE........DE.......ARP.LAEL.....LLLAIADLLF.CPDFTVQ....SC.KRNSP
B3RQA8_TRIAD/1-734.....................................AQP.LAKS.....LLNAILDLLF.CPDFTVP....KH.KKAGP
I3JLL2_ORENI/1-646................................SCGETGSEDLLEE.....LLSNLVHLIV.....EVPL...........
U1M0X7_ASCSU/1-660........................KEDESDGEQDCEDVYENTAEE.....FLDALVDIIV.....ELPV...........
H2XV68_CIOIN/1-762............................NETDPNGEPCAP.LAKS.....LILSLSNLLY.CPEFTVA....SHSKKGST
Q5ZBZ3_ORYSJ/1-682................NWQELSLEIDKDEKGLENFPSEQS.VEYF.....LMRGVLNYIG.....SVDV...........
D0NH97_PHYIT/1-769SNAV...AATMRQSLSIQMEDDRADNKRNADEVSLEDSSDDLAAR.....FLDALLTALI.....EFPP...........
T1FYR2_HELRO/1-642................................TNQLEARDALMEE.....FLNRLVYILI.....DVPQ...........
Q4DJF1_TRYCC/1-725N...........................DAQPEQMLPFLP.GQNTTLSKFVGRLLVDCCF.IRGLTLA.......ASSLP
I3KNU8_ORENI/1-782............HLDHDAD.........DE.......GRP.LAES.....LLLAIADLLF.CPDFTIQ....SH.KKNSP
I3JCX3_ORENI/1-776............................TDELDDDEGARP.LAES.....LLLAIADLLF.CPDFTVH....SH..KRGP
Q01H67_OSTTA/38-724............................VTASGASTRARS.PFDD.....LMLACANTLG.....KKRV...........
Q38FE7_TRYB2/1-706GDASRLLWTIGEDLGESVHGALRVSTTGDSDTVFMNRWLSTGIGK.....LCIALEKFIV.....FVPL...........
Q8RWV1_ARATH/1-679................SLQELHLSLDESEPVPHGFVMDQD.IQNF.....VMHSVLSFIG.....SNEV...........
I1MHZ5_SOYBN/1-671.................DVELYLSLHDSESIPKNILRDQT.IENL.....VMRNVLNFIA.....SIDV...........
B0WBZ3_CULQU/1-681...........DADVEQGSEAVTVAVTGETRTALAKLIDGTKFET.....FLEALVNIIV.....VIPV...........
F0Y4A0_AURAN/723-1436............................EGGEEEDGGAEP.LARL.....IVHAALHLLF.LPAFTVDATAFEGEAEDAP
D7T740_VITVI/12-678................NIEELHLSLDESEVIQNNFPADQN.IENF.....VMHGVLSFIG.....TLDV...........
E1ZEP5_CHLVA/1-748VEQQAAAAQGEQPSPAPSPQPSPQDGAPGGGTGRGSGGGEPEFSRLHNGSLVQTLVREAMLTLADDKLL...........
M4BPB3_HYAAE/1-729............................EEKEEATGAGES.LAKQ.....MLHAIMGLLF.LPEFTVSIHAYKGYGEERR
Q5CRW2_CRYPI/1-755..........................KENEHLLASFEDLS.VFEQ.....IFLNIPSFLV.CSQKYIDQSNSLSEI....
DYM_DROME/1-676...LQAALEQQQQTPAESATIAMEATEQSAAAAVPVIVDGSKFET.....FIDALVNLIV.....VIPV...........
H0VNU2_CAVPO/1-646.................................SYSSDSEDLLEE.....LLCCLIQLIT.....DIPL...........
E9ICM4_SOLIN/1-654.........................................ALPAYRLAYFIEALIELIT.....DVPL...........
L9KZV5_TUPCH/1-826GKLSGGERGLPLSGQGEEDD........ES.......ARP.LAES.....LLLAIADLLF.CPDFTVQ....SH.RRSTV
E9G1Z8_DAPPU/1-633.......................................ESLLEN.....LAVQLVEILV.....DVPL...........
D7FT96_ECTSI/1-808............................QQQQQQQQQQQP.DARVALGSAMVSATMRLLF.TRQLTVDVYSSCESVDADA
H2MFX7_ORYLA/1-772............CLDEDVDE........NE.......ARP.LAES.....LLLAVADLLF.CPDFTVQ....SH.KKSGT
B7S488_PHATC/1-694.....................................QEP.LALL.....VVHAAMHMLF.LPQFTCDYYEDSSSTVAQR
W1NV48_AMBTC/1-680................NFDELHLCLDESEAAPSEIPKGQN.LVNL.....LTRNLFSFIG.....TADI...........
B6A9V3_CRYMR/1-794............................DPFMITHNSDNS.VIGE.....LMIEICCYCI.CSQLYIDKISESNGKNYNM
H2KSV6_CLOSI/110-1035............................DE.......CVP.LAHS.....LISALCDLLF.CPDFTVH....SI.AKSGP
M4AQZ4_XIPMA/1-781............SLDEGADE........NE.......ARP.LAES.....LLLTIADLLF.CPDFTVQ....SH.KKNNP
E0VG76_PEDHC/1-766............................EE.......SAP.LAQS.....LINAVCDLLF.CPDFTVI....GN.RKSGP
B4MQL1_DROWI/1-832.....................................TMP.LAQS.....LLNAICDLLF.CPDFTVT....SSTRRAGP
HID1_DICDI/1-880ENKTTTTTTTTNTTNNTNNN........NNSDESSFDTTP.LAVK.....LMDSLLDLLF.FPGFTVT.......ESLGL
W4XTN1_STRPU/1-721............................EE.......SLP.LAQS.....LLAALSDLLF.CPDFTVV....AA.KKAGP
T1K251_TETUR/1-842............................DD.......NLP.LAQS.....LILALCDLLF.CPDFTVASLPSSRNKSSGP
T1I7V2_RHOPR/1-802............................EE.......SSP.LAHS.....LLNAISDLLF.CPDFTVA....S..KKSGP
Q7QGJ8_ANOGA/1-825............................EEPG.....SVP.LAQS.....LLNAICDLLF.CPDFTVV....GY.RKSGP
A0A068YEV3_ECHMU/1-732....................................NSPS.LAEY.....TVHLLFLLVI.....EIIP...........
J9KB63_ACYPI/1-736.....................................PIP.LAHS.....LCSAICDLLF.CPDFTVA....SN.RKNGP
Q17L03_AEDAE/1-819............................DN.......ATP.LAQS.....LLNAICDLLF.CPDFTVV....GL.RKSGP
W4Z6Q3_STRPU/1-667....................SSTVLNVEDVMENGDADGDESLLER.....FIQTLIQLLI.....EVPV...........
W5JW75_ANODA/1-876............................ENGGAGGGAAVP.LAQS.....LLNAICDLLF.CPDFSVV....GY.RKSGP
DYM_XENTR/1-646.................................NYESDTENLFEE.....LLFCLIQLIV.....EIPL...........
A8WTE9_CAEBR/1-690..TESSSTSSSDDEDDDDAQQTEGSDNNNGETKEAQIVFQNTAEE.....FTYELVSILF.....NISV...........
M4C137_HYAAE/1-768TEDVDGYQATSQQG..................VIDGNSTDNLAAR.....FLDALLSVLI.....EFCP...........
B9HUR0_POPTR/1-672................SIEEFHLSLNESEPAPNGFKTDQN.IESL.....VMHNVLNFIG.....SVEV...........
F6TGV4_CIOIN/1-683........................QKDLTSGSVFEGTENVNYAHE.....LLSALMDIII.....HVPI...........
H3AL71_LATCH/1-849...............GDEED........EN.......ARP.LAES.....LLLAIADLLF.CPDFTVQ....SH.KKGGP

PF12722

C4XYD9_CLAL4/17-927.YPESPP---------------DMCLWEPGICVPG----KYHSP..NPIHDSNRTEVLRVLLVLA--STTFYEKVSDTV.
A3LX71_PICST/1-905.RSKSNK---------------ILSVWEPGIGTSS----KYLAP..NLIIDSNRAEVLKLLLTLC--SSTFYNTPSEVV.
Q6BSE0_DEBHA/1-924GRSGSKR---------------MMSVWEPGIGTTA----KYQTP..NLIIDSNRMEVLKLMLVLM--TTSVYSVPSQVV.
C3Z701_BRAFL/1-784LQSIDSC---------------EY.IWESGVGFAH----SPAQ...YPHHDQNRSEILKLLLTCF--SETMYQPPG...D
Q0E9B5_DROME/1-834LANIDSC---------------EY.IWEAGVGFAQ----SPPH...NAHMERRRTELLKLLLTCF--SEPMYRSPQ..QS
B0WUT2_CULQU/1-851LNSIDSC---------------EY.IWEAGVGFAQ----SPPR...NGHMDARRTELLKLLLTCF--SETMYRVPN..MS
A7RKV1_NEMVE/1-693LSSIDSC---------------EY.IWEAGVGFAT----SPPS...NAQFDCNRAELLKLLLTCF--SEAMYLPPTPENH
A8WRZ4_CAEBR/1-727LSTIDSC---------------EY.IWEAGVGSGN----KPPM...VALHYQNRSEILKLLLTCF--SEVIYAPV...SD
A0A0H5SQP5_BRUMA/1-721LSTIDSC---------------EY.IWEAGVGFAT----KPPQ...VAEHDQRRTEILKLLLTCF--SEVIYVSI...SD
C5K8E7_PERM5/1-865LPTHRVD---------------SRFVWRGGIGTAK----ELPV.NQNNEIMSARCEVLKCLLTVL--SEPLFQPISS.YS
B6JW01_SCHJY/1-778.YKSKGV---------------QLCIWETGVGCNT----LLTS...KHSYEQNKIEILLLLLVLF--SETMYRE.....R
YIOC_SCHPO/1-796.DLTHGV---------------HYCIWETGVVYHP----TMLK...ERSYELHRVEVLRLLLSLF--SEEIYRT.....D
Q2GWB4_CHAGB/1-825.HGKPKV---------------TYAIWQSGVGCNT----SIPT...TREHESNRCEILRLLLTLA--GHSLYLSPSV.LP
Q0UAJ2_PHANO/1-733.AGKNKV---------------TYAIWQSGVGCNT----PVAS...TKEFESNRTEILRLLLTFA--SKSMYMSS.....
B8M9N3_TALSN/1-838.SSEGKV---------------SYAIWQSGVGCNT----SMVS...TKEHENNRMEILRLLLTLT--GKSMYMSPTL.LP
C5FVH3_ARTOC/1-827.ASKGKV---------------VYSIWQSGVGCNT----AMGS...NKELESNRTEVLRLLLTIT--GQSMYMQPNL.LP
C0NTS7_AJECG/1-843.NAKGKV---------------SYSIWQSGVGCTT----AMGS...NKELESNRCEILRLLLTLS--SQSMYMPLSL.LP
B6HUK2_PENRW/1-841.TVKSKV---------------SFSIWQSGVGCNT----AMGS...NKTFESNRCEILRLMLTLT--GKAMYLPSNT.LP
Q5ASC1_EMENI/1-732.SAKAKV---------------SYSIWQSGVGCNT----SMGS...TRELEDNRCEVLRLLLTIT--GKAMYMSSSL.LP

PF09742

F4WRP0_ACREC/1-730.....DKADELQSIDS......CEYIWEAGVGFAY.....SPPRYPI..LDSNRTELLKLLLTCF..SETMYNPPMDLSI
E9H938_DAPPU/1-832.....DKHEDLHSIDS......CEFIWEAGVGFAH.....AAPHDPR..LDNNRNEILKLLLTCF..SQAMYHPPGSESE
T1JUN4_TETUR/1-644..............................................SDSTYALHCECINLLLVLL..SVQMYSV.KPASK
J9F5Y0_WUCBA/1-661..............................................NDSTETIHIEAVKCLMVLL..SSQLYDD.DVMRP
B4JW54_DROGR/1-859.....EKAEELANIDS......CEYIWEAGVGFAQ.....SPPRNAQ..MERRRTELLKLLLTCF..SEPMYRTPQQSEE
I1EYR3_AMPQE/506-1206AITLTIIYAVVKAFTSSYPFCEVLLISLIVNVAPLIIEWMEHLLYPDPFTYDVLTEAANLSIVLM..SGQLFNKDDLFST
E0VAE1_PEDHC/1-723..............................................DFQTYSLHLEVVNCLLVFL..SAQMYTR.KPAAK
C1FEV8_MICSR/1-964..............................................GCHVYALRVACCRSLEAIA..DEYSTADDSKADS
G1MRD7_MELGA/1-648..............................................LVISKHLHLPASATMYVFL..LCVLHAK.D.LRK
D6WWB7_TRICA/1-769.....DKAEELSAIDS......CEYIWEAGVGFAH.....SPPRSPV..LDSNRTELLKLLLTCF..SETMYQPPTDISQ
H3BX91_TETNG/1-768.....DAALDLQSVDS......CEYIWEAGVGFAH.....SPPYNHV..HDMNRTELLKLLLTCF..SEAMYLPPSPDRK
F7D5K7_XENTR/1-770.....DTTEDIHTLDS......CEYIWEAGVGFAH.....SPPLNQT..HDLNRTELLKLLLTCF..SEAMYLPPSPESS
H2SJN1_TAKRU/1-774.....DTALDTQAIDS......CEYIWEAGVGFAH.....SPPYNHV..HDTNRTELLKLLLTCF..SEAMYLPPSADRK
B3RQA8_TRIAD/1-734.....ETPDDLPSIDS......CEYIWEAGVGFAT.....STPANPQ..FDRNRTEILKLLLTCF..SESLYMLPSADSG
I3JLL2_ORENI/1-646..............................................LDITYSILFEAVTVLLVFF..SYQLFHK.DILRD
U1M0X7_ASCSU/1-660..............................................SDTTEPIHIEAVKCVMAIL..SSQLYHD.SVLTS
H2XV68_CIOIN/1-762.....DKPEDLTSVDS......CEYIWEAGVGFPR.....SPPAYGY..IDQNRTEILKLLLTCF..SETIYTPPGAGDD
Q5ZBZ3_ORYSJ/1-682..............................................SLESCYLHHELLNLMLVLM..STQLCSGPSPEPK
D0NH97_PHYIT/1-769..............................................NDRTYDLHVEAVNTLLVLL..SPVAYPR.DHSKQ
T1FYR2_HELRO/1-642..............................................TDVTYSIHIECINIILSLL..SIQLFQM.SPASE
Q4DJF1_TRYCC/1-725....AKESESHPCVDE.......SLLWYPGVGGKQVEGTSTQPMNGT..MHALRQELLYTLTALL..SYPLFSPPGTRDT
I3KNU8_ORENI/1-782.....DTADDIRAIDS......CEYIWEAGVGFAQ.....APPLNYL..HDLNRTELLKLLLTCF..SEAMYLPPSPENK
I3JCX3_ORENI/1-776.....DSVESMQSIDS......CEYIWEAGVGFAQ.....SPPLNYI..HDLNRTELLRLLLTCF..SEAMYLPPSSDNT
Q01H67_OSTTA/38-724..............................................TTQTMALHTACARVLLITC..SSQLAFD......
Q38FE7_TRYB2/1-706..............................................TVSTVEAHGEVVSLLLCMC..STALYHS.TACDT
Q8RWV1_ARATH/1-679..............................................SPNSYVLHQELLNFMLVTM..STQLLSGPSHGPT
I1MHZ5_SOYBN/1-671..............................................SPNTYFLHLELLNFMIIAM..STQLLRGPSPGPN
B0WBZ3_CULQU/1-681..............................................KEFTYHLHLEAVNCLIVLL..SVSQFTQQGTEKS
F0Y4A0_AURAN/723-1436....................VPARALWAPGLGCPP.....DVVPTSSVAFDRNRVEVLRLLLAAS..CEPLYESADGFDR
D7T740_VITVI/12-678..............................................NPETHLLHHELLNFMLIVM..STQLLSGPSPGPK
E1ZEP5_CHLVA/1-748..............................................PSTSYMLLLECSQLLLALC..SSALYSASPRGQL
M4BPB3_HYAAE/1-729SATRSGESTTSGVLVF......PSLLWHSGVGYP......DASVVNSSTYDKNRKEVLALLLTCF..SSILYQKAETCSK
Q5CRW2_CRYPI/1-755..............................................CNLLISLQNTLMDIMLVLFLPNVE..........
DYM_DROME/1-676..............................................KEFTYHLHLEAVNMLITLL..SVHLFAQ.QPTDK
H0VNU2_CAVPO/1-646..............................................LDITYEISVEAISTMVVFL..SCQLFHK.EVLRQ
E9ICM4_SOLIN/1-654..............................................CEFTYVVHLEAINCLLVLL..SVQLFSQTAAEYS
L9KZV5_TUPCH/1-826.....DLAEDVHSLDS......CEYIWEAGVGFAH.....SPQPNYV..HDMNRMELLKLLLTCF..SEAMYLPPALESG
E9G1Z8_DAPPU/1-633..............................................KEETALLHRESVQTLMLLLFVAASSYLI...NNK
D7FT96_ECTSI/1-808..............DNPLEIHDPRALWSGGLDVGR.....KARIQRSRELEANRIEVMRLLLVLM..CEPLFQRNVGFDP
H2MFX7_ORYLA/1-772.....DPAEEIRSIDS......CEYIWEAGVGFAQ.....SPPLNYV..HDLHRTELLKLLLTCF..SEAMYLPPSSDSK
B7S488_PHATC/1-694RRERVETKDD............KELKADAGLKVKTVDWGVTL.......YDKNRIEVLRLVLTAC..CDPLFSPADEYNP
W1NV48_AMBTC/1-680..............................................SPRMYLLHHEVLNLVLVAM..STQLRAGPSRGPK
B6A9V3_CRYMR/1-794..............................................IHSIYALQAIVMDILIVFFLNSTSEFSISRSISS
H2KSV6_CLOSI/110-1035.....EGPEDMHTIDS......CEYIWQAGVGFAQ.....NPVHNTA..HDSNRTEILKLLLTCF..SETMYMERDEAQQ
M4AQZ4_XIPMA/1-781.....DASEEMRSIDS......CEYIWEAGVGFAQ.....SPPLNYI..HDLNRTELLKLLLTCF..SEAMYLSPLSDSQ
E0VG76_PEDHC/1-766.....DKAEDLSAIDS......CEYIWEAGVGFAH.....SPPRLPQ..YDLARTELLKLLLTCF..SETIYQPPVELKI
B4MQL1_DROWI/1-832.....EKAEELANLDS......CEYIWEAGVGFAQ.....SPPKNAQ..MERRRTELLKLLLTCF..SEPMYRSPQQSEE
HID1_DICDI/1-880KSPKEASPDAIPVLFS..........WAGGFGVDS.....VPTVHNKQ.FWINRLSVLQCLITCL..SEQLYVPQDSVST
W4XTN1_STRPU/1-721.....EKPEDPQSIDS......CEYIWDAGVGCAT.....APPHFAH..LDQNRTEILKLLLTCF..SETMYLAPASDAH
T1K251_TETUR/1-842FGSPDCPPEDLQSIDS......CEYIWESGVGFTS.....PTSSSTT..YDKHRTELLRLILTCF..STTMYKTPNEARL
T1I7V2_RHOPR/1-802.....DKAEDLQSIDS......CEYIWEAGVGFAH.....SPPHYTT..YDSARTELLKLLLTCF..SETMYQPPVDLQS
Q7QGJ8_ANOGA/1-825.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPRNGS..MDARRTELLKLLLTCF..SETMYRPPTASDE
A0A068YEV3_ECHMU/1-732..............................................SDITYGLLYESLSSLLILL..SAQVSGY.GGDEI
J9KB63_ACYPI/1-736.....DKAEDLHAVDS......CEYIWEKGVGFAQ.....SPIKNAT..FESNRTELLRLLLTCF..SQAIYSPNQNG..
Q17L03_AEDAE/1-819.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPRNGN..MDSRRTELLKLLLTCF..SETMYRVPTMSDE
W4Z6Q3_STRPU/1-667..............................................LNFTYVIHLETINTLLVLL..SVQMYIP.RISHK
W5JW75_ANODA/1-876.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPRNGH..LDARRTELLKLLLTCF..SETMYRPPTASDE
DYM_XENTR/1-646..............................................LDLTYSILLEAVTALIVLL..SYQLFRK.DILHE
A8WTE9_CAEBR/1-690..............................................NDTTLAIHVEAVRCLLTLL..SSQLYNE.SIVNT
M4C137_HYAAE/1-768..............................................NDKTYNLHVEVVNTLLVLL..SPVVYSQ.DGFKH
B9HUR0_POPTR/1-672..............................................SPKTYLLHHELLNFMLVAM..STQLLYGPAPGPT
F6TGV4_CIOIN/1-683..............................................LDFTYSLHIEALNTILVLL..SVQMFVP.SPGDN
H3AL71_LATCH/1-849.....ETAEDIHSIDS......CEYIWEAGVGFAH.....SPPLNYN..HDLNRTELLKLLLTCF..SEAMYLLPSSETS

PF12722

C4XYD9_CLAL4/17-927R-------------------TGSRFLT-----------FLVAGLASSEINTLTANLTNILCRSART--------------
A3LX71_PICST/1-905S-------------------AGSKFMT-----------LLVTSTPRVELLTLVCSLTNLVCRSTRS--------------
Q6BSE0_DEBHA/1-924S-------------------NGSKFLT-----------LLVATTPRVELLILVCSLMNLLCRSARS--------------
C3Z701_BRAFL/1-784P-------------------LPNQWLT-----------YFASSENRH.ALPLFTSLLNIVCAYDPI--------------
Q0E9B5_DROME/1-834E-------------------EPNKWIA-----------YFTSADNRH.ALPLFTSFLNTVCSYDPV--------------
B0WUT2_CULQU/1-851D-------------------EPNKWIV-----------HFTSADNRH.ALPLFTSLLNTVCAYDPV--------------
A7RKV1_NEMVE/1-693T-------------------RPNKWLC-----------YFASSENRH.ALPLFTSILNTVCSYDPL--------------
A8WRZ4_CAEBR/1-727E-------------------NRLRWIC-----------HFTAVTNPH.VLPIFTSLLNIVCAYDPV--------------
A0A0H5SQP5_BRUMA/1-721E-------------------NRMRWIA-----------RFTSAENRH.VLPLFTSLLNIVCAYDPV--------------
C5K8E7_PERM5/1-865S-------------------NPSRVLL-----------TFCSGDLPY.TANLYCSLMSTVVAYDPR--------------
B6JW01_SCHJY/1-778S-------------------HSSSYLA-----------YVISHNNSDLSLSLLCSLLNTAMQFNTS--------------
YIOC_SCHPO/1-796G-------------------NGSSCCA-----------YVASIANRRLVLCLLSSLINTAMRFNTM--------------
Q2GWB4_CHAGB/1-825Q-------------------QGTKALT-----------YMCTNSDKQVVLSVLCSLLNTTLKYNPA--------------
Q0UAJ2_PHANO/1-733.-------------------.......-----------............................--------------
B8M9N3_TALSN/1-838V-------------------KGVKAIT-----------YLATCSDKQIVLTLLCSLLNTTIKYNPA--------------
C5FVH3_ARTOC/1-827V-------------------KGVKSLT-----------YLVTCGEKKLVMSLLCSLLNTTIKYNPT--------------
C0NTS7_AJECG/1-843V-------------------KGVKTIT-----------YLVTCPDKQVVLSLLCSLLNTTIKYNPT--------------
B6HUK2_PENRW/1-841V-------------------QGVKAIT-----------YITTCQDKQAVLTLLCSLLNTAMKYNPA--------------
Q5ASC1_EMENI/1-732V-------------------QGVRAIT-----------YITTSQEKQAVLTLLCSLLNTAIKYNPA--------------

PF09742

F4WRP0_ACREC/1-730T...................P.NRWIE...........HLTSSENRH-ALPMFTSLLNTVCAYDPV..............
E9H938_DAPPU/1-832A...................P.NKWVQ...........HFTSPENRH-ALPLFTSLLNVLCAYDPV..............
T1JUN4_TETUR/1-644S.............V.....IYRCIMK............KCAIHSL.-..LLTKCLINNFIRQDLP..............
J9F5Y0_WUCBA/1-661N.............I.....FYRYLMQ...........GKCSTRSL.-..ELSRALISNYLQRYTP..............
B4JW54_DROGR/1-859P.....................NKWIA...........YFTSADNRH-ALPLFTSFLNSVCSYDPV..............
I1EYR3_AMPQE/506-1206S.............V.....IINELMD...............IPLDV-SSSLVQSLVSFFISQPIP..............
E0VAE1_PEDHC/1-723L.............I.....IFKTLMQ...........GRPSIHSP.-..LLIKTLLGHFIKQEKP..............
C1FEV8_MICSR/1-964SSPLSTPSAPFANETDGEFDAFDVLMDAVDGCTAVDAGGDGRSGESI-YRDVVAETLRLWSRRPPL..............
G1MRD7_MELGA/1-648G.............F.....SLSYSVQ...........SSCAARSS.-..DCVLCLPHNNTXKTTP..............
D6WWB7_TRICA/1-769N...................P.NKWIA...........HLTSSENRH-ALPMFTSLLNTVCAYDPV..............
H3BX91_TETNG/1-768S...................T.NPWVS...........FFCSSENRH-ALPLFTSLLNVVCAYDPV..............
F7D5K7_XENTR/1-770N...................TSNPWVQ...........FFCSTENRH-ALPLFTSLLNVVCAYDPV..............
H2SJN1_TAKRU/1-774S...................V.NPWVS...........FFCSSENRH-ALPLFTSLLNVVCAYDPV..............
B3RQA8_TRIAD/1-734N.....................NQWLD...........YFTSTNNRH-ALPLFTSLLNTVCSYDPV..............
I3JLL2_ORENI/1-646G.............I.....IYQHIMK...........GRCMCLTS.-..RLVKTLLYNFIRQEKC..............
U1M0X7_ASCSU/1-660S.............I.....FFGYLMQ...........GKCSSRSM.-..ELTKALLTNYLQRNTP..............
H2XV68_CIOIN/1-762S...................AANKWIE...........CFCSSDNRQ-ALPLFTSLLNVFCAYDPV..............
Q5ZBZ3_ORYSJ/1-682D....................VHPFID...........AAMLQDSSI-VSSVVQKLLLNFVKRPRI..............
D0NH97_PHYIT/1-769A.GDLLTHNPFLYML.....MASALPD...........GKKSYWAS.-..AIVRRLLQNSIEQIQATGASSASNTAVIAL
T1FYR2_HELRO/1-642S.............M.....LHRCFMQ...........GKCSRNSC.-..KLVKNLLETFTSQCRT..............
Q4DJF1_TRYCC/1-725L...................FSEPLLN...........V...DENPL-LPTLVASTLNAILAYKPF..............
I3KNU8_ORENI/1-782V...................L.NPWIS...........FFCSTENRH-ALPLFTSLLNVVCAYDPV..............
I3JCX3_ORENI/1-776I...................L.NPWVT...........FFCSTENRH-ALPLFTSLLNVVCAYDPV..............
Q01H67_OSTTA/38-724....................LTDVEAREMGHPLAMSLLKLGASDSKM-TGTLMCSLLRQIVAR.................
Q38FE7_TRYB2/1-706N...................FTDPFTRLI.............LASGD-LHALVLVLLQRLMDWGEG..............
Q8RWV1_ARATH/1-679D....................ANPFID...........AAMTQEKSL-VSLVVRRLLLNYISRHRT..............
I1MHZ5_SOYBN/1-671D....................VNPFLD...........AAMAQDSHL-VTSVVCKLLLNYITRPRV..............
B0WBZ3_CULQU/1-681N...................IFRTIYK...........C...QHAN.-..TLMSALLHFLSRMTQV..............
F0Y4A0_AURAN/723-1436W...................S.SRWLG...........VATAPDAPN-AKLLLYSLLNVVCGYDPI..............
D7T740_VITVI/12-678D....................VNPFID...........AAMAQESSL-VGLVVRRLLINYINRPRI..............
E1ZEP5_CHLVA/1-748G....................QHPFLD...........AAM.QQKDL-ANTTVEALLRLFIAAPPV..............
M4BPB3_HYAAE/1-729W...................K.DRFLE...........VATAPECPF-VPTLFYSLLNIVVAYDPV..............
Q5CRW2_CRYPI/1-755..........................................NHQHI-DNGDIYTFITCFQVHSSI..............
DYM_DROME/1-676S.............I.....VFRTVFK...........C...QHAN.-..VLMSALLHFVARIVEV..............
H0VNU2_CAVPO/1-646S.............I.....SHKYLMQ...........GPCLPYTS.-..KLVKTLLYNFIRQEKP..............
E9ICM4_SOLIN/1-654T...................VYRIAMH...........AHLNQHAP.-..AMVCTLLHNFVQQEHA..............
L9KZV5_TUPCH/1-826S...................T.NPWVQ...........FFCSTENRH-ALPLFTSLLNTVCAYDPV..............
E9G1Z8_DAPPU/1-633S.............I.....IFKCLMH...........GPGALHAG.-..LLTRTLLQHYCQQQSV..............
D7FT96_ECTSI/1-808T...................A.SRFAE...........EVCKADAPF-AAELFFSLLSVIATYDPV..............
H2MFX7_ORYLA/1-772V...................I.NPWVA...........FFCSAENRH-TLPLFTSLLNVVCGYDPV..............
B7S488_PHATC/1-694L...................A.SRWLA...........VATAADAPN-ACCLFFSLLNTILHYDPR..............
W1NV48_AMBTC/1-680D....................VHPFID...........AAMAQESAL-VGSVVRRLLLTYITHPRI..............
B6A9V3_CRYMR/1-794L.....................................TKIENKTNI-LLPSFLDIFQILSVHLMN..............
H2KSV6_CLOSI/110-1035T...................Q.NKWVS...........FFTSTNNRH-ALPLFASLLNVVCAYDPV..............
M4AQZ4_XIPMA/1-781V...................L.NPWVS...........FFCSAENRH-ALPLFTSLLNVVCSYDPV..............
E0VG76_PEDHC/1-766S...................P.NKWIQ...........YVTSAENRH-ALPMFTSLLNTVCAYDPV..............
B4MQL1_DROWI/1-832P.....................NKWIA...........YFTSADNRH-ALPLFTSFLNTVCSYDPV..............
HID1_DICDI/1-880F...................K.SKWLD...........WITHTQEYY-TEALLFSLINTFATFDPI..............
W4XTN1_STRPU/1-721S...................LPNQWIS...........FFCSSDNRH-ALPLFTSMINIACAYDPV..............
T1K251_TETUR/1-842T...................P.NRWIT...........FFTSPDNRH-ALPLFTSLINTVFSYDPA..............
T1I7V2_RHOPR/1-802A...................P.NKWVE...........YLTSTENRH-ALPMFTSLLNTVCAYDPV..............
Q7QGJ8_ANOGA/1-825P.....................NRWIV...........HFTSADNRH-ALPLFTSLLNTVCAYDPV..............
A0A068YEV3_ECHMU/1-732P.............A.....TCKYFTS...........NKCLADAP.-..AFIHRLVLNVAENLPC..............
J9KB63_ACYPI/1-736......................NRWVQ...........YVTSAENRH-ALPMLTSLLNTVCGYDPI..............
Q17L03_AEDAE/1-819P.....................NKWIV...........HFTSAENRH-ALPLFTSLLNTVCAYDPV..............
W4Z6Q3_STRPU/1-667S.............L.....ITEYIMH...........GKCSSDAH.-..VLVKILLDQFIKREDC..............
W5JW75_ANODA/1-876P.....................NRWIV...........HFTSADNRH-ALPLFTSLLNTVCAYDPV..............
DYM_XENTR/1-646S.............P.....IHRHLMK...........GPCLPYTS.-..RLVKTLLYNFIRQEKS..............
A8WTE9_CAEBR/1-690S.............I.....VFRFFID...........GACAQHAA.-..KLTKTLLLNYLIHNSE..............
M4C137_HYAAE/1-768ASGDVRSHNPFLYML.....MESALPD...........GSRSYWAS.-..SLIHRLLRNSIDQLQATGLNAMANTAVVAI
B9HUR0_POPTR/1-672D....................MNPFID...........AAMAQESSL-VGLVVRRLLLNYIIRPRI..............
F6TGV4_CIOIN/1-683G.............P.....IYRILMT...........GQCAAKAN.-..NFMRALLQNFIEQRPS..............
H3AL71_LATCH/1-849S...................L.NPWVQ...........FFCSTDNRH-ALPLFTSLLNIVCAYDPV..............

PF12722

C4XYD9_CLAL4/17-927-------------------GLDD.SGLKY.DNSSL--VEGR---------------------------------------
A3LX71_PICST/1-905-------------------SPED.NALSYPSNSQL--TEMR---------------------------------------
Q6BSE0_DEBHA/1-924-------------------PVEE.NMLFY.RNIEL--TEMR---------------------------------------
C3Z701_BRAFL/1-784-------------------G....YGMPY.NHLLF--SDYR---------------------------------------
Q0E9B5_DROME/1-834-------------------G....FGVPY.NHLLF--ADTT---------------------------------------
B0WUT2_CULQU/1-851-------------------G....IGVPY.NHLLF--TDTL---------------------------------------
A7RKV1_NEMVE/1-693-------------------G....YGVPT......--.DFK---------------------------------------
A8WRZ4_CAEBR/1-727-------------------G....YGLPY.NYLLF--NDSR---------------------------------------
A0A0H5SQP5_BRUMA/1-721-------------------G....FGVPY.NYLLF--TDTR---------------------------------------
C5K8E7_PERM5/1-865-------------------G....YGVPY.GSAFS--SGSQ---------------------------------------
B6JW01_SCHJY/1-778-------------------FWKPRSVMSA.HLATH--A...---------------------------------------
YIOC_SCHPO/1-796-------------------FWKP.EFLPLDNSVAH--M...---------------------------------------
Q2GWB4_CHAGB/1-825-------------------S....WRVPY.NALVL--KDPK---------------------------------------
Q0UAJ2_PHANO/1-733-------------------..............VF--KDQR---------------------------------------
B8M9N3_TALSN/1-838-------------------I....WRVPY.DHVVW--KDSK---------------------------------------
C5FVH3_ARTOC/1-827-------------------P....WRLPY.DHVVW--KDPK---------------------------------------
C0NTS7_AJECG/1-843-------------------P....WRLPY.DHVVW--KDPK---------------------------------------
B6HUK2_PENRW/1-841-------------------S....WRVPY.DHVVW--KDPK---------------------------------------
Q5ASC1_EMENI/1-732-------------------S....WRVPY.DHVVW--KDPR---------------------------------------

PF09742

F4WRP0_ACREC/1-730.......................GYGVPY-NHLLF..TDSL.......................................
E9H938_DAPPU/1-832.......................GLGLPY-NHLLF..TDSR.......................................
T1JUN4_TETUR/1-644.........P.........REDGGSVI..-.......LDLA.....SGL...................WSALTLGYGKNN
J9F5Y0_WUCBA/1-661..............CVVKHDKEPESIV..-...LG....LA.....ASV...................WSAVQIVTGMDD
B4JW54_DROGR/1-859.......................GFGVPY-NHLLF..ADTT.......................................
I1EYR3_AMPQE/506-1206.........PPDTLRVQP...........-...SGVFSSFA.....SGL...................LSLVLPQHDILE
E0VAE1_PEDHC/1-723..................YERGGGSIV..-...IG....LA.....SNI...................WHILSLAYKNST
C1FEV8_MICSR/1-964.........PRGSDAWMHDPNDASGKP..-...RGGFLGAM.....AALLLGDDDDDDDNGDDDKGKDWDVSVF......
G1MRD7_MELGA/1-648.........KSSSAYSFPQIFDSKKTK..-...YYEVIGVS.....PSL...................WKVFNEVGLCSQ
D6WWB7_TRICA/1-769.......................GLGVPY-NHLLF..NDSL.......................................
H3BX91_TETNG/1-768.......................GYGIPY-NYLLS..SDQR.......................................
F7D5K7_XENTR/1-770.......................GYGIPY-NHLLF..WDSR.......................................
H2SJN1_TAKRU/1-774.......................GYGIPY-NYLLS..SDQR.......................................
B3RQA8_TRIAD/1-734.......................GYGVPY-NHLMF..QDAR.......................................
I3JLL2_ORENI/1-646.........PPPSTHIFEPKAE.GGLL..-...YGLASGVA.....SGL...................WSVFTLGGAGSR
U1M0X7_ASCSU/1-660..............YVTKREKEPESIV..-...LG....LA.....ASV...................WSVMQIAAGYDE
H2XV68_CIOIN/1-762.......................GLGVPY-NHLLF..HDYR.......................................
Q5ZBZ3_ORYSJ/1-682.........PLNS.SHPAFSDDGGPGV..-...LQRVGSVA.....ANF............VLLPYYTFNYLVSSNAEGA
D0NH97_PHYIT/1-769RKARETSLIAMSGMSDQAYELEQFSYL..-..TLEGVGSIA.....ASIFR............FP...WSFIRYFTTRED
T1FYR2_HELRO/1-642..................NNNTPHGAL..-...YGVACRFI.....SSL...................WSVVTLGLANQK
Q4DJF1_TRYCC/1-725.......................G.SIPY-TSHWV...GPE.......................................
I3KNU8_ORENI/1-782.......................GYGIPY-NHLLF..SDYR.......................................
I3JCX3_ORENI/1-776.......................GYGIPY-NHLLF..SDYR.......................................
Q01H67_OSTTA/38-724.........PPNSGDICALPANRDDEK..-...CGVTRGLV.....SAF...................SALFPSRSDKSA
Q38FE7_TRYB2/1-706.........................RLPK-TPVLYRCAQYS.........................SLWTLYNMFAGGTE
Q8RWV1_ARATH/1-679.........PPNAKSY.MYSDGDSQGI..-...LERVGSAA.....ASL............VLLP...LNYLVSNSG.GS
I1MHZ5_SOYBN/1-671.........PFSRASYSIFYDGSQNSV..-...LKKVGSEA.....ANI............VLLP...FSYLISSSSEGS
B0WBZ3_CULQU/1-681.........P....ATMFGFGSGGSFV..-...FG....IA.....ESL...................WSILTFA.....
F0Y4A0_AURAN/723-1436.......................GLGVPY-GGHLS..DEAP.......................................
D7T740_VITVI/12-678.........PLNDVSYSIFSEGSQPGV..-...LQRVGSAA.....ANF............VLLP...FNYLVSSGGEGP
E1ZEP5_CHLVA/1-748.........PLSLKIFTYMPTDTRSM...-...LKIVRSAA.....ASM............LWLPYQAYTLLLRPSRPGG
M4BPB3_HYAAE/1-729.......................GWGVPY-AGSIV..SDDR.......................................
Q5CRW2_CRYPI/1-755.........KSVKLIYCEDDSDLFQDNRY-LFLQYLIKKSLNFEKKCQLF..............................
DYM_DROME/1-676.........P....HTMFGSSSAGSFV..-...FG....IA.....ESL...................LSIFTF......
H0VNU2_CAVPO/1-646.........PPPGSHVFSQQSDGGGLL..-...YGLASGVA.....TGL...................WTVFTLGGVGSK
E9ICM4_SOLIN/1-654.........P....PGLLTQQSGGSIV..-.......FSIA.....AGL...................WNVIRMGIGSSS
L9KZV5_TUPCH/1-826.......................GYGIPY-NHLLF..SDYR.......................................
E9G1Z8_DAPPU/1-633.........P...VRWLRKPEQGGSIV..-...LGLASKFVIFVYLAGL...................WSLISRNSSTAE
D7FT96_ECTSI/1-808.......................GWGVPY-AGSFT..TDLP.......................................
H2MFX7_ORYLA/1-772.......................GYGVPY-NHLLF..SDSR.......................................
B7S488_PHATC/1-694.........................GLPV-AAGFS..ENSH.......................................
W1NV48_AMBTC/1-680.........PLNSASYNSFLEGSQTGV..-...LQKVGSAA.....ATF............VLLPYYTFNYIVNSSSDGS
B6A9V3_CRYMR/1-794...........PSLIIQRDDSENTETIPY-SFFFFLTRTTINGKKHSPTP..............................
H2KSV6_CLOSI/110-1035.......................GFGVPY-NHLMF..SDSR.......................................
M4AQZ4_XIPMA/1-781.......................GYGIPY-NHLLF..SDYR.......................................
E0VG76_PEDHC/1-766.......................GLGVPY-NHLLF..SDTA.......................................
B4MQL1_DROWI/1-832.......................GFGVPY-NHLIF..VDTT.......................................
HID1_DICDI/1-880.......................GWGIPY-NHLMY..SDDH.......................................
W4XTN1_STRPU/1-721.......................GYGMPY-NHLLF..SDTR.......................................
T1K251_TETUR/1-842.......................GY.LPF-NHLLF..SDSR.......................................
T1I7V2_RHOPR/1-802.......................GLGLPY-NHLLF..SDTA.......................................
Q7QGJ8_ANOGA/1-825.......................GIGVPY-NHLLF..TDTL.......................................
A0A068YEV3_ECHMU/1-732.........P....PNMLAESHAPGML..-...WNAASTIA.....SGL...................MTVVTLGYSRRA
J9KB63_ACYPI/1-736.......................GMGVPY-NHLLF..ADTS.......................................
Q17L03_AEDAE/1-819.......................GMGVPY-NHLLF..TDTL.......................................
W4Z6Q3_STRPU/1-667.........P...AELLRDSPKPASFL..-...YGISAAIA.....AGI...................WAVLTLGYGTRS
W5JW75_ANODA/1-876.......................GMGVPY-NHLLF..TDTL.......................................
DYM_XENTR/1-646.........PPPGSHIFPQQQDGGGLL..-...YGLASGVA.....SGI...................WTVLTLGGVGSK
A8WTE9_CAEBR/1-690..............YHMTVAKPQESIV..-...FG....LA.....SSM...................WSMVQMATGLDS
M4C137_HYAAE/1-768RKAQEMSLGTMSGISEQTREPEESSYLSR-YFTLEGVGSIA.....VSIFR............SP...WSFVRHCTTREE
B9HUR0_POPTR/1-672.........PYNSASYPVFSGGSQPGV..-...LQRVGSAA.....ATL............VLLP...FNYLVSSTGDGS
F6TGV4_CIOIN/1-683.........P....EAGSRENGGGSFV..-...IGIASAVA.....SGL...................WSALKLGGKKDS
H3AL71_LATCH/1-849.......................GFGIPY-NHLLF..SDYR.......................................

PF12722

C4XYD9_CLAL4/17-927---------------------------HLCVSYSA................ELLA-------CMVVCPMPSSAHTAFMTN
A3LX71_PICST/1-905---------------------------HLTVTYSI................QLLT-------AMVVYPLPSPEKLDFLKE
Q6BSE0_DEBHA/1-924---------------------------HLCVTYAT................QLLT-------LMIVYPLPSQPNLQFLYD
C3Z701_BRAFL/1-784---------------------------EPTVEVAL................QLLI-------VVLDHD.NGQSAISVDGT
Q0E9B5_DROME/1-834---------------------------EPLVEACL................QLLI-------VTLDHDMVVQQQLTQPGQ
B0WUT2_CULQU/1-851---------------------------EPLVEVCL................QILI-------VTLDHDITSNTSSNSPTG
A7RKV1_NEMVE/1-693---------------------------EPMVEVAA................QLLV-------VLLDHDGGDGQNPINDDL
A8WRZ4_CAEBR/1-727---------------------------EPLVEIAL................QVLI-------VCLDKESQPKTDDSGY..
A0A0H5SQP5_BRUMA/1-721---------------------------EPLVQTAL................QVLI-------VCLDNETQSSDKKNEY..
C5K8E7_PERM5/1-865---------------------------EALVDLSLQVKVPGSNPGAGTCTVQVLC-------ALLDFNPSPDNTGSEMVK
B6JW01_SCHJY/1-778---------------------------.TLVELCF................TVFL-------TLITDPVIGSSSRFLEFA
YIOC_SCHPO/1-796---------------------------.SLIEYCF................SVLL-------ILMSEENNNGTPCYNNYR
Q2GWB4_CHAGB/1-825---------------------------EILVTYTL................QLLL-------ATLLYPIPEQTGV.....
Q0UAJ2_PHANO/1-733---------------------------QILVTYCL................QLLL-------VLILYPIPEAGNG.....
B8M9N3_TALSN/1-838---------------------------QILVIYCL................QLLL-------VILLYPIPEDGRG.....
C5FVH3_ARTOC/1-827---------------------------QILVIYCL................QFLL-------ALLLYPIPEDGRG.....
C0NTS7_AJECG/1-843---------------------------QIFVIYCL................QFLL-------VLLLYPIPEDGRG.....
B6HUK2_PENRW/1-841---------------------------QILVIYCV................QLLL-------VLLMYPIPEDGRG.....
Q5ASC1_EMENI/1-732---------------------------QIL.........................-------..................

PF09742

F4WRP0_ACREC/1-730...........................EPLVDVAL----------------QILI.......VTLDHDTTGGIPME....
E9H938_DAPPU/1-832...........................EPLVETAL----------------QLLI.......VTLDWDSSAQCSQLNTID
T1JUN4_TETUR/1-644NDETLK.....................PVLSKLSL----------------FLLL.......VLTYHCTTDS........
J9F5Y0_WUCBA/1-661SNSLSSDSEITPP..............VSLGSLSV----------------LLLL.......NLACHQDPEAKL......
B4JW54_DROGR/1-859...........................EPLVEACL----------------QLLI.......VTLDHDMVIQQQQQQQQH
I1EYR3_AMPQE/506-1206NT.........................SPLALSSL----------------LFLL.......ILVHQHSRGH........
E0VAE1_PEDHC/1-723NLEPPKG....................ITLANQSL----------------LLIL.......VLVSHCTAEKNLL.....
C1FEV8_MICSR/1-964...........................SPLGDAAG----------------AALT.......RLLHRPARYDGVAEVGRC
G1MRD7_MELGA/1-648ETAPSQL.V..................VPVAASEL----------------MIVL.......ICSQYRSLSDHP......
D6WWB7_TRICA/1-769...........................EPLVEAAL----------------QILI.......VTLDHDTSSSSPAEGE..
H3BX91_TETNG/1-768...........................EQLVVQAI----------------QVLV.......VTLEHEGGAVARAALQVL
F7D5K7_XENTR/1-770...........................EPLVEVSA----------------QLLI.......VTLDSDLTVTSSP...SM
H2SJN1_TAKRU/1-774...........................EQLVVHVI----------------QVLI.......IALEHEG..VARASLQVL
B3RQA8_TRIAD/1-734...........................EPLVEIAV----------------QLLV.......VVLDHEPSTITIDRSAEH
I3JLL2_ORENI/1-646AGIDQEHDP..................LPLSNQSL----------------LLLL.......VLANLTDGPEWP......
U1M0X7_ASCSU/1-660ANGYDEDANLIPP..............ASLGSLSV----------------LLLL.......NLACHQNADNNKA.....
H2XV68_CIOIN/1-762...........................EPLVEAAC----------------QILI.......VALDHNAAEKEDEPVDSS
Q5ZBZ3_ORYSJ/1-682S..........................SQLADNSL----------------LVLL.......ILIHYRKCITMSESFPSS
D0NH97_PHYIT/1-769TA.........................SPLADRSV----------------LLLL.......ILLQS.............
T1FYR2_HELRO/1-642TEHVVNESR..................AMLANQSL----------------LLLL.......VLCNQFCSNGSFI.....
Q4DJF1_TRYCC/1-725...........................EMVVLMSA----------------RFLSALICYPGALLDGSTQTRHTKSPEES
I3KNU8_ORENI/1-782...........................EQLVEQAV----------------QILI.......VTLEHEAGSAASAALQAL
I3JCX3_ORENI/1-776...........................EQLVEQAV----------------QILI.......VTLEHDGGIPHPP.....
Q01H67_OSTTA/38-724QSCRSKRVAHNLVRCTHSTQ.......SPLADEFS----------------NLFL.......ALCAQGAFDPNVK.....
Q38FE7_TRYB2/1-706NESITCG....................NHLGRHCA----------------QLLS.......VLVSYGKGYRP.......
Q8RWV1_ARATH/1-679K..........................NPLAECSL----------------HVLL.......ILINYHKSIMSDESMTDK
I1MHZ5_SOYBN/1-671R..........................NPIADSSL----------------QVLL.......VIIHYEKCLVSEGYSVLK
B0WBZ3_CULQU/1-681..RKQPDVLTAH......DLPAAFKDHYPLANQSL----------------LLIL.......ILTNHYTTKD........
F0Y4A0_AURAN/723-1436...........................TQAVYAAA----------------QVLI.......ALLDYGESPKVGPHPEGR
D7T740_VITVI/12-678R..........................SPLADSSL----------------QVLL.......ILIHYRKCILVDESIADR
E1ZEP5_CHLVA/1-748GGEGTGGAAAAPSN.............SPLGDSAL----------------LLLL.......VLLFHAPPQDAPFG....
M4BPB3_HYAAE/1-729...........................EVLVDLSL----------------QVLL.......VLLDFGQTLETTTGAMSL
Q5CRW2_CRYPI/1-755...........................ELNKKKSI----------------ILLS.......TILFNPPELKF.......
DYM_DROME/1-676..RKQPDILKAGQAAGGGELSQRFRTHYPLANQSL----------------LLIL.......ILTNHCTAQD........
H0VNU2_CAVPO/1-646AAASAELP...................SPLANQSL----------------LLLL.......VLTNLTDAPDAP......
E9ICM4_SOLIN/1-654KNIQVAHNGTAEEEERKRDTE......TPLASQSL----------------LLLL.......VLTNHCTATQ........
L9KZV5_TUPCH/1-826...........................EPLVEEAA----------------QVLI.......VTLDHDCASSASP...TV
E9G1Z8_DAPPU/1-633SVDAV......................SDFASQSL----------------LLLL.......VLTNHCSTEKNWS.....
D7FT96_ECTSI/1-808...........................ARQLEMSA----------------QLLI.......VLLDHGKPPLPVVTSSAG
H2MFX7_ORYLA/1-772...........................EQLVEQAL----------------QVLV.......VALEHEAGSAASSALQAL
B7S488_PHATC/1-694...........................VKLVELSA----------------QVLC.......VLLDCGIPGSPEPVMDQN
W1NV48_AMBTC/1-680R..........................SPLADISL----------------LVLL.......VLVHYQKRIIVDDNFMDK
B6A9V3_CRYMR/1-794...........................IGIKNRSL----------------CILS.......MLIFHSPFFKE.......
H2KSV6_CLOSI/110-1035...........................EPLVEVAL----------------QVLC.......IVLETELTASYPTHSSQG
M4AQZ4_XIPMA/1-781...........................EQLVEQAL----------------QVLI.......VTLEHETGSAVSAALQAL
E0VG76_PEDHC/1-766...........................EPLVDTAL----------------QILI.......VTLDHDTSLGD.......
B4MQL1_DROWI/1-832...........................EPLVEACL----------------QLLI.......VTLDHDMVMHQQQQQQLL
HID1_DICDI/1-880...........................EICSKLSI----------------QILN.......VLLTYDPIENNDQQPQQQ
W4XTN1_STRPU/1-721...........................EPLVEIAS----------------QILV.......VTLDHANPHNVASSVDGA
T1K251_TETUR/1-842...........................ESLVEVCL----------------QILI.......VTLDHDFITESLPGGNSA
T1I7V2_RHOPR/1-802...........................EPLVDTAL----------------QILI.......VTLDHDTSSSQTY.....
Q7QGJ8_ANOGA/1-825...........................EPLVEVCL----------------QILI.......VTLDHDITSNGPAQSSAY
A0A068YEV3_ECHMU/1-732ASTRAEAKLESGSPGGGVL........HPLAKQSC----------------HLLL.......VLTTQ.............
J9KB63_ACYPI/1-736...........................EPLVDMCL----------------QIII.......VALDSDVQQN........
Q17L03_AEDAE/1-819...........................EPLVEVCL----------------QILI.......VTLDHDITSNSPTQSASY
W4Z6Q3_STRPU/1-667KPDDREDR...................ALLANQSL----------------LLLQ.......VLTNHYTHEKGIH.....
W5JW75_ANODA/1-876...........................EPLVEVCL----------------QLLI.......VTLDHDITGNAAGSGTPG
DYM_XENTR/1-646PTPQQEQS...................SPLANQSL----------------LLLL.......VLSNLTDAPDCP......
A8WTE9_CAEBR/1-690AEEDNKPP...................LTLGNLCI----------------LLLL.......NLSCHQPVNAS.......
M4C137_HYAAE/1-768TA.........................SPLADRST----------------LLLL.......VLLQS.............
B9HUR0_POPTR/1-672R..........................NPLADSSL----------------HVLL.......ILNYYHKCVVGDESLTDR
F6TGV4_CIOIN/1-683GVSKELTSELGP...............PTIGRQSA----------------LLIL.......ALINHQSYVDPTGQPFV.
H3AL71_LATCH/1-849...........................ENLVEVAA----------------QVLI.......VNLDHDSSNSASP...SV

PF12722

C4XYD9_CLAL4/17-927LGLCS.........................................HKPY------------------------------
A3LX71_PICST/1-905TELIST........................................SKPG------------------------------
Q6BSE0_DEBHA/1-924LNLLTT........................................AKPF------------------------------
C3Z701_BRAFL/1-784TTGTAMDQGAE...................................GEPQ------------------------------
Q0E9B5_DROME/1-834ASYDEG........................................NCGD------------------------------
B0WUT2_CULQU/1-851GAQSAQSYSHDDT.................................TIAD------------------------------
A7RKV1_NEMVE/1-693ANDMMEP.......................................PPMD------------------------------
A8WRZ4_CAEBR/1-727................................................QD------------------------------
A0A0H5SQP5_BRUMA/1-721................................................AD------------------------------
C5K8E7_PERM5/1-865THRTGTGSEDGSNNSISESSNQEESAAARRRFSSCAFPLAGPDDDASKPR------------------------------
B6JW01_SCHJY/1-778RTRN..........................................IALN------------------------------
YIOC_SCHPO/1-796SSKN..........................................TLPK------------------------------
Q2GWB4_CHAGB/1-825..............................................PTPK------------------------------
Q0UAJ2_PHANO/1-733..............................................PAPK------------------------------
B8M9N3_TALSN/1-838..............................................APPK------------------------------
C5FVH3_ARTOC/1-827..............................................ALPK------------------------------
C0NTS7_AJECG/1-843..............................................TPPK------------------------------
B6HUK2_PENRW/1-841..............................................SPPK------------------------------
Q5ASC1_EMENI/1-732..................................................------------------------------

PF09742

F4WRP0_ACREC/1-730..................................................EGAVGD........................
E9H938_DAPPU/1-832EQ................................................SGMIHE........................
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859QHQPQQQQHQQQQQLTHAGGVLVTPYD.......................EVGCGD........................
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964VANESASTAVVSTAGKVVRREPNVAGSSPGRSAGIVKSSREKWGGGLGEVETVMRRASMDVDDDPGSPVGSSRSPFAPPG
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769..................................................DSTVPD........................
H3BX91_TETNG/1-768DGTAPTEAMGEQ.......................................AAEPE........................
F7D5K7_XENTR/1-770DGTTTSTAMDET......................................ESPPPD........................
H2SJN1_TAKRU/1-774GGISPSAAVGQQ......................................EPAEAE........................
B3RQA8_TRIAD/1-734D.................................................TVRIND........................
I3JLL2_ORENI/1-646................................................................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762SLSPSILS..........................................TSGSSS........................
Q5ZBZ3_ORYSJ/1-682NVYTSDLNTNVKDAPAFHD.............................................................
D0NH97_PHYIT/1-769......CRDSDSPVAS................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725DKNEPKENVEAKDRE...................................DGTTTE........................
I3KNU8_ORENI/1-782DPSTSPSAEEEQE...................................VHTAGGPD........................
I3JCX3_ORENI/1-776...ASPSSIEEQ......................................ESTGPE........................
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679SDDSATSESVSKVHVFSSD.............................................................
I1MHZ5_SOYBN/1-671NQVSTSLDSLPKENTYFSE.............................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436R...............................................................................
D7T740_VITVI/12-678KSGGATSDSLSKENTYFSE.............................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729KPQLGSLTPVIKRRSSSVTLRPSNPLFDGVP.................................................
Q5CRW2_CRYPI/1-755................................................................................
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826DGTTTGTAMDDA......................................DPPGPE........................
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808PDGESPDQQTAVREDPPTPGDVGY........................................................
H2MFX7_ORYLA/1-772DASASPTADEEEK.....................................GPAGPD........................
B7S488_PHATC/1-694GNPCVEFEVASRGGF.................................................................
W1NV48_AMBTC/1-680SEDGVEMNGFLKESSYFQD.............................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035YRNLVGRMSSEAE....................E......ASSTTATSAGDGTIEM........................
M4AQZ4_XIPMA/1-781DSSSSNPPEELE.......................................PAGPD........................
E0VG76_PEDHC/1-766..................................................ENVSSD........................
B4MQL1_DROWI/1-832LNQSQSGLASYE......................................EANCGD........................
HID1_DICDI/1-880HHHHQQQHHQQQQQQQQ.................................STIECR........................
W4XTN1_STRPU/1-721EEVH..............................................EGVLPE........................
T1K251_TETUR/1-842ERTPI.............................................DPTIHE........................
T1I7V2_RHOPR/1-802..................................................DSNSPD........................
Q7QGJ8_ANOGA/1-825IHD...............................................DSTIAD........................
A0A068YEV3_ECHMU/1-732......STGFISAASAAPITDGKDGATSPPNSASASAVA.........................................
J9KB63_ACYPI/1-736..................................................DEAAID........................
Q17L03_AEDAE/1-819SHD...............................................DTTIAD........................
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876SQQAGQSPVGYVHD....................................ESTIAD........................
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768......CRDTDSLVTS................................................................
B9HUR0_POPTR/1-672SDDSATSDSLSKGKTYFSD.............................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849DGTYTPPALYLHR....................NRIMTRHKPNLIVTCYLLPPGPD........................

PF12722

C4XYD9_CLAL4/17-927------------------------------NMVRFY-LGS.Q--------KNN-----------------------DL--
A3LX71_PICST/1-905------------------------------NLARLY-MGKLH--------KDQ-----------------------EL--
Q6BSE0_DEBHA/1-924------------------------------NMARVY-IGKLR--------KEN-----------------------EL--
C3Z701_BRAFL/1-784------------------------------NLFVNY-LSRIH--------REE-----------------------DF--
Q0E9B5_DROME/1-834------------------------------NLFINY-LSRVH--------RDE-----------------------DF--
B0WUT2_CULQU/1-851------------------------------NLFINY-LSRIH--------RDD-----------------------DF--
A7RKV1_NEMVE/1-693------------------------------NLFCNY-LSRIH--------REE-----------------------DF--
A8WRZ4_CAEBR/1-727------------------------------NYFINY-LSRIH--------REE-----------------------DF--
A0A0H5SQP5_BRUMA/1-721------------------------------NFFINY-LSRIH--------REE-----------------------DF--
C5K8E7_PERM5/1-865------------------------------NVYRIM-ARGVQ--------KTG-----------------------EL--
B6JW01_SCHJY/1-778------------------------------NFFSKS-ISQLH--------RKS-----------------------DF--
YIOC_SCHPO/1-796------------------------------NYFSIL-LSKLQ--------PYS-----------------------DF--
Q2GWB4_CHAGB/1-825------------------------------NYYRHF-LGRLH--------RPQ-----------------------DF--
Q0UAJ2_PHANO/1-733------------------------------NFFRHF-LGRLH--------RPQ-----------------------DF--
B8M9N3_TALSN/1-838------------------------------NYYRHY-FGRLH--------RPQ-----------------------DF--
C5FVH3_ARTOC/1-827------------------------------NYYRHF-LGRLH--------QPQ-----------------------DF--
C0NTS7_AJECG/1-843------------------------------NYYRHF-YGRLH--------RPQ-----------------------DF--
B6HUK2_PENRW/1-841------------------------------NYYRHY-FGRLH--------RPQ-----------------------DF--
Q5ASC1_EMENI/1-732------------------------------......-.....--------...-----------------------..--

PF09742

F4WRP0_ACREC/1-730..............................NLFINY.LSRIH........RDE.......................DF..
E9H938_DAPPU/1-832..............................NLFINY.LSRIH........REE.......................DF..
T1JUN4_TETUR/1-644..............................NPYREA.LFNCC........DLQ............VDSIGVAGLVSGF..
J9F5Y0_WUCBA/1-661..............................NPYKES.LSKFQ........NSQ............EVSSLNNSETDTF..
B4JW54_DROGR/1-859..............................NLFINY.LSRVH........RDE.......................DF..
I1EYR3_AMPQE/506-1206..............................NPYREA.LSLIC........DEN.................ESKDKASF..
E0VAE1_PEDHC/1-723..............................NPYRDF.LFTFI........HNS....PGHLSLGSNPEEIPVSSVSAL..
C1FEV8_MICSR/1-964FDSGADRSGLVFSKNYPPETPPATGSSIAANPFRDA.LFRLV........RLE......RSNKDDDSGESDALRVRVL..
G1MRD7_MELGA/1-648..............................NPNANI.LMLKF........SVS............DSSAFSSSHPHVF..
D6WWB7_TRICA/1-769..............................NLFINY.LSRIH........RDE.......................DF..
H3BX91_TETNG/1-768..............................NLFVNY.LSRIH........RDE.......................DL..
F7D5K7_XENTR/1-770..............................NLFVNY.LSRIH........REE.......................DF..
H2SJN1_TAKRU/1-774..............................NLFVNY.LSRIH........RDE.......................DL..
B3RQA8_TRIAD/1-734..............................NLFCNY.LSRIH........REE.......................DF..
I3JLL2_ORENI/1-646..............................NPYRQA.ITCFR........NTQ............DTSSLPVEQPHTF..
U1M0X7_ASCSU/1-660..............................NVYKET.LSAFQ........NAR............EVSSVNSSTTRIF..
H2XV68_CIOIN/1-762..............................NLFINY.LSRIH........RDE.......................DF..
Q5ZBZ3_ORYSJ/1-682..............................NPYYKA.LSNAK........DSQYDRADVEGNAQ.N..GLVV........
D0NH97_PHYIT/1-769..............................NPFRGA.LCGITDGADTDTHDVS.EIEDPRAHLVQQSEATSSSSAEKL..
T1FYR2_HELRO/1-642..............................NPYQTA.FLSLH........DDI............PNAIETPATRDHI..
Q4DJF1_TRYCC/1-725..............................QLNSPP.LRIVH........SAR.......................DLIS
I3KNU8_ORENI/1-782..............................NLFVNY.LSRIH........REE.......................DL..
I3JCX3_ORENI/1-776..............................NLFVNY.LSRIH........REE.......................DF..
Q01H67_OSTTA/38-724..............................NPFREA.VKGMR........DVS............ARSSVSSGKRDAT..
Q38FE7_TRYB2/1-706..............................NEALHY.IASLG........DSS...........................
Q8RWV1_ARATH/1-679..............................NTFSKA.LANAR........DVEFDRSDVEGNAHPA..GPHV........
I1MHZ5_SOYBN/1-671..............................NPYCRV.LVRAT........DCELDRVDKEGNAH.SDQDQHV........
B0WBZ3_CULQU/1-681..............................NPYRVS.LFGCA........DSQ.......GAADSSGSSKEPEQAVTF..
F0Y4A0_AURAN/723-1436..............................NVFREL.LGEID........DPD.......................YL..
D7T740_VITVI/12-678..............................NPYCKA.LENAR........DIEFDRVDIEGNAH.S..GPLV........
E1ZEP5_CHLVA/1-748..............................NPYRSS.LQRLQ........DTD...........................
M4BPB3_HYAAE/1-729..............................NAYRAL.LSSLQ........RPE.......................DF..
Q5CRW2_CRYPI/1-755..............................NIYSEW.INHFS........DPRFIPDNLILSDSNTDSDVDANKT.....
DYM_DROME/1-676..............................NAYRTS.LFSCA........DSK...............DSPKQGAVSF..
H0VNU2_CAVPO/1-646..............................NPYRQA.IMSFK........NTQ............DSSSFPSSIPHAF..
E9ICM4_SOLIN/1-654..............................NPYRNA.LFSFI........DMQ...........EDHTISQGTAAETF..
L9KZV5_TUPCH/1-826..............................NLFVNY.LSRIH........REE.......................DF..
E9G1Z8_DAPPU/1-633..............................NPYRQA.LLSFT........DSQ...............VSPVHPSACF..
D7FT96_ECTSI/1-808..............................NVFRNLVLHGLK........DEE.......................DF..
H2MFX7_ORYLA/1-772..............................NLFVNY.LSRIH........REE.......................DL..
B7S488_PHATC/1-694..............................NILRTL.LARID........TGK.......................EL..
W1NV48_AMBTC/1-680..............................NPYCSA.LENAR........DIEFDRVDVEGNAH.S..GPLV........
B6A9V3_CRYMR/1-794..............................NVYSDF.MRNIL........DPRFLPETSSLLIKDIQSEVDSDEDTS...
H2KSV6_CLOSI/110-1035..............................NLFANY.MSRIH........RDE.......................DF..
M4AQZ4_XIPMA/1-781..............................NLFVNY.LSRIH........REE.......................DL..
E0VG76_PEDHC/1-766..............................NLFINY.LSRIH........RDE.......................DF..
B4MQL1_DROWI/1-832..............................NLFINY.LSRVH........RDE.......................DF..
HID1_DICDI/1-880..............................NKFIQY.IKTLK........RVR.......................DF..
W4XTN1_STRPU/1-721..............................NLFVNY.LSRIH........REE.......................DF..
T1K251_TETUR/1-842..............................NLFINY.LSRIH........REE.......................DF..
T1I7V2_RHOPR/1-802..............................NLFINY.LSRIH........RDE.......................DF..
Q7QGJ8_ANOGA/1-825..............................NLFINY.LSRIH........RDD.......................DF..
A0A068YEV3_ECHMU/1-732............AAVAAATASRSIFRNIGSNPYREA.LFALTPLGEVNAEAKQ....SGGQGKDLEKGGGNERGIIPP..
J9KB63_ACYPI/1-736..............................NLFINY.LSRVH........RDE.......................DF..
Q17L03_AEDAE/1-819..............................NLFINY.LSRIH........RDD.......................DF..
W4Z6Q3_STRPU/1-667..............................NPYRKA.LCNFA........NSQ..........DGGMPIGPSGSLPPF..
W5JW75_ANODA/1-876..............................NLFINY.LSRIH........RDD.......................DF..
DYM_XENTR/1-646..............................NPFRQS.VTFFR........NTQ............DSSVSPTPNPHSF..
A8WTE9_CAEBR/1-690..............................NPFKET.LALFQ........NAQ.............EVSTLPTQVISF..
M4C137_HYAAE/1-768..............................NPFRET.LCEMMKGADIHSSSVEMKDRDPRALSMEHDGMSTDSSTENM..
B9HUR0_POPTR/1-672..............................NPYCKA.LENAR........DIEY....IEGNAH.S..GSHV........
F6TGV4_CIOIN/1-683..............................NPYKAA.LCCFR........HVQ.......GQLQGPSNGKQKGSLPSF..
H3AL71_LATCH/1-849..............................NLFVNY.LSRIH........REE.......................DF..

PF12722

C4XYD9_CLAL4/17-927-------VFLVSHLLSILKHPFSVNRLENRGKF.......TKPHPSPW..AIEAIMILWELLQCNQYLR-SFVAE-.RLV
A3LX71_PICST/1-905-------VFLSTYLIAILKLPVVTSKDVESSKF...NIIKSGNQPSLW..ATEATMLIWELIQCNKKFK-TLIYE-.QSL
Q6BSE0_DEBHA/1-924-------LFLASYLINVLRAPMQSSKESENLKF..NLNTGRQNQVSIW..ATECIMLLWELFQCNKSFR-TLVGE-.RYL
C3Z701_BRAFL/1-784-------HFILKGITNLLNNPLI............QTYLPNSCKKINF..HQEILVLFWKLCEFNKKFL-FYVLK-SSDV
Q0E9B5_DROME/1-834-------HFVLKGITRLLNNPLV............QNYLPNSTKRLHC..HQELLILFWKICDYNKKFL-YFVLK-SSDV
B0WUT2_CULQU/1-851-------QFILRGITRLLNNPLV............QSYLPNSTKRLHC..HQELLVFFWKICDYNK...-.....-SSDV
A7RKV1_NEMVE/1-693-------HFILHGLANLLNNPLI............QTYLPNSCKKISF..HQELLILFWKMCDQNKKFL-FYVLK-SSDV
A8WRZ4_CAEBR/1-727-------DFMLKGITRLLSNPIH..........SSSSYLPNSTKKVNF..HQELLVLLWKCCEFNQKFM-FYVLK-TSDV
A0A0H5SQP5_BRUMA/1-721-------EFMLKGMTRLLTNPLV............ATYLPSSTKKITC..HQELLVLLWKCCEYNQKFM-FYLLK-TSDV
C5K8E7_PERM5/1-865-------DFMADGLVRIVTTVDD..........AKRTYLPSSRKVVPF..YQEALILLWHLITINSTYR-KRLCI-.RHT
B6JW01_SCHJY/1-778-------QFILDGFSRLLYSPIH.............FEKPNVVGVVMYDYYPLTLNLCKQMLHYNTRFF-HYLVD-TGRA
YIOC_SCHPO/1-796-------QIILDGMSRLLYPPMQ.............STIPKRSSLIMFDYYPLVLIFCKLFIHYNERFF-HYLID-TDRA
Q2GWB4_CHAGB/1-825-------QFAVDGMTRILNQPLQ..........SNSSYIPGTQSSVRF..APETIMLFWEITQCNKRFR-SFIID-TERA
Q0UAJ2_PHANO/1-733-------QFLVDGMTRILNQPVW..................SQKSLTW..APEMIMLFWEALQCNKRFR-SFIID-TDRA
B8M9N3_TALSN/1-838-------QFLVEGMTRILNQPMQ..........VTSSYLPGSQKSVKW..APEMLMLFWEALQCNKRFR-AFIIE-SNRS
C5FVH3_ARTOC/1-827-------QFLVEGMTRILNQPMQ..........ATSSYLPGSQKSIKW..APEMLMLFWEMVQCNKRFR-SFIVD-SNRA
C0NTS7_AJECG/1-843-------QFIVEGMTRILNQPMQ..........ATTSYLPGSHKSVKW..APEMIMLFWEALQCNKRFR-SYMID-SSRA
B6HUK2_PENRW/1-841-------QFLVDGMTRILNQPMQ..........ATASYLPGSQRSVKW..APEMLVLFWETLQCNKRFR-SFIID-SNRS
Q5ASC1_EMENI/1-732-------..............MQ..........ATTAYLPGSQKSVKW..APEMLVLFWEALQCNKRFR-SFIID-SNRS

PF09742

F4WRP0_ACREC/1-730.......QFVLKGITRLLNN..P----------LMQTYLPNSTKKVHF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDV
E9H938_DAPPU/1-832.......AFMLHGFTRLLKN..P----------LIQTYLPNSNKKVQN--HQELLVFFWKVCDFNKKFL.YYVLK.SSDV
T1JUN4_TETUR/1-644.......KMNFNQLFSTLCATQN----------EDQS...........--....TLILYLLLYKNPSFR.AFLISRTSQL
J9F5Y0_WUCBA/1-661.......KLDYSLLYERLCATVN----------QQSP...........--....MLFLYILLHRNVGFR.NYILS.RINL
B4JW54_DROGR/1-859.......HFVLRGITRLLNN..P----------LVQNYLPNSTKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDV
I1EYR3_AMPQE/506-1206.......QLNFNQLHEAICKQLN----------TEQT...........--....TLFFYQLLHNNLNFA.SFVFS.RSDI
E0VAE1_PEDHC/1-723.......QINFDHLYVALCNTAA----------NECS...........--....TLMLYLLLHRNENVK.NFILA.RADL
C1FEV8_MICSR/1-964.......RACVLAMHSADTAGAA----------SGASGDKSHAASCQQ--AAVGVFLAYSLLYGNEGFY.RAVVADANAV
G1MRD7_MELGA/1-648.......QINFNSLYLKSCQKSV----------SSNS...........--....TVIVNFVLHLNS.LK.SFLLKCRTVT
D6WWB7_TRICA/1-769.......EFILTGVTRLLNN..P----------LVQTYLPNSTKKVHF--HQELLVFFWKMCDYNKKFL.YFVLK.SSDV
H3BX91_TETNG/1-768.......SFMLKGMTQLLNN..P----------LVQTYLPHSTKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDV
F7D5K7_XENTR/1-770.......QFILKGLARLLLN..P----------LSQTYLPNSIKKINF--HQELLVLFWKLCDYNKKFL.FFVLK.SSDV
H2SJN1_TAKRU/1-774.......SFMLKGLTQLLNN..P----------LVQTYLPHSAKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDV
B3RQA8_TRIAD/1-734.......TFILRGIILLLNN..P----------LLQTYLPNSCKKIGF--YQELLIFLWKVCDCNKKFL.YYVLK.SSDV
I3JLL2_ORENI/1-646.......QINFNSLYTALCEQQR----------SDQA...........--....TLLLYTLLHQNANMR.TYVLS.RTDM
U1M0X7_ASCSU/1-660.......RLDYSALYDRLCATVD----------QQPP...........--....MLLLYLLLHTNCGFR.NYVLS.RINL
H2XV68_CIOIN/1-762.......AFILSGICRLLNN..P----------LQQTYLPGSTKKVGF--HQELLVFFWKLCDTNKKFL.FFVLK.SSDV
Q5ZBZ3_ORYSJ/1-682.......RLSFASLFDALGTCLK----------DESS...........--....VLLLYSLVHGNCDFQ.EYVLV.RTDL
D0NH97_PHYIT/1-769.......ELLYSDLFKVIGRHAP----------YEAS...........--....HLMLYTLLYSNPMIL.DTALS.DVDM
T1FYR2_HELRO/1-642.......SVKFLDLYTTICSTIK----------TDTC...........--....TLLVYMLLHRVEPFK.TYCLS.RTNI
Q4DJF1_TRYCC/1-725AITPEEAKYVIERLKNTIGLKVY----------SNRTVLPDSQRCFIT--QDEFMMLLWRLIELSPECQ.LAFAQ.QPAA
I3KNU8_ORENI/1-782.......SFVLKGLARLLNN..P----------LIQTYLPRSTKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDV
I3JCX3_ORENI/1-776.......DFVLKGLARLLTN..P----------LTQTYLPNSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDV
Q01H67_OSTTA/38-724.......LVNFEKTCEALSESSS----------TDSG...........--....LLTLYTLLSTNSRFV.AYLGSKGSAA
Q38FE7_TRYB2/1-706.......QIQVKALLVTFNRHVL----------RCPA...........--...LCILLYTLLHDNPTFIHTVMTAYPDEF
Q8RWV1_ARATH/1-679.......RIPFASLFDTLGMFLA----------DEGA...........--....VLLLYSLLQGNSDFK.EYVLV.RTDL
I1MHZ5_SOYBN/1-671.......KLPFAPLFDTLGMCLA----------DETA...........--....VLLLYSLLQGNSTFL.EYVLV.RTDL
B0WBZ3_CULQU/1-681.......KIDFSSLYNTLCRIVT----------IDQT...........--....TLLLYLLLHRNQRFY.KYVMA.QQNL
F0Y4A0_AURAN/723-1436.......EFLFEGLCRLLNNVHE----------ALNTTLPGSLSQIEC--YQEVLVILWKLLEENDHFA.PHALR.ECDV
D7T740_VITVI/12-678.......RLPFASLFDTLGMFLA----------DETA...........--....ILLLYSLVHGNSDFL.EYVLV.RTDL
E1ZEP5_CHLVA/1-748.......DL...ALFDALGAALT----------SERA...........--....VLLLYVLLHTCPRFH.EYCLV.RSDL
M4BPB3_HYAAE/1-729.......KLIFSGISRLLNNYHQ----------SMSTLLPNSIKQIKC--HQELLVLLWKMLDENAEFL.QYALK.KADA
Q5CRW2_CRYPI/1-755.......DFVDFPYFEQAYRSVT----------FNGV........LVK--HNLFVFFLYSLVHSNSYFI.SYCLS.RADP
DYM_DROME/1-676.......QIDFSAVYETLCTIVT----------IDQA...........--....TLLLYLLLHRNERFY.RFVMQ.QQDL
H0VNU2_CAVPO/1-646.......QINFNSLYTALCEQQT----------SDQA...........--....TLLLYTLLHQNSNVR.TYMLA.RTDM
E9ICM4_SOLIN/1-654.......KFNLNKLYTTICKIPN----------TDEV...........--....TLLLYMLLHRNSSVK.HDIMR.RPDI
L9KZV5_TUPCH/1-826.......QFILKGIARLLSN..P----------LLQTYLPHSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDV
E9G1Z8_DAPPU/1-633.......RLDYSVLYSTLCDRLG----------DERT...........--....TLLLYMLLHQHQQFR.NYVYT.HADI
D7FT96_ECTSI/1-808.......ELVYTGLSRLLNTLHR----------SRNTYMPGAATEVYC--YQEVLVLLWKLLEENPVFM.QYVLK.NCDI
H2MFX7_ORYLA/1-772.......SFILRGLTQLLNN..P----------LIQTYLPRSTKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDV
B7S488_PHATC/1-694.......SMIFDGFARLLRNVYE----------AESNYIAGV..KLEC--FQELLVLFWKFLEENPLFM.PHILK.RCNV
W1NV48_AMBTC/1-680.......RLPFASLFDTLGACLF----------DETS...........--....VLLLYSLVHGNSDFL.EYVLV.RTDL
B6A9V3_CRYMR/1-794.......GITKFTYFDQICSTIS----------SEYG........LKN--HILESYIFYFLIHSNSNFR.LYCMS.RGDP
H2KSV6_CLOSI/110-1035.......AFILNGLTRLLNN..P----------LQQTYLPGSTKKVQM--HQELLVLFWRMCEINKKFM.YYVLK.SSQV
M4AQZ4_XIPMA/1-781.......SFVLRGFAQLLNN..P----------LIQTYLPRSTKKIHF--HQELLILFWKCCDFNKKFL.FFVLK.SSDV
E0VG76_PEDHC/1-766.......QFVLGGFTRLLNN..P----------LVQTYLPNSTKKVQF--HQELLVFFWKLCDYNKKFL.YYVLK.SSDV
B4MQL1_DROWI/1-832.......HFVLKGITRLLNN..P----------LVQNYLPNSTKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDV
HID1_DICDI/1-880.......KFFFNAFERIMNVPLI----------ASHTKLPNSTKKIEL--HQDLTYTMWLFLSYNHDFL.RSIVN.YENS
W4XTN1_STRPU/1-721.......HFILKGITRLLNN..P----------LIQTYLPGSTKKIAF--HQELLVLFWKMCDHNKKFL.FYVLK.SSDV
T1K251_TETUR/1-842.......AFILKGFTRLLNN..P----------LQQTYIPNSTKRIQF--HQELLVLFWKICDYNKKFM.FYVLK.SSHV
T1I7V2_RHOPR/1-802.......GFVLRGFTRLLNN..P----------LVQTYLPNSTKKVQF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDV
Q7QGJ8_ANOGA/1-825.......QFILKGVTRLLNN..P----------LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDV
A0A068YEV3_ECHMU/1-732.......RIPFGRLCETLASTVN----------TDSS...........--....VLLLYLLLHRNDFFR.AFVME.TRAY
J9KB63_ACYPI/1-736.......SFILSGFTRLLMN..P----------LRQTYLPHSTKKVQF--HQELLIFFWKICEFNKKFL.YFVLK.SSDV
Q17L03_AEDAE/1-819.......QFILKGVTRLLNN..P----------LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDV
W4Z6Q3_STRPU/1-667.......KLNSANLYEAFCNHLK----------DDQS...........--....TLLLYLLLHQNINFR.NYVLS.RTNI
W5JW75_ANODA/1-876.......QFILKGVTRLLNN..P----------LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDV
DYM_XENTR/1-646.......QINFNSLYTALCEQQK----------SDQA...........--....TLLLYTLLHQNSNVR.TYVLA.RSDM
A8WTE9_CAEBR/1-690.......KIDYNGLYERLCATAG----------QEPP...........--....MLLLYMLLQANSGFR.NYVLS.RINL
M4C137_HYAAE/1-768.......TISISDLFDIFGSRAS----------YETS...........--....HLMLYTLLYSNPAIL.NTALS.DRDM
B9HUR0_POPTR/1-672.......RLPFASLFDTLGMCLA----------DETA...........--....VLLLYTLVHGNSDFL.EYVLV.RTDL
F6TGV4_CIOIN/1-683.......HINLSRLYGTACSVQV----------YESS...........--....TLLLYSLLHGNPDVK.AFVLS.KTDI
H3AL71_LATCH/1-849.......HFILKGIARLLSN..P----------LVQTYLPNSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDV

PF12722

C4XYD9_CLAL4/17-927VKL-VPYIAYHIFAFC-------DVP-HY-------------------KVLVK---------------------LCAYFL
A3LX71_PICST/1-905PEL-LVVLFYYIFAFH-------SNV-QH-------------------KNLVR---------------------ICAYLM
Q6BSE0_DEBHA/1-924HEL-LVIMLYYVCTYH-------RNV-NH-------------------KNSVR---------------------IFSYFI
C3Z701_BRAFL/1-784LDV-IAPILYHLNDSR-------QDQ-SR-------------------VGLMH---------------------IGVFIL
Q0E9B5_DROME/1-834LDI-LIPILYHLNYSR-------ADQ-SR-------------------VGLMH---------------------IGVFIL
B0WUT2_CULQU/1-851LDI-LVPILYHLNDSR-------ADQ-SR-------------------VGLMH---------------------IGVFIL
A7RKV1_NEMVE/1-693LDI-LVPILYHLNDAR-------SDQ-SR-------------------LGLMH---------------------IGVFIL
A8WRZ4_CAEBR/1-727LDI-LVPILYHISDAR-------NDS-AR-------------------VGLIH---------------------MGVFII
A0A0H5SQP5_BRUMA/1-721LEV-LVPILFHISASR-------NDP-AR-------------------VGLIH---------------------MGVFII
C5K8E7_PERM5/1-865EDI-LHPLLDLLVSSR-------NSQ-AK-------------------IGLLH---------------------MCSFII
B6JW01_SCHJY/1-778LDL-FVFILYLSFEYL-------SEA-ST-------------------FDHLK---------------------ICLIIL
YIOC_SCHPO/1-796IDL-FIFLLYLSFEYL-------GDP-ST-------------------YNHLK---------------------LCVILL
Q2GWB4_CHAGB/1-825HDF-IILILFYALEYK-------GDA-SK-------------------QGVVR---------------------MCAFLL
Q0UAJ2_PHANO/1-733HDF-VVLVLYYAIDQR-------NDP-TK-------------------QGLVR---------------------MCVFVL
B8M9N3_TALSN/1-838HDF-VILCIFYATEYR-------NDP-SK-------------------QGMVK---------------------MCIFIL
C5FVH3_ARTOC/1-827HDF-IVICTFYAIEYK-------TDP-SK-------------------NGLVK---------------------M.....
C0NTS7_AJECG/1-843LDF-VVLCIFYAIEYK-------TDA-SK-------------------LGVVK---------------------MCIFIL
B6HUK2_PENRW/1-841HDF-LVLCIFYAMEYR-------MDA-SK-------------------QGVVR---------------------MCVFIL
Q5ASC1_EMENI/1-732HDF-IILCIFYSITYK-------SDP-AK-------------------QGVVR---------------------MCIFIL

PF09742

F4WRP0_ACREC/1-730LEV.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
E9H938_DAPPU/1-832LDV.LVPILFHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
T1JUN4_TETUR/1-644DDL.TIPILKILYHSG.......EKT.SH.....................HIY.....................MAVIIL
J9F5Y0_WUCBA/1-661EKL.VLPVLIVLSDGAQSSSMINSYN.AH.....................HVY.....................LALIVI
B4JW54_DROGR/1-859LDI.LIPILYHLNYSR.......ADQ.SR...................VGLMH.....................IGVFIL
I1EYR3_AMPQE/506-1206NTL.LLPLLKELSSEG.......KKP.SH.....................HSY.....................MLLIIL
E0VAE1_PEDHC/1-723EYL.VVPILKTLYNIT.......ESN.SH.....................HIY.....................MSLIIL
C1FEV8_MICSR/1-964RAL.VSALLRR................AH.....................ATYAEVGGSSPRGTTQLNVSGVASVATATL
G1MRD7_MELGA/1-648LVLKVLPILEILYHVE.......ERN.SH.....................HVY.....................MALIIL
D6WWB7_TRICA/1-769LEV.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
H3BX91_TETNG/1-768LDV.LVPILFYLNDAR.......ADQ.SR...................VGLVH.....................IGVFIL
F7D5K7_XENTR/1-770LDI.LVPILYFLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL
H2SJN1_TAKRU/1-774LDV.LVPILFYLNDAR.......ADQ.SR...................VGLVH.....................IGVFIL
B3RQA8_TRIAD/1-734LDI.LVPILYYLNDAR.......CDP.AR...................IGLMH.....................IGVFIL
I3JLL2_ORENI/1-646DNL.VLPILEILYHVE.......ERN.SH.....................HVY.....................MALIIL
U1M0X7_ASCSU/1-660ENL.VIPVLRVLHDGTPSGSLNLSSN.SH.....................HVY.....................LSLIVI
H2XV68_CIOIN/1-762LDI.LVPILYHLNDAR.......ADQ.SR...................VGLIH.....................IGVFIL
Q5ZBZ3_ORYSJ/1-682DTL.LMPILEMLYNAS.......RKT.SN.....................QIY.....................MLLIVL
D0NH97_PHYIT/1-769ERL.LLPLLETLYHAR.......SVE.PS.....................RLY.....................MLVIVL
T1FYR2_HELRO/1-642EQL.VLPILEMLYNSH.......EGN.SQ.....................HLY.....................MALIII
Q4DJF1_TRYCC/1-725LNY.IVPFVDYALNAK.......RDP.KY...................FPHLQ.....................LVLFLL
I3KNU8_ORENI/1-782LDM.LVPILFYLNDAR.......ADQ.SR...................LGLMH.....................IGVFIL
I3JCX3_ORENI/1-776LDI.LVPILYYLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL
Q01H67_OSTTA/38-724KRL.VENLIRELYEAE.......MDGITH.....................VSQ.....................LIITSL
Q38FE7_TRYB2/1-706LGV.IQGVLRLSYTAS.......SEAWASGFNSSDDDIDGGQCAIPIVEDAITPEAVASIVRRMTAFSYPFISFMTGTLV
Q8RWV1_ARATH/1-679DTL.LMPILETLYNAS.......KRTSSN.....................QIY.....................MMLIVL
I1MHZ5_SOYBN/1-671DTL.LMPILEALYDAR.......RRT.AN.....................QIY.....................ILLIIL
B0WBZ3_CULQU/1-681QQL.VIPILQTLYNAP.......DST.SH.....................HIY.....................MSLIVL
F0Y4A0_AURAN/723-1436TRA.VVPVAFLMYEAR.......KDA.AR...................VGLVH.....................ICTFVL
D7T740_VITVI/12-678DTL.LMPILETLYNAS.......RRT.SN.....................QIY.....................MLLIIL
E1ZEP5_CHLVA/1-748DTL.LLPLLELLYSAH.......ERT.AN.....................QMY.....................MLLIIL
M4BPB3_HYAAE/1-729NQL.VVPLLFLMYEGR.......QEP.AK...................VGMIH.....................ICTFIL
Q5CRW2_CRYPI/1-755DAL.ILALLEPVYIIS.......KDIDET..................NLCQLI.....................ALLSII
DYM_DROME/1-676EQL.VIPILQTLYNAP.......DSN.SH.....................HIY.....................MSLIVL
H0VNU2_CAVPO/1-646ENL.VLPILEILYHVE.......ERN.SH.....................HVY.....................MALIIL
E9ICM4_SOLIN/1-654QLL.VTPILQILYHAP.......NNT.SH.....................HIY.....................MSLIIL
L9KZV5_TUPCH/1-826LDI.LVPILYFLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL
E9G1Z8_DAPPU/1-633QRM.VIALLQELFNGD.......DQG.SH.....................HLY.....................MSLIIL
D7FT96_ECTSI/1-808NEI.LVPVCYLLVENR.......KDV.SK...................GGLIH.....................ICTFVL
H2MFX7_ORYLA/1-772LEM.LVPILFYLNDAR.......ADQ.SR...................VGLVH.....................IGVFIL
B7S488_PHATC/1-694NEI.IVPICFLMYKSR.......RDP.AQ...................IGLVH.....................ICTFVL
W1NV48_AMBTC/1-680DTL.LMPVLEMLYNAS.......RRT.SN.....................QIY.....................MLLIIL
B6A9V3_CRYMR/1-794EYL.IVPILEVLYILP.......IQK.QRN..............VIIGTCHLI.....................PLLTIL
H2KSV6_CLOSI/110-1035LDL.LVPILYHLNDAR.......SDP.AR...................LGLVH.....................VGVFIL
M4AQZ4_XIPMA/1-781LEM.LVPILFYLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL
E0VG76_PEDHC/1-766LEI.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
B4MQL1_DROWI/1-832LDI.LIPILYHLNYSR.......ADQ.SR...................VGLMH.....................IGVFIL
HID1_DICDI/1-880PEF.LIPLLQYMDEGR.......KSQ.TT...................HGIVQ.....................IGTFIL
W4XTN1_STRPU/1-721LEV.LVPILYHLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL
T1K251_TETUR/1-842LDI.LVPILYHLNDSR.......SDQ.SR...................IGLIH.....................IGVFIL
T1I7V2_RHOPR/1-802LEI.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFII
Q7QGJ8_ANOGA/1-825LDI.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
A0A068YEV3_ECHMU/1-732EKF.TFSICSLLYQSP.......AEN.SH.....................LVY.....................MALIVL
J9KB63_ACYPI/1-736LDV.LVPILYHLNDSR.......ADQ.SR...................IGLMH.....................IGVFIL
Q17L03_AEDAE/1-819LDI.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
W4Z6Q3_STRPU/1-667DTL.VIPLLKILYNAQ.......ERN.SH.....................HIY.....................MTLIIL
W5JW75_ANODA/1-876LDI.LVPILYHLNDSR.......ADQ.SR...................VGLMH.....................IGVFIL
DYM_XENTR/1-646ENL.VLPILEILYHVE.......DRN.SH.....................HVY.....................MALIIL
A8WTE9_CAEBR/1-690ENL.VVPVLRILHDGVAT.....SNN.SH.....................HVY.....................LALIVA
M4C137_HYAAE/1-768ERL.LLPLLKTLYHAR.......YVE.PR.....................RLY.....................MLIIVL
B9HUR0_POPTR/1-672DTL.LMPILETLYSAS.......KRT.SN.....................HIY.....................ILLIIL
F6TGV4_CIOIN/1-683DSL.VTPILQILYFAP.......SQN.SH.....................HIY.....................MALIIL
H3AL71_LATCH/1-849LDV.LVPILYFLNDAR.......ADQ.SR...................VGLMH.....................IGVFIL

PF12722

C4XYD9_CLAL4/17-927LYISSQETWVQALVLP--------------------------------MSENMNEVLP.......SEFRLT-------GG
A3LX71_PICST/1-905LYCSSDKN.LDSIFEP--------------------------------MDHNLYESLP.......TNYKTN-------PA
Q6BSE0_DEBHA/1-924LYLSSDCLIMDKLFEP--------------------------------MDLTFYESLP.......TGYKIS-------PG
C3Z701_BRAFL/1-784LLLSGERNFGVRLNKP--------------------------------YTV....RVP.........MDIP-------VF
Q0E9B5_DROME/1-834LLLSGERNFGVRLNKA--------------------------------YSA....TVP.........MDIP-------VF
B0WUT2_CULQU/1-851LLLSGERNFGVRLNKP--------------------------------YTA....TVP.........MDIP-------VF
A7RKV1_NEMVE/1-693LLLSGERNFGVRLNKP--------------------------------YAV....RVP.........MDIP-------VF
A8WRZ4_CAEBR/1-727LLLSGERNFGVRLNKP--------------------------------YTA....KAN.........INIQ-------TF
A0A0H5SQP5_BRUMA/1-721LLLSGERNFGVRLNKP--------------------------------YTP....RAA.........IDVQ-------SF
C5K8E7_PERM5/1-865LVLSSDRDFAVALNAP--------------------------------FRG...SRIQ..........DVP-------VF
B6JW01_SCHJY/1-778RRLTTSKQFCEKLNIP--------------------------------FEQ..LSSLP.......TNRRVP-------FS
YIOC_SCHPO/1-796KRLTAEKYFCKRLNKP--------------------------------FQQ..QTALP.......ISMPVP-------FE
Q2GWB4_CHAGB/1-825QTLSVEKNFGVNLNKS--------------------------------FDA..QDTLPLLSALLASGARMG-------TF
Q0UAJ2_PHANO/1-733QTLSVEPNFGKSLNKT--------------------------------FEG..QESLP.......PSIRIP-------NF
B8M9N3_TALSN/1-838QTLSVEVSFGKRLNMK--------------------------------FEA..QDTLP.......TSIRIA-------GF
C5FVH3_ARTOC/1-827...............K--------------------------------FEA..QDTLP.......PSIRLE-------NF
C0NTS7_AJECG/1-843QTLSVEPNFGKNLNKK--------------------------------FES..QDTLP.......QSIRLQ-------NF
B6HUK2_PENRW/1-841QTMSAEPTFAKSLNNS--------------------------------FEA..QETLP.......QSIRLP-------KF
Q5ASC1_EMENI/1-732QTMSVEPTFGKSLNKK--------------------------------FEA..QDTLP.......QSIRIP-------GF

PF09742

F4WRP0_ACREC/1-730LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
E9H938_DAPPU/1-832LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
T1JUN4_TETUR/1-644LILSEDALFNESIHDI.....TLKNIT....................WY.S---ERTL---------PEIS.........
J9F5Y0_WUCBA/1-661LILSEDDFFCKVAHET.....MIKDTT....................WFNS---ERPL---------GEIS.........
B4JW54_DROGR/1-859LLLSGERNFGVRLNKA................................Y.S---ATVP---------MDIP....VFT..
I1EYR3_AMPQE/506-1206LILSQDECFNKSVHEIKSLFQTVKNIT....................WA.S---EKSI---------PQTT.........
E0VAE1_PEDHC/1-723LILSEDGGFGQTVHQI.....TIKNVT....................WY.H---EKVL---------TEIS.........
C1FEV8_MICSR/1-964AMLSQDPVVNRAVHSLSTSQRLASSSNDSQLNDSQLNDSQLNDRTDFWFNS---SASA---------KTLSGFKSIGKPP
G1MRD7_MELGA/1-648LILTEDDGFNRSIHEV.....ILKNIT....................WY.A---ERVL---------TEIS.........
D6WWB7_TRICA/1-769LLLSGERNFGVRLNKP................................Y.T---ATIP---------MDIP....VFT..
H3BX91_TETNG/1-768LLLSGERNFGVRLNKP................................Y.I---LRVP---------MDIP....VFT..
F7D5K7_XENTR/1-770LLLSGERNFGVRLNKP................................Y.S---VPFP---------MDIP....VFT..
H2SJN1_TAKRU/1-774LLLSGERNFGVRLNKP................................Y.V---LRVP---------MDIP....VFT..
B3RQA8_TRIAD/1-734LLLSGERNFGVRLNKP................................F.S---AKVP---------MDLP....VFN..
I3JLL2_ORENI/1-646LILTEDDAFNRSIHEV.....ILKNVS....................WY.T---ERSL---------TEIS.........
U1M0X7_ASCSU/1-660LILSEDDFFCKIVHET.....MIKNTS....................WYQA---ERPI---------GEVS.........
H2XV68_CIOIN/1-762LLLSGERNFGVRLNKP................................F.S---AAAP---------TDVP....AFA..
Q5ZBZ3_ORYSJ/1-682LILSQDSTFNASVHKL.....VLPSVP....................WY.H---ERLM---------HQTS.........
D0NH97_PHYIT/1-769LTFTQDPSFVRTAHTQ....LVVPNVS....................WY.Q---EHYM---------LDVS.........
T1FYR2_HELRO/1-642LILSEDANFSLAVHDI....PISKQIP....................WF.N---ERQL---------GEIS.........
Q4DJF1_TRYCC/1-725LRLSETRAFCLQCNAL................................F.H---ERIP---------FEFE....SFV..
I3KNU8_ORENI/1-782LLLSGERNFGVRLNKP................................Y.A---LRVP---------MDIP....VFT..
I3JCX3_ORENI/1-776LLLSGERNFGVRLNKP................................Y.S---LHVP---------MDIP....VFT..
Q01H67_OSTTA/38-724LILSQDVGFNRLMQTQ.....KCSSTA....................WY.K---ERII---------EKSS.........
Q38FE7_TRYB2/1-706LVCSQDQVINKRMSN......TIAETT.....................FKV---GRLV---------GRCP.........
Q8RWV1_ARATH/1-679LILSQDSSFNSSIHKM.....ILPSVP....................WY.K---EHLL---------HQTS.........
I1MHZ5_SOYBN/1-671LILSQDSSFNAGIHKL.....ILPTVP....................WY.K---ERLL---------LQSS.........
B0WBZ3_CULQU/1-681LILSEDDNFNKSVHEI.....ILKNIT....................WY.T---ERSI---------SEIS.........
F0Y4A0_AURAN/723-1436LKLSGERSFCVALNKP................................Y.E---ARLP---------ADLP....LFS..
D7T740_VITVI/12-678LILSQDSSFNASIHKL.....ILPSVP....................WY.K---ERLL---------HQTS.........
E1ZEP5_CHLVA/1-748LMLSQDTAFAQNVHKI.....GLPSVP....................FY.R---ERSS---------TRTT.........
M4BPB3_HYAAE/1-729LLLSGERDFGVNLNKP................................F.T---NHLP---------LDLP....PFS..
Q5CRW2_CRYPI/1-755LRLTNDLNMCKVLSYT.....YIESLPHWLEDDSLKKVIHKCSGN.....K---EKSG---------FELS......ENH
DYM_DROME/1-676LILSEDEGFNKNVHTI.....MLKNIT....................WY.T---ERTI---------SEIS.........
H0VNU2_CAVPO/1-646LILTEDDGFNRSIHEV.....ILKNIT....................WY.S---ERVL---------TEIS.........
E9ICM4_SOLIN/1-654LILSEDETFNKRIHEI.....MLKSVT....................WY.T---ERSI---------SEIS.........
L9KZV5_TUPCH/1-826LLLSGERNFGVRLNKP................................Y.S---VRVP---------MDIP....VFT..
E9G1Z8_DAPPU/1-633LLLSEDEGFNSNIHNV.....VVRNPL....................WY.T---DRVL---------NEIS.........
D7FT96_ECTSI/1-808LKLSGERAFGVAINK.................................ACS---VRLP---------TDLP....LFY..
H2MFX7_ORYLA/1-772LLLSGERNFGVRLNKP................................Y.T---LRVP---------MDIP....VFT..
B7S488_PHATC/1-694LKLSGERSFGVALNQK................................F.T---KKLP---------TDLP....LFR..
W1NV48_AMBTC/1-680LILSQDSSFNASIHKL.....ILPSVP....................WY.Q---ERLL---------HHTS.........
B6A9V3_CRYMR/1-794TKLTDEPNYCKALHRT.....IIGSLPDWLKDSSLNKTIGMY........Q---GQNY---------YSNSTYEYAISDS
H2KSV6_CLOSI/110-1035LLLSGERNFGVRLNKP................................Y.K---NRAA---------LDIP....VFT..
M4AQZ4_XIPMA/1-781LLLSGERNFGVRLNKP................................Y.T---LRVP---------MDIP....VFT..
E0VG76_PEDHC/1-766LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
B4MQL1_DROWI/1-832LLLSGERNFGVRLNKA................................Y.S---ATIP---------MDIP....VFT..
HID1_DICDI/1-880LLLSGERDFSISLNKP................................F.V---GRIH---------IDIQ.QPQVYS..
W4XTN1_STRPU/1-721LLLSGERNFGVRLNKP................................Y.S---VRVP---------MDIP....VFT..
T1K251_TETUR/1-842LLLSGERNFGVRLNKP................................Y.A---ASIP---------MDLP....IFT..
T1I7V2_RHOPR/1-802LLLSGERNFGVRLNKP................................Y.T---ATIP---------MDIP.SHLFFTFC
Q7QGJ8_ANOGA/1-825LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
A0A068YEV3_ECHMU/1-732LILTENENFAKDVHDI.....PVKKPP....................PN.V---ERQL---------TGVS.........
J9KB63_ACYPI/1-736LLLSGERNFGVRLNKP................................Y.T---TTIP---------MDIP....VFS..
Q17L03_AEDAE/1-819LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
W4Z6Q3_STRPU/1-667LILSEDDSFNKCVHEL.....MVKQVT....................WY.T---DRTI---------TEIT.........
W5JW75_ANODA/1-876LLLSGERNFGVRLNKP................................Y.T---ATVP---------MDIP....VFT..
DYM_XENTR/1-646LILTEDDGFNRSIHEV.....ILKNIT....................WY.T---ERVL---------TEIS.........
A8WTE9_CAEBR/1-690LILSEDDIFCKIIHET....VPIKDLG....................WLDS---DFSV---------REIS.........
M4C137_HYAAE/1-768LIFTQNPTFVRTAHTL....LVVPNVS....................WY.Q---EQYM---------LDIP.........
B9HUR0_POPTR/1-672LILSQDSSFNASIHKI.....VLPSIP....................WY.Q---EHLL---------HRTS.........
F6TGV4_CIOIN/1-683LMFTEDDHFNKYVHDI.....RLPTVP....................WY.T---DRIL---------SDIS.........
H3AL71_LATCH/1-849LLLSGERNFGVRLNKP................................Y.S---VRVP---------MDIP....VFT..

PF12722

C4XYD9_CLAL4/17-927PHSTRDFLIVQLCSILSYVFSGFGSNPKSDTANEMKR-------------------------------FLVPTF------
A3LX71_PICST/1-905PTTTRDFLVTQICNLLIYMQTPQSTYTYGATLTPSP.-------------------------------LMVTTL------
Q6BSE0_DEBHA/1-924PVTYRDFIVTQICKLLITLSSGSN.....NTNNAKPS-------------------------------LLLTTL------
C3Z701_BRAFL/1-784TGTHADFLIIVFHKII.............TTGHQRLQ-------------------------------PLFDCL------
Q0E9B5_DROME/1-834TGTHADLLITVFHKII.............ATGHQRLQ-------------------------------PLFDCL------
B0WUT2_CULQU/1-851TGTHADLLITVFHKII.............ATGHQRLQ-------------------------------PLFDCL------
A7RKV1_NEMVE/1-693TGTHADFLVVVFHKII.............TTGHQRLQ-------------------------------PLFDCL------
A8WRZ4_CAEBR/1-727TGTHADLLILVFHKLI.............TTGNYRLQ-------------------------------SLFDCF------
A0A0H5SQP5_BRUMA/1-721TGTHADLLILVFHKLI.............TTGNHRLQ-------------------------------SLFDCL------
C5K8E7_PERM5/1-865TGTWADLMTLSIYRVVSDALFVAATAKSPTTGAE...-------------------------------SLIDMM------
B6JW01_SCHJY/1-778KGSYADFSVTAMTSII.............TACKDYQS-------------------------------EAVLLL------
YIOC_SCHPO/1-796GGTYADFTIIAISLLV.............QYTKDYHS-------------------------------EIAQML------
Q2GWB4_CHAGB/1-825SSSQSIYVLI...................TTSQGKLT-------------------------------AVYPAL------
Q0UAJ2_PHANO/1-733HGTYADYVIT...........................-------------------------------......------
B8M9N3_TALSN/1-838RGTYADYLIISIHTLM.............TSSKGKLD-------------------------------AVYPAL------
C5FVH3_ARTOC/1-827GGTYGDFLIISIHTLM.............TTSKGKLD-------------------------------AVYPAL------
C0NTS7_AJECG/1-843RGSYADFLIISIHTLL.............TTSKGKLD-------------------------------AVYPAL------
B6HUK2_PENRW/1-841RGSYGDYLITSIHTLM.............TTSKGNLD-------------------------------TVYPAL------
Q5ASC1_EMENI/1-732KGSYADFLLI...........................-------------------------------......------

PF09742

F4WRP0_ACREC/1-730.GTHADLLVTVFHKII-------------TTGHQRLQ...............................PLFDCL......
E9H938_DAPPU/1-832.GTHADLLVVVFHKII-------------TTGHQRLQ...............................PLFDCL......
T1JUN4_TETUR/1-644...LGGLIILMIIRTV-------------QYNISRTR................D.............KFLHTNL......
J9F5Y0_WUCBA/1-661...LGGLIILVFVRII-------------QLNTLKTK................D.............RYLHTNC......
B4JW54_DROGR/1-859.GTHADLLITVFHKII-------------ATGHQRLQ...............................PLFDCL......
I1EYR3_AMPQE/506-1206...LGSLMIIVLVRTV-------------HRNIQHLR................D.............KFLHTNC......
E0VAE1_PEDHC/1-723...LGGLLLLVVIRTI-------------HYNMLKMR................D.............KYLHTNC......
C1FEV8_MICSR/1-964QQTLGSAWVLVLCRVA-------------RGGGIEKG................DVTSGEGGIEPATSSFARACA......
G1MRD7_MELGA/1-648...LGSLLILVVIRTI-------------QYNMTRTR................D.............KYLHTNC......
D6WWB7_TRICA/1-769.GTHADLLIIVFHKII-------------TTGHQRLQ...............................PLFDCL......
H3BX91_TETNG/1-768.GTHADLLIVIFHKII-------------SSGHQRLQ...............................PLFDCL......
F7D5K7_XENTR/1-770.GTHADLLIVVFHKII-------------TSGHQRLQ...............................PLYDCL......
H2SJN1_TAKRU/1-774.GTHADLLIVIFHKIV-------------SSGHHRLQ...............................PLFDCL......
B3RQA8_TRIAD/1-734.GTHIDFLVIVFHKVI-------------TTGHQRLA...............................PIFDCL......
I3JLL2_ORENI/1-646...LGSLLILVVIRTI-------------QFNMTRTR................D.............KYLHTNC......
U1M0X7_ASCSU/1-660...LGGLIILVFVRTI-------------QLNTLKTR................D.............RYLHTNC......
H2XV68_CIOIN/1-762.GTHADFLVLVFHRVI-------------TAGHQRLQ...............................PLYDCL......
Q5ZBZ3_ORYSJ/1-682...LGSLMVVILIRTI-------------KYNLSKLR................D.............VYLHTNC......
D0NH97_PHYIT/1-769...LGSLMMVIFTRLI-------------FRNITHFQ................D.............SFIHLNA......
T1FYR2_HELRO/1-642...LGGLMVLVLVRTI-------------QYNMTRMR................D.............QYLHTNC......
Q4DJF1_TRYCC/1-725.GTYNDLLIIMLCSFI-------------LLRHELIR...............................PLHVTC......
I3KNU8_ORENI/1-782.GTHADLLIVIFHKII-------------SSGHQRLQ...............................PLFDCL......
I3JCX3_ORENI/1-776.GTHADLLIVVFHKII-------------TTGHQRLQ...............................PLFDCL......
Q01H67_OSTTA/38-724...MGSLMFVVLSRAL-------------KYNCSESTK............ISRD.................LSV......
Q38FE7_TRYB2/1-706...VIAVCIVIIVHSI-------------ARALNDGN..............................EALAAVF......
Q8RWV1_ARATH/1-679...LGSLMVIILIRTV-------------QHNLSKLR................D.............VYLQTTC......
I1MHZ5_SOYBN/1-671...LGSLMVIILIRTI-------------QYNLSKLR................D.............VYLHTTC......
B0WBZ3_CULQU/1-681...LGGLLILVVIRTI-------------QYNMLKMR................D.............KYLHTNC......
F0Y4A0_AURAN/723-1436.GSHVDLLVVVLHKMV-------------VNGGDRLA...............................PLYNCF......
D7T740_VITVI/12-678...LGSLMVIILIRTV-------------KYNLSKLR................D.............VYLHTNC......
E1ZEP5_CHLVA/1-748...LGSLLVVLLLRTA-------------HYNLAKLR................D.............VYLHTNT......
M4BPB3_HYAAE/1-729.GNHADLLIVCLHKII-------------VSGYEKLN...............................SVYNCF......
Q5CRW2_CRYPI/1-755SISIGNILIAVLLRAM-------------FYNYKFGK................D.............IYLCSII......
DYM_DROME/1-676...LGGILILIVIRTI-------------QYNMLKMR................D.............KYLHTNC......
H0VNU2_CAVPO/1-646...LGSLLILVVIRTI-------------QYNMTRTR................D.............KYLHTNC......
E9ICM4_SOLIN/1-654...LGGLLILVVIRTI-------------QYNMFKMR................D.............KYLHTNC......
L9KZV5_TUPCH/1-826.GTHADLLIVVFHKII-------------TSGHQRLG...............................PLFLRLPAHHRG
E9G1Z8_DAPPU/1-633...LGGLAVLVIARTI-------------QRNIVKAS................D.............KYLHTNC......
D7FT96_ECTSI/1-808.GSHLDLLILTVHKLL-------------VAGSDRLS...............................TLYHCF......
H2MFX7_ORYLA/1-772.GTHADLLIVIFHKVI-------------TSGHQRLH...............................PLFDCL......
B7S488_PHATC/1-694.GCHADLLTITLHKLV-------------VNGAYKLV...............................PLYSCF......
W1NV48_AMBTC/1-680...LGSLMVVILIRTV-------------KYNMSKLR................D.............VYLHTNC......
B6A9V3_CRYMR/1-794IVSLGSLIILTLIKLL-------------LWNSKTHS................D.............IFLCELA......
H2KSV6_CLOSI/110-1035.GTHADVLIIVFHKLI-------------TTGHRRLQ...............................PLFDCL......
M4AQZ4_XIPMA/1-781.GTHADLLIVIFHKII-------------TCGHQRLH...............................PLFDCL......
E0VG76_PEDHC/1-766.GTHADLLIVVFHKVI-------------TTGHQRLQ...............................PLFDCL......
B4MQL1_DROWI/1-832.GTHADLLITVFHKII-------------ATGHQRLQ...............................PLFDCL......
HID1_DICDI/1-880.....DFVITVMYRLL-------------VDTPDRLE...............................SIYECV......
W4XTN1_STRPU/1-721.GTHADFLIIVFHKII-------------TSGHQRLQ...............................PLYDCL......
T1K251_TETUR/1-842.GTHADLLIIVFHKLI-------------TAGHQRLQ...............................PLFECL......
T1I7V2_RHOPR/1-802SGTHADLLITVFHKII-------------TTGHQRLQ...............................PLFDCL......
Q7QGJ8_ANOGA/1-825.GTHADLLITVFHKII-------------ATGHQRLQ...............................PLFDCL......
A0A068YEV3_ECHMU/1-732...LGSLLVYVLTRTI-------------RHHLNQLR................D.............KYLHINS......
J9KB63_ACYPI/1-736.GTHADLLIIVFHKII-------------TTGHNRMQ...............................PLFDCL......
Q17L03_AEDAE/1-819.GTHADLLITVFHKII-------------ATGHQRLQ...............................PLFDCL......
W4Z6Q3_STRPU/1-667...LGGLIVLVVIRTI-------------QYNMTRMR................D.............KYLHTNC......
W5JW75_ANODA/1-876.GTHADLLITVFHKII-------------ATGHQRLQ...............................PLFDCL......
DYM_XENTR/1-646...LGSLLILVVIRTI-------------QYNMTRTR................D.............KYLHTNC......
A8WTE9_CAEBR/1-690...LGGLTALVFIRAI-------------QKNALKTKVSSVFLFPNTIPLIKQD.............RYLHTNC......
M4C137_HYAAE/1-768...LGSLMMVIFTRLI-------------FRNITHFQ................D.............NFIHLNA......
B9HUR0_POPTR/1-672...LGSLMVIILIRTV-------------KYNLSKLR................D.............LYLHTTC......
F6TGV4_CIOIN/1-683...LGDLIILVVIRTI-------------QFNMSRMR................D.............RYLHTNC......
H3AL71_LATCH/1-849.GTHADLLIIVFHKII-------------TSGHQRLQ...............................PLFDCL......

PF12722

C4XYD9_CLAL4/17-927-----SEVLYN--IVPV.VNDSIVGTDDTSKRMNNVNSKGGLSYQACSALLQLMSTLSSKQALA---ESYR---------
A3LX71_PICST/1-905-----VEILYN--LIPPVATKSLEATNDPAKKLTNSNPNGGLSYSTCSVINLLIGKYSSRTFLQ---EKSI---------
Q6BSE0_DEBHA/1-924-----VEILYN--LIPVVSSKDIEVKDDPEKKLGNSNPRGGLSYGACSSITQLILKFSTRPFLL---DASF---------
C3Z701_BRAFL/1-784-----LTIIVN--VSPY.....................LKSLSMVASTKLLHLLEAFSTPWFLF---SNPS---------
Q0E9B5_DROME/1-834-----LTILVN--VSPY.....................LKTLSMVASVKMLHLLEAFSTPWFLL---SAPS---------
B0WUT2_CULQU/1-851-----LTILVN--VSPY.....................LKTLSMVASIKLLHLLEAFSTPWFLY---SAPS---------
A7RKV1_NEMVE/1-693-----LTIIVN--VSPY.....................LKSLSMVAANKLLHLLEAFSTPWFLF---ANPT---------
A8WRZ4_CAEBR/1-727-----LTIMVN--VSPY.....................MKSLSMVAANKLVHLVEAFSTPWFLF---SSPT---------
A0A0H5SQP5_BRUMA/1-721-----LTIIVN--VSPY.....................LKSISMIAANKLIHLIEAFSTPWFLF---SSPT---------
C5K8E7_PERM5/1-865-----LTSLCN--ISAY.....................VRTFCLESCIKILNLVERFSKPHWLF---KGPL---------
B6JW01_SCHJY/1-778-----TETLSY--LVKY.....................VDNITIASSRRLVKLFVNVSDLGFLL---ANPT---------
YIOC_SCHPO/1-796-----CCSLCY--LCLY.....................AQNLNSHSSQSLFELFQSASYPGFLI---SNDV---------
Q2GWB4_CHAGB/1-825-----LAVINN--IAAY.....................LEGLSGPTCSRIMQLFNSMSSPSFLL---ANDS---------
Q0UAJ2_PHANO/1-733-----......--.......................................LFASMSSPSFLF---ANEN---------
B8M9N3_TALSN/1-838-----MAILKN--IGPY.....................VERLSSTACSKILQLFASMSSPSFLL---ANET---------
C5FVH3_ARTOC/1-827-----LAIINN--VAAY.....................AQRLSPACAFKILQLFVSMSSPSFLL---ANET---------
C0NTS7_AJECG/1-843-----LAIINN--IGAY.....................CEHLSATTCSKIIQLFSLLSSPSFLL---ANES---------
B6HUK2_PENRW/1-841-----LIILNN--IAPY.....................IERISPSACSKVIQLFTSMSSPSFLL---ANES---------
Q5ASC1_EMENI/1-732-----......--.......................................LFTSMSAPSFLL---ANES---------

PF09742

F4WRP0_ACREC/1-730.....LTILVN..VSPY---------------------LKTLSMVASTKLLHLLEAFSTPWFLF...SAPT.........
E9H938_DAPPU/1-832.....LTILVN..VSPY---------------------LKTLSMVASTKLLHLLEAFSTPWFLF...SAPN.........
T1JUN4_TETUR/1-644.....LATLAN..MSNH---------------------FRRLSPYVCQRLVTLFEKISKKLHKILNSQNAI.........
J9F5Y0_WUCBA/1-661.....LAALAN..MSSY---------------------FKNLSSIVCQKLIGLLEVFTRRHAKL...IENM.........
B4JW54_DROGR/1-859.....LTILVN..VSPY---------------------LKTLSMVASVKLLHLLEAFSTPWFLL...SAPS.........
I1EYR3_AMPQE/506-1206.....LATLAN..MSSH---------------------FHSLSLEAAEKIVNLFRVLSRKYLKS................
E0VAE1_PEDHC/1-723.....LAALAN..MSNN---------------------FCNLNSYVSQRLLSLFETLAKKYHRLEITLKTNMVKINSETR
C1FEV8_MICSR/1-964.....LAALAN..SAPY---------------------FDGLTSAASQRLVAVFDVLHRRRRKR...VSAAMGRPGIE..
G1MRD7_MELGA/1-648.....LAALAN..MSSQ---------------------FRSLHQYAAQRIIRLFGIFSELHNKA...LASA.........
D6WWB7_TRICA/1-769.....LTILVN..VSPY---------------------LKTLSMVASTKLLHLLEAFSTPWFLF...SSST.........
H3BX91_TETNG/1-768.....LTVIVNTTVSPY---------------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ.........
F7D5K7_XENTR/1-770.....LTIIVN..VSPY---------------------LKSLSMVASNKLLHLLEAFSSTWFLF...SSPQ.........
H2SJN1_TAKRU/1-774.....LTVIVN..ISPY---------------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ.........
B3RQA8_TRIAD/1-734.....LTVLVN..VSPY---------------------SKTLSIVASNKLLHLLEAFSTPWFLF...SNNN.........
I3JLL2_ORENI/1-646.....LAALAN..MSAQ---------------------FRCLHQYAAQRIISLFALLSKKHNKV...LEQA.........
U1M0X7_ASCSU/1-660.....LAALAN..MSSS---------------------FKQLSSTVCQKLIGLLELFTKRHAKL...IKHM.........
H2XV68_CIOIN/1-762.....LTIIVN..VSPY---------------------LKSLSMTAASKLLHLLEAFSTPWFLF...SSPQ.........
Q5ZBZ3_ORYSJ/1-682.....LAILAN..MAPH---------------------VHRLSAYASQRLVSLFDMLSRKYTKL...AELK.........
D0NH97_PHYIT/1-769.....FAALSN..LARS---------------------AENLHMYAAQGIVGLIDMLAKNEAKL................
T1FYR2_HELRO/1-642.....LGALAN..MSSH---------------------FMNLHPYVAQRLVSLFALLLKKHKKAADRLKEI.........
Q4DJF1_TRYCC/1-725.....SAIISN..IAPF---------------------MIKISPVSSEKLGLVFTSVSTRYLAY...KALF.........
I3KNU8_ORENI/1-782.....LTIIVN..ISPY---------------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ.........
I3JCX3_ORENI/1-776.....LTIIVN..VSPY---------------------LKSLSMVAANKLLHLLEAFSTTWFLF...SAAQ.........
Q01H67_OSTTA/38-724.....LGVIAN..MAGV---------------------TRDISGYAAQRLVNILELLTKKRARL...LSAENKDLQE...
Q38FE7_TRYB2/1-706.....IPCLAN..FAPF---------------------VHDIDVYTSQRLVGLLLLTLRKVQRT...AEHA.........
Q8RWV1_ARATH/1-679.....LATLAN..MAPH---------------------AHHLSAYASQRLVSLFYMLSRKYNKL...SDLT.........
I1MHZ5_SOYBN/1-671.....LATLAN..LAPH---------------------VHRLSAYASQRLVSLFGMLSRKYNKL...ADLR.........
B0WBZ3_CULQU/1-681.....LAALAN..MSGQ---------------------FRSLHPYVAQRLVSLFETLAKKHARLDQQLRQP.........
F0Y4A0_AURAN/723-1436.....LTVLCN..LSPY---------------------AKCIDLVAAVKLVNLFELFTSPKFLY...AAEA.........
D7T740_VITVI/12-678.....LATLAN..MAPH---------------------AHRLSAYASQRLVSLFDMLSRKYNKL...AELM.........
E1ZEP5_CHLVA/1-748.....LAALAN..LAPH---------------------MSGLSTHAAQRLVSLFHLLARRYSRL...QAAA........E
M4BPB3_HYAAE/1-729.....LTIICN..ISPY---------------------CKKLNMVSAVRLMRLFKLFAQPRYLF...DNEA.........
Q5CRW2_CRYPI/1-755.....YSIIEN..ISIY---------------------MKNFHWHVAEKITHYLIFLSSQIYCS...LNTY.........
DYM_DROME/1-676.....LAALAN..MSGH---------------------FRALHPYVAQRLVSLFETLARKHTRLDAQLKEP.........
H0VNU2_CAVPO/1-646.....LAALAN..MSAQ---------------------FRSLHQYAAQRIISLFSLLSKKHNKV...LEQA.........
E9ICM4_SOLIN/1-654.....LAALAN..MSAQ---------------------FTSLHPYVSQRLLSLFETLAKKHARLEARILEQ.........
L9KZV5_TUPCH/1-826QRSEPLPHLPT..VSPY---------------------LKSLSMVTANKLLHLLEAFSTPWFLF...SAAQ.........
E9G1Z8_DAPPU/1-633.....LATLAN..MAAH---------------------FRRLHPYTCQRLVSLLCTLNKRRIRV...VQQI.........
D7FT96_ECTSI/1-808.....LTVLCN..VSPY---------------------AKGLSLIASVKLLSLFELFTSPGNLY...ASEA.........
H2MFX7_ORYLA/1-772.....LTIIVN..ISPY---------------------LKSLSMVAANKLLHLLEAFSAPWFLL...SAQR.........
B7S488_PHATC/1-694.....LTIITN..ISPY---------------------WKSMSLVAAVKLVNLFELFASPKFLY...SGEF.........
W1NV48_AMBTC/1-680.....LATLAN..MAPH---------------------VHRLSAYASQRLVSLFDMLARKYTKL...AELR.........
B6A9V3_CRYMR/1-794.....CVIIQN..LSSS---------------------VENFHWIVSEKTLQYCNILISRINGI...LSLQ.........
H2KSV6_CLOSI/110-1035.....LTIIVN..VSPY---------------------LKSMSMVTANKLLHLLEAFSQPWFLY...SGQT.........
M4AQZ4_XIPMA/1-781.....LTIIVN..ISPY---------------------LKSLSMVAANKLLHLLEAFSMPWYLL...SAPQ.........
E0VG76_PEDHC/1-766.....LTILVN..VSPY---------------------LKTLSMVSSTKLLHLLEAFSTPWFLL...SAPS.........
B4MQL1_DROWI/1-832.....LTILVN..VSPY---------------------LKTLSMVASVKLLHLLEAFSTPWFLL...SAPS.........
HID1_DICDI/1-880.....LTILSN..LSPY---------------------MKNLSMVTCVKLMKLFEYLSTPRFLF...ATNH.........
W4XTN1_STRPU/1-721.....LTIIVN..VSPY---------------------LKSLSMVSANKMLHLLEAFSTPWFLF...SSPS.........
T1K251_TETUR/1-842.....LTIIVN..VSPY---------------------LKTLSMVSANKLLHLLEAFSTPWFLY...SNPI.........
T1I7V2_RHOPR/1-802.....LTILVN..VSPY---------------------LKTLSMVASTKLLHLLEAFSTPWFLF...SSPS.........
Q7QGJ8_ANOGA/1-825.....LTILVN..VSPY---------------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS.........
A0A068YEV3_ECHMU/1-732.....LAALAN..LSPK---------------------IANLHPYVSQALVDLLQKLVKRHKRL...VNEI.........
J9KB63_ACYPI/1-736.....LTILVN..VSPY---------------------LKTLSMVSSTKLLHLVDAFTTPWFLF...SSPS.........
Q17L03_AEDAE/1-819.....LTILVN..VSPY---------------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS.........
W4Z6Q3_STRPU/1-667.....LAALAN..MSSQ---------------------FHSLHPYVTQRIVSLFELLIKKHDKI...VEQL.........
W5JW75_ANODA/1-876.....LTILVN..VSPY---------------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS.........
DYM_XENTR/1-646.....LAALAN..MSAQ---------------------FRSLHQYAAQRIISLFSLLSKKHNKV...LEQA.........
A8WTE9_CAEBR/1-690.....LAALAN..MSAF---------------------FKNLAPIVCQRLISLLDLLTKRHAKM...VDHM.........
M4C137_HYAAE/1-768.....FAALSN..LARS---------------------AENLHIYAAQGLIGLIEMLAKNEAKL...VAQMKYLKSTDK.
B9HUR0_POPTR/1-672.....LATLAN..MAPH---------------------FHHLSAYASQRLVSLFYMLSRKYNKL...AERI.........
F6TGV4_CIOIN/1-683.....LAALAN..MSAH---------------------FRSLHPYAAQRIFSLVTLLTKKYRKL...TEKV.........
H3AL71_LATCH/1-849.....LTIIVN..VSPY---------------------LKSLSMVAANKLLHLLEAFSTTWFLF...SAPQ.........

PF12722

C4XYD9_CLAL4/17-927--------------------------------------------------------------------------------
A3LX71_PICST/1-905--------------------------------------------------------------------------------
Q6BSE0_DEBHA/1-924--------------------------------------------------------------------------------
C3Z701_BRAFL/1-784--------------------------------------------------------------------------------
Q0E9B5_DROME/1-834--------------------------------------------------------------------------------
B0WUT2_CULQU/1-851--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-693--------------------------------------------------------------------------------
A8WRZ4_CAEBR/1-727--------------------------------------------------------------------------------
A0A0H5SQP5_BRUMA/1-721--------------------------------------------------------------------------------
C5K8E7_PERM5/1-865--------------------------------------------------------------------------------
B6JW01_SCHJY/1-778--------------------------------------------------------------------------------
YIOC_SCHPO/1-796--------------------------------------------------------------------------------
Q2GWB4_CHAGB/1-825--------------------------------------------------------------------------------
Q0UAJ2_PHANO/1-733--------------------------------------------------------------------------------
B8M9N3_TALSN/1-838--------------------------------------------------------------------------------
C5FVH3_ARTOC/1-827--------------------------------------------------------------------------------
C0NTS7_AJECG/1-843--------------------------------------------------------------------------------
B6HUK2_PENRW/1-841--------------------------------------------------------------------------------
Q5ASC1_EMENI/1-732--------------------------------------------------------------------------------

PF09742

F4WRP0_ACREC/1-730................................................................................
E9H938_DAPPU/1-832................................................................................
T1JUN4_TETUR/1-644....................................................NGNGGDSGEKLSDKDTDVASTVGPLDPT
J9F5Y0_WUCBA/1-661............................................................RVRAEYDIIQE..KESHNYH
B4JW54_DROGR/1-859................................................................................
I1EYR3_AMPQE/506-1206....................................................KGEPIPAITGAQPTSPTTPTSPTTPTEL
E0VAE1_PEDHC/1-723ENDDGEKENSFVEMGKNSTTSQSKPNEENSVKETIINGTHESDKEDMAIQIKSSTDLDVKNLSGDEAVINVDDNASSDIV
C1FEV8_MICSR/1-964.........................................................................PGSDGLR
G1MRD7_MELGA/1-648.............................................................VQSKPSSLTSNSIPCVSQA
D6WWB7_TRICA/1-769................................................................................
H3BX91_TETNG/1-768................................................................................
F7D5K7_XENTR/1-770................................................................................
H2SJN1_TAKRU/1-774................................................................................
B3RQA8_TRIAD/1-734................................................................................
I3JLL2_ORENI/1-646.............................................................TQSLRGRQG.ESAALPDYA
U1M0X7_ASCSU/1-660............................................................RISAEYDLEHE..KQTHNYH
H2XV68_CIOIN/1-762................................................................................
Q5ZBZ3_ORYSJ/1-682.........................................................NDKAIKVISDQIEAD.NISDDTS
D0NH97_PHYIT/1-769.............................................................................VLA
T1FYR2_HELRO/1-642................................................................AEIARTNENKIFIPLL
Q4DJF1_TRYCC/1-725................................................................................
I3KNU8_ORENI/1-782................................................................................
I3JCX3_ORENI/1-776................................................................................
Q01H67_OSTTA/38-724.........................................................................QALHTPR
Q38FE7_TRYB2/1-706........................................................RSGAGDCLGTLEGTTPAGGCSSAD
Q8RWV1_ARATH/1-679.........................................................GDKLQSIKINLSGEDVGVSEDLA
I1MHZ5_SOYBN/1-671.........................................................DGKLNNAGSNSIERS.SLVEDMS
B0WBZ3_CULQU/1-681.....................................................AAVAANGDAAAVVAVPIVAGSNPDDML
F0Y4A0_AURAN/723-1436................................................................................
D7T740_VITVI/12-678.........................................................DDKMHIDKANSPEGD.SIAEDVS
E1ZEP5_CHLVA/1-748GMPPPPTPNDLLSPSLESPLTPWTPAASPAPGPDAPAAAPQQQQGQQGAAGAEAAGQGAGVTGAAGGSGEAPAGASEAAE
M4BPB3_HYAAE/1-729................................................................................
Q5CRW2_CRYPI/1-755..................................................................NGDRSNLRFFNRFY
DYM_DROME/1-676...............................................................ADSAVFVNVSTTPEDML
H0VNU2_CAVPO/1-646.............................................................TQSLRGSLSSNDVPLPDYA
E9ICM4_SOLIN/1-654..........................................................TQVTTLSSKDSIVLNTANDTTI
L9KZV5_TUPCH/1-826................................................................................
E9G1Z8_DAPPU/1-633..............................................................KSDVKGDSATGASREELE
D7FT96_ECTSI/1-808................................................................................
H2MFX7_ORYLA/1-772................................................................................
B7S488_PHATC/1-694................................................................................
W1NV48_AMBTC/1-680.........................................................NDKIQNFKANLAEGN.TIGDDMP
B6A9V3_CRYMR/1-794......................................................................YDKKSEISFS
H2KSV6_CLOSI/110-1035................................................................................
M4AQZ4_XIPMA/1-781................................................................................
E0VG76_PEDHC/1-766................................................................................
B4MQL1_DROWI/1-832................................................................................
HID1_DICDI/1-880................................................................................
W4XTN1_STRPU/1-721................................................................................
T1K251_TETUR/1-842................................................................................
T1I7V2_RHOPR/1-802................................................................................
Q7QGJ8_ANOGA/1-825................................................................................
A0A068YEV3_ECHMU/1-732............................................RTLNDQLKEQKNTTGTKVPPYPDVRLNMMSSSDALL
J9KB63_ACYPI/1-736................................................................................
Q17L03_AEDAE/1-819................................................................................
W4Z6Q3_STRPU/1-667........................................................RASSALEPNGDLTQDAEVEHDDLL
W5JW75_ANODA/1-876................................................................................
DYM_XENTR/1-646.............................................................TQSLRGSLGSDESPLPDYA
A8WTE9_CAEBR/1-690............................................................RVSSQNDVAG...GQPINFH
M4C137_HYAAE/1-768.........................................................................EENDVLA
B9HUR0_POPTR/1-672.........................................................DDKM..GKSGSLGQD.SLAEDLS
F6TGV4_CIOIN/1-683.............................................LAIMATSDTPGTVSDASATSSEQAEIDMEPERDYA
H3AL71_LATCH/1-849................................................................................

PF12722

C4XYD9_CLAL4/17-927-----NAEFLAL--------------ILRALCSAAT---KNPV--P................SRMLLFSFVKNE------
A3LX71_PICST/1-905-----NSDLLAL--------------LIRAVCTAAL---KYPK--S................SRMLLFSILKNA------
Q6BSE0_DEBHA/1-924-----NADLLAL--------------IFRSVCTAII---KYPK--P................SRMLLFSMLKNE------
C3Z701_BRAFL/1-784-----NHHLVFF--------------LLEVFNNIIQ---YQFD--G................NANLVYTIIRKR------
Q0E9B5_DROME/1-834-----NHHLVFF--------------LLEIFNNIIQ---YQFD--G................NSNLVYTIIRKR------
B0WUT2_CULQU/1-851-----NHHLVFF--------------LLEIFNNIIQ---YQFD--G................NSNLVYTIIRKR------
A7RKV1_NEMVE/1-693-----NHHLVFF--------------LLEIFNNIIQ---YQFD--G................NSQLVYAIIRKR------
A8WRZ4_CAEBR/1-727-----NPQLVFS--------------LLEVFNNVIQ---YQFD--G................NSNLIYTIIRKR------
A0A0H5SQP5_BRUMA/1-721-----NHLLIFF--------------LLEVLNNIIQ---YQFD--G................NSNLVYTIIRKR------
C5K8E7_PERM5/1-865-----NHNAVFF--------------LVESLNNVIQ---YQYE--G................NHQLVYSVLRHK------
B6JW01_SCHJY/1-778-----NFKSTKN--------------VYKIFGNLLR---RRFS--Q................NPKFVYTVLRAH------
YIOC_SCHPO/1-796-----NHKILKY--------------VIGAINNAIQ---YAQK--Y................NAPLLYFFSMHK------
Q2GWB4_CHAGB/1-825-----NHSLLRS--------------LLEAINAIVE---HQFS--R................NPNFIFAILRNR------
Q0UAJ2_PHANO/1-733-----NHTLLQS--------------LLEVLNAMIE---HQYQ--RKYITNDTILVSDTTPDNPNLIYAIVRSR------
B8M9N3_TALSN/1-838-----NNYLLSA--------------LLEFMNVVLE---HQFT--R................NPFLVYGILKTR------
C5FVH3_ARTOC/1-827-----NHLLLSS--------------LLEFINTVLE---HQFS--K................NAYMVYVVLKSR------
C0NTS7_AJECG/1-843-----NHILLHS--------------LLEFFNSVLE---HQYS--N................NPLLVYSILKSA------
B6HUK2_PENRW/1-841-----NHTLLAS--------------LLDFINIMLE---HKFT--D................NPYLVYSILKYR------
Q5ASC1_EMENI/1-732-----NHALLAS--------------VLESINAILE---HKF.--....................MIYAILKYR------

PF09742

F4WRP0_ACREC/1-730.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
E9H938_DAPPU/1-832.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NANLVYTIIRKR......
T1JUN4_TETUR/1-644QDTSIYEEVLRM..............LLEIMNSTLS...SQLI..H----------------NPNLVYTLLYNR......
J9F5Y0_WUCBA/1-661KDITALEEGIRT..............LLEICNSCLS...SNLR..S----------------NPHFIYTILYKR......
B4JW54_DROGR/1-859.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
I1EYR3_AMPQE/506-1206ADTETLQEILLM..............LLEIINSSLT...YTLH..V----------------NPHFVYSLLYQR......
E0VAE1_PEDHC/1-723QDLNVLEEVLRM..............ILEIINSCLS...NQIQ..H----------------NPNLVYALLYKK......
C1FEV8_MICSR/1-964GRTGLPTAVAAL..............VSAALASALV...TSAS..K----------------CPELVYAALQRRD.....
G1MRD7_MELGA/1-648QDLN.IEEVIRM..............MLEIINSCLT...NSLH..H----------------NPNLVYALLYKR......
D6WWB7_TRICA/1-769.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
H3BX91_TETNG/1-768.....NHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NSHLVYAIIRKR......
F7D5K7_XENTR/1-770.....NHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NSSLVYAIIRKR......
H2SJN1_TAKRU/1-774.....NHYLVFF..............LLEVFNNVIQ...YQFD..G----------------NSNLVYAIIRKR......
B3RQA8_TRIAD/1-734.....NHHLIFF..............LLEVFNNIIQ...YQFD..G----------------NSHLVYTIIRKR......
I3JLL2_ORENI/1-646QDLSVIEEVIRM..............MLEIINSCLC...NSLH..H----------------NPNLVYALLYKR......
U1M0X7_ASCSU/1-660QDITALEEGIRT..............LLEICNSCLT...ANLR..N----------------NPHFIYTILYKR......
H2XV68_CIOIN/1-762.....NHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NANLIYTIIRKR......
Q5ZBZ3_ORYSJ/1-682TELHIYTDFLRI..............VLEIINAILT...YALP..R----------------NPEVVYAILHRQ......
D0NH97_PHYIT/1-769QKQSAYVEFIRL..............LLGVISSCLKA..RQLP..R----------------NPQLIYSLLHRA......
T1FYR2_HELRO/1-642QELAVIEEVIRM..............TLEILNSCLC...HSLN..Y----------------NPNLVYTMLYQK......
Q4DJF1_TRYCC/1-725.....ASNEVILDDAEIKAEQVVLLNIVEAVAGVLQ...YHEG..A----------------AATLLAAFIKHK......
I3KNU8_ORENI/1-782.....NHHLVFF..............LLEVCNNIIQ...YQFD..G----------------NFNLVYAIIRKR......
I3JCX3_ORENI/1-776.....NHHLVFF..............LLEAFNNIIQ...YQFD..G----------------NCNLVYAIIRKR......
Q01H67_OSTTA/38-724SEIAVCEDFIRI..............AFEILN.CLTTDLNSLE..Q----------------NPEIVYALMHKE......
Q38FE7_TRYB2/1-706TSIQMFLRQLLA..............LTEAVGGLLQ...GDCR..N----------------NYSFIYELVYQRSHLEEG
Q8RWV1_ARATH/1-679AELQIFTDFLRL..............VLDILNAILT...YALP..R----------------NPEIVYAIMHRQ......
I1MHZ5_SOYBN/1-671AELQIYTDFLRL..............VLEIINAILT...YALP..R----------------NPEVVYEIMHKQ......
B0WBZ3_CULQU/1-681QDLSVLEEVLRM..............VLEILNSCLS...HQLV..Y----------------CPNLVYTLLYKR......
F0Y4A0_AURAN/723-1436.....NHVYVSL..............LLELFNNVIQ...YQYG..G----------------NAHLVYAIVRRK......
D7T740_VITVI/12-678TELHIYTDFLRI..............VLEILNAILT...YALP..R----------------NPEVVYAIMHRQ......
E1ZEP5_CHLVA/1-748LELQLYADFLRI..............VLEIINSILT...SALP..Q----------------NPELVYTLLHRQ......
M4BPB3_HYAAE/1-729.....NHHLIFF..............LLETFDNIIQ...YQYE..G----------------NQQVVYAMIQTK......
Q5CRW2_CRYPI/1-755CGILMHKSLLKL..............IIESLKD......ENLL..S----------------NSELIYIIIKFS......
DYM_DROME/1-676QDLSVLEEVLRM..............VLEILNSCLT...NQLV..Y----------------CPNLVYTLLYKR......
H0VNU2_CAVPO/1-646QDLNVIEEVIRM..............MLEIINSCLT...NSLH..H----------------NPNLVYALLYKR......
E9ICM4_SOLIN/1-654QDLTILEEVLRM..............VLEIINSCLT...HRLA..H----------------NPNLIYTLLYKK......
L9KZV5_TUPCH/1-826.....NHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NSNLVYAIIRKR......
E9G1Z8_DAPPU/1-633QDLSILEEVLRM..............LLEILNAAFT...HQLG..C----------------NQNLIYSVLHKR......
D7FT96_ECTSI/1-808.....NQTYVSL..............LLEMFSNIIQ...YQYV..G----------------NAHLVYAIVRRQ......
H2MFX7_ORYLA/1-772.....HHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NSNLVYAIIRKR......
B7S488_PHATC/1-694.....AHRHLAL..............LLEVFNNIIQ...YQYH..G----------------NSHLVYAIVRRK......
W1NV48_AMBTC/1-680TELHIYTDFLRI..............VLEILNAIMT...YALP..R----------------NPEVVYAIMHRQ......
B6A9V3_CRYMR/1-794NTIYCTSLTLRN..............LLLIVGSCLA...TNNKVIS----------------NIQLAYAFIRIS......
H2KSV6_CLOSI/110-1035.....HYQLVFL..............LLEVFNNIIQ...YQFD..G----------------NSNLVYTLIRKR......
M4AQZ4_XIPMA/1-781.....NHNLVFF..............LLEVFNNIIQ...YQFD..G----------------NFNLVYAIIRKR......
E0VG76_PEDHC/1-766.....NHHLIFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
B4MQL1_DROWI/1-832.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
HID1_DICDI/1-880.....NYRYVGF..............LLESLNNLLQ...HQYE..S----------------NTRLIYAILRCQ......
W4XTN1_STRPU/1-721.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
T1K251_TETUR/1-842.....NHHLVFF..............LLEVFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
T1I7V2_RHOPR/1-802.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
Q7QGJ8_ANOGA/1-825.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
A0A068YEV3_ECHMU/1-732QDLSLLEEVIRM..............TLEIFNSILT...HSLT..A----------------NTHLIYNLLYQR......
J9KB63_ACYPI/1-736.....ANHLAFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
Q17L03_AEDAE/1-819.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
W4Z6Q3_STRPU/1-667SDLSVLEEVIRM..............VLEIINSCLI...NMLP..H----------------NPHLVYTLLYKQ......
W5JW75_ANODA/1-876.....NHHLVFF..............LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR......
DYM_XENTR/1-646QDLNVIEEVIRM..............MLEIINSCLT...NSLH..H----------------NPNMVYALLYKR......
A8WTE9_CAEBR/1-690DDITALEEGIRT..............LLEIINSALC...GGLR..H----------------NTHLIYNLLYHR......
M4C137_HYAAE/1-768QKHAAYIEFIRL..............SLGLLSSCLKT..EQLS..R----------------NPQLIYALLHRA......
B9HUR0_POPTR/1-672AELHIYTDFLRI..............VLEILNAILT...YALP..R----------------NPEVVYAIMHRQ......
F6TGV4_CIOIN/1-683SNLKVLEEVLRM..............LLEIVNSCLTG..GALR..H----------------NANLVYALLQRR......
H3AL71_LATCH/1-849.....NHHLVFF..............LLEVFNNIIQ...YQFDGIG----------------NSNLVYAIIRKR......

PF12722

C4XYD9_CLAL4/17-927-KIYDSIWTSIYSLESENINGEPL................................................RLMNVQED
A3LX71_PICST/1-905-KVYDQVWNTIYSFRTEYFNGNKL..................................................NRIDDG
Q6BSE0_DEBHA/1-924-KVYDQVWSTIYSFSTEYFSGDTL................................................VLNSIDDN
C3Z701_BRAFL/1-784-NVFHQLANLPTDRASIEKAVSRK................................................RKGSEASQ
Q0E9B5_DROME/1-834-HVFHAMANLPTDMAGIAKCLSGRKTGGKFNLPRVPQRRTPAVSQELPSAHVPEEYNEEDEDEDEEEIINEEPKAEEDLE
B0WUT2_CULQU/1-851-QVFHALANLPTDAAGIARCMSNRKGGKLNNSSHGSRSSGREQLQNKEVLPSTSHAEDDSEEDITVRTG.QIQIQDRHSD
A7RKV1_NEMVE/1-693-NIFHQLANLPTDPATIQKPKRKEH.......................................................
A8WRZ4_CAEBR/1-727-NVFYQLSNLSVDSASIAKTLSGRKSKS..........................................ANRDEMVDQL
A0A0H5SQP5_BRUMA/1-721-QVFYQLANLSSDSAYIMKMLQGRK.............................................GRKSGAVAES
C5K8E7_PERM5/1-865-EVFDSLKQLRLPKSS................................................................
B6JW01_SCHJY/1-778-ETLCSTIPANFSRAKEIVTQNQP...........................DMSVYLSSSNKTYTKHIFERALLDEKLNA
YIOC_SCHPO/1-796-DYIEAVSALSFDAIMSVRNSSAE...........................GDSAYWTRNGKTFS.....SKAFDSILLS
Q2GWB4_CHAGB/1-825-KRFEALRSLTLESGQEEVERRNQRRKDS.........................................GAPLDPLEPN
Q0UAJ2_PHANO/1-733-KRFQALRDFTLESGQEEIERQNQLRK...............................................EGASEL
B8M9N3_TALSN/1-838-KKFESLRTFTLESGQQEIERQNQLKK...........................................AASSTDGLTG
C5FVH3_ARTOC/1-827-HRFESLRAFTLESGQQEIEQQNQLRKAT.........................................SSSSGDFSTN
C0NTS7_AJECG/1-843-KRFEALRAFTLESGQEEIERLNQRRKVNQI.......................................SGNSDALLSP
B6HUK2_PENRW/1-841-QRFEAVRAFTLESGQQEIERQNERRKA..........................................GSSSDVATSP
Q5ASC1_EMENI/1-732-RRFEAVREFTLESGQQEIERQNQRRK...........................................SENRDSIASP

PF09742

F4WRP0_ACREC/1-730.QVFHALANLPSDCNTIAKSLSKRQRRH....................................................
E9H938_DAPPU/1-832.HVFHALASLPTDCGTINRSLSRRGRK.....................................................
T1JUN4_TETUR/1-644.HVFEPFQSHPS.FQD................................................................
J9F5Y0_WUCBA/1-661.DLFDAFQNHPM.FQD................................................................
B4JW54_DROGR/1-859.HVFHAMANLPTDMAGISKCLSGRKTG.................GKFNLPRVPQRKQTMPTTSTMSNQELPSAHAPEEYA
I1EYR3_AMPQE/506-1206.EIFTPYHGRPG.FID................................................................
E0VAE1_PEDHC/1-723.DIFDPFRTHQN.FND................................................................
C1FEV8_MICSR/1-964.EVFAPFLDE...FLD................................................................
G1MRD7_MELGA/1-648.DLFEQFRTHPS.FQD................................................................
D6WWB7_TRICA/1-769.QVFHNLANLPSDYGTIAKSLNKRTRS.....................................................
H3BX91_TETNG/1-768.SIFHQLANLPSDTASIQKALQKKRKS.....................................................
F7D5K7_XENTR/1-770.AVFQQLANLPSDTSSIQHALQRKKKP.....................................................
H2SJN1_TAKRU/1-774.SIFHQLANLPSDMASIQKALQQKKRK.....................................................
B3RQA8_TRIAD/1-734.NIFHQLANLPTDPSTVVKPNKKEDSS.....................................................
I3JLL2_ORENI/1-646.ELFEQFRTHPS.FQD................................................................
U1M0X7_ASCSU/1-660.ELFDGFQNHPM.FQD................................................................
H2XV68_CIOIN/1-762.QVFHQLANLPTDSASLSKGVNKKRNR.....................................................
Q5ZBZ3_ORYSJ/1-682.EVFQPFKNHPR.FNE................................................................
D0NH97_PHYIT/1-769.DTFAALQQHSE.FAA................................................................
T1FYR2_HELRO/1-642.EIFVQLSSHPS.FQD................................................................
Q4DJF1_TRYCC/1-725.SLVGEVSDIFL....................................................................
I3KNU8_ORENI/1-782.SVFHQLANLPSDTASIQRALQKKKRT.....................................................
I3JCX3_ORENI/1-776.NVFHQLANLPSDPSSIQKALQRKKKS.....................................................
Q01H67_OSTTA/38-724.ELVVGYRTDAA.FAE................................................................
Q38FE7_TRYB2/1-706AKLLSTVSCHSSEAQT................................................................
Q8RWV1_ARATH/1-679.EVFQPFKNHPR.FHE................................................................
I1MHZ5_SOYBN/1-671.EVFQPFKNHPC.FNE................................................................
B0WBZ3_CULQU/1-681.NVFEAFRSHSA.FQD................................................................
F0Y4A0_AURAN/723-1436.PVFDALEQLTLPRAITAAVEREHARR.....................................................
D7T740_VITVI/12-678.EVFQPFKNHPR.FNE................................................................
E1ZEP5_CHLVA/1-748.EVFAPFGAHPR.YAE................................................................
M4BPB3_HYAAE/1-729.SVFYQLNDLQLPPIRAATSEGKNPAK.....................................................
Q5CRW2_CRYPI/1-755..LITEIQKLNIFLKR................................................................
DYM_DROME/1-676.SVFEGFRSHHA.FQD................................................................
H0VNU2_CAVPO/1-646.DLFEQFRTHPS.FED................................................................
E9ICM4_SOLIN/1-654.DVFQPFRTHSA.FQD................................................................
L9KZV5_TUPCH/1-826.SVFHQLANLPTDPPTIHKALQRRRRT.....................................................
E9G1Z8_DAPPU/1-633.EVLDVLRRQPA.FQD................................................................
D7FT96_ECTSI/1-808.EAFESLYELDLPAAVAAASKFARSGA.....................................................
H2MFX7_ORYLA/1-772.NVFHQLANLPTDKESIQNALQRKKPG.....................................................
B7S488_PHATC/1-694.DAFGQIAALTLENAQAQC.............................................................
W1NV48_AMBTC/1-680.EVFEPFKQHPR.FYE................................................................
B6A9V3_CRYMR/1-794......FSNEAKKLQEMINIDFKTSSSNIQETNRFVELEFCNKYTPEFTNQSPEKLKSCYFKINGIFF............
H2KSV6_CLOSI/110-1035.QVFYHLANLPTDQSTIQRILKRRPTTLPN..................................................
M4AQZ4_XIPMA/1-781.NVFHQLANLPTDEGSIQKTLQKKKKK.....................................................
E0VG76_PEDHC/1-766.QVFHSLANLPTDYGSITKSLNKKSRR.....................................................
B4MQL1_DROWI/1-832.HVFHAMANLPTDMAGIAKCLSGRKTG.................GKFNLPRVPQRK..LAASNSYSSQELPSAQVPDEYA
HID1_DICDI/1-880.NQFSKLAYLKISPVTPSKPMEQITQPSPISTSEEAFGKLN.......................................
W4XTN1_STRPU/1-721.TVFHQLANLPSDQASISKALAKRSKK.....................................................
T1K251_TETUR/1-842.NIFHNLANLATDYGTIQKSLNRSSSSSSSASRRPRKLTLSSSQSTASASSIPPTSCQSPSANCKSAPTSPLSVDTCTSP
T1I7V2_RHOPR/1-802.QVFHSLANLPSDYGTIAKSLSRRGSS.....................................................
Q7QGJ8_ANOGA/1-825.QVFHALANLPTDAAGIARCLSNRKGGAGGGGGAGGRMVGSSH....GSASSGSRSLAGHDDDAADYQQRKAALTAPGAA
A0A068YEV3_ECHMU/1-732.EYLAPIHNHPS.FSD................................................................
J9KB63_ACYPI/1-736.QVFHSLANLPTDYSTIIKSLTKKAKR.....................................................
Q17L03_AEDAE/1-819.QVFHALANLPTDAAGIARCMSNRKGGKLNNSSHGSRDGVRNPQNNEVLPSTANAGNESEEEITVRTSQLAL........
W4Z6Q3_STRPU/1-667.DLFTSFKSHPK.FQD................................................................
W5JW75_ANODA/1-876.QVFHALANLPTDAAGIARCLSNRKGG...SGAGGARISGSSHAGGQGGPGAGARGGVQRHDDEVDYQQRKAALTAPGRD
DYM_XENTR/1-646.ELFEQFRSHPS.FQD................................................................
A8WTE9_CAEBR/1-690.ALFDAYVQHPM.FQD................................................................
M4C137_HYAAE/1-768.NTFAALQRHSE.FAA................................................................
B9HUR0_POPTR/1-672.EVFEPFKNHPR.FSE................................................................
F6TGV4_CIOIN/1-683.EAFDQLRLHTV.YQD................................................................
H3AL71_LATCH/1-849.NVFHQLANLPTDPPSIQKALQRKKKT.....................................................

PF12722

C4XYD9_CLAL4/17-927DEENEDSPVNFQERGNDSLQMNMHAQR.ELPKSLLKSPDEYSISS..FTSTEEIASPLYQS.------------------
A3LX71_PICST/1-905EEENENILSVVNSNNSE...........RFKPESETTDSESPQTR..KNSMFGIGTPPMTI.------------------
Q6BSE0_DEBHA/1-924EDENISPLQQIDSNRSDQVSISSSIES.EANDSIFINNFTSPKSR..HGSNVSGSIPPSTP.------------------
C3Z701_BRAFL/1-784RPVPHSPAVTDPPSMEGSFPAQEAQPG.TLKATLAEMPGIERLTE..KMEASSLAEQAAED.------------------
Q0E9B5_DROME/1-834SETESHERSQAGELQSDVLTAQPAEPG.TLKTSLLDTPGITQMTE..REQAHPNDKPQVED.------------------
B0WUT2_CULQU/1-851EEESDSRSEIIEESMEGSHPALPAEPG.TLKVTLLETPDIAQMTE..RESAHPSSADALAA.------------------
A7RKV1_NEMVE/1-693..........IPNMREGEHSRSPEDPV.S.....RATPGPSHTQK..K..............------------------
A8WRZ4_CAEBR/1-727KSPTTANPPEFPAAGASSSTPPASSGP.STTAGLAATPALASMT..................------------------
A0A0H5SQP5_BRUMA/1-721KSIAVAKSVDDVENKANI............KATLAETPLVSAMTE..K..............------------------
C5K8E7_PERM5/1-865....................PSTSTVP.SIVDESSMESDNAAAGQ..EKSSQETSAQQAVN.------------------
B6JW01_SCHJY/1-778EKRQNGYSTRDRRHRRIEKLYRDVDHS.SLESSVSVTHPEEKPFR..QGKDSETQNEQFFT.------------------
YIOC_SCHPO/1-796RLRYVRSKSPTPYYPIESSEFGFTNLK.DVTSKDEITDGFDKALR..SNSLRTHRDSRPVQ.------------------
Q2GWB4_CHAGB/1-825STRSSMESIMSPT.TQPSRAPTLGDVP.EEDSTFAIGDDEDDSDD..EARPTPAASSP...S------------------
Q0UAJ2_PHANO/1-733QRTNSIDSIRSPT...VSRTPTLGNVP.EENSAFAIGDDDDSDAD..EPHPTEAPQSPIHSP------------------
B8M9N3_TALSN/1-838SASQSMEDLRRSS...GARSS.LTHIP.EENSPFAIGGDDSEDEG..EIPTTPSQSSP...S------------------
C5FVH3_ARTOC/1-827SRTHARDSYEAGN....GRRP.LSHVPEEEDGTFAIGDDDSDEEG..DGGQPASQVTS...P------------------
C0NTS7_AJECG/1-843TVSHSGDDNRGSG...AGRRQ.LSHVP..EDGAFAIGDDDSDEEE.QEPQNTPSQSP....S------------------
B6HUK2_PENRW/1-841TLSQSEDDLHTPS...GARSP.LTRIP.EENSPFAIGDDDSDDEREEEGTQTPSQSSF...S------------------
Q5ASC1_EMENI/1-732VLSASDEDPRLSS...GARSP.LGRIP.EENNPFAIGGDDSEDEG..DGRHTPPQDSA...S------------------

PF09742

F4WRP0_ACREC/1-730......................................................MPAS......................
E9H938_DAPPU/1-832...........................QLGRQPSVESVKEAPS...........MEGS.HPA.........LPAQPG...
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859DDVEDDDDEEGEEDEDDLNVNRIRLDKQTIAEEDLESETESHERSQ........LGDTTQLPDTVAPPLSAQPAEPG...
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769............................RMSSTTSHENVAELA...........MEGS.HPA.........LPAEPG...
H3BX91_TETNG/1-768..........................GISRSVS.....VTSET...........GDHS.RVP.........VPADSS...
F7D5K7_XENTR/1-770........................VEPISRTNS.....QDGAS...........MEGS.RPA.........APAEPG...
H2SJN1_TAKRU/1-774.........................SGLSRSGS.....VTSEA...........ADNS.RVP.........VAAEPR...
B3RQA8_TRIAD/1-734........................DISVAQYQSGTESASDPNN...........ISGSESDT..................
I3JLL2_ORENI/1-646................................................................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762................................PQSASNSERKD...........THGEVSTV.........EVAESG...
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725......................................................AEGSNA....................
I3KNU8_ORENI/1-782..........................GISRTNS.....VENES...........MEGS.RPA.........VPAEPG...
I3JCX3_ORENI/1-776........................PDVISRTSS.....QETVS...........MEGS.HPA.........VPAEPG...
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436.........................GAAKPAPSQTPPAPPANGDASDAPPAPPVPHGAEPDA..................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729......................................................KEGDSTEE..................
Q5CRW2_CRYPI/1-755................................................................................
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826........................PEPLSRSGS.....QEGTS...........MEGS.RPA.........APAEPG...
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808..............................AAAQKVRAAAAAAEAAAAEAAAEAGNGEAAHA..................
H2MFX7_ORYLA/1-772...........................VSRVNS.....ADSEA...........TEDS.KPA.........EPAEPG...
B7S488_PHATC/1-694........................HKVYGEQTAVKRDIDAHLNVDNKGIPNMVGDDNASASS..................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035........................SDHSSPESSPTISAKSKSHSIKDNHDAQTTKEGARKKSQADIISPTSAVAPAGNRD
M4AQZ4_XIPMA/1-781.........................SGISRLNS.....TDGES...........MEGS.RPA.........APAEPG...
E0VG76_PEDHC/1-766..........................SLQSTNLSDNSSPESPS...........MEGS.KPA.........LPAEPG...
B4MQL1_DROWI/1-832EE......................DDQEEQEEDDFEGEDEEAKAEEDFESKTDIDRVTPQLPVAAVEVPTAQPAEPG...
HID1_DICDI/1-880........................KLSISEEPSTLSNEKSDKT...........TDGGDHQD..................
W4XTN1_STRPU/1-721..........................IQTAQAVSPQSDTESHT...........SESSRVPP............QDG...
T1K251_TETUR/1-842NVTSPQPQQQFNEKVEKSEQQSAPSNTIASKSTTPISNNNNDSNEVQQASLTDLNEGS.SPS........KTVNQES...
T1I7V2_RHOPR/1-802.............................RRHIPSQSGPESPS...........MEGS.KPA.........LPAEPG...
Q7QGJ8_ANOGA/1-825AAGG.........................DESGDARSDIVEES...........MEGS.HPA.........QEAEPG...
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736.........................NMQATSSVSLTAATETPS...........MEGS.TPA.........LPAEPG...
Q17L03_AEDAE/1-819........................DDRQPSDEEDSRSEIVEES...........MEGS.HPA.........QPAEPG...
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876SPGSGVADDSEDDISDRAGRVTLRDEDDSSASADARSDIVEES...........MEGS.RPA.........QEAEPG...
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849........................PEPISRTNS.....QDGTS...........MEGS.RPA.........APAEPG...

PF12722

C4XYD9_CLAL4/17-927--------------------------------------------------------------------------------
A3LX71_PICST/1-905--------------------------------------------------------------------------------
Q6BSE0_DEBHA/1-924--------------------------------------------------------------------------------
C3Z701_BRAFL/1-784--------------------------------------------------------------------------------
Q0E9B5_DROME/1-834--------------------------------------------------------------------------------
B0WUT2_CULQU/1-851--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-693--------------------------------------------------------------------------------
A8WRZ4_CAEBR/1-727--------------------------------------------------------------------------------
A0A0H5SQP5_BRUMA/1-721--------------------------------------------------------------------------------
C5K8E7_PERM5/1-865--------------------------------------------------------------------------------
B6JW01_SCHJY/1-778--------------------------------------------------------------------------------
YIOC_SCHPO/1-796--------------------------------------------------------------------------------
Q2GWB4_CHAGB/1-825--------------------------------------------------------------------------------
Q0UAJ2_PHANO/1-733--------------------------------------------------------------------------------
B8M9N3_TALSN/1-838--------------------------------------------------------------------------------
C5FVH3_ARTOC/1-827--------------------------------------------------------------------------------
C0NTS7_AJECG/1-843--------------------------------------------------------------------------------
B6HUK2_PENRW/1-841--------------------------------------------------------------------------------
Q5ASC1_EMENI/1-732--------------------------------------------------------------------------------

PF09742

F4WRP0_ACREC/1-730..........................................TP....................................
E9H938_DAPPU/1-832...............................THTCSLAI...MP....................................
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859...............................TLKTSLLD...TP....................................
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769...............................TLKATLPD...TP....................................
H3BX91_TETNG/1-768...............................MFKASLEA...TP....................................
F7D5K7_XENTR/1-770...............................TLKASLVA...TP....................................
H2SJN1_TAKRU/1-774...............................MFNASLEA...TP....................................
B3RQA8_TRIAD/1-734...........................SSDDELSKTGAA.........................................
I3JLL2_ORENI/1-646................................................................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762...............................VLSTSLAA...TP....................................
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725................................................................................
I3KNU8_ORENI/1-782...............................TLKASLEA...TP....................................
I3JCX3_ORENI/1-776...............................TLKASLVA...MP....................................
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436................................................................................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729................................................................................
Q5CRW2_CRYPI/1-755................................................................................
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826...............................TLKTSLVA...TP....................................
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808................................................................................
H2MFX7_ORYLA/1-772...............................ALKASLEA...TP....................................
B7S488_PHATC/1-694................................................................................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035VNGSAIDTPEVRFSQVLRDDVHSVSELSVFCALQPALAE...TP....................................
M4AQZ4_XIPMA/1-781...............................TLKATLEA...TP....................................
E0VG76_PEDHC/1-766...............................TLKASLLD...TP....................................
B4MQL1_DROWI/1-832...............................TLKTSLLD...TP....................................
HID1_DICDI/1-880.............................ESISKSKVQS...KP....................................
W4XTN1_STRPU/1-721...............................QARAGFSGDDFRP....................................
T1K251_TETUR/1-842...............................SIKVSLAA...TP....................................
T1I7V2_RHOPR/1-802...............................TLKATLPA...TP....................................
Q7QGJ8_ANOGA/1-825...............................TLKATLLD...TP....................................
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736...............................TLNATLPD...TP....................................
Q17L03_AEDAE/1-819...............................TLKATLLD...TP....................................
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876...............................TLQATLLD...TP....................................
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849...............................TLKASLFA...TPGITLSTPTLEAQVFIYMENPLPMQTTENSSLGSHQR

PF12722

C4XYD9_CLAL4/17-927--------------------------------------------------------------------------------
A3LX71_PICST/1-905--------------------------------------------------------------------------------
Q6BSE0_DEBHA/1-924--------------------------------------------------------------------------------
C3Z701_BRAFL/1-784--------------------------------------------------------------------------------
Q0E9B5_DROME/1-834--------------------------------------------------------------------------------
B0WUT2_CULQU/1-851--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-693--------------------------------------------------------------------------------
A8WRZ4_CAEBR/1-727--------------------------------------------------------------------------------
A0A0H5SQP5_BRUMA/1-721--------------------------------------------------------------------------------
C5K8E7_PERM5/1-865--------------------------------------------------------------------------------
B6JW01_SCHJY/1-778--------------------------------------------------------------------------------
YIOC_SCHPO/1-796--------------------------------------------------------------------------------
Q2GWB4_CHAGB/1-825--------------------------------------------------------------------------------
Q0UAJ2_PHANO/1-733--------------------------------------------------------------------------------
B8M9N3_TALSN/1-838--------------------------------------------------------------------------------
C5FVH3_ARTOC/1-827--------------------------------------------------------------------------------
C0NTS7_AJECG/1-843--------------------------------------------------------------------------------
B6HUK2_PENRW/1-841--------------------------------------------------------------------------------
Q5ASC1_EMENI/1-732--------------------------------------------------------------------------------

PF09742

F4WRP0_ACREC/1-730............CIENMTEKESAHPLSPSVSIDINK....................LITNHSERESKTEDIAEESM....
E9H938_DAPPU/1-832............GIEKITEQETAHPSLQQLSQLTGAAVAVNGALENITVSHEIEERATALVQGEEDDEDNSSEVAD....
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859............DIGQMTEREQAHLDYD.......................KPSSSSPVSTKSKSPTADGSPTDQS....
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769............GIGQMTEKEPAHPSYQNEQLLTNGMASI..............TMNTPTASTPEEPTNDNSEQKL....
H3BX91_TETNG/1-768............GIDKITEKAQVSEEGTMVSVSVPP..........................PAAAGTSDTESNSD....
F7D5K7_XENTR/1-770............GIEKLTEKSQVSEDGTLRAVDPEV...................PLSPGETSPAHPQSDTESHSG....
H2SJN1_TAKRU/1-774............GIDKITEKAQVSEEGTMVSVSDVP...........................PSVGTSDTESNLD....
B3RQA8_TRIAD/1-734............SMKKKTKKIKKSPRFDSVSPD...............................................
I3JLL2_ORENI/1-646................................................................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762............DLGNLVSQVHSERAEKQSPQSRQSEAEN..........SEVEANRASPYYPESPDATNHTNHEE....
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725................................................................................
I3KNU8_ORENI/1-782............GIDKITEKSQVSQDGTMVTLPHSD..................SPHTSTKSGIAAGASDSESNSE....
I3JCX3_ORENI/1-776............GIDKLTEKSQVSEDGTMVSVPKTD.................SPNTVHPDHSAVTGTSDTESNSG....
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436.................DEDAAAERAAELKALPGTA............................................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729..............EKQEEEQSSNG.......................................................
Q5CRW2_CRYPI/1-755................................................................................
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826............GIDKLTEKSQVSEDGTLRSLEPES...........................PQNSADGSPAKGE....
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808.......IGLKAGPEEKGERVTASQAVLRQSPGPSQAQTASSRGQGSPQAEEARAPSGAAGDEALIPL............
H2MFX7_ORYLA/1-772............GIDKITEKAQVSKDGTMVTVPHSP.......................CDGSAIDGASDTESNSE....
B7S488_PHATC/1-694................................................................................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035............AIRSMTDRLLANAAGSTSGDFHSSDGATHPLEDALISHLSPSRRFRSLSDNSSPPKLTSYPHESGDGL
M4AQZ4_XIPMA/1-781............GIDKITEKSQVSEDGTMIALPRSS..................SPATPPHRGAINGASDTESNSE....
E0VG76_PEDHC/1-766............GIEKMTEQESAHPVNSVSQQS.................QIITNHTIENIPNKSDTDDDIFSNEK....
B4MQL1_DROWI/1-832............GIGQMTEREQAHPTDKEEPLATDV...............VPYEKSPTPEPNKSGRKSTSPTDQT....
HID1_DICDI/1-880............TTEHPNSTGATPSSTNSGTPTIKAFSSTTPNQESPKLGGDGIDSQSSTPNKQQLPPPPPQQTKK....
W4XTN1_STRPU/1-721............AALQRTGSTSSSAAASVA..................................................
T1K251_TETUR/1-842............KIHNMTETTHPNPTGDPEEL................................................
T1I7V2_RHOPR/1-802............GIEKMTGRESAHMSRSPIEEDVPDAAGD..........SVASELSVSNASNENNKGDGSSCESE....
Q7QGJ8_ANOGA/1-825............NLAQITERESAHPTDLASPTSPDE..............EEPEANGATRKGADEPSSK...........
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736............GVMKITERESAHPGNLTLPAELVTSNGM........................................
Q17L03_AEDAE/1-819............DITQMTERESAHPSGEATTPSPVEPNAKTPVGD............TDRAPKVSPSKE...........
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876............NLAQITERESAHPTSPDSIAAGAAAIATTPTKDDEGSEENDDGAGSPKGGNSSPSK............
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849FTYPVLAPYFCAGIEKLTEKSQVSEDGTMRSVETDS...................LQTSTESTSPAIASDTESLSG....

PF12722

C4XYD9_CLAL4/17-927--------------------------------...................FNSSTASIGPEERDESFTEEKELENALRP
A3LX71_PICST/1-905--------------------------------.............................PEESQQSDAEEELEASLRP
Q6BSE0_DEBHA/1-924--------------------------------............................EFDLNFFEDESQAIDSALRP
C3Z701_BRAFL/1-784--------------------------------...............ADTPGAAGPSPSDTETSVQPDLRGAVKRTASMS
Q0E9B5_DROME/1-834--------------------------------.........STDIVPYDRSAASTPTDERKSTSPTELSRLSVAHRASIR
B0WUT2_CULQU/1-851--------------------------------ATPSPVEPNAKSAIGGDGVKSGSSP