Sequence alignment for CL0456

PF12722

Q2GWB4_CHAGB/1-825MGASDS-------------------KLV..FKKGI-------FRLSEE................................
B9W786_CANDC/1-930MKTTEE-------------------KAK..FRNQF-------LKLGQG................................
B6JW01_SCHJY/1-778MGAQES-------------------KLC..FRRAV-------LRL...................................
C3Z701_BRAFL/1-784MGNSDT-------------------KLN..FRKAV-------IQLTTK................................
A7TNQ6_VANPO/1-1209MGNTDS-------------------KLNVLYRDHV-------FRLSGY........FDGIIPLFSKNTNLNELIDLY...
A6RRS3_BOTFB/1-641MGASDS-------------------KLV..FKKGI-------FRLSED................................
B6HUK2_PENCW/1-841MGASES-------------------KLV..FKQGI-------FRLSEE................................
Q3UU20_MOUSE/1-784MGSADS-------------------KLN..FRKAV-------IQLTTK................................
Q5ASC1_EMENI/1-732MGASES-------------------KLV..FKQGI-------FRLSEE................................
C4XYD9_CLAL4/17-927MKTAEE-------------------KIA..FKNSF-------FKLGQG................................
C5K8E7_PERM5/1-865MGNSES-------------------RAL..VSDYL-------DELGQC................................
B8M9N3_TALSN/1-838MGASES-------------------KLV..FKQGI-------FRLYED................................
C5FVH3_ARTOC/1-827MGASES-------------------KLV..FKQGI-------FRLSEQ................................
A3LX71_PICST/1-905MKTADD-------------------KLR..YKNHF-------FKLGQG................................
A8WRZ4_CAEBR/1-727MGAQGS-------------------RVD..FKQAV-------LDLTSK................................
Q0E9B5_DROME/1-834MGNTDS-------------------KLN..FRKAI-------VQLTQK................................
C0NTS7_AJECG/1-843MGGSES-------------------KLA..FRQGI-------FRLSEE................................
YIOC_SCHPO/1-796MGSQQS-------------------KLD..FRNAV-------LRLHEE................................
A8NNK7_BRUMA/1-721MGNSGS-------------------KIN..FRKAV-------VELTTK................................
C5DS55_ZYGRC/1-1145MGNTDS-------------------KLSSLYRDHI-------LQLAGV................................
Q0UAJ2_PHANO/1-733MGASDS-------------------KLT..FKQGI-------FRLSEP................................
B0WUT2_CULQU/1-851MGNADT-------------------KLN..FRKAI-------VQLTSK................................
A7A1V5_YEAS7/1-1223MGNTDS-------------------KSSSILLNHC-------IALVRPEDASASSP........SRTSSPSPSLSVDADP
A7RKV1_NEMVE/1-693MGGTES-------------------KLN..FRKAV-------VQLTTK................................
C5DFL0_LACTC/1-1131MGQSDS-------------------KLTQ.YRDHI-------FQLADP..........GVLPLYSPSAHPRDIIRCYNDP
Q6FK58_CANGA/1-1248MGNTDS-------------------KLNSLYKEHL-------LKLARPEITSIDNSQNGVICLFNPEYSLREIIDLYNN.
Q6DGD7_DANRE/1-801MGNSDS-------------------KLR..FRKAV-------IQLTTK................................
Q6BSE0_DEBHA/1-924MKTAEE-------------------RLR..FKNHF-------FKLGQG................................

PF09742

DYM_DROME/1-676MGINVS...................RTADLGSNQW.......LQRFVG--------------------------------
B0WBZ3_CULQU/1-681MGMNVS...................RQVDLAENEY.......LKRFVG--------------------------------
DYM_XENTR/1-646MGANSS...................TIKELSENEF.......LKKLSG--------------------------------
A7RPK6_NEMVE/1-620MGARPS...................SISDLQHNAV.......LKKLTG--------------------------------
C3Z701_BRAFL/1-763MGNSDT......................KLNFRKA......VIQLTTK--------------------------------
A7RKV1_NEMVE/1-672MGGTES......................KLNFRKA......VVQLTTK--------------------------------
Q3UU20_MOUSE/1-763MGSADS......................KLNFRKA......VIQLTTK--------------------------------
Q6DGD7_DANRE/1-780MGNSDS......................KLRFRKA......VIQLTTK--------------------------------
Q7Z135_CAEEL/1-705MGAQGS......................RVDFKQV.........VLDV--------------------------------
A8NNK7_BRUMA/1-700MGNSGS......................KINFRKA........VVELT--------------------------------
B7S488_PHATC/1-694MGQSAS......................KEKFRES........VTALI--------------------------------
Q6C5S1_YARLI/38-656SPCTRDLGSGHLTTLNIPTCTSMGQTESKQTFRTE.......IFRLST--------------------------------
Q4CSH4_TRYCC/1-696MGGAQA...................KEAVQYFTDV............A--------------------------------
C1FEV8_MICSR/1-966MGAGSS...................TAAAAYARCK.DDVDANLARLSD--------------------------------
Q5CRW2_CRYPI/1-761MGSSIS...................KDKDNSLPQN.........CLRF--------------------------------
B6A9V3_CRYMR/1-807MGSSIS...................KEGPVFLLEN...SFRLINGLLG--------------------------------
A2ETH4_TRIVA/1-444MQD.............................................--------------------------------
Q01H67_OSTTA/7-725DGVDDDARRARRGLKARETVMESERRTSTSGRESASELRRGLKAMCEA--------------------------------
A4RQD6_OSTLU/1-676MCETRD..........................................--------------------------------
A2ZYB0_ORYSJ/1-682MGAAPS.........TPRLGAVAGAAASPGAAEQM.......FAALVG--------------------------------
Q8RWV1_ARATH/1-679MGGVPS..............TPRKTGGDDVSVAEY......LIATFVG--------------------------------
B9RTK0_RICCO/1-498MLVAMS....................................TQLLYG--------------------------------
B3RI35_TRIAD/1-583MTAVQK...................RTWRSQFDRS.............--------------------------------
A8WTE9_CAEBR/1-690MGSVIT...................KETILQDNVY.......LKKLSG--------------------------------
A8Q618_BRUMA/1-661MGAKIS...................SETLIEENTY.......LRRFVG--------------------------------

PF12722

Q2GWB4_CHAGB/1-825.............RHI..PA...............GDA...Y--WSSFW....ELPESPEDIFS.LFTPADVRRTRDNAL
B9W786_CANDC/1-930.............HII..ST...............DESNNIF--WSSFW....TMPTCANDVYE.LITVADIKKVRQQNL
B6JW01_SCHJY/1-778.........................................Y--EERFW....RFSNTAKDVFN.LLPLKDIRKTRDLAF
C3Z701_BRAFL/1-784.............TQPVEAQ...............DEA...F--WDQFWT...DSVTSVQDVFA.LVPAAEIRALREESP
A7TNQ6_VANPO/1-1209.............NSKVIPD...............DSKFDQF--YLEFVA...VGTDLTFEMLNQIINNEEMRNIFELNP
A6RRS3_BOTFB/1-641.............KII..PA...............DDP...Y--WASFW....ELPESTEDIFS.LFSPADIRRTRDTAL
B6HUK2_PENCW/1-841.............QEI..PA...............DDP...Y--WTRFW....ELPESTEDVFS.LFTPADIRRTRDHAL
Q3UU20_MOUSE/1-784.............TQPVEAT...............DNA...F--WDQFWA...DTATSVQDVFA.LVPAAEIRAVREESP
Q5ASC1_EMENI/1-732.............KEI..PP...............DDP...Y--WARFW....ELPESTEDVFS.LFTPADIRRTRDHAL
C4XYD9_CLAL4/17-927.............RLM..DH...............GDVA..F--WSIFW....NTPQSASDIYD.LLTPFDLQTVRDQNL
C5K8E7_PERM5/1-865.............DLAVDAE...............AAP...M--KEEFWTTIFDTPLSIEEIFE.IITPEWVRNLRDEKP
B8M9N3_TALSN/1-838.............QNI..SA...............DDP...F--WIKFW....ELPESTEDVFS.LFTPTDIRRVRDSSL
C5FVH3_ARTOC/1-827.............ANI..PP...............DDQ...Y--WTGFW....ELPESVEDVFS.LFSPVDIRRTRDTSL
A3LX71_PICST/1-905.............RVI..AG...............NDSD..Y--WKVLW....TEPDNSDDIFE.LLTSYDIRTIRDQNR
A8WRZ4_CAEBR/1-727.............PGKDDEQ.....................F--WDQAW.....WPDTVNDIFA.MIPGEDIRKLRDESP
Q0E9B5_DROME/1-834.............NQKIDPS...............DEQ...F--WEQFWQ...GHQTTLEDVFA.LVTSSEIRQIRNENP
C0NTS7_AJECG/1-843.............SNI..AA...............DDP...Y--WTGFW....ELPESPEDVFS.LFSPADIRRTRDASI
YIOC_SCHPO/1-796.............RNI..PK...............FDL...I--WERLW....TLPETTEDVFH.LMSIDDLTKVKDNAP
A8NNK7_BRUMA/1-721.............KSKVE.................EDA...F--WEELCA...SNINSAADIFS.LITADDVRSLRDNSP
C5DS55_ZYGRC/1-1145.............TIPLRDD...............NGEFSQF--YRDFI....AGGNFTMEMFNHLVSPNELRGICRNNS
Q0UAJ2_PHANO/1-733.............KQI..PA...............DDV...Y--WTGFW....ELPESTEDVFS.LFSPADIRRTRDNNL
B0WUT2_CULQU/1-851.............SQPIDAS...............DDA...F--WEQFWC...EHSTTVQDVFA.LIPSNEVRKVRDVMP
A7A1V5_YEAS7/1-1223LSLNLSIF.....KLDSGPD..VEALFSDKPNVPLDTVFNDF--YLDFI....SVDVQDFSINSSF..KKILHIISSLNP
A7RKV1_NEMVE/1-693.............KSAAEPN...............DDA...F--WDQFWS...ESAATISDVFT.LIPAAEIRNLRDENP
C5DFL0_LACTC/1-1131LSQNGLTGEVEDGAGDALPD...............EELFSPV--FSAFA....SSDAEARDVYS.VVSTQELRLIFQSNQ
Q6FK58_CANGA/1-1248.............RGNITPDKSLKHTSDNHSTSIEDNLFTDY--YKNFL....KFDFQKIDNFNDLISKDELRTIYKNNK
Q6DGD7_DANRE/1-801.............TQPVEAS...............EDV...F--WDQFWN...DIDLMAQDIFT.LVPAAEIRAVREESP
Q6BSE0_DEBHA/1-924.............RLI..PS...............SDST..Y--WDAFW....KEPETTSDIYE.LITPYDIRTIREQNR

PF09742

DYM_DROME/1-676-------------RQHIAHD---------------DEA---F..WNGLLNYNIVLPENSQDQLN-.LDSRLEALCQSFIG
B0WBZ3_CULQU/1-681-------------RDHVPAY---------------NDD---F..WNSFLQYHINLPTNSQEQLS-.LDSRLESLCQSFIA
DYM_XENTR/1-646-------------TDSIS.E---------------NEP---F..WNQLLSFSFSTPTNSADSKL-.LEEGTLSICKSLIE
A7RPK6_NEMVE/1-620-------------ELSVG.D---------------DEE---F..WDELLSFSFRVPYNSADARL-.LEEATEPICQHLAQ
C3Z701_BRAFL/1-763-------------TQPVEAQ---------------DEA---F..WDQFWT...DSVTSVQDVFA-LVPAAEIRALREESP
A7RKV1_NEMVE/1-672-------------KSAAEPN---------------DDA---F..WDQFWS...ESAATISDVFT-LIPAAEIRNLRDENP
Q3UU20_MOUSE/1-763-------------TQPVEAT---------------DNA---F..WDQFWA...DTATSVQDVFA-LVPAAEIRAVREESP
Q6DGD7_DANRE/1-780-------------TQPVEAS---------------EDV---F..WDQFWN...DIDLMAQDIFT-LVPAAEIRAVREESP
Q7Z135_CAEEL/1-705-------------TSKPGKD---------------DET---F..WDQAW.....WPDSVNEIFA-MISGEDIRKLRDESP
A8NNK7_BRUMA/1-700-------------TKKSKVE---------------EDA---F..WEELCASNIN...SAADIFS-LITADDVRSLRDNSP
B7S488_PHATC/1-694-------------QVDVSAD---------------DAD---F..WDELWK....IPSSAEEVFE-LLPARSARKLRDDRF
Q6C5S1_YARLI/38-656-------------DSSIPES---------------DTI---F..WSKLW....MVPENASDIFT-LVGENDVRMALQTFP
Q4CSH4_TRYCC/1-696-------------CAEADPE---------------EKE---F..VERLTRYKKDICFGAE....-.YFGASLPVLRELVP
C1FEV8_MICSR/1-966-------------PDPTTPD---------------DPT---...WDELLRFPAAITSASDADLD-VVLGRVDFGSIAPGT
Q5CRW2_CRYPI/1-761-------------IEPFLQK---------------ENI---RTNLSLLNELQKLIITPIEDNSF-ADQFIFEHISSKLFV
B6A9V3_CRYMR/1-807-------------QNTVD.D---------------EDP---I..WEKMKSEFILPPIAPNILDN-YIY...EHISTTLFE
A2ETH4_TRIVA/1-444-------------......D---------------QDP---AILLQKLGTKIIQFRTIPKNFPI-LLHAFSEKLLTSSSK
Q01H67_OSTTA/7-725-------------TRETPDA---------------MDV---F..WYELGNASSEPLTAMSERT.-.LDEMLRPYGRSLYA
A4RQD6_OSTLU/1-676-------------..ATPEI---------------TDV---F..WYEIGNAVSEPMTSVSERT.-.LDEILRPYGRALFV
A2ZYB0_ORYSJ/1-682-------------GKAYP.I---------------SSE---F..WRQLLELPLTQQWPRD....-....RVLQACHAFAQ
Q8RWV1_ARATH/1-679-------------EKSFP.L---------------ASD---F..WNKLLELPLSSRWPSD....-....RVQQACELFAQ
B9RTK0_RICCO/1-498-------------PSPGPTD---------------MNP---F......................-.IDAAMV........
B3RI35_TRIAD/1-583-------------.......---------------...---.....TLFLYQFEVLREETIVRQ-FLSSPRNPQIRFIHE
A8WTE9_CAEBR/1-690-------------LEPVD.D---------------YDP---F..WNKLLSFSLKFDDDDEKTRI-ALESALDDHLQCLMY
A8Q618_BRUMA/1-661-------------LQPIS.D---------------NDP---F..WNHFLSFNFLIDSNNRKEVE-QFDISLSDSLQSLMY

PF12722

Q2GWB4_CHAGB/1-825ENLESLIQAVTNRLFMLRHH.PSFPDP...........EIAPDR..E-------------------------ALNCLRVL
B9W786_CANDC/1-930MNIVQLIRQLCLKIISTVKECKEFCI............NKKEII..E-------------------------LLNCVRFL
B6JW01_SCHJY/1-778ENLQTLIILLCHRIIACSSD.PNLVEP...........SNVLVT..Q-------------------------LLNAVRIL
C3Z701_BRAFL/1-784SNLATLCYKAVEKLVMAAES.SCA..............TAKEQQ..T-------------------------VLNCVRLL
A7TNQ6_VANPO/1-1209INYLNLTRFTALQIHLLTNS.LNVP...........SLELLKFRFSR-------------------------ILVCIRVL
A6RRS3_BOTFB/1-641ENLETLILAITSRLFVLRHH.PSFPHP...........EFAPER..D-------------------------ALNCIRIL
B6HUK2_PENCW/1-841HNFQTLLLAVTSRLTVLKNH.PSFPDP...........DLAPER..D-------------------------VLNCIRIL
Q3UU20_MOUSE/1-784SNLATLCYKAVEKLVQGAEG.GCH..............SEKEKQ..V-------------------------VLNCSRLL
Q5ASC1_EMENI/1-732GNFETLLLSITSRLTTLKNH.PSFPDP...........DLAPDR..D-------------------------ALNCIRIL
C4XYD9_CLAL4/17-927PNFLLLVHIVACRVVELARD...................LSPTQHMP-------------------------LLNCLRLL
C5K8E7_PERM5/1-865YNMQFLLRRIIEKLEEVCAT.GLVQSEEDEG...SHELTQGQRS..E-------------------------ALQCVRLL
B8M9N3_TALSN/1-838ANLETLLLAICSRLIVLKNH.PSFPDP...........EFAPDT..N-------------------------ALNCIRIL
C5FVH3_ARTOC/1-827SNLETLLLAICSRLVALRHH.PSFPDP...........EIAPAK..D-------------------------ALNCIRIL
A3LX71_PICST/1-905VNYLVMIHVLCNQIIATARD.SEFPS............SKSPLSIRQ-------------------------LLTCIRLL
A8WRZ4_CAEBR/1-727KNLATLVYKAVEKIQFSRHH.P................ANIDQK..K-------------------------VINAIRLL
Q0E9B5_DROME/1-834ANLATLCYKAVEKLAQAVDS.SCR..............TQAEQQ..C-------------------------VLNCVRLL
C0NTS7_AJECG/1-843ANLETLILAVTSRLIVLKNH.PSFPDP...........DLAPDR..D-------------------------ALNCIRVL
YIOC_SCHPO/1-796ENLQTIIAVLWDKLEDLQKE.TLFDDP...........AAPTTK..C-------------------------ALNCMRLL
A8NNK7_BRUMA/1-721SNLAALCYKTVDQITTACNS.P................SAISST..K-------------------------VLNCIRLL
C5DS55_ZYGRC/1-1145VNISNLVQFVSLTIIEITKS.LIDEEEQGVPLSSPSSISLLEMKLTD-------------------------LLVCIRIL
Q0UAJ2_PHANO/1-733ANLETLILAVTSRLNVLRNH.PSFPDP...........ELAPER..D-------------------------ALNCIRVL
B0WUT2_CULQU/1-851TNLATLCYKATERLVRAVDN.SCR..............TQGEQQ..T-------------------------VLNCVRLL
A7A1V5_YEAS7/1-1223PNFNNLIVFLSLYIILSANS.L..............PASRTGLHSSR-------------------------LINAIKTL
A7RKV1_NEMVE/1-693SNLATL........................................S-------------------------RVFCVRLL
C5DFL0_LACTC/1-1131ANFISLVRFFAFKIHALACQ.LQHCD..........DVDEFRARRAE-------------------------LLSSVRIM
Q6FK58_CANGA/1-1248ENYLNLIRFVILKIILIPSI.FGNTQNKS.......SFNKL...FKQ-------------------------LLTCIKIL
Q6DGD7_DANRE/1-801SNLATLCYKAVERLVLNADS.GCV..............CERDRQ..T-------------------------VLICTRLL
Q6BSE0_DEBHA/1-924ANFVLMIRVLILRLTYLAQH.ENFPS............KDAPVS..E-------------------------LLNCIRFL

PF09742

DYM_DROME/1-676NNLKTGNFGSLVTVFLEKT.----------......SELLSLSDQES......NMHVWQ.............TFNALFII
B0WBZ3_CULQU/1-681HNLSSGNFGSLFNVFLVKV.----------......SELLALSDAES......TVHIWQ.............AFNALFII
DYM_XENTR/1-646NNPRTGNLGALIRVFLSRT.----------......KELKISAECQN......QLFIWQ.............AHNALFII
A7RPK6_NEMVE/1-620NNLTSKNFIFLVRVLLSRI.----------......SELKNSDKAED......SDFLVQ.............LYNALLLK
C3Z701_BRAFL/1-763SNLATLCYKAVEKLVMAAE.----------......SSCATAKEQQT.........................VLNCVRLL
A7RKV1_NEMVE/1-672SNLAT.....LSRVF.....----------.............................................CVRLL
Q3UU20_MOUSE/1-763SNLATLCYKAVEKLVQGAE.----------......GGCHSEKEKQV.........................VLNCSRLL
Q6DGD7_DANRE/1-780SNLATLCYKAVERLVLNAD.----------......SGCVCERDRQT.........................VLICTRLL
Q7Z135_CAEEL/1-705KNLATLVYKTVEKLQFSRN.----------......HPATIDQKK...........................TINAIRLL
A8NNK7_BRUMA/1-700SNLAALCYKTVDQITTACN.----------......SPSAISSTK...........................VLNCIRLL
B7S488_PHATC/1-694ENLATLFTQAVAQLCQIVE.----------......TPYNIYFDQ...........................ALNCVRVL
Q6C5S1_YARLI/38-656DNIAT.....LVRVVSQQI.----------......INCDDTTPEPQ.........................LLNCIRVL
Q4CSH4_TRYCC/1-696LCVKTQRVRWLFSFCLQQLE----------H.....ASCNYNQGHSDA........................FIATLHIT
C1FEV8_MICSR/1-966LDALLERAAAALRRCSRSDV----------AGSNPSRGDVANEDRAD........DAWTAAINATTLATRALRRCSRDTL
Q5CRW2_CRYPI/1-761RNATSGNFRSLTLFFIEILL----------EKE...RELYISIESNRFQYDRLIT.................SINHLIGL
B6A9V3_CRYMR/1-807TNKSSGNLRRLTLFFTKLLS----------SSR...KDILMNLEKDMSSLLPCPSTYST.............LISTALLL
A2ETH4_TRIVA/1-444NDP.................----------......NQVKITEDFQG............................SVYIL
Q01H67_OSTTA/7-725KNARSGGLYKLVRHAATQI.----------......GAAGAHATPVS.........................AINVTVLA
A4RQD6_OSTLU/1-676NNARNGGLYKLAKHAARQL.----------......SVASGNARSTPVS.......................AINVTLLV
A2ZYB0_ORYSJ/1-682NNYHTKHLAKILIHLVWCL.----------......QECMAESSHAAYRK......................AINAAYIS
Q8RWV1_ARATH/1-679SNGYTRHLAKLLIHLSWCL.----------......QELLQASDDQSSLYKK....................AVNATYIS
B9RTK0_RICCO/1-498....................----------..................................................
B3RI35_TRIAD/1-583TKEDSVNKKKV.........----------......SECDDERKKET...........................NVAKLT
A8WTE9_CAEBR/1-690NTQTTGNFAAFIRLFLRRA.----------......TELKTSEQCENENSCFSKIYLWQ.............TSNALLIL
A8Q618_BRUMA/1-661NTPTTCNFASFIHVLLRRT.----------......AELKASEIYNN......TIFLWQ.............TGNALIIL

PF12722

Q2GWB4_CHAGB/1-825TRVLP--FIYE.KESLQQWED..QLFWSPRRKPTRKSS.IANEVLFDGGQDVQPKPP...........VEEF--------
B9W786_CANDC/1-930IKVLP--FIFEMADYSNELER..EIFWNNDFDPMRLLQRIDNSKEEEEEEESDKNRNWERL.......LSPD--------
B6JW01_SCHJY/1-778TRVLP--VVFE.TEIGSSWIE..SVFWTINDKNKR.....................................--------
C3Z701_BRAFL/1-784TRILP--YIFE....DADWRG...FFWSTLPG....................................QAED--------
A7TNQ6_VANPO/1-1209TKLMP--LYFELQLNNKDVPNIADIFWTNDPKVLFGIDDDS...........................LDPD--------
A6RRS3_BOTFB/1-641TRILP--YVYE.AEKLQSWEE..TFFWGVRRKRTRKAA.LARDVIFDESQEELQKLEAA.........AQEF--------
B6HUK2_PENCW/1-841TRLLP--YVYE.AEHLEQWED..NFFWARRKRRTRQSQ.IAGEVLFDEAQPEDNQEATSPR.......AEDY--------
Q3UU20_MOUSE/1-784TRVLP--YIFE....DPDWRG...FFWSTVPGAGRGG..............................GEEED--------
Q5ASC1_EMENI/1-732TRLLP--YIYE.AEHLEQWEE..KFFWTRRKKKTREAQ.LAADVLFDESQVEEVRDRASPR.......VNEY--------
C4XYD9_CLAL4/17-927AKVLP--YLFELPDYAETIEN..PLFWERNFNPRDFFNQPAAPALVLPRNS.................SFAD--------
C5K8E7_PERM5/1-865TRIAP--FLLE....DVDAENCLALLWHSGGLVVRNRG..ESVVVEPASPSVEEAAGDDGSSVTSSVEDVAD--------
B8M9N3_TALSN/1-838TRILP--FVYE.ADHLEEWEE..QFFWAPRKKKTRQAQ.VASEVLFDEAQGETDNAQTQPR.......VDGR--------
C5FVH3_ARTOC/1-827TRLLP--YIYE.TDNLEEWED..EFFWRRRRKLSRKAQ.LSSRVLFDESRHEDDEEEGNGQTGRRGVAREDY--------
A3LX71_PICST/1-905VKLIP--FLYEIPEYTQEIEP..RLFWVENFDPLVFIKPSTFASLSSSTSQPC...............LTKE--------
A8WRZ4_CAEBR/1-727TRITP--YMLE....DAEWRG...YFWSPIPH.......................................G--------
Q0E9B5_DROME/1-834VRCLP--YIFE....DEKWRD...FFWSSLPS.......................................Q--------
C0NTS7_AJECG/1-843TRILP--FIYE.SENLEAWEE..KFFWGRRRKKHRHAQ.IASQVLFDGASEDDEMRRSNPQD.....HQNDY--------
YIOC_SCHPO/1-796TRLMP--IIFE.DKSMLEWFD..YFAWTVPKDPNINT...................................--------
A8NNK7_BRUMA/1-721TRVCP--YLFE....DSDWKC...FFWS.LPSAE..................................ENEQ--------
C5DS55_ZYGRC/1-1145TKVYP--VHLS........TGKENWLWNHNEDAIVP....................................--------
Q0UAJ2_PHANO/1-733TRLLP--FLYE.EDRLEQWED..DFFWATRRKRSRRGQ.VRSEVIFDEADPEQTPTQQ..........EPEF--------
B0WUT2_CULQU/1-851NRVLP--YIFE....DAQWKD...FFWSSLPAGN..................................EKEE--------
A7A1V5_YEAS7/1-1223SILIP--IYFD..RVKSSTQDHYDVFWATQHEI...................................EGLP--------
A7RKV1_NEMVE/1-693TRFIP--YIFE....DPDWRG...FFWSTIP.....................................SQEP--------
C5DFL0_LACTC/1-1131TKIMP--VFFE.MDTDQSLED..SLFWSRDSSQALQCGELPAPVVVPKLNVNHA..............PTES--------
Q6FK58_CANGA/1-1248TKLVP--VYLE.....NIVNGEKDILWDTSPDALFGEHIPDTDLIPVSMTSALKTSLDMPTAD.....LASP--------
Q6DGD7_DANRE/1-801TRILP--YIFE....DPDWHG...FFWSTVPKLGKSVD..............................EGEE--------
Q6BSE0_DEBHA/1-924TKLLP--FVFELPEYCSELDD..ILFWSETFDPMTVATGSSLNNIQTPVSVLGGEKENEKT..........V--------

PF09742

DYM_DROME/1-676RSLVK..YINE..TGSEFQLL--QHFEAMPNA................................................
B0WBZ3_CULQU/1-681RCLVK..YMIE..TGSEYQLL--QHFEALPVQ................................................
DYM_XENTR/1-646CRLIK..VFTS..QISEEELL--LHFTYRPAD................................................
A7RPK6_NEMVE/1-620RSFCK..YFVE..........--.........................................................
C3Z701_BRAFL/1-763TRILP..YIFE.....DADWR--GFFWSTLPG.........QAED...................................
A7RKV1_NEMVE/1-672TRFIP..YIFE.....DPDWR--GFFWSTIPSQEP.............................................
Q3UU20_MOUSE/1-763TRVLP..YIFE.....DPDWR--GFFWSTVPGAGRGG.G..EEED...................................
Q6DGD7_DANRE/1-780TRILP..YIFE.....DPDWH--GFFWSTVPKLGKSVDEGEE......................................
Q7Z135_CAEEL/1-705TRIVP..YLLE.....DAEWR--GYFWSPIPH.........G......................................
A8NNK7_BRUMA/1-700TRVCP..YLFE.....DSDWK--CFFWSLPSAEENEQ...........................................
B7S488_PHATC/1-694TRMLP..FLLE..KGTQSNIY--IGLVTSDEQ.........E......................................
Q6C5S1_YARLI/38-656TRVLP..IVFE..SGTKTFDD--DLFWSNDILGE..............................................
Q4CSH4_TRYCC/1-696EFVVR..YAHQVSRGDAAQLL--DIIMGKAPH................................................
C1FEV8_MICSR/1-966RFLCRRRRQIANDDDDAPDES--GGVATAEPAVCDFMAAVVDVVAGCADERAPRGCHVYALRVACCRSLEAIADEYSTAD
Q5CRW2_CRYPI/1-761GIVIKFIIIHYLKNFGIDELI--KSAEHTQYI................................................
B6A9V3_CRYMR/1-807RSIIR..HYTQ..KFSLSNLL--LQIEHDYLNFDNESLDT........................................
A2ETH4_TRIVA/1-444CKLAI................--.........................................................
Q01H67_OSTTA/7-725GTFIK..YFIEFASESGGTTV--GVQALGGARS...............................................
A4RQD6_OSTLU/1-676SIFIK..YFIEFASEGDGGFG--GVAALGGGRS...............................................
A2ZYB0_ORYSJ/1-682SIFLK..FIIE..NAKTDNWQ--ELSLEIDKD................................................
Q8RWV1_ARATH/1-679SVFLK..YLIE..NGKSDSLQ--ELHLSLDES................................................
B9RTK0_RICCO/1-498.....................--.........................................................
B3RI35_TRIAD/1-583DTIIS....VN......SEIR--DQ.......................................................
A8WTE9_CAEBR/1-690RYIAR..FLTQ..RMTEKEFV--RIFAKNQEN................................................
A8Q618_BRUMA/1-661RHICK..FLVQ..RLSETEFI--KVFHMDKTY................................................

PF12722

Q2GWB4_CHAGB/1-825------EDAKPLAEELIDTLLDLLFFSDLTVPKAP..........HGKPKVTYA--IWQSGVGCNTSIPT.......---
B9W786_CANDC/1-930------QVANSIAVNLISSLVDLLFIRNFTVPSTA..........SGKENKLLH--VWEPGIGGTSKYQQP......---
B6JW01_SCHJY/1-778------....ALGEQVMDSLLYLLFYVGFTIPAVD..........YKSKGVQLC--IWETGVGCNTLLTS.......---
C3Z701_BRAFL/1-784------GGSMPLAQSLLNALSDLLFCPDFTVAPNKKAGPETHEDLQSIDSCEY.--IWESGVGFAHSPAQ.......---
A7TNQ6_VANPO/1-1209------VTIEPLGLNLVKSCVNLLFVEAFTIPSNG...........SPGLVSDL--LWDNGINTQDAVYHP.....Q---
A6RRS3_BOTFB/1-641------EEVKPLAEELIDTLIDLLFFADFTLPKPQ..........NSKNKVSYA--IWQSGVGCNTPVGT.......---
B6HUK2_PENCW/1-841------EDVKPLAEELIDTLVDLLFFADFTIPRLP..........TVKSKVSFS--IWQSGVGCNTAMGS.......---
Q3UU20_MOUSE/1-784------ENARPLAESLLLAIADLLFCPDFTVQNHRRNDVDSAEDVHSLDSCEY.--IWEAGVGFAHSPQP.......---
Q5ASC1_EMENI/1-732------EDVKPLAEELIDTLMDLLFYTGFTIPKLP..........SAKAKVSYS--IWQSGVGCNTSMGS.......---
C4XYD9_CLAL4/17-927------VSENVLGADLVLALVRLLVAQGFTVAEP...........YPESPPDMC--LWEPGICVPGKYHSP......---
C5K8E7_PERM5/1-865------LGRAPLMYRMLRALQWSLFLKDFTVLIPQ....GASLPLPTHRVDSRF--VWRGGIGTAKELPV.....NQ---
B8M9N3_TALSN/1-838------EDAKPLAEELIDTLTDLLFYTGFTIPKLA..........SSEGKVSYA--IWQSGVGCNTSMVS.......---
C5FVH3_ARTOC/1-827------EDVKPLAEELLDTLLDLLFFSGFTIPQVP..........ASKGKVVYS--IWQSGVGCNTAMGS.......---
A3LX71_PICST/1-905------SIHNVTAVQLMRALVDLLFIRTFTIDAP...........RSKSNKILS--VWEPGIGTSSKYLAP......---
A8WRZ4_CAEBR/1-727------DSTKPLAAVLLENLSDLLFCPEFTISHSN...GLKVNDLSTIDSCEY.--IWEAGVGSGNKPPM.......---
Q0E9B5_DROME/1-834------DKTMPLAQSLLNATCDLLFCPDFTVTATRRAGPEKAEELANIDSCEY.--IWEAGVGFAQSPPH.......---
C0NTS7_AJECG/1-843------YDAKPLAEELIDTLVDLLFYSGFTIPTIP..........NAKGKVSYS--IWQSGVGCTTAMGS.......---
YIOC_SCHPO/1-796------....PRGASFLNTVVDYLFLINFTIPAHN..........DLTHGVHYC--IWETGVVYHPTMLK.......---
A8NNK7_BRUMA/1-721------FPHQPLAYTLISALTDLLFCPEFTVSSLR.NHPGGSDDLSTIDSCEY.--IWEAGVGFATKPPQ.......---
C5DS55_ZYGRC/1-1145------......GFLLLKSLLKLSFVEGFTLPSVG...........KPGRITHL--LWENGVNTQDSSYDA.....Q---
Q0UAJ2_PHANO/1-733------ETAKPLAEEVIDTLIDLLFFSEFTLPKVP..........AGKNKVTYA--IWQSGVGCNTPVAS.......---
B0WUT2_CULQU/1-851------PTAAPLAQSLLNAICDLLFCPDFTVVGLRKSGPEKAEELNSIDSCEY.--IWEAGVGFAQSPPR.......---
A7A1V5_YEAS7/1-1223------LQNIPLGERLLLAILKLAFQDNFTTAVTA...........HPSE....--LWEIGILTNSNKYRSLLNMHH---
A7RKV1_NEMVE/1-693------EGQTPLAQTLLDALADLCFCPEFTVHPNKKAGPEQHEDLSSIDSCEY.--IWEAGVGFATSPPS.......---
C5DFL0_LACTC/1-1131------QAVVPLGVALLQACVKLLFMQGFTLPLSK.......PQLDELGKTSFL--LWENGINTSESNYRP.....P---
Q6FK58_CANGA/1-1248------HMERPLGAALLDSCLNLLFIEDFTVSSSS.......DTSQKTGDLTMI--LWENGINTYDTSYYT.....Q---
Q6DGD7_DANRE/1-801------ECTRPLAESLLSAVSDLLFCPDFTVESNFKTSADA..DIQSIDSCEF.--IWEAGVGFAQTPPL.......---
Q6BSE0_DEBHA/1-924------NKENILGVNIVKCLVDLLFIRSFTMDVPI......GDEGRSGSKRMMS--VWEPGIGTTAKYQTP......---

PF09742

DYM_DROME/1-676......ELLQAALEQQQQTPAESATIAMEATEQSAA......AAVPVIVDGSKFETFIDALVN.LIVVIPV.........
B0WBZ3_CULQU/1-681....................QDDADVEQGSEAVTVAVTGETRTALAKLIDGTKFETFLEALVN.IIVVIPV.........
DYM_XENTR/1-646......PGNYESD....................................TENLFEELLFCLIQ.LIVEIPL.........
A7RPK6_NEMVE/1-620..............................................MLPYCGITEDAICGLFD.ILISIPV.........
C3Z701_BRAFL/1-763......GGSMPLAQSLLNALSDLLFCPDFTVAPNKKAGP...ETHEDLQSIDSCEYIWESGVG.FAHSPAQ.........
A7RKV1_NEMVE/1-672......EGQTPLAQTLLDALADLCFCPEFTVHPNKKAGP...EQHEDLSSIDSCEYIWEAGVG.FATSPPS.........
Q3UU20_MOUSE/1-763......ENARPLAESLLLAIADLLFCPDFTVQNHRRNDV...DSAEDVHSLDSCEYIWEAGVG.FAHSPQP.........
Q6DGD7_DANRE/1-780......ECTRPLAESLLSAVSDLLFCPDFTVESNFKTSA.....DADIQSIDSCEFIWEAGVG.FAQTPPL.........
Q7Z135_CAEEL/1-705......DAAKPLAAVLLETLSDLLFCPEFTITHANG......QKIDDLSTIDSCEYIWEAGVG.SGNKPPM.........
A8NNK7_BRUMA/1-700......FPHQPLAYTLISALTDLLFCPEFTVSSLRNHP....GGSDDLSTIDSCEYIWEAGVG.FATKPPQ.........
B7S488_PHATC/1-694......PLALLVVHAAMHMLFLPQFTCDYYEDSSSTVAQ...RRRERVETKDDKELKADAGLK.VKTVDWG.........
Q6C5S1_YARLI/38-656......KLVTKLVSLLFNK..............................KLCGTSQIWEMGVGCHSVEGGV.........
Q4CSH4_TRYCC/1-696.......GTDGATTMQW................................TSTEANKVCCALMD.YCVSVPV.........
C1FEV8_MICSR/1-966DSKADSSSPLSTPSAPFANETDGEFDAFDVLMDAVDGCTAVDAGGDGRSGESIYRDVVAETLRLWSRRPPL....PRGSD
Q5CRW2_CRYPI/1-761..........NFVNDSNFTSEQLSELEKFILFKYNEVEGNNSSKLNLIKYVSKSSKFLKENEH.LLASFED.........
B6A9V3_CRYMR/1-807......GSINSQGTCPISKYLDKDFFDIY.............RTELKTLDLNYYKRFILFILSNISDRDPFMITH.....
A2ETH4_TRIVA/1-444................................................................VCHDCIP.........
Q01H67_OSTTA/7-725......ESLRNLAKTFEYDARWESVTASGASTR................ARSPFDDLMLACAN.TLGKKRV.........
A4RQD6_OSTLU/1-676......ERVRALAATFARDERWETGG................GPNASLENTSPFDDLLRACVD.VLCGKHV.........
A2ZYB0_ORYSJ/1-682.........................................EKGLENFPSEQSVEYFLMRGVLNYIGSVDV.........
Q8RWV1_ARATH/1-679.........................................EPVPHGFVMDQDIQNFVMHSVLSFIGSNEV.........
B9RTK0_RICCO/1-498................................................................................
B3RI35_TRIAD/1-583.................................................NLNDDEKDLQS....................
A8WTE9_CAEBR/1-690......ERTESSSTSSSDDEDDDDAQQTEGSDNNNGE.....TKEAQIVFQNTAEEFTYELVS.ILFNISV.........
A8Q618_BRUMA/1-661......LGKKDAYDSDFEEEFDGL.........................CENKAEELLDTLVD.ILVDLPS.........

PF12722

Q2GWB4_CHAGB/1-825------TREHESNRCEILRLLLTLAGHSLYLSPSV.L....PQQGTKALTYMCTN--SDKQVVLSVLCSLLNTTLKYNPA
B9W786_CANDC/1-930------NVVIDSNRTEILKLLLTLCSNSLYQQVSCVT.....THGSKFLTLLVTV--TPKIELLTLVSSLLNITCRSSKS
B6JW01_SCHJY/1-778------KHSYEQNKIEILLLLLVLFSETMYRE.........RSHSSSYLAYVISH--NNSDLSLSLLCSLLNTAMQFNTS
C3Z701_BRAFL/1-784------YPHHDQNRSEILKLLLTCFSETMYQPPG.......DPLPNQWLTYFASS--ENRH.ALPLFTSLLNIVCAYDPI
A7TNQ6_VANPO/1-1209------NPKYDSNRLEIINLLLSLSSKDLYLKQ...A....SKVQNLFLFSLSYL--VPEYDSICLISSLINVVCRHCTN
A6RRS3_BOTFB/1-641------SKEFENNRTEILRLLLTLTSQSMYMSANL.L....PVQGVKAITYIATC--PDKQVVLSVLCSLLNTTLKYNPA
B6HUK2_PENCW/1-841------NKTFESNRCEILRLMLTLTGKAMYLPSNT.L....PVQGVKAITYITTC--QDKQAVLTLLCSLLNTAMKYNPA
Q3UU20_MOUSE/1-784------NYIHDMNRMELLKLLLTCFSEAMYLPPSP.E....SGSTNPWVQFFCST--ENRH.ALPLFTSLLNTVCAYDPV
Q5ASC1_EMENI/1-732------TRELEDNRCEVLRLLLTITGKAMYMSSSL.L....PVQGVRAITYITTS--QEKQAVLTLLCSLLNTAIKYNPA
C4XYD9_CLAL4/17-927------NPIHDSNRTEVLRVLLVLASTTFYEKVSDTV.....RTGSRFLTFLVAG--LASSEINTLTANLTNILCRSART
C5K8E7_PERM5/1-865------NNEIMSARCEVLKCLLTVLSEPLFQPISS.Y....SSNPSRVLLTFCSG--DLPY.TANLYCSLMSTVVAYDPR
B8M9N3_TALSN/1-838------TKEHENNRMEILRLLLTLTGKSMYMSPTL.L....PVKGVKAITYLATC--SDKQIVLTLLCSLLNTTIKYNPA
C5FVH3_ARTOC/1-827------NKELESNRTEVLRLLLTITGQSMYMQPNL.L....PVKGVKSLTYLVTC--GEKKLVMSLLCSLLNTTIKYNPT
A3LX71_PICST/1-905------NLIIDSNRAEVLKLLLTLCSSTFYNTPSEVV.....SAGSKFMTLLVTS--TPRVELLTLVCSLTNLVCRSTRS
A8WRZ4_CAEBR/1-727------VALHYQNRSEILKLLLTCFSEVIYAPV...S....DENRLRWICHFTAV--TNPH.VLPIFTSLLNIVCAYDPV
Q0E9B5_DROME/1-834------NAHMERRRTELLKLLLTCFSEPMYRSPQ..Q....SEEPNKWIAYFTSA--DNRH.ALPLFTSFLNTVCSYDPV
C0NTS7_AJECG/1-843------NKELESNRCEILRLLLTLSSQSMYMPLSL.L....PVKGVKTITYLVTC--PDKQVVLSLLCSLLNTTIKYNPT
YIOC_SCHPO/1-796------ERSYELHRVEVLRLLLSLFSEEIYRT.........DGNGSSCCAYVASI--ANRRLVLCLLSSLINTAMRFNTM
A8NNK7_BRUMA/1-721------VAEHDQRRTEILKLLLTCFSEVIYVSI...S....DENRMRWIARFTSA--ENRH.VLPLFTSLLNIVCAYDPV
C5DS55_ZYGRC/1-1145------TARIDSNRLEIVNLLLALCSADLY............GLPNKFLVALCHL--APEYDVVCLVASIVNTVCRYCNN
Q0UAJ2_PHANO/1-733------TKEFESNRTEILRLLLTFASKSMYMSS......................--.......................
B0WUT2_CULQU/1-851------NGHMDARRTELLKLLLTCFSETMYRVPN..M....SDEPNKWIVHFTSA--DNRH.ALPLFTSLLNTVCAYDPV
A7A1V5_YEAS7/1-1223------QWHLFANRLLLLRLLAALFSSDLYTSGG.......KQDINMFLVYWCTQ--MPKDKSIQFTSSLLNCTMRFILN
A7RKV1_NEMVE/1-693------NAQFDCNRAELLKLLLTCFSEAMYLPPTPEN....HTRPNKWLCYFASS--ENRH.ALPLFTSILNTVCSYDPL
C5DFL0_LACTC/1-1131------SPKLDSNRLEVLRLLLTVSSKELY...........SNHIPKFLCVLTTS--LPEFHIICLASSLLNLVCRSCRN
Q6FK58_CANGA/1-1248------FVHLDANRLQIIELLLALVSIDIYLPVNSDGFKAKDKIKNKYLDYMKYE--AREHSVICLTASIINLFCRHSAY
Q6DGD7_DANRE/1-801------NYSHDSNRTEMLKLLLTCFSEEMYQSPS..D....THTLNPWVSFFCSR--ENRH.ALPLFTSLLNVVCAYDPI
Q6BSE0_DEBHA/1-924------NLIIDSNRMEVLKLMLVLMTTSVYSVPSQVV.....SNGSKFLTLLVAT--TPRVELLILVCSLMNLLCRSARS

PF09742

DYM_DROME/1-676......KEFTYHLHLEAVNMLITLLSVHLFAQQPTD........KSIVFRTVFKC.....QHANVLMSALLHFVARIVEV
B0WBZ3_CULQU/1-681......KEFTYHLHLEAVNCLIVLLSVSQFTQQGTE........KSNIFRTIYKC.....QHANTLMSALLHFLSRMTQV
DYM_XENTR/1-646......LDLTYSILLEAVTALIVLLSYQLFRKDILH........ESPIHRHLMKG..PCLPYTSRLVKTLLYNFIRQEKS
A7RPK6_NEMVE/1-620......NNQTYALHVETMNCVLVLLAVQMFDPNASS........NSIFYHTIMRG..KCAKMSGNIVHSLLQNFIQQMPT
C3Z701_BRAFL/1-763......YPHHDQNRSEILKLLLTCFSETMYQPPGDPL.......PNQWLTYFAS...SENRHALPLFTSLLNIVCAYDPI
A7RKV1_NEMVE/1-672......NAQFDCNRAELLKLLLTCFSEAMYLPPTPENHTR....PNKWLCYFAS...SENRHALPLFTSILNTVCSYDPL
Q3UU20_MOUSE/1-763......NYIHDMNRMELLKLLLTCFSEAMYLPPSPESGS.....TNPWVQFFCS...TENRHALPLFTSLLNTVCAYDPV
Q6DGD7_DANRE/1-780......NYSHDSNRTEMLKLLLTCFSEEMYQSPSDTHT......LNPWVSFFCS...RENRHALPLFTSLLNVVCAYDPI
Q7Z135_CAEEL/1-705......VALHYQNRTEILKLLLTCFAELIYAPVSDET.......RLRWVIHFTS...VTNPHVLPIFTSLLNIVCAYDPV
A8NNK7_BRUMA/1-700......VAEHDQRRTEILKLLLTCFSEVIYVSISDEN.......RMRWIARFTS...AENRHVLPLFTSLLNIVCAYDPV
B7S488_PHATC/1-694......VTLYDKNRIEVLRLVLTACCDPLFSPADEYNPL.....ASRWLAVATA...ADAPNACCLFFSLLNTILHYDPR
Q6C5S1_YARLI/38-656......TSAQEGNRCEILRLLVCCSCKQLYTSVNHVTTQ.....GSRFLTCIVSG..LGKSDTLLLLCSLLNLSLVRLLR
Q4CSH4_TRYCC/1-696......TYATAEAHNGVVSLLLSMNSSALYHSTTF.........DGKHMDVFTEIM.MSYEGLGAFIATLLKRLVEWGSG
C1FEV8_MICSR/1-966AWMHDPNDASGKPRGGFLGAMAALLLGDDDDDDDNGDDDK....GKDWDVSVFS...PLGDAAGAALTRLLHRPARYDGV
Q5CRW2_CRYPI/1-761......LSVFEQIFLNIPSFLV...CSQKYIDQSNS........LSEICNLLIS...LQNTLMDIMLVLFLPNVENHQHI
B6A9V3_CRYMR/1-807......NSDNSVIGELMIEICCYCICSQLYIDKISES.......NGKNYNMIH....SIYALQAIVMDILIVFFLNSTSE
A2ETH4_TRIVA/1-444......EDVFFLIFRTISALNLHFFSIS................KSEFSKFVTE...FPISFVEPLFDSLITHFFTLPVN
Q01H67_OSTTA/7-725......TTQTMALHTACARVLLITCSSQLAFDLTDVEAREM...GHPLAMSLLKLGASDSKMTGTLMCSLLRQIVARPPN
A4RQD6_OSTLU/1-676......TAQAMALHVACARLLLVATSSQLTFNLDDAEAREI...GHPLARRIAAIGSSDSRRTGVLMCALLRRVIERPPN
A2ZYB0_ORYSJ/1-682......SLESCYLHHELLNLMLVLMSTQLCSGPSPEPKD.....VHPFIDAAML...QDSSIVSSVVQKLLLNFVKRPRI
Q8RWV1_ARATH/1-679......SPNSYVLHQELLNFMLVTMSTQLLSGPSHGPTD.....ANPFIDAAMT...QEKSLVSLVVRRLLLNYISRHRT
B9RTK0_RICCO/1-498.........................................................QENSLVSSVVRRLLLNYIVRSRI
B3RI35_TRIAD/1-583......NNDIRLIPEETINIILSLLSAEIYNPK........TSCNSPFHKVIM....AQKSVAQNVVRSLLDNFTQQVPP
A8WTE9_CAEBR/1-690......NDTTLAIHVEAVRCLLTLLSSQLYNESIVN........TSIVFRFFIDG..ACAQHAAKLTKTLLLNYLIHNSE
A8Q618_BRUMA/1-661......NDSTETIHIEAVKCLMVLLSSQLYDDDVMK........SNIFYRYLMQG..KCSTRSLELSLALISNYLQRYTP

PF12722

Q2GWB4_CHAGB/1-825S....WRVPY.NALVLK---------------------------------------------------------------
B9W786_CANDC/1-930TASE.NGLVF.EKPEYS---------------------------------------------------------------
B6JW01_SCHJY/1-778FWKPRSVMSA.HLATHA---------------------------------------------------------------
C3Z701_BRAFL/1-784G....YGMPY.NHLLFS---------------------------------------------------------------
A7TNQ6_VANPO/1-1209FKNE.STLPY.TMVSSK---------------------------------------------------------------
A6RRS3_BOTFB/1-641K....WQVPY.NVQVFK---------------------------------------------------------------
B6HUK2_PENCW/1-841S....WRVPY.DHVVWK---------------------------------------------------------------
Q3UU20_MOUSE/1-784G....YGIPY.NHLLFS---------------------------------------------------------------
Q5ASC1_EMENI/1-732S....WRVPY.DHVVWK---------------------------------------------------------------
C4XYD9_CLAL4/17-927GLDD.SGLKY.DNSSLV---------------------------------------------------------------
C5K8E7_PERM5/1-865G....YGVPY.GSAFSS---------------------------------------------------------------
B8M9N3_TALSN/1-838I....WRVPY.DHVVWK---------------------------------------------------------------
C5FVH3_ARTOC/1-827P....WRLPY.DHVVWK---------------------------------------------------------------
A3LX71_PICST/1-905SPED.NALSYPSNSQLT---------------------------------------------------------------
A8WRZ4_CAEBR/1-727G....YGLPY.NYLLFN---------------------------------------------------------------
Q0E9B5_DROME/1-834G....FGVPY.NHLLFA---------------------------------------------------------------
C0NTS7_AJECG/1-843P....WRLPY.DHVVWK---------------------------------------------------------------
YIOC_SCHPO/1-796FWKP.EFLPLDNSVAHM---------------------------------------------------------------
A8NNK7_BRUMA/1-721G....FGVPY.NYLLFT---------------------------------------------------------------
C5DS55_ZYGRC/1-1145NEE..SSMPY.QNFSYK---------------------------------------------------------------
Q0UAJ2_PHANO/1-733..............VFK---------------------------------------------------------------
B0WUT2_CULQU/1-851G....IGVPY.NHLLFT---------------------------------------------------------------
A7A1V5_YEAS7/1-1223NNKDFQSLK..ANFFSS---------------------------------------------------------------
A7RKV1_NEMVE/1-693G....YGVPT.......---------------------------------------------------------------
C5DFL0_LACTC/1-1131NEEN.NGLNYPPNSYHT---------------------------------------------------------------
Q6FK58_CANGA/1-1248YKQE.GTNPY.KIIPKE---------------------------------------------------------------
Q6DGD7_DANRE/1-801G....YGVPY.NHLMFS---------------------------------------------------------------
Q6BSE0_DEBHA/1-924PVEE.NMLFY.RNIELT---------------------------------------------------------------

PF09742

DYM_DROME/1-676P.........-.HTMFG..............SSSAGSFVFGIAESLLSIF...........TFRKQPDILKAGQAAGGGE
B0WBZ3_CULQU/1-681PA........-..TMFG..............FGSGGSFVFGIAESLWSIL................TFARKQPDVLTAHD
DYM_XENTR/1-646PP......PG-SHIFPQ..............QQDGGGLLYGLASGVASGI..................WTVLTLGGVGSK
A7RPK6_NEMVE/1-620PA........-..........................EIFIISAGFWWLF............................GS
C3Z701_BRAFL/1-763GY....GMPY-NHLLFS...............................................................
A7RKV1_NEMVE/1-672GY........-.....................................................................
Q3UU20_MOUSE/1-763GY....GIPY-NHLLFS...............................................................
Q6DGD7_DANRE/1-780GY....GVPY-NHLMFS...............................................................
Q7Z135_CAEEL/1-705GY....GLPY-NYLLFN...............................................................
A8NNK7_BRUMA/1-700GF....GVPY-NYLLFT...............................................................
B7S488_PHATC/1-694GL........-..................................................................PVA
Q6C5S1_YARLI/38-656DA........-....................NAFQTVVFGGSQTAFW.................................
Q4CSH4_TRYCC/1-696RL......SP-SPLLYR..............DGHQPSLRNMYN...............................VFGNGK
C1FEV8_MICSR/1-966AEVGRCVANE-SASTAVVSTAGKVVRREPNVAGSSPGRSAGIVKSSREKW.....GGGLGEVETVMRRASMDVDDDPGSP
Q5CRW2_CRYPI/1-761DNGDIYTFIT-CFQVHS................SIKSVKLIYCEDDSDLF.................QDNRYLFLQYLIK
B6A9V3_CRYMR/1-807FSISRSISSL-TKIENK.............TNILLPSFLDIFQILSVHLM.NPSLIIQRDDSENTETIPYSFFFFLTRTT
A2ETH4_TRIVA/1-444..........-.....................................................................
Q01H67_OSTTA/7-725S.......GD-ICALPA............NRDDEKCGVTRGLVSAFSALF..........PSRSDKSAQSCRSKRVAHNL
A4RQD6_OSTLU/1-676IGDIYEGAVN-RE..................NAEANGITRGMASVLSSML...........SMRSKPNKDVTDNTGSHVV
A2ZYB0_ORYSJ/1-682PL......NS-SHPAFS..............DDGGPGVLQRVGSVAANFV...................LLPYYTFNYLV
Q8RWV1_ARATH/1-679PP......NA-KSYMYS..............DGDSQGILERVGSAAASLV.......................LLPLNYL
B9RTK0_RICCO/1-498PL.....KNT-SYSLFS..............EGSQPGVLQRVGSAAATIV......................LLPFNYLV
B3RI35_TRIAD/1-583PK........-KISLYL.................NTGLFYNIGSAVASGLW......................SMVSKTN
A8WTE9_CAEBR/1-690..........-.YHMTV..............AKPQESIVFGLASSMWSMV........................QMATGL
A8Q618_BRUMA/1-661CA........-...VKH..............DREPESIVLGLAASVWSAV...................QIVTGMDDSNS

PF12722

Q2GWB4_CHAGB/1-825-----DPKE..............................ILV--TYTL................QLLLATLLYPIPEQTG
B9W786_CANDC/1-930-----EIRH..............................LCV--TYAI................QLLTLMVVYPLPQKSE
B6JW01_SCHJY/1-778-----..................................TLV--ELCF................TVFLTLITDPVIGSSS
C3Z701_BRAFL/1-784-----DYRE..............................PTV--EVAL................QLLIVVLDHD.NGQSA
A7TNQ6_VANPO/1-1209-----YSQQ......................HQLPQLRSAFI--ISSL................QLLNIMCSKFWLDNEK
A6RRS3_BOTFB/1-641-----DPKQ..............................ILV--TYAL................QFLLAILLYPIPESG.
B6HUK2_PENCW/1-841-----DPKQ..............................ILV--IYCV................QLLLVLLMYPIPEDGR
Q3UU20_MOUSE/1-784-----DYRE..............................PLV--EEAA................QVLIVTLDHDSATSTS
Q5ASC1_EMENI/1-732-----DPRQ..............................IL.--....................................
C4XYD9_CLAL4/17-927-----EGRH..............................LCV--SYSA................ELLACMVVCPMPSSAH
C5K8E7_PERM5/1-865-----GSQE..............................ALV--DLSLQVKVPGSNPGAGTCTVQVLCALLDFNPSPDNT
B8M9N3_TALSN/1-838-----DSKQ..............................ILV--IYCL................QLLLVILLYPIPEDGR
C5FVH3_ARTOC/1-827-----DPKQ..............................ILV--IYCL................QFLLALLLYPIPEDGR
A3LX71_PICST/1-905-----EMRH..............................LTV--TYSI................QLLTAMVVYPLPSPEK
A8WRZ4_CAEBR/1-727-----DSRE..............................PLV--EIAL................QVLIVCLDKESQPKTD
Q0E9B5_DROME/1-834-----DTTE..............................PLV--EACL................QLLIVTLDHDMVVQQQ
C0NTS7_AJECG/1-843-----DPKQ..............................IFV--IYCL................QFLLVLLLYPIPEDGR
YIOC_SCHPO/1-796-----..................................SLI--EYCF................SVLLILMSEENNNGTP
A8NNK7_BRUMA/1-721-----DTRE..............................PLV--QTAL................QVLIVCLDNETQSSDK
C5DS55_ZYGRC/1-1145-----QSQQ......................QQLPQLRFSMV--SSSL................QLLNIMCLRSDLKEAQ
Q0UAJ2_PHANO/1-733-----DQRQ..............................ILV--TYCL................QLLLVLILYPIPEAGN
B0WUT2_CULQU/1-851-----DTLE..............................PLV--EVCL................QILIVTLDHDITSNTS
A7A1V5_YEAS7/1-1223-----DATA......................SNWQTLYFQFV--QSCL................HVLNLSMSY.......
A7RKV1_NEMVE/1-693-----DFKE..............................PMV--EVAA................QLLVVLLDHDGGDGQN
C5DFL0_LACTC/1-1131-----SCKS......................TNMRALRKALA--AASA................QMLNLSLLCSIEGPRR
Q6FK58_CANGA/1-1248-----NSRENPKYSNRNSFDTNPGSSNNINSQWLPELRSKLV--ISSL................QFLNVMICPEESNTKV
Q6DGD7_DANRE/1-801-----DQRG..............................ELA--ELAL................QTLIISLEQELNDTHP
Q6BSE0_DEBHA/1-924-----EMRH..............................LCV--TYAT................QLLTLMIVYPLPSQPN

PF09742

DYM_DROME/1-676LSQRFRTHY------------------------------PLA..NQSL----------------LLILILTNHCTA....
B0WBZ3_CULQU/1-681LPAAFKDHY------------------------------PLA..NQSL----------------LLILILTNHYTT....
DYM_XENTR/1-646PTPQQEQSS------------------------------PLA..NQSL----------------LLLLVLSNLTDAPD..
A7RPK6_NEMVE/1-620QSTEEESDP------------------------------LLA..NQSL----------------LLLLVLVNHCTQSKK.
C3Z701_BRAFL/1-763.....DYRE------------------------------PTV..EVAL----------------QLLIVVLDHDNGQSAI
A7RKV1_NEMVE/1-672.GVPTDFKE------------------------------PMV..EVAA----------------QLLVVLLDHDGGDGQN
Q3UU20_MOUSE/1-763.....DYRE------------------------------PLV..EEAA----------------QVLIVTLDHDSATSTS
Q6DGD7_DANRE/1-780.....DQRG------------------------------ELA..ELAL----------------QTLIISLEQELNDTHP
Q7Z135_CAEEL/1-705.....DSRE------------------------------PLV..EIAL----------------QVLIVCLDKETQPNT.
A8NNK7_BRUMA/1-700.....DTRE------------------------------PLV..QTAL----------------QVLIVCLDNETQSSD.
B7S488_PHATC/1-694AGFSENSHV------------------------------KLV..ELSA----------------QVLCVLLDCGIPGSPE
Q6C5S1_YARLI/38-656.........------------------------------.......AL----------------ELLLLLVVYYPPEPG.
Q4CSH4_TRYCC/1-696GNNSISCRE------------------------------SLG..RHCA----------------QLLAVLLAHL......
C1FEV8_MICSR/1-966VGSSRSPFA------------------------------PPGFDSGAD----------------RSGLVFSKNYPPETPP
Q5CRW2_CRYPI/1-761KSLNFEKKC------------------------------QLFELNKKK----------------SIILLSTILFNPPEL.
B6A9V3_CRYMR/1-807INGKKHSPT------------------------------PIGIKNRSL----------------CILSMLIFHSPFF...
A2ETH4_TRIVA/1-444........S------------------------------RLL..VVTM----------------ASILLFVYFCDSP...
Q01H67_OSTTA/7-725VRCTHSTQS------------------------------PLA..DEFS----------------NLFLALCAQGAFDPN.
A4RQD6_OSTLU/1-676IKCAHTSRS------------------------------PLA..DECA----------------NLFLALCTHGAFGNR.
A2ZYB0_ORYSJ/1-682SSNAEGASS------------------------------QLA..DNSL----------------LVLLILIHYRKCITMS
Q8RWV1_ARATH/1-679VSNSGGSKN------------------------------PLA..ECSL----------------HVLLILINYHKSIMSD
B9RTK0_RICCO/1-498SSNGEGIRN------------------------------PMA..DASL----------------HVLLILNYYHKCIVGD
B3RI35_TRIAD/1-583AIPEDNRKS------------------------------PLG..VQSL----------------LLLLALSSHHIQDEG.
A8WTE9_CAEBR/1-690DSAEEDNKP------------------------------PLTLGNLCI----------------LLLLNLSCHQPVN...
A8Q618_BRUMA/1-661LSNDSEIIP------------------------------PVSLGSLSV----------------LLLLNLACHQDPEX..

PF12722

Q2GWB4_CHAGB/1-825V...................................................PTPKNY--YRHFLGRLHR--------PQ
B9W786_CANDC/1-930LKFLIEGGLC..........................................SKPYNM--ARVYVGKIHK--------EN
B6JW01_SCHJY/1-778RFLEFARTRN..........................................IALNNF--FSKSISQLHR--------KS
C3Z701_BRAFL/1-784ISVDGTTTGTAMDQGAE...................................GEPQNL--FVNYLSRIHR--------EE
A7TNQ6_VANPO/1-1209LIVENLEKLGVLNRQDIQ..................................HHGKTI--ALSYVSTLNR--------EL
A6RRS3_BOTFB/1-641..........................................................--..........--------..
B6HUK2_PENCW/1-841G...................................................SPPKNY--YRHYFGRLHR--------PQ
Q3UU20_MOUSE/1-784PTVDGTTTGTAMDDADP...................................PGPENL--FVNYLSRIHR--------EE
Q5ASC1_EMENI/1-732..........................................................--..........--------..
C4XYD9_CLAL4/17-927TAFMTNLGLCS.........................................HKPYNM--VRFYLGS.QK--------NN
C5K8E7_PERM5/1-865GSEMVKTHRTGTGSEDGSNNSISESSNQEESAAARRRFSSCAFPLAGPDDDASKPRNV--YRIMARGVQK--------TG
B8M9N3_TALSN/1-838G...................................................APPKNY--YRHYFGRLHR--------PQ
C5FVH3_ARTOC/1-827G...................................................ALPKNY--YRHFLGRLHQ--------PQ
A3LX71_PICST/1-905LDFLKETELIST........................................SKPGNL--ARLYMGKLHK--------DQ
A8WRZ4_CAEBR/1-727DSGY..................................................QDNY--FINYLSRIHR--------EE
Q0E9B5_DROME/1-834LTQPGQASYDEG........................................NCGDNL--FINYLSRVHR--------DE
C0NTS7_AJECG/1-843G...................................................TPPKNY--YRHFYGRLHR--------PQ
YIOC_SCHPO/1-796CYNNYRSSKN..........................................TLPKNY--FSILLSKLQP--------YS
A8NNK7_BRUMA/1-721KNEY..................................................ADNF--FINYLSRIHR--------EE
C5DS55_ZYGRC/1-1145ILAQSMDPNSKS........................................VVNSNI--ALSYLATLNR--------EF
Q0UAJ2_PHANO/1-733G...................................................PAPKNF--FRHFLGRLHR--------PQ
B0WUT2_CULQU/1-851SNSPTGGAQSAQSYSHDDT.................................TIADNL--FINYLSRIHR--------DD
A7A1V5_YEAS7/1-1223....................................................KAQDNV--ITIFLTQLQR--------EY
A7RKV1_NEMVE/1-693PINDDLANDMMEP.......................................PPMDNL--FCNYLSRIHR--------EE
C5DFL0_LACTC/1-1131SEIYLFLYGLNLYSTN....................................YEIKNL--VSSYLGTLNR--------EF
Q6FK58_CANGA/1-1248TK..................................................KRMVNT--AVSYLATLQR--------EF
Q6DGD7_DANRE/1-801NTHITADTDYNRNNTTEACPT...............................SRGENL--FVNYLSRIHR--------EE
Q6BSE0_DEBHA/1-924LQFLYDLNLLTT........................................AKPFNM--ARVYIGKLRK--------EN

PF09742

DYM_DROME/1-676.......................Q----------------------------DNAYRT..SLFSCADSKD..........
B0WBZ3_CULQU/1-681.......................K----------------------------DNPYRV..SLFGCADSQG..........
DYM_XENTR/1-646.......................C----------------------------PNPFRQ..SVTFFRNTQD..........
A7RPK6_NEMVE/1-620.......................K----------------------------MNPYRL..ALFSFADRQA.........K
C3Z701_BRAFL/1-763SVDGTTTGTAMDQGA........E----------------------------GEPQNL..FVNYLSRIHR........EE
A7RKV1_NEMVE/1-672PINDDLANDMME...........P----------------------------PPMDNL..FCNYLSRIHR........EE
Q3UU20_MOUSE/1-763PTVDGTTTGTAMDDAD.......P----------------------------PGPENL..FVNYLSRIHR........EE
Q6DGD7_DANRE/1-780NTHITADTDYNRNNTTEACP...T----------------------------SRGENL..FVNYLSRIHR........EE
Q7Z135_CAEEL/1-705.......................D----------------------------DSGYKDNYFINYLSRIHR........EE
A8NNK7_BRUMA/1-700.......................K----------------------------KNEYADNFFINYLSRIHR........EE
B7S488_PHATC/1-694PVMDQNGNPCVEFEVA.......S----------------------------RGGFNI..LRTLLARIDT........GK
Q6C5S1_YARLI/38-656.......................V----------------------------KNNFRY..FLGKLKQDVD..........
Q4CSH4_TRYCC/1-696.......................K----------------------------GNGQNL..AMEYIKKIEN..........
C1FEV8_MICSR/1-966ATGSSI.................A----------------------------ANPFRD..ALFRLVRLER.........S
Q5CRW2_CRYPI/1-761.......................K----------------------------FNIYSE..WINHFSDPRF........IP
B6A9V3_CRYMR/1-807.......................K----------------------------ENVYSD..FMRNILDPRFLPETSSLLIK
A2ETH4_TRIVA/1-444.......................D----------------------------NNPFVT..AVRKFNEPK...........
Q01H67_OSTTA/7-725.......................V----------------------------KNPFRE..AVKGMRDVSA..........
A4RQD6_OSTLU/1-676.......................D----------------------------ENPFRI..AVKNMKDISS..........
A2ZYB0_ORYSJ/1-682ESFPSSNVYTSDLNTNVKDAPAFH----------------------------DNPYYK..ALSNAKDSQY..........
Q8RWV1_ARATH/1-679ESMTDKSDDSATSESVSKVHVFSS----------------------------DNTFSK..ALANARDVEF..........
B9RTK0_RICCO/1-498EPFTGKSDDSAASDSLS......K----------------------------ANMYFS..DNPYCKALEN.....ARDIE
B3RI35_TRIAD/1-583.......................K----------------------------FNPFRH..SLFRLGAKES..DVN...VE
A8WTE9_CAEBR/1-690.......................A----------------------------SNPFKE..TLALFQNAQE..........
A8Q618_BRUMA/1-661.......................K----------------------------LNPYKE..SLSKFQNSQE..........

PF12722

Q2GWB4_CHAGB/1-825DFQFAVDGMTRILNQPLQ..............................................................
B9W786_CANDC/1-930ELLFIASSLIEFLKVPLINAKDQETDTF....................................................
B6JW01_SCHJY/1-778DFQFILDGFSRLLYSPIH..............................................................
C3Z701_BRAFL/1-784DFHFILKGITNLLNNPLI..............................................................
A7TNQ6_VANPO/1-1209DLKLMLTSFAKIFKHPVEVAIEQETSPFGSFPSMKQNQNYSHNRVNSNSSNNYEND.........SQQPNTPNQNLSNLK
A6RRS3_BOTFB/1-641...............PAQ..............................................................
B6HUK2_PENCW/1-841DFQFLVDGMTRILNQPMQ..............................................................
Q3UU20_MOUSE/1-784DFQFILKGIARLLSNPLL..............................................................
Q5ASC1_EMENI/1-732................MQ..............................................................
C4XYD9_CLAL4/17-927DLVFLVSHLLSILKHPFSVNRLENRGKF....................................................
C5K8E7_PERM5/1-865ELDFMADGLVRIVTTVDD..............................................................
B8M9N3_TALSN/1-838DFQFLVEGMTRILNQPMQ..............................................................
C5FVH3_ARTOC/1-827DFQFLVEGMTRILNQPMQ..............................................................
A3LX71_PICST/1-905ELVFLSTYLIAILKLPVVTSKDVESSKF....................................................
A8WRZ4_CAEBR/1-727DFDFMLKGITRLLSNPIH..............................................................
Q0E9B5_DROME/1-834DFHFVLKGITRLLNNPLV..............................................................
C0NTS7_AJECG/1-843DFQFIVEGMTRILNQPMQ..............................................................
YIOC_SCHPO/1-796DFQIILDGMSRLLYPPMQ..............................................................
A8NNK7_BRUMA/1-721DFEFMLKGMTRLLTNPLV..............................................................
C5DS55_ZYGRC/1-1145DLRLLLTSFAKIFKLPINLAIDQESNLLSL..PRKQSSSSIGSVDGSNRSNNAANSIPYANAAVTGTAATSTNSAASPTA
Q0UAJ2_PHANO/1-733DFQFLVDGMTRILNQPVW..............................................................
B0WUT2_CULQU/1-851DFQFILRGITRLLNNPLV..............................................................
A7A1V5_YEAS7/1-1223DLKLILSSFIKIFKYPIDLAIEQESNIFNFTNNKHIDASRRRAVSTSSHDNSSSSHASLPSSSSAAYH............
A7RKV1_NEMVE/1-693DFHFILHGLANLLNNPLI..............................................................
C5DFL0_LACTC/1-1131DLKFILISLVTLLKRPIDRAIENESNPFSLLNGSSNASTKQGKGPTKKNGHSRSNSA.......................
Q6FK58_CANGA/1-1248DLKLILTSVIRIFKLPIDAAIDEDSNLF.TFPTASSRKKHQNLSNHSRTSSSSNIKRSTSNSSATSRYDSNPNTVTGSPK
Q6DGD7_DANRE/1-801DFNFILRGISRLLNNPLM..............................................................
Q6BSE0_DEBHA/1-924ELLFLASYLINVLRAPMQSSKESENLKF....................................................

PF09742

DYM_DROME/1-676........SPKQGAVSFQ--------------------------------------------------------------
B0WBZ3_CULQU/1-681AADSSGSSKEPEQAVTFK--------------------------------------------------------------
DYM_XENTR/1-646.....SSVSPTPNPHSFQ--------------------------------------------------------------
A7RPK6_NEMVE/1-620ASGGKSPDEKRRADPPFC--------------------------------------------------------------
C3Z701_BRAFL/1-763DFHFILKGITNLLN..NP--------------------------------------------------------------
A7RKV1_NEMVE/1-672DFHFILHGLANLLN..NP--------------------------------------------------------------
Q3UU20_MOUSE/1-763DFQFILKGIARLLS..NP--------------------------------------------------------------
Q6DGD7_DANRE/1-780DFNFILRGISRLLN..NP--------------------------------------------------------------
Q7Z135_CAEEL/1-705DFDFMLKGITRLLSNPIH--------------------------------------------------------------
A8NNK7_BRUMA/1-700DFEFMLKGMTRLLT..NP--------------------------------------------------------------
B7S488_PHATC/1-694ELSMIFDGFARLLRNVYE--------------------------------------------------------------
Q6C5S1_YARLI/38-656......FEFIARHISEIL--------------------------------------------------------------
Q4CSH4_TRYCC/1-696...............EDP--------------------------------------------------------------
C1FEV8_MICSR/1-966NKDDDSGESDALRVRVLR--------------------------------------------------------------
Q5CRW2_CRYPI/1-761DNLILSDSNTDSDVDANK--------------------------------------------------------------
B6A9V3_CRYMR/1-807DIQSEVDSDEDTSGITKF--------------------------------------------------------------
A2ETH4_TRIVA/1-444..................--------------------------------------------------------------
Q01H67_OSTTA/7-725.....RSSVSSGKRDATL--------------------------------------------------------------
A4RQD6_OSTLU/1-676.....RSSVASNKRPSEL--------------------------------------------------------------
A2ZYB0_ORYSJ/1-682.DRADVEGNAQNGLV.VR--------------------------------------------------------------
Q8RWV1_ARATH/1-679.DRSDVEGNAHPAGPHVR--------------------------------------------------------------
B9RTK0_RICCO/1-498LDRVDIEGNVHNASH.VR--------------------------------------------------------------
B3RI35_TRIAD/1-583IESAHSDDTPSSSPHDSS--------------------------------------------------------------
A8WTE9_CAEBR/1-690......VSTLPTQVISFK--------------------------------------------------------------
A8Q618_BRUMA/1-661.....VSSLNNSETGTFK--------------------------------------------------------------

PF12722

Q2GWB4_CHAGB/1-825...........................SNSSYI------PGTQ------------SS---VRF..APETIMLFWEITQCN
B9W786_CANDC/1-930...........................SLLRSG------SNYK------------RP---SLW..SLEAVMLIWELLQSN
B6JW01_SCHJY/1-778..............................FEK------PNVV------------GV---VMYDYYPLTLNLCKQMLHYN
C3Z701_BRAFL/1-784.............................QTYL------PNSC------------KK---INF..HQEILVLFWKLCEFN
A7TNQ6_VANPO/1-1209NKPYNNIGNNTKTDNTKKTNTNDTNENNSTGSS------LSLP------------VP---PTI..LPQVLILFTTIITEN
A6RRS3_BOTFB/1-641.................................------....------------..---....................
B6HUK2_PENCW/1-841...........................ATASYL------PGSQ------------RS---VKW..APEMLVLFWETLQCN
Q3UU20_MOUSE/1-784.............................QTYL------PNST------------KK---IQF..HQELLVLFWKLCDFN
Q5ASC1_EMENI/1-732...........................ATTAYL------PGSQ------------KS---VKW..APEMLVLFWEALQCN
C4XYD9_CLAL4/17-927.................................------.TKP------------HP---SPW..AIEAIMILWELLQCN
C5K8E7_PERM5/1-865...........................AKRTYL------PSSR------------KV---VPF..YQEALILLWHLITIN
B8M9N3_TALSN/1-838...........................VTSSYL------PGSQ------------KS---VKW..APEMLMLFWEALQCN
C5FVH3_ARTOC/1-827...........................ATSSYL------PGSQ------------KS---IKW..APEMLMLFWEMVQCN
A3LX71_PICST/1-905..............................NII------KSGN------------QP---SLW..ATEATMLIWELIQCN
A8WRZ4_CAEBR/1-727...........................SSSSYL------PNST------------KK---VNF..HQELLVLLWKCCEFN
Q0E9B5_DROME/1-834.............................QNYL------PNST------------KR---LHC..HQELLILFWKICDYN
C0NTS7_AJECG/1-843...........................ATTSYL------PGSH------------KS---VKW..APEMIMLFWEALQCN
YIOC_SCHPO/1-796..............................STI------PKRS------------SL---IMFDYYPLVLIFCKLFIHYN
A8NNK7_BRUMA/1-721.............................ATYL------PSST------------KK---ITC..HQELLVLLWKCCEYN
C5DS55_ZYGRC/1-1145GSTSRRSRDNERIGNTNGTTNFNSTSHGNSSSS------PSLP------------PV---SPL..FLQSLIFLTILVQNN
Q0UAJ2_PHANO/1-733.................................------..SQ------------KS---LTW..APEMIMLFWEALQCN
B0WUT2_CULQU/1-851.............................QSYL------PNST------------KR---LHC..HQELLVFFWKICDYN
A7A1V5_YEAS7/1-1223...........................TKPQTK------PQLP------------EI---HPL..LIPMTILMTNLIDCN
A7RKV1_NEMVE/1-693.............................QTYL------PNSC------------KK---ISF..HQELLILFWKMCDQN
C5DFL0_LACTC/1-1131...........................KGASSK------SNLS------------RL---PRS..TLQVTTLLWELMKCN
Q6FK58_CANGA/1-1248LANMRE.....................NNTSSY------SSLP------------PL---PPI..LCQSLVFLINVIKIN
Q6DGD7_DANRE/1-801.............................QTYL------PHSC------------KK---IQF..HQELLVLFWKLCDLN
Q6BSE0_DEBHA/1-924.............................NLNT------GRQN------------QV---SIW..ATECIMLLWELFQCN

PF09742

DYM_DROME/1-676---------------------------IDFSAV......YETL............CT...IVT--IDQATLLLYLLLHRN
B0WBZ3_CULQU/1-681---------------------------IDFSSL......YNTL............CR...IVT--IDQTTLLLYLLLHRN
DYM_XENTR/1-646---------------------------INFNSL......YTAL............CE...QQK--SDQATLLLYTLLHQN
A7RPK6_NEMVE/1-620---------------------------INLGLL......YTTI............CK...GLI--KDQTTLLLYLILHRN
C3Z701_BRAFL/1-763---------------------------LIQTYL......PNSC............KK...INF--HQEILVLFWKLCEFN
A7RKV1_NEMVE/1-672---------------------------LIQTYL......PNSC............KK...ISF--HQELLILFWKMCDQN
Q3UU20_MOUSE/1-763---------------------------LLQTYL......PNST............KK...IQF--HQELLVLFWKLCDFN
Q6DGD7_DANRE/1-780---------------------------LMQTYL......PHSC............KK...IQF--HQELLVLFWKLCDLN
Q7Z135_CAEEL/1-705---------------------------SSSSYL......PNST............KR...VNF--HQELLVLLWKCCEIN
A8NNK7_BRUMA/1-700---------------------------LVATYL......PSST............KK...ITC--HQELLVLLWKCCEYN
B7S488_PHATC/1-694---------------------------AESNYI......AGVK.................LEC--FQELLVLFWKFLEEN
Q6C5S1_YARLI/38-656---------------------------AKFSAS......SGSI............LTGKKETR--TNEIICLLWEIIQTN
Q4CSH4_TRYCC/1-696---------------------------VPFAAL......LTAFV...........NR...LKV--CPSLCIVLYVLVYDH
C1FEV8_MICSR/1-966---------------------------ACVLAM......HSADTAGAASGASGDKSHAASCQQ--AAVGVFLAYSLLYGN
Q5CRW2_CRYPI/1-761---------------------------TDFVDFPYFEQAYRSV............TFNGVLVK--HNLFVFFLYSLVHSN
B6A9V3_CRYMR/1-807---------------------------TYFDQI......CSTI............SSEYGLKN--HILESYIFYFLIHSN
A2ETH4_TRIVA/1-444---------------------------..FSEI......FDSL............TK...HFG--QTPAILLFYTFIIQN
Q01H67_OSTTA/7-725---------------------------VNFEKT......CEAL............SE...SSS--TDSGLLTLYTLLSTN
A4RQD6_OSTLU/1-676---------------------------VDFERL......AVAL............SA...SLC--TDVGLLLSYVTLSTN
A2ZYB0_ORYSJ/1-682---------------------------LSFASL......FDAL............GT...CLK--DESSVLLLYSLVHGN
Q8RWV1_ARATH/1-679---------------------------IPFASL......FDTL............GM...FLA--DEGAVLLLYSLLQGN
B9RTK0_RICCO/1-498---------------------------LPFASL......FDTL............GM...CLG--DETAALLLYTLVHGN
B3RI35_TRIAD/1-583---------------------------FNMSQL......YNTI............CK...ELH--ADETTLLLYLLLHRN
A8WTE9_CAEBR/1-690---------------------------IDYNGL......YERL............CA...TAG--QEPPMLLLYMLLQAN
A8Q618_BRUMA/1-661---------------------------LDYSLL......YERL............CA...TVN--QQSPMLFLYILLHRN

PF12722

Q2GWB4_CHAGB/1-825KRFRSFIID-TER-AHDFIILILFYALEYKGD------------------------------------------------
B9W786_CANDC/1-930RNFVSIVGE-.KY-ISELMIILLYYVFAYHSQ------------------------------------------------
B6JW01_SCHJY/1-778TRFFHYLVD-TGR-ALDLFVFILYLSFEYLSE------------------------------------------------
C3Z701_BRAFL/1-784KKFLFYVLK-SSD-VLDVIAPILYHLNDSRQD------------------------------------------------
A7TNQ6_VANPO/1-1209KSFENYVAD-.KF-ANKFIIFSIYYMHYYNHI------------------------------------------------
A6RRS3_BOTFB/1-641.........-...-..................------------------------------------------------
B6HUK2_PENCW/1-841KRFRSFIID-SNR-SHDFLVLCIFYAMEYRMD------------------------------------------------
Q3UU20_MOUSE/1-784KKFLFFVLK-SSD-VLDILVPILYFLNDARAD------------------------------------------------
Q5ASC1_EMENI/1-732KRFRSFIID-SNR-SHDFIILCIFYSITYKSD------------------------------------------------
C4XYD9_CLAL4/17-927QYLRSFVAE-.RL-VVKLVPYIAYHIFAFCDV------------------------------------------------
C5K8E7_PERM5/1-865STYRKRLCI-.RH-TEDILHPLLDLLVSSRNS------------------------------------------------
B8M9N3_TALSN/1-838KRFRAFIIE-SNR-SHDFVILCIFYATEYRND------------------------------------------------
C5FVH3_ARTOC/1-827KRFRSFIVD-SNR-AHDFIVICTFYAIEYKTD------------------------------------------------
A3LX71_PICST/1-905KKFKTLIYE-.QS-LPELLVVLFYYIFAFHSN------------------------------------------------
A8WRZ4_CAEBR/1-727QKFMFYVLK-TSD-VLDILVPILYHISDARND------------------------------------------------
Q0E9B5_DROME/1-834KKFLYFVLK-SSD-VLDILIPILYHLNYSRAD------------------------------------------------
C0NTS7_AJECG/1-843KRFRSYMID-SSR-ALDFVVLCIFYAIEYKTD------------------------------------------------
YIOC_SCHPO/1-796ERFFHYLID-TDR-AIDLFIFLLYLSFEYLGD------------------------------------------------
A8NNK7_BRUMA/1-721QKFMFYLLK-TSD-VLEVLVPILFHISASRND------------------------------------------------
C5DS55_ZYGRC/1-1145KNFQNYVAD-.KF-GPKLIIFSIYYLQFYDNN------------------------------------------------
Q0UAJ2_PHANO/1-733KRFRSFIID-TDR-AHDFVVLVLYYAIDQRND------------------------------------------------
B0WUT2_CULQU/1-851K........-SSD-VLDILVPILYHLNDSRAD------------------------------------------------
A7A1V5_YEAS7/1-1223KCFQNYFAD-.KF-ASRFIIFSIYYLKYYDYS------------------------------------------------
A7RKV1_NEMVE/1-693KKFLFYVLK-SSD-VLDILVPILYHLNDARSD------------------------------------------------
C5DFL0_LACTC/1-1131KSFENYVAD-.KY-ANKLLLVCIFHIKYYSDS------------------------------------------------
Q6FK58_CANGA/1-1248KLVKNQFAD-.KF-ASKFVVFAVYYLKYYNDN------------------------------------------------
Q6DGD7_DANRE/1-801KKFLFYVLK-SSD-VLDILVPVLFYLNDARAN------------------------------------------------
Q6BSE0_DEBHA/1-924KSFRTLVGE-.RY-LHELLVIMLYYVCTYHRN------------------------------------------------

PF09742

DYM_DROME/1-676ERFYRFVMQ.QQD.LEQLVIPILQTLYNAPDS................................................
B0WBZ3_CULQU/1-681QRFYKYVMA.QQN.LQQLVIPILQTLYNAPDS................................................
DYM_XENTR/1-646SNVRTYVLA.RSD.MENLVLPILEILYHVEDR................................................
A7RPK6_NEMVE/1-620PNVSSFILS.RTD.IDTLVIPILKLLYNAEEQ................................................
C3Z701_BRAFL/1-763KKFLFYVLK.SSD.VLDVIAPILYHLNDSRQD................................................
A7RKV1_NEMVE/1-672KKFLFYVLK.SSD.VLDILVPILYHLNDARSD................................................
Q3UU20_MOUSE/1-763KKFLFFVLK.SSD.VLDILVPILYFLNDARAD................................................
Q6DGD7_DANRE/1-780KKFLFYVLK.SSD.VLDILVPVLFYLNDARAN................................................
Q7Z135_CAEEL/1-705QKFMFYVLK.TSD.VLDILVPILYHISDARND................................................
A8NNK7_BRUMA/1-700QKFMFYLLK.TSD.VLEVLVPILFHISASRND................................................
B7S488_PHATC/1-694PLFMPHILK.RCN.VNEIIVPICFLMYKSRRD................................................
Q6C5S1_YARLI/38-656KRFLPWLLK.KGY.LDNIILSILQQIKMCEST................................................
Q4CSH4_TRYCC/1-696PTFLHTTMTLHAKELLDVIQEVLHLSYIAATETGEGNMACNNSISSTHPTTTTLESCQVFIYREVLTPECVAQLLKDMVQ
C1FEV8_MICSR/1-966EGFYRAVVA.DANAVRALVSALLRRAHATYAE.....................................VGGSSPRGTTQ
Q5CRW2_CRYPI/1-761SYFISYCLS.RAD.PDALILALLEPVYIISKD..............................................ID
B6A9V3_CRYMR/1-807SNFRLYCMS.RGD.PEYLIVPILEVLYILPIQ...........................................KQRNV
A2ETH4_TRIVA/1-444EQFKNFCLS.KSD..PNWILQIVPPLNKTDDQ................................................
Q01H67_OSTTA/7-725SRFVAYLGS.KGSAAKRLVENLIRELYEAEMD................................................
A4RQD6_OSTLU/1-676SRFVSHLSS.SAA.TSRFVQGLLKELYEAESN................................................
A2ZYB0_ORYSJ/1-682CDFQEYVLV.RTD.LDTLLMPILEMLYNASRK................................................
Q8RWV1_ARATH/1-679SDFKEYVLV.RTD.LDTLLMPILETLYNASKR................................................
B9RTK0_RICCO/1-498SDFLEYVLV.RTD.LDTLLMPILETLYNASKK................................................
B3RI35_TRIAD/1-583PSFASYVLS.RVD.IDSLVIPILKLLYEAEEK................................................
A8WTE9_CAEBR/1-690SGFRNYVLS.RIN.LENLVVPVLRILHDGVAT................................................
A8Q618_BRUMA/1-661VGFRNYILS.RIN.LEKLVLPVLIVLSDGAQS...........................................SGMIN

PF12722

Q2GWB4_CHAGB/1-825ASKQG....................................VVRMCAFLLQTLSV..EKNFGVNLNKS------------
B9W786_CANDC/1-930KSSKN....................................LIFLCAYLLLYLSSAQQNRFLEPLFVP------------
B6JW01_SCHJY/1-778ASTFD....................................HLKICLIILRRLTT..SKQFCEKLNIP------------
C3Z701_BRAFL/1-784QSRVG....................................LMHIGVFILLLLSG..ERNFGVRLNKP------------
A7TNQ6_VANPO/1-1209PELQSS...................................MIPLCSNLSLYLSS..KKLVLSKMLDT------------
A6RRS3_BOTFB/1-641.TKKT...............................................................------------
B6HUK2_PENCW/1-841ASKQG....................................VVRMCVFILQTMSA..EPTFAKSLNNS------------
Q3UU20_MOUSE/1-784QSRVG....................................LMHIGVFILLLLSG..ERNFGVRLNKP------------
Q5ASC1_EMENI/1-732PAKQG....................................VVRMCIFILQTMSV..EPTFGKSLNKK------------
C4XYD9_CLAL4/17-927PHYKV....................................LVKLCAYFLLYISS..QETWVQALVLP------------
C5K8E7_PERM5/1-865QAKIG....................................LLHMCSFIILVLSS..DRDFAVALNAP------------
B8M9N3_TALSN/1-838PSKQG....................................MVKMCIFILQTLSV..EVSFGKRLNMK------------
C5FVH3_ARTOC/1-827PSKNG....................................LVKM......................K------------
A3LX71_PICST/1-905VQHKN....................................LVRICAYLMLYCSS..DKN.LDSIFEP------------
A8WRZ4_CAEBR/1-727SARVG....................................LIHMGVFIILLLSG..ERNFGVRLNKP------------
Q0E9B5_DROME/1-834QSRVG....................................LMHIGVFILLLLSG..ERNFGVRLNKA------------
C0NTS7_AJECG/1-843ASKLG....................................VVKMCIFILQTLSV..EPNFGKNLNKK------------
YIOC_SCHPO/1-796PSTYN....................................HLKLCVILLKRLTA..EKYFCKRLNKP------------
A8NNK7_BRUMA/1-721PARVG....................................LIHMGVFIILLLSG..ERNFGVRLNKP------------
C5DS55_ZYGRC/1-1145VNQNGGWELGST.............................VIPLCYNLALFFSS..KKLVLSKMLET------------
Q0UAJ2_PHANO/1-733PTKQG....................................LVRMCVFVLQTLSV..EPNFGKSLNKT------------
B0WUT2_CULQU/1-851QSRVG....................................LMHIGVFILLLLSG..ERNFGVRLNKP------------
A7A1V5_YEAS7/1-1223SLSSSSSTTRSNSSTTSNGTSNDTSDERSIVELNENSVSQILLPLLNHLLLILTS..KKLVLFKMLQT------------
A7RKV1_NEMVE/1-693QSRLG....................................LMHIGVFILLLLSG..ERNFGVRLNKP------------
C5DFL0_LACTC/1-1131PDWRTS...................................LIPAISGFAIYLSS..KKLVFSKMSFC------------
Q6FK58_CANGA/1-1248PEYSLT...................................VIPVINMLALYLTS..KPLVLLKMLDP------------
Q6DGD7_DANRE/1-801QSRVG....................................LVHIGVFILLLLSG..ERNFGVRLNKP------------
Q6BSE0_DEBHA/1-924VNHKN....................................SVRIFSYFILYLSS..DCLIMDKLFEP------------

PF09742

DYM_DROME/1-676..NSH------------------------------------HIYMSLIVLLILSE--DEGFNKNVHTI............
B0WBZ3_CULQU/1-681..TSH------------------------------------HIYMSLIVLLILSE--DDNFNKSVHEI............
DYM_XENTR/1-646..NSH------------------------------------HVYMALIILLILTE--DDGFNRSIHEV............
A7RPK6_NEMVE/1-620..NAH------------------------------------HIYMSLIILLILSQ--DENFNKSVHEL............
C3Z701_BRAFL/1-763QSRVG------------------------------------LMHIGVFILLLLSG--ERNFGVRLNKP............
A7RKV1_NEMVE/1-672QSRLG------------------------------------LMHIGVFILLLLSG--ERNFGVRLNKP............
Q3UU20_MOUSE/1-763QSRVG------------------------------------LMHIGVFILLLLSG--ERNFGVRLNKP............
Q6DGD7_DANRE/1-780QSRVG------------------------------------LVHIGVFILLLLSG--ERNFGVRLNKP............
Q7Z135_CAEEL/1-705SGRVG------------------------------------LIHMGVFIILLLSG--ERNFGVRLNKP............
A8NNK7_BRUMA/1-700PARVG------------------------------------LIHMGVFIILLLSG--ERNFGVRLNKP............
B7S488_PHATC/1-694PAQIG------------------------------------LVHICTFVLLKLSG--ERSFGVALNQK............
Q6C5S1_YARLI/38-656....Q------------------------------------TLRLLSNFLLYLSD--DDVVVSSFDDG............
Q4CSH4_TRYCC/1-696FSYPF------------------------------------IGFMTSTLVLLFSQ--DQVLNRNMSDT............
C1FEV8_MICSR/1-966LNVSG------------------------------------VASVATATLAMLSQ--DPVVNRAVHSLSTSQRLASSSND
Q5CRW2_CRYPI/1-761ETNLC------------------------------------QLIALLSIILRLTN--DLNMCKVLSYT............
B6A9V3_CRYMR/1-807IIGTC------------------------------------HLIPLLTILTKLTD--EPNYCKALHRT............
A2ETH4_TRIVA/1-444...SH------------------------------------ELRLNILLILTQDP--SFLFSVSIEKS............
Q01H67_OSTTA/7-725.GITH------------------------------------VSQLIITSLLILSQ--DVGFNRLMQTQ............
A4RQD6_OSTLU/1-676.KLAH------------------------------------VSQLIVTIFLILSQ--DVRFNRMMQTE............
A2ZYB0_ORYSJ/1-682..TSN------------------------------------QIYMLLIVLLILSQ--DSTFNASVHKL............
Q8RWV1_ARATH/1-679.TSSN------------------------------------QIYMMLIVLLILSQ--DSSFNSSIHKM............
B9RTK0_RICCO/1-498..TSN------------------------------------HIYILLIILLILSQ--DSSFNASIHKM............
B3RI35_TRIAD/1-583..NSH------------------------------------HIYMALIILLILSQ--DSGFNNSIHIL............
A8WTE9_CAEBR/1-690SNNSH------------------------------------HVYLALIVALILSE--DDIFCKIIHET............
A8Q618_BRUMA/1-661SYNAH------------------------------------HVYLALIVILILSE--DDFFCKVAHET............

PF12722

Q2GWB4_CHAGB/1-825------------FDA.......QDTLPLLSALLASGARMGTFSS.....S-------------------------QSIYV
B9W786_CANDC/1-930------------LNSSASLHEFYNCLP.......SNYKLSITPI.....N-------------------------TRDFL
B6JW01_SCHJY/1-778------------FEQ.......LSSLP.......TNRRVPFSKG.....S-------------------------YADFS
C3Z701_BRAFL/1-784------------YTV.........RVP.........MDIPVFTG.....T-------------------------HADFL
A7TNQ6_VANPO/1-1209------------FTT....NYYTNKLP.......DFFKLS..SGNINNLT-------------------------YRDFS
A6RRS3_BOTFB/1-641------------......................................-------------------------.....
B6HUK2_PENCW/1-841------------FEA.......QETLP.......QSIRLPKFRG.....S-------------------------YGDYL
Q3UU20_MOUSE/1-784------------YSV.........RVP.........MDIPVFTG.....T-------------------------HADLL
Q5ASC1_EMENI/1-732------------FEA.......QDTLP.......QSIRIPGFKG.....S-------------------------YADFL
C4XYD9_CLAL4/17-927------------MSE.....NMNEVLP.......SEFRLTGGPH.....S-------------------------TRDFL
C5K8E7_PERM5/1-865------------FRG........SRIQ..........DVPVFTG.....T-------------------------WADLM
B8M9N3_TALSN/1-838------------FEA.......QDTLP.......TSIRIAGFRG.....T-------------------------YADYL
C5FVH3_ARTOC/1-827------------FEA.......QDTLP.......PSIRLENFGG.....T-------------------------YGDFL
A3LX71_PICST/1-905------------MDH.....NLYESLP.......TNYKTNPAPT.....T-------------------------TRDFL
A8WRZ4_CAEBR/1-727------------YTA.........KAN.........INIQTFTG.....T-------------------------HADLL
Q0E9B5_DROME/1-834------------YSA.........TVP.........MDIPVFTG.....T-------------------------HADLL
C0NTS7_AJECG/1-843------------FES.......QDTLP.......QSIRLQNFRG.....S-------------------------YADFL
YIOC_SCHPO/1-796------------FQQ.......QTALP.......ISMPVPFEGG.....T-------------------------YADFT
A8NNK7_BRUMA/1-721------------YTP.........RAA.........IDVQSFTG.....T-------------------------HADLL
C5DS55_ZYGRC/1-1145------------FSP....NYYTNKLP.......NFFKLS..SGNINHIT-------------------------YRDFA
Q0UAJ2_PHANO/1-733------------FEG.......QESLP.......PSIRIPNFHG.....T-------------------------YADYV
B0WUT2_CULQU/1-851------------YTA.........TVP.........MDIPVFTG.....T-------------------------HADLL
A7A1V5_YEAS7/1-1223------------FNL....NYYTNNLP.......NFYKLSNINGDINNLT-------------------------FRDFT
A7RKV1_NEMVE/1-693------------YAV.........RVP.........MDIPVFTG.....T-------------------------HADFL
C5DFL0_LACTC/1-1131------------FNV....NYYTNKLP.......NFFKLS..VGDVNHLT-------------------------YRDFA
Q6FK58_CANGA/1-1248------------FNS....NYYTNKIP.......NAFKLT..SGNINNLT-------------------------YRDFT
Q6DGD7_DANRE/1-801------------YSV.........RVP.........MDITVFAG.....T-------------------------HADLL
Q6BSE0_DEBHA/1-924------------MDL.....TFYESLP.......TGYKISPGPV.....T-------------------------YRDFI

PF09742

DYM_DROME/1-676............M.L--------KNIT-------.WY..TERTI-----S..........EIS............LGGIL
B0WBZ3_CULQU/1-681............I.L--------KNIT-------.WY..TERSI-----S..........EIS............LGGLL
DYM_XENTR/1-646............I.L--------KNIT-------.WY..TERVL-----T..........EIS............LGSLL
A7RPK6_NEMVE/1-620............V.I--------SNIP-------.WY..TERVI-----T..........NIT............LGGLL
C3Z701_BRAFL/1-763............Y.T--------VRVP-------.....MDIPV-----F..........TGT............HADFL
A7RKV1_NEMVE/1-672............Y.A--------VRVP-------.....MDIPV-----F..........TGT............HADFL
Q3UU20_MOUSE/1-763............Y.S--------VRVP-------.....MDIPV-----F..........TGT............HADLL
Q6DGD7_DANRE/1-780............Y.S--------VRVP-------.....MDITV-----F..........AGT............HADLL
Q7Z135_CAEEL/1-705............Y.T--------AKAN-------.....INVQT-----F..........TGT............HADLL
A8NNK7_BRUMA/1-700............Y.T--------PRAA-------.....IDVQS-----F..........TGT............HADLL
B7S488_PHATC/1-694............F.T--------KKLP-------.....TDLPL-----F..........RGC............HADLL
Q6C5S1_YARLI/38-656..............T--------VNFN-------.YV.......-----..........................LGQLF
Q4CSH4_TRYCC/1-696............IIE--------PRFK-------.....AGRFS-----G..........KMS............IISLC
C1FEV8_MICSR/1-966SQLNDSQLNDSQL.N--------DRTD-------FWFN.SSASA-----K..........TLSGFKSIGKPPQQTLGSAW
Q5CRW2_CRYPI/1-761............Y.I--------ESLP-------HWL..EDDSL-----KKVIHKCSGNKEKSGFELSENHSIS.IGNIL
B6A9V3_CRYMR/1-807............I.I--------GSLP-------DWLKDSSLNK-----TIGMYQGQNYYSNSTYEYAISDSIVSLGSLI
A2ETH4_TRIVA/1-444...............--------....-------..........-----..........................IIPKL
Q01H67_OSTTA/7-725..............K--------CSST-------AWY..KERII-----E..........KSS............MGSLM
A4RQD6_OSTLU/1-676..............T--------IASS-------NWY..KERIL-----Q..........NSS............LASLI
A2ZYB0_ORYSJ/1-682............V.L--------PSVP-------.WY..HERLM-----H..........QTS............LGSLM
Q8RWV1_ARATH/1-679............I.L--------PSVP-------.WY..KEHLL-----H..........QTS............LGSLM
B9RTK0_RICCO/1-498............I.L--------PSVP-------.WY..QDHLL-----H..........QTS............LGSLM
B3RI35_TRIAD/1-583............D.L--------RSVA-------.WF..TERSL-----N..........DIT............LGGLL
A8WTE9_CAEBR/1-690............VPI--------KDLG-------.WLD.SDFSV-----R..........EIS............LGGLT
A8Q618_BRUMA/1-661............M.I--------KNTT-------.WFN.SERPL-----G..........EIS............LGGLI

PF12722

Q2GWB4_CHAGB/1-825LI...................TTSQG---KLT------------------AVYPALLAVINNIAAY..............
B9W786_CANDC/1-930VTHICTILINNQVNVSSSNYLSSSSP---LSD------------------LLIKTLIEILYNLISR..............
B6JW01_SCHJY/1-778VTAMTSII.............TACKD---YQS------------------EAVLLLTETLSYLVKY..............
C3Z701_BRAFL/1-784IIVFHKII.............TTGHQ---RLQ------------------PLFDCLLTIIVNVSPY..............
A7TNQ6_VANPO/1-1209VVHICNII.............INDVK---ENV------------------QPRPWLYELLYNLIQI........PSNIKD
A6RRS3_BOTFB/1-641..........................---...------------------.....LLAVINNIAAY..............
B6HUK2_PENCW/1-841ITSIHTLM.............TTSKG---NLD------------------TVYPALLIILNNIAPY..............
Q3UU20_MOUSE/1-784IVVFHKII.............TSGHQ---RLQ------------------PLFDCLLTIVVNVSPY..............
Q5ASC1_EMENI/1-732LI........................---...------------------..............................
C4XYD9_CLAL4/17-927IVQLCSILSYVFSGFGSNPKSDTANE---MKR------------------FLVPTFSEVLYNIVPV..............
C5K8E7_PERM5/1-865TLSIYRVVSDALFVAATAKSPTTGAE---...------------------SLIDMMLTSLCNISAY..............
B8M9N3_TALSN/1-838IISIHTLM.............TSSKG---KLD------------------AVYPALMAILKNIGPY..............
C5FVH3_ARTOC/1-827IISIHTLM.............TTSKG---KLD------------------AVYPALLAIINNVAAY..............
A3LX71_PICST/1-905VTQICNLLIYMQTPQSTYTYGATLTP---SP.------------------LMVTTLVEILYNLIPP..............
A8WRZ4_CAEBR/1-727ILVFHKLI.............TTGNY---RLQ------------------SLFDCFLTIMVNVSPY..............
Q0E9B5_DROME/1-834ITVFHKII.............ATGHQ---RLQ------------------PLFDCLLTILVNVSPY..............
C0NTS7_AJECG/1-843IISIHTLL.............TTSKG---KLD------------------AVYPALLAIINNIGAY..............
YIOC_SCHPO/1-796IIAISLLV.............QYTKD---YHS------------------EIAQMLCCSLCYLCLY..............
A8NNK7_BRUMA/1-721ILVFHKLI.............TTGNH---RLQ------------------SLFDCLLTIIVNVSPY..............
C5DS55_ZYGRC/1-1145IVHLCNMA.............ISDVR---DNL------------------QPRPWIFELIYNLLPI........RANLRD
Q0UAJ2_PHANO/1-733IT........................---...------------------..............................
B0WUT2_CULQU/1-851ITVFHKII.............ATGHQ---RLQ------------------PLFDCLLTILVNVSPY..............
A7A1V5_YEAS7/1-1223IIQLSNLI.............LDNIK---FNL------------------QPNPIFYELIYNLLPINDEILTSSHKNDDS
A7RKV1_NEMVE/1-693VVVFHKII.............TTGHQ---RLQ------------------PLFDCLLTIIVNVSPY..............
C5DFL0_LACTC/1-1131IIHLSNIA.............MNQVH---ENL------------------FLDPNLIEIIYNLLPM.........AHEKD
Q6FK58_CANGA/1-1248VIQLCNIA.............DYEVK---NNI------------------QPNPIIYETLYNLIPIDPKWLASDTSGADD
Q6DGD7_DANRE/1-801IVVFHKII.............TSGHQ---RLQ------------------PLYDCLLTIIVNVSPY..............
Q6BSE0_DEBHA/1-924VTQICKLLITLSSGSN.....NTNNA---KPS------------------LLLTTLVEILYNLIPV..............

PF09742

DYM_DROME/1-676ILIVIRTI-------------QYNML...KMR................DKYLHTNCLAALANMSGH--------------
B0WBZ3_CULQU/1-681ILVVIRTI-------------QYNML...KMR................DKYLHTNCLAALANMSGQ--------------
DYM_XENTR/1-646ILVVIRTI-------------QYNMT...RTR................DKYLHTNCLAALANMSAQ--------------
A7RPK6_NEMVE/1-620VLVVLRTI-------------QYNMT...KMR................DKYLHTNCLATLANMSSQ--------------
C3Z701_BRAFL/1-763IIVFHKII-------------TTGHQ...RLQ..................PLFDCLLTIIVNVSPY--------------
A7RKV1_NEMVE/1-672VVVFHKII-------------TTGHQ...RLQ..................PLFDCLLTIIVNVSPY--------------
Q3UU20_MOUSE/1-763IVVFHKII-------------TSGHQ...RLQ..................PLFDCLLTIVVNVSPY--------------
Q6DGD7_DANRE/1-780IVVFHKII-------------TSGHQ...RLQ..................PLYDCLLTIIVNVSPY--------------
Q7Z135_CAEEL/1-705ILVIHKLI-------------TTGNY...RLQ..................TLFDCFLTIMVNVSPY--------------
A8NNK7_BRUMA/1-700ILVFHKLI-------------TTGNH...RLQ..................SLFDCLLTIIVNVSPY--------------
B7S488_PHATC/1-694TITLHKLV-------------VNGAY...KLV..................PLYSCFLTIITNISPY--------------
Q6C5S1_YARLI/38-656SVITQP..-------------........REE................INPIIPTLVECIYNLSVQ--------------
Q4CSH4_TRYCC/1-696VVVLAHGI-------------LRAMN....ER................NEPLASVFVPSLSNLAPF--------------
C1FEV8_MICSR/1-966VLVLCRVA-------------RGGGIEKGDVTSGEGGIEPAT......SSFARACALAALANSAPY--------------
Q5CRW2_CRYPI/1-761IAVLLRAM-------------FYNYK...FGK................DIYLCSIIYSIIENISIY--------------
B6A9V3_CRYMR/1-807ILTLIKLL-------------LWNSK...THS................DIFLCELACVIIQNLSSS--------------
A2ETH4_TRIVA/1-444LRDLISYT-------------RHNLK...DES................HHQAINTALSVCVNLARK--------------
Q01H67_OSTTA/7-725FVVLSRAL-------------KYNCS...EST................KISRDLSVLGVIANMAGV--------------
A4RQD6_OSTLU/1-676VVVLSRTI-------------KYNVA...KTA................TVSKMLNALGSIANMACV--------------
A2ZYB0_ORYSJ/1-682VVILIRTI-------------KYNLS...KLR................DVYLHTNCLAILANMAPH--------------
Q8RWV1_ARATH/1-679VIILIRTV-------------QHNLS...KLR................DVYLQTTCLATLANMAPH--------------
B9RTK0_RICCO/1-498VIILIRTV-------------KYNLS...KLR................DLYLHTTCLATLANMAPH--------------
B3RI35_TRIAD/1-583VLIVIRTI-------------QFNMA...KMR................DKYLHTNCLAALANMSAH--------------
A8WTE9_CAEBR/1-690ALVFIRAI-------------QKNAL...KTKVSSVFLFPNTIPLIKQDRYLHTNCLAALANMSAF--------------
A8Q618_BRUMA/1-661ILVFVRII-------------QLNTL...KTK................DRYLHTNCLAALANMSSY--------------

PF12722

Q2GWB4_CHAGB/1-825.........................LEGLSGPTCSRIMQLFNSMSSPSFLLA............................
B9W786_CANDC/1-930...VSSEEAMGFKTETSKKLNNPNPRGGLSYQSSSSITQLVSVLSNKRFLLE............................
B6JW01_SCHJY/1-778.........................VDNITIASSRRLVKLFVNVSDLGFLLA............................
C3Z701_BRAFL/1-784.........................LKSLSMVASTKLLHLLEAFSTPWFLFS............................
A7TNQ6_VANPO/1-1209.EELIKLSGNRNESPSATS......NGGLNYNASITLLHLISKLSNKMYLTSN.SIPNSAQSN............N...F
A6RRS3_BOTFB/1-641.........................LENISAPTSSKLLQLFASMSSPGFLLS............................
B6HUK2_PENCW/1-841.........................IERISPSACSKVIQLFTSMSSPSFLLA............................
Q3UU20_MOUSE/1-784.........................LKSLSMVTANKLLHLLEAFSTTWFLFS............................
Q5ASC1_EMENI/1-732.......................................LFTSMSAPSFLLA............................
C4XYD9_CLAL4/17-927.....VNDSIVGTDDTSKRMNNVNSKGGLSYQACSALLQLMSTLSSKQALAE............................
C5K8E7_PERM5/1-865.........................VRTFCLESCIKILNLVERFSKPHWLFK............................
B8M9N3_TALSN/1-838.........................VERLSSTACSKILQLFASMSSPSFLLA............................
C5FVH3_ARTOC/1-827.........................AQRLSPACAFKILQLFVSMSSPSFLLA............................
A3LX71_PICST/1-905....VATKSLEATNDPAKKLTNSNPNGGLSYSTCSVINLLIGKYSSRTFLQE............................
A8WRZ4_CAEBR/1-727.........................MKSLSMVAANKLVHLVEAFSTPWFLFS............................
Q0E9B5_DROME/1-834.........................LKTLSMVASVKMLHLLEAFSTPWFLLS............................
C0NTS7_AJECG/1-843.........................CEHLSATTCSKIIQLFSLLSSPSFLLA............................
YIOC_SCHPO/1-796.........................AQNLNSHSSQSLFELFQSASYPGFLIS............................
A8NNK7_BRUMA/1-721.........................LKSISMIAANKLIHLIEAFSTPWFLFS............................
C5DS55_ZYGRC/1-1145.EELVQLSSKKRPKNIG........SGGISYNAAMPLLHLLSKMSNKNYLTTYASSPSGASRG................F
Q0UAJ2_PHANO/1-733.......................................LFASMSSPSFLFA............................
B0WUT2_CULQU/1-851.........................LKTLSMVASIKLLHLLEAFSTPWFLYS............................
A7A1V5_YEAS7/1-1223HDDLILLSAKKKSASPSAATSSHTSSSKLSYNAAMSLLYVLSKSSNKVYLTTY....ATPVFK............TKDIP
A7RKV1_NEMVE/1-693.........................LKSLSMVAANKLLHLLEAFSTPWFLFA............................
C5DFL0_LACTC/1-1131GGELVQLSSERSNK...........LTGLSYNACVALLQLISKMTSKNYLTTFAGEKGDPDSSGNSSDATINKPDEKAKP
Q6FK58_CANGA/1-1248.EELTLLSRKKSINSSGNGLKS...CERLSYNASLAVLHLISKMSSRNYLTTY.STPRIASMV............TSIPA
Q6DGD7_DANRE/1-801.........................LKSLSMVAANKLLHLLEVFSSPWFLFS............................
Q6BSE0_DEBHA/1-924....VSSKDIEVKDDPEKKLGNSNPRGGLSYGACSSITQLILKFSTRPFLLD............................

PF09742

DYM_DROME/1-676-------------------------FRALHPYVAQRLVSLFETLARKHTRLD----------------------------
B0WBZ3_CULQU/1-681-------------------------FRSLHPYVAQRLVSLFETLAKKHARLD----------------------------
DYM_XENTR/1-646-------------------------FRSLHQYAAQRIISLFSLLSKKHNKVL----------------------------
A7RPK6_NEMVE/1-620-------------------------FHALHPYVTQRIVSLYALLSKKHAKVT----------------------------
C3Z701_BRAFL/1-763-------------------------LKSLSMVASTKLLHLLEAFSTPWFLFS----------------------------
A7RKV1_NEMVE/1-672-------------------------LKSLSMVAANKLLHLLEAFSTPWFLFA----------------------------
Q3UU20_MOUSE/1-763-------------------------LKSLSMVTANKLLHLLEAFSTTWFLFS----------------------------
Q6DGD7_DANRE/1-780-------------------------LKSLSMVAANKLLHLLEVFSSPWFLFS----------------------------
Q7Z135_CAEEL/1-705-------------------------MKSLSMVAANKLVHLVEAFSTPWFLFS----------------------------
A8NNK7_BRUMA/1-700-------------------------LKSISMIAANKLIHLIEAFSTPWFLFS----------------------------
B7S488_PHATC/1-694-------------------------WKSMSLVAAVKLVNLFELFASPKFLYS----------------------------
Q6C5S1_YARLI/38-656-------------------------AKHIDYTVSCQLVDIFDVLSSPSFLFA----------------------------
Q4CSH4_TRYCC/1-696-------------------------IYDIDAYTSQQLIRLLVLIIRKLRRSS----------------------------
C1FEV8_MICSR/1-966-------------------------FDGLTSAASQRLVAVFDVLHRRRRKRV----------------------------
Q5CRW2_CRYPI/1-761-------------------------MKNFHWHVAEKITHYLIFLSSQIYCSL----------------------------
B6A9V3_CRYMR/1-807-------------------------VENFHWIVSEKTLQYCNILISRINGIL----------------------------
A2ETH4_TRIVA/1-444-------------------------LNNFDSETGEPLIGLIRVL......LV----------------------------
Q01H67_OSTTA/7-725-------------------------TRDISGYAAQRLVNILELLTKKRARLL----------------------------
A4RQD6_OSTLU/1-676-------------------------TRDISGYAAQRLVNTLALFTRRYFKIT----------------------------
A2ZYB0_ORYSJ/1-682-------------------------VHRLSAYASQRLVSLFDMLSRKYTKLA----------------------------
Q8RWV1_ARATH/1-679-------------------------AHHLSAYASQRLVSLFYMLSRKYNKLS----------------------------
B9RTK0_RICCO/1-498-------------------------VHRLSAYASQRLVSLFYMLSRKYNKLA----------------------------
B3RI35_TRIAD/1-583-------------------------FRALHPYVAQRLLSLYGILSKKHAKVS----------------------------
A8WTE9_CAEBR/1-690-------------------------FKNLAPIVCQRLISLLDLLTKRHAKMV----------------------------
A8Q618_BRUMA/1-661-------------------------FKNLPSVVCQKLIGLLEVFTRRHAKLI----------------------------

PF12722

Q2GWB4_CHAGB/1-825....NDSNHSL---------------------------------------------LRSLLEAINAIVE--HQFSR....
B9W786_CANDC/1-930....KSFHPDL---------------------------------------------VALLIRAICAAVT--KFPVP....
B6JW01_SCHJY/1-778....NPTNFKS---------------------------------------------TKNVYKIFGNLLR--RRFSQ....
C3Z701_BRAFL/1-784....NPSNHHL---------------------------------------------VFFLLEVFNNIIQ--YQFDG....
A7TNQ6_VANPO/1-1209YACSPGYKLDL---------------------------------------------LSLVLRSMLNYIV--YYYEE....
A6RRS3_BOTFB/1-641....NDSNHDL---------------------------------------------LQSLLESMNAIIE--HQYPT....
B6HUK2_PENCW/1-841....NESNHTL---------------------------------------------LASLLDFINIMLE--HKFTD....
Q3UU20_MOUSE/1-784....ASQNHHL---------------------------------------------VFFLLEVFNNIIQ--YQFDG....
Q5ASC1_EMENI/1-732....NESNHAL---------------------------------------------LASVLESINAILE--HKF......
C4XYD9_CLAL4/17-927....SYRNAEF---------------------------------------------LALILRALCSAAT--KNPVP....
C5K8E7_PERM5/1-865....GPLNHNA---------------------------------------------VFFLVESLNNVIQ--YQYEG....
B8M9N3_TALSN/1-838....NETNNYL---------------------------------------------LSALLEFMNVVLE--HQFTR....
C5FVH3_ARTOC/1-827....NETNHLL---------------------------------------------LSSLLEFINTVLE--HQFSK....
A3LX71_PICST/1-905....KSINSDL---------------------------------------------LALLIRAVCTAAL--KYPKS....
A8WRZ4_CAEBR/1-727....SPTNPQL---------------------------------------------VFSLLEVFNNVIQ--YQFDG....
Q0E9B5_DROME/1-834....APSNHHL---------------------------------------------VFFLLEIFNNIIQ--YQFDG....
C0NTS7_AJECG/1-843....NESNHIL---------------------------------------------LHSLLEFFNSVLE--HQYSN....
YIOC_SCHPO/1-796....NDVNHKI---------------------------------------------LKYVIGAINNAIQ--YAQKY....
A8NNK7_BRUMA/1-721....SPTNHLL---------------------------------------------IFFLLEVLNNIIQ--YQFDG....
C5DS55_ZYGRC/1-1145YPCSPGYKLDC---------------------------------------------LALLLRVISIYVI--LYFEE....
Q0UAJ2_PHANO/1-733....NENNHTL---------------------------------------------LQSLLEVLNAMIE--HQYQRKYIT
B0WUT2_CULQU/1-851....APSNHHL---------------------------------------------VFFLLEIFNNIIQ--YQFDG....
A7A1V5_YEAS7/1-1223YMISPGFKMDL---------------------------------------------LALLLRSITIFFT--LYFDD....
A7RKV1_NEMVE/1-693....NPTNHHL---------------------------------------------VFFLLEIFNNIIQ--YQFDG....
C5DFL0_LACTC/1-1131YAFSPGFKLDT---------------------------------------------LALLLHAFNSCIF--NYFRD....
Q6FK58_CANGA/1-1248YVLSPGFKLDL---------------------------------------------LAILLRAVSLYVV--SNTDE....
Q6DGD7_DANRE/1-801....TPVHHHL---------------------------------------------VFFLLEVFNNIIQ--YQFDG....
Q6BSE0_DEBHA/1-924....ASFNADL---------------------------------------------LALIFRSVCTAII--KYPKP....

PF09742

DYM_DROME/1-676----AQLKEPA...........DSAVFV....NVSTTPEDMLQD.....LSVLEEVLRMVLEILNSCLT..NQLVY----
B0WBZ3_CULQU/1-681----QQLRQPA.AVAANGDAAAVVAVPI....VAGSNPDDMLQD.....LSVLEEVLRMVLEILNSCLS..HQLVY----
DYM_XENTR/1-646----EQATQSL............RGSLG....SDESPLPDYAQD.....LNVIEEVIRMMLEIINSCLT..NSLHH----
A7RPK6_NEMVE/1-620----EHIKQLE......TTPLVTENGGP....DHAAGSHDADSEHYMADLAILEEVLRMVLEIINSCVT..NTLHH----
C3Z701_BRAFL/1-763----NPSNHHL.............................................VFFLLEVFNNIIQ..YQFDG----
A7RKV1_NEMVE/1-672----NPTNHHL.............................................VFFLLEIFNNIIQ..YQFDG----
Q3UU20_MOUSE/1-763----ASQNHHL.............................................VFFLLEVFNNIIQ..YQFDG----
Q6DGD7_DANRE/1-780----TPVHHHL.............................................VFFLLEVFNNIIQ..YQFDG----
Q7Z135_CAEEL/1-705----SPTNPQL.............................................VFSLLEVFNNVIQ..YQFDG----
A8NNK7_BRUMA/1-700----SPTNHLL.............................................IFFLLEVLNNIIQ..YQFDG----
B7S488_PHATC/1-694----GEFAHRH.............................................LALLLEVFNNIIQ..YQYHG----
Q6C5S1_YARLI/38-656----NSTNRFL.............................................LELTLESINAMLE..YNFQA----
Q4CSH4_TRYCC/1-696----GLIQMDE...........KEVSLT....TESTIREGAAEMKEDTESQMFLRQLKLLVEAVEAMLQ..GEDRQ----
C1FEV8_MICSR/1-966----SAAMGRP.....................GIEPGSDGL.....RGRTGLPTAVAALVSAALASALV..TSASK----
Q5CRW2_CRYPI/1-761----NTYNGDR.....................SNLRFFNRF.....YCGILMHKSLLKLIIESLKD.....ENLLS----
B6A9V3_CRYMR/1-807----SLQYDKK......................SEISFSNT........IYCTSLTLRNLLLIVGSCLATNNKVIS----
A2ETH4_TRIVA/1-444----SKIGNRA..........................................SQYLRLITMFIESVLV..NRLKN----
Q01H67_OSTTA/7-725----SAENKDL...............QE....QALHTPRSE........IAVCEDFIRIAFEILNCLTTDLNSLEQ----
A4RQD6_OSTLU/1-676----RENALSS.....................DGLREPFSD........ADVCEDFIRVIFEILNCLATDLDSLEH----
A2ZYB0_ORYSJ/1-682----ELKNDKA.................IKVISDQIEADNI.SDDTSTELHIYTDFLRIVLEIINAILT..YALPR----
Q8RWV1_ARATH/1-679----DLTGDKL.........QSIKINLS....GEDVGVSED....LAAELQIFTDFLRLVLDILNAILT..YALPR----
B9RTK0_RICCO/1-498----ERIDDKI...........GKNGTA....EQDSLAEDMSAE.....LHIYTDFLRIVLEILNATLT..YALPR----
B3RI35_TRIAD/1-583----EKMRQYASQQKNDNKSHEESESIL....EEYQESSDYAAD.....LAILEEVIRMVLEIINSCLT..HSLKY----
A8WTE9_CAEBR/1-690----DHMRVSS...........QNDVAG....GQPINFHDD........ITALEEGIRTLLEIINSALC..GGLRH----
A8Q618_BRUMA/1-661----ENMRVRA..........EYDIIQE....KESHNYHKD........ITALEEGIRTLLEICNSCLS..SNLRS----

PF12722

Q2GWB4_CHAGB/1-825............NPNFIFAILR------NR-KRFEALRSLTLESGQEEVERRNQ.............RRKDS........
B9W786_CANDC/1-930............SRMLLFCILK------NE-KVYDELWNTIFSFSGVFFRGNSL..........................
B6JW01_SCHJY/1-778............NPKFVYTVLR------AH-ETLCSTIPANFSRAKEIVTQNQP..........................
C3Z701_BRAFL/1-784............NANLVYTIIR------KR-NVFHQLANLPTDRASIEKAVSRK..........................
A7TNQ6_VANPO/1-1209............SLNLLFALTR------HQ-KVLLQVRESLLTISKSIDSKSSMEGVNKV.......QETEYYDFRE.NT
A6RRS3_BOTFB/1-641......................------..-.....LRHFTLESGQEEIERRNR.............RKK..........
B6HUK2_PENCW/1-841............NPYLVYSILK------YR-QRFEAVRAFTLESGQQEIERQNE.............RRKA.........
Q3UU20_MOUSE/1-784............NSNLVYAIIR------KR-AVFHQLANLPTDPPSIHKALQRR.............R............
Q5ASC1_EMENI/1-732...............MIYAILK------YR-RRFEAVREFTLESGQQEIERQNQ.............RRK..........
C4XYD9_CLAL4/17-927............SRMLLFSFVK------NE-KIYDSIWTSIYSLESENINGEPL..........................
C5K8E7_PERM5/1-865............NHQLVYSVLR------HK-EVFDSLKQLRLPKSS..................................
B8M9N3_TALSN/1-838............NPFLVYGILK------TR-KKFESLRTFTLESGQQEIERQNQ.............LKK..........
C5FVH3_ARTOC/1-827............NAYMVYVVLK------SR-HRFESLRAFTLESGQQEIEQQNQ.............LRKAT........
A3LX71_PICST/1-905............SRMLLFSILK------NA-KVYDQVWNTIYSFRTEYFNGNKL..........................
A8WRZ4_CAEBR/1-727............NSNLIYTIIR------KR-NVFYQLSNLSVDSASIAKTLSGR.............KSKS.........
Q0E9B5_DROME/1-834............NSNLVYTIIR------KR-HVFHAMANLPTDMAGIAKCLSGR.............KTGGKFNLPRVPQ
C0NTS7_AJECG/1-843............NPLLVYSILK------SA-KRFEALRAFTLESGQEEIERLNQ.............RRKVNQI......
YIOC_SCHPO/1-796............NAPLLYFFSM------HK-DYIEAVSALSFDAIMSVRNSSAE..........................
A8NNK7_BRUMA/1-721............NSNLVYTIIR------KR-QVFYQLANLSSDSAYIMKMLQGR.............K............
C5DS55_ZYGRC/1-1145............AKNLTFALCR------HQ-RILFQVKDSIDTISKNLNGSV...............QDLKIDDYFE...
Q0UAJ2_PHANO/1-733NDTILVSDTTPDNPNLIYAIVR------SR-KRFQALRDFTLESGQEEIERQNQ.............LRK..........
B0WUT2_CULQU/1-851............NSNLVYTIIR------KR-QVFHALANLPTDAAGIARCMSNR.............KGGKLNNSSHGSR
A7A1V5_YEAS7/1-1223............AENLLFAMVR------HQ-SITHQINDSINSISKALDMNPNLNSHIMTLKQMGFNRKVQWKDFYQFE.
A7RKV1_NEMVE/1-693............NSQLVYAIIR------KR-NIFHQLANLPTDPATIQKPKRKE.............H............
C5DFL0_LACTC/1-1131............SKHLLFVLCR------HA-RVVQRLDEILQEISSEINYVYDR.............QDSRASL......
Q6FK58_CANGA/1-1248............AMNLIFAFAR------HK-SVILQLSEVMNSIAKNFSPTNTQISTTD........KNIRLRDFYRLHD
Q6DGD7_DANRE/1-801............NSNLVYGIIR------KR-SLFHQLANLPTDITLIQKALQRK.............K............
Q6BSE0_DEBHA/1-924............SRMLLFSMLK------NE-KVYDQVWSTIYSFSTEYFSGDTL..........................

PF09742

DYM_DROME/1-676------------CPNLVYTLLY......KR.SVFEGFRS........H......--------------------------
B0WBZ3_CULQU/1-681------------CPNLVYTLLY......KR.NVFEAFRS........H......--------------------------
DYM_XENTR/1-646------------NPNMVYALLY......KR.ELFEQFRS........H......--------------------------
A7RPK6_NEMVE/1-620------------NPNLVYTLLH......RR.ELFAQFRT........H......--------------------------
C3Z701_BRAFL/1-763------------NANLVYTIIR......KR.NVFHQLANLPTDRASIEKAVSRK--------------------------
A7RKV1_NEMVE/1-672------------NSQLVYAIIR......KR.NIFHQLANLPTDPATIQ......--------------------------
Q3UU20_MOUSE/1-763------------NSNLVYAIIR......KR.AVFHQLANLPTDPPSIH.....K--------------------------
Q6DGD7_DANRE/1-780------------NSNLVYGIIR......KR.SLFHQLANLPTDITLIQ..KALQ--------------------------
Q7Z135_CAEEL/1-705------------NSNLIYTIIR......KR.NVFYQLSNLSTDAASIA......--------------------------
A8NNK7_BRUMA/1-700------------NSNLVYTIIR......KR.QVFYQLANLSSDSAYIMKMLQGR--------------------------
B7S488_PHATC/1-694------------NSHLVYAIVR......RK.DAFGQIAALTLENAQAQ......--------------------------
Q6C5S1_YARLI/38-656------------NKSLVFVLQK......RR.SSFEKLHRLVKEKGKEP......--------------------------
Q4CSH4_TRYCC/1-696------------NDSLVYELLY......NRSKLQEGISA...DSPCSH......--------------------------
C1FEV8_MICSR/1-966------------CPELVYAALQ......RRDEVFAPFLDEFLDPVKDR......--------------------------
Q5CRW2_CRYPI/1-761------------NSELIYIIIK......FS..LITEIQKL..............--------------------------
B6A9V3_CRYMR/1-807------------NIQLAYAFIRISFSNEAK..KLQEMINIDFKTSSSN......--------------------------
A2ETH4_TRIVA/1-444------------NEELLYSVMRSSDVIKKLYYIKDNVDD...............--------------------------
Q01H67_OSTTA/7-725------------NPEIVYALMH......KE.ELVVGYRT........D......--------------------------
A4RQD6_OSTLU/1-676------------NPEIVYALMH......RE.ELLTTYRT........H......--------------------------
A2ZYB0_ORYSJ/1-682------------NPEVVYAILH......RQ.EVFQPFKN........H......--------------------------
Q8RWV1_ARATH/1-679------------NPEIVYAIMH......RQ.EVFQPFKN........H......--------------------------
B9RTK0_RICCO/1-498------------NPEVVYAIMH......RQ.EVFQPFKN........H......--------------------------
B3RI35_TRIAD/1-583------------NPHLIYAMLH......QK.ELFIQFRT........H......--------------------------
A8WTE9_CAEBR/1-690------------NTHLIYNLLY......HR.ALFDAYVQ........H......--------------------------
A8Q618_BRUMA/1-661------------NPHFIYTILY......KR.DLFDAFQN........H......--------------------------

PF12722

Q2GWB4_CHAGB/1-825.................................GAPLDPLEPNSTRSSMESIMSPT.TQPSRAPTLGDVP.EEDSTFAIG
B9W786_CANDC/1-930.....................................TRIEDESDESPSENT...................EADTSIASY
B6JW01_SCHJY/1-778..............DMSVYLSSSNKTYTKHIFERALLDEKLNAEKRQNGYSTRDRRHRRIEKLYRDVDHS.SLESSVSVT
C3Z701_BRAFL/1-784...................................RKGSEASQRPVPHSPAVTDPPSMEGSFPAQEAQPG.TLKATLAEM
A7TNQ6_VANPO/1-1209LLLQKSKKMTGNNNSQNSRRWAPDSINNNSSSVEVLNQYILLDKKLKSTELTDNESNDNDEISAQTNHVH.KNSENNTAR
A6RRS3_BOTFB/1-641.................................ERLAESGDVDSRRGSADSMRSPSISHPRGAPALSNVP..EEDTFAIG
B6HUK2_PENCW/1-841.................................GSSSDVATSPTLSQSEDDLHTPS...GARSP.LTRIP.EENSPFAIG
Q3UU20_MOUSE/1-784.........................................RTPEPLSRTGSQEGTSMEGSRPAAPAEPG.TLKTSLVAT
Q5ASC1_EMENI/1-732.................................SENRDSIASPVLSASDEDPRLSS...GARSP.LGRIP.EENNPFAIG
C4XYD9_CLAL4/17-927...................................RLMNVQEDDEENEDSPVNFQERGNDSLQMNMHAQR.ELPKSLLKS
C5K8E7_PERM5/1-865...............................................................PSTSTVP.SIVDESSME
B8M9N3_TALSN/1-838.................................AASSTDGLTGSASQSMEDLRRSS...GARSS.LTHIP.EENSPFAIG
C5FVH3_ARTOC/1-827.................................SSSSGDFSTNSRTHARDSYEAGN....GRRP.LSHVPEEEDGTFAIG
A3LX71_PICST/1-905.....................................NRIDDGEEENENILSVVNSNNSE...........RFKPESETT
A8WRZ4_CAEBR/1-727.................................ANRDEMVDQLKSPTTANPPEFPAAGASSSTPPASSGP.STTAGLAAT
Q0E9B5_DROME/1-834RRTPAVSQELPSAHVPEEYNEEDEDEDEEEIINEEPKAEEDLESETESHERSQAGELQSDVLTAQPAEPG.TLKTSLLDT
C0NTS7_AJECG/1-843.................................SGNSDALLSPTVSHSGDDNRGSG...AGRRQ.LSHVP..EDGAFAIG
YIOC_SCHPO/1-796..............GDSAYWTRNGKTFS.....SKAFDSILLSRLRYVRSKSPTPYYPIESSEFGFTNLK.DVTSKDEIT
A8NNK7_BRUMA/1-721.................................GRKSGAVAESKSIAVAKSVDDVENKANI............KATLAET
C5DS55_ZYGRC/1-1145......................................HAFNFNSVDKGSTTPSRDNNEENKVYSNQALI.FNNKGMSTT
Q0UAJ2_PHANO/1-733.....................................EGASELQRTNSIDSIRSPT...VSRTPTLGNVP.EENSAFAIG
B0WUT2_CULQU/1-851SSGREQLQNKEVLPSTSHAEDDSEEDITVRTG.QIQIQDRHSDEEESDSRSEIIEESMEGSHPALPAEPG.TLKVTLLET
A7A1V5_YEAS7/1-1223.................................EITDLPQVNLYSSANQQHQNQQQGQNDNRGQNQNEDPGQENESPTPY
A7RKV1_NEMVE/1-693.....................................................IPNMREGEHSRSPEDPV.S.....RAT
C5DFL0_LACTC/1-1131.................................KPNSLFISDFFDDSLPYDVRISQANTGLQSFSGSEYSLMEKAQLQSL
Q6FK58_CANGA/1-1248LSYNNINFRKAFNNDE.................GFHRSSSPNLIKSNNGKNNDNNDSDNDSMDMNSSAYL.VLTKPIARE
Q6DGD7_DANRE/1-801......................................SRSNSIHNAVFMEISNPYSSEGLSKTTPAQTG.TLNASLKDI
Q6BSE0_DEBHA/1-924...................................VLNSIDDNEDENISPLQQIDSNRSDQVSISSSIES.EANDSIFIN

PF09742

DYM_DROME/1-676-----------------------------------.............................................
B0WBZ3_CULQU/1-681-----------------------------------.............................................
DYM_XENTR/1-646-----------------------------------.............................................
A7RPK6_NEMVE/1-620-----------------------------------.............................................
C3Z701_BRAFL/1-763-----------------------------------RKGSEASQRPVPHSPAVTDPPSMEGSFPAQEAQPGTLKATLAEMP
A7RKV1_NEMVE/1-672-----------------------------------.............................................
Q3UU20_MOUSE/1-763-----------------------------------ALQRRRRTPEPLSRTGSQEGTSMEGSRPAAPAEPGTLKTSLVATP
Q6DGD7_DANRE/1-780-----------------------------------RKKSRSNSIHNAVFMEISNPYSSEGLSKTTPAQTGTLNASLKDIP
Q7Z135_CAEEL/1-705-----------------------------------..........................KTLSGRKSKSANRDEMVDQ
A8NNK7_BRUMA/1-700-----------------------------------KGRKSGAVAESKSIAVAKSVDDVENKANIKATLAETPLVSAMTEK
B7S488_PHATC/1-694-----------------------------------.............................................
Q6C5S1_YARLI/38-656-----------------------------------.............................................
Q4CSH4_TRYCC/1-696-----------------------------------.............................................
C1FEV8_MICSR/1-966-----------------------------------.............................................
Q5CRW2_CRYPI/1-761-----------------------------------.............................................
B6A9V3_CRYMR/1-807-----------------------------------.............................................
A2ETH4_TRIVA/1-444-----------------------------------.............................................
Q01H67_OSTTA/7-725-----------------------------------.............................................
A4RQD6_OSTLU/1-676-----------------------------------.............................................
A2ZYB0_ORYSJ/1-682-----------------------------------.............................................
Q8RWV1_ARATH/1-679-----------------------------------.............................................
B9RTK0_RICCO/1-498-----------------------------------.............................................
B3RI35_TRIAD/1-583-----------------------------------.............................................
A8WTE9_CAEBR/1-690-----------------------------------.............................................
A8Q618_BRUMA/1-661-----------------------------------.............................................

PF12722

Q2GWB4_CHAGB/1-825DDEDDSDD..EARPTPAASSP...SDNPSGASSVASAADDDVPRQLQGMSEKARGKMPAGATNFSRQNSTTSLGGPVAG.
B9W786_CANDC/1-930DSTKDEVL..GSTVKPIPIPIPIP.......................TNKYEDDGTVKSASVETENIEASLRPNLPTGMS
B6JW01_SCHJY/1-778HPEEKPFR..QGKDSETQNEQFFT............................RAAPLSQSNIDYNTDVNGESKLLDSIVP
C3Z701_BRAFL/1-784PGIERLTE..KMEASSLAEQAAED................ADTPGAAGPSPSDTETSVQPDLRGAVKRTASMSSRE....
A7TNQ6_VANPO/1-1209GLRDYSDN..NNNHSNATLQNNSNNNHLELMKTNSNSTVINGNKGYEIHEHMDYEDNIYFN..NRKIFLAFRPEWPIGIG
A6RRS3_BOTFB/1-641DDDDEDSD.GEERATPAASPP...TDHPSRASSISSSIDDTVPTQLRGMSEKARGKMPAGMPTFSRHNSTTSLSSYAAF.
B6HUK2_PENCW/1-841DDDSDDEREEEGTQTPSQSSF...SAQTSRRPSTTSTMDENGVQQVRAMSEKARGKKPAGHPPFSRQNSMTSQTSMSALF
Q3UU20_MOUSE/1-784PGIDKLTE..KSQVSEDGTLRSLE...............PESQQSSAENSPSDGESSQTWREQRRLSNASA.........
Q5ASC1_EMENI/1-732GDDSEDEG..DGRHTPPQDSA...SVQTSRRQSMSSVIDESVPLQLRGMSEKARGKMPAGQPSFSRQNSMTSQISMSAIF
C4XYD9_CLAL4/17-927PDEYSISS..FTSTEEIASPLYQS....................FNSSTASIGPEERDESFTEEKELENALRPKPPAGMS
C5K8E7_PERM5/1-865SDNAAAGQ..EKSSQETSAQQAVN.......................EFDEYGRAVGSPESRVKKQTALMHQAAGASGDP
B8M9N3_TALSN/1-838GDDSEDEG..EIPTTPSQSSP...SLRNSRAPSISSSLDDSVPLQVRGMSEKARGKRPAGQMGFSRQNSLTSLSSYSATI
C5FVH3_ARTOC/1-827DDDSDEEG..DGGQPASQVTS...PTAESFCSAPVSPLDESVPLQLRGLSEKARGKMPAGQPTFSRQNSMTSLNSYAPTV
A3LX71_PICST/1-905DSESPQTR..KNSMFGIGTPPMTI..............................PEESQQSDAEEELEASLRPKLPTGMS
A8WRZ4_CAEBR/1-727PALASMT........................................................GNVGNWEEKPESQ....
Q0E9B5_DROME/1-834PGITQMTE..REQAHPNDKPQVED..........STDIVPYDRSAASTPTDERKSTSPTELSRLSVAHRASIRMVPGE..
C0NTS7_AJECG/1-843DDDSDEEE.QEPQNTPSQSP....SRENSRAPSVASATDDSVPLQLRGMSEKARGKMPAGQVTFSRQNSTTSLSSYTPTI
YIOC_SCHPO/1-796DGFDKALR..SNSLRTHRDSRPVQ..................PLLKQRPQLHRALTESATLHGNDRSLEDTDEAKVEPIA
A8NNK7_BRUMA/1-721PLVSAMTE..K.....................................................GVNDLAQASDDV....
C5DS55_ZYGRC/1-1145PENRDTSG..DNTNDEPGIDNFVDDENYELSRYASDN...NMGKSIELLEYADLSINPIMS..DDKVFNGIRPKWPAGLT
Q0UAJ2_PHANO/1-733DDDDSDAD..EPHPTEAPQSPIHSPSGASRSASIASSIDEAVPLQLRGMSEKARGKMPVGQPAFSRQNSISSLSSLATPA
B0WUT2_CULQU/1-851PDIAQMTE..RESAHPSSADALAA.ATPSPVEPNAKSAIGGDGVKSGSSPKGSPSKEQPSPIKRAVAQRGSIRVTPTGTH
A7A1V5_YEAS7/1-1223LLFNPASL..ENETSGTVKHFSST................NHDKNYQVIAFIDFKSDSNLNLQHQLEYWPHRPQWPTPLT
A7RKV1_NEMVE/1-693PGPSHTQK..K.....................................................AIGRSASVSS......
C5DFL0_LACTC/1-1131LFFDAEKT..YSEEVEATAERIAN...............GSPNKTIELFEHSDKEHNPILS..STELLLALRPIRPLGLS
Q6FK58_CANGA/1-1248YSSDDLRN..NNLTTREHAGSNNN...........NNINSSNDKTLQVLEYVDFINDPIISLANESDYFKMRPKWPVGIS
Q6DGD7_DANRE/1-801PRIDKLTE..TSQVSEDGTTLLIQ..............HSESARSQSDHSSETRVQHNDPTSGEEDKNSANEDCDGSQKS
Q6BSE0_DEBHA/1-924NFTSPKSR..HGSNVSGSIPPSTP.............................EFDLNFFEDESQAIDSALRPKPPTGMS

PF09742

DYM_DROME/1-676........--......................................................................
B0WBZ3_CULQU/1-681........--......................................................................
DYM_XENTR/1-646........--......................................................................
A7RPK6_NEMVE/1-620........--......................................................................
C3Z701_BRAFL/1-763GIERLTEK--MEASSLAEQAAEDADTP........................GAAGPSPSDTETSVQPDLRGAVKRTASMS
A7RKV1_NEMVE/1-672........--..........................KPKRKEHIPNMREGEHSRSPEDPVSRATPGPSHTQKKAIGRSAS
Q3UU20_MOUSE/1-763GIDKLTEK--SQVSEDGTLRSLEPES.........................QQSSAENSPSDGESSQTWREQ...RRLSN
Q6DGD7_DANRE/1-780RIDKLTET--SQVSEDGTTLLIQHSESARSQSDHSS...............ETRVQHNDPTSGEEDKNSANEDCDGSQKS
Q7Z135_CAEEL/1-705LKSPTSTA--PPEIPAADAPAAQTLG.........................GVSTTTGLAATPALASMTGNVGNWEERPE
A8NNK7_BRUMA/1-700GVNDLAQA--SDDVQEG...............................................................
B7S488_PHATC/1-694........--...CHKVYGEQTAVKR.........................DIDAHLNVDNKGIPNMVGDDN...ASASS
Q6C5S1_YARLI/38-656........--......................................................................
Q4CSH4_TRYCC/1-696........--......................................................................
C1FEV8_MICSR/1-966........--...........................................................VDERKDSNPRE
Q5CRW2_CRYPI/1-761........--......................................................................
B6A9V3_CRYMR/1-807........--......................................................................
A2ETH4_TRIVA/1-444........--......................................................................
Q01H67_OSTTA/7-725........--......................................................................
A4RQD6_OSTLU/1-676........--......................................................................
A2ZYB0_ORYSJ/1-682........--......................................................................
Q8RWV1_ARATH/1-679........--......................................................................
B9RTK0_RICCO/1-498........--......................................................................
B3RI35_TRIAD/1-583........--......................................................................
A8WTE9_CAEBR/1-690........--......................................................................
A8Q618_BRUMA/1-661........--......................................................................

PF12722

Q2GWB4_CHAGB/1-825QSMSGQFQPSAHWMDSWLPEL..PLHTTLTV--L....QQLSVLIP-----RQALTSDAPTSA...--------.....T
B9W786_CANDC/1-930FNAREKLKKDTPLNKTWAGND..ALAVILTI--VIPHLKVVLNEV.-----.WSRVEGSSVDSYEL--------VQRIEK
B6JW01_SCHJY/1-778HAYDHTFTPTKQWYEEWRHQL..DIEPFTRL--V....ELVFPDVV-----RMRSE..........--------.....G
C3Z701_BRAFL/1-784...GGEWRPTSEWVQSWKQKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....K
A7TNQ6_VANPO/1-1209EKIKIKSPLDHDLSKTWGGAS..TLSLLIKF--V....RIMMKEFP-----TICTINTAEYFDLVK--------EISTFK
A6RRS3_BOTFB/1-641.SSSGAFEPTPQWIETWLPEL..PLHTILTL--I....DQV.....-----.DSLLSSPNNPSDTP--------SNNILR
B6HUK2_PENCW/1-841TPSASGFTPTVPWLESWLPEL..PLHTTLTI--I....SAIAPHIP-----GAALASAASPEARTL--------VHNLPS
Q3UU20_MOUSE/1-784...SGQWSPTSDWILSWKSKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....R
Q5ASC1_EMENI/1-732PSSSGGFTPTTAWLESWLPEL..PLHTILTI--I....SAIMPSIP-----ESAFQSS.NGESRTL--------ISNLPS
C4XYD9_CLAL4/17-927QKAKEKLPQDTPLSKAWGGKN..ALSVIITV--LIPEIKAKLKDL.-----.WIKRDECNYDNYFI--------VQQIEH
C5K8E7_PERM5/1-865SVAEDKWVPTEAWLEEWKNKLMQKMEAIYRL--F....NALYPKIV-----SECESEGVTDQNGVL--------.....E
B8M9N3_TALSN/1-838HSTAASFIPTAAWIESWVVEL..PLHTILTI--I....SSILPHIP-----DAALQSSSNPEARTL--------INNLPT
C5FVH3_ARTOC/1-827TTNARGFVPTSAWIETWVPEL..PLHTILTV--I....SAISHRIP-----AVALESSLNPEARTL--------ISELPS
A3LX71_PICST/1-905ERAREKLPKESSLKRSWGGND..SLRILLTI--VIPYLKVVLKEI.-----.WSSKDGPTVDSYLL--------VEHIEK
A8WRZ4_CAEBR/1-727...EEEWIATQEWAEAWKSKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....K
Q0E9B5_DROME/1-834...SDRWTPTPEWIVSWRSKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....K
C0NTS7_AJECG/1-843PTSSGGFAPTSSWIESWVPEL..PLHTIITL--I....SAITPHIP-----SSALQSTLNPDARTF--------ISNLPS
YIOC_SCHPO/1-796HSVDYTFKPTVEWWNKWWPSL..NFRTMLDI--F....TDLSLKIS-----DMKKA..........--------.....G
A8NNK7_BRUMA/1-721...QEGWMASTDWVESWKSKL..PLQTVMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....K
C5DS55_ZYGRC/1-1145SKSKAKLRAKSDLTSSWSGAN..CLLLLMRM--A....RLLLKQFP-----TISTISTKEYYQLLG--------EIAQFK
Q0UAJ2_PHANO/1-733LATNEFFTPSSAWLESWLSQL..PLHSILML--I....SQLGPKMP-----STSSNDTVAAL....--------.....E
B0WUT2_CULQU/1-851GSQAKVWQPSPEWVQSWRSKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....K
A7A1V5_YEAS7/1-1223FTHKCKNPKYENFNEVWSGTV..YLQILLRV--I....KQILSKVP-----EIPRIKSVQYFETLS--------KLSALR
A7RKV1_NEMVE/1-693...TGAFIATPEWVQSWKQKL..PLQTIMRM--L....QVLVPQVE-----KICIDKGLTDESEII--------.....K
C5DFL0_LACTC/1-1131FKSKLKTRKEGPLKDSWLGSQ..TLSILKRT--V....KIVNKMFP-----EIPQVTTATYIPLLR--------KLLESE
Q6FK58_CANGA/1-1248MKSKVKSSMKKDFVRSWQGND..SMVLLVKI--V....KVLLYDFP-----EIATINNSEYYVLLK--------KMEESK
Q6DGD7_DANRE/1-801ASSSSDWAPTPDWVLSWKSKL..PLQTIMRL--L....QVLVPQVE-----KICIDKGLTDESEIL--------.....R
Q6BSE0_DEBHA/1-924QKARDKLPKDAPLKRSWGGND..SLRIILTI--IIPHLKLVLKEI.-----.WSSREGPSIDSFLL--------VKYIES

PF09742

DYM_DROME/1-676...............HAFQDV--.IQNIDMV..V----GFFSSRLQ.....RVQEQRGE.LG............VNEVLE
B0WBZ3_CULQU/1-681...............SAFQDI--.IQNIDMV..V----GFFSSRLV.....RVQDQRGE.LG............VNEVLE
DYM_XENTR/1-646...............PSFQDI--.MQNIDMV..I----SFFSLRLE.....QAGAD....LS............VERVLE
A7RPK6_NEMVE/1-620...............PTFQDI--.IQNIDTV..L----AFFSARLE.....QHPDQT...LS............VGVVLD
C3Z701_BRAFL/1-763SREGGEWRPTSEWVQSWKQKL--PLQTIMRL..L----QVLVPQVE.....KICIDK.GLTD............ESEILK
A7RKV1_NEMVE/1-672VSSTGAFIATPEWVQSWKQKL--PLQTIMRM..L----QVLVPQVE.....KICIDK.GLTD............ESEIIK
Q3UU20_MOUSE/1-763ASASGQWSPTSDWILSWKSKL--PLQTIMRL..L----QVLVPQVE.....KICIDK.GLTD............ESEILR
Q6DGD7_DANRE/1-780ASSSSDWAPTPDWVLSWKSKL--PLQTIMRL..L----QVLVPQVE.....KICIDK.GLTD............ESEILR
Q7Z135_CAEEL/1-705SSQDNEWIATQEWADAWKSKL--PLQTIMRL..L----QVLVPQVE.....KICIDK.GLTD............ESEILK
A8NNK7_BRUMA/1-700......WMASTDWVESWKSKL--PLQTVMRL..L----QVLVPQVE.....KICIDKGL.TD............ESEILK
B7S488_PHATC/1-694SVNGVPFLPTADWLEDFKDSM--PIETVTRL..L----QHLVPVVD.....EIVAQKSGNVD............EQEILN
Q6C5S1_YARLI/38-656........TNGEEDLSWLEDL--PLDTIDTV..Y----AMIESSVPGLNTYSAVPPPSSSTSPASDEPKTTKDTPSTMID
Q4CSH4_TRYCC/1-696...............LAAAHA--ALVPLFRI..A----DYYETELA.....SVTSAES................YQDILG
C1FEV8_MICSR/1-966GLSHEGFHANDPELELAIHRM--REHAVAIHQRL----EFFNARVDAAREASTNHRPGSHWT............MDKAMD
Q5CRW2_CRYPI/1-761...............NIFLKR--CISNNE....I----SFFKSSLEGKISAPPVAEI.................LNSIIE
B6A9V3_CRYMR/1-807.....................--.IQETNRFVEL----EFCNKYTP.....EFTNQSPEKLKSCYFKINGIFFDIDSLLI
A2ETH4_TRIVA/1-444...............PDEIER--MVSNIEKI..I----AYFNPKVM.....ELGDKI...TD............YDSMLH
Q01H67_OSTTA/7-725...............AAFAEY--.VQNIECV..M----EHYHDAVR.....SKGADSP..MS............VGCIKR
A4RQD6_OSTLU/1-676...............EVFAEY--.VQNIETV..L----QHYKDAVESAQNRETDSP....IS............VRRLKR
A2ZYB0_ORYSJ/1-682...............PRFNEL--.LENIYTV..L----DFFNSRMDMQ...QLDGE....WS............VDKVLE
Q8RWV1_ARATH/1-679...............PRFHEL--.VENIYTV..L----DFFNSRMD.....SQRSDRE..WS............VQKVLQ
B9RTK0_RICCO/1-498...............PRFNEL--.IENIYMV..L----DFFNSRMDA....QTQDGE...WS............VEKVLQ
B3RI35_TRIAD/1-583...............PIFQDI--.IQNIETV..L----TYFNTRLE.....ETGESN...LS............VETVFR
A8WTE9_CAEBR/1-690...............PMFQDL--.LVNIAAV..I----SHFSSKVV.....HVPAGD.................GMTMMQ
A8Q618_BRUMA/1-661...............PMFQDL--.IWNICAV..I----NHFASRVQ.....LLERG....SS............VSAILA

PF12722

Q2GWB4_CHAGB/1-825LAKIREVQ------------------------------LIGV.......DP--------------SPVRVHSFEWSPLAL
B9W786_CANDC/1-930AGFDKVFE------------------------------ANKSQLCYDLLPN--------------TPLDQLRFNWSHLSL
B6JW01_SCHJY/1-778FSSQQIFQ------------------------------ALSNCELYDDQPA--------------EPPSFETSTWRDELA
C3Z701_BRAFL/1-784FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANSGTT
A7TNQ6_VANPO/1-1209EGFVDEAK------------------------------QLLPIYLKDHNEP--------------HVLKLDLTNSNFILK
A6RRS3_BOTFB/1-641TIQKAEIR------------------------------GI.........ET--------------TAIRIHSFEWTPLSL
B6HUK2_PENCW/1-841FADEPEVK------------------------------SIIS.......EP--------------TPVRVQSFEWSALSM
Q3UU20_MOUSE/1-784FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANSGTA
Q5ASC1_EMENI/1-732FAEDPLIQ------------------------------SIIS.......DP--------------TPPRVHSFEWSALSM
C4XYD9_CLAL4/17-927ADVDKTIM------------------------------ENKKELIYDLMPD--------------TPVDRLVFSWNYLSL
C5K8E7_PERM5/1-865LLKDTTMV------------------------------GILP.......VP--------------HPIVIRTYQQNAYTQ
B8M9N3_TALSN/1-838FAEEPNIR------------------------------ALLA.......EP--------------SAIKVHSFEWSALAL
C5FVH3_ARTOC/1-827FAAAPQIR------------------------------SILA.......EP--------------SPIRVHMFEWSPLSL
A3LX71_PICST/1-905ADFDDLLE------------------------------RSKTQINYDFLPD--------------KPLDKLKFNWSHLSL
A8WRZ4_CAEBR/1-727FLQHGTLV------------------------------GLLP.......VP--------------HPIVIRRYQTNVGTN
Q0E9B5_DROME/1-834FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANAGTT
C0NTS7_AJECG/1-843FAEEPRVH------------------------------ALIA.......EP--------------SPIRVHLFEWSPLSL
YIOC_SCHPO/1-796HPASEIMA------------------------------MIKTQKYPATNQP--------------YIPKYRTKEWRQQLA
A8NNK7_BRUMA/1-721FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANAGTN
C5DS55_ZYGRC/1-1145NQFESTIK------------------------------PHLPIFMSELSEG--------------QPLKIDLSQKNLIYQ
Q0UAJ2_PHANO/1-733IIHDTEVR------------------------------GI.........EP--------------SPIRVHLFEWSPLSL
B0WUT2_CULQU/1-851FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANSGTT
A7A1V5_YEAS7/1-1223SDILTTIH------------------------------PRLPLDVRRLTTF--------------QPLSMHTNDK...LL
A7RKV1_NEMVE/1-693FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANSGTQ
C5DFL0_LACTC/1-1131SFLKKELS------------------------------HAMPYETKISIKV--------------TNPLLISWEHSAPAS
Q6FK58_CANGA/1-1248DHFLSMIK------------------------------DNIPIYMRTGSSI--------------QHQKLSIDDESKFST
Q6DGD7_DANRE/1-801FLQHGTLV------------------------------GLLP.......VP--------------HPILIRKYQANEGTA
Q6BSE0_DEBHA/1-924TDFDKLIQ------------------------------ENKGQLNYDFLPT--------------TPLEPLKFNWSHLSL

PF09742

DYM_DROME/1-676VISKGASQ.............................WSSDRLRK....................FPDLKFKYVEEDAPE
B0WBZ3_CULQU/1-681VISKGASQ.............................WSSDRLRK....................FPDLKFKYVEEDAPE
DYM_XENTR/1-646VIKQGAVA.............................LPKDRLRK....................FPELKFKYVEEEQPE
A7RPK6_NEMVE/1-620VIKQGTLQ.............................WPKDRLKK....................FPELKFKYVEEEQPE
C3Z701_BRAFL/1-763FLQHGTLV..............................GLLPVP.....................HPILIRKYQANSGTT
A7RKV1_NEMVE/1-672FLQHGTLV..............................GLLPVP.....................HPILIRKYQANSGTQ
Q3UU20_MOUSE/1-763FLQHGTLV..............................GLLPVP.....................HPILIRKYQANSGTA
Q6DGD7_DANRE/1-780FLQHGTLV..............................GLLPVP.....................HPILIRKYQANEGTA
Q7Z135_CAEEL/1-705FLQHGTLV..............................GLLPVP.....................HPIVIRRYQTNIGTN
A8NNK7_BRUMA/1-700FLQHGTLV..............................GLLPVP.....................HPILIRKYQANAGTN
B7S488_PHATC/1-694VLDEMTMV..............................GLLPVP.....................HPIVIRKYQPNQYTA
Q6C5S1_YARLI/38-656TI..GTLN.............................PPVQPTK.....................FHKIEFQWDPVLL..
Q4CSH4_TRYCC/1-696VIRRAARE..............................QTGSIPTVKNHSPTSVPAKSAGSAPWRPREILYVYEESLQSY
C1FEV8_MICSR/1-966VIRAACEEDQSKEDHSKEDHSST..............SGSAPPSFQ...................YAPETFVYREEIDAH
Q5CRW2_CRYPI/1-761LYEPIKIT...............INCFENELIGIDSIVATENIRTIFQTIRNIILSKKYSNQIFCYTSKRTAFQRDYYSE
B6A9V3_CRYMR/1-807FLETVYSK.............................LSNFILSSEICSDDSDFQLYT.......FIKIIKLYLGEEEYI
A2ETH4_TRIVA/1-444CLINFVND.............................WQPMTTLNR...................KEPPVFEYQSNDTKS
Q01H67_OSTTA/7-725IISENSLD.............................RSPSPTKFRNGNCSDCAIHN........FYPMAFEYVEDEESA
A4RQD6_OSTLU/1-676VISETSLT..............................PSPQKRNQNACDRDCSVHD........FHPMRFAYVEDEVNA
A2ZYB0_ORYSJ/1-682VINKNCRS.............................WRGEGMKM....................FTQLRFTYEQESHPE
Q8RWV1_ARATH/1-679FIINNCRS.............................WRGEGMKM....................FTQLHFSYEQESHPE
B9RTK0_RICCO/1-498LIIINCRS.............................WRGEGMKM....................FTQLHFSYEQESHPE
B3RI35_TRIAD/1-583VINEGAQL.............................WPGDRLK............................YVNKDNAD
A8WTE9_CAEBR/1-690IIEKEANV.............................WPTDKLAK....................FPELKFRYVEDEYTV
A8Q618_BRUMA/1-661TIQKGVLH.............................WPTDRLKK....................FPELKFKYVEDDNTV

PF12722

Q2GWB4_CHAGB/1-825GWY-ES--------LLWGFIFSSEM.......................................................
B9W786_CANDC/1-930GWY-IS--------LLYGQIYNSGA.......................................................
B6JW01_SCHJY/1-778HFS-KL--------LTWSTAYDLDR.......................................................
C3Z701_BRAFL/1-784MWF-RT--------YMWGIIYLRNV.......................................................
A7TNQ6_VANPO/1-1209KWM-YV--------ICWSDIFDSHTGCYTISE.......NSMNGIFSFSMVNNSDGVGSVAR..........DSISEMSA
A6RRS3_BOTFB/1-641GWY-ES--------LLWAFVFTSEM.......................................................
B6HUK2_PENCW/1-841GWY-ES--------LLWGFIFSSEM.......................................................
Q3UU20_MOUSE/1-784MWF-RT--------YMWGVIYLRNV.......................................................
Q5ASC1_EMENI/1-732GWY-ES--------LLWGFIFSAEM.......................................................
C4XYD9_CLAL4/17-927GWY-IS--------VLYWDIYNTQE.......................................................
C5K8E7_PERM5/1-865LWF-TS--------YLWGVIFTRSQ.......................................................
B8M9N3_TALSN/1-838GWY-ES--------LLWGFIFSSEM.......................................................
C5FVH3_ARTOC/1-827GWY-ES--------LLWGFIFASEM.......................................................
A3LX71_PICST/1-905GWY-IS--------LLGGAVYNSVD.......................................................
A8WRZ4_CAEBR/1-727HWF-RI--------YMWGVIYLRNT.......................................................
Q0E9B5_DROME/1-834AWF-RT--------YIWGVIYLRNV.......................................................
C0NTS7_AJECG/1-843GWY-ES--------LLWGFIFASEM.......................................................
YIOC_SCHPO/1-796NFA-RL--------FAWQVSCDLDS.......................................................
A8NNK7_BRUMA/1-721HWF-RT--------YLWGVIYLRNI.......................................................
C5DS55_ZYGRC/1-1145SWI-YM--------VCWTNIFNTHSGAYAVSQSANANNNTNTNTNTNTNTHNNTNKSSDPNTYNGSSNGPALSRVSSTDT
Q0UAJ2_PHANO/1-733GWY-ES--------LLWGFVFAQEM.......................................................
B0WUT2_CULQU/1-851AWF-RT--------YMWGVIYLRNV.......................................................
A7A1V5_YEAS7/1-1223MWF-HI--------ATWANIFTQTSFKYEETFSHELRQFESLLDISIDECEGNTISKPTTDRLGYIRRSRGQSSVSLERT
A7RKV1_NEMVE/1-693MWF-RT--------YMWGIIYLRNI.......................................................
C5DFL0_LACTC/1-1131RWY-LS--------ILWADIFNYNSVPFISAYTKENSQQDAFLQHQNQSLSQPQT.........................
Q6FK58_CANGA/1-1248IWF-YT--------LCWSDIFNTHSSPYNKSLINELEEVEETNDIIPTISNNGSNIFADPGS..................
Q6DGD7_DANRE/1-801LWF-RT--------YMWGIIYLRNV.......................................................
Q6BSE0_DEBHA/1-924GWY-MS--------LLFGNVYNAGD.......................................................

PF09742

DYM_DROME/1-676EFF.IP........YVWTL-------------------------------------------------------------
B0WBZ3_CULQU/1-681EFF.IP........YVWTL-------------------------------------------------------------
DYM_XENTR/1-646EFF.IP........YAWSL-------------------------------------------------------------
A7RPK6_NEMVE/1-620EFF.IP........YVWFR-------------------------------------------------------------
C3Z701_BRAFL/1-763MWF.RT........YMWGI-------------------------------------------------------------
A7RKV1_NEMVE/1-672MWF.RT........YMWGI-------------------------------------------------------------
Q3UU20_MOUSE/1-763MWF.RT........YMWGV-------------------------------------------------------------
Q6DGD7_DANRE/1-780LWF.RT........YMWGI-------------------------------------------------------------
Q7Z135_CAEEL/1-705HWF.RI........YMWGV-------------------------------------------------------------
A8NNK7_BRUMA/1-700HWF.RT........YLWGV-------------------------------------------------------------
B7S488_PHATC/1-694LWF.TA........FMWGV-------------------------------------------------------------
Q6C5S1_YARLI/38-656GWY.LS........LIWTS-------------------------------------------------------------
Q4CSH4_TRYCC/1-696DFF.GP........FVWST-------------------------------------------------------------
C1FEV8_MICSR/1-966EFF.RP.........IVDL-------------------------------------------------------------
Q5CRW2_CRYPI/1-761....FK........FYFKA-------------------------------------------------------------
B6A9V3_CRYMR/1-807THS.IPSCILNCPNYTFTR-------------------------------------------------------------
A2ETH4_TRIVA/1-444S...LN........YFRVI-------------------------------------------------------------
Q01H67_OSTTA/7-725PYFMIP........YIWGA-------------------------------------------------------------
A4RQD6_OSTLU/1-676PYFLIP........YVWGV-------------------------------------------------------------
A2ZYB0_ORYSJ/1-682EFF.IP........YAWRV-------------------------------------------------------------
Q8RWV1_ARATH/1-679EFF.IP........YVWQL-------------------------------------------------------------
B9RTK0_RICCO/1-498EFF.TP........YIWRL-------------------------------------------------------------
B3RI35_TRIAD/1-583K..............VNSI-------------------------------------------------------------
A8WTE9_CAEBR/1-690DFF.VP........YVWRL-------------------------------------------------------------
A8Q618_BRUMA/1-661EFF.VP........YVWRL-------------------------------------------------------------

PF12722

Q2GWB4_CHAGB/1-825.....................................................QVSK.......................
B9W786_CANDC/1-930.....................................................QVQSYSGN.................SI
B6JW01_SCHJY/1-778................................................................................
C3Z701_BRAFL/1-784................................................................................
A7TNQ6_VANPO/1-1209LPSLERKVSNGTMLSRTNSN.SSFITGYLS..NQN..................YEQSQTPL...DIGDMYSTS..PSSNN
A6RRS3_BOTFB/1-641.....................................................QVAK.......................
B6HUK2_PENCW/1-841.....................................................VVGSASGA..............T....
Q3UU20_MOUSE/1-784................................................................................
Q5ASC1_EMENI/1-732.....................................................VVGSASGA..............T....
C4XYD9_CLAL4/17-927.....................................................NIKAHVGS.................NT
C5K8E7_PERM5/1-865................................................................................
B8M9N3_TALSN/1-838.....................................................LVGSASNS..............T....
C5FVH3_ARTOC/1-827.....................................................VVGSAANS..............T....
A3LX71_PICST/1-905.....................................................SVKTYTGN.................NN
A8WRZ4_CAEBR/1-727................................................................................
Q0E9B5_DROME/1-834................................................................................
C0NTS7_AJECG/1-843.....................................................LVGSASGS..............T....
YIOC_SCHPO/1-796................................................................................
A8NNK7_BRUMA/1-721................................................................................
C5DS55_ZYGRC/1-1145LPSLEKFNSNGSMLSRTNSN.SSSLMGYLSSYRNT..................ETSFSSPL...EITNYSSPTSKSNGSR
Q0UAJ2_PHANO/1-733.....................................................LVAK.......................
B0WUT2_CULQU/1-851................................................................................
A7A1V5_YEAS7/1-1223ISAGSGVSTPTMALNRTKSNGSGNLMNYFFQNTAQNHFQHLRSSSSSSSITLEKTTSNSSSIRTRPNSHHVAPETNNNNS
A7RKV1_NEMVE/1-693................................................................................
C5DFL0_LACTC/1-1131.PRLERHNSQGSSLSRTNSNSSSISTFFLHQEP....................ESASNSAP.....NSPSVGSSFSSWLN
Q6FK58_CANGA/1-1248.PVLERWNSNSSNLSRTNSN.SSSLMGYFFQQPQS..................ASSNRSSV...DHTSRFIES..KNASA
Q6DGD7_DANRE/1-801................................................................................
Q6BSE0_DEBHA/1-924.....................................................NVKAFTGY.................KN

PF09742

DYM_DROME/1-676--------------------------------------------------------------------------------
B0WBZ3_CULQU/1-681--------------------------------------------------------------------------------
DYM_XENTR/1-646--------------------------------------------------------------------------------
A7RPK6_NEMVE/1-620--------------------------------------------------------------------------------
C3Z701_BRAFL/1-763--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-672--------------------------------------------------------------------------------
Q3UU20_MOUSE/1-763--------------------------------------------------------------------------------
Q6DGD7_DANRE/1-780--------------------------------------------------------------------------------
Q7Z135_CAEEL/1-705--------------------------------------------------------------------------------
A8NNK7_BRUMA/1-700--------------------------------------------------------------------------------
B7S488_PHATC/1-694--------------------------------------------------------------------------------
Q6C5S1_YARLI/38-656--------------------------------------------------------------------------------
Q4CSH4_TRYCC/1-696--------------------------------------------------------------------------------
C1FEV8_MICSR/1-966--------------------------------------------------------------------------------
Q5CRW2_CRYPI/1-761--------------------------------------------------------------------------------
B6A9V3_CRYMR/1-807--------------------------------------------------------------------------------
A2ETH4_TRIVA/1-444--------------------------------------------------------------------------------
Q01H67_OSTTA/7-725--------------------------------------------------------------------------------
A4RQD6_OSTLU/1-676--------------------------------------------------------------------------------
A2ZYB0_ORYSJ/1-682--------------------------------------------------------------------------------
Q8RWV1_ARATH/1-679--------------------------------------------------------------------------------
B9RTK0_RICCO/1-498--------------------------------------------------------------------------------
B3RI35_TRIAD/1-583--------------------------------------------------------------------------------
A8WTE9_CAEBR/1-690--------------------------------------------------------------------------------
A8Q618_BRUMA/1-661--------------------------------------------------------------------------------

PF12722

Q2GWB4_CHAGB/1-825...................................................................GTVGVWNSTHIKL
B9W786_CANDC/1-930RNYKIVKTFSSGMSRLTSNWTSFLK..............QDSQSEPSSSETTLPKIDENLEWVNNALSNINTWSGSEIKL
B6JW01_SCHJY/1-778................................................................RNHNGMGIWTNTEVRL
C3Z701_BRAFL/1-784....................................................................DPPIWYDTDVKL
A7TNQ6_VANPO/1-1209NYRHKRTNSNSDNSFFKFSWMGFNKNND....CNSIKE.DASDNDSEYSSASAIKSCSFILDVG..LLKPNIWAGTNVKL
A6RRS3_BOTFB/1-641...................................................................GTIGVWNGTAIKL
B6HUK2_PENCW/1-841..................................................................PGTVGVWNGTAIKL
Q3UU20_MOUSE/1-784....................................................................DPPIWYDTDVKL
Q5ASC1_EMENI/1-732..................................................................PGTVGVWNGTSIKL
C4XYD9_CLAL4/17-927SLMNSISSSIAVFSKFASSWSGL......................GSRHSDNTSELGFITDHVDRALTTHNVWSHTNVRL
C5K8E7_PERM5/1-865....................................................................ALPLYDWKKIQL
B8M9N3_TALSN/1-838..................................................................PGSVGVWNGTGIKL
C5FVH3_ARTOC/1-827..................................................................PGTVGVWNGTSIKL
A3LX71_PICST/1-905KIMKNITTSIASVSKLTSSWTGFMK....................HSTTAYSANDSAEVAEWVKSSLTAVNQWNHTDVKL
A8WRZ4_CAEBR/1-727....................................................................QPPIWYDTDVKL
Q0E9B5_DROME/1-834....................................................................EPAIWYDTEVKL
C0NTS7_AJECG/1-843..................................................................PGAVGVWNGTAIKL
YIOC_SCHPO/1-796................................................................HKREGPGIFEGTDVKI
A8NNK7_BRUMA/1-721....................................................................DPPIWYDTNVKL
C5DS55_ZYGRC/1-1145ANGGNNSNSSSGTSFFRFAWNGFTKKDN....NYAPIQEEASDPPGSPMGSAPSRPNPFIPDVG..LLKPNIWTGTKIKL
Q0UAJ2_PHANO/1-733...................................................................GTAGVWNNTSIRL
B0WUT2_CULQU/1-851....................................................................DPAIWYDTEVKL
A7A1V5_YEAS7/1-1223TNGNSNNSSNGGFSFFKWKWGGNNSNGGSDDTKASQRDPNVSTSILTDNLNSYMFEEEISPGVVNNIIENNIWVGTDIRL
A7RKV1_NEMVE/1-693....................................................................DPPIWYDTDVKL
C5DFL0_LACTC/1-1131NKYQAGSQNNERSSLFRFSWAGFQKNPQDEKICEEISNEPEDDLVSPEGSFV..........LDMGLLKPNIWVGTRVEL
Q6FK58_CANGA/1-1248PTKKASAPQNSSFSLFKFSWTGFNKNGNSDD.CDVIKE.EEETTVSQTSTRNGVNQQIFVSALDMSLLKSNIWVDTKVRM
Q6DGD7_DANRE/1-801....................................................................DPPVWYDTDVKL
Q6BSE0_DEBHA/1-924KIMKNFSSTLVSFSKLTSGWAGLNM...................QLTGTGTMSNDSDVVSSYVESALTNINPWAYTSIKL

PF09742

DYM_DROME/1-676--------------------------------------------------------------------------------
B0WBZ3_CULQU/1-681--------------------------------------------------------------------------------
DYM_XENTR/1-646--------------------------------------------------------------------------------
A7RPK6_NEMVE/1-620--------------------------------------------------------------------------------
C3Z701_BRAFL/1-763--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-672--------------------------------------------------------------------------------
Q3UU20_MOUSE/1-763--------------------------------------------------------------------------------
Q6DGD7_DANRE/1-780--------------------------------------------------------------------------------
Q7Z135_CAEEL/1-705--------------------------------------------------------------------------------
A8NNK7_BRUMA/1-700--------------------------------------------------------------------------------
B7S488_PHATC/1-694--------------------------------------------------------------------------------
Q6C5S1_YARLI/38-656--------------------------------------------------------------------------------
Q4CSH4_TRYCC/1-696--------------------------------------------------------------------------------
C1FEV8_MICSR/1-966--------------------------------------------------------------------------------
Q5CRW2_CRYPI/1-761--------------------------------------------------------------------------------
B6A9V3_CRYMR/1-807--------------------------------------------------------------------------------
A2ETH4_TRIVA/1-444--------------------------------------------------------------------------------
Q01H67_OSTTA/7-725--------------------------------------------------------------------------------
A4RQD6_OSTLU/1-676--------------------------------------------------------------------------------
A2ZYB0_ORYSJ/1-682--------------------------------------------------------------------------------
Q8RWV1_ARATH/1-679--------------------------------------------------------------------------------
B9RTK0_RICCO/1-498--------------------------------------------------------------------------------
B3RI35_TRIAD/1-583--------------------------------------------------------------------------------
A8WTE9_CAEBR/1-690--------------------------------------------------------------------------------
A8Q618_BRUMA/1-661--------------------------------------------------------------------------------

PF12722

Q2GWB4_CHAGB/1-825FRV
B9W786_CANDC/1-930FDV
B6JW01_SCHJY/1-778LKF
C3Z701_BRAFL/1-784FEI
A7TNQ6_VANPO/1-1209FKV
A6RRS3_BOTFB/1-641FRV
B6HUK2_PENCW/1-841FRV
Q3UU20_MOUSE/1-784FEI
Q5ASC1_EMENI/1-732FKV
C4XYD9_CLAL4/17-927FKI
C5K8E7_PERM5/1-865ILI
B8M9N3_TALSN/1-838FKV
C5FVH3_ARTOC/1-827FRV
A3LX71_PICST/1-905FKI
A8WRZ4_CAEBR/1-727FEI
Q0E9B5_DROME/1-834FEI
C0NTS7_AJECG/1-843FKV
YIOC_SCHPO/1-796FDS
A8NNK7_BRUMA/1-721FEI
C5DS55_ZYGRC/1-1145FDV
Q0UAJ2_PHANO/1-733FKV
B0WUT2_CULQU/1-851FEI
A7A1V5_YEAS7/1-1223FKI
A7RKV1_NEMVE/1-693FEI
C5DFL0_LACTC/1-1131FKT
Q6FK58_CANGA/1-1248FIV
Q6DGD7_DANRE/1-801FEI
Q6BSE0_DEBHA/1-924FKI

PF09742

DYM_DROME/1-676---
B0WBZ3_CULQU/1-681---
DYM_XENTR/1-646---
A7RPK6_NEMVE/1-620---
C3Z701_BRAFL/1-763---
A7RKV1_NEMVE/1-672---
Q3UU20_MOUSE/1-763---
Q6DGD7_DANRE/1-780---
Q7Z135_CAEEL/1-705---
A8NNK7_BRUMA/1-700---
B7S488_PHATC/1-694---
Q6C5S1_YARLI/38-656---
Q4CSH4_TRYCC/1-696---
C1FEV8_MICSR/1-966---
Q5CRW2_CRYPI/1-761---
B6A9V3_CRYMR/1-807---
A2ETH4_TRIVA/1-444---
Q01H67_OSTTA/7-725---
A4RQD6_OSTLU/1-676---
A2ZYB0_ORYSJ/1-682---
Q8RWV1_ARATH/1-679---
B9RTK0_RICCO/1-498---
B3RI35_TRIAD/1-583---
A8WTE9_CAEBR/1-690---
A8Q618_BRUMA/1-661---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window