Sequence alignment for CL0456

PF12722

Q2GWB4_CHAGB/1-825MGASD---SKLV..----------FKKG-IFRLSEE............................................
B9W786_CANDC/1-930MKTTE---EKAK..----------FRNQ-FLKLGQG............................................
B6JW01_SCHJY/1-778MGAQE---SKLC..----------FRRA-VLRL...............................................
C3Z701_BRAFL/1-784MGNSD---TKLN..----------FRKA-VIQLTTK............................................
A7TNQ6_VANPO/1-1209MGNTD---SKLNVL----------YRDH-VFRLSGY........FDGIIPLFSKNTNLNELIDLY...............
B6HUK2_PENCW/1-841MGASE---SKLV..----------FKQG-IFRLSEE............................................
Q3UU20_MOUSE/1-784MGSAD---SKLN..----------FRKA-VIQLTTK............................................
Q5ASC1_EMENI/1-732MGASE---SKLV..----------FKQG-IFRLSEE............................................
C4XYD9_CLAL4/17-927MKTAE---EKIA..----------FKNS-FFKLGQG............................................
C5K8E7_PERM5/1-865MGNSE---SRAL..----------VSDY-LDELGQC............................................
B8M9N3_TALSN/1-838MGASE---SKLV..----------FKQG-IFRLYED............................................
C5FVH3_ARTOC/1-827MGASE---SKLV..----------FKQG-IFRLSEQ............................................
A3LX71_PICST/1-905MKTAD---DKLR..----------YKNH-FFKLGQG............................................
A8WRZ4_CAEBR/1-727MGAQG---SRVD..----------FKQA-VLDLTSK............................................
Q0E9B5_DROME/1-834MGNTD---SKLN..----------FRKA-IVQLTQK............................................
C0NTS7_AJECG/1-843MGGSE---SKLA..----------FRQG-IFRLSEE............................................
YIOC_SCHPO/1-796MGSQQ---SKLD..----------FRNA-VLRLHEE............................................
A8NNK7_BRUMA/1-721MGNSG---SKIN..----------FRKA-VVELTTK............................................
C5DS55_ZYGRC/1-1145MGNTD---SKLSSL----------YRDH-ILQLAGV............................................
Q0UAJ2_PHANO/1-733MGASD---SKLT..----------FKQG-IFRLSEP............................................
B0WUT2_CULQU/1-851MGNAD---TKLN..----------FRKA-IVQLTSK............................................
A7A1V5_YEAS7/1-1223MGNTD---SKSSSI----------LLNH-CIALVRPEDASASSP........SRTSSPSPSLSVDADPLSLNLSIF....
A7RKV1_NEMVE/1-693MGGTE---SKLN..----------FRKA-VVQLTTK............................................
C5DFL0_LACTC/1-1131MGQSD---SKLTQ.----------YRDH-IFQLADP..........GVLPLYSPSAHPRDIIRCYNDPLSQNGLTGEVED
Q6FK58_CANGA/1-1248MGNTD---SKLNSL----------YKEH-LLKLARPEITSIDNSQNGVICLFNPEYSLREIIDLYNN.............
Q6DGD7_DANRE/1-801MGNSD---SKLR..----------FRKA-VIQLTTK............................................
Q6BSE0_DEBHA/1-924MKTAE---ERLR..----------FKNH-FFKLGQG............................................

PF09742

F4WRP0_ACREC/1-730MGNAD...TKLN............FRKA.VVQLTSK--------------------------------------------
E9H938_DAPPU/1-832MGNAD...TKLN............FRKA.VVQLTSK--------------------------------------------
T1JUN4_TETUR/1-644MGITN...SALN.NL.........KSNE.HLNKFAS--------------------------------------------
J9F5Y0_WUCBA/1-661MGAKI...SSET.LI.........EENA.YLRRFVG--------------------------------------------
B4JW54_DROGR/1-859MGNTD...SKLN............FRKA.IVQLTQK--------------------------------------------
I1EYR3_AMPQE/506-1206MGIAS...STSLKEL.........GRNE.LLEKFVG--------------------------------------------
E0VAE1_PEDHC/1-723MGASN...SK...DL.........SSNE.YLLKFSG--------------------------------------------
C1FEV8_MICSR/1-964MGAGS...STAAAAY....ARCKDDVDA.NLARLSD--------------------------------------------
G1MRD7_MELGA/1-648MGANS...SSIS.EL.........PDNE.YLKKLSG--------------------------------------------
D6WWB7_TRICA/1-769MGNVD...TKLN............FRKA.VVQLTSK--------------------------------------------
H3BX91_TETNG/1-768MGGGD...SKLH............FRKA.VIQLTTK--------------------------------------------
F7D5K7_XENTR/1-770MGNTD...TKLN............FRKA.VIQLTTK--------------------------------------------
H2SJN1_TAKRU/1-774MGSGD...SKLH............FRKA.VIQLTTK--------------------------------------------
B3RQA8_TRIAD/1-734MGGTD...SKLY............FRKA.IVQLTTK--------------------------------------------
I3JLL2_ORENI/1-646MGANT...SQVS.DL.........SDNP.SLKALVG--------------------------------------------
G7DXH4_MIXOS/12-858...KD...AKLA............FRQTGIAKLA..--------------------------------------------
U1M0X7_ASCSU/1-660MGAVI...SSET.IL.........DENI.YLRRFTG--------------------------------------------
H2XV68_CIOIN/1-762MGNTE...TKLS............FRKA.VIQLTTR--------------------------------------------
Q5ZBZ3_ORYSJ/1-682MGAAP...STPRLGAVAGAAASPGAAEQ.MFAALVG--------------------------------------------
D0NH97_PHYIT/1-769MGASSSTPSSATGSAAIEQIFRSAQEKA.AFEKIVS--------------------------------------------
T1FYR2_HELRO/1-642MGANN...STLSKDL.........SNNE.YLLKLSG--------------------------------------------
Q4DJF1_TRYCC/1-725MGTSS...STLE............VGKA..IRLLLV--------------------------------------------
I3KNU8_ORENI/1-782MGNAD...SKLN............FRKA.VVQLTTK--------------------------------------------
I3JCX3_ORENI/1-776MGSTD...SKLN............FRKA.VIQLTTK--------------------------------------------
Q01H67_OSTTA/38-724.RESA...SELRRGLKAMCEATRETPDA........--------------------------------------------
Q38FE7_TRYB2/1-706MGGTS...TKES.................LLYFMDV--------------------------------------------
Q8RWV1_ARATH/1-679MGGVP...STPRK....TGGDDVSVAEY.LIATFVG--------------------------------------------
I1MHZ5_SOYBN/1-671MGSAL...STPD............TAEH.LVGSFVG--------------------------------------------
B0WBZ3_CULQU/1-681MGMNV...SRQV.DL.........AENE.YLKRFVG--------------------------------------------
F0Y4A0_AURAN/723-1436MGGGN...SKAD............LADI.LVMLSQS--------------------------------------------
D7T740_VITVI/12-678..................SARPVDTAEY.LIGTFVG--------------------------------------------
E1ZEP5_CHLVA/1-748MGNAGSAHAQLQ.................AVAAVSG--------------------------------------------
M4BPB3_HYAAE/1-729MGNSD...SKSK............FRES.VYKLNNE--------------------------------------------
Q5CRW2_CRYPI/1-755MGSSI...SKDKDNSLPQNCLR.......FIEPFLQ--------------------------------------------
C5K8E7_PERM5/1-844MGNSE...SRAL............VSDY.LDELGQC--------------------------------------------
U6HDN4_ECHMU/1-876MGSGQ...SSLS............YRTA.FVELANK--------------------------------------------
DYM_DROME/1-676MGINV...SRTA.DL.........GSNQ.WLQRFVG--------------------------------------------
H0VNU2_CAVPO/1-646MGSNS...SRIS.DL.........PKNE.YLQKLSG--------------------------------------------
E9ICM4_SOLIN/1-654MGATP...SRYE.DL.........SKNV.HLGRFCG--------------------------------------------
L9KZV5_TUPCH/1-826MGSAD...SKLN............FRKA.VIQLTTK--------------------------------------------
E9G1Z8_DAPPU/1-633MGAQC...SSVA.NL.........NSNE.HLFQLCG--------------------------------------------
D7FT96_ECTSI/1-808MGTGA...SKVA............FRDV.LAQLKNE--------------------------------------------
H2MFX7_ORYLA/1-772MGNSD...TKLH............FRKA.VIQLTTK--------------------------------------------
B7S488_PHATC/1-694MGQSA...SKEK............FRES.VTALIQV--------------------------------------------
W1NV48_AMBTC/1-680MGGVP...STPSK.....SSRPRDQAEY.LLATFVG--------------------------------------------
B6A9V3_CRYMR/1-794MGSSI...SKEGPVFLLENSFR.......LINGLLG--------------------------------------------
H2KSV6_CLOSI/110-1035MGGDN...SKLT............YRNV.VIQLTTK--------------------------------------------
M4AQZ4_XIPMA/1-781MGNAD...TKLH............FRKA.VIQLTTK--------------------------------------------
E0VG76_PEDHC/1-766MGNTD...TKLN............FRKA.VVQLTSK--------------------------------------------
B4MQL1_DROWI/1-832MGNTD...SKLN............FRKA.IVQLTQK--------------------------------------------
HID1_DICDI/1-880MGTGS...SREQ............HLNS.FNTLQKE--------------------------------------------
W4XTN1_STRPU/1-721MGSSD...SKLN............FRKA.VVQLTTK--------------------------------------------
T1K251_TETUR/1-842MGNSD...SKLN............FRKA.VVQLSSK--------------------------------------------
T1I7V2_RHOPR/1-802MGNVD...TKLN............FRKA.VIQLTSK--------------------------------------------
Q7QGJ8_ANOGA/1-825MGNTD...TKLN............FRKA.IVQLTSK--------------------------------------------
U6I4G6_ECHMU/1-732MGSSV...SNLA.DL.........ATNP.YLIKLVG--------------------------------------------
J9KB63_ACYPI/1-736MGNAD...TKLV............FRKA.VVQLTSK--------------------------------------------
Q17L03_AEDAE/1-819MGNTD...TKLN............FRKA.IVQLTSK--------------------------------------------
W4Z6Q3_STRPU/1-667MGGTG...SSLS.EL.........GENE.FLRRFVG--------------------------------------------
W5JW75_ANODA/1-876MGNTD...TKLN............FRKA.IVQLTSK--------------------------------------------
DYM_XENTR/1-646MGANS...STIK.EL.........SENE.FLKKLSG--------------------------------------------
A8WTE9_CAEBR/1-690MGSVI...TKET.IL.........QDNV.YLKKLSG--------------------------------------------
M4C137_HYAAE/1-768MGATSS..SSATSTASIESLFCSTQEKG.AFEKIVS--------------------------------------------
B9HUR0_POPTR/1-672MGAVP...STPRL....SGARPQDTADY.LIGSFVG--------------------------------------------
F6TGV4_CIOIN/1-683MGIGC...SSFA.HL.........EDNE.YLKRLSS--------------------------------------------
H3AL71_LATCH/1-849MGNVD...SKLN............FRKA.VIQLTTK--------------------------------------------
C3Z701_BRAFL/1-763MGNSD...TKLN............FRKA.VIQLTTK--------------------------------------------

PF12722

Q2GWB4_CHAGB/1-825.RHI..PA...............GDA...YWSSFW....ELP-ESPEDIFS.L----FTPADVRRTRDNALENLESLIQA
B9W786_CANDC/1-930.HII..ST...............DESNNIFWSSFW....TMP-TCANDVYE.L----ITVADIKKVRQQNLMNIVQLIRQ
B6JW01_SCHJY/1-778.............................YEERFW....RFS-NTAKDVFN.L----LPLKDIRKTRDLAFENLQTLIIL
C3Z701_BRAFL/1-784.TQPVEAQ...............DEA...FWDQFWT...DSV-TSVQDVFA.L----VPAAEIRALREESPSNLATLCYK
A7TNQ6_VANPO/1-1209.NSKVIPD...............DSKFDQFYLEFVA...VGT-DLTFEMLNQI----INNEEMRNIFELNPINYLNLTRF
B6HUK2_PENCW/1-841.QEI..PA...............DDP...YWTRFW....ELP-ESTEDVFS.L----FTPADIRRTRDHALHNFQTLLLA
Q3UU20_MOUSE/1-784.TQPVEAT...............DNA...FWDQFWA...DTA-TSVQDVFA.L----VPAAEIRAVREESPSNLATLCYK
Q5ASC1_EMENI/1-732.KEI..PP...............DDP...YWARFW....ELP-ESTEDVFS.L----FTPADIRRTRDHALGNFETLLLS
C4XYD9_CLAL4/17-927.RLM..DH...............GDVA..FWSIFW....NTP-QSASDIYD.L----LTPFDLQTVRDQNLPNFLLLVHI
C5K8E7_PERM5/1-865.DLAVDAE...............AAP...MKEEFWTTIFDTP-LSIEEIFE.I----ITPEWVRNLRDEKPYNMQFLLRR
B8M9N3_TALSN/1-838.QNI..SA...............DDP...FWIKFW....ELP-ESTEDVFS.L----FTPTDIRRVRDSSLANLETLLLA
C5FVH3_ARTOC/1-827.ANI..PP...............DDQ...YWTGFW....ELP-ESVEDVFS.L----FSPVDIRRTRDTSLSNLETLLLA
A3LX71_PICST/1-905.RVI..AG...............NDSD..YWKVLW....TEP-DNSDDIFE.L----LTSYDIRTIRDQNRVNYLVMIHV
A8WRZ4_CAEBR/1-727.PGKDDEQ.....................FWDQAW.....WP-DTVNDIFA.M----IPGEDIRKLRDESPKNLATLVYK
Q0E9B5_DROME/1-834.NQKIDPS...............DEQ...FWEQFWQ...GHQ-TTLEDVFA.L----VTSSEIRQIRNENPANLATLCYK
C0NTS7_AJECG/1-843.SNI..AA...............DDP...YWTGFW....ELP-ESPEDVFS.L----FSPADIRRTRDASIANLETLILA
YIOC_SCHPO/1-796.RNI..PK...............FDL...IWERLW....TLP-ETTEDVFH.L----MSIDDLTKVKDNAPENLQTIIAV
A8NNK7_BRUMA/1-721.KSKVE.................EDA...FWEELCA...SNI-NSAADIFS.L----ITADDVRSLRDNSPSNLAALCYK
C5DS55_ZYGRC/1-1145.TIPLRDD...............NGEFSQFYRDFI....AGG-NFTMEMFNHL----VSPNELRGICRNNSVNISNLVQF
Q0UAJ2_PHANO/1-733.KQI..PA...............DDV...YWTGFW....ELP-ESTEDVFS.L----FSPADIRRTRDNNLANLETLILA
B0WUT2_CULQU/1-851.SQPIDAS...............DDA...FWEQFWC...EHS-TTVQDVFA.L----IPSNEVRKVRDVMPTNLATLCYK
A7A1V5_YEAS7/1-1223.KLDSGPD..VEALFSDKPNVPLDTVFNDFYLDFI....SVD-VQDFSINSSF----..KKILHIISSLNPPNFNNLIVF
A7RKV1_NEMVE/1-693.KSAAEPN...............DDA...FWDQFWS...ESA-ATISDVFT.L----IPAAEIRNLRDENPSNLATL...
C5DFL0_LACTC/1-1131GAGDALPD...............EELFSPVFSAFA....SSD-AEARDVYS.V----VSTQELRLIFQSNQANFISLVRF
Q6FK58_CANGA/1-1248.RGNITPDKSLKHTSDNHSTSIEDNLFTDYYKNFL....KFD-FQKIDNFNDL----ISKDELRTIYKNNKENYLNLIRF
Q6DGD7_DANRE/1-801.TQPVEAS...............EDV...FWDQFWN...DID-LMAQDIFT.L----VPAAEIRAVREESPSNLATLCYK
Q6BSE0_DEBHA/1-924.RLI..PS...............SDST..YWDAFW....KEP-ETTSDIYE.L----ITPYDIRTIREQNRANFVLMIRV

PF09742

F4WRP0_ACREC/1-730-TQVIDAS---------------DDI---FWDQFWS...ENV.TNVQDIFT-L....IPAPEIRVLREEAPSNLATLCYK
E9H938_DAPPU/1-832-TQPIDPS---------------DNT---FWSQFWS...ESI.TNIQDVFT-L....IPATEIRVLREECPSNLATLCYK
T1JUN4_TETUR/1-644-NQHIPV.---------------GDS---FWNEMLSFSFTKSIRTLEETRV-LEDSVSPLLNSLLSHNLNSNNLGSLVKI
J9F5Y0_WUCBA/1-661-LQPISD.---------------NDP---FWNHFLSFNFLIDSNNRKEVEQ-FDISLSDSLQSLMYNTPTTCNFASFIHV
B4JW54_DROGR/1-859-NQKIDNN---------------DDQ---FWEQFWQ...AHQ.TTLEDVFA-L....VTASEIRQIRNDNPANLATLCYK
I1EYR3_AMPQE/506-1206-ESPIAD.---------------SEE---YWDKLLTFSFKPP.TLPGDNKV-LYEATAPIIEKLVAHNPKSGNVLSLVKV
E0VAE1_PEDHC/1-723-KDHISC.---------------SDQ---FWNVFLSFSFKPP.SSKSENEV-INDKLSKIFENLLKNNLESGNFVSLIRV
C1FEV8_MICSR/1-964-PDPTTP.---------------DDP---TWDELLRFPAAITSASDADLDV-VLGRVD.......FGSIAPGTLDALLER
G1MRD7_MELGA/1-648-AEPISE.---------------NDP---FWNQLLSFSFTAP.TNSADLKL-LEEATISVCKSLVEKNPRTGNLGSLIKV
D6WWB7_TRICA/1-769-SEPIDAN---------------DDS---FWEQFWS...ENV.TNVQDIFT-L....VPAAEIRALREDAPSNLATLCYK
H3BX91_TETNG/1-768-TQPVEAS---------------DDA---FWDQFWA...NAS.TTVQDIFA-L....VPAAEIRAVREESPSNLATLCYK
F7D5K7_XENTR/1-770-TQPVEAT---------------DDV---FWDQFWT...DSS.TSVQDVFA-L....IPAAEIRAVREESPSNLATLCYK
H2SJN1_TAKRU/1-774-TQPVEAS---------------DDA---FWDQFWS...DAS.TTVQDIFA-L....VPAAEIRAVREESPSNLATLCYK
B3RQA8_TRIAD/1-734-TMPIDAN---------------DDA---FWDQFWS...ESI.ASVQDIFT-L....VTAQEIRTLRDEAPSNLATLSIK
I3JLL2_ORENI/1-646-TESISE.---------------NDP---FWNQLISFTFISP.TSSGESKL-LEEAVIPLAKILIENNPRTGNFGALVRI
G7DXH4_MIXOS/12-858-TQPVPPE---------------DVA---YWEQYW....LVF.DTAWDVTT-L....ITAADVRTALRDQPSNVKTLISV
U1M0X7_ASCSU/1-660-LQPITD.---------------NDP---FWNQLLSFNLKINTDDRREVKQ-FNESQLDLLQSLMYNTQTTGNFAAFIRV
H2XV68_CIOIN/1-762-MQPVEAN---------------DDA---FWDQFWT...EPI.NNVQDVFA-L....VPAAEVRALREESPSNLATLCYK
Q5ZBZ3_ORYSJ/1-682-GKAYPI.---------------SSE---FWRQLLELPLTQQ........W-PRDRVLQACHAFAQNNYHTKHLAKILIH
D0NH97_PHYIT/1-769-ETPAPR.---------------EDV---AYHALLGTPKPLPQLTQAQVEL-L...TREYGETLAQNSLQSGNFRVLLRF
T1FYR2_HELRO/1-642-PDYISP.---------------NEP---FWNQLLSFAFSVP.KTSADQRH-LEDITSNLCKNFAINNCRTGNFGSLIRV
Q4DJF1_TRYCC/1-725-DTPVD..---------------...---..DGIFNLLLNTA.LSKSELER-A....LPFSTLRVMRHYYTRNFALLLFK
I3KNU8_ORENI/1-782-TQPVEAS---------------DDV---FWDQFWV...DSS.TTVQDVFA-L....VPAAEIRAVREESPSNLATLCYK
I3JCX3_ORENI/1-776-TQPVEAT---------------DDA---FWDQFWA...DTT.TTVQDVFA-L....VPAAEIRAVREESPSNLATLCYK
Q01H67_OSTTA/38-724-.......---------------MDV---FWYELGNAS.SEP.LTAMSERT-LDEMLRPYGRSLYAKNARSGGLYKLVRH
Q38FE7_TRYB2/1-706-ARGVSPP---------------DEK---DFSSHLGRCRKELCSGAELYRT-L....LPIMQTLMPANAQASQVQWVVRF
Q8RWV1_ARATH/1-679-EKSFPL.---------------ASD---FWNKLLELPLSSR........W-PSDRVQQACELFAQSNGYTRHLAKLLIH
I1MHZ5_SOYBN/1-671-DESIPL.---------------SSD---FWQKLLELPFDAE........L-PSQRLHQTCQLLVENNHNTRHLAKILFH
B0WBZ3_CULQU/1-681-RDHVPAY---------------NDD---FWNSFLQYHINLP.TNSQEQLS-LDSRLESLCQSFIAHNLSSGNFGSLFNV
F0Y4A0_AURAN/723-1436-D..VSPD---------------AHD---FWDELW....KLS.TTPEDVFE-L....ISPDDVRQLKRERPENVVTLFTQ
D7T740_VITVI/12-678-EKSFPL.---------------TSD---FWQKLLELPLSLQ........W-PSHRVRQACELFAQNNYYTRHLAKILIH
E1ZEP5_CHLVA/1-748-ATLLPM.---------------DAP---EWQILLG..VSQP.LSRFDPGE-VEREIRPHCAELVYNNAHTLNLQRFIYL
M4BPB3_HYAAE/1-729-V..ISSK---------------NLE---FWDKLW....RIP.TVAEEIFT-L....IQPDDVRMLRHQQPTNLATMLSQ
Q5CRW2_CRYPI/1-755-KENIRT.---------------NLS---LLNELQKLIITPI...EDNSFA-DQFIFEHISSKLFVRNATSGNFRSLTLF
C5K8E7_PERM5/1-844-DLAVDAE---------------AAP---MKEEFWTTIFDTP.LSIEEIFE-I....ITPEWVRNLRDEKPYNMQFLLRR
U6HDN4_ECHMU/1-876-TQPINAY---------------NDE---FWDQFWC...GGP.TRISDMFA-S....VPGSEIRTLREESPGNLATLCYK
DYM_DROME/1-676-RQHIAHD---------------DEA---FWNGLLNYNIVLP.ENSQDQLN-LDSRLEALCQSFIGNNLKTGNFGSLVTV
H0VNU2_CAVPO/1-646-TESVSE.---------------NDP---FWNQLLSFSFPAP.TSSTELKL-LEEATISVCKCLVENNPRTGNLAALIKV
E9ICM4_SOLIN/1-654-KQSIPA.---------------NDP---FWSTFLSYNIRPP.ITRNDQIE-LDSRLDSSCQQLLVNNLVTGNFGTLIQI
L9KZV5_TUPCH/1-826-TQPVEAT---------------DDA---FWDQFWA...DTA.TSVQDVFA-L....VPAAEIRAVREESPSNLATLCYK
E9G1Z8_DAPPU/1-633-STPMTA.---------------NDP---TWNQLFSFNLQIP.LSSLENHE-VIEGTAQLFQLLESNNQATRNTSALLRV
D7FT96_ECTSI/1-808-D..IATN---------------DAA---FWSKLW....KTE.TNPHDVFE-V....ISPTAVRKLKVARPGNVEALLRM
H2MFX7_ORYLA/1-772-TQPVEAT---------------DDA---FWDQFWT....SA.ISVQDVFA-L....VPAAEIRAVREESPSNLATLCFK
B7S488_PHATC/1-694-D..VSAD---------------DAD---FWDELW....KIP.SSAEEVFE-L....LPARSARKLRDDRFENLATLFTQ
W1NV48_AMBTC/1-680-EKSFPI.---------------SSD---FWQKLLASPLTLQ........W-PQDKVSEACESLAQNNYYTRHLAKILIH
B6A9V3_CRYMR/1-794-QNTVDD.---------------EDP---IWEKMKSEFILPP...IAPNIL-DNYIYEHISTTLFETNKSSGNLRRLTLF
H2KSV6_CLOSI/110-1035-TQPIDSN---------------DNA---FWERFWT...DIS.ISVQDMFV-L....IPAAEIRALREESPNNLATLSYK
M4AQZ4_XIPMA/1-781-TQPVEAT---------------DNV---FWDQFWA...ECS.IAVQDVFA-L....VPAAEIRAVREESPSNLATLCYK
E0VG76_PEDHC/1-766-TQPIDAS---------------DDN---FWNQFWA...ENN.TSVQDIFT-L....VPAAEIRAVREEAPANLATLCYK
B4MQL1_DROWI/1-832-NQKVDPN---------------DEQ---FWEQFWQ...GHQ.TTMEDVFA-L....VTSNEIRQIRNENPANLATLCYK
HID1_DICDI/1-880-TVP....---------------...---FSSDLWKTILSQN.LEDDSLYL-........ENLKKLKNERPENLATFIKK
W4XTN1_STRPU/1-721-TQPVEAG---------------DDA---FWDQFWA...DSV.TSVTDVFA-L....IPAAEIRALREESPSNLATLCYK
T1K251_TETUR/1-842-THPIDAK---------------EDS---FWDQFWC...ESI.NNIQDVFT-L....IPSPEIRALREESPSNLATLVYK
T1I7V2_RHOPR/1-802-TQPIDAA---------------DNT---FWDQFWS...ENV.TNVQDVFT-L....VPATEIRALREEAPSNLATLCYK
Q7QGJ8_ANOGA/1-825-SQPIDAS---------------DDA---FWEQFWC...EHN.TPVQDVFA-L....VPANEIRKVRDVMPTNLATLCYK
U6I4G6_ECHMU/1-732-QESVNC.---------------SNE---YWNRLLPFDIQTP.LTNEASFY-LEAAVSSLQQRFYRNDLRTHNLATLLQQ
J9KB63_ACYPI/1-736-TQTISAE---------------DND---FWDQFWS...ETV.TNVQDVFT-L....VPAAEIRLLREDVPANLATLCYK
Q17L03_AEDAE/1-819-SQPIDAG---------------DDV---FWEQFWI...EHS.TSVQDVFA-L....IPSNEIRKVRDVMPANLATLCYK
W4Z6Q3_STRPU/1-667-KESIDD.---------------TDP---FWEQLLSFSFNIP.HSSADARL-IEESSQNLCKTLAHSNLHSGNLCALVRV
W5JW75_ANODA/1-876-SQPIDAS---------------DDA---FWEQFWC...EHN.TPVQDVFA-L....VPANEIRKVRDVMPSNLATLCYK
DYM_XENTR/1-646-TDSISE.---------------NEP---FWNQLLSFSFSTP.TNSADSKL-LEEGTLSICKSLIENNPRTGNLGALIRV
A8WTE9_CAEBR/1-690-LEPVDD.---------------YDP---FWNKLLSFSLKFDDDDEKTRIA-LESALDDHLQCLMYNTQTTGNFAAFIRL
M4C137_HYAAE/1-768-KVPIPH.---------------TDA---AYDTVLAAPKVLPQLIQTQVEL-L...TQEYGEAFARNSVYSGNFHVLVRD
B9HUR0_POPTR/1-672-EKTFPI.---------------GSD---FWQKLLELPLNLH........W-PTHRVQEACKLFAQNNCNTRHLTKILIH
F6TGV4_CIOIN/1-683-NVSISE.---------------NDP---FWNQLFSFTLSAP.RDRNEAIL-LEEATETFCKMLVDHNQHTGNFTSLLKV
H3AL71_LATCH/1-849-TQPVEAT---------------DDA---FWDQFWA...DTA.TSVQDVFA-L....VPAAEIRAVREESPSNLATLCYK
C3Z701_BRAFL/1-763-TQPVEAQ---------------DEA---FWDQFWT...DSV.TSVQDVFA-L....VPAAEIRALREESPSNLATLCYK

PF12722

Q2GWB4_CHAGB/1-825VTN------RLFMLRH--------------------------------------------------------------H.
B9W786_CANDC/1-930LCL------KIISTVK--------------------------------------------------------------EC
B6JW01_SCHJY/1-778LCH------RIIACSS--------------------------------------------------------------D.
C3Z701_BRAFL/1-784AVE------KLVMAAE--------------------------------------------------------------S.
A7TNQ6_VANPO/1-1209TAL------QIHLLTN--------------------------------------------------------------S.
B6HUK2_PENCW/1-841VTS------RLTVLKN--------------------------------------------------------------H.
Q3UU20_MOUSE/1-784AVE------KLVQGAE--------------------------------------------------------------G.
Q5ASC1_EMENI/1-732ITS------RLTTLKN--------------------------------------------------------------H.
C4XYD9_CLAL4/17-927VAC------RVVELAR--------------------------------------------------------------D.
C5K8E7_PERM5/1-865IIE------KLEEVCA--------------------------------------------------------------T.
B8M9N3_TALSN/1-838ICS------RLIVLKN--------------------------------------------------------------H.
C5FVH3_ARTOC/1-827ICS------RLVALRH--------------------------------------------------------------H.
A3LX71_PICST/1-905LCN------QIIATAR--------------------------------------------------------------D.
A8WRZ4_CAEBR/1-727AVE------KIQFSRH--------------------------------------------------------------H.
Q0E9B5_DROME/1-834AVE------KLAQAVD--------------------------------------------------------------S.
C0NTS7_AJECG/1-843VTS------RLIVLKN--------------------------------------------------------------H.
YIOC_SCHPO/1-796LWD------KLEDLQK--------------------------------------------------------------E.
A8NNK7_BRUMA/1-721TVD------QITTACN--------------------------------------------------------------S.
C5DS55_ZYGRC/1-1145VSL------TIIEITK--------------------------------------------------------------S.
Q0UAJ2_PHANO/1-733VTS------RLNVLRN--------------------------------------------------------------H.
B0WUT2_CULQU/1-851ATE------RLVRAVD--------------------------------------------------------------N.
A7A1V5_YEAS7/1-1223LSL------YIILSAN--------------------------------------------------------------S.
A7RKV1_NEMVE/1-693...------.......--------------------------------------------------------------..
C5DFL0_LACTC/1-1131FAF------KIHALAC--------------------------------------------------------------Q.
Q6FK58_CANGA/1-1248VIL------KIILIPS--------------------------------------------------------------I.
Q6DGD7_DANRE/1-801AVE------RLVLNAD--------------------------------------------------------------S.
Q6BSE0_DEBHA/1-924LIL------RLTYLAQ--------------------------------------------------------------H.

PF09742

F4WRP0_ACREC/1-730AVE......KLVKAVD.......................SSC....................................R-
E9H938_DAPPU/1-832AVE......RLVSAAD.......................SSC....................................A-
T1JUN4_TETUR/1-644FIS......KSAALKDELN...........................................................K-
J9F5Y0_WUCBA/1-661LLR......RTAELKA..............................................................S-
B4JW54_DROGR/1-859AVE......KLAQAVD.......................SSC....................................R-
I1EYR3_AMPQE/506-1206CMR......KASKLRD..............................................................E-
E0VAE1_PEDHC/1-723FIN......KSTDVLS..............................................................A-
C1FEV8_MICSR/1-964.........AAAALRR........................CS....................................R-
G1MRD7_MELGA/1-648FLS......RTKELKI..............................................................S-
D6WWB7_TRICA/1-769AVE......KLVKAVD.......................SSC....................................R-
H3BX91_TETNG/1-768AVE......KLVQVAD.......................SGC....................................S-
F7D5K7_XENTR/1-770AVE......KLVAGAD.......................NGC....................................H-
H2SJN1_TAKRU/1-774AVE......KLVQGAD.......................SGC....................................S-
B3RQA8_TRIAD/1-734AVE......KLVAASM.......................TAC....................................S-
I3JLL2_ORENI/1-646FLG......RTKELKI..............................................................S-
G7DXH4_MIXOS/12-858LGG......KLLQILSEPGFPAPTQASLAAGLTAAWGGGTAE....................................P-
U1M0X7_ASCSU/1-660FLR......RAAEVKA..............................................................S-
H2XV68_CIOIN/1-762AVE......KLVQASD.......................SGC....................................H-
Q5ZBZ3_ORYSJ/1-682LVW......CLQECMA..............................................................E-
D0NH97_PHYIT/1-769VIHELPFSCRVAKMTE........................SE....................................L-
T1FYR2_HELRO/1-642FLM......RANELST..............................................................S-
Q4DJF1_TRYCC/1-725CIE......VVSQIRN.......................ASL....................................E-
I3KNU8_ORENI/1-782AVE......RLVRGAD.......................SGC....................................P-
I3JCX3_ORENI/1-776AVE......KLVQGAE.......................SGC....................................P-
Q01H67_OSTTA/38-724.........AATQIGA........................AG....................................A-
Q38FE7_TRYB2/1-706CLK......QVEHASC...............................................................-
Q8RWV1_ARATH/1-679LSW......CLQELLQ..............................................................A-
I1MHZ5_SOYBN/1-671LAC......YLQESMS..............................................................T-
B0WBZ3_CULQU/1-681FLV......KVSELLA..............................................................L-
F0Y4A0_AURAN/723-1436AVA......QLCQIVH.......................TPV....................................P-
D7T740_VITVI/12-678LGQ......CLQECIS..............................................................T-
E1ZEP5_CHLVA/1-748VVQ......QLRRTRHHPGGG.........................................................S-
M4BPB3_HYAAE/1-729AVA......QLVQLVE.......................TPV....................................P-
Q5CRW2_CRYPI/1-755FIE......ILLEKERELYISIESNRFQYDRLITSINHLIGLGIVIKFIIIHYLKNFGIDELIKSAEHTQYINFVNDSN-
C5K8E7_PERM5/1-844IIE......KLEEVCA.......................TGL....................................V-
U6HDN4_ECHMU/1-876AVE......RLAQLAE.......................TSF....................................L-
DYM_DROME/1-676FLE......KTSELLS..............................................................L-
H0VNU2_CAVPO/1-646FLA......RTKELKL..............................................................S-
E9ICM4_SOLIN/1-654ALI......RINELLA..............................................................P-
L9KZV5_TUPCH/1-826AVE......KLVQGAD.......................SGC....................................H-
E9G1Z8_DAPPU/1-633FLS......RATELKA..............................................................S-
D7FT96_ECTSI/1-808AVS......HLEKVVD.......................DPD....................................P-
H2MFX7_ORYLA/1-772AVE......RLVQAAD.......................SGC....................................P-
B7S488_PHATC/1-694AVA......QLCQIVE.......................TPY....................................N-
W1NV48_AMBTC/1-680LVW......CLQELAS..............................................................A-
B6A9V3_CRYMR/1-794FTK......LLSSSRKDILMNLEKDMSSLLPCPSTYSTLISTALLLRSIIRHYTQKFSLSNLLLQIEHDYLNFDNESLD-
H2KSV6_CLOSI/110-1035AVE......KLSRIAE.......................ASF....................................P-
M4AQZ4_XIPMA/1-781AVE......RLVQCAD.......................SGC....................................P-
E0VG76_PEDHC/1-766AVE......KLVKAVD.......................SSC....................................R-
B4MQL1_DROWI/1-832AVE......KLAQAVD.......................SSC....................................R-
HID1_DICDI/1-880LVN......QLVLVKG...............................................................-
W4XTN1_STRPU/1-721AVE......KLVSAAE.......................SGC....................................S-
T1K251_TETUR/1-842GVE......KLVSSTD.......................TLC....................................N-
T1I7V2_RHOPR/1-802AVE......KMVRAVD.......................NSC....................................R-
Q7QGJ8_ANOGA/1-825ATE......RMVRAVD.......................NSC....................................R-
U6I4G6_ECHMU/1-732FIV......KGTSVL..........................G....................................S-
J9KB63_ACYPI/1-736AVE......KFVKAVE.......................NSC....................................R-
Q17L03_AEDAE/1-819ATE......RLVRAVD.......................NSC....................................R-
W4Z6Q3_STRPU/1-667FNK......RAMQLKV..............................................................S-
W5JW75_ANODA/1-876ATE......RMVRAVD.......................NSC....................................R-
DYM_XENTR/1-646FLS......RTKELKI..............................................................S-
A8WTE9_CAEBR/1-690FLR......RATELKT..............................................................S-
M4C137_HYAAE/1-768VIHTLPLSCRVATMTE........................SE....................................V-
B9HUR0_POPTR/1-672LSW......CLQECVS..............................................................N-
F6TGV4_CIOIN/1-683FLS......RFSELKS..............................................................S-
H3AL71_LATCH/1-849AVE......KLVQGAE.......................SGC....................................P-
C3Z701_BRAFL/1-763AVE......KLVMAAE.......................SSC....................................A-

PF12722

Q2GWB4_CHAGB/1-825PSFPDP...........EIAPDR..EALNCLRV--L--------TRVLPFI-----------------------------
B9W786_CANDC/1-930KEFCI............NKKEII..ELLNCVRF--L--------IKVLPFI-----------------------------
B6JW01_SCHJY/1-778PNLVEP...........SNVLVT..QLLNAVRI--L--------TRVLPVV-----------------------------
C3Z701_BRAFL/1-784SCA..............TAKEQQ..TVLNCVRL--L--------TRILPYI-----------------------------
A7TNQ6_VANPO/1-1209LNVP...........SLELLKFRFSRILVCIRV--L--------TKLMPLY-----------------------------
B6HUK2_PENCW/1-841PSFPDP...........DLAPER..DVLNCIRI--L--------TRLLPYV-----------------------------
Q3UU20_MOUSE/1-784GCH..............SEKEKQ..VVLNCSRL--L--------TRVLPYI-----------------------------
Q5ASC1_EMENI/1-732PSFPDP...........DLAPDR..DALNCIRI--L--------TRLLPYI-----------------------------
C4XYD9_CLAL4/17-927..................LSPTQHMPLLNCLRL--L--------AKVLPYL-----------------------------
C5K8E7_PERM5/1-865GLVQSEEDEG...SHELTQGQRS..EALQCVRL--L--------TRIAPFL-----------------------------
B8M9N3_TALSN/1-838PSFPDP...........EFAPDT..NALNCIRI--L--------TRILPFV-----------------------------
C5FVH3_ARTOC/1-827PSFPDP...........EIAPAK..DALNCIRI--L--------TRLLPYI-----------------------------
A3LX71_PICST/1-905SEFPS............SKSPLSIRQLLTCIRL--L--------VKLIPFL-----------------------------
A8WRZ4_CAEBR/1-727P................ANIDQK..KVINAIRL--L--------TRITPYM-----------------------------
Q0E9B5_DROME/1-834SCR..............TQAEQQ..CVLNCVRL--L--------VRCLPYI-----------------------------
C0NTS7_AJECG/1-843PSFPDP...........DLAPDR..DALNCIRV--L--------TRILPFI-----------------------------
YIOC_SCHPO/1-796TLFDDP...........AAPTTK..CALNCMRL--L--------TRLMPII-----------------------------
A8NNK7_BRUMA/1-721P................SAISST..KVLNCIRL--L--------TRVCPYL-----------------------------
C5DS55_ZYGRC/1-1145LIDEEEQGVPLSSPSSISLLEMKLTDLLVCIRI--L--------TKVYPVH-----------------------------
Q0UAJ2_PHANO/1-733PSFPDP...........ELAPER..DALNCIRV--L--------TRLLPFL-----------------------------
B0WUT2_CULQU/1-851SCR..............TQGEQQ..TVLNCVRL--L--------NRVLPYI-----------------------------
A7A1V5_YEAS7/1-1223L..............PASRTGLHSSRLINAIKT--L--------SILIPIY-----------------------------
A7RKV1_NEMVE/1-693.........................SRVFCVRL--L--------TRFIPYI-----------------------------
C5DFL0_LACTC/1-1131LQHCD..........DVDEFRARRAELLSSVRI--M--------TKIMPVF-----------------------------
Q6FK58_CANGA/1-1248FGNTQNKS.......SFNKL...FKQLLTCIKI--L--------TKLVPVY-----------------------------
Q6DGD7_DANRE/1-801GCV..............CERDRQ..TVLICTRL--L--------TRILPYI-----------------------------
Q6BSE0_DEBHA/1-924ENFPS............KDAPVS..ELLNCIRF--L--------TKLLPFV-----------------------------

PF09742

F4WRP0_ACREC/1-730TQREHQI...................VLNCCRL..L........TRLLPYI......................FE.....
E9H938_DAPPU/1-832TQQEHST...................VINCVRI..L........TRLLPYI......................FE.....
T1JUN4_TETUR/1-644EASQ................NIIICQTFNSMFV..I........RCCAKHL.............................
J9F5Y0_WUCBA/1-661EIYN.........N......TIFLWQTGNALIV..L........RYICKFL.............................
B4JW54_DROGR/1-859TQADQQC...................VLNCVRL..L........VRILPYI......................FE.....
I1EYR3_AMPQE/506-1206SKCE...............SNMATLQLRNSLFI..L........RCISHHV.............................
E0VAE1_PEDHC/1-723SSTG.........N......EILVWQTYNALFI..I........RCFTRYL.............................
C1FEV8_MICSR/1-964SDVAGSNPSRGDVANEDRA.DDAWTAAINATTL..ATRALRRCSRDTLRFL.............................
G1MRD7_MELGA/1-648AECQ.........N......HLFIWQAHNALFI..I........CCLLKVF.............................
D6WWB7_TRICA/1-769TQHEQQT...................VLNCARL..L........TRILPYI......................FE.....
H3BX91_TETNG/1-768TEKQCHM...................VLNCTRL..L........TRILPYI......................FE.....
F7D5K7_XENTR/1-770SDKQKQV...................VLNCARL..L........TRVLPYI......................FE.....
H2SJN1_TAKRU/1-774SEKQRQT...................VLNCTRL..L........TRILPYI......................FE.....
B3RQA8_TRIAD/1-734TPKEQTTGKKYITKALSILIHRLLIYILNCCRL..L........TRILPYI......................FE.....
I3JLL2_ORENI/1-646TECQ.........D......QLFIWQAHNALFM..I........RCLLKVF.............................
G7DXH4_MIXOS/12-858SDTRQ.....................LLNCVRV..L........TRVLPFVWEGQALPNAAGESESSPADVEEFE.....
U1M0X7_ASCSU/1-660EICQ.........N......TIFLWQTANALII..L........RYICKFL.............................
H2XV68_CIOIN/1-762TDREQHI...................VLNCCRL..L........TRILPYI......................FE.....
Q5ZBZ3_ORYSJ/1-682SS..................HAAYRKAINAAYI..S........SIFLKFI.............................
D0NH97_PHYIT/1-769AAYAPGVVGLDPLNGKPQTVDTHLHRALNALFL..V........RQFAMRF.............................
T1FYR2_HELRO/1-642ALCK.........D......DLFTWQTCNALFI..I........RIVCKYF.............................
Q4DJF1_TRYCC/1-725SASDVQSASQG...............LQNALCL..M........RRIIPIA......................MEGGDTP
I3KNU8_ORENI/1-782SEKERQT...................VLNCTRL..L........TRILPYI......................FE.....
I3JCX3_ORENI/1-776SEKEKQV...................VLNCCRI..L........TRILPYI......................FE.....
Q01H67_OSTTA/38-724HATP....................VSAINVTVL..A........GTFIKYF.............................
Q38FE7_TRYB2/1-706......................NYSQGVSDIFLTTV.........RAVQFV.............................
Q8RWV1_ARATH/1-679SDDQ................SSLYKKAVNATYI..S........SVFLKYL.............................
I1MHZ5_SOYBN/1-671SGVP................QLVYEKAVNAVYF..T........SVFLKHL.............................
B0WBZ3_CULQU/1-681SDAE.........S......TVHIWQAFNALFI..I........RCLVKYM.............................
F0Y4A0_AURAN/723-1436MYFGQ.....................ASNCLRI..L........TRLLPFL......................LEDGG..
D7T740_VITVI/12-678SGVP................STVYTKAVNAVYI..S........SVFLKYL.............................
E1ZEP5_CHLVA/1-748TATA........................NAVYC..L........RTIVKDL.............................
M4BPB3_HYAAE/1-729KYYQQ.....................ALNCVRV..L........TRLVPFI......................LEEGG..
Q5CRW2_CRYPI/1-755FTSEQLSELEKFILFKYNEVEGNNSSKLNLIKY..V........SKSSKFL.............................
C5K8E7_PERM5/1-844QSEEDEGSHELTQGQRSE........ALQCVRL..L........TRIAPFL......................LE.....
U6HDN4_ECHMU/1-876TTQDQQI...................AINCVRL..L........TRIIPYI......................FE.....
DYM_DROME/1-676SDQE.........S......NMHVWQTFNALFI..I........RSLVKYI.............................
H0VNU2_CAVPO/1-646AECQ.........N......HLFIWQTHNALFI..I........CCLLKIF.............................
E9ICM4_SOLIN/1-654VQNQ.........N......IISAWQTYNALFA..V........RCILKYL.............................
L9KZV5_TUPCH/1-826SEKERQM...................VLNCSRL..L........TRVLPYI......................FE.....
E9G1Z8_DAPPU/1-633AQCD................KIFIWQTCNALFI..V........RVIFSHW.............................
D7FT96_ECTSI/1-808FVLKS.....................AMTAVSV..L........TRVLPFI......................LEAYTDP
H2MFX7_ORYLA/1-772SEKERRI...................VVNCTRL..L........TRILPYI......................FE.....
B7S488_PHATC/1-694IYFDQ.....................ALNCVRV..L........TRMLPFL......................LEKGTQS
W1NV48_AMBTC/1-680AAVP................SILYAKAVNAAHL..S........SIFLKYL.............................
B6A9V3_CRYMR/1-794TGSINSQGTCPISKYLDKDFFDIYRTELKTLDLNYY........KRFILFI.............................
H2KSV6_CLOSI/110-1035TAKDQQT...................ALNCIRL..L........TRLFPYI......................FE.....
M4AQZ4_XIPMA/1-781SEKERQI...................VLNCTRL..L........TRILPYI......................FE.....
E0VG76_PEDHC/1-766TQHEQQT...................VLNCVRL..L........TRILPYI......................FE.....
B4MQL1_DROWI/1-832TQTEQQS...................VLNCVRL..L........TRCLPYI......................FE.....
HID1_DICDI/1-880LQRETNTPGDF...............QLTSISLSYL........SRILPIV......................FESG...
W4XTN1_STRPU/1-721APRDQQV...................VLNAARL..L........TRILPYI......................FE.....
T1K251_TETUR/1-842STNQQTL...................VLNSTRL..L........TRILPYI......................FE.....
T1I7V2_RHOPR/1-802TQQEQQT...................VLNCARL..L........TRVLPYI......................FE.....
Q7QGJ8_ANOGA/1-825TQGEQQT...................VLNCVRL..L........TRILPYV......................FE.....
U6I4G6_ECHMU/1-732IKMG.........QEIN...ALDIKMARNALLI..F........RIFTKYI.............................
J9KB63_ACYPI/1-736TQQDQNT...................VLNCSRL..L........TRVLPYV......................FE.....
Q17L03_AEDAE/1-819TQGEQQT...................VLNCVRL..L........NRILPYI......................FE.....
W4Z6Q3_STRPU/1-667AQNE.........D......HVFTWQTYNALFI..I........RRSMKYF.............................
W5JW75_ANODA/1-876TQAEQQT...................VLNCVRL..L........TRILPYI......................FE.....
DYM_XENTR/1-646AECQ.........N......QLFIWQAHNALFI..I........CRLIKVF.............................
A8WTE9_CAEBR/1-690EQCE.........NENSCFSKIYLWQTSNALLI..L........RYIARFL.............................
M4C137_HYAAE/1-768AALGLETAGLDPVDSKLQTVEKDLYRAVNTLFL..V........RQFTMRF.............................
B9HUR0_POPTR/1-672SGAP................SEVYEKAVNAVYI..S........SVFLKYL.............................
F6TGV4_CIOIN/1-683AECD.........D......QLFIWQSRNAMFV..I........QHLCKFL.............................
H3AL71_LATCH/1-849TEKEKQI...................VLNCTRL..L........TRILPYI......................FE.....
C3Z701_BRAFL/1-763TAKEQQT...................VLNCVRL..L........TRILPYI......................FE.....

PF12722

Q2GWB4_CHAGB/1-825--------------------------------------------------------------------------YE.KES
B9W786_CANDC/1-930--------------------------------------------------------------------------FEMADY
B6JW01_SCHJY/1-778--------------------------------------------------------------------------FE.TEI
C3Z701_BRAFL/1-784--------------------------------------------------------------------------FE....
A7TNQ6_VANPO/1-1209--------------------------------------------------------------------------FELQLN
B6HUK2_PENCW/1-841--------------------------------------------------------------------------YE.AEH
Q3UU20_MOUSE/1-784--------------------------------------------------------------------------FE....
Q5ASC1_EMENI/1-732--------------------------------------------------------------------------YE.AEH
C4XYD9_CLAL4/17-927--------------------------------------------------------------------------FELPDY
C5K8E7_PERM5/1-865--------------------------------------------------------------------------LE....
B8M9N3_TALSN/1-838--------------------------------------------------------------------------YE.ADH
C5FVH3_ARTOC/1-827--------------------------------------------------------------------------YE.TDN
A3LX71_PICST/1-905--------------------------------------------------------------------------YEIPEY
A8WRZ4_CAEBR/1-727--------------------------------------------------------------------------LE....
Q0E9B5_DROME/1-834--------------------------------------------------------------------------FE....
C0NTS7_AJECG/1-843--------------------------------------------------------------------------YE.SEN
YIOC_SCHPO/1-796--------------------------------------------------------------------------FE.DKS
A8NNK7_BRUMA/1-721--------------------------------------------------------------------------FE....
C5DS55_ZYGRC/1-1145--------------------------------------------------------------------------LS....
Q0UAJ2_PHANO/1-733--------------------------------------------------------------------------YE.EDR
B0WUT2_CULQU/1-851--------------------------------------------------------------------------FE....
A7A1V5_YEAS7/1-1223--------------------------------------------------------------------------FD..RV
A7RKV1_NEMVE/1-693--------------------------------------------------------------------------FE....
C5DFL0_LACTC/1-1131--------------------------------------------------------------------------FE.MDT
Q6FK58_CANGA/1-1248--------------------------------------------------------------------------LE....
Q6DGD7_DANRE/1-801--------------------------------------------------------------------------FE....
Q6BSE0_DEBHA/1-924--------------------------------------------------------------------------FELPEY

PF09742

F4WRP0_ACREC/1-730.....DPDWKG...FFW.........................................SS..............LPGKDD
E9H938_DAPPU/1-832.....DPDWRS...FFW.........................................SS..............LPSSSK
T1JUN4_TETUR/1-644..........................................................................VQTLTE
J9F5Y0_WUCBA/1-661..........................................................................VQRLSE
B4JW54_DROGR/1-859.....DDKWRD...FFW.........................................SS..............LPA...
I1EYR3_AMPQE/506-1206..........................................................................LQSHSE
E0VAE1_PEDHC/1-723..........................................................................VETVKE
C1FEV8_MICSR/1-964..........................................................................CRRRRQ
G1MRD7_MELGA/1-648..........................................................................ISRMSE
D6WWB7_TRICA/1-769.....DPEWRG...FFW.........................................SS..............LPSQGE
H3BX91_TETNG/1-768.....DADWRG...FFW.........................................ST..............VPGAGR
F7D5K7_XENTR/1-770.....DPDWRG...FFW.........................................SS..............VPGAGR
H2SJN1_TAKRU/1-774.....DADWRG...FFW.........................................ST..............VPGAGR
B3RQA8_TRIAD/1-734.....DSDWRG...FFW.........................................SS..............VPANTD
I3JLL2_ORENI/1-646..........................................................................IREMSE
G7DXH4_MIXOS/12-858.....DA.......IFWRATRIAQAQSSKQHLDGSARDDNHFVLGADEDEEGEQDPLNSS..............KPSSPT
U1M0X7_ASCSU/1-660..........................................................................TQRLSE
H2XV68_CIOIN/1-762.....DPDWQG...FFW.........................................TS..............LPTNS.
Q5ZBZ3_ORYSJ/1-682..........................................................................IENAKT
D0NH97_PHYIT/1-769..........................................................................VERTDE
T1FYR2_HELRO/1-642..........................................................................IENLTE
Q4DJF1_TRYCC/1-725CAAE.EPEKRG...............................................................APASNP
I3KNU8_ORENI/1-782.....DADWRG...FFW.........................................ST..............IPG..R
I3JCX3_ORENI/1-776.....DQDWRG...FFW.........................................ST..............VPGAGR
Q01H67_OSTTA/38-724..........................................................................IEFASE
Q38FE7_TRYB2/1-706..........................................................................VRHACE
Q8RWV1_ARATH/1-679..........................................................................IENGKS
I1MHZ5_SOYBN/1-671..........................................................................IESAPD
B0WBZ3_CULQU/1-681..........................................................................IETGSE
F0Y4A0_AURAN/723-1436.....DDFCEQ...LCWGVE......................................................EPEEGR
D7T740_VITVI/12-678..........................................................................IENAKS
E1ZEP5_CHLVA/1-748..........................................................................MEQLNS
M4BPB3_HYAAE/1-729.....DDFVQE...LFWHVKEDGEKG................................................EEKEEE
Q5CRW2_CRYPI/1-755................................................................................
C5K8E7_PERM5/1-844.....DVDAENCLALLW.........................................HSGGLVVRNRGESVVVEPASPS
U6HDN4_ECHMU/1-876.....VPEWRP...FFW.........................................SV..............LPAQ..
DYM_DROME/1-676..........................................................................NETGSE
H0VNU2_CAVPO/1-646..........................................................................ICEMSE
E9ICM4_SOLIN/1-654..........................................................................IEIVGE
L9KZV5_TUPCH/1-826.....DPDWRG...FFW.........................................ST..............VPGAGR
E9G1Z8_DAPPU/1-633..........................................................................IRLEKE
D7FT96_ECTSI/1-808ETGEVDPALHS...MFWSAEE.....................................................EPPSTA
H2MFX7_ORYLA/1-772.....DADWRG...FFW.........................................ST..............IPGASR
B7S488_PHATC/1-694NIYIGLVTSDE.....................................................................
W1NV48_AMBTC/1-680..........................................................................IENAKS
B6A9V3_CRYMR/1-794..........................................................................LSNISD
H2KSV6_CLOSI/110-1035.....DPEWRS...FFW.........................................SA..............LPLEPD
M4AQZ4_XIPMA/1-781.....DADWRG...FFW.........................................ST..............IPGTKK
E0VG76_PEDHC/1-766.....DPDWRG...FFW.........................................SS..............LPTGSS
B4MQL1_DROWI/1-832.....DEKWRE...FFW.........................................SS..............LPSTQE
HID1_DICDI/1-880.....DDFADK...VFWLNEGIEPLSHPSAKI..........................STPPSITTTKTTEIIEEQEKKD
W4XTN1_STRPU/1-721.....DPDWRG...FFW.........................................ST..............LPGQSS
T1K251_TETUR/1-842.....DPEWKG...FFW.........................................YT..............FSFASR
T1I7V2_RHOPR/1-802.....DPEWRG...FFW.........................................TS..............LPDNSG
Q7QGJ8_ANOGA/1-825.....DVQWKD...FFW.........................................SS..............LPSGSG
U6I4G6_ECHMU/1-732..........................................................................LEHRSS
J9KB63_ACYPI/1-736.....EPDWEN...IFW.........................................SS..............LPAGKG
Q17L03_AEDAE/1-819.....DPQWKD...FFW.........................................SS..............LPSGNE
W4Z6Q3_STRPU/1-667..........................................................................LEMLSE
W5JW75_ANODA/1-876.....DAQWKD...FFW.........................................SS..............LPSNSA
DYM_XENTR/1-646..........................................................................TSQISE
A8WTE9_CAEBR/1-690..........................................................................TQRMTE
M4C137_HYAAE/1-768..........................................................................VERTDK
B9HUR0_POPTR/1-672..........................................................................IENAQS
F6TGV4_CIOIN/1-683..........................................................................AENTTE
H3AL71_LATCH/1-849.....DADWRG...FFW.........................................ST..............VPGAGR
C3Z701_BRAFL/1-763.....DADWRG...FFW.........................................ST..............LPGQAE

PF12722

Q2GWB4_CHAGB/1-825L---------------QQWED..QLFWSPRRKPTRKSS.IANEVLFDGGQDVQPKPP...........VEEFEDAKPLAE
B9W786_CANDC/1-930S---------------NELER..EIFWNNDFDPMRLLQRIDNSKEEEEEEESDKNRNWERL.......LSPDQVANSIAV
B6JW01_SCHJY/1-778G---------------SSWIE..SVFWTINDKNKR.........................................ALGE
C3Z701_BRAFL/1-784D---------------ADWRG...FFWSTLPG....................................QAEDGGSMPLAQ
A7TNQ6_VANPO/1-1209N---------------KDVPNIADIFWTNDPKVLFGIDDDS...........................LDPDVTIEPLGL
B6HUK2_PENCW/1-841L---------------EQWED..NFFWARRKRRTRQSQ.IAGEVLFDEAQPEDNQEATSPR.......AEDYEDVKPLAE
Q3UU20_MOUSE/1-784D---------------PDWRG...FFWSTVPGAGRGG..............................GEEEDENARPLAE
Q5ASC1_EMENI/1-732L---------------EQWEE..KFFWTRRKKKTREAQ.LAADVLFDESQVEEVRDRASPR.......VNEYEDVKPLAE
C4XYD9_CLAL4/17-927A---------------ETIEN..PLFWERNFNPRDFFNQPAAPALVLPRNS.................SFADVSENVLGA
C5K8E7_PERM5/1-865D---------------VDAENCLALLWHSGGLVVRNRG..ESVVVEPASPSVEEAAGDDGSSVTSSVEDVADLGRAPLMY
B8M9N3_TALSN/1-838L---------------EEWEE..QFFWAPRKKKTRQAQ.VASEVLFDEAQGETDNAQTQPR.......VDGREDAKPLAE
C5FVH3_ARTOC/1-827L---------------EEWED..EFFWRRRRKLSRKAQ.LSSRVLFDESRHEDDEEEGNGQTGRRGVAREDYEDVKPLAE
A3LX71_PICST/1-905T---------------QEIEP..RLFWVENFDPLVFIKPSTFASLSSSTSQPC...............LTKESIHNVTAV
A8WRZ4_CAEBR/1-727D---------------AEWRG...YFWSPIPH.......................................GDSTKPLAA
Q0E9B5_DROME/1-834D---------------EKWRD...FFWSSLPS.......................................QDKTMPLAQ
C0NTS7_AJECG/1-843L---------------EAWEE..KFFWGRRRKKHRHAQ.IASQVLFDGASEDDEMRRSNPQD.....HQNDYYDAKPLAE
YIOC_SCHPO/1-796M---------------LEWFD..YFAWTVPKDPNINT.......................................PRGA
A8NNK7_BRUMA/1-721D---------------SDWKC...FFWS.LPSAE..................................ENEQFPHQPLAY
C5DS55_ZYGRC/1-1145.---------------...TGKENWLWNHNEDAIVP..........................................GF
Q0UAJ2_PHANO/1-733L---------------EQWED..DFFWATRRKRSRRGQ.VRSEVIFDEADPEQTPTQQ..........EPEFETAKPLAE
B0WUT2_CULQU/1-851D---------------AQWKD...FFWSSLPAGN..................................EKEEPTAAPLAQ
A7A1V5_YEAS7/1-1223K---------------SSTQDHYDVFWATQHEI...................................EGLPLQNIPLGE
A7RKV1_NEMVE/1-693D---------------PDWRG...FFWSTIP.....................................SQEPEGQTPLAQ
C5DFL0_LACTC/1-1131D---------------QSLED..SLFWSRDSSQALQCGELPAPVVVPKLNVNHA..............PTESQAVVPLGV
Q6FK58_CANGA/1-1248.---------------NIVNGEKDILWDTSPDALFGEHIPDTDLIPVSMTSALKTSLDMPTAD.....LASPHMERPLGA
Q6DGD7_DANRE/1-801D---------------PDWHG...FFWSTVPKLGKSVD..............................EGEEECTRPLAE
Q6BSE0_DEBHA/1-924C---------------SELDD..ILFWSETFDPMTVATGSSLNNIQTPVSVLGGEKENEKT..........VNKENILGV

PF09742

F4WRP0_ACREC/1-730EE.......................................................................SLP.LAH
E9H938_DAPPU/1-832QQFKDDG.........................................................ENPEGHAEESVP.LAQ
T1JUN4_TETUR/1-644E...................NVLKHFLARKDGKE....................................GNETGVEVME
J9F5Y0_WUCBA/1-661T...................EFIKVFHMDKTYLE........................KKDAYDSDFEEEFDGLCENKAE
B4JW54_DROGR/1-859................................................................QEHATNPGQTVP.LAQ
I1EYR3_AMPQE/506-1206E...................ALLNMFDPPPPQSS..............................RGSNSTEADDKEGVAI
E0VAE1_PEDHC/1-723A...................EYIRHFNVKPMMVS........................QTVAEQQLDNLSNKKIHENPLE
C1FEV8_MICSR/1-964.........................................................IANDDDDAPDESGGVATAEPAVC
G1MRD7_MELGA/1-648E...................ELQLHFTYEDKTPG.................................SYGSAMEERDVVQ
D6WWB7_TRICA/1-769DE..............................................................DE.......SVP.LAQ
H3BX91_TETNG/1-768AR..............................................SFGEDEGE........DE.......ARP.LAE
F7D5K7_XENTR/1-770SQ..............................................................EDEEEEEDGSRP.LAE
H2SJN1_TAKRU/1-774AG..................................................DDGE........DE.......ARP.LAE
B3RQA8_TRIAD/1-734G........................................................................AQP.LAK
I3JLL2_ORENI/1-646A...................ELHQQFSYQERAPG..................................SCGETGSEDLLE
G7DXH4_MIXOS/12-858S...............................................................SRKLQTETLLPP.LGE
U1M0X7_ASCSU/1-660A...................EFVKVFDKKLLTNS..........................KEDESDGEQDCEDVYENTAE
H2XV68_CIOIN/1-762................................................................NETDPNGEPCAP.LAK
Q5ZBZ3_ORYSJ/1-682D...................................................NWQELSLEIDKDEKGLENFPSEQS.VEY
D0NH97_PHYIT/1-769C...................PLLAHFNHKPTTEPRRSNAV...AATMRQSLSIQMEDDRADNKRNADEVSLEDSSDDLAA
T1FYR2_HELRO/1-642E...................VVVQQFETINYTEG..................................TNQLEARDALME
Q4DJF1_TRYCC/1-725PVEGANLPAGEAKDEKKRTLFTATFVRSFFEENLACN...........................DAQPEQMLPFLP.GQN
I3KNU8_ORENI/1-782AG..............................................HLDHDAD.........DE.......GRP.LAE
I3JCX3_ORENI/1-776AG..............................................................TDELDDDEGARP.LAE
Q01H67_OSTTA/38-724SGGTTVGVQALGGARSESLRNLAKTFEYDARWES..............................VTASGASTRARS.PFD
Q38FE7_TRYB2/1-706T.................................SRGDASRLLWTIGEDLGESVHGALRVSTTGDSDTVFMNRWLSTGIG
Q8RWV1_ARATH/1-679D...................................................SLQELHLSLDESEPVPHGFVMDQD.IQN
I1MHZ5_SOYBN/1-671G....................................................DVELYLSLHDSESIPKNILRDQT.IEN
B0WBZ3_CULQU/1-681Y...................QLLQHFEALPVQQD.............DADVEQGSEAVTVAVTGETRTALAKLIDGTKFE
F0Y4A0_AURAN/723-1436G...............................................................EGGEEEDGGAEP.LAR
D7T740_VITVI/12-678E...................................................NIEELHLSLDESEVIQNNFPADQN.IEN
E1ZEP5_CHLVA/1-748E...................QLLAFVEVPPDVAAAAVEQQAAAAQGEQPSPAPSPQPSPQDGAPGGGTGRGSGGGEPEFS
M4BPB3_HYAAE/1-729AEEV............................................................EEKEEATGAGES.LAK
Q5CRW2_CRYPI/1-755..............................................................KENEHLLASFEDLS.VFE
C5K8E7_PERM5/1-844VEEAAGDDGSSVTS..................................................SVEDVADLGRAP.LMY
U6HDN4_ECHMU/1-876................................................................PDPNPDTADSVP.LAQ
DYM_DROME/1-676F...................QLLQHFEAMPNAEL.....LQAALEQQQQTPAESATIAMEATEQSAAAAVPVIVDGSKFE
H0VNU2_CAVPO/1-646E...................ELQLHFTYEDKSPG...................................SYSSDSEDLLE
E9ICM4_SOLIN/1-654E...................QMLNHIEAPQTTNE...........................................ALP
L9KZV5_TUPCH/1-826GGGSGPGRGWRVAGASVAGTGTLWSRPHPSRPLLGFGKLSGGERGLPLSGQGEEDD........ES.......ARP.LAE
E9G1Z8_DAPPU/1-633A...................VLIKKFSFQEENSC.........................................ESLLE
D7FT96_ECTSI/1-808ATATRDGAGAGAGTGE................................................QQQQQQQQQQQP.DAR
H2MFX7_ORYLA/1-772GG..............................................CLDEDVDE........NE.......ARP.LAE
B7S488_PHATC/1-694.........................................................................QEP.LAL
W1NV48_AMBTC/1-680D...................................................NFDELHLCLDESEAAPSEIPKGQN.LVN
B6A9V3_CRYMR/1-794R...............................................................DPFMITHNSDNS.VIG
H2KSV6_CLOSI/110-1035SAVD............................................................DE.......CVP.LAH
M4AQZ4_XIPMA/1-781SG..............................................SLDEGADE........NE.......ARP.LAE
E0VG76_PEDHC/1-766QDD.............................................................EE.......SAP.LAQ
B4MQL1_DROWI/1-832K........................................................................TMP.LAQ
HID1_DICDI/1-880QENKQVEENKENEEKKDEEKKDEEKKDEEKKDEDKKENKTTTTTTTTNTTNNTNNN........NNSDESSFDTTP.LAV
W4XTN1_STRPU/1-721D...............................................................EE.......SLP.LAQ
T1K251_TETUR/1-842................................................................DD.......NLP.LAQ
T1I7V2_RHOPR/1-802ERN.............................................................EE.......SSP.LAH
Q7QGJ8_ANOGA/1-825GSSEK...........................................................EEPG.....SVP.LAQ
U6I4G6_ECHMU/1-732H...................SMNLHFADITSKAS......................................NSPS.LAE
J9KB63_ACYPI/1-736DP.......................................................................PIP.LAH
Q17L03_AEDAE/1-819KE..............................................................DN.......ATP.LAQ
W4Z6Q3_STRPU/1-667G...................RILQQLSVLVRTKP......................SSTVLNVEDVMENGDADGDESLLE
W5JW75_ANODA/1-876GEKE............................................................ENGGAGGGAAVP.LAQ
DYM_XENTR/1-646E...................ELLLHFTYRPADPG...................................NYESDTENLFE
A8WTE9_CAEBR/1-690K...................EFVRIFAKNQENER....TESSSTSSSDDEDDDDAQQTEGSDNNNGETKEAQIVFQNTAE
M4C137_HYAAE/1-768S...................PLLDHF......IPRLTEDVDGYQATSQQG..................VIDGNSTDNLAA
B9HUR0_POPTR/1-672N...................................................SIEEFHLSLNESEPAPNGFKTDQN.IES
F6TGV4_CIOIN/1-683M...................KMMEQFGARSLVER..........................QKDLTSGSVFEGTENVNYAH
H3AL71_LATCH/1-849GG.................................................GDEED........EN.......ARP.LAE
C3Z701_BRAFL/1-763DGG......................................................................SMP.LAQ

PF12722

Q2GWB4_CHAGB/1-825E-----LIDTLLDLLF-FSDLTVPKAP..........HGKPKV---------------TYAIWQSGVGCNTSIPT.....
B9W786_CANDC/1-930N-----LISSLVDLLF-IRNFTVPSTA..........SGKENK---------------LLHVWEPGIGGTSKYQQP....
B6JW01_SCHJY/1-778Q-----VMDSLLYLLF-YVGFTIPAVD..........YKSKGV---------------QLCIWETGVGCNTLLTS.....
C3Z701_BRAFL/1-784S-----LLNALSDLLF-CPDFTVAPNKKAGPETHEDLQSIDSC---------------EY.IWESGVGFAHSPAQ.....
A7TNQ6_VANPO/1-1209N-----LVKSCVNLLF-VEAFTIPSNG...........SPGLV---------------SDLLWDNGINTQDAVYHP....
B6HUK2_PENCW/1-841E-----LIDTLVDLLF-FADFTIPRLP..........TVKSKV---------------SFSIWQSGVGCNTAMGS.....
Q3UU20_MOUSE/1-784S-----LLLAIADLLF-CPDFTVQNHRRNDVDSAEDVHSLDSC---------------EY.IWEAGVGFAHSPQP.....
Q5ASC1_EMENI/1-732E-----LIDTLMDLLF-YTGFTIPKLP..........SAKAKV---------------SYSIWQSGVGCNTSMGS.....
C4XYD9_CLAL4/17-927D-----LVLALVRLLV-AQGFTVAEP...........YPESPP---------------DMCLWEPGICVPGKYHSP....
C5K8E7_PERM5/1-865R-----MLRALQWSLF-LKDFTVLIPQ....GASLPLPTHRVD---------------SRFVWRGGIGTAKELPV.....
B8M9N3_TALSN/1-838E-----LIDTLTDLLF-YTGFTIPKLA..........SSEGKV---------------SYAIWQSGVGCNTSMVS.....
C5FVH3_ARTOC/1-827E-----LLDTLLDLLF-FSGFTIPQVP..........ASKGKV---------------VYSIWQSGVGCNTAMGS.....
A3LX71_PICST/1-905Q-----LMRALVDLLF-IRTFTIDAP...........RSKSNK---------------ILSVWEPGIGTSSKYLAP....
A8WRZ4_CAEBR/1-727V-----LLENLSDLLF-CPEFTISHSN...GLKVNDLSTIDSC---------------EY.IWEAGVGSGNKPPM.....
Q0E9B5_DROME/1-834S-----LLNATCDLLF-CPDFTVTATRRAGPEKAEELANIDSC---------------EY.IWEAGVGFAQSPPH.....
C0NTS7_AJECG/1-843E-----LIDTLVDLLF-YSGFTIPTIP..........NAKGKV---------------SYSIWQSGVGCTTAMGS.....
YIOC_SCHPO/1-796S-----FLNTVVDYLF-LINFTIPAHN..........DLTHGV---------------HYCIWETGVVYHPTMLK.....
A8NNK7_BRUMA/1-721T-----LISALTDLLF-CPEFTVSSLR.NHPGGSDDLSTIDSC---------------EY.IWEAGVGFATKPPQ.....
C5DS55_ZYGRC/1-1145L-----LLKSLLKLSF-VEGFTLPSVG...........KPGRI---------------THLLWENGVNTQDSSYDA....
Q0UAJ2_PHANO/1-733E-----VIDTLIDLLF-FSEFTLPKVP..........AGKNKV---------------TYAIWQSGVGCNTPVAS.....
B0WUT2_CULQU/1-851S-----LLNAICDLLF-CPDFTVVGLRKSGPEKAEELNSIDSC---------------EY.IWEAGVGFAQSPPR.....
A7A1V5_YEAS7/1-1223R-----LLLAILKLAF-QDNFTTAVTA...........HPSE.---------------...LWEIGILTNSNKYRSLLNM
A7RKV1_NEMVE/1-693T-----LLDALADLCF-CPEFTVHPNKKAGPEQHEDLSSIDSC---------------EY.IWEAGVGFATSPPS.....
C5DFL0_LACTC/1-1131A-----LLQACVKLLF-MQGFTLPLSK.......PQLDELGKT---------------SFLLWENGINTSESNYRP....
Q6FK58_CANGA/1-1248A-----LLDSCLNLLF-IEDFTVSSSS.......DTSQKTGDL---------------TMILWENGINTYDTSYYT....
Q6DGD7_DANRE/1-801S-----LLSAVSDLLF-CPDFTVESNFKTSADA..DIQSIDSC---------------EF.IWEAGVGFAQTPPL.....
Q6BSE0_DEBHA/1-924N-----IVKCLVDLLF-IRSFTMDVPI......GDEGRSGSKR---------------MMSVWEPGIGTTAKYQTP....

PF09742

F4WRP0_ACREC/1-730S.....LLNALCDLLF.CPDFTVA....AN.RKSGP.....DKADELQSIDS......CEYIWEAGVGFAY.....SPPR
E9H938_DAPPU/1-832S.....LLNALCDLLF.CPDFTVY....SS.KKFGP.....DKHEDLHSIDS......CEFIWEAGVGFAH.....AAPH
T1JUN4_TETUR/1-644S.....LINNLVSVLV.....DIPL.......................................................
J9F5Y0_WUCBA/1-661E.....LLDTLVDILV.....DLPS.......................................................
B4JW54_DROGR/1-859S.....LLNAICDLLF.CPDFTVQ.....GTRRAGP.....EKAEELANIDS......CEYIWEAGVGFAQ.....SPPR
I1EYR3_AMPQE/506-1206RSGLKILLHGTVMLIG.....GVPLVFITATTKFIIAITLTIIYAVVKAFTSSYPFCEVLLISLIVNVAPLIIEWMEHLL
E0VAE1_PEDHC/1-723S.....LLESLLEILI.....DVPL.......................................................
C1FEV8_MICSR/1-964D.....FMAAVVDVVAGCADERAPR.......................................................
G1MRD7_MELGA/1-648S.....LLCCLC..IS.....VISL.......................................................
D6WWB7_TRICA/1-769S.....LLNAVCDLLF.CPDFTVV....AS.RKSGP.....DKAEELSAIDS......CEYIWEAGVGFAH.....SPPR
H3BX91_TETNG/1-768S.....LLLAIADLLF.CLDFTVH....ST.KKSGP.....DAALDLQSVDS......CEYIWEAGVGFAH.....SPPY
F7D5K7_XENTR/1-770S.....LLLAIADLLF.CPEFTVQ....SH.RKSGT.....DTTEDIHTLDS......CEYIWEAGVGFAH.....SPPL
H2SJN1_TAKRU/1-774L.....LLLAIADLLF.CPDFTVQ....SC.KRNSP.....DTALDTQAIDS......CEYIWEAGVGFAH.....SPPY
B3RQA8_TRIAD/1-734S.....LLNAILDLLF.CPDFTVP....KH.KKAGP.....ETPDDLPSIDS......CEYIWEAGVGFAT.....STPA
I3JLL2_ORENI/1-646E.....LLSNLVHLIV.....EVPL.......................................................
G7DXH4_MIXOS/12-858R.....LLAAVVDMLF.FAGLTLP.......RDIVP...........KELKI......SYIIWEAGVGTSV.....SAGA
U1M0X7_ASCSU/1-660E.....FLDALVDIIV.....ELPV.......................................................
H2XV68_CIOIN/1-762S.....LILSLSNLLY.CPEFTVA....SHSKKGST.....DKPEDLTSVDS......CEYIWEAGVGFPR.....SPPA
Q5ZBZ3_ORYSJ/1-682F.....LMRGVLNYIG.....SVDV.......................................................
D0NH97_PHYIT/1-769R.....FLDALLTALI.....EFPP.......................................................
T1FYR2_HELRO/1-642E.....FLNRLVYILI.....DVPQ.......................................................
Q4DJF1_TRYCC/1-725TTLSKFVGRLLVDCCF.IRGLTLA.......ASSLP....AKESESHPCVDE.......SLLWYPGVGGKQVEGTSTQPM
I3KNU8_ORENI/1-782S.....LLLAIADLLF.CPDFTIQ....SH.KKNSP.....DTADDIRAIDS......CEYIWEAGVGFAQ.....APPL
I3JCX3_ORENI/1-776S.....LLLAIADLLF.CPDFTVH....SH..KRGP.....DSVESMQSIDS......CEYIWEAGVGFAQ.....SPPL
Q01H67_OSTTA/38-724D.....LMLACANTLG.....KKRV.......................................................
Q38FE7_TRYB2/1-706K.....LCIALEKFIV.....FVPL.......................................................
Q8RWV1_ARATH/1-679F.....VMHSVLSFIG.....SNEV.......................................................
I1MHZ5_SOYBN/1-671L.....VMRNVLNFIA.....SIDV.......................................................
B0WBZ3_CULQU/1-681T.....FLEALVNIIV.....VIPV.......................................................
F0Y4A0_AURAN/723-1436L.....IVHAALHLLF.LPAFTVDATAFEGEAEDAP....................VPARALWAPGLGCPP.....DVVP
D7T740_VITVI/12-678F.....VMHGVLSFIG.....TLDV.......................................................
E1ZEP5_CHLVA/1-748RLHNGSLVQTLVREAMLTLADDKLL.......................................................
M4BPB3_HYAAE/1-729Q.....MLHAIMGLLF.LPEFTVSIHAYKGYGEERRSATRSGESTTSGVLVF......PSLLWHSGVGYP......DASV
Q5CRW2_CRYPI/1-755Q.....IFLNIPSFLV.CSQKYIDQSNSLSEI................................................
C5K8E7_PERM5/1-844R.....MLRALQWSLF.LKDFTVL.......IPQGA.....SLPLPTHRVDS.......RFVWRGGIGTAK.....ELPV
U6HDN4_ECHMU/1-876T.....LVSSLCDLLF.CPDFTVH....SL.TKSGP.....ENAEDIHTIDS......CEYIWEAGVGFAQ.....SPPQ
DYM_DROME/1-676T.....FIDALVNLIV.....VIPV.......................................................
H0VNU2_CAVPO/1-646E.....LLCCLIQLIT.....DIPL.......................................................
E9ICM4_SOLIN/1-654AYRLAYFIEALIELIT.....DVPL.......................................................
L9KZV5_TUPCH/1-826S.....LLLAIADLLF.CPDFTVQ....SH.RRSTV.....DLAEDVHSLDS......CEYIWEAGVGFAH.....SPQP
E9G1Z8_DAPPU/1-633N.....LAVQLVEILV.....DVPL.......................................................
D7FT96_ECTSI/1-808VALGSAMVSATMRLLF.TRQLTVDVYSSCESVDADA..............DNPLEIHDPRALWSGGLDVGR.....KARI
H2MFX7_ORYLA/1-772S.....LLLAVADLLF.CPDFTVQ....SH.KKSGT.....DPAEEIRSIDS......CEYIWEAGVGFAQ.....SPPL
B7S488_PHATC/1-694L.....VVHAAMHMLF.LPQFTCDYYEDSSSTVAQRRRERVETKDD............KELKADAGLKVKTVDWGVTL..
W1NV48_AMBTC/1-680L.....LTRNLFSFIG.....TADI.......................................................
B6A9V3_CRYMR/1-794E.....LMIEICCYCI.CSQLYIDKISESNGKNYNM............................................
H2KSV6_CLOSI/110-1035S.....LISALCDLLF.CPDFTVH....SI.AKSGP.....EGPEDMHTIDS......CEYIWQAGVGFAQ.....NPVH
M4AQZ4_XIPMA/1-781S.....LLLTIADLLF.CPDFTVQ....SH.KKNNP.....DASEEMRSIDS......CEYIWEAGVGFAQ.....SPPL
E0VG76_PEDHC/1-766S.....LINAVCDLLF.CPDFTVI....GN.RKSGP.....DKAEDLSAIDS......CEYIWEAGVGFAH.....SPPR
B4MQL1_DROWI/1-832S.....LLNAICDLLF.CPDFTVT....SSTRRAGP.....EKAEELANLDS......CEYIWEAGVGFAQ.....SPPK
HID1_DICDI/1-880K.....LMDSLLDLLF.FPGFTVT.......ESLGLKSPKEASPDAIPVLFS..........WAGGFGVDS.....VPTV
W4XTN1_STRPU/1-721S.....LLAALSDLLF.CPDFTVV....AA.KKAGP.....EKPEDPQSIDS......CEYIWDAGVGCAT.....APPH
T1K251_TETUR/1-842S.....LILALCDLLF.CPDFTVASLPSSRNKSSGPFGSPDCPPEDLQSIDS......CEYIWESGVGFTS.....PTSS
T1I7V2_RHOPR/1-802S.....LLNAISDLLF.CPDFTVA....S..KKSGP.....DKAEDLQSIDS......CEYIWEAGVGFAH.....SPPH
Q7QGJ8_ANOGA/1-825S.....LLNAICDLLF.CPDFTVV....GY.RKSGP.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPR
U6I4G6_ECHMU/1-732Y.....TVHLLFLLVI.....EIIP.......................................................
J9KB63_ACYPI/1-736S.....LCSAICDLLF.CPDFTVA....SN.RKNGP.....DKAEDLHAVDS......CEYIWEKGVGFAQ.....SPIK
Q17L03_AEDAE/1-819S.....LLNAICDLLF.CPDFTVV....GL.RKSGP.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPR
W4Z6Q3_STRPU/1-667R.....FIQTLIQLLI.....EVPV.......................................................
W5JW75_ANODA/1-876S.....LLNAICDLLF.CPDFSVV....GY.RKSGP.....EKAEELNSIDS......CEYIWEAGVGFAQ.....SPPR
DYM_XENTR/1-646E.....LLFCLIQLIV.....EIPL.......................................................
A8WTE9_CAEBR/1-690E.....FTYELVSILF.....NISV.......................................................
M4C137_HYAAE/1-768R.....FLDALLSVLI.....EFCP.......................................................
B9HUR0_POPTR/1-672L.....VMHNVLNFIG.....SVEV.......................................................
F6TGV4_CIOIN/1-683E.....LLSALMDIII.....HVPI.......................................................
H3AL71_LATCH/1-849S.....LLLAIADLLF.CPDFTVQ....SH.KKGGP.....ETAEDIHSIDS......CEYIWEAGVGFAH.....SPPL
C3Z701_BRAFL/1-763S.....LLNALSDLLF.CPDFTVA....PN.KKAGP.....ETHEDLQSIDS......CEYIWESGVGFAH.....SPAQ

PF12722

Q2GWB4_CHAGB/1-825..TREHESNRCEILRLLLTLA--GHSLYLSPSV.L....PQ-------------------QGTKALT-----------YM
B9W786_CANDC/1-930..NVVIDSNRTEILKLLLTLC--SNSLYQQVSCVT.....T-------------------HGSKFLT-----------LL
B6JW01_SCHJY/1-778..KHSYEQNKIEILLLLLVLF--SETMYRE.........RS-------------------HSSSYLA-----------YV
C3Z701_BRAFL/1-784..YPHHDQNRSEILKLLLTCF--SETMYQPPG.......DP-------------------LPNQWLT-----------YF
A7TNQ6_VANPO/1-1209.QNPKYDSNRLEIINLLLSLS--SKDLYLKQ...A....SK-------------------VQNLFLF-----------SL
B6HUK2_PENCW/1-841..NKTFESNRCEILRLMLTLT--GKAMYLPSNT.L....PV-------------------QGVKAIT-----------YI
Q3UU20_MOUSE/1-784..NYIHDMNRMELLKLLLTCF--SEAMYLPPSP.E....SG-------------------STNPWVQ-----------FF
Q5ASC1_EMENI/1-732..TRELEDNRCEVLRLLLTIT--GKAMYMSSSL.L....PV-------------------QGVRAIT-----------YI
C4XYD9_CLAL4/17-927..NPIHDSNRTEVLRVLLVLA--STTFYEKVSDTV.....R-------------------TGSRFLT-----------FL
C5K8E7_PERM5/1-865NQNNEIMSARCEVLKCLLTVL--SEPLFQPISS.Y....SS-------------------NPSRVLL-----------TF
B8M9N3_TALSN/1-838..TKEHENNRMEILRLLLTLT--GKSMYMSPTL.L....PV-------------------KGVKAIT-----------YL
C5FVH3_ARTOC/1-827..NKELESNRTEVLRLLLTIT--GQSMYMQPNL.L....PV-------------------KGVKSLT-----------YL
A3LX71_PICST/1-905..NLIIDSNRAEVLKLLLTLC--SSTFYNTPSEVV.....S-------------------AGSKFMT-----------LL
A8WRZ4_CAEBR/1-727..VALHYQNRSEILKLLLTCF--SEVIYAPV...S....DE-------------------NRLRWIC-----------HF
Q0E9B5_DROME/1-834..NAHMERRRTELLKLLLTCF--SEPMYRSPQ..Q....SE-------------------EPNKWIA-----------YF
C0NTS7_AJECG/1-843..NKELESNRCEILRLLLTLS--SQSMYMPLSL.L....PV-------------------KGVKTIT-----------YL
YIOC_SCHPO/1-796..ERSYELHRVEVLRLLLSLF--SEEIYRT.........DG-------------------NGSSCCA-----------YV
A8NNK7_BRUMA/1-721..VAEHDQRRTEILKLLLTCF--SEVIYVSI...S....DE-------------------NRMRWIA-----------RF
C5DS55_ZYGRC/1-1145.QTARIDSNRLEIVNLLLALC--SADLY............G-------------------LPNKFLV-----------AL
Q0UAJ2_PHANO/1-733..TKEFESNRTEILRLLLTFA--SKSMYMSS..........-------------------.......-----------..
B0WUT2_CULQU/1-851..NGHMDARRTELLKLLLTCF--SETMYRVPN..M....SD-------------------EPNKWIV-----------HF
A7A1V5_YEAS7/1-1223HHQWHLFANRLLLLRLLAALF--SSDLYTSGG.......KQ-------------------DINMFLV-----------YW
A7RKV1_NEMVE/1-693..NAQFDCNRAELLKLLLTCF--SEAMYLPPTPEN....HT-------------------RPNKWLC-----------YF
C5DFL0_LACTC/1-1131.PSPKLDSNRLEVLRLLLTVS--SKELY...........SN-------------------HIPKFLC-----------VL
Q6FK58_CANGA/1-1248.QFVHLDANRLQIIELLLALV--SIDIYLPVNSDGFKAKDK-------------------IKNKYLD-----------YM
Q6DGD7_DANRE/1-801..NYSHDSNRTEMLKLLLTCF--SEEMYQSPS..D....TH-------------------TLNPWVS-----------FF
Q6BSE0_DEBHA/1-924..NLIIDSNRMEVLKLMLVLM--TTSVYSVPSQVV.....S-------------------NGSKFLT-----------LL

PF09742

F4WRP0_ACREC/1-730YPI..LDSNRTELLKLLLTCF..SETMYNPPMDLS----IT...................P.NRWIE...........HL
E9H938_DAPPU/1-832DPR..LDNNRNEILKLLLTCF..SQAMYHPPGSES----EA...................P.NKWVQ...........HF
T1JUN4_TETUR/1-644..SDSTYALHCECINLLLVLL..SVQMYSV.KPAS----KS.............V.....IYRCIMK............K
J9F5Y0_WUCBA/1-661..NDSTETIHIEAVKCLMVLL..SSQLYDD.DVMR----PN.............I.....FYRYLMQ...........GK
B4JW54_DROGR/1-859NAQ..MERRRTELLKLLLTCF..SEPMYRTPQQSE----EP.....................NKWIA...........YF
I1EYR3_AMPQE/506-1206YPDPFTYDVLTEAANLSIVLM..SGQLFNKDDLFS----TS.............V.....IINELMD.............
E0VAE1_PEDHC/1-723..DFQTYSLHLEVVNCLLVFL..SAQMYTR.KPAA----KL.............I.....IFKTLMQ...........GR
C1FEV8_MICSR/1-964..GCHVYALRVACCRSLEAIA..DEYSTADDSKAD----SSSPLSTPSAPFANETDGEFDAFDVLMDAVDGCTAVDAGGD
G1MRD7_MELGA/1-648..LVISKHLHLPASATMYVFL..LCVLHAK.D.LR----KG.............F.....SLSYSVQ...........SS
D6WWB7_TRICA/1-769SPV..LDSNRTELLKLLLTCF..SETMYQPPTDIS----QN...................P.NKWIA...........HL
H3BX91_TETNG/1-768NHV..HDMNRTELLKLLLTCF..SEAMYLPPSPDR----KS...................T.NPWVS...........FF
F7D5K7_XENTR/1-770NQT..HDLNRTELLKLLLTCF..SEAMYLPPSPES----SN...................TSNPWVQ...........FF
H2SJN1_TAKRU/1-774NHV..HDTNRTELLKLLLTCF..SEAMYLPPSADR----KS...................V.NPWVS...........FF
B3RQA8_TRIAD/1-734NPQ..FDRNRTEILKLLLTCF..SESLYMLPSADS----GN.....................NQWLD...........YF
I3JLL2_ORENI/1-646..LDITYSILFEAVTVLLVFF..SYQLFHK.DILR----DG.............I.....IYQHIMK...........GR
G7DXH4_MIXOS/12-858TRE..LESNRLELLRLLLVLI..AKTMYMPTTGEH----RV...................Q.NKWTE...........AL
U1M0X7_ASCSU/1-660..SDTTEPIHIEAVKCVMAIL..SSQLYHD.SVLT----SS.............I.....FFGYLMQ...........GK
H2XV68_CIOIN/1-762YGY..IDQNRTEILKLLLTCF..SETIYTPPGAGD----DS...................AANKWIE...........CF
Q5ZBZ3_ORYSJ/1-682..SLESCYLHHELLNLMLVLM..STQLCSGPSPEP----KD....................VHPFID...........AA
D0NH97_PHYIT/1-769..NDRTYDLHVEAVNTLLVLL..SPVAYPR.DHSK----QA.GDLLTHNPFLYML.....MASALPD...........GK
T1FYR2_HELRO/1-642..TDVTYSIHIECINIILSLL..SIQLFQM.SPAS----ES.............M.....LHRCFMQ...........GK
Q4DJF1_TRYCC/1-725NGT..MHALRQELLYTLTALL..SYPLFSPPGTRD----TL...................FSEPLLN...........V.
I3KNU8_ORENI/1-782NYL..HDLNRTELLKLLLTCF..SEAMYLPPSPEN----KV...................L.NPWIS...........FF
I3JCX3_ORENI/1-776NYI..HDLNRTELLRLLLTCF..SEAMYLPPSSDN----TI...................L.NPWVT...........FF
Q01H67_OSTTA/38-724..TTQTMALHTACARVLLITC..SSQLAFD.....----.....................LTDVEAREMGHPLAMSLLKL
Q38FE7_TRYB2/1-706..TVSTVEAHGEVVSLLLCMC..STALYHS.TACD----TN...................FTDPFTRLI...........
Q8RWV1_ARATH/1-679..SPNSYVLHQELLNFMLVTM..STQLLSGPSHGP----TD....................ANPFID...........AA
I1MHZ5_SOYBN/1-671..SPNTYFLHLELLNFMIIAM..STQLLRGPSPGP----ND....................VNPFLD...........AA
B0WBZ3_CULQU/1-681..KEFTYHLHLEAVNCLIVLL..SVSQFTQQGTEK----SN...................IFRTIYK...........C.
F0Y4A0_AURAN/723-1436TSSVAFDRNRVEVLRLLLAAS..CEPLYESADGFD----RW...................S.SRWLG...........VA
D7T740_VITVI/12-678..NPETHLLHHELLNFMLIVM..STQLLSGPSPGP----KD....................VNPFID...........AA
E1ZEP5_CHLVA/1-748..PSTSYMLLLECSQLLLALC..SSALYSASPRGQ----LG....................QHPFLD...........AA
M4BPB3_HYAAE/1-729VNSSTYDKNRKEVLALLLTCF..SSILYQKAETCS----KW...................K.DRFLE...........VA
Q5CRW2_CRYPI/1-755..CNLLISLQNTLMDIMLVLFLPNVE.........----.........................................
C5K8E7_PERM5/1-844NQNNEIMSARCEVLKCLLTVL..SEPLFQPISSYS----SN...................P.SRVLL...........TF
U6HDN4_ECHMU/1-876NAQ..HDANRTEIIRLLLVCF..SETMYLTQAEAR----SE...................I.NKWIA...........FF
DYM_DROME/1-676..KEFTYHLHLEAVNMLITLL..SVHLFAQ.QPTD----KS.............I.....VFRTVFK...........C.
H0VNU2_CAVPO/1-646..LDITYEISVEAISTMVVFL..SCQLFHK.EVLR----QS.............I.....SHKYLMQ...........GP
E9ICM4_SOLIN/1-654..CEFTYVVHLEAINCLLVLL..SVQLFSQTAAEY----ST...................VYRIAMH...........AH
L9KZV5_TUPCH/1-826NYV..HDMNRMELLKLLLTCF..SEAMYLPPALES----GS...................T.NPWVQ...........FF
E9G1Z8_DAPPU/1-633..KEETALLHRESVQTLMLLLFVAASSYLI...NN----KS.............I.....IFKCLMH...........GP
D7FT96_ECTSI/1-808QRSRELEANRIEVMRLLLVLM..CEPLFQRNVGFD----PT...................A.SRFAE...........EV
H2MFX7_ORYLA/1-772NYV..HDLHRTELLKLLLTCF..SEAMYLPPSSDS----KV...................I.NPWVA...........FF
B7S488_PHATC/1-694.....YDKNRIEVLRLVLTAC..CDPLFSPADEYN----PL...................A.SRWLA...........VA
W1NV48_AMBTC/1-680..SPRMYLLHHEVLNLVLVAM..STQLRAGPSRGP----KD....................VHPFID...........AA
B6A9V3_CRYMR/1-794..IHSIYALQAIVMDILIVFFLNSTSEFSISRSIS----SL.....................................TK
H2KSV6_CLOSI/110-1035NTA..HDSNRTEILKLLLTCF..SETMYMERDEAQ----QT...................Q.NKWVS...........FF
M4AQZ4_XIPMA/1-781NYI..HDLNRTELLKLLLTCF..SEAMYLSPLSDS----QV...................L.NPWVS...........FF
E0VG76_PEDHC/1-766LPQ..YDLARTELLKLLLTCF..SETIYQPPVELK----IS...................P.NKWIQ...........YV
B4MQL1_DROWI/1-832NAQ..MERRRTELLKLLLTCF..SEPMYRSPQQSE----EP.....................NKWIA...........YF
HID1_DICDI/1-880HNKQ.FWINRLSVLQCLITCL..SEQLYVPQDSVS----TF...................K.SKWLD...........WI
W4XTN1_STRPU/1-721FAH..LDQNRTEILKLLLTCF..SETMYLAPASDA----HS...................LPNQWIS...........FF
T1K251_TETUR/1-842STT..YDKHRTELLRLILTCF..STTMYKTPNEAR----LT...................P.NRWIT...........FF
T1I7V2_RHOPR/1-802YTT..YDSARTELLKLLLTCF..SETMYQPPVDLQ----SA...................P.NKWVE...........YL
Q7QGJ8_ANOGA/1-825NGS..MDARRTELLKLLLTCF..SETMYRPPTASD----EP.....................NRWIV...........HF
U6I4G6_ECHMU/1-732..SDITYGLLYESLSSLLILL..SAQVSGY.GGDE----IP.............A.....TCKYFTS...........NK
J9KB63_ACYPI/1-736NAT..FESNRTELLRLLLTCF..SQAIYSPNQNG.----.......................NRWVQ...........YV
Q17L03_AEDAE/1-819NGN..MDSRRTELLKLLLTCF..SETMYRVPTMSD----EP.....................NKWIV...........HF
W4Z6Q3_STRPU/1-667..LNFTYVIHLETINTLLVLL..SVQMYIP.RISH----KS.............L.....ITEYIMH...........GK
W5JW75_ANODA/1-876NGH..LDARRTELLKLLLTCF..SETMYRPPTASD----EP.....................NRWIV...........HF
DYM_XENTR/1-646..LDLTYSILLEAVTALIVLL..SYQLFRK.DILH----ES.............P.....IHRHLMK...........GP
A8WTE9_CAEBR/1-690..NDTTLAIHVEAVRCLLTLL..SSQLYNE.SIVN----TS.............I.....VFRFFID...........GA
M4C137_HYAAE/1-768..NDKTYNLHVEVVNTLLVLL..SPVVYSQ.DGFK----HASGDVRSHNPFLYML.....MESALPD...........GS
B9HUR0_POPTR/1-672..SPKTYLLHHELLNFMLVAM..STQLLYGPAPGP----TD....................MNPFID...........AA
F6TGV4_CIOIN/1-683..LDFTYSLHIEALNTILVLL..SVQMFVP.SPGD----NG.............P.....IYRILMT...........GQ
H3AL71_LATCH/1-849NYN..HDLNRTELLKLLLTCF..SEAMYLLPSSET----SS...................L.NPWVQ...........FF
C3Z701_BRAFL/1-763YPH..HDQNRSEILKLLLTCF..SETMYQPPGDP.----.....................LPNQWLT...........YF

PF12722

Q2GWB4_CHAGB/1-825CTNSDKQVVLSVLCSLLNTTLKYNPA---------------------------------S....WRVPY.NALVLKDPKE
B9W786_CANDC/1-930VTVTPKIELLTLVSSLLNITCRSSKS---------------------------------TASE.NGLVF.EKPEYSEIRH
B6JW01_SCHJY/1-778ISHNNSDLSLSLLCSLLNTAMQFNTS---------------------------------FWKPRSVMSA.HLATHA....
C3Z701_BRAFL/1-784ASSENRH.ALPLFTSLLNIVCAYDPI---------------------------------G....YGMPY.NHLLFSDYRE
A7TNQ6_VANPO/1-1209SYLVPEYDSICLISSLINVVCRHCTN---------------------------------FKNE.STLPY.TMVSSKYSQQ
B6HUK2_PENCW/1-841TTCQDKQAVLTLLCSLLNTAMKYNPA---------------------------------S....WRVPY.DHVVWKDPKQ
Q3UU20_MOUSE/1-784CSTENRH.ALPLFTSLLNTVCAYDPV---------------------------------G....YGIPY.NHLLFSDYRE
Q5ASC1_EMENI/1-732TTSQEKQAVLTLLCSLLNTAIKYNPA---------------------------------S....WRVPY.DHVVWKDPRQ
C4XYD9_CLAL4/17-927VAGLASSEINTLTANLTNILCRSART---------------------------------GLDD.SGLKY.DNSSLVEGRH
C5K8E7_PERM5/1-865CSGDLPY.TANLYCSLMSTVVAYDPR---------------------------------G....YGVPY.GSAFSSGSQE
B8M9N3_TALSN/1-838ATCSDKQIVLTLLCSLLNTTIKYNPA---------------------------------I....WRVPY.DHVVWKDSKQ
C5FVH3_ARTOC/1-827VTCGEKKLVMSLLCSLLNTTIKYNPT---------------------------------P....WRLPY.DHVVWKDPKQ
A3LX71_PICST/1-905VTSTPRVELLTLVCSLTNLVCRSTRS---------------------------------SPED.NALSYPSNSQLTEMRH
A8WRZ4_CAEBR/1-727TAVTNPH.VLPIFTSLLNIVCAYDPV---------------------------------G....YGLPY.NYLLFNDSRE
Q0E9B5_DROME/1-834TSADNRH.ALPLFTSFLNTVCSYDPV---------------------------------G....FGVPY.NHLLFADTTE
C0NTS7_AJECG/1-843VTCPDKQVVLSLLCSLLNTTIKYNPT---------------------------------P....WRLPY.DHVVWKDPKQ
YIOC_SCHPO/1-796ASIANRRLVLCLLSSLINTAMRFNTM---------------------------------FWKP.EFLPLDNSVAHM....
A8NNK7_BRUMA/1-721TSAENRH.VLPLFTSLLNIVCAYDPV---------------------------------G....FGVPY.NYLLFTDTRE
C5DS55_ZYGRC/1-1145CHLAPEYDVVCLVASIVNTVCRYCNN---------------------------------NEE..SSMPY.QNFSYKQSQQ
Q0UAJ2_PHANO/1-733..........................---------------------------------..............VFKDQRQ
B0WUT2_CULQU/1-851TSADNRH.ALPLFTSLLNTVCAYDPV---------------------------------G....IGVPY.NHLLFTDTLE
A7A1V5_YEAS7/1-1223CTQMPKDKSIQFTSSLLNCTMRFILN---------------------------------NNKDFQSLK..ANFFSSDATA
A7RKV1_NEMVE/1-693ASSENRH.ALPLFTSILNTVCSYDPL---------------------------------G....YGVPT.......DFKE
C5DFL0_LACTC/1-1131TTSLPEFHIICLASSLLNLVCRSCRN---------------------------------NEEN.NGLNYPPNSYHTSCKS
Q6FK58_CANGA/1-1248KYEAREHSVICLTASIINLFCRHSAY---------------------------------YKQE.GTNPY.KIIPKENSRE
Q6DGD7_DANRE/1-801CSRENRH.ALPLFTSLLNVVCAYDPI---------------------------------G....YGVPY.NHLMFSDQRG
Q6BSE0_DEBHA/1-924VATTPRVELLILVCSLMNLLCRSARS---------------------------------PVEE.NMLFY.RNIELTEMRH

PF09742

F4WRP0_ACREC/1-730TS.SENRHALPMFTSLLNTVCAYDPV.....................................GYGVPYNHLLF..TDSL
E9H938_DAPPU/1-832TS.PENRHALPLFTSLLNVLCAYDPV.....................................GLGLPYNHLLF..TDSR
T1JUN4_TETUR/1-644CA.IHSL...LLTKCLINNFIRQDLP.......................P.........REDGGSVI.........LDLA
J9F5Y0_WUCBA/1-661CS.TRSL...ELSRALISNYLQRYTP............................CVVKHDKEPESIV.....LG....LA
B4JW54_DROGR/1-859TS.ADNRHALPLFTSFLNSVCSYDPV.....................................GFGVPYNHLLF..ADTT
I1EYR3_AMPQE/506-1206...IPLDVSSSLVQSLVSFFISQPIP.......................PPDTLRVQP..............SGVFSSFA
E0VAE1_PEDHC/1-723PS.IHSP...LLIKTLLGHFIKQEKP................................YERGGGSIV.....IG....LA
C1FEV8_MICSR/1-964GR.SGESIYRDVVAETLRLWSRRPPL.......................PRGSDAWMHDPNDASGKP.....RGGFLGAM
G1MRD7_MELGA/1-648CA.ARSS...DCVLCLPHNNTXKTTP.......................KSSSAYSFPQIFDSKKTK.....YYEVIGVS
D6WWB7_TRICA/1-769TS.SENRHALPMFTSLLNTVCAYDPV.....................................GLGVPYNHLLF..NDSL
H3BX91_TETNG/1-768CS.SENRHALPLFTSLLNVVCAYDPV.....................................GYGIPYNYLLS..SDQR
F7D5K7_XENTR/1-770CS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPYNHLLF..WDSR
H2SJN1_TAKRU/1-774CS.SENRHALPLFTSLLNVVCAYDPV.....................................GYGIPYNYLLS..SDQR
B3RQA8_TRIAD/1-734TS.TNNRHALPLFTSLLNTVCSYDPV.....................................GYGVPYNHLMF..QDAR
I3JLL2_ORENI/1-646CM.CLTS...RLVKTLLYNFIRQEKC.......................PPPSTHIFEPKAE.GGLL.....YGLASGVA
G7DXH4_MIXOS/12-858VSLSDRKVVLSLLCSLLNTSLNNANP.....................................GL.LNYDTLVLRREDTK
U1M0X7_ASCSU/1-660CS.SRSM...ELTKALLTNYLQRNTP............................YVTKREKEPESIV.....LG....LA
H2XV68_CIOIN/1-762CS.SDNRQALPLFTSLLNVFCAYDPV.....................................GLGVPYNHLLF..HDYR
Q5ZBZ3_ORYSJ/1-682ML.QDSSIVSSVVQKLLLNFVKRPRI.......................PLNS.SHPAFSDDGGPGV.....LQRVGSVA
D0NH97_PHYIT/1-769KS.YWAS...AIVRRLLQNSIEQIQATGASSASNTAVIALRKARETSLIAMSGMSDQAYELEQFSYL....TLEGVGSIA
T1FYR2_HELRO/1-642CS.RNSC...KLVKNLLETFTSQCRT................................NNNTPHGAL.....YGVACRFI
Q4DJF1_TRYCC/1-725...DENPLLPTLVASTLNAILAYKPF.....................................G.SIPYTSHWV...GPE
I3KNU8_ORENI/1-782CS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPYNHLLF..SDYR
I3JCX3_ORENI/1-776CS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPYNHLLF..SDYR
Q01H67_OSTTA/38-724GA.SDSKMTGTLMCSLLRQIVAR..........................PPNSGDICALPANRDDEK.....CGVTRGLV
Q38FE7_TRYB2/1-706...LASGDLHALVLVLLQRLMDWGEG.......................................RLPKTPVLYRCAQYS
Q8RWV1_ARATH/1-679MT.QEKSLVSLVVRRLLLNYISRHRT.......................PPNAKSY.MYSDGDSQGI.....LERVGSAA
I1MHZ5_SOYBN/1-671MA.QDSHLVTSVVCKLLLNYITRPRV.......................PFSRASYSIFYDGSQNSV.....LKKVGSEA
B0WBZ3_CULQU/1-681...QHAN...TLMSALLHFLSRMTQV.......................P....ATMFGFGSGGSFV.....FG....IA
F0Y4A0_AURAN/723-1436TA.PDAPNAKLLLYSLLNVVCGYDPI.....................................GLGVPYGGHLS..DEAP
D7T740_VITVI/12-678MA.QESSLVGLVVRRLLINYINRPRI.......................PLNDVSYSIFSEGSQPGV.....LQRVGSAA
E1ZEP5_CHLVA/1-748M..QQKDLANTTVEALLRLFIAAPPV.......................PLSLKIFTYMPTDTRSM......LKIVRSAA
M4BPB3_HYAAE/1-729TA.PECPFVPTLFYSLLNIVVAYDPV.....................................GWGVPYAGSIV..SDDR
Q5CRW2_CRYPI/1-755...NHQHIDNGDIYTFITCFQVHSSI.......................KSVKLIYCEDDSDLFQDNRYLFLQYLIKKSL
C5K8E7_PERM5/1-844CS.GDLPYTANLYCSLMSTVVAYDPR.....................................GYGVPYGSAFS..SGSQ
U6HDN4_ECHMU/1-876SG.PENRHVLPLFTSLLNVVCAYNPA.....................................SSSLPYNHLMF..TDSR
DYM_DROME/1-676...QHAN...VLMSALLHFVARIVEV.......................P....HTMFGSSSAGSFV.....FG....IA
H0VNU2_CAVPO/1-646CL.PYTS...KLVKTLLYNFIRQEKP.......................PPPGSHVFSQQSDGGGLL.....YGLASGVA
E9ICM4_SOLIN/1-654LN.QHAP...AMVCTLLHNFVQQEHA.......................P....PGLLTQQSGGSIV.........FSIA
L9KZV5_TUPCH/1-826CS.TENRHALPLFTSLLNTVCAYDPV.....................................GYGIPYNHLLF..SDYR
E9G1Z8_DAPPU/1-633GA.LHAG...LLTRTLLQHYCQQQSV.......................P...VRWLRKPEQGGSIV.....LGLASKFV
D7FT96_ECTSI/1-808CK.ADAPFAAELFFSLLSVIATYDPV.....................................GWGVPYAGSFT..TDLP
H2MFX7_ORYLA/1-772CS.AENRHTLPLFTSLLNVVCGYDPV.....................................GYGVPYNHLLF..SDSR
B7S488_PHATC/1-694TA.ADAPNACCLFFSLLNTILHYDPR.......................................GLPVAAGFS..ENSH
W1NV48_AMBTC/1-680MA.QESALVGSVVRRLLLTYITHPRI.......................PLNSASYNSFLEGSQTGV.....LQKVGSAA
B6A9V3_CRYMR/1-794IE.NKTNILLPSFLDIFQILSVHLMN.........................PSLIIQRDDSENTETIPYSFFFFLTRTTI
H2KSV6_CLOSI/110-1035TS.TNNRHALPLFASLLNVVCAYDPV.....................................GFGVPYNHLMF..SDSR
M4AQZ4_XIPMA/1-781CS.AENRHALPLFTSLLNVVCSYDPV.....................................GYGIPYNHLLF..SDYR
E0VG76_PEDHC/1-766TS.AENRHALPMFTSLLNTVCAYDPV.....................................GLGVPYNHLLF..SDTA
B4MQL1_DROWI/1-832TS.ADNRHALPLFTSFLNTVCSYDPV.....................................GFGVPYNHLIF..VDTT
HID1_DICDI/1-880TH.TQEYYTEALLFSLINTFATFDPI.....................................GWGIPYNHLMY..SDDH
W4XTN1_STRPU/1-721CS.SDNRHALPLFTSMINIACAYDPV.....................................GYGMPYNHLLF..SDTR
T1K251_TETUR/1-842TS.PDNRHALPLFTSLINTVFSYDPA.....................................GY.LPFNHLLF..SDSR
T1I7V2_RHOPR/1-802TS.TENRHALPMFTSLLNTVCAYDPV.....................................GLGLPYNHLLF..SDTA
Q7QGJ8_ANOGA/1-825TS.ADNRHALPLFTSLLNTVCAYDPV.....................................GIGVPYNHLLF..TDTL
U6I4G6_ECHMU/1-732CL.ADAP...AFIHRLVLNVAENLPC.......................P....PNMLAESHAPGML.....WNAASTIA
J9KB63_ACYPI/1-736TS.AENRHALPMLTSLLNTVCGYDPI.....................................GMGVPYNHLLF..ADTS
Q17L03_AEDAE/1-819TS.AENRHALPLFTSLLNTVCAYDPV.....................................GMGVPYNHLLF..TDTL
W4Z6Q3_STRPU/1-667CS.SDAH...VLVKILLDQFIKREDC.......................P...AELLRDSPKPASFL.....YGISAAIA
W5JW75_ANODA/1-876TS.ADNRHALPLFTSLLNTVCAYDPV.....................................GMGVPYNHLLF..TDTL
DYM_XENTR/1-646CL.PYTS...RLVKTLLYNFIRQEKS.......................PPPGSHIFPQQQDGGGLL.....YGLASGVA
A8WTE9_CAEBR/1-690CA.QHAA...KLTKTLLLNYLIHNSE............................YHMTVAKPQESIV.....FG....LA
M4C137_HYAAE/1-768RS.YWAS...SLIHRLLRNSIDQLQATGLNAMANTAVVAIRKAQEMSLGTMSGISEQTREPEESSYLSRYFTLEGVGSIA
B9HUR0_POPTR/1-672MA.QESSLVGLVVRRLLLNYIIRPRI.......................PYNSASYPVFSGGSQPGV.....LQRVGSAA
F6TGV4_CIOIN/1-683CA.AKAN...NFMRALLQNFIEQRPS.......................P....EAGSRENGGGSFV.....IGIASAVA
H3AL71_LATCH/1-849CS.TDNRHALPLFTSLLNIVCAYDPV.....................................GFGIPYNHLLF..SDYR
C3Z701_BRAFL/1-763AS.SENRHALPLFTSLLNIVCAYDPI.....................................GYGMPYNHLLF..SDYR

PF12722

Q2GWB4_CHAGB/1-825.............................-------------------------------------.ILVTYTL......
B9W786_CANDC/1-930.............................-------------------------------------.LCVTYAI......
B6JW01_SCHJY/1-778.............................-------------------------------------.TLVELCF......
C3Z701_BRAFL/1-784.............................-------------------------------------.PTVEVAL......
A7TNQ6_VANPO/1-1209......................HQLPQLR-------------------------------------SAFIISSL......
B6HUK2_PENCW/1-841.............................-------------------------------------.ILVIYCV......
Q3UU20_MOUSE/1-784.............................-------------------------------------.PLVEEAA......
Q5ASC1_EMENI/1-732.............................-------------------------------------.IL...........
C4XYD9_CLAL4/17-927.............................-------------------------------------.LCVSYSA......
C5K8E7_PERM5/1-865.............................-------------------------------------.ALVDLSLQVKVPG
B8M9N3_TALSN/1-838.............................-------------------------------------.ILVIYCL......
C5FVH3_ARTOC/1-827.............................-------------------------------------.ILVIYCL......
A3LX71_PICST/1-905.............................-------------------------------------.LTVTYSI......
A8WRZ4_CAEBR/1-727.............................-------------------------------------.PLVEIAL......
Q0E9B5_DROME/1-834.............................-------------------------------------.PLVEACL......
C0NTS7_AJECG/1-843.............................-------------------------------------.IFVIYCL......
YIOC_SCHPO/1-796.............................-------------------------------------.SLIEYCF......
A8NNK7_BRUMA/1-721.............................-------------------------------------.PLVQTAL......
C5DS55_ZYGRC/1-1145......................QQLPQLR-------------------------------------FSMVSSSL......
Q0UAJ2_PHANO/1-733.............................-------------------------------------.ILVTYCL......
B0WUT2_CULQU/1-851.............................-------------------------------------.PLVEVCL......
A7A1V5_YEAS7/1-1223......................SNWQTLY-------------------------------------FQFVQSCL......
A7RKV1_NEMVE/1-693.............................-------------------------------------.PMVEVAA......
C5DFL0_LACTC/1-1131......................TNMRALR-------------------------------------KALAAASA......
Q6FK58_CANGA/1-1248NPKYSNRNSFDTNPGSSNNINSQWLPELR-------------------------------------SKLVISSL......
Q6DGD7_DANRE/1-801.............................-------------------------------------.ELAELAL......
Q6BSE0_DEBHA/1-924.............................-------------------------------------.LCVTYAT......

PF09742

F4WRP0_ACREC/1-730..................................................................EPLVDVAL......
E9H938_DAPPU/1-832..................................................................EPLVETAL......
T1JUN4_TETUR/1-644.....SGL...................WSALTLGYGKNNNDETLK.....................PVLSKLSL......
J9F5Y0_WUCBA/1-661.....ASV...................WSAVQIVTGMDDSNSLSSDSEITPP..............VSLGSLSV......
B4JW54_DROGR/1-859..................................................................EPLVEACL......
I1EYR3_AMPQE/506-1206.....SGL...................LSLVLPQHDILENT.........................SPLALSSL......
E0VAE1_PEDHC/1-723.....SNI...................WHILSLAYKNSTNLEPPKG....................ITLANQSL......
C1FEV8_MICSR/1-964.....AALLLGDDDDDDDNGDDDKGKDWDVSVF.................................SPLGDAAG......
G1MRD7_MELGA/1-648.....PSL...................WKVFNEVGLCSQETAPSQL.V..................VPVAASEL......
D6WWB7_TRICA/1-769..................................................................EPLVEAAL......
H3BX91_TETNG/1-768..................................................................EQLVVQAI......
F7D5K7_XENTR/1-770..................................................................EPLVEVSA......
H2SJN1_TAKRU/1-774..................................................................EQLVVHVI......
B3RQA8_TRIAD/1-734..................................................................EPLVEIAV......
I3JLL2_ORENI/1-646.....SGL...................WSVFTLGGAGSRAGIDQEHDP..................LPLSNQSL......
G7DXH4_MIXOS/12-858..................................................................SQLASLSL......
U1M0X7_ASCSU/1-660.....ASV...................WSVMQIAAGYDEANGYDEDANLIPP..............ASLGSLSV......
H2XV68_CIOIN/1-762..................................................................EPLVEAAC......
Q5ZBZ3_ORYSJ/1-682.....ANF............VLLPYYTFNYLVSSNAEGAS..........................SQLADNSL......
D0NH97_PHYIT/1-769.....ASIFR............FP...WSFIRYFTTREDTA.........................SPLADRSV......
T1FYR2_HELRO/1-642.....SSL...................WSVVTLGLANQKTEHVVNESR..................AMLANQSL......
Q4DJF1_TRYCC/1-725..................................................................EMVVLMSA......
I3KNU8_ORENI/1-782..................................................................EQLVEQAV......
I3JCX3_ORENI/1-776..................................................................EQLVEQAV......
Q01H67_OSTTA/38-724.....SAF...................SALFPSRSDKSAQSCRSKRVAHNLVRCTHSTQ.......SPLADEFS......
Q38FE7_TRYB2/1-706.........................SLWTLYNMFAGGTENESITCG....................NHLGRHCA......
Q8RWV1_ARATH/1-679.....ASL............VLLP...LNYLVSNSG.GSK..........................NPLAECSL......
I1MHZ5_SOYBN/1-671.....ANI............VLLP...FSYLISSSSEGSR..........................NPIADSSL......
B0WBZ3_CULQU/1-681.....ESL...................WSILTFA.......RKQPDVLTAH......DLPAAFKDHYPLANQSL......
F0Y4A0_AURAN/723-1436..................................................................TQAVYAAA......
D7T740_VITVI/12-678.....ANF............VLLP...FNYLVSSGGEGPR..........................SPLADSSL......
E1ZEP5_CHLVA/1-748.....ASM............LWLPYQAYTLLLRPSRPGGGGEGTGGAAAAPSN.............SPLGDSAL......
M4BPB3_HYAAE/1-729..................................................................EVLVDLSL......
Q5CRW2_CRYPI/1-755NFEKKCQLF.........................................................ELNKKKSI......
C5K8E7_PERM5/1-844..................................................................EALVDLSLQVKVPG
U6HDN4_ECHMU/1-876..................................................................EPLVEAAL......
DYM_DROME/1-676.....ESL...................LSIFTF........RKQPDILKAGQAAGGGELSQRFRTHYPLANQSL......
H0VNU2_CAVPO/1-646.....TGL...................WTVFTLGGVGSKAAASAELP...................SPLANQSL......
E9ICM4_SOLIN/1-654.....AGL...................WNVIRMGIGSSSKNIQVAHNGTAEEEERKRDTE......TPLASQSL......
L9KZV5_TUPCH/1-826..................................................................EPLVEEAA......
E9G1Z8_DAPPU/1-633IFVYLAGL...................WSLISRNSSTAESVDAV......................SDFASQSL......
D7FT96_ECTSI/1-808..................................................................ARQLEMSA......
H2MFX7_ORYLA/1-772..................................................................EQLVEQAL......
B7S488_PHATC/1-694..................................................................VKLVELSA......
W1NV48_AMBTC/1-680.....ATF............VLLPYYTFNYIVNSSSDGSR..........................SPLADISL......
B6A9V3_CRYMR/1-794NGKKHSPTP.........................................................IGIKNRSL......
H2KSV6_CLOSI/110-1035..................................................................EPLVEVAL......
M4AQZ4_XIPMA/1-781..................................................................EQLVEQAL......
E0VG76_PEDHC/1-766..................................................................EPLVDTAL......
B4MQL1_DROWI/1-832..................................................................EPLVEACL......
HID1_DICDI/1-880..................................................................EICSKLSI......
W4XTN1_STRPU/1-721..................................................................EPLVEIAS......
T1K251_TETUR/1-842..................................................................ESLVEVCL......
T1I7V2_RHOPR/1-802..................................................................EPLVDTAL......
Q7QGJ8_ANOGA/1-825..................................................................EPLVEVCL......
U6I4G6_ECHMU/1-732.....SGL...................MTVVTLGYSRRAASTRAEAKLESGSPGGGVL........HPLAKQSC......
J9KB63_ACYPI/1-736..................................................................EPLVDMCL......
Q17L03_AEDAE/1-819..................................................................EPLVEVCL......
W4Z6Q3_STRPU/1-667.....AGI...................WAVLTLGYGTRSKPDDREDR...................ALLANQSL......
W5JW75_ANODA/1-876..................................................................EPLVEVCL......
DYM_XENTR/1-646.....SGI...................WTVLTLGGVGSKPTPQQEQS...................SPLANQSL......
A8WTE9_CAEBR/1-690.....SSM...................WSMVQMATGLDSAEEDNKPP...................LTLGNLCI......
M4C137_HYAAE/1-768.....VSIFR............SP...WSFVRHCTTREETA.........................SPLADRST......
B9HUR0_POPTR/1-672.....ATL............VLLP...FNYLVSSTGDGSR..........................NPLADSSL......
F6TGV4_CIOIN/1-683.....SGL...................WSALKLGGKKDSGVSKELTSELGP...............PTIGRQSA......
H3AL71_LATCH/1-849..................................................................ENLVEVAA......
C3Z701_BRAFL/1-763..................................................................EPTVEVAL......

PF12722

Q2GWB4_CHAGB/1-825..........QLLL-------ATLLYPIPEQTGV..............................................
B9W786_CANDC/1-930..........QLLT-------LMVVYPLPQKSELKFLIEGGLC.....................................
B6JW01_SCHJY/1-778..........TVFL-------TLITDPVIGSSSRFLEFARTRN.....................................
C3Z701_BRAFL/1-784..........QLLI-------VVLDHD.NGQSAISVDGTTTGTAMDQGAE..............................
A7TNQ6_VANPO/1-1209..........QLLN-------IMCSKFWLDNEKLIVENLEKLGVLNRQDIQ.............................
B6HUK2_PENCW/1-841..........QLLL-------VLLMYPIPEDGRG..............................................
Q3UU20_MOUSE/1-784..........QVLI-------VTLDHDSATSTSPTVDGTTTGTAMDDADP..............................
Q5ASC1_EMENI/1-732..............-------...........................................................
C4XYD9_CLAL4/17-927..........ELLA-------CMVVCPMPSSAHTAFMTNLGLCS....................................
C5K8E7_PERM5/1-865SNPGAGTCTVQVLC-------ALLDFNPSPDNTGSEMVKTHRTGTGSEDGSNNSISESSNQEESAAARRRFSSCAFPLAG
B8M9N3_TALSN/1-838..........QLLL-------VILLYPIPEDGRG..............................................
C5FVH3_ARTOC/1-827..........QFLL-------ALLLYPIPEDGRG..............................................
A3LX71_PICST/1-905..........QLLT-------AMVVYPLPSPEKLDFLKETELIST...................................
A8WRZ4_CAEBR/1-727..........QVLI-------VCLDKESQPKTDDSGY...........................................
Q0E9B5_DROME/1-834..........QLLI-------VTLDHDMVVQQQLTQPGQASYDEG...................................
C0NTS7_AJECG/1-843..........QFLL-------VLLLYPIPEDGRG..............................................
YIOC_SCHPO/1-796..........SVLL-------ILMSEENNNGTPCYNNYRSSKN.....................................
A8NNK7_BRUMA/1-721..........QVLI-------VCLDNETQSSDKKNEY...........................................
C5DS55_ZYGRC/1-1145..........QLLN-------IMCLRSDLKEAQILAQSMDPNSKS...................................
Q0UAJ2_PHANO/1-733..........QLLL-------VLILYPIPEAGNG..............................................
B0WUT2_CULQU/1-851..........QILI-------VTLDHDITSNTSSNSPTGGAQSAQSYSHDDT............................
A7A1V5_YEAS7/1-1223..........HVLN-------LSMSY......................................................
A7RKV1_NEMVE/1-693..........QLLV-------VLLDHDGGDGQNPINDDLANDMMEP..................................
C5DFL0_LACTC/1-1131..........QMLN-------LSLLCSIEGPRRSEIYLFLYGLNLYSTN...............................
Q6FK58_CANGA/1-1248..........QFLN-------VMICPEESNTKVTK.............................................
Q6DGD7_DANRE/1-801..........QTLI-------ISLEQELNDTHPNTHITADTDYNRNNTTEACPT..........................
Q6BSE0_DEBHA/1-924..........QLLT-------LMIVYPLPSQPNLQFLYDLNLLTT...................................

PF09742

F4WRP0_ACREC/1-730..........QILI.......VTLDHDTTGGIPME.............................................
E9H938_DAPPU/1-832..........QLLI.......VTLDWDSSAQCSQLNTIDEQ.......................................
T1JUN4_TETUR/1-644..........FLLL.......VLTYHCTTDS.................................................
J9F5Y0_WUCBA/1-661..........LLLL.......NLACHQDPEAKL...............................................
B4JW54_DROGR/1-859..........QLLI.......VTLDHDMVIQQQQQQQQHQHQPQQQQHQQQQQLTHAGGVLVTPYD..............
I1EYR3_AMPQE/506-1206..........LFLL.......ILVHQHSRGH.................................................
E0VAE1_PEDHC/1-723..........LLIL.......VLVSHCTAEKNLL..............................................
C1FEV8_MICSR/1-964..........AALT.......RLLHRPARYDGVAEVGRCVANESASTAVVSTAGKVVRREPNVAGSSPGRSAGIVKSSRE
G1MRD7_MELGA/1-648..........MIVL.......ICSQYRSLSDHP...............................................
D6WWB7_TRICA/1-769..........QILI.......VTLDHDTSSSSPAEGE...........................................
H3BX91_TETNG/1-768..........QVLV.......VTLEHEGGAVARAALQVLDGTAPTEAMGEQ.............................
F7D5K7_XENTR/1-770..........QLLI.......VTLDSDLTVTSSP...SMDGTTTSTAMDET.............................
H2SJN1_TAKRU/1-774..........QVLI.......IALEHEG..VARASLQVLGGISPSAAVGQQ.............................
B3RQA8_TRIAD/1-734..........QLLV.......VVLDHEPSTITIDRSAEHD........................................
I3JLL2_ORENI/1-646..........LLLL.......VLANLTDGPEWP...............................................
G7DXH4_MIXOS/12-858.......LALDILL.......VCQDGRADSTSVPSTPMPSLKRNTSFLSDASFSSMA.......................
U1M0X7_ASCSU/1-660..........LLLL.......NLACHQNADNNKA..............................................
H2XV68_CIOIN/1-762..........QILI.......VALDHNAAEKEDEPVDSSSLSPSILS.................................
Q5ZBZ3_ORYSJ/1-682..........LVLL.......ILIHYRKCITMSESFPSSNVYTSDLNTNVKDAPAFHD......................
D0NH97_PHYIT/1-769..........LLLL.......ILLQS...................CRDSDSPVAS.........................
T1FYR2_HELRO/1-642..........LLLL.......VLCNQFCSNGSFI..............................................
Q4DJF1_TRYCC/1-725..........RFLSALICYPGALLDGSTQTRHTKSPEESDKNEPKENVEAKDRE..........................
I3KNU8_ORENI/1-782..........QILI.......VTLEHEAGSAASAALQALDPSTSPSAEEEQE............................
I3JCX3_ORENI/1-776..........QILI.......VTLEHDGGIPHPP........ASPSSIEEQ.............................
Q01H67_OSTTA/38-724..........NLFL.......ALCAQGAFDPNVK..............................................
Q38FE7_TRYB2/1-706..........QLLS.......VLVSYGKGYRP................................................
Q8RWV1_ARATH/1-679..........HVLL.......ILINYHKSIMSDESMTDKSDDSATSESVSKVHVFSSD......................
I1MHZ5_SOYBN/1-671..........QVLL.......VIIHYEKCLVSEGYSVLKNQVSTSLDSLPKENTYFSE......................
B0WBZ3_CULQU/1-681..........LLIL.......ILTNHYTTKD.................................................
F0Y4A0_AURAN/723-1436..........QVLI.......ALLDYGESPKVGPHPEGRR........................................
D7T740_VITVI/12-678..........QVLL.......ILIHYRKCILVDESIADRKSGGATSDSLSKENTYFSE......................
E1ZEP5_CHLVA/1-748..........LLLL.......VLLFHAPPQDAPFG.............................................
M4BPB3_HYAAE/1-729..........QVLL.......VLLDFGQTLETTTGAMSLKPQLGSLTPVIKRRSSSVTLRPSNPLFDGVP..........
Q5CRW2_CRYPI/1-755..........ILLS.......TILFNPPELKF................................................
C5K8E7_PERM5/1-844SNPGAGTCTVQVLC.......ALLDFNPSPDNTGSEMVKTHRTGTGSEDGSNNSISESSNQEESAA......ARRRFSSC
U6HDN4_ECHMU/1-876..........QMLC.......VILEADTSNLDGGKTLSDSTT......................................
DYM_DROME/1-676..........LLIL.......ILTNHCTAQD.................................................
H0VNU2_CAVPO/1-646..........LLLL.......VLTNLTDAPDAP...............................................
E9ICM4_SOLIN/1-654..........LLLL.......VLTNHCTATQ.................................................
L9KZV5_TUPCH/1-826..........QVLI.......VTLDHDCASSASP...TVDGTTTGTAMDDA.............................
E9G1Z8_DAPPU/1-633..........LLLL.......VLTNHCSTEKNWS..............................................
D7FT96_ECTSI/1-808..........QLLI.......VLLDHGKPPLPVVTSSAGPDGESPDQQTAVREDPPTPGDVGY.................
H2MFX7_ORYLA/1-772..........QVLV.......VALEHEAGSAASSALQALDASASPTADEEEK............................
B7S488_PHATC/1-694..........QVLC.......VLLDCGIPGSPEPVMDQNGNPCVEFEVASRGGF..........................
W1NV48_AMBTC/1-680..........LVLL.......VLVHYQKRIIVDDNFMDKSEDGVEMNGFLKESSYFQD......................
B6A9V3_CRYMR/1-794..........CILS.......MLIFHSPFFKE................................................
H2KSV6_CLOSI/110-1035..........QVLC.......IVLETELTASYPTHSSQGYRNLVGRMSSEAE....................E......A
M4AQZ4_XIPMA/1-781..........QVLI.......VTLEHETGSAVSAALQALDSSSSNPPEELE.............................
E0VG76_PEDHC/1-766..........QILI.......VTLDHDTSLGD................................................
B4MQL1_DROWI/1-832..........QLLI.......VTLDHDMVMHQQQQQQLLLNQSQSGLASYE.............................
HID1_DICDI/1-880..........QILN.......VLLTYDPIENNDQQPQQQHHHHQQQHHQQQQQQQQ........................
W4XTN1_STRPU/1-721..........QILV.......VTLDHANPHNVASSVDGAEEVH.....................................
T1K251_TETUR/1-842..........QILI.......VTLDHDFITESLPGGNSAERTPI....................................
T1I7V2_RHOPR/1-802..........QILI.......VTLDHDTSSSQTY..............................................
Q7QGJ8_ANOGA/1-825..........QILI.......VTLDHDITSNGPAQSSAYIHD......................................
U6I4G6_ECHMU/1-732..........HLLL.......VLTTQ...................STGFISAASAAPITDGKDGATSPPNSASASAVA..
J9KB63_ACYPI/1-736..........QIII.......VALDSDVQQN.................................................
Q17L03_AEDAE/1-819..........QILI.......VTLDHDITSNSPTQSASYSHD......................................
W4Z6Q3_STRPU/1-667..........LLLQ.......VLTNHYTHEKGIH..............................................
W5JW75_ANODA/1-876..........QLLI.......VTLDHDITGNAAGSGTPGSQQAGQSPVGYVHD...........................
DYM_XENTR/1-646..........LLLL.......VLSNLTDAPDCP...............................................
A8WTE9_CAEBR/1-690..........LLLL.......NLSCHQPVNAS................................................
M4C137_HYAAE/1-768..........LLLL.......VLLQS...................CRDTDSLVTS.........................
B9HUR0_POPTR/1-672..........HVLL.......ILNYYHKCVVGDESLTDRSDDSATSDSLSKGKTYFSD......................
F6TGV4_CIOIN/1-683..........LLIL.......ALINHQSYVDPTGQPFV..........................................
H3AL71_LATCH/1-849..........QVLI.......VNLDHDSSNSASP...SVDGTYTPPALYLHR....................NRIMTRHK
C3Z701_BRAFL/1-763..........QLLI.......VVLDHDNGQSAISVDGTTTGTAMDQG.................................

PF12722

Q2GWB4_CHAGB/1-825.....PTPK------------------------------------------------------------NYYRHF-LGRL
B9W786_CANDC/1-930.....SKPY------------------------------------------------------------NMARVY-VGKI
B6JW01_SCHJY/1-778.....IALN------------------------------------------------------------NFFSKS-ISQL
C3Z701_BRAFL/1-784.....GEPQ------------------------------------------------------------NLFVNY-LSRI
A7TNQ6_VANPO/1-1209.....HHGK------------------------------------------------------------TIALSY-VSTL
B6HUK2_PENCW/1-841.....SPPK------------------------------------------------------------NYYRHY-FGRL
Q3UU20_MOUSE/1-784.....PGPE------------------------------------------------------------NLFVNY-LSRI
Q5ASC1_EMENI/1-732.........------------------------------------------------------------......-....
C4XYD9_CLAL4/17-927.....HKPY------------------------------------------------------------NMVRFY-LGS.
C5K8E7_PERM5/1-865PDDDASKPR------------------------------------------------------------NVYRIM-ARGV
B8M9N3_TALSN/1-838.....APPK------------------------------------------------------------NYYRHY-FGRL
C5FVH3_ARTOC/1-827.....ALPK------------------------------------------------------------NYYRHF-LGRL
A3LX71_PICST/1-905.....SKPG------------------------------------------------------------NLARLY-MGKL
A8WRZ4_CAEBR/1-727.......QD------------------------------------------------------------NYFINY-LSRI
Q0E9B5_DROME/1-834.....NCGD------------------------------------------------------------NLFINY-LSRV
C0NTS7_AJECG/1-843.....TPPK------------------------------------------------------------NYYRHF-YGRL
YIOC_SCHPO/1-796.....TLPK------------------------------------------------------------NYFSIL-LSKL
A8NNK7_BRUMA/1-721.......AD------------------------------------------------------------NFFINY-LSRI
C5DS55_ZYGRC/1-1145.....VVNS------------------------------------------------------------NIALSY-LATL
Q0UAJ2_PHANO/1-733.....PAPK------------------------------------------------------------NFFRHF-LGRL
B0WUT2_CULQU/1-851.....TIAD------------------------------------------------------------NLFINY-LSRI
A7A1V5_YEAS7/1-1223.....KAQD------------------------------------------------------------NVITIF-LTQL
A7RKV1_NEMVE/1-693.....PPMD------------------------------------------------------------NLFCNY-LSRI
C5DFL0_LACTC/1-1131.....YEIK------------------------------------------------------------NLVSSY-LGTL
Q6FK58_CANGA/1-1248.....KRMV------------------------------------------------------------NTAVSY-LATL
Q6DGD7_DANRE/1-801.....SRGE------------------------------------------------------------NLFVNY-LSRI
Q6BSE0_DEBHA/1-924.....AKPF------------------------------------------------------------NMARVY-IGKL

PF09742

F4WRP0_ACREC/1-730.........EGAVGD......................................................NLFINY.LSRI
E9H938_DAPPU/1-832.........SGMIHE......................................................NLFINY.LSRI
T1JUN4_TETUR/1-644.....................................................................NPYREA.LFNC
J9F5Y0_WUCBA/1-661.....................................................................NPYKES.LSKF
B4JW54_DROGR/1-859.........EVGCGD......................................................NLFINY.LSRV
I1EYR3_AMPQE/506-1206.....................................................................NPYREA.LSLI
E0VAE1_PEDHC/1-723.....................................................................NPYRDF.LFTF
C1FEV8_MICSR/1-964KWGGGLGEVETVMRRASMDVDDDPGSPVGSSRSPFAPPGFDSGADRSGLVFSKNYPPETPPATGSSIAANPFRDA.LFRL
G1MRD7_MELGA/1-648.....................................................................NPNANI.LMLK
D6WWB7_TRICA/1-769.........DSTVPD......................................................NLFINY.LSRI
H3BX91_TETNG/1-768..........AAEPE......................................................NLFVNY.LSRI
F7D5K7_XENTR/1-770.........ESPPPD......................................................NLFVNY.LSRI
H2SJN1_TAKRU/1-774.........EPAEAE......................................................NLFVNY.LSRI
B3RQA8_TRIAD/1-734.........TVRIND......................................................NLFCNY.LSRI
I3JLL2_ORENI/1-646.....................................................................NPYRQA.ITCF
G7DXH4_MIXOS/12-858.........SPATSS......................................................NTFLHY.LSKV
U1M0X7_ASCSU/1-660.....................................................................NVYKET.LSAF
H2XV68_CIOIN/1-762.........TSGSSS......................................................NLFINY.LSRI
Q5ZBZ3_ORYSJ/1-682.....................................................................NPYYKA.LSNA
D0NH97_PHYIT/1-769.....................................................................NPFRGA.LCGI
T1FYR2_HELRO/1-642.....................................................................NPYQTA.FLSL
Q4DJF1_TRYCC/1-725.........DGTTTE......................................................QLNSPP.LRIV
I3KNU8_ORENI/1-782.......VHTAGGPD......................................................NLFVNY.LSRI
I3JCX3_ORENI/1-776.........ESTGPE......................................................NLFVNY.LSRI
Q01H67_OSTTA/38-724.....................................................................NPFREA.VKGM
Q38FE7_TRYB2/1-706.....................................................................NEALHY.IASL
Q8RWV1_ARATH/1-679.....................................................................NTFSKA.LANA
I1MHZ5_SOYBN/1-671.....................................................................NPYCRV.LVRA
B0WBZ3_CULQU/1-681.....................................................................NPYRVS.LFGC
F0Y4A0_AURAN/723-1436.....................................................................NVFREL.LGEI
D7T740_VITVI/12-678.....................................................................NPYCKA.LENA
E1ZEP5_CHLVA/1-748.....................................................................NPYRSS.LQRL
M4BPB3_HYAAE/1-729.....................................................................NAYRAL.LSSL
Q5CRW2_CRYPI/1-755.....................................................................NIYSEW.INHF
C5K8E7_PERM5/1-844AFPLAGPDDDASKPR......................................................NVYRIM.ARGV
U6HDN4_ECHMU/1-876.........SDGKGS......................................................NLFLNY.MSRI
DYM_DROME/1-676.....................................................................NAYRTS.LFSC
H0VNU2_CAVPO/1-646.....................................................................NPYRQA.IMSF
E9ICM4_SOLIN/1-654.....................................................................NPYRNA.LFSF
L9KZV5_TUPCH/1-826.........DPPGPE......................................................NLFVNY.LSRI
E9G1Z8_DAPPU/1-633.....................................................................NPYRQA.LLSF
D7FT96_ECTSI/1-808.....................................................................NVFRNLVLHGL
H2MFX7_ORYLA/1-772.........GPAGPD......................................................NLFVNY.LSRI
B7S488_PHATC/1-694.....................................................................NILRTL.LARI
W1NV48_AMBTC/1-680.....................................................................NPYCSA.LENA
B6A9V3_CRYMR/1-794.....................................................................NVYSDF.MRNI
H2KSV6_CLOSI/110-1035SSTTATSAGDGTIEM......................................................NLFANY.MSRI
M4AQZ4_XIPMA/1-781..........PAGPD......................................................NLFVNY.LSRI
E0VG76_PEDHC/1-766.........ENVSSD......................................................NLFINY.LSRI
B4MQL1_DROWI/1-832.........EANCGD......................................................NLFINY.LSRV
HID1_DICDI/1-880.........STIECR......................................................NKFIQY.IKTL
W4XTN1_STRPU/1-721.........EGVLPE......................................................NLFVNY.LSRI
T1K251_TETUR/1-842.........DPTIHE......................................................NLFINY.LSRI
T1I7V2_RHOPR/1-802.........DSNSPD......................................................NLFINY.LSRI
Q7QGJ8_ANOGA/1-825.........DSTIAD......................................................NLFINY.LSRI
U6I4G6_ECHMU/1-732...................................................AAVAAATASRSIFRNIGSNPYREA.LFAL
J9KB63_ACYPI/1-736.........DEAAID......................................................NLFINY.LSRV
Q17L03_AEDAE/1-819.........DTTIAD......................................................NLFINY.LSRI
W4Z6Q3_STRPU/1-667.....................................................................NPYRKA.LCNF
W5JW75_ANODA/1-876.........ESTIAD......................................................NLFINY.LSRI
DYM_XENTR/1-646.....................................................................NPFRQS.VTFF
A8WTE9_CAEBR/1-690.....................................................................NPFKET.LALF
M4C137_HYAAE/1-768.....................................................................NPFRET.LCEM
B9HUR0_POPTR/1-672.....................................................................NPYCKA.LENA
F6TGV4_CIOIN/1-683.....................................................................NPYKAA.LCCF
H3AL71_LATCH/1-849PNLIVTCYLLPPGPD......................................................NLFVNY.LSRI
C3Z701_BRAFL/1-763.........AEGEPQ......................................................NLFVNY.LSRI

PF12722

Q2GWB4_CHAGB/1-825H--------RPQ-----------------------DF---------QFAVDGMTRILNQPLQ..................
B9W786_CANDC/1-930H--------KEN-----------------------EL---------LFIASSLIEFLKVPLINAKDQETDTF........
B6JW01_SCHJY/1-778H--------RKS-----------------------DF---------QFILDGFSRLLYSPIH..................
C3Z701_BRAFL/1-784H--------REE-----------------------DF---------HFILKGITNLLNNPLI..................
A7TNQ6_VANPO/1-1209N--------REL-----------------------DL---------KLMLTSFAKIFKHPVEVAIEQETSPFGSFPSMKQ
B6HUK2_PENCW/1-841H--------RPQ-----------------------DF---------QFLVDGMTRILNQPMQ..................
Q3UU20_MOUSE/1-784H--------REE-----------------------DF---------QFILKGIARLLSNPLL..................
Q5ASC1_EMENI/1-732.--------...-----------------------..---------..............MQ..................
C4XYD9_CLAL4/17-927Q--------KNN-----------------------DL---------VFLVSHLLSILKHPFSVNRLENRGKF........
C5K8E7_PERM5/1-865Q--------KTG-----------------------EL---------DFMADGLVRIVTTVDD..................
B8M9N3_TALSN/1-838H--------RPQ-----------------------DF---------QFLVEGMTRILNQPMQ..................
C5FVH3_ARTOC/1-827H--------QPQ-----------------------DF---------QFLVEGMTRILNQPMQ..................
A3LX71_PICST/1-905H--------KDQ-----------------------EL---------VFLSTYLIAILKLPVVTSKDVESSKF........
A8WRZ4_CAEBR/1-727H--------REE-----------------------DF---------DFMLKGITRLLSNPIH..................
Q0E9B5_DROME/1-834H--------RDE-----------------------DF---------HFVLKGITRLLNNPLV..................
C0NTS7_AJECG/1-843H--------RPQ-----------------------DF---------QFIVEGMTRILNQPMQ..................
YIOC_SCHPO/1-796Q--------PYS-----------------------DF---------QIILDGMSRLLYPPMQ..................
A8NNK7_BRUMA/1-721H--------REE-----------------------DF---------EFMLKGMTRLLTNPLV..................
C5DS55_ZYGRC/1-1145N--------REF-----------------------DL---------RLLLTSFAKIFKLPINLAIDQESNLLSL..PRKQ
Q0UAJ2_PHANO/1-733H--------RPQ-----------------------DF---------QFLVDGMTRILNQPVW..................
B0WUT2_CULQU/1-851H--------RDD-----------------------DF---------QFILRGITRLLNNPLV..................
A7A1V5_YEAS7/1-1223Q--------REY-----------------------DL---------KLILSSFIKIFKYPIDLAIEQESNIFNFTNNKHI
A7RKV1_NEMVE/1-693H--------REE-----------------------DF---------HFILHGLANLLNNPLI..................
C5DFL0_LACTC/1-1131N--------REF-----------------------DL---------KFILISLVTLLKRPIDRAIENESNPFSLLNGSSN
Q6FK58_CANGA/1-1248Q--------REF-----------------------DL---------KLILTSVIRIFKLPIDAAIDEDSNLF.TFPTASS
Q6DGD7_DANRE/1-801H--------REE-----------------------DF---------NFILRGISRLLNNPLM..................
Q6BSE0_DEBHA/1-924R--------KEN-----------------------EL---------LFLASYLINVLRAPMQSSKESENLKF........

PF09742

F4WRP0_ACREC/1-730H........RDE.......................DF.........QFVLKGITRLLNN..P------------------
E9H938_DAPPU/1-832H........REE.......................DF.........AFMLHGFTRLLKN..P------------------
T1JUN4_TETUR/1-644C........DLQ............VDSIGVAGLVSGF.........KMNFNQLFSTLCATQN------------------
J9F5Y0_WUCBA/1-661Q........NSQ............EVSSLNNSETDTF.........KLDYSLLYERLCATVN------------------
B4JW54_DROGR/1-859H........RDE.......................DF.........HFVLRGITRLLNN..P------------------
I1EYR3_AMPQE/506-1206C........DEN.................ESKDKASF.........QLNFNQLHEAICKQLN------------------
E0VAE1_PEDHC/1-723I........HNS....PGHLSLGSNPEEIPVSSVSAL.........QINFDHLYVALCNTAA------------------
C1FEV8_MICSR/1-964V........RLE......RSNKDDDSGESDALRVRVL.........RACVLAMHSADTAGAA------------------
G1MRD7_MELGA/1-648F........SVS............DSSAFSSSHPHVF.........QINFNSLYLKSCQKSV------------------
D6WWB7_TRICA/1-769H........RDE.......................DF.........EFILTGVTRLLNN..P------------------
H3BX91_TETNG/1-768H........RDE.......................DL.........SFMLKGMTQLLNN..P------------------
F7D5K7_XENTR/1-770H........REE.......................DF.........QFILKGLARLLLN..P------------------
H2SJN1_TAKRU/1-774H........RDE.......................DL.........SFMLKGLTQLLNN..P------------------
B3RQA8_TRIAD/1-734H........REE.......................DF.........TFILRGIILLLNN..P------------------
I3JLL2_ORENI/1-646R........NTQ............DTSSLPVEQPHTF.........QINFNSLYTALCEQQR------------------
G7DXH4_MIXOS/12-858H........RQP.......................DI.........RYLFSNIIASLNR...------------------
U1M0X7_ASCSU/1-660Q........NAR............EVSSVNSSTTRIF.........RLDYSALYDRLCATVD------------------
H2XV68_CIOIN/1-762H........RDE.......................DF.........AFILSGICRLLNN..P------------------
Q5ZBZ3_ORYSJ/1-682K........DSQYDRADVEGNAQ.N..GLVV...............RLSFASLFDALGTCLK------------------
D0NH97_PHYIT/1-769TDGADTDTHDVS.EIEDPRAHLVQQSEATSSSSAEKL.........ELLYSDLFKVIGRHAP------------------
T1FYR2_HELRO/1-642H........DDI............PNAIETPATRDHI.........SVKFLDLYTTICSTIK------------------
Q4DJF1_TRYCC/1-725H........SAR.......................DLISAITPEEAKYVIERLKNTIGLKVY------------------
I3KNU8_ORENI/1-782H........REE.......................DL.........SFVLKGLARLLNN..P------------------
I3JCX3_ORENI/1-776H........REE.......................DF.........DFVLKGLARLLTN..P------------------
Q01H67_OSTTA/38-724R........DVS............ARSSVSSGKRDAT.........LVNFEKTCEALSESSS------------------
Q38FE7_TRYB2/1-706G........DSS..................................QIQVKALLVTFNRHVL------------------
Q8RWV1_ARATH/1-679R........DVEFDRSDVEGNAHPA..GPHV...............RIPFASLFDTLGMFLA------------------
I1MHZ5_SOYBN/1-671T........DCELDRVDKEGNAH.SDQDQHV...............KLPFAPLFDTLGMCLA------------------
B0WBZ3_CULQU/1-681A........DSQ.......GAADSSGSSKEPEQAVTF.........KIDFSSLYNTLCRIVT------------------
F0Y4A0_AURAN/723-1436D........DPD.......................YL.........EFLFEGLCRLLNNVHE------------------
D7T740_VITVI/12-678R........DIEFDRVDIEGNAH.S..GPLV...............RLPFASLFDTLGMFLA------------------
E1ZEP5_CHLVA/1-748Q........DTD..................................DL...ALFDALGAALT------------------
M4BPB3_HYAAE/1-729Q........RPE.......................DF.........KLIFSGISRLLNNYHQ------------------
Q5CRW2_CRYPI/1-755S........DPRFIPDNLILSDSNTDSDVDANKT............DFVDFPYFEQAYRSVT------------------
C5K8E7_PERM5/1-844Q........KTG.......................EL.........DFMADGLVRIVTTVDD------------------
U6HDN4_ECHMU/1-876H........RDE.......................DF.........SFVLDGITRLLNN..P------------------
DYM_DROME/1-676A........DSK...............DSPKQGAVSF.........QIDFSAVYETLCTIVT------------------
H0VNU2_CAVPO/1-646K........NTQ............DSSSFPSSIPHAF.........QINFNSLYTALCEQQT------------------
E9ICM4_SOLIN/1-654I........DMQ...........EDHTISQGTAAETF.........KFNLNKLYTTICKIPN------------------
L9KZV5_TUPCH/1-826H........REE.......................DF.........QFILKGIARLLSN..P------------------
E9G1Z8_DAPPU/1-633T........DSQ...............VSPVHPSACF.........RLDYSVLYSTLCDRLG------------------
D7FT96_ECTSI/1-808K........DEE.......................DF.........ELVYTGLSRLLNTLHR------------------
H2MFX7_ORYLA/1-772H........REE.......................DL.........SFILRGLTQLLNN..P------------------
B7S488_PHATC/1-694D........TGK.......................EL.........SMIFDGFARLLRNVYE------------------
W1NV48_AMBTC/1-680R........DIEFDRVDVEGNAH.S..GPLV...............RLPFASLFDTLGACLF------------------
B6A9V3_CRYMR/1-794L........DPRFLPETSSLLIKDIQSEVDSDEDTS..........GITKFTYFDQICSTIS------------------
H2KSV6_CLOSI/110-1035H........RDE.......................DF.........AFILNGLTRLLNN..P------------------
M4AQZ4_XIPMA/1-781H........REE.......................DL.........SFVLRGFAQLLNN..P------------------
E0VG76_PEDHC/1-766H........RDE.......................DF.........QFVLGGFTRLLNN..P------------------
B4MQL1_DROWI/1-832H........RDE.......................DF.........HFVLKGITRLLNN..P------------------
HID1_DICDI/1-880K........RVR.......................DF.........KFFFNAFERIMNVPLI------------------
W4XTN1_STRPU/1-721H........REE.......................DF.........HFILKGITRLLNN..P------------------
T1K251_TETUR/1-842H........REE.......................DF.........AFILKGFTRLLNN..P------------------
T1I7V2_RHOPR/1-802H........RDE.......................DF.........GFVLRGFTRLLNN..P------------------
Q7QGJ8_ANOGA/1-825H........RDD.......................DF.........QFILKGVTRLLNN..P------------------
U6I4G6_ECHMU/1-732TPLGEVNAEAKQ....SGGQGKDLEKGGGNERGIIPP.........RIPFGRLCETLASTVN------------------
J9KB63_ACYPI/1-736H........RDE.......................DF.........SFILSGFTRLLMN..P------------------
Q17L03_AEDAE/1-819H........RDD.......................DF.........QFILKGVTRLLNN..P------------------
W4Z6Q3_STRPU/1-667A........NSQ..........DGGMPIGPSGSLPPF.........KLNSANLYEAFCNHLK------------------
W5JW75_ANODA/1-876H........RDD.......................DF.........QFILKGVTRLLNN..P------------------
DYM_XENTR/1-646R........NTQ............DSSVSPTPNPHSF.........QINFNSLYTALCEQQK------------------
A8WTE9_CAEBR/1-690Q........NAQ.............EVSTLPTQVISF.........KIDYNGLYERLCATAG------------------
M4C137_HYAAE/1-768MKGADIHSSSVEMKDRDPRALSMEHDGMSTDSSTENM.........TISISDLFDIFGSRAS------------------
B9HUR0_POPTR/1-672R........DIEY....IEGNAH.S..GSHV...............RLPFASLFDTLGMCLA------------------
F6TGV4_CIOIN/1-683R........HVQ.......GQLQGPSNGKQKGSLPSF.........HINLSRLYGTACSVQV------------------
H3AL71_LATCH/1-849H........REE.......................DF.........HFILKGIARLLSN..P------------------
C3Z701_BRAFL/1-763H........REE.......................DF.........HFILKGITNLLNN..P------------------

PF12722

Q2GWB4_CHAGB/1-825.......................................................................SNSSYIPGT
B9W786_CANDC/1-930.......................................................................SLLRSGSNY
B6JW01_SCHJY/1-778..........................................................................FEKPNV
C3Z701_BRAFL/1-784.........................................................................QTYLPNS
A7TNQ6_VANPO/1-1209NQNYSHNRVNSNSSNNYEND.........SQQPNTPNQNLSNLKNKPYNNIGNNTKTDNTKKTNTNDTNENNSTGSSLSL
B6HUK2_PENCW/1-841.......................................................................ATASYLPGS
Q3UU20_MOUSE/1-784.........................................................................QTYLPNS
Q5ASC1_EMENI/1-732.......................................................................ATTAYLPGS
C4XYD9_CLAL4/17-927..............................................................................TK
C5K8E7_PERM5/1-865.......................................................................AKRTYLPSS
B8M9N3_TALSN/1-838.......................................................................VTSSYLPGS
C5FVH3_ARTOC/1-827.......................................................................ATSSYLPGS
A3LX71_PICST/1-905..........................................................................NIIKSG
A8WRZ4_CAEBR/1-727.......................................................................SSSSYLPNS
Q0E9B5_DROME/1-834.........................................................................QNYLPNS
C0NTS7_AJECG/1-843.......................................................................ATTSYLPGS
YIOC_SCHPO/1-796..........................................................................STIPKR
A8NNK7_BRUMA/1-721.........................................................................ATYLPSS
C5DS55_ZYGRC/1-1145SSSSIGSVDGSNRSNNAANSIPYANAAVTGTAATSTNSAASPTAGSTSRRSRDNERIGNTNGTTNFNSTSHGNSSSSPSL
Q0UAJ2_PHANO/1-733...............................................................................S
B0WUT2_CULQU/1-851.........................................................................QSYLPNS
A7A1V5_YEAS7/1-1223DASRRRAVSTSSHDNSSSSHASLPSSSSAAYH.......................................TKPQTKPQL
A7RKV1_NEMVE/1-693.........................................................................QTYLPNS
C5DFL0_LACTC/1-1131ASTKQGKGPTKKNGHSRSNSA..................................................KGASSKSNL
Q6FK58_CANGA/1-1248RKKHQNLSNHSRTSSSSNIKRSTSNSSATSRYDSNPNTVTGSPKLANMRE.....................NNTSSYSSL
Q6DGD7_DANRE/1-801.........................................................................QTYLPHS
Q6BSE0_DEBHA/1-924.........................................................................NLNTGRQ

PF09742

F4WRP0_ACREC/1-730-----------------------------------------------------------------------LMQTYLPNS
E9H938_DAPPU/1-832-----------------------------------------------------------------------LIQTYLPNS
T1JUN4_TETUR/1-644-----------------------------------------------------------------------EDQS.....
J9F5Y0_WUCBA/1-661-----------------------------------------------------------------------QQSP.....
B4JW54_DROGR/1-859-----------------------------------------------------------------------LVQNYLPNS
I1EYR3_AMPQE/506-1206-----------------------------------------------------------------------TEQT.....
E0VAE1_PEDHC/1-723-----------------------------------------------------------------------NECS.....
C1FEV8_MICSR/1-964-----------------------------------------------------------------------SGASGDKSH
G1MRD7_MELGA/1-648-----------------------------------------------------------------------SSNS.....
D6WWB7_TRICA/1-769-----------------------------------------------------------------------LVQTYLPNS
H3BX91_TETNG/1-768-----------------------------------------------------------------------LVQTYLPHS
F7D5K7_XENTR/1-770-----------------------------------------------------------------------LSQTYLPNS
H2SJN1_TAKRU/1-774-----------------------------------------------------------------------LVQTYLPHS
B3RQA8_TRIAD/1-734-----------------------------------------------------------------------LLQTYLPNS
I3JLL2_ORENI/1-646-----------------------------------------------------------------------SDQA.....
G7DXH4_MIXOS/12-858-----------------------------------------------------------------------ELSSRLPTR
U1M0X7_ASCSU/1-660-----------------------------------------------------------------------QQPP.....
H2XV68_CIOIN/1-762-----------------------------------------------------------------------LQQTYLPGS
Q5ZBZ3_ORYSJ/1-682-----------------------------------------------------------------------DESS.....
D0NH97_PHYIT/1-769-----------------------------------------------------------------------YEAS.....
T1FYR2_HELRO/1-642-----------------------------------------------------------------------TDTC.....
Q4DJF1_TRYCC/1-725-----------------------------------------------------------------------SNRTVLPDS
I3KNU8_ORENI/1-782-----------------------------------------------------------------------LIQTYLPRS
I3JCX3_ORENI/1-776-----------------------------------------------------------------------LTQTYLPNS
Q01H67_OSTTA/38-724-----------------------------------------------------------------------TDSG.....
Q38FE7_TRYB2/1-706-----------------------------------------------------------------------RCPA.....
Q8RWV1_ARATH/1-679-----------------------------------------------------------------------DEGA.....
I1MHZ5_SOYBN/1-671-----------------------------------------------------------------------DETA.....
B0WBZ3_CULQU/1-681-----------------------------------------------------------------------IDQT.....
F0Y4A0_AURAN/723-1436-----------------------------------------------------------------------ALNTTLPGS
D7T740_VITVI/12-678-----------------------------------------------------------------------DETA.....
E1ZEP5_CHLVA/1-748-----------------------------------------------------------------------SERA.....
M4BPB3_HYAAE/1-729-----------------------------------------------------------------------SMSTLLPNS
Q5CRW2_CRYPI/1-755-----------------------------------------------------------------------FNGV.....
C5K8E7_PERM5/1-844-----------------------------------------------------------------------AKRTYLPSS
U6HDN4_ECHMU/1-876-----------------------------------------------------------------------LTQTYLPGS
DYM_DROME/1-676-----------------------------------------------------------------------IDQA.....
H0VNU2_CAVPO/1-646-----------------------------------------------------------------------SDQA.....
E9ICM4_SOLIN/1-654-----------------------------------------------------------------------TDEV.....
L9KZV5_TUPCH/1-826-----------------------------------------------------------------------LLQTYLPHS
E9G1Z8_DAPPU/1-633-----------------------------------------------------------------------DERT.....
D7FT96_ECTSI/1-808-----------------------------------------------------------------------SRNTYMPGA
H2MFX7_ORYLA/1-772-----------------------------------------------------------------------LIQTYLPRS
B7S488_PHATC/1-694-----------------------------------------------------------------------AESNYIAGV
W1NV48_AMBTC/1-680-----------------------------------------------------------------------DETS.....
B6A9V3_CRYMR/1-794-----------------------------------------------------------------------SEYG.....
H2KSV6_CLOSI/110-1035-----------------------------------------------------------------------LQQTYLPGS
M4AQZ4_XIPMA/1-781-----------------------------------------------------------------------LIQTYLPRS
E0VG76_PEDHC/1-766-----------------------------------------------------------------------LVQTYLPNS
B4MQL1_DROWI/1-832-----------------------------------------------------------------------LVQNYLPNS
HID1_DICDI/1-880-----------------------------------------------------------------------ASHTKLPNS
W4XTN1_STRPU/1-721-----------------------------------------------------------------------LIQTYLPGS
T1K251_TETUR/1-842-----------------------------------------------------------------------LQQTYIPNS
T1I7V2_RHOPR/1-802-----------------------------------------------------------------------LVQTYLPNS
Q7QGJ8_ANOGA/1-825-----------------------------------------------------------------------LVQSYLPNS
U6I4G6_ECHMU/1-732-----------------------------------------------------------------------TDSS.....
J9KB63_ACYPI/1-736-----------------------------------------------------------------------LRQTYLPHS
Q17L03_AEDAE/1-819-----------------------------------------------------------------------LVQSYLPNS
W4Z6Q3_STRPU/1-667-----------------------------------------------------------------------DDQS.....
W5JW75_ANODA/1-876-----------------------------------------------------------------------LVQSYLPNS
DYM_XENTR/1-646-----------------------------------------------------------------------SDQA.....
A8WTE9_CAEBR/1-690-----------------------------------------------------------------------QEPP.....
M4C137_HYAAE/1-768-----------------------------------------------------------------------YETS.....
B9HUR0_POPTR/1-672-----------------------------------------------------------------------DETA.....
F6TGV4_CIOIN/1-683-----------------------------------------------------------------------YESS.....
H3AL71_LATCH/1-849-----------------------------------------------------------------------LVQTYLPNS
C3Z701_BRAFL/1-763-----------------------------------------------------------------------LIQTYLPNS

PF12722

Q2GWB4_CHAGB/1-825QSSVRF..APETIMLFWEITQCNKRFR-SFIID-TERAHDF-IILILFYALEYK-------GDA-SK-------------
B9W786_CANDC/1-930KRPSLW..SLEAVMLIWELLQSNRNFV-SIVGE-.KYISEL-MIILLYYVFAYH-------SQK-SS-------------
B6JW01_SCHJY/1-778VGVVMYDYYPLTLNLCKQMLHYNTRFF-HYLVD-TGRALDL-FVFILYLSFEYL-------SEA-ST-------------
C3Z701_BRAFL/1-784CKKINF..HQEILVLFWKLCEFNKKFL-FYVLK-SSDVLDV-IAPILYHLNDSR-------QDQ-SR-------------
A7TNQ6_VANPO/1-1209PVPPTI..LPQVLILFTTIITENKSFE-NYVAD-.KFANKF-IIFSIYYMHYYN-------HIP-EL-------------
B6HUK2_PENCW/1-841QRSVKW..APEMLVLFWETLQCNKRFR-SFIID-SNRSHDF-LVLCIFYAMEYR-------MDA-SK-------------
Q3UU20_MOUSE/1-784TKKIQF..HQELLVLFWKLCDFNKKFL-FFVLK-SSDVLDI-LVPILYFLNDAR-------ADQ-SR-------------
Q5ASC1_EMENI/1-732QKSVKW..APEMLVLFWEALQCNKRFR-SFIID-SNRSHDF-IILCIFYSITYK-------SDP-AK-------------
C4XYD9_CLAL4/17-927PHPSPW..AIEAIMILWELLQCNQYLR-SFVAE-.RLVVKL-VPYIAYHIFAFC-------DVP-HY-------------
C5K8E7_PERM5/1-865RKVVPF..YQEALILLWHLITINSTYR-KRLCI-.RHTEDI-LHPLLDLLVSSR-------NSQ-AK-------------
B8M9N3_TALSN/1-838QKSVKW..APEMLMLFWEALQCNKRFR-AFIIE-SNRSHDF-VILCIFYATEYR-------NDP-SK-------------
C5FVH3_ARTOC/1-827QKSIKW..APEMLMLFWEMVQCNKRFR-SFIVD-SNRAHDF-IVICTFYAIEYK-------TDP-SK-------------
A3LX71_PICST/1-905NQPSLW..ATEATMLIWELIQCNKKFK-TLIYE-.QSLPEL-LVVLFYYIFAFH-------SNV-QH-------------
A8WRZ4_CAEBR/1-727TKKVNF..HQELLVLLWKCCEFNQKFM-FYVLK-TSDVLDI-LVPILYHISDAR-------NDS-AR-------------
Q0E9B5_DROME/1-834TKRLHC..HQELLILFWKICDYNKKFL-YFVLK-SSDVLDI-LIPILYHLNYSR-------ADQ-SR-------------
C0NTS7_AJECG/1-843HKSVKW..APEMIMLFWEALQCNKRFR-SYMID-SSRALDF-VVLCIFYAIEYK-------TDA-SK-------------
YIOC_SCHPO/1-796SSLIMFDYYPLVLIFCKLFIHYNERFF-HYLID-TDRAIDL-FIFLLYLSFEYL-------GDP-ST-------------
A8NNK7_BRUMA/1-721TKKITC..HQELLVLLWKCCEYNQKFM-FYLLK-TSDVLEV-LVPILFHISASR-------NDP-AR-------------
C5DS55_ZYGRC/1-1145PPVSPL..FLQSLIFLTILVQNNKNFQ-NYVAD-.KFGPKL-IIFSIYYLQFYD-------NNV-NQ-------------
Q0UAJ2_PHANO/1-733QKSLTW..APEMIMLFWEALQCNKRFR-SFIID-TDRAHDF-VVLVLYYAIDQR-------NDP-TK-------------
B0WUT2_CULQU/1-851TKRLHC..HQELLVFFWKICDYNK...-.....-SSDVLDI-LVPILYHLNDSR-------ADQ-SR-------------
A7A1V5_YEAS7/1-1223PEIHPL..LIPMTILMTNLIDCNKCFQ-NYFAD-.KFASRF-IIFSIYYLKYYD-------YSS-LS-------------
A7RKV1_NEMVE/1-693CKKISF..HQELLILFWKMCDQNKKFL-FYVLK-SSDVLDI-LVPILYHLNDAR-------SDQ-SR-------------
C5DFL0_LACTC/1-1131SRLPRS..TLQVTTLLWELMKCNKSFE-NYVAD-.KYANKL-LLVCIFHIKYYS-------DSP-DW-------------
Q6FK58_CANGA/1-1248PPLPPI..LCQSLVFLINVIKINKLVK-NQFAD-.KFASKF-VVFAVYYLKYYN-------DNP-EY-------------
Q6DGD7_DANRE/1-801CKKIQF..HQELLVLFWKLCDLNKKFL-FYVLK-SSDVLDI-LVPVLFYLNDAR-------ANQ-SR-------------
Q6BSE0_DEBHA/1-924NQVSIW..ATECIMLLWELFQCNKSFR-TLVGE-.RYLHEL-LVIMLYYVCTYH-------RNV-NH-------------

PF09742

F4WRP0_ACREC/1-730TKKVHF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDVLEV.LVPILYHLNDSR.......ADQ.SR.............
E9H938_DAPPU/1-832NKKVQN--HQELLVFFWKVCDFNKKFL.YYVLK.SSDVLDV.LVPILFHLNDSR.......ADQ.SR.............
T1JUN4_TETUR/1-644......--....TLILYLLLYKNPSFR.AFLISRTSQLDDL.TIPILKILYHSG.......EKT.SH.............
J9F5Y0_WUCBA/1-661......--....MLFLYILLHRNVGFR.NYILS.RINLEKL.VLPVLIVLSDGAQSSSMINSYN.AH.............
B4JW54_DROGR/1-859TKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDVLDI.LIPILYHLNYSR.......ADQ.SR.............
I1EYR3_AMPQE/506-1206......--....TLFFYQLLHNNLNFA.SFVFS.RSDINTL.LLPLLKELSSEG.......KKP.SH.............
E0VAE1_PEDHC/1-723......--....TLMLYLLLHRNENVK.NFILA.RADLEYL.VVPILKTLYNIT.......ESN.SH.............
C1FEV8_MICSR/1-964AASCQQ--AAVGVFLAYSLLYGNEGFY.RAVVADANAVRAL.VSALLRR................AH.............
G1MRD7_MELGA/1-648......--....TVIVNFVLHLNS.LK.SFLLKCRTVTLVLKVLPILEILYHVE.......ERN.SH.............
D6WWB7_TRICA/1-769TKKVHF--HQELLVFFWKMCDYNKKFL.YFVLK.SSDVLEV.LVPILYHLNDSR.......ADQ.SR.............
H3BX91_TETNG/1-768TKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDVLDV.LVPILFYLNDAR.......ADQ.SR.............
F7D5K7_XENTR/1-770IKKINF--HQELLVLFWKLCDYNKKFL.FFVLK.SSDVLDI.LVPILYFLNDAR.......ADQ.SR.............
H2SJN1_TAKRU/1-774AKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDVLDV.LVPILFYLNDAR.......ADQ.SR.............
B3RQA8_TRIAD/1-734CKKIGF--YQELLIFLWKVCDCNKKFL.YYVLK.SSDVLDI.LVPILYYLNDAR.......CDP.AR.............
I3JLL2_ORENI/1-646......--....TLLLYTLLHQNANMR.TYVLS.RTDMDNL.VLPILEILYHVE.......ERN.SH.............
G7DXH4_MIXOS/12-858KMNING--LVTSLIFLWKMFECNPKFR.EYALE.GDKPGSL.VVYLLGLSLECR.......GDP.AK.............
U1M0X7_ASCSU/1-660......--....MLLLYLLLHTNCGFR.NYVLS.RINLENL.VIPVLRVLHDGTPSGSLNLSSN.SH.............
H2XV68_CIOIN/1-762TKKVGF--HQELLVFFWKLCDTNKKFL.FFVLK.SSDVLDI.LVPILYHLNDAR.......ADQ.SR.............
Q5ZBZ3_ORYSJ/1-682......--....VLLLYSLVHGNCDFQ.EYVLV.RTDLDTL.LMPILEMLYNAS.......RKT.SN.............
D0NH97_PHYIT/1-769......--....HLMLYTLLYSNPMIL.DTALS.DVDMERL.LLPLLETLYHAR.......SVE.PS.............
T1FYR2_HELRO/1-642......--....TLLVYMLLHRVEPFK.TYCLS.RTNIEQL.VLPILEMLYNSH.......EGN.SQ.............
Q4DJF1_TRYCC/1-725QRCFIT--QDEFMMLLWRLIELSPECQ.LAFAQ.QPAALNY.IVPFVDYALNAK.......RDP.KY.............
I3KNU8_ORENI/1-782TKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDVLDM.LVPILFYLNDAR.......ADQ.SR.............
I3JCX3_ORENI/1-776TKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDI.LVPILYYLNDAR.......ADQ.SR.............
Q01H67_OSTTA/38-724......--....LLTLYTLLSTNSRFV.AYLGSKGSAAKRL.VENLIRELYEAE.......MDGITH.............
Q38FE7_TRYB2/1-706......--...LCILLYTLLHDNPTFIHTVMTAYPDEFLGV.IQGVLRLSYTAS.......SEAWASGFNSSDDDIDGGQ
Q8RWV1_ARATH/1-679......--....VLLLYSLLQGNSDFK.EYVLV.RTDLDTL.LMPILETLYNAS.......KRTSSN.............
I1MHZ5_SOYBN/1-671......--....VLLLYSLLQGNSTFL.EYVLV.RTDLDTL.LMPILEALYDAR.......RRT.AN.............
B0WBZ3_CULQU/1-681......--....TLLLYLLLHRNQRFY.KYVMA.QQNLQQL.VIPILQTLYNAP.......DST.SH.............
F0Y4A0_AURAN/723-1436LSQIEC--YQEVLVILWKLLEENDHFA.PHALR.ECDVTRA.VVPVAFLMYEAR.......KDA.AR.............
D7T740_VITVI/12-678......--....ILLLYSLVHGNSDFL.EYVLV.RTDLDTL.LMPILETLYNAS.......RRT.SN.............
E1ZEP5_CHLVA/1-748......--....VLLLYVLLHTCPRFH.EYCLV.RSDLDTL.LLPLLELLYSAH.......ERT.AN.............
M4BPB3_HYAAE/1-729IKQIKC--HQELLVLLWKMLDENAEFL.QYALK.KADANQL.VVPLLFLMYEGR.......QEP.AK.............
Q5CRW2_CRYPI/1-755...LVK--HNLFVFFLYSLVHSNSYFI.SYCLS.RADPDAL.ILALLEPVYIIS.......KDIDET.............
C5K8E7_PERM5/1-844RKVVPF--YQEALILLWHLITINSTYRKRLCIR.HTE..DI.LHPLLDLLVSSR.......NSQ.AK.............
U6HDN4_ECHMU/1-876AKKVHM--HQELLILFWRICDINKKFM.YYVLK.SSRVLDV.LVPILYYLNEAR.......KDK.SQ.............
DYM_DROME/1-676......--....TLLLYLLLHRNERFY.RFVMQ.QQDLEQL.VIPILQTLYNAP.......DSN.SH.............
H0VNU2_CAVPO/1-646......--....TLLLYTLLHQNSNVR.TYMLA.RTDMENL.VLPILEILYHVE.......ERN.SH.............
E9ICM4_SOLIN/1-654......--....TLLLYMLLHRNSSVK.HDIMR.RPDIQLL.VTPILQILYHAP.......NNT.SH.............
L9KZV5_TUPCH/1-826TKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDI.LVPILYFLNDAR.......ADQ.SR.............
E9G1Z8_DAPPU/1-633......--....TLLLYMLLHQHQQFR.NYVYT.HADIQRM.VIALLQELFNGD.......DQG.SH.............
D7FT96_ECTSI/1-808ATEVYC--YQEVLVLLWKLLEENPVFM.QYVLK.NCDINEI.LVPVCYLLVENR.......KDV.SK.............
H2MFX7_ORYLA/1-772TKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDVLEM.LVPILFYLNDAR.......ADQ.SR.............
B7S488_PHATC/1-694..KLEC--FQELLVLFWKFLEENPLFM.PHILK.RCNVNEI.IVPICFLMYKSR.......RDP.AQ.............
W1NV48_AMBTC/1-680......--....VLLLYSLVHGNSDFL.EYVLV.RTDLDTL.LMPVLEMLYNAS.......RRT.SN.............
B6A9V3_CRYMR/1-794...LKN--HILESYIFYFLIHSNSNFR.LYCMS.RGDPEYL.IVPILEVLYILP.......IQK.QRN............
H2KSV6_CLOSI/110-1035TKKVQM--HQELLVLFWRMCEINKKFM.YYVLK.SSQVLDL.LVPILYHLNDAR.......SDP.AR.............
M4AQZ4_XIPMA/1-781TKKIHF--HQELLILFWKCCDFNKKFL.FFVLK.SSDVLEM.LVPILFYLNDAR.......ADQ.SR.............
E0VG76_PEDHC/1-766TKKVQF--HQELLVFFWKLCDYNKKFL.YYVLK.SSDVLEI.LVPILYHLNDSR.......ADQ.SR.............
B4MQL1_DROWI/1-832TKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDVLDI.LIPILYHLNYSR.......ADQ.SR.............
HID1_DICDI/1-880TKKIEL--HQDLTYTMWLFLSYNHDFL.RSIVN.YENSPEF.LIPLLQYMDEGR.......KSQ.TT.............
W4XTN1_STRPU/1-721TKKIAF--HQELLVLFWKMCDHNKKFL.FYVLK.SSDVLEV.LVPILYHLNDAR.......ADQ.SR.............
T1K251_TETUR/1-842TKRIQF--HQELLVLFWKICDYNKKFM.FYVLK.SSHVLDI.LVPILYHLNDSR.......SDQ.SR.............
T1I7V2_RHOPR/1-802TKKVQF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDVLEI.LVPILYHLNDSR.......ADQ.SR.............
Q7QGJ8_ANOGA/1-825TKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR.............
U6I4G6_ECHMU/1-732......--....VLLLYLLLHRNDFFR.AFVME.TRAYEKF.TFSICSLLYQSP.......AEN.SH.............
J9KB63_ACYPI/1-736TKKVQF--HQELLIFFWKICEFNKKFL.YFVLK.SSDVLDV.LVPILYHLNDSR.......ADQ.SR.............
Q17L03_AEDAE/1-819TKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR.............
W4Z6Q3_STRPU/1-667......--....TLLLYLLLHQNINFR.NYVLS.RTNIDTL.VIPLLKILYNAQ.......ERN.SH.............
W5JW75_ANODA/1-876TKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR.............
DYM_XENTR/1-646......--....TLLLYTLLHQNSNVR.TYVLA.RSDMENL.VLPILEILYHVE.......DRN.SH.............
A8WTE9_CAEBR/1-690......--....MLLLYMLLQANSGFR.NYVLS.RINLENL.VVPVLRILHDGVAT.....SNN.SH.............
M4C137_HYAAE/1-768......--....HLMLYTLLYSNPAIL.NTALS.DRDMERL.LLPLLKTLYHAR.......YVE.PR.............
B9HUR0_POPTR/1-672......--....VLLLYTLVHGNSDFL.EYVLV.RTDLDTL.LMPILETLYSAS.......KRT.SN.............
F6TGV4_CIOIN/1-683......--....TLLLYSLLHGNPDVK.AFVLS.KTDIDSL.VTPILQILYFAP.......SQN.SH.............
H3AL71_LATCH/1-849TKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDV.LVPILYFLNDAR.......ADQ.SR.............
C3Z701_BRAFL/1-763CKKINF--HQEILVLFWKLCEFNKKFL.FYVLK.SSDVLDV.IAPILYHLNDSR.......QDQ.SR.............

PF12722

Q2GWB4_CHAGB/1-825------QG....................................VVR---------------------MCAFLLQTLSV.
B9W786_CANDC/1-930------KN....................................LIF---------------------LCAYLLLYLSSA
B6JW01_SCHJY/1-778------FD....................................HLK---------------------ICLIILRRLTT.
C3Z701_BRAFL/1-784------VG....................................LMH---------------------IGVFILLLLSG.
A7TNQ6_VANPO/1-1209------QSS...................................MIP---------------------LCSNLSLYLSS.
B6HUK2_PENCW/1-841------QG....................................VVR---------------------MCVFILQTMSA.
Q3UU20_MOUSE/1-784------VG....................................LMH---------------------IGVFILLLLSG.
Q5ASC1_EMENI/1-732------QG....................................VVR---------------------MCIFILQTMSV.
C4XYD9_CLAL4/17-927------KV....................................LVK---------------------LCAYFLLYISS.
C5K8E7_PERM5/1-865------IG....................................LLH---------------------MCSFIILVLSS.
B8M9N3_TALSN/1-838------QG....................................MVK---------------------MCIFILQTLSV.
C5FVH3_ARTOC/1-827------NG....................................LVK---------------------M...........
A3LX71_PICST/1-905------KN....................................LVR---------------------ICAYLMLYCSS.
A8WRZ4_CAEBR/1-727------VG....................................LIH---------------------MGVFIILLLSG.
Q0E9B5_DROME/1-834------VG....................................LMH---------------------IGVFILLLLSG.
C0NTS7_AJECG/1-843------LG....................................VVK---------------------MCIFILQTLSV.
YIOC_SCHPO/1-796------YN....................................HLK---------------------LCVILLKRLTA.
A8NNK7_BRUMA/1-721------VG....................................LIH---------------------MGVFIILLLSG.
C5DS55_ZYGRC/1-1145------NGGWELGST.............................VIP---------------------LCYNLALFFSS.
Q0UAJ2_PHANO/1-733------QG....................................LVR---------------------MCVFVLQTLSV.
B0WUT2_CULQU/1-851------VG....................................LMH---------------------IGVFILLLLSG.
A7A1V5_YEAS7/1-1223------SSSSTTRSNSSTTSNGTSNDTSDERSIVELNENSVSQILLP---------------------LLNHLLLILTS.
A7RKV1_NEMVE/1-693------LG....................................LMH---------------------IGVFILLLLSG.
C5DFL0_LACTC/1-1131------RTS...................................LIP---------------------AISGFAIYLSS.
Q6FK58_CANGA/1-1248------SLT...................................VIP---------------------VINMLALYLTS.
Q6DGD7_DANRE/1-801------VG....................................LVH---------------------IGVFILLLLSG.
Q6BSE0_DEBHA/1-924------KN....................................SVR---------------------IFSYFILYLSS.

PF09742

F4WRP0_ACREC/1-730......VG------------------------------------LMH.....................IGVFILLLLSG-
E9H938_DAPPU/1-832......VG------------------------------------LMH.....................IGVFILLLLSG-
T1JUN4_TETUR/1-644........------------------------------------HIY.....................MAVIILLILSE-
J9F5Y0_WUCBA/1-661........------------------------------------HVY.....................LALIVILILSE-
B4JW54_DROGR/1-859......VG------------------------------------LMH.....................IGVFILLLLSG-
I1EYR3_AMPQE/506-1206........------------------------------------HSY.....................MLLIILLILSQ-
E0VAE1_PEDHC/1-723........------------------------------------HIY.....................MSLIILLILSE-
C1FEV8_MICSR/1-964........------------------------------------ATYAEVGGSSPRGTTQLNVSGVASVATATLAMLSQ-
G1MRD7_MELGA/1-648........------------------------------------HVY.....................MALIILLILTE-
D6WWB7_TRICA/1-769......VG------------------------------------LMH.....................IGVFILLLLSG-
H3BX91_TETNG/1-768......VG------------------------------------LVH.....................IGVFILLLLSG-
F7D5K7_XENTR/1-770......VG------------------------------------LMH.....................IGVFILLLLSG-
H2SJN1_TAKRU/1-774......VG------------------------------------LVH.....................IGVFILLLLSG-
B3RQA8_TRIAD/1-734......IG------------------------------------LMH.....................IGVFILLLLSG-
I3JLL2_ORENI/1-646........------------------------------------HVY.....................MALIILLILTE-
G7DXH4_MIXOS/12-858......LG------------------------------------LIR.....................LCAFILHSLSA-
U1M0X7_ASCSU/1-660........------------------------------------HVY.....................LSLIVILILSE-
H2XV68_CIOIN/1-762......VG------------------------------------LIH.....................IGVFILLLLSG-
Q5ZBZ3_ORYSJ/1-682........------------------------------------QIY.....................MLLIVLLILSQ-
D0NH97_PHYIT/1-769........------------------------------------RLY.....................MLVIVLLTFTQ-
T1FYR2_HELRO/1-642........------------------------------------HLY.....................MALIIILILSE-
Q4DJF1_TRYCC/1-725......FP------------------------------------HLQ.....................LVLFLLLRLSE-
I3KNU8_ORENI/1-782......LG------------------------------------LMH.....................IGVFILLLLSG-
I3JCX3_ORENI/1-776......VG------------------------------------LMH.....................IGVFILLLLSG-
Q01H67_OSTTA/38-724........------------------------------------VSQ.....................LIITSLLILSQ-
Q38FE7_TRYB2/1-706CAIPIVED------------------------------------AITPEAVASIVRRMTAFSYPFISFMTGTLVLVCSQ-
Q8RWV1_ARATH/1-679........------------------------------------QIY.....................MMLIVLLILSQ-
I1MHZ5_SOYBN/1-671........------------------------------------QIY.....................ILLIILLILSQ-
B0WBZ3_CULQU/1-681........------------------------------------HIY.....................MSLIVLLILSE-
F0Y4A0_AURAN/723-1436......VG------------------------------------LVH.....................ICTFVLLKLSG-
D7T740_VITVI/12-678........------------------------------------QIY.....................MLLIILLILSQ-
E1ZEP5_CHLVA/1-748........------------------------------------QMY.....................MLLIILLMLSQ-
M4BPB3_HYAAE/1-729......VG------------------------------------MIH.....................ICTFILLLLSG-
Q5CRW2_CRYPI/1-755.....NLC------------------------------------QLI.....................ALLSIILRLTN-
C5K8E7_PERM5/1-844......IG------------------------------------LLH.....................MCSFIILVLSS-
U6HDN4_ECHMU/1-876......LG------------------------------------LMH.....................IGVFIILLLSG-
DYM_DROME/1-676........------------------------------------HIY.....................MSLIVLLILSE-
H0VNU2_CAVPO/1-646........------------------------------------HVY.....................MALIILLILTE-
E9ICM4_SOLIN/1-654........------------------------------------HIY.....................MSLIILLILSE-
L9KZV5_TUPCH/1-826......VG------------------------------------LMH.....................IGVFILLLLSG-
E9G1Z8_DAPPU/1-633........------------------------------------HLY.....................MSLIILLLLSE-
D7FT96_ECTSI/1-808......GG------------------------------------LIH.....................ICTFVLLKLSG-
H2MFX7_ORYLA/1-772......VG------------------------------------LVH.....................IGVFILLLLSG-
B7S488_PHATC/1-694......IG------------------------------------LVH.....................ICTFVLLKLSG-
W1NV48_AMBTC/1-680........------------------------------------QIY.....................MLLIILLILSQ-
B6A9V3_CRYMR/1-794..VIIGTC------------------------------------HLI.....................PLLTILTKLTD-
H2KSV6_CLOSI/110-1035......LG------------------------------------LVH.....................VGVFILLLLSG-
M4AQZ4_XIPMA/1-781......VG------------------------------------LMH.....................IGVFILLLLSG-
E0VG76_PEDHC/1-766......VG------------------------------------LMH.....................IGVFILLLLSG-
B4MQL1_DROWI/1-832......VG------------------------------------LMH.....................IGVFILLLLSG-
HID1_DICDI/1-880......HG------------------------------------IVQ.....................IGTFILLLLSG-
W4XTN1_STRPU/1-721......VG------------------------------------LMH.....................IGVFILLLLSG-
T1K251_TETUR/1-842......IG------------------------------------LIH.....................IGVFILLLLSG-
T1I7V2_RHOPR/1-802......VG------------------------------------LMH.....................IGVFIILLLSG-
Q7QGJ8_ANOGA/1-825......VG------------------------------------LMH.....................IGVFILLLLSG-
U6I4G6_ECHMU/1-732........------------------------------------LVY.....................MALIVLLILTE-
J9KB63_ACYPI/1-736......IG------------------------------------LMH.....................IGVFILLLLSG-
Q17L03_AEDAE/1-819......VG------------------------------------LMH.....................IGVFILLLLSG-
W4Z6Q3_STRPU/1-667........------------------------------------HIY.....................MTLIILLILSE-
W5JW75_ANODA/1-876......VG------------------------------------LMH.....................IGVFILLLLSG-
DYM_XENTR/1-646........------------------------------------HVY.....................MALIILLILTE-
A8WTE9_CAEBR/1-690........------------------------------------HVY.....................LALIVALILSE-
M4C137_HYAAE/1-768........------------------------------------RLY.....................MLIIVLLIFTQ-
B9HUR0_POPTR/1-672........------------------------------------HIY.....................ILLIILLILSQ-
F6TGV4_CIOIN/1-683........------------------------------------HIY.....................MALIILLMFTE-
H3AL71_LATCH/1-849......VG------------------------------------LMH.....................IGVFILLLLSG-
C3Z701_BRAFL/1-763......VG------------------------------------LMH.....................IGVFILLLLSG-

PF12722

Q2GWB4_CHAGB/1-825.EKNFGVNLNK--------S--------------------------------FDA.......QDTLPLLSALLASGARMG
B9W786_CANDC/1-930QQNRFLEPLFV--------P--------------------------------LNSSASLHEFYNCLP.......SNYKLS
B6JW01_SCHJY/1-778.SKQFCEKLNI--------P--------------------------------FEQ.......LSSLP.......TNRRVP
C3Z701_BRAFL/1-784.ERNFGVRLNK--------P--------------------------------YTV.........RVP.........MDIP
A7TNQ6_VANPO/1-1209.KKLVLSKMLD--------T--------------------------------FTT....NYYTNKLP.......DFFKLS
B6HUK2_PENCW/1-841.EPTFAKSLNN--------S--------------------------------FEA.......QETLP.......QSIRLP
Q3UU20_MOUSE/1-784.ERNFGVRLNK--------P--------------------------------YSV.........RVP.........MDIP
Q5ASC1_EMENI/1-732.EPTFGKSLNK--------K--------------------------------FEA.......QDTLP.......QSIRIP
C4XYD9_CLAL4/17-927.QETWVQALVL--------P--------------------------------MSE.....NMNEVLP.......SEFRLT
C5K8E7_PERM5/1-865.DRDFAVALNA--------P--------------------------------FRG........SRIQ..........DVP
B8M9N3_TALSN/1-838.EVSFGKRLNM--------K--------------------------------FEA.......QDTLP.......TSIRIA
C5FVH3_ARTOC/1-827...........--------K--------------------------------FEA.......QDTLP.......PSIRLE
A3LX71_PICST/1-905.DKN.LDSIFE--------P--------------------------------MDH.....NLYESLP.......TNYKTN
A8WRZ4_CAEBR/1-727.ERNFGVRLNK--------P--------------------------------YTA.........KAN.........INIQ
Q0E9B5_DROME/1-834.ERNFGVRLNK--------A--------------------------------YSA.........TVP.........MDIP
C0NTS7_AJECG/1-843.EPNFGKNLNK--------K--------------------------------FES.......QDTLP.......QSIRLQ
YIOC_SCHPO/1-796.EKYFCKRLNK--------P--------------------------------FQQ.......QTALP.......ISMPVP
A8NNK7_BRUMA/1-721.ERNFGVRLNK--------P--------------------------------YTP.........RAA.........IDVQ
C5DS55_ZYGRC/1-1145.KKLVLSKMLE--------T--------------------------------FSP....NYYTNKLP.......NFFKLS
Q0UAJ2_PHANO/1-733.EPNFGKSLNK--------T--------------------------------FEG.......QESLP.......PSIRIP
B0WUT2_CULQU/1-851.ERNFGVRLNK--------P--------------------------------YTA.........TVP.........MDIP
A7A1V5_YEAS7/1-1223.KKLVLFKMLQ--------T--------------------------------FNL....NYYTNNLP.......NFYKLS
A7RKV1_NEMVE/1-693.ERNFGVRLNK--------P--------------------------------YAV.........RVP.........MDIP
C5DFL0_LACTC/1-1131.KKLVFSKMSF--------C--------------------------------FNV....NYYTNKLP.......NFFKLS
Q6FK58_CANGA/1-1248.KPLVLLKMLD--------P--------------------------------FNS....NYYTNKIP.......NAFKLT
Q6DGD7_DANRE/1-801.ERNFGVRLNK--------P--------------------------------YSV.........RVP.........MDIT
Q6BSE0_DEBHA/1-924.DCLIMDKLFE--------P--------------------------------MDL.....TFYESLP.......TGYKIS

PF09742

F4WRP0_ACREC/1-730-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
E9H938_DAPPU/1-832-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
T1JUN4_TETUR/1-644-DALFNESIHD........I.....TLKNIT....................WY.S--------ERTL-------PEIS..
J9F5Y0_WUCBA/1-661-DDFFCKVAHE........T.....MIKDTT....................WFNS--------ERPL-------GEIS..
B4JW54_DROGR/1-859-ERNFGVRLNK........A................................Y.S--------ATVP-------MDIP..
I1EYR3_AMPQE/506-1206-DECFNKSVHE........IKSLFQTVKNIT....................WA.S--------EKSI-------PQTT..
E0VAE1_PEDHC/1-723-DGGFGQTVHQ........I.....TIKNVT....................WY.H--------EKVL-------TEIS..
C1FEV8_MICSR/1-964-DPVVNRAVHS........LSTSQRLASSSNDSQLNDSQLNDSQLNDRTDFWFNS--------SASA-------KTLSGF
G1MRD7_MELGA/1-648-DDGFNRSIHE........V.....ILKNIT....................WY.A--------ERVL-------TEIS..
D6WWB7_TRICA/1-769-ERNFGVRLNK........P................................Y.T--------ATIP-------MDIP..
H3BX91_TETNG/1-768-ERNFGVRLNK........P................................Y.I--------LRVP-------MDIP..
F7D5K7_XENTR/1-770-ERNFGVRLNK........P................................Y.S--------VPFP-------MDIP..
H2SJN1_TAKRU/1-774-ERNFGVRLNK........P................................Y.V--------LRVP-------MDIP..
B3RQA8_TRIAD/1-734-ERNFGVRLNK........P................................F.S--------AKVP-------MDLP..
I3JLL2_ORENI/1-646-DDAFNRSIHE........V.....ILKNVS....................WY.T--------ERSL-------TEIS..
G7DXH4_MIXOS/12-858-DRRFGSRLNGSADPQGILP................................A.R--------HAVP-------......
U1M0X7_ASCSU/1-660-DDFFCKIVHE........T.....MIKNTS....................WYQA--------ERPI-------GEVS..
H2XV68_CIOIN/1-762-ERNFGVRLNK........P................................F.S--------AAAP-------TDVP..
Q5ZBZ3_ORYSJ/1-682-DSTFNASVHK........L.....VLPSVP....................WY.H--------ERLM-------HQTS..
D0NH97_PHYIT/1-769-DPSFVRTAHT........Q....LVVPNVS....................WY.Q--------EHYM-------LDVS..
T1FYR2_HELRO/1-642-DANFSLAVHD........I....PISKQIP....................WF.N--------ERQL-------GEIS..
Q4DJF1_TRYCC/1-725-TRAFCLQCNA........L................................F.H--------ERIP-------FEFE..
I3KNU8_ORENI/1-782-ERNFGVRLNK........P................................Y.A--------LRVP-------MDIP..
I3JCX3_ORENI/1-776-ERNFGVRLNK........P................................Y.S--------LHVP-------MDIP..
Q01H67_OSTTA/38-724-DVGFNRLMQT........Q.....KCSSTA....................WY.K--------ERII-------EKSS..
Q38FE7_TRYB2/1-706-DQVINKRMSN..............TIAETT.....................FKV--------GRLV-------GRCP..
Q8RWV1_ARATH/1-679-DSSFNSSIHK........M.....ILPSVP....................WY.K--------EHLL-------HQTS..
I1MHZ5_SOYBN/1-671-DSSFNAGIHK........L.....ILPTVP....................WY.K--------ERLL-------LQSS..
B0WBZ3_CULQU/1-681-DDNFNKSVHE........I.....ILKNIT....................WY.T--------ERSI-------SEIS..
F0Y4A0_AURAN/723-1436-ERSFCVALNK........P................................Y.E--------ARLP-------ADLP..
D7T740_VITVI/12-678-DSSFNASIHK........L.....ILPSVP....................WY.K--------ERLL-------HQTS..
E1ZEP5_CHLVA/1-748-DTAFAQNVHK........I.....GLPSVP....................FY.R--------ERSS-------TRTT..
M4BPB3_HYAAE/1-729-ERDFGVNLNK........P................................F.T--------NHLP-------LDLP..
Q5CRW2_CRYPI/1-755-DLNMCKVLSY........T.....YIESLPHWLEDDSLKKVIHKCSGN.....K--------EKSG-------FELS..
C5K8E7_PERM5/1-844-DRDFAVALNA........P................................F.R--------GSRI-------QDVP..
U6HDN4_ECHMU/1-876-ERNFGVRLNK........P................................Y.S--------NRAS-------FDIT..
DYM_DROME/1-676-DEGFNKNVHT........I.....MLKNIT....................WY.T--------ERTI-------SEIS..
H0VNU2_CAVPO/1-646-DDGFNRSIHE........V.....ILKNIT....................WY.S--------ERVL-------TEIS..
E9ICM4_SOLIN/1-654-DETFNKRIHE........I.....MLKSVT....................WY.T--------ERSI-------SEIS..
L9KZV5_TUPCH/1-826-ERNFGVRLNK........P................................Y.S--------VRVP-------MDIP..
E9G1Z8_DAPPU/1-633-DEGFNSNIHN........V.....VVRNPL....................WY.T--------DRVL-------NEIS..
D7FT96_ECTSI/1-808-ERAFGVAINK.........................................ACS--------VRLP-------TDLP..
H2MFX7_ORYLA/1-772-ERNFGVRLNK........P................................Y.T--------LRVP-------MDIP..
B7S488_PHATC/1-694-ERSFGVALNQ........K................................F.T--------KKLP-------TDLP..
W1NV48_AMBTC/1-680-DSSFNASIHK........L.....ILPSVP....................WY.Q--------ERLL-------HHTS..
B6A9V3_CRYMR/1-794-EPNYCKALHR........T.....IIGSLPDWLKDSSLNKTIGMY........Q--------GQNY-------YSNSTY
H2KSV6_CLOSI/110-1035-ERNFGVRLNK........P................................Y.K--------NRAA-------LDIP..
M4AQZ4_XIPMA/1-781-ERNFGVRLNK........P................................Y.T--------LRVP-------MDIP..
E0VG76_PEDHC/1-766-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
B4MQL1_DROWI/1-832-ERNFGVRLNK........A................................Y.S--------ATIP-------MDIP..
HID1_DICDI/1-880-ERDFSISLNK........P................................F.V--------GRIH-------IDIQ.Q
W4XTN1_STRPU/1-721-ERNFGVRLNK........P................................Y.S--------VRVP-------MDIP..
T1K251_TETUR/1-842-ERNFGVRLNK........P................................Y.A--------ASIP-------MDLP..
T1I7V2_RHOPR/1-802-ERNFGVRLNK........P................................Y.T--------ATIP-------MDIP.S
Q7QGJ8_ANOGA/1-825-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
U6I4G6_ECHMU/1-732-NENFAKDVHD........I.....PVKKPP....................PN.V--------ERQL-------TGVS..
J9KB63_ACYPI/1-736-ERNFGVRLNK........P................................Y.T--------TTIP-------MDIP..
Q17L03_AEDAE/1-819-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
W4Z6Q3_STRPU/1-667-DDSFNKCVHE........L.....MVKQVT....................WY.T--------DRTI-------TEIT..
W5JW75_ANODA/1-876-ERNFGVRLNK........P................................Y.T--------ATVP-------MDIP..
DYM_XENTR/1-646-DDGFNRSIHE........V.....ILKNIT....................WY.T--------ERVL-------TEIS..
A8WTE9_CAEBR/1-690-DDIFCKIIHE........T....VPIKDLG....................WLDS--------DFSV-------REIS..
M4C137_HYAAE/1-768-NPTFVRTAHT........L....LVVPNVS....................WY.Q--------EQYM-------LDIP..
B9HUR0_POPTR/1-672-DSSFNASIHK........I.....VLPSIP....................WY.Q--------EHLL-------HRTS..
F6TGV4_CIOIN/1-683-DDHFNKYVHD........I.....RLPTVP....................WY.T--------DRIL-------SDIS..
H3AL71_LATCH/1-849-ERNFGVRLNK........P................................Y.S--------VRVP-------MDIP..
C3Z701_BRAFL/1-763-ERNFGVRLNK........P................................Y.T--------VRVP-------MDIP..

PF12722

Q2GWB4_CHAGB/1-825TFSS.....SQSIYVLI...................TTSQGKLT-------------------------------AVYPA
B9W786_CANDC/1-930ITPI.....NTRDFLVTHICTILINNQVNVSSSNYLSSSSPLSD-------------------------------LLIKT
B6JW01_SCHJY/1-778FSKG.....SYADFSVTAMTSII.............TACKDYQS-------------------------------EAVLL
C3Z701_BRAFL/1-784VFTG.....THADFLIIVFHKII.............TTGHQRLQ-------------------------------PLFDC
A7TNQ6_VANPO/1-1209..SGNINNLTYRDFSVVHICNII.............INDVKENV-------------------------------QPRPW
B6HUK2_PENCW/1-841KFRG.....SYGDYLITSIHTLM.............TTSKGNLD-------------------------------TVYPA
Q3UU20_MOUSE/1-784VFTG.....THADLLIVVFHKII.............TSGHQRLQ-------------------------------PLFDC
Q5ASC1_EMENI/1-732GFKG.....SYADFLLI...........................-------------------------------.....
C4XYD9_CLAL4/17-927GGPH.....STRDFLIVQLCSILSYVFSGFGSNPKSDTANEMKR-------------------------------FLVPT
C5K8E7_PERM5/1-865VFTG.....TWADLMTLSIYRVVSDALFVAATAKSPTTGAE...-------------------------------SLIDM
B8M9N3_TALSN/1-838GFRG.....TYADYLIISIHTLM.............TSSKGKLD-------------------------------AVYPA
C5FVH3_ARTOC/1-827NFGG.....TYGDFLIISIHTLM.............TTSKGKLD-------------------------------AVYPA
A3LX71_PICST/1-905PAPT.....TTRDFLVTQICNLLIYMQTPQSTYTYGATLTPSP.-------------------------------LMVTT
A8WRZ4_CAEBR/1-727TFTG.....THADLLILVFHKLI.............TTGNYRLQ-------------------------------SLFDC
Q0E9B5_DROME/1-834VFTG.....THADLLITVFHKII.............ATGHQRLQ-------------------------------PLFDC
C0NTS7_AJECG/1-843NFRG.....SYADFLIISIHTLL.............TTSKGKLD-------------------------------AVYPA
YIOC_SCHPO/1-796FEGG.....TYADFTIIAISLLV.............QYTKDYHS-------------------------------EIAQM
A8NNK7_BRUMA/1-721SFTG.....THADLLILVFHKLI.............TTGNHRLQ-------------------------------SLFDC
C5DS55_ZYGRC/1-1145..SGNINHITYRDFAIVHLCNMA.............ISDVRDNL-------------------------------QPRPW
Q0UAJ2_PHANO/1-733NFHG.....TYADYVIT...........................-------------------------------.....
B0WUT2_CULQU/1-851VFTG.....THADLLITVFHKII.............ATGHQRLQ-------------------------------PLFDC
A7A1V5_YEAS7/1-1223NINGDINNLTFRDFTIIQLSNLI.............LDNIKFNL-------------------------------QPNPI
A7RKV1_NEMVE/1-693VFTG.....THADFLVVVFHKII.............TTGHQRLQ-------------------------------PLFDC
C5DFL0_LACTC/1-1131..VGDVNHLTYRDFAIIHLSNIA.............MNQVHENL-------------------------------FLDPN
Q6FK58_CANGA/1-1248..SGNINNLTYRDFTVIQLCNIA.............DYEVKNNI-------------------------------QPNPI
Q6DGD7_DANRE/1-801VFAG.....THADLLIVVFHKII.............TSGHQRLQ-------------------------------PLYDC
Q6BSE0_DEBHA/1-924PGPV.....TYRDFIVTQICKLLITLSSGSN.....NTNNAKPS-------------------------------LLLTT

PF09742

F4WRP0_ACREC/1-730..VFT...GTHADLLVTVFHKII.............TTGHQRLQ...............................PLFDC
E9H938_DAPPU/1-832..VFT...GTHADLLVVVFHKII.............TTGHQRLQ...............................PLFDC
T1JUN4_TETUR/1-644..........LGGLIILMIIRTV.............QYNISRTR................D.............KFLHTN
J9F5Y0_WUCBA/1-661..........LGGLIILVFVRII.............QLNTLKTK................D.............RYLHTN
B4JW54_DROGR/1-859..VFT...GTHADLLITVFHKII.............ATGHQRLQ...............................PLFDC
I1EYR3_AMPQE/506-1206..........LGSLMIIVLVRTV.............HRNIQHLR................D.............KFLHTN
E0VAE1_PEDHC/1-723..........LGGLLLLVVIRTI.............HYNMLKMR................D.............KYLHTN
C1FEV8_MICSR/1-964KSIGKPPQQTLGSAWVLVLCRVA.............RGGGIEKG................DVTSGEGGIEPATSSFARAC
G1MRD7_MELGA/1-648..........LGSLLILVVIRTI.............QYNMTRTR................D.............KYLHTN
D6WWB7_TRICA/1-769..VFT...GTHADLLIIVFHKII.............TTGHQRLQ...............................PLFDC
H3BX91_TETNG/1-768..VFT...GTHADLLIVIFHKII.............SSGHQRLQ...............................PLFDC
F7D5K7_XENTR/1-770..VFT...GTHADLLIVVFHKII.............TSGHQRLQ...............................PLYDC
H2SJN1_TAKRU/1-774..VFT...GTHADLLIVIFHKIV.............SSGHHRLQ...............................PLFDC
B3RQA8_TRIAD/1-734..VFN...GTHIDFLVIVFHKVI.............TTGHQRLA...............................PIFDC
I3JLL2_ORENI/1-646..........LGSLLILVVIRTI.............QFNMTRTR................D.............KYLHTN
G7DXH4_MIXOS/12-858........GSTADFLVVSIAQLV.............FTTKGSLN...............................TLYST
U1M0X7_ASCSU/1-660..........LGGLIILVFVRTI.............QLNTLKTR................D.............RYLHTN
H2XV68_CIOIN/1-762..AFA...GTHADFLVLVFHRVI.............TAGHQRLQ...............................PLYDC
Q5ZBZ3_ORYSJ/1-682..........LGSLMVVILIRTI.............KYNLSKLR................D.............VYLHTN
D0NH97_PHYIT/1-769..........LGSLMMVIFTRLI.............FRNITHFQ................D.............SFIHLN
T1FYR2_HELRO/1-642..........LGGLMVLVLVRTI.............QYNMTRMR................D.............QYLHTN
Q4DJF1_TRYCC/1-725..SFV...GTYNDLLIIMLCSFI.............LLRHELIR...............................PLHVT
I3KNU8_ORENI/1-782..VFT...GTHADLLIVIFHKII.............SSGHQRLQ...............................PLFDC
I3JCX3_ORENI/1-776..VFT...GTHADLLIVVFHKII.............TTGHQRLQ...............................PLFDC
Q01H67_OSTTA/38-724..........MGSLMFVVLSRAL.............KYNCSESTK............ISRD.................LS
Q38FE7_TRYB2/1-706..........VIAVCIVIIVHSI.............ARALNDGN..............................EALAAV
Q8RWV1_ARATH/1-679..........LGSLMVIILIRTV.............QHNLSKLR................D.............VYLQTT
I1MHZ5_SOYBN/1-671..........LGSLMVIILIRTI.............QYNLSKLR................D.............VYLHTT
B0WBZ3_CULQU/1-681..........LGGLLILVVIRTI.............QYNMLKMR................D.............KYLHTN
F0Y4A0_AURAN/723-1436..LFS...GSHVDLLVVVLHKMV.............VNGGDRLA...............................PLYNC
D7T740_VITVI/12-678..........LGSLMVIILIRTV.............KYNLSKLR................D.............VYLHTN
E1ZEP5_CHLVA/1-748..........LGSLLVVLLLRTA.............HYNLAKLR................D.............VYLHTN
M4BPB3_HYAAE/1-729..PFS...GNHADLLIVCLHKII.............VSGYEKLN...............................SVYNC
Q5CRW2_CRYPI/1-755....ENHSISIGNILIAVLLRAM.............FYNYKFGK................D.............IYLCSI
C5K8E7_PERM5/1-844..VFT...GTWADLMTLSIYRVVSDALFVAATAKSPTTGAE..................................SLIDM
U6HDN4_ECHMU/1-876..VFT...GNHADLLIIVFHKII.............TTGHQCLQ...............................PLFDC
DYM_DROME/1-676..........LGGILILIVIRTI.............QYNMLKMR................D.............KYLHTN
H0VNU2_CAVPO/1-646..........LGSLLILVVIRTI.............QYNMTRTR................D.............KYLHTN
E9ICM4_SOLIN/1-654..........LGGLLILVVIRTI.............QYNMFKMR................D.............KYLHTN
L9KZV5_TUPCH/1-826..VFT...GTHADLLIVVFHKII.............TSGHQRLG...............................PLFLR
E9G1Z8_DAPPU/1-633..........LGGLAVLVIARTI.............QRNIVKAS................D.............KYLHTN
D7FT96_ECTSI/1-808..LFY...GSHLDLLILTVHKLL.............VAGSDRLS...............................TLYHC
H2MFX7_ORYLA/1-772..VFT...GTHADLLIVIFHKVI.............TSGHQRLH...............................PLFDC
B7S488_PHATC/1-694..LFR...GCHADLLTITLHKLV.............VNGAYKLV...............................PLYSC
W1NV48_AMBTC/1-680..........LGSLMVVILIRTV.............KYNMSKLR................D.............VYLHTN
B6A9V3_CRYMR/1-794EYAISDSIVSLGSLIILTLIKLL.............LWNSKTHS................D.............IFLCEL
H2KSV6_CLOSI/110-1035..VFT...GTHADVLIIVFHKLI.............TTGHRRLQ...............................PLFDC
M4AQZ4_XIPMA/1-781..VFT...GTHADLLIVIFHKII.............TCGHQRLH...............................PLFDC
E0VG76_PEDHC/1-766..VFT...GTHADLLIVVFHKVI.............TTGHQRLQ...............................PLFDC
B4MQL1_DROWI/1-832..VFT...GTHADLLITVFHKII.............ATGHQRLQ...............................PLFDC
HID1_DICDI/1-880PQVYS.......DFVITVMYRLL.............VDTPDRLE...............................SIYEC
W4XTN1_STRPU/1-721..VFT...GTHADFLIIVFHKII.............TSGHQRLQ...............................PLYDC
T1K251_TETUR/1-842..IFT...GTHADLLIIVFHKLI.............TAGHQRLQ...............................PLFEC
T1I7V2_RHOPR/1-802HLFFTFCSGTHADLLITVFHKII.............TTGHQRLQ...............................PLFDC
Q7QGJ8_ANOGA/1-825..VFT...GTHADLLITVFHKII.............ATGHQRLQ...............................PLFDC
U6I4G6_ECHMU/1-732..........LGSLLVYVLTRTI.............RHHLNQLR................D.............KYLHIN
J9KB63_ACYPI/1-736..VFS...GTHADLLIIVFHKII.............TTGHNRMQ...............................PLFDC
Q17L03_AEDAE/1-819..VFT...GTHADLLITVFHKII.............ATGHQRLQ...............................PLFDC
W4Z6Q3_STRPU/1-667..........LGGLIVLVVIRTI.............QYNMTRMR................D.............KYLHTN
W5JW75_ANODA/1-876..VFT...GTHADLLITVFHKII.............ATGHQRLQ...............................PLFDC
DYM_XENTR/1-646..........LGSLLILVVIRTI.............QYNMTRTR................D.............KYLHTN
A8WTE9_CAEBR/1-690..........LGGLTALVFIRAI.............QKNALKTKVSSVFLFPNTIPLIKQD.............RYLHTN
M4C137_HYAAE/1-768..........LGSLMMVIFTRLI.............FRNITHFQ................D.............NFIHLN
B9HUR0_POPTR/1-672..........LGSLMVIILIRTV.............KYNLSKLR................D.............LYLHTT
F6TGV4_CIOIN/1-683..........LGDLIILVVIRTI.............QFNMSRMR................D.............RYLHTN
H3AL71_LATCH/1-849..VFT...GTHADLLIIVFHKII.............TSGHQRLQ...............................PLFDC
C3Z701_BRAFL/1-763..VFT...GTHADFLIIVFHKII.............TTGHQRLQ...............................PLFDC

PF12722

Q2GWB4_CHAGB/1-825L-----------LAVINN--IAAY.......................................LEGLSGPTCSRIMQLFN
B9W786_CANDC/1-930L-----------IEILYN--LISR.................VSSEEAMGFKTETSKKLNNPNPRGGLSYQSSSSITQLVS
B6JW01_SCHJY/1-778L-----------TETLSY--LVKY.......................................VDNITIASSRRLVKLFV
C3Z701_BRAFL/1-784L-----------LTIIVN--VSPY.......................................LKSLSMVASTKLLHLLE
A7TNQ6_VANPO/1-1209L-----------YELLYN--LIQI........PSNIKD.EELIKLSGNRNESPSATS......NGGLNYNASITLLHLIS
B6HUK2_PENCW/1-841L-----------LIILNN--IAPY.......................................IERISPSACSKVIQLFT
Q3UU20_MOUSE/1-784L-----------LTIVVN--VSPY.......................................LKSLSMVTANKLLHLLE
Q5ASC1_EMENI/1-732.-----------......--.........................................................LFT
C4XYD9_CLAL4/17-927F-----------SEVLYN--IVPV...................VNDSIVGTDDTSKRMNNVNSKGGLSYQACSALLQLMS
C5K8E7_PERM5/1-865M-----------LTSLCN--ISAY.......................................VRTFCLESCIKILNLVE
B8M9N3_TALSN/1-838L-----------MAILKN--IGPY.......................................VERLSSTACSKILQLFA
C5FVH3_ARTOC/1-827L-----------LAIINN--VAAY.......................................AQRLSPACAFKILQLFV
A3LX71_PICST/1-905L-----------VEILYN--LIPP..................VATKSLEATNDPAKKLTNSNPNGGLSYSTCSVINLLIG
A8WRZ4_CAEBR/1-727F-----------LTIMVN--VSPY.......................................MKSLSMVAANKLVHLVE
Q0E9B5_DROME/1-834L-----------LTILVN--VSPY.......................................LKTLSMVASVKMLHLLE
C0NTS7_AJECG/1-843L-----------LAIINN--IGAY.......................................CEHLSATTCSKIIQLFS
YIOC_SCHPO/1-796L-----------CCSLCY--LCLY.......................................AQNLNSHSSQSLFELFQ
A8NNK7_BRUMA/1-721L-----------LTIIVN--VSPY.......................................LKSISMIAANKLIHLIE
C5DS55_ZYGRC/1-1145I-----------FELIYN--LLPI........RANLRD.EELVQLSSKKRPKNIG........SGGISYNAAMPLLHLLS
Q0UAJ2_PHANO/1-733.-----------......--.........................................................LFA
B0WUT2_CULQU/1-851L-----------LTILVN--VSPY.......................................LKTLSMVASIKLLHLLE
A7A1V5_YEAS7/1-1223F-----------YELIYN--LLPINDEILTSSHKNDDSHDDLILLSAKKKSASPSAATSSHTSSSKLSYNAAMSLLYVLS
A7RKV1_NEMVE/1-693L-----------LTIIVN--VSPY.......................................LKSLSMVAANKLLHLLE
C5DFL0_LACTC/1-1131L-----------IEIIYN--LLPM.........AHEKDGGELVQLSSERSNK...........LTGLSYNACVALLQLIS
Q6FK58_CANGA/1-1248I-----------YETLYN--LIPIDPKWLASDTSGADD.EELTLLSRKKSINSSGNGLKS...CERLSYNASLAVLHLIS
Q6DGD7_DANRE/1-801L-----------LTIIVN--VSPY.......................................LKSLSMVAANKLLHLLE
Q6BSE0_DEBHA/1-924L-----------VEILYN--LIPV..................VSSKDIEVKDDPEKKLGNSNPRGGLSYGACSSITQLIL

PF09742

F4WRP0_ACREC/1-730L...........LTILVN..VSPY---------------------------------------LKTLSMVASTKLLHLLE
E9H938_DAPPU/1-832L...........LTILVN..VSPY---------------------------------------LKTLSMVASTKLLHLLE
T1JUN4_TETUR/1-644L...........LATLAN..MSNH---------------------------------------FRRLSPYVCQRLVTLFE
J9F5Y0_WUCBA/1-661C...........LAALAN..MSSY---------------------------------------FKNLSSIVCQKLIGLLE
B4JW54_DROGR/1-859L...........LTILVN..VSPY---------------------------------------LKTLSMVASVKLLHLLE
I1EYR3_AMPQE/506-1206C...........LATLAN..MSSH---------------------------------------FHSLSLEAAEKIVNLFR
E0VAE1_PEDHC/1-723C...........LAALAN..MSNN---------------------------------------FCNLNSYVSQRLLSLFE
C1FEV8_MICSR/1-964A...........LAALAN..SAPY---------------------------------------FDGLTSAASQRLVAVFD
G1MRD7_MELGA/1-648C...........LAALAN..MSSQ---------------------------------------FRSLHQYAAQRIIRLFG
D6WWB7_TRICA/1-769L...........LTILVN..VSPY---------------------------------------LKTLSMVASTKLLHLLE
H3BX91_TETNG/1-768L...........LTVIVNTTVSPY---------------------------------------LKSLSMVAANKLLHLLE
F7D5K7_XENTR/1-770L...........LTIIVN..VSPY---------------------------------------LKSLSMVASNKLLHLLE
H2SJN1_TAKRU/1-774L...........LTVIVN..ISPY---------------------------------------LKSLSMVAANKLLHLLE
B3RQA8_TRIAD/1-734L...........LTVLVN..VSPY---------------------------------------SKTLSIVASNKLLHLLE
I3JLL2_ORENI/1-646C...........LAALAN..MSAQ---------------------------------------FRCLHQYAAQRIISLFA
G7DXH4_MIXOS/12-858Y...........AIILAN..TSPY---------------------------------------WKATSVLASQRLLQLFM
U1M0X7_ASCSU/1-660C...........LAALAN..MSSS---------------------------------------FKQLSSTVCQKLIGLLE
H2XV68_CIOIN/1-762L...........LTIIVN..VSPY---------------------------------------LKSLSMTAASKLLHLLE
Q5ZBZ3_ORYSJ/1-682C...........LAILAN..MAPH---------------------------------------VHRLSAYASQRLVSLFD
D0NH97_PHYIT/1-769A...........FAALSN..LARS---------------------------------------AENLHMYAAQGIVGLID
T1FYR2_HELRO/1-642C...........LGALAN..MSSH---------------------------------------FMNLHPYVAQRLVSLFA
Q4DJF1_TRYCC/1-725C...........SAIISN..IAPF---------------------------------------MIKISPVSSEKLGLVFT
I3KNU8_ORENI/1-782L...........LTIIVN..ISPY---------------------------------------LKSLSMVAANKLLHLLE
I3JCX3_ORENI/1-776L...........LTIIVN..VSPY---------------------------------------LKSLSMVAANKLLHLLE
Q01H67_OSTTA/38-724V...........LGVIAN..MAGV---------------------------------------TRDISGYAAQRLVNILE
Q38FE7_TRYB2/1-706F...........IPCLAN..FAPF---------------------------------------VHDIDVYTSQRLVGLLL
Q8RWV1_ARATH/1-679C...........LATLAN..MAPH---------------------------------------AHHLSAYASQRLVSLFY
I1MHZ5_SOYBN/1-671C...........LATLAN..LAPH---------------------------------------VHRLSAYASQRLVSLFG
B0WBZ3_CULQU/1-681C...........LAALAN..MSGQ---------------------------------------FRSLHPYVAQRLVSLFE
F0Y4A0_AURAN/723-1436F...........LTVLCN..LSPY---------------------------------------AKCIDLVAAVKLVNLFE
D7T740_VITVI/12-678C...........LATLAN..MAPH---------------------------------------AHRLSAYASQRLVSLFD
E1ZEP5_CHLVA/1-748T...........LAALAN..LAPH---------------------------------------MSGLSTHAAQRLVSLFH
M4BPB3_HYAAE/1-729F...........LTIICN..ISPY---------------------------------------CKKLNMVSAVRLMRLFK
Q5CRW2_CRYPI/1-755I...........YSIIEN..ISIY---------------------------------------MKNFHWHVAEKITHYLI
C5K8E7_PERM5/1-844M...........LTSLCN..ISAY---------------------------------------VRTFCLESCIKILNLVE
U6HDN4_ECHMU/1-876L...........ITIIDN..VSPY---------------------------------------VKSLSMVSASKLMHLTE
DYM_DROME/1-676C...........LAALAN..MSGH---------------------------------------FRALHPYVAQRLVSLFE
H0VNU2_CAVPO/1-646C...........LAALAN..MSAQ---------------------------------------FRSLHQYAAQRIISLFS
E9ICM4_SOLIN/1-654C...........LAALAN..MSAQ---------------------------------------FTSLHPYVSQRLLSLFE
L9KZV5_TUPCH/1-826LPAHHRGQRSEPLPHLPT..VSPY---------------------------------------LKSLSMVTANKLLHLLE
E9G1Z8_DAPPU/1-633C...........LATLAN..MAAH---------------------------------------FRRLHPYTCQRLVSLLC
D7FT96_ECTSI/1-808F...........LTVLCN..VSPY---------------------------------------AKGLSLIASVKLLSLFE
H2MFX7_ORYLA/1-772L...........LTIIVN..ISPY---------------------------------------LKSLSMVAANKLLHLLE
B7S488_PHATC/1-694F...........LTIITN..ISPY---------------------------------------WKSMSLVAAVKLVNLFE
W1NV48_AMBTC/1-680C...........LATLAN..MAPH---------------------------------------VHRLSAYASQRLVSLFD
B6A9V3_CRYMR/1-794A...........CVIIQN..LSSS---------------------------------------VENFHWIVSEKTLQYCN
H2KSV6_CLOSI/110-1035L...........LTIIVN..VSPY---------------------------------------LKSMSMVTANKLLHLLE
M4AQZ4_XIPMA/1-781L...........LTIIVN..ISPY---------------------------------------LKSLSMVAANKLLHLLE
E0VG76_PEDHC/1-766L...........LTILVN..VSPY---------------------------------------LKTLSMVSSTKLLHLLE
B4MQL1_DROWI/1-832L...........LTILVN..VSPY---------------------------------------LKTLSMVASVKLLHLLE
HID1_DICDI/1-880V...........LTILSN..LSPY---------------------------------------MKNLSMVTCVKLMKLFE
W4XTN1_STRPU/1-721L...........LTIIVN..VSPY---------------------------------------LKSLSMVSANKMLHLLE
T1K251_TETUR/1-842L...........LTIIVN..VSPY---------------------------------------LKTLSMVSANKLLHLLE
T1I7V2_RHOPR/1-802L...........LTILVN..VSPY---------------------------------------LKTLSMVASTKLLHLLE
Q7QGJ8_ANOGA/1-825L...........LTILVN..VSPY---------------------------------------LKTLSMVASIKLLHLLE
U6I4G6_ECHMU/1-732S...........LAALAN..LSPK---------------------------------------IANLHPYVSQALVDLLQ
J9KB63_ACYPI/1-736L...........LTILVN..VSPY---------------------------------------LKTLSMVSSTKLLHLVD
Q17L03_AEDAE/1-819L...........LTILVN..VSPY---------------------------------------LKTLSMVASIKLLHLLE
W4Z6Q3_STRPU/1-667C...........LAALAN..MSSQ---------------------------------------FHSLHPYVTQRIVSLFE
W5JW75_ANODA/1-876L...........LTILVN..VSPY---------------------------------------LKTLSMVASIKLLHLLE
DYM_XENTR/1-646C...........LAALAN..MSAQ---------------------------------------FRSLHQYAAQRIISLFS
A8WTE9_CAEBR/1-690C...........LAALAN..MSAF---------------------------------------FKNLAPIVCQRLISLLD
M4C137_HYAAE/1-768A...........FAALSN..LARS---------------------------------------AENLHIYAAQGLIGLIE
B9HUR0_POPTR/1-672C...........LATLAN..MAPH---------------------------------------FHHLSAYASQRLVSLFY
F6TGV4_CIOIN/1-683C...........LAALAN..MSAH---------------------------------------FRSLHPYAAQRIFSLVT
H3AL71_LATCH/1-849L...........LTIIVN..VSPY---------------------------------------LKSLSMVAANKLLHLLE
C3Z701_BRAFL/1-763L...........LTIIVN..VSPY---------------------------------------LKSLSMVASTKLLHLLE

PF12722

Q2GWB4_CHAGB/1-825SMSSPSFLLA......----------------------------------------------------------------
B9W786_CANDC/1-930VLSNKRFLLE......----------------------------------------------------------------
B6JW01_SCHJY/1-778NVSDLGFLLA......----------------------------------------------------------------
C3Z701_BRAFL/1-784AFSTPWFLFS......----------------------------------------------------------------
A7TNQ6_VANPO/1-1209KLSNKMYLTSN.SIPN----------------------------------------------------------------
B6HUK2_PENCW/1-841SMSSPSFLLA......----------------------------------------------------------------
Q3UU20_MOUSE/1-784AFSTTWFLFS......----------------------------------------------------------------
Q5ASC1_EMENI/1-732SMSAPSFLLA......----------------------------------------------------------------
C4XYD9_CLAL4/17-927TLSSKQALAE......----------------------------------------------------------------
C5K8E7_PERM5/1-865RFSKPHWLFK......----------------------------------------------------------------
B8M9N3_TALSN/1-838SMSSPSFLLA......----------------------------------------------------------------
C5FVH3_ARTOC/1-827SMSSPSFLLA......----------------------------------------------------------------
A3LX71_PICST/1-905KYSSRTFLQE......----------------------------------------------------------------
A8WRZ4_CAEBR/1-727AFSTPWFLFS......----------------------------------------------------------------
Q0E9B5_DROME/1-834AFSTPWFLLS......----------------------------------------------------------------
C0NTS7_AJECG/1-843LLSSPSFLLA......----------------------------------------------------------------
YIOC_SCHPO/1-796SASYPGFLIS......----------------------------------------------------------------
A8NNK7_BRUMA/1-721AFSTPWFLFS......----------------------------------------------------------------
C5DS55_ZYGRC/1-1145KMSNKNYLTTYASSPS----------------------------------------------------------------
Q0UAJ2_PHANO/1-733SMSSPSFLFA......----------------------------------------------------------------
B0WUT2_CULQU/1-851AFSTPWFLYS......----------------------------------------------------------------
A7A1V5_YEAS7/1-1223KSSNKVYLTTY....A----------------------------------------------------------------
A7RKV1_NEMVE/1-693AFSTPWFLFA......----------------------------------------------------------------
C5DFL0_LACTC/1-1131KMTSKNYLTTFAGEKG----------------------------------------------------------------
Q6FK58_CANGA/1-1248KMSSRNYLTTY.STPR----------------------------------------------------------------
Q6DGD7_DANRE/1-801VFSSPWFLFS......----------------------------------------------------------------
Q6BSE0_DEBHA/1-924KFSTRPFLLD......----------------------------------------------------------------

PF09742

F4WRP0_ACREC/1-730AFSTPWFLF...SAPT................................................................
E9H938_DAPPU/1-832AFSTPWFLF...SAPN................................................................
T1JUN4_TETUR/1-644KISKKLHKILNSQNAI.............................................................NGN
J9F5Y0_WUCBA/1-661VFTRRHAKL...IENM................................................................
B4JW54_DROGR/1-859AFSTPWFLL...SAPS................................................................
I1EYR3_AMPQE/506-1206VLSRKYLKS....................................................................KGE
E0VAE1_PEDHC/1-723TLAKKYHRLEITLKTNMVKINSETRENDDGEKENSFVEMGKNSTTSQSKPNEENSVKETIINGTHESDKEDMAIQIKSST
C1FEV8_MICSR/1-964VLHRRRRKR...VSAAMGRPGIE.........................................................
G1MRD7_MELGA/1-648IFSELHNKA...LASA................................................................
D6WWB7_TRICA/1-769AFSTPWFLF...SSST................................................................
H3BX91_TETNG/1-768AFSTPWFLF...SSPQ................................................................
F7D5K7_XENTR/1-770AFSSTWFLF...SSPQ................................................................
H2SJN1_TAKRU/1-774AFSTPWFLF...SSPQ................................................................
B3RQA8_TRIAD/1-734AFSTPWFLF...SNNN................................................................
I3JLL2_ORENI/1-646LLSKKHNKV...LEQA................................................................
G7DXH4_MIXOS/12-858AMSAPSFLL...AEEG................................................................
U1M0X7_ASCSU/1-660LFTKRHAKL...IKHM................................................................
H2XV68_CIOIN/1-762AFSTPWFLF...SSPQ................................................................
Q5ZBZ3_ORYSJ/1-682MLSRKYTKL...AELK................................................................
D0NH97_PHYIT/1-769MLAKNEAKL.......................................................................
T1FYR2_HELRO/1-642LLLKKHKKAADRLKEI................................................................
Q4DJF1_TRYCC/1-725SVSTRYLAY...KALF................................................................
I3KNU8_ORENI/1-782AFSTPWFLF...SSPQ................................................................
I3JCX3_ORENI/1-776AFSTTWFLF...SAAQ................................................................
Q01H67_OSTTA/38-724LLTKKRARL...LSAENKDLQE..........................................................
Q38FE7_TRYB2/1-706LTLRKVQRT...AEHA................................................................
Q8RWV1_ARATH/1-679MLSRKYNKL...SDLT................................................................
I1MHZ5_SOYBN/1-671MLSRKYNKL...ADLR................................................................
B0WBZ3_CULQU/1-681TLAKKHARLDQQLRQP..............................................................AA
F0Y4A0_AURAN/723-1436LFTSPKFLY...AAEA................................................................
D7T740_VITVI/12-678MLSRKYNKL...AELM................................................................
E1ZEP5_CHLVA/1-748LLARRYSRL...QAAA........EGMPPPPTPNDLLSPSLESPLTPWTPAASPAPGPDAPAAAPQQQQGQQGAAGAEAA
M4BPB3_HYAAE/1-729LFAQPRYLF...DNEA................................................................
Q5CRW2_CRYPI/1-755FLSSQIYCS...LNTY................................................................
C5K8E7_PERM5/1-844RFSKPHWLF...KGPL................................................................
U6HDN4_ECHMU/1-876AFSQPWFLF...SSPN................................................................
DYM_DROME/1-676TLARKHTRLDAQLKEP................................................................
H0VNU2_CAVPO/1-646LLSKKHNKV...LEQA................................................................
E9ICM4_SOLIN/1-654TLAKKHARLEARILEQ................................................................
L9KZV5_TUPCH/1-826AFSTPWFLF...SAAQ................................................................
E9G1Z8_DAPPU/1-633TLNKRRIRV...VQQI................................................................
D7FT96_ECTSI/1-808LFTSPGNLY...ASEA................................................................
H2MFX7_ORYLA/1-772AFSAPWFLL...SAQR................................................................
B7S488_PHATC/1-694LFASPKFLY...SGEF................................................................
W1NV48_AMBTC/1-680MLARKYTKL...AELR................................................................
B6A9V3_CRYMR/1-794ILISRINGI...LSLQ................................................................
H2KSV6_CLOSI/110-1035AFSQPWFLY...SGQT................................................................
M4AQZ4_XIPMA/1-781AFSMPWYLL...SAPQ................................................................
E0VG76_PEDHC/1-766AFSTPWFLL...SAPS................................................................
B4MQL1_DROWI/1-832AFSTPWFLL...SAPS................................................................
HID1_DICDI/1-880YLSTPRFLF...ATNH................................................................
W4XTN1_STRPU/1-721AFSTPWFLF...SSPS................................................................
T1K251_TETUR/1-842AFSTPWFLY...SNPI................................................................
T1I7V2_RHOPR/1-802AFSTPWFLF...SSPS................................................................
Q7QGJ8_ANOGA/1-825AFSTPWFLY...SAPS................................................................
U6I4G6_ECHMU/1-732KLVKRHKRL...VNEI.....................................................RTLNDQLKEQK
J9KB63_ACYPI/1-736AFTTPWFLF...SSPS................................................................
Q17L03_AEDAE/1-819AFSTPWFLY...SAPS................................................................
W4Z6Q3_STRPU/1-667LLIKKHDKI...VEQL................................................................
W5JW75_ANODA/1-876AFSTPWFLY...SAPS................................................................
DYM_XENTR/1-646LLSKKHNKV...LEQA................................................................
A8WTE9_CAEBR/1-690LLTKRHAKM...VDHM................................................................
M4C137_HYAAE/1-768MLAKNEAKL...VAQMKYLKSTDK........................................................
B9HUR0_POPTR/1-672MLSRKYNKL...AERI................................................................
F6TGV4_CIOIN/1-683LLTKKYRKL...TEKV......................................................LAIMATSDTP
H3AL71_LATCH/1-849AFSTTWFLF...SAPQ................................................................
C3Z701_BRAFL/1-763AFSTPWFLF...SNPS................................................................

PF12722

Q2GWB4_CHAGB/1-825-..........................NDSNHSLLRS--------------LLEAINAIVE---HQFS--R.........
B9W786_CANDC/1-930-..........................KSFHPDLV</