Sequence alignment for CL0456

PF12722

C4XYD9_CLAL4/17-927MKTAE---EKIA------------FKNS-FFKLGQGRLM..DHGDVAFWSIFW....NTP-QSASDIYDL----LTPFDL
A3LX71_PICST/1-905MKTAD---DKLR------------YKNH-FFKLGQGRVI..AGNDSDYWKVLW....TEP-DNSDDIFEL----LTSYDI
Q6BSE0_DEBHA/1-924MKTAE---ERLR------------FKNH-FFKLGQGRLI..PSSDSTYWDAFW....KEP-ETTSDIYEL----ITPYDI
C3Z701_BRAFL/1-784MGNSD---TKLN------------FRKA-VIQLTTKTQPVEAQDEA.FWDQFWT...DSV-TSVQDVFAL----VPAAEI
Q0E9B5_DROME/1-834MGNTD---SKLN------------FRKA-IVQLTQKNQKIDPSDEQ.FWEQFWQ...GHQ-TTLEDVFAL----VTSSEI
B0WUT2_CULQU/1-851MGNAD---TKLN------------FRKA-IVQLTSKSQPIDASDDA.FWEQFWC...EHS-TTVQDVFAL----IPSNEV
A7RKV1_NEMVE/1-693MGGTE---SKLN------------FRKA-VVQLTTKKSAAEPNDDA.FWDQFWS...ESA-ATISDVFTL----IPAAEI
A8WRZ4_CAEBR/1-727MGAQG---SRVD------------FKQA-VLDLTSKPGKDDEQ....FWDQAW.....WP-DTVNDIFAM----IPGEDI
A8NNK7_BRUMA/1-721MGNSG---SKIN------------FRKA-VVELTTKKSKVE..EDA.FWEELCA...SNI-NSAADIFSL----ITADDV
C5K8E7_PERM5/1-865MGNSE---SRAL------------VSDY-LDELGQCDLAVDAEAAP.MKEEFWTTIFDTP-LSIEEIFEI----ITPEWV
B6JW01_SCHJY/1-778MGAQE---SKLC------------FRRA-VLRL..............YEERFW....RFS-NTAKDVFNL----LPLKDI
YIOC_SCHPO/1-796MGSQQ---SKLD------------FRNA-VLRLHEERNI..PKFDL.IWERLW....TLP-ETTEDVFHL----MSIDDL
Q2GWB4_CHAGB/1-825MGASD---SKLV------------FKKG-IFRLSEERHI..PAGDA.YWSSFW....ELP-ESPEDIFSL----FTPADV
Q0UAJ2_PHANO/1-733MGASD---SKLT------------FKQG-IFRLSEPKQI..PADDV.YWTGFW....ELP-ESTEDVFSL----FSPADI
B8M9N3_TALSN/1-838MGASE---SKLV------------FKQG-IFRLYEDQNI..SADDP.FWIKFW....ELP-ESTEDVFSL----FTPTDI
C5FVH3_ARTOC/1-827MGASE---SKLV------------FKQG-IFRLSEQANI..PPDDQ.YWTGFW....ELP-ESVEDVFSL----FSPVDI
C0NTS7_AJECG/1-843MGGSE---SKLA------------FRQG-IFRLSEESNI..AADDP.YWTGFW....ELP-ESPEDVFSL----FSPADI
B6HUK2_PENCW/1-841MGASE---SKLV------------FKQG-IFRLSEEQEI..PADDP.YWTRFW....ELP-ESTEDVFSL----FTPADI
Q5ASC1_EMENI/1-732MGASE---SKLV------------FKQG-IFRLSEEKEI..PPDDP.YWARFW....ELP-ESTEDVFSL----FTPADI

PF09742

F4WRP0_ACREC/1-730MGNAD...TKLN............FRKA.VVQLTSKTQVIDASDDI-FWDQFWS...ENV.TNVQDIFTL....IPAPEI
E9H938_DAPPU/1-832MGNAD...TKLN............FRKA.VVQLTSKTQPIDPSDNT-FWSQFWS...ESI.TNIQDVFTL....IPATEI
T1JUN4_TETUR/1-644MGITN...SALN.NL.........KSNE.HLNKFASNQHIPV.GDS-FWNEMLSFSFTKSIRTLEETRVLEDSVSPLLNS
J9F5Y0_WUCBA/1-661MGAKI...SSET.LI.........EENA.YLRRFVGLQPISD.NDP-FWNHFLSFNFLIDSNNRKEVEQFDISLSDSLQS
B4JW54_DROGR/1-859MGNTD...SKLN............FRKA.IVQLTQKNQKIDNNDDQ-FWEQFWQ...AHQ.TTLEDVFAL....VTASEI
I1EYR3_AMPQE/506-1206MGIAS...STSLKEL.........GRNE.LLEKFVGESPIAD.SEE-YWDKLLTFSFKPP.TLPGDNKVLYEATAPIIEK
E0VAE1_PEDHC/1-723MGASN...SK...DL.........SSNE.YLLKFSGKDHISC.SDQ-FWNVFLSFSFKPP.SSKSENEVINDKLSKIFEN
C1FEV8_MICSR/1-964MGAGS...STAAAAY....ARCKDDVDA.NLARLSDPDPTTP.DDP-TWDELLRFPAAITSASDADLDVVLGRVD.....
G1MRD7_MELGA/1-648MGANS...SSIS.EL.........PDNE.YLKKLSGAEPISE.NDP-FWNQLLSFSFTAP.TNSADLKLLEEATISVCKS
D6WWB7_TRICA/1-769MGNVD...TKLN............FRKA.VVQLTSKSEPIDANDDS-FWEQFWS...ENV.TNVQDIFTL....VPAAEI
H3BX91_TETNG/1-768MGGGD...SKLH............FRKA.VIQLTTKTQPVEASDDA-FWDQFWA...NAS.TTVQDIFAL....VPAAEI
F7D5K7_XENTR/1-770MGNTD...TKLN............FRKA.VIQLTTKTQPVEATDDV-FWDQFWT...DSS.TSVQDVFAL....IPAAEI
H2SJN1_TAKRU/1-774MGSGD...SKLH............FRKA.VIQLTTKTQPVEASDDA-FWDQFWS...DAS.TTVQDIFAL....VPAAEI
B3RQA8_TRIAD/1-734MGGTD...SKLY............FRKA.IVQLTTKTMPIDANDDA-FWDQFWS...ESI.ASVQDIFTL....VTAQEI
I3JLL2_ORENI/1-646MGANT...SQVS.DL.........SDNP.SLKALVGTESISE.NDP-FWNQLISFTFISP.TSSGESKLLEEAVIPLAKI
G7DXH4_MIXOS/12-858...KD...AKLA............FRQTGIAKLA..TQPVPPEDVA-YWEQYW....LVF.DTAWDVTTL....ITAADV
U1M0X7_ASCSU/1-660MGAVI...SSET.IL.........DENI.YLRRFTGLQPITD.NDP-FWNQLLSFNLKINTDDRREVKQFNESQLDLLQS
H2XV68_CIOIN/1-762MGNTE...TKLS............FRKA.VIQLTTRMQPVEANDDA-FWDQFWT...EPI.NNVQDVFAL....VPAAEV
Q5ZBZ3_ORYSJ/1-682MGAAP...STPRLGAVAGAAASPGAAEQ.MFAALVGGKAYPI.SSE-FWRQLLELPLTQQ........WPRDRVLQACHA
D0NH97_PHYIT/1-769MGASSSTPSSATGSAAIEQIFRSAQEKA.AFEKIVSETPAPR.EDV-AYHALLGTPKPLPQLTQAQVELL...TREYGET
T1FYR2_HELRO/1-642MGANN...STLSKDL.........SNNE.YLLKLSGPDYISP.NEP-FWNQLLSFAFSVP.KTSADQRHLEDITSNLCKN
Q4DJF1_TRYCC/1-725MGTSS...STLE............VGKA..IRLLLVDTPVD.....-..DGIFNLLLNTA.LSKSELERA....LPFSTL
I3KNU8_ORENI/1-782MGNAD...SKLN............FRKA.VVQLTTKTQPVEASDDV-FWDQFWV...DSS.TTVQDVFAL....VPAAEI
I3JCX3_ORENI/1-776MGSTD...SKLN............FRKA.VIQLTTKTQPVEATDDA-FWDQFWA...DTT.TTVQDVFAL....VPAAEI
Q01H67_OSTTA/38-724.RESA...SELRRGLKAMCEATRETPDA...............MDV-FWYELGNAS.SEP.LTAMSERTLDEMLRPYGRS
Q38FE7_TRYB2/1-706MGGTS...TKES.................LLYFMDVARGVSPPDEK-DFSSHLGRCRKELCSGAELYRTL....LPIMQT
Q8RWV1_ARATH/1-679MGGVP...STPRK....TGGDDVSVAEY.LIATFVGEKSFPL.ASD-FWNKLLELPLSSR........WPSDRVQQACEL
I1MHZ5_SOYBN/1-671MGSAL...STPD............TAEH.LVGSFVGDESIPL.SSD-FWQKLLELPFDAE........LPSQRLHQTCQL
B0WBZ3_CULQU/1-681MGMNV...SRQV.DL.........AENE.YLKRFVGRDHVPAYNDD-FWNSFLQYHINLP.TNSQEQLSLDSRLESLCQS
F0Y4A0_AURAN/723-1436MGGGN...SKAD............LADI.LVMLSQSD..VSPDAHD-FWDELW....KLS.TTPEDVFEL....ISPDDV
D7T740_VITVI/12-678..................SARPVDTAEY.LIGTFVGEKSFPL.TSD-FWQKLLELPLSLQ........WPSHRVRQACEL
E1ZEP5_CHLVA/1-748MGNAGSAHAQLQ.................AVAAVSGATLLPM.DAP-EWQILLG..VSQP.LSRFDPGEVEREIRPHCAE
M4BPB3_HYAAE/1-729MGNSD...SKSK............FRES.VYKLNNEV..ISSKNLE-FWDKLW....RIP.TVAEEIFTL....IQPDDV
Q5CRW2_CRYPI/1-755MGSSI...SKDKDNSLPQNCLR.......FIEPFLQKENIRT.NLS-LLNELQKLIITPI...EDNSFADQFIFEHISSK
A0A087VXA6_ECHMU/1-876MGSGQ...SSLS............YRTA.FVELANKTQPINAYNDE-FWDQFWC...GGP.TRISDMFAS....VPGSEI
DYM_DROME/1-676MGINV...SRTA.DL.........GSNQ.WLQRFVGRQHIAHDDEA-FWNGLLNYNIVLP.ENSQDQLNLDSRLEALCQS
H0VNU2_CAVPO/1-646MGSNS...SRIS.DL.........PKNE.YLQKLSGTESVSE.NDP-FWNQLLSFSFPAP.TSSTELKLLEEATISVCKC
E9ICM4_SOLIN/1-654MGATP...SRYE.DL.........SKNV.HLGRFCGKQSIPA.NDP-FWSTFLSYNIRPP.ITRNDQIELDSRLDSSCQQ
L9KZV5_TUPCH/1-826MGSAD...SKLN............FRKA.VIQLTTKTQPVEATDDA-FWDQFWA...DTA.TSVQDVFAL....VPAAEI
E9G1Z8_DAPPU/1-633MGAQC...SSVA.NL.........NSNE.HLFQLCGSTPMTA.NDP-TWNQLFSFNLQIP.LSSLENHEVIEGTAQLFQL
D7FT96_ECTSI/1-808MGTGA...SKVA............FRDV.LAQLKNED..IATNDAA-FWSKLW....KTE.TNPHDVFEV....ISPTAV
H2MFX7_ORYLA/1-772MGNSD...TKLH............FRKA.VIQLTTKTQPVEATDDA-FWDQFWT....SA.ISVQDVFAL....VPAAEI
B7S488_PHATC/1-694MGQSA...SKEK............FRES.VTALIQVD..VSADDAD-FWDELW....KIP.SSAEEVFEL....LPARSA
W1NV48_AMBTC/1-680MGGVP...STPSK.....SSRPRDQAEY.LLATFVGEKSFPI.SSD-FWQKLLASPLTLQ........WPQDKVSEACES
B6A9V3_CRYMR/1-794MGSSI...SKEGPVFLLENSFR.......LINGLLGQNTVDD.EDP-IWEKMKSEFILPP...IAPNILDNYIYEHISTT
H2KSV6_CLOSI/110-1035MGGDN...SKLT............YRNV.VIQLTTKTQPIDSNDNA-FWERFWT...DIS.ISVQDMFVL....IPAAEI
M4AQZ4_XIPMA/1-781MGNAD...TKLH............FRKA.VIQLTTKTQPVEATDNV-FWDQFWA...ECS.IAVQDVFAL....VPAAEI
E0VG76_PEDHC/1-766MGNTD...TKLN............FRKA.VVQLTSKTQPIDASDDN-FWNQFWA...ENN.TSVQDIFTL....VPAAEI
B4MQL1_DROWI/1-832MGNTD...SKLN............FRKA.IVQLTQKNQKVDPNDEQ-FWEQFWQ...GHQ.TTMEDVFAL....VTSNEI
HID1_DICDI/1-880MGTGS...SREQ............HLNS.FNTLQKETVP.......-FSSDLWKTILSQN.LEDDSLYL........ENL
W4XTN1_STRPU/1-721MGSSD...SKLN............FRKA.VVQLTTKTQPVEAGDDA-FWDQFWA...DSV.TSVTDVFAL....IPAAEI
T1K251_TETUR/1-842MGNSD...SKLN............FRKA.VVQLSSKTHPIDAKEDS-FWDQFWC...ESI.NNIQDVFTL....IPSPEI
T1I7V2_RHOPR/1-802MGNVD...TKLN............FRKA.VIQLTSKTQPIDAADNT-FWDQFWS...ENV.TNVQDVFTL....VPATEI
Q7QGJ8_ANOGA/1-825MGNTD...TKLN............FRKA.IVQLTSKSQPIDASDDA-FWEQFWC...EHN.TPVQDVFAL....VPANEI
A0A068YEV3_ECHMU/1-732MGSSV...SNLA.DL.........ATNP.YLIKLVGQESVNC.SNE-YWNRLLPFDIQTP.LTNEASFYLEAAVSSLQQR
J9KB63_ACYPI/1-736MGNAD...TKLV............FRKA.VVQLTSKTQTISAEDND-FWDQFWS...ETV.TNVQDVFTL....VPAAEI
Q17L03_AEDAE/1-819MGNTD...TKLN............FRKA.IVQLTSKSQPIDAGDDV-FWEQFWI...EHS.TSVQDVFAL....IPSNEI
W4Z6Q3_STRPU/1-667MGGTG...SSLS.EL.........GENE.FLRRFVGKESIDD.TDP-FWEQLLSFSFNIP.HSSADARLIEESSQNLCKT
W5JW75_ANODA/1-876MGNTD...TKLN............FRKA.IVQLTSKSQPIDASDDA-FWEQFWC...EHN.TPVQDVFAL....VPANEI
DYM_XENTR/1-646MGANS...STIK.EL.........SENE.FLKKLSGTDSISE.NEP-FWNQLLSFSFSTP.TNSADSKLLEEGTLSICKS
A8WTE9_CAEBR/1-690MGSVI...TKET.IL.........QDNV.YLKKLSGLEPVDD.YDP-FWNKLLSFSLKFDDDDEKTRIALESALDDHLQC
M4C137_HYAAE/1-768MGATSS..SSATSTASIESLFCSTQEKG.AFEKIVSKVPIPH.TDA-AYDTVLAAPKVLPQLIQTQVELL...TQEYGEA
B9HUR0_POPTR/1-672MGAVP...STPRL....SGARPQDTADY.LIGSFVGEKTFPI.GSD-FWQKLLELPLNLH........WPTHRVQEACKL
F6TGV4_CIOIN/1-683MGIGC...SSFA.HL.........EDNE.YLKRLSSNVSISE.NDP-FWNQLFSFTLSAP.RDRNEAILLEEATETFCKM
H3AL71_LATCH/1-849MGNVD...SKLN............FRKA.VIQLTTKTQPVEATDDA-FWDQFWA...DTA.TSVQDVFAL....VPAAEI

PF12722

C4XYD9_CLAL4/17-927QTVRDQNLPNFLLLVHIVAC------RVVELAR-----------------------------------------------
A3LX71_PICST/1-905RTIRDQNRVNYLVMIHVLCN------QIIATAR-----------------------------------------------
Q6BSE0_DEBHA/1-924RTIREQNRANFVLMIRVLIL------RLTYLAQ-----------------------------------------------
C3Z701_BRAFL/1-784RALREESPSNLATLCYKAVE------KLVMAAE-----------------------------------------------
Q0E9B5_DROME/1-834RQIRNENPANLATLCYKAVE------KLAQAVD-----------------------------------------------
B0WUT2_CULQU/1-851RKVRDVMPTNLATLCYKATE------RLVRAVD-----------------------------------------------
A7RKV1_NEMVE/1-693RNLRDENPSNLATL......------.......-----------------------------------------------
A8WRZ4_CAEBR/1-727RKLRDESPKNLATLVYKAVE------KIQFSRH-----------------------------------------------
A8NNK7_BRUMA/1-721RSLRDNSPSNLAALCYKTVD------QITTACN-----------------------------------------------
C5K8E7_PERM5/1-865RNLRDEKPYNMQFLLRRIIE------KLEEVCA-----------------------------------------------
B6JW01_SCHJY/1-778RKTRDLAFENLQTLIILLCH------RIIACSS-----------------------------------------------
YIOC_SCHPO/1-796TKVKDNAPENLQTIIAVLWD------KLEDLQK-----------------------------------------------
Q2GWB4_CHAGB/1-825RRTRDNALENLESLIQAVTN------RLFMLRH-----------------------------------------------
Q0UAJ2_PHANO/1-733RRTRDNNLANLETLILAVTS------RLNVLRN-----------------------------------------------
B8M9N3_TALSN/1-838RRVRDSSLANLETLLLAICS------RLIVLKN-----------------------------------------------
C5FVH3_ARTOC/1-827RRTRDTSLSNLETLLLAICS------RLVALRH-----------------------------------------------
C0NTS7_AJECG/1-843RRTRDASIANLETLILAVTS------RLIVLKN-----------------------------------------------
B6HUK2_PENCW/1-841RRTRDHALHNFQTLLLAVTS------RLTVLKN-----------------------------------------------
Q5ASC1_EMENI/1-732RRTRDHALGNFETLLLSITS------RLTTLKN-----------------------------------------------

PF09742

F4WRP0_ACREC/1-730RVLREEAPSNLATLCYKAVE......KLVKAVD.......................SSC.....................
E9H938_DAPPU/1-832RVLREECPSNLATLCYKAVE......RLVSAAD.......................SSC.....................
T1JUN4_TETUR/1-644LLSHNLNSNNLGSLVKIFIS......KSAALKDELN............................................
J9F5Y0_WUCBA/1-661LMYNTPTTCNFASFIHVLLR......RTAELKA...............................................
B4JW54_DROGR/1-859RQIRNDNPANLATLCYKAVE......KLAQAVD.......................SSC.....................
I1EYR3_AMPQE/506-1206LVAHNPKSGNVLSLVKVCMR......KASKLRD...............................................
E0VAE1_PEDHC/1-723LLKNNLESGNFVSLIRVFIN......KSTDVLS...............................................
C1FEV8_MICSR/1-964..FGSIAPGTLDALLER.........AAAALRR........................CS.....................
G1MRD7_MELGA/1-648LVEKNPRTGNLGSLIKVFLS......RTKELKI...............................................
D6WWB7_TRICA/1-769RALREDAPSNLATLCYKAVE......KLVKAVD.......................SSC.....................
H3BX91_TETNG/1-768RAVREESPSNLATLCYKAVE......KLVQVAD.......................SGC.....................
F7D5K7_XENTR/1-770RAVREESPSNLATLCYKAVE......KLVAGAD.......................NGC.....................
H2SJN1_TAKRU/1-774RAVREESPSNLATLCYKAVE......KLVQGAD.......................SGC.....................
B3RQA8_TRIAD/1-734RTLRDEAPSNLATLSIKAVE......KLVAASM.......................TAC.....................
I3JLL2_ORENI/1-646LIENNPRTGNFGALVRIFLG......RTKELKI...............................................
G7DXH4_MIXOS/12-858RTALRDQPSNVKTLISVLGG......KLLQILSEPGFPAPTQASLAAGLTAAWGGGTAE.....................
U1M0X7_ASCSU/1-660LMYNTQTTGNFAAFIRVFLR......RAAEVKA...............................................
H2XV68_CIOIN/1-762RALREESPSNLATLCYKAVE......KLVQASD.......................SGC.....................
Q5ZBZ3_ORYSJ/1-682FAQNNYHTKHLAKILIHLVW......CLQECMA...............................................
D0NH97_PHYIT/1-769LAQNSLQSGNFRVLLRFVIHELPFSCRVAKMTE........................SE.....................
T1FYR2_HELRO/1-642FAINNCRTGNFGSLIRVFLM......RANELST...............................................
Q4DJF1_TRYCC/1-725RVMRHYYTRNFALLLFKCIE......VVSQIRN.......................ASL.....................
I3KNU8_ORENI/1-782RAVREESPSNLATLCYKAVE......RLVRGAD.......................SGC.....................
I3JCX3_ORENI/1-776RAVREESPSNLATLCYKAVE......KLVQGAE.......................SGC.....................
Q01H67_OSTTA/38-724LYAKNARSGGLYKLVRH.........AATQIGA........................AG.....................
Q38FE7_TRYB2/1-706LMPANAQASQVQWVVRFCLK......QVEHASC...............................................
Q8RWV1_ARATH/1-679FAQSNGYTRHLAKLLIHLSW......CLQELLQ...............................................
I1MHZ5_SOYBN/1-671LVENNHNTRHLAKILFHLAC......YLQESMS...............................................
B0WBZ3_CULQU/1-681FIAHNLSSGNFGSLFNVFLV......KVSELLA...............................................
F0Y4A0_AURAN/723-1436RQLKRERPENVVTLFTQAVA......QLCQIVH.......................TPV.....................
D7T740_VITVI/12-678FAQNNYYTRHLAKILIHLGQ......CLQECIS...............................................
E1ZEP5_CHLVA/1-748LVYNNAHTLNLQRFIYLVVQ......QLRRTRHHPGGG..........................................
M4BPB3_HYAAE/1-729RMLRHQQPTNLATMLSQAVA......QLVQLVE.......................TPV.....................
Q5CRW2_CRYPI/1-755LFVRNATSGNFRSLTLFFIE......ILLEKERELYISIESNRFQYDRLITSINHLIGLGIVIKFIIIHYLKNFGIDELI
A0A087VXA6_ECHMU/1-876RTLREESPGNLATLCYKAVE......RLAQLAE.......................TSF.....................
DYM_DROME/1-676FIGNNLKTGNFGSLVTVFLE......KTSELLS...............................................
H0VNU2_CAVPO/1-646LVENNPRTGNLAALIKVFLA......RTKELKL...............................................
E9ICM4_SOLIN/1-654LLVNNLVTGNFGTLIQIALI......RINELLA...............................................
L9KZV5_TUPCH/1-826RAVREESPSNLATLCYKAVE......KLVQGAD.......................SGC.....................
E9G1Z8_DAPPU/1-633LESNNQATRNTSALLRVFLS......RATELKA...............................................
D7FT96_ECTSI/1-808RKLKVARPGNVEALLRMAVS......HLEKVVD.......................DPD.....................
H2MFX7_ORYLA/1-772RAVREESPSNLATLCFKAVE......RLVQAAD.......................SGC.....................
B7S488_PHATC/1-694RKLRDDRFENLATLFTQAVA......QLCQIVE.......................TPY.....................
W1NV48_AMBTC/1-680LAQNNYYTRHLAKILIHLVW......CLQELAS...............................................
B6A9V3_CRYMR/1-794LFETNKSSGNLRRLTLFFTK......LLSSSRKDILMNLEKDMSSLLPCPSTYSTLISTALLLRSIIRHYTQKFSLSNLL
H2KSV6_CLOSI/110-1035RALREESPNNLATLSYKAVE......KLSRIAE.......................ASF.....................
M4AQZ4_XIPMA/1-781RAVREESPSNLATLCYKAVE......RLVQCAD.......................SGC.....................
E0VG76_PEDHC/1-766RAVREEAPANLATLCYKAVE......KLVKAVD.......................SSC.....................
B4MQL1_DROWI/1-832RQIRNENPANLATLCYKAVE......KLAQAVD.......................SSC.....................
HID1_DICDI/1-880KKLKNERPENLATFIKKLVN......QLVLVKG...............................................
W4XTN1_STRPU/1-721RALREESPSNLATLCYKAVE......KLVSAAE.......................SGC.....................
T1K251_TETUR/1-842RALREESPSNLATLVYKGVE......KLVSSTD.......................TLC.....................
T1I7V2_RHOPR/1-802RALREEAPSNLATLCYKAVE......KMVRAVD.......................NSC.....................
Q7QGJ8_ANOGA/1-825RKVRDVMPTNLATLCYKATE......RMVRAVD.......................NSC.....................
A0A068YEV3_ECHMU/1-732FYRNDLRTHNLATLLQQFIV......KGTSVL..........................G.....................
J9KB63_ACYPI/1-736RLLREDVPANLATLCYKAVE......KFVKAVE.......................NSC.....................
Q17L03_AEDAE/1-819RKVRDVMPANLATLCYKATE......RLVRAVD.......................NSC.....................
W4Z6Q3_STRPU/1-667LAHSNLHSGNLCALVRVFNK......RAMQLKV...............................................
W5JW75_ANODA/1-876RKVRDVMPSNLATLCYKATE......RMVRAVD.......................NSC.....................
DYM_XENTR/1-646LIENNPRTGNLGALIRVFLS......RTKELKI...............................................
A8WTE9_CAEBR/1-690LMYNTQTTGNFAAFIRLFLR......RATELKT...............................................
M4C137_HYAAE/1-768FARNSVYSGNFHVLVRDVIHTLPLSCRVATMTE........................SE.....................
B9HUR0_POPTR/1-672FAQNNCNTRHLTKILIHLSW......CLQECVS...............................................
F6TGV4_CIOIN/1-683LVDHNQHTGNFTSLLKVFLS......RFSELKS...............................................
H3AL71_LATCH/1-849RAVREESPSNLATLCYKAVE......KLVQGAE.......................SGC.....................

PF12722

C4XYD9_CLAL4/17-927------------------D...............LSPTQHMPLLNCLRL--L--------AKVLPYL-------------
A3LX71_PICST/1-905------------------DSEFPS.........SKSPLSIRQLLTCIRL--L--------VKLIPFL-------------
Q6BSE0_DEBHA/1-924------------------HENFPS.........KDAPVS..ELLNCIRF--L--------TKLLPFV-------------
C3Z701_BRAFL/1-784------------------SSCA...........TAKEQQ..TVLNCVRL--L--------TRILPYI-------------
Q0E9B5_DROME/1-834------------------SSCR...........TQAEQQ..CVLNCVRL--L--------VRCLPYI-------------
B0WUT2_CULQU/1-851------------------NSCR...........TQGEQQ..TVLNCVRL--L--------NRVLPYI-------------
A7RKV1_NEMVE/1-693------------------.......................SRVFCVRL--L--------TRFIPYI-------------
A8WRZ4_CAEBR/1-727------------------HP.............ANIDQK..KVINAIRL--L--------TRITPYM-------------
A8NNK7_BRUMA/1-721------------------SP.............SAISST..KVLNCIRL--L--------TRVCPYL-------------
C5K8E7_PERM5/1-865------------------TGLVQSEEDEGSHELTQGQRS..EALQCVRL--L--------TRIAPFL-------------
B6JW01_SCHJY/1-778------------------DPNLVEP........SNVLVT..QLLNAVRI--L--------TRVLPVV-------------
YIOC_SCHPO/1-796------------------ETLFDDP........AAPTTK..CALNCMRL--L--------TRLMPII-------------
Q2GWB4_CHAGB/1-825------------------HPSFPDP........EIAPDR..EALNCLRV--L--------TRVLPFI-------------
Q0UAJ2_PHANO/1-733------------------HPSFPDP........ELAPER..DALNCIRV--L--------TRLLPFL-------------
B8M9N3_TALSN/1-838------------------HPSFPDP........EFAPDT..NALNCIRI--L--------TRILPFV-------------
C5FVH3_ARTOC/1-827------------------HPSFPDP........EIAPAK..DALNCIRI--L--------TRLLPYI-------------
C0NTS7_AJECG/1-843------------------HPSFPDP........DLAPDR..DALNCIRV--L--------TRILPFI-------------
B6HUK2_PENCW/1-841------------------HPSFPDP........DLAPER..DVLNCIRI--L--------TRLLPYV-------------
Q5ASC1_EMENI/1-732------------------HPSFPDP........DLAPDR..DALNCIRI--L--------TRLLPYI-------------

PF09742

F4WRP0_ACREC/1-730...............RTQREHQI...................VLNCCRL..L........TRLLPYI.............
E9H938_DAPPU/1-832...............ATQQEHST...................VINCVRI..L........TRLLPYI.............
T1JUN4_TETUR/1-644...............KEASQ................NIIICQTFNSMFV..I........RCCAKHL.............
J9F5Y0_WUCBA/1-661...............SEIYN.........N......TIFLWQTGNALIV..L........RYICKFL.............
B4JW54_DROGR/1-859...............RTQADQQC...................VLNCVRL..L........VRILPYI.............
I1EYR3_AMPQE/506-1206...............ESKCE...............SNMATLQLRNSLFI..L........RCISHHV.............
E0VAE1_PEDHC/1-723...............ASSTG.........N......EILVWQTYNALFI..I........RCFTRYL.............
C1FEV8_MICSR/1-964...............RSDVAGSNPSRGDVANEDRA.DDAWTAAINATTL..ATRALRRCSRDTLRFL.............
G1MRD7_MELGA/1-648...............SAECQ.........N......HLFIWQAHNALFI..I........CCLLKVF.............
D6WWB7_TRICA/1-769...............RTQHEQQT...................VLNCARL..L........TRILPYI.............
H3BX91_TETNG/1-768...............STEKQCHM...................VLNCTRL..L........TRILPYI.............
F7D5K7_XENTR/1-770...............HSDKQKQV...................VLNCARL..L........TRVLPYI.............
H2SJN1_TAKRU/1-774...............SSEKQRQT...................VLNCTRL..L........TRILPYI.............
B3RQA8_TRIAD/1-734...............STPKEQTTGKKYITKALSILIHRLLIYILNCCRL..L........TRILPYI.............
I3JLL2_ORENI/1-646...............STECQ.........D......QLFIWQAHNALFM..I........RCLLKVF.............
G7DXH4_MIXOS/12-858...............PSDTRQ.....................LLNCVRV..L........TRVLPFVWEGQALPNAAGES
U1M0X7_ASCSU/1-660...............SEICQ.........N......TIFLWQTANALII..L........RYICKFL.............
H2XV68_CIOIN/1-762...............HTDREQHI...................VLNCCRL..L........TRILPYI.............
Q5ZBZ3_ORYSJ/1-682...............ESS..................HAAYRKAINAAYI..S........SIFLKFI.............
D0NH97_PHYIT/1-769...............LAAYAPGVVGLDPLNGKPQTVDTHLHRALNALFL..V........RQFAMRF.............
T1FYR2_HELRO/1-642...............SALCK.........D......DLFTWQTCNALFI..I........RIVCKYF.............
Q4DJF1_TRYCC/1-725...............ESASDVQSASQG...............LQNALCL..M........RRIIPIA.............
I3KNU8_ORENI/1-782...............PSEKERQT...................VLNCTRL..L........TRILPYI.............
I3JCX3_ORENI/1-776...............PSEKEKQV...................VLNCCRI..L........TRILPYI.............
Q01H67_OSTTA/38-724...............AHATP....................VSAINVTVL..A........GTFIKYF.............
Q38FE7_TRYB2/1-706......................................NYSQGVSDIFLTTV.........RAVQFV.............
Q8RWV1_ARATH/1-679...............ASDDQ................SSLYKKAVNATYI..S........SVFLKYL.............
I1MHZ5_SOYBN/1-671...............TSGVP................QLVYEKAVNAVYF..T........SVFLKHL.............
B0WBZ3_CULQU/1-681...............LSDAE.........S......TVHIWQAFNALFI..I........RCLVKYM.............
F0Y4A0_AURAN/723-1436...............PMYFGQ.....................ASNCLRI..L........TRLLPFL.............
D7T740_VITVI/12-678...............TSGVP................STVYTKAVNAVYI..S........SVFLKYL.............
E1ZEP5_CHLVA/1-748...............STATA........................NAVYC..L........RTIVKDL.............
M4BPB3_HYAAE/1-729...............PKYYQQ.....................ALNCVRV..L........TRLVPFI.............
Q5CRW2_CRYPI/1-755KSAEHTQYINFVNDSNFTSEQLSELEKFILFKYNEVEGNNSSKLNLIKY..V........SKSSKFL.............
A0A087VXA6_ECHMU/1-876...............LTTQDQQI...................AINCVRL..L........TRIIPYI.............
DYM_DROME/1-676...............LSDQE.........S......NMHVWQTFNALFI..I........RSLVKYI.............
H0VNU2_CAVPO/1-646...............SAECQ.........N......HLFIWQTHNALFI..I........CCLLKIF.............
E9ICM4_SOLIN/1-654...............PVQNQ.........N......IISAWQTYNALFA..V........RCILKYL.............
L9KZV5_TUPCH/1-826...............HSEKERQM...................VLNCSRL..L........TRVLPYI.............
E9G1Z8_DAPPU/1-633...............SAQCD................KIFIWQTCNALFI..V........RVIFSHW.............
D7FT96_ECTSI/1-808...............PFVLKS.....................AMTAVSV..L........TRVLPFI.............
H2MFX7_ORYLA/1-772...............PSEKERRI...................VVNCTRL..L........TRILPYI.............
B7S488_PHATC/1-694...............NIYFDQ.....................ALNCVRV..L........TRMLPFL.............
W1NV48_AMBTC/1-680...............AAAVP................SILYAKAVNAAHL..S........SIFLKYL.............
B6A9V3_CRYMR/1-794LQIEHDYLNFDNESLDTGSINSQGTCPISKYLDKDFFDIYRTELKTLDLNYY........KRFILFI.............
H2KSV6_CLOSI/110-1035...............PTAKDQQT...................ALNCIRL..L........TRLFPYI.............
M4AQZ4_XIPMA/1-781...............PSEKERQI...................VLNCTRL..L........TRILPYI.............
E0VG76_PEDHC/1-766...............RTQHEQQT...................VLNCVRL..L........TRILPYI.............
B4MQL1_DROWI/1-832...............RTQTEQQS...................VLNCVRL..L........TRCLPYI.............
HID1_DICDI/1-880................LQRETNTPGDF...............QLTSISLSYL........SRILPIV.............
W4XTN1_STRPU/1-721...............SAPRDQQV...................VLNAARL..L........TRILPYI.............
T1K251_TETUR/1-842...............NSTNQQTL...................VLNSTRL..L........TRILPYI.............
T1I7V2_RHOPR/1-802...............RTQQEQQT...................VLNCARL..L........TRVLPYI.............
Q7QGJ8_ANOGA/1-825...............RTQGEQQT...................VLNCVRL..L........TRILPYV.............
A0A068YEV3_ECHMU/1-732...............SIKMG.........QEIN...ALDIKMARNALLI..F........RIFTKYI.............
J9KB63_ACYPI/1-736...............RTQQDQNT...................VLNCSRL..L........TRVLPYV.............
Q17L03_AEDAE/1-819...............RTQGEQQT...................VLNCVRL..L........NRILPYI.............
W4Z6Q3_STRPU/1-667...............SAQNE.........D......HVFTWQTYNALFI..I........RRSMKYF.............
W5JW75_ANODA/1-876...............RTQAEQQT...................VLNCVRL..L........TRILPYI.............
DYM_XENTR/1-646...............SAECQ.........N......QLFIWQAHNALFI..I........CRLIKVF.............
A8WTE9_CAEBR/1-690...............SEQCE.........NENSCFSKIYLWQTSNALLI..L........RYIARFL.............
M4C137_HYAAE/1-768...............VAALGLETAGLDPVDSKLQTVEKDLYRAVNTLFL..V........RQFTMRF.............
B9HUR0_POPTR/1-672...............NSGAP................SEVYEKAVNAVYI..S........SVFLKYL.............
F6TGV4_CIOIN/1-683...............SAECD.........D......QLFIWQSRNAMFV..I........QHLCKFL.............
H3AL71_LATCH/1-849...............PTEKEKQI...................VLNCTRL..L........TRILPYI.............

PF12722

C4XYD9_CLAL4/17-927--------------------------------------------------------------------------------
A3LX71_PICST/1-905--------------------------------------------------------------------------------
Q6BSE0_DEBHA/1-924--------------------------------------------------------------------------------
C3Z701_BRAFL/1-784--------------------------------------------------------------------------------
Q0E9B5_DROME/1-834--------------------------------------------------------------------------------
B0WUT2_CULQU/1-851--------------------------------------------------------------------------------
A7RKV1_NEMVE/1-693--------------------------------------------------------------------------------
A8WRZ4_CAEBR/1-727--------------------------------------------------------------------------------
A8NNK7_BRUMA/1-721--------------------------------------------------------------------------------
C5K8E7_PERM5/1-865--------------------------------------------------------------------------------
B6JW01_SCHJY/1-778--------------------------------------------------------------------------------
YIOC_SCHPO/1-796--------------------------------------------------------------------------------
Q2GWB4_CHAGB/1-825--------------------------------------------------------------------------------
Q0UAJ2_PHANO/1-733--------------------------------------------------------------------------------
B8M9N3_TALSN/1-838--------------------------------------------------------------------------------
C5FVH3_ARTOC/1-827--------------------------------------------------------------------------------
C0NTS7_AJECG/1-843--------------------------------------------------------------------------------
B6HUK2_PENCW/1-841--------------------------------------------------------------------------------
Q5ASC1_EMENI/1-732--------------------------------------------------------------------------------

PF09742

F4WRP0_ACREC/1-730.........FE..........DPDWKGFFW.........................................SS.......
E9H938_DAPPU/1-832.........FE..........DPDWRSFFW.........................................SS.......
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859.........FE..........DDKWRDFFW.........................................SS.......
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769.........FE..........DPEWRGFFW.........................................SS.......
H3BX91_TETNG/1-768.........FE..........DADWRGFFW.........................................ST.......
F7D5K7_XENTR/1-770.........FE..........DPDWRGFFW.........................................SS.......
H2SJN1_TAKRU/1-774.........FE..........DADWRGFFW.........................................ST.......
B3RQA8_TRIAD/1-734.........FE..........DSDWRGFFW.........................................SS.......
I3JLL2_ORENI/1-646................................................................................
G7DXH4_MIXOS/12-858ESSPADVEEFE..........DA....IFWRATRIAQAQSSKQHLDGSARDDNHFVLGADEDEEGEQDPLNSS.......
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762.........FE..........DPDWQGFFW.........................................TS.......
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725.........MEGGDTPCAAE.EPEKRG.....................................................
I3KNU8_ORENI/1-782.........FE..........DADWRGFFW.........................................ST.......
I3JCX3_ORENI/1-776.........FE..........DQDWRGFFW.........................................ST.......
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436.........LEDGG.......DDFCEQLCWGVE...............................................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729.........LEEGG.......DDFVQELFWHVKEDGEKG.........................................
Q5CRW2_CRYPI/1-755................................................................................
A0A087VXA6_ECHMU/1-876.........FE..........VPEWRPFFW.........................................SV.......
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826.........FE..........DPDWRGFFW.........................................ST.......
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808.........LEAYTDPETGEVDPALHSMFWSAEE..............................................
H2MFX7_ORYLA/1-772.........FE..........DADWRGFFW.........................................ST.......
B7S488_PHATC/1-694.........LEKGTQSNIYIGLVTSDE.....................................................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035.........FE..........DPEWRSFFW.........................................SA.......
M4AQZ4_XIPMA/1-781.........FE..........DADWRGFFW.........................................ST.......
E0VG76_PEDHC/1-766.........FE..........DPDWRGFFW.........................................SS.......
B4MQL1_DROWI/1-832.........FE..........DEKWREFFW.........................................SS.......
HID1_DICDI/1-880.........FESG........DDFADKVFWLNEGIEPLSHPSAKI..........................STPPSITTT
W4XTN1_STRPU/1-721.........FE..........DPDWRGFFW.........................................ST.......
T1K251_TETUR/1-842.........FE..........DPEWKGFFW.........................................YT.......
T1I7V2_RHOPR/1-802.........FE..........DPEWRGFFW.........................................TS.......
Q7QGJ8_ANOGA/1-825.........FE..........DVQWKDFFW.........................................SS.......
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736.........FE..........EPDWENIFW.........................................SS.......
Q17L03_AEDAE/1-819.........FE..........DPQWKDFFW.........................................SS.......
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876.........FE..........DAQWKDFFW.........................................SS.......
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849.........FE..........DADWRGFFW.........................................ST.......

PF12722

C4XYD9_CLAL4/17-927-------FELPDYA---------------ETIEN..PLFWERNFNPRDFFNQPAAPALVLPRNS................
A3LX71_PICST/1-905-------YEIPEYT---------------QEIEP..RLFWVENFDPLVFIKPSTFASLSSSTSQPC..............
Q6BSE0_DEBHA/1-924-------FELPEYC---------------SELDD..ILFWSETFDPMTVATGSSLNNIQTPVSVLGGEKENEKT......
C3Z701_BRAFL/1-784-------FE....D---------------ADWRG...FFWSTLPG...................................
Q0E9B5_DROME/1-834-------FE....D---------------EKWRD...FFWSSLPS...................................
B0WUT2_CULQU/1-851-------FE....D---------------AQWKD...FFWSSLPAGN.................................
A7RKV1_NEMVE/1-693-------FE....D---------------PDWRG...FFWSTIP....................................
A8WRZ4_CAEBR/1-727-------LE....D---------------AEWRG...YFWSPIPH...................................
A8NNK7_BRUMA/1-721-------FE....D---------------SDWKC...FFWS.LPSAE.................................
C5K8E7_PERM5/1-865-------LE....D---------------VDAENCLALLWHSGGLVVRNRG..ESVVVEPASPSVEEAAGDDGSSVTSSV
B6JW01_SCHJY/1-778-------FE.TEIG---------------SSWIE..SVFWTINDKNKR................................
YIOC_SCHPO/1-796-------FE.DKSM---------------LEWFD..YFAWTVPKDPNINT..............................
Q2GWB4_CHAGB/1-825-------YE.KESL---------------QQWED..QLFWSPRRKPTRKSS.IANEVLFDGGQDVQPKPP..........
Q0UAJ2_PHANO/1-733-------YE.EDRL---------------EQWED..DFFWATRRKRSRRGQ.VRSEVIFDEADPEQTPTQQ.........
B8M9N3_TALSN/1-838-------YE.ADHL---------------EEWEE..QFFWAPRKKKTRQAQ.VASEVLFDEAQGETDNAQTQPR......
C5FVH3_ARTOC/1-827-------YE.TDNL---------------EEWED..EFFWRRRRKLSRKAQ.LSSRVLFDESRHEDDEEEGNGQTGRRGV
C0NTS7_AJECG/1-843-------YE.SENL---------------EAWEE..KFFWGRRRKKHRHAQ.IASQVLFDGASEDDEMRRSNPQD.....
B6HUK2_PENCW/1-841-------YE.AEHL---------------EQWED..NFFWARRKRRTRQSQ.IAGEVLFDEAQPEDNQEATSPR......
Q5ASC1_EMENI/1-732-------YE.AEHL---------------EQWEE..KFFWTRRKKKTREAQ.LAADVLFDESQVEEVRDRASPR......

PF09742

F4WRP0_ACREC/1-730.......LPGKDDEE.................................................................
E9H938_DAPPU/1-832.......LPSSSKQQFKDDG.........................................................ENP
T1JUN4_TETUR/1-644.......VQTLTEE...................NVLKHFLARKDGKE.................................
J9F5Y0_WUCBA/1-661.......VQRLSET...................EFIKVFHMDKTYLE........................KKDAYDSDF
B4JW54_DROGR/1-859.......LPA...................................................................QEH
I1EYR3_AMPQE/506-1206.......LQSHSEE...................ALLNMFDPPPPQSS..............................RGS
E0VAE1_PEDHC/1-723.......VETVKEA...................EYIRHFNVKPMMVS........................QTVAEQQLD
C1FEV8_MICSR/1-964.......CRRRRQ.........................................................IANDDDDAPD
G1MRD7_MELGA/1-648.......ISRMSEE...................ELQLHFTYEDKTPG.................................
D6WWB7_TRICA/1-769.......LPSQGEDE..............................................................DE.
H3BX91_TETNG/1-768.......VPGAGRAR..............................................SFGEDEGE........DE.
F7D5K7_XENTR/1-770.......VPGAGRSQ..............................................................EDE
H2SJN1_TAKRU/1-774.......VPGAGRAG..................................................DDGE........DE.
B3RQA8_TRIAD/1-734.......VPANTDG..................................................................
I3JLL2_ORENI/1-646.......IREMSEA...................ELHQQFSYQERAPG.................................
G7DXH4_MIXOS/12-858.......KPSSPTS...............................................................SRK
U1M0X7_ASCSU/1-660.......TQRLSEA...................EFVKVFDKKLLTNS..........................KEDESDG
H2XV68_CIOIN/1-762.......LPTNS.................................................................NET
Q5ZBZ3_ORYSJ/1-682.......IENAKTD...................................................NWQELSLEIDKDEKG
D0NH97_PHYIT/1-769.......VERTDEC...................PLLAHFNHKPTTEPRRSNAV...AATMRQSLSIQMEDDRADNKRNAD
T1FYR2_HELRO/1-642.......IENLTEE...................VVVQQFETINYTEG.................................
Q4DJF1_TRYCC/1-725.......APASNPPVEGANLPAGEAKDEKKRTLFTATFVRSFFEENLACN...........................DAQ
I3KNU8_ORENI/1-782.......IPG..RAG..............................................HLDHDAD.........DE.
I3JCX3_ORENI/1-776.......VPGAGRAG..............................................................TDE
Q01H67_OSTTA/38-724.......IEFASESGGTTVGVQALGGARSESLRNLAKTFEYDARWES..............................VTA
Q38FE7_TRYB2/1-706.......VRHACET.................................SRGDASRLLWTIGEDLGESVHGALRVSTTGDSD
Q8RWV1_ARATH/1-679.......IENGKSD...................................................SLQELHLSLDESEPV
I1MHZ5_SOYBN/1-671.......IESAPDG....................................................DVELYLSLHDSESI
B0WBZ3_CULQU/1-681.......IETGSEY...................QLLQHFEALPVQQD.............DADVEQGSEAVTVAVTGETR
F0Y4A0_AURAN/723-1436.......EPEEGRG...............................................................EGG
D7T740_VITVI/12-678.......IENAKSE...................................................NIEELHLSLDESEVI
E1ZEP5_CHLVA/1-748.......MEQLNSE...................QLLAFVEVPPDVAAAAVEQQAAAAQGEQPSPAPSPQPSPQDGAPGGG
M4BPB3_HYAAE/1-729.......EEKEEEAEEV............................................................EEK
Q5CRW2_CRYPI/1-755...........................................................................KENEH
A0A087VXA6_ECHMU/1-876.......LPAQ..................................................................PDP
DYM_DROME/1-676.......NETGSEF...................QLLQHFEAMPNAEL.....LQAALEQQQQTPAESATIAMEATEQSAA
H0VNU2_CAVPO/1-646.......ICEMSEE...................ELQLHFTYEDKSPG.................................
E9ICM4_SOLIN/1-654.......IEIVGEE...................QMLNHIEAPQTTNE.................................
L9KZV5_TUPCH/1-826.......VPGAGRGGGSGPGRGWRVAGASVAGTGTLWSRPHPSRPLLGFGKLSGGERGLPLSGQGEEDD........ES.
E9G1Z8_DAPPU/1-633.......IRLEKEA...................VLIKKFSFQEENSC.................................
D7FT96_ECTSI/1-808.......EPPSTAATATRDGAGAGAGTGE................................................QQQ
H2MFX7_ORYLA/1-772.......IPGASRGG..............................................CLDEDVDE........NE.
B7S488_PHATC/1-694................................................................................
W1NV48_AMBTC/1-680.......IENAKSD...................................................NFDELHLCLDESEAA
B6A9V3_CRYMR/1-794.......LSNISDR...............................................................DPF
H2KSV6_CLOSI/110-1035.......LPLEPDSAVD............................................................DE.
M4AQZ4_XIPMA/1-781.......IPGTKKSG..............................................SLDEGADE........NE.
E0VG76_PEDHC/1-766.......LPTGSSQDD.............................................................EE.
B4MQL1_DROWI/1-832.......LPSTQEK..................................................................
HID1_DICDI/1-880KTTEIIEEQEKKDQENKQVEENKENEEKKDEEKKDEEKKDEEKKDEDKKENKTTTTTTTTNTTNNTNNN........NNS
W4XTN1_STRPU/1-721.......LPGQSSD...............................................................EE.
T1K251_TETUR/1-842.......FSFASR................................................................DD.
T1I7V2_RHOPR/1-802.......LPDNSGERN.............................................................EE.
Q7QGJ8_ANOGA/1-825.......LPSGSGGSSEK...........................................................EEP
A0A068YEV3_ECHMU/1-732.......LEHRSSH...................SMNLHFADITSKAS.................................
J9KB63_ACYPI/1-736.......LPAGKGDP.................................................................
Q17L03_AEDAE/1-819.......LPSGNEKE..............................................................DN.
W4Z6Q3_STRPU/1-667.......LEMLSEG...................RILQQLSVLVRTKP......................SSTVLNVEDVM
W5JW75_ANODA/1-876.......LPSNSAGEKE............................................................ENG
DYM_XENTR/1-646.......TSQISEE...................ELLLHFTYRPADPG.................................
A8WTE9_CAEBR/1-690.......TQRMTEK...................EFVRIFAKNQENER....TESSSTSSSDDEDDDDAQQTEGSDNNNGE
M4C137_HYAAE/1-768.......VERTDKS...................PLLDHF......IPRLTEDVDGYQATSQQG.................
B9HUR0_POPTR/1-672.......IENAQSN...................................................SIEEFHLSLNESEPA
F6TGV4_CIOIN/1-683.......AENTTEM...................KMMEQFGARSLVER..........................QKDLTSG
H3AL71_LATCH/1-849.......VPGAGRGG.................................................GDEED........EN.

PF12722

C4XYD9_CLAL4/17-927.SFADVSENVLGAD-----LVLALVRLLV-AQGFTVAEP...........YPESPP---------------DMCLWEPGI
A3LX71_PICST/1-905.LTKESIHNVTAVQ-----LMRALVDLLF-IRTFTIDAP...........RSKSNK---------------ILSVWEPGI
Q6BSE0_DEBHA/1-924....VNKENILGVN-----IVKCLVDLLF-IRSFTMDVPI......GDEGRSGSKR---------------MMSVWEPGI
C3Z701_BRAFL/1-784.QAEDGGSMPLAQS-----LLNALSDLLF-CPDFTVAPNKKAGPETHEDLQSIDSC---------------EY.IWESGV
Q0E9B5_DROME/1-834....QDKTMPLAQS-----LLNATCDLLF-CPDFTVTATRRAGPEKAEELANIDSC---------------EY.IWEAGV
B0WUT2_CULQU/1-851.EKEEPTAAPLAQS-----LLNAICDLLF-CPDFTVVGLRKSGPEKAEELNSIDSC---------------EY.IWEAGV
A7RKV1_NEMVE/1-693.SQEPEGQTPLAQT-----LLDALADLCF-CPEFTVHPNKKAGPEQHEDLSSIDSC---------------EY.IWEAGV
A8WRZ4_CAEBR/1-727....GDSTKPLAAV-----LLENLSDLLF-CPEFTISHSN...GLKVNDLSTIDSC---------------EY.IWEAGV
A8NNK7_BRUMA/1-721.ENEQFPHQPLAYT-----LISALTDLLF-CPEFTVSSLR.NHPGGSDDLSTIDSC---------------EY.IWEAGV
C5K8E7_PERM5/1-865EDVADLGRAPLMYR-----MLRALQWSLF-LKDFTVLIPQ....GASLPLPTHRVD---------------SRFVWRGGI
B6JW01_SCHJY/1-778.........ALGEQ-----VMDSLLYLLF-YVGFTIPAVD..........YKSKGV---------------QLCIWETGV
YIOC_SCHPO/1-796.........PRGAS-----FLNTVVDYLF-LINFTIPAHN..........DLTHGV---------------HYCIWETGV
Q2GWB4_CHAGB/1-825.VEEFEDAKPLAEE-----LIDTLLDLLF-FSDLTVPKAP..........HGKPKV---------------TYAIWQSGV
Q0UAJ2_PHANO/1-733.EPEFETAKPLAEE-----VIDTLIDLLF-FSEFTLPKVP..........AGKNKV---------------TYAIWQSGV
B8M9N3_TALSN/1-838.VDGREDAKPLAEE-----LIDTLTDLLF-YTGFTIPKLA..........SSEGKV---------------SYAIWQSGV
C5FVH3_ARTOC/1-827AREDYEDVKPLAEE-----LLDTLLDLLF-FSGFTIPQVP..........ASKGKV---------------VYSIWQSGV
C0NTS7_AJECG/1-843HQNDYYDAKPLAEE-----LIDTLVDLLF-YSGFTIPTIP..........NAKGKV---------------SYSIWQSGV
B6HUK2_PENCW/1-841.AEDYEDVKPLAEE-----LIDTLVDLLF-FADFTIPRLP..........TVKSKV---------------SFSIWQSGV
Q5ASC1_EMENI/1-732.VNEYEDVKPLAEE-----LIDTLMDLLF-YTGFTIPKLP..........SAKAKV---------------SYSIWQSGV

PF09742

F4WRP0_ACREC/1-730......SLP.LAHS.....LLNALCDLLF.CPDFTVA....AN.RKSGP.....DKADELQSIDS......CEYIWEAGV
E9H938_DAPPU/1-832EGHAEESVP.LAQS.....LLNALCDLLF.CPDFTVY....SS.KKFGP.....DKHEDLHSIDS......CEFIWEAGV
T1JUN4_TETUR/1-644...GNETGVEVMES.....LINNLVSVLV.....DIPL..........................................
J9F5Y0_WUCBA/1-661EEEFDGLCENKAEE.....LLDTLVDILV.....DLPS..........................................
B4JW54_DROGR/1-859ATNPGQTVP.LAQS.....LLNAICDLLF.CPDFTVQ.....GTRRAGP.....EKAEELANIDS......CEYIWEAGV
I1EYR3_AMPQE/506-1206NSTEADDKEGVAIRSGLKILLHGTVMLIG.....GVPLVFITATTKFIIAITLTIIYAVVKAFTSSYPFCEVLLISLIVN
E0VAE1_PEDHC/1-723NLSNKKIHENPLES.....LLESLLEILI.....DVPL..........................................
C1FEV8_MICSR/1-964ESGGVATAEPAVCD.....FMAAVVDVVAGCADERAPR..........................................
G1MRD7_MELGA/1-648SYGSAMEERDVVQS.....LLCCLC..IS.....VISL..........................................
D6WWB7_TRICA/1-769......SVP.LAQS.....LLNAVCDLLF.CPDFTVV....AS.RKSGP.....DKAEELSAIDS......CEYIWEAGV
H3BX91_TETNG/1-768......ARP.LAES.....LLLAIADLLF.CLDFTVH....ST.KKSGP.....DAALDLQSVDS......CEYIWEAGV
F7D5K7_XENTR/1-770EEEEDGSRP.LAES.....LLLAIADLLF.CPEFTVQ....SH.RKSGT.....DTTEDIHTLDS......CEYIWEAGV
H2SJN1_TAKRU/1-774......ARP.LAEL.....LLLAIADLLF.CPDFTVQ....SC.KRNSP.....DTALDTQAIDS......CEYIWEAGV
B3RQA8_TRIAD/1-734......AQP.LAKS.....LLNAILDLLF.CPDFTVP....KH.KKAGP.....ETPDDLPSIDS......CEYIWEAGV
I3JLL2_ORENI/1-646.SCGETGSEDLLEE.....LLSNLVHLIV.....EVPL..........................................
G7DXH4_MIXOS/12-858LQTETLLPP.LGER.....LLAAVVDMLF.FAGLTLP.......RDIVP...........KELKI......SYIIWEAGV
U1M0X7_ASCSU/1-660EQDCEDVYENTAEE.....FLDALVDIIV.....ELPV..........................................
H2XV68_CIOIN/1-762DPNGEPCAP.LAKS.....LILSLSNLLY.CPEFTVA....SHSKKGST.....DKPEDLTSVDS......CEYIWEAGV
Q5ZBZ3_ORYSJ/1-682LENFPSEQS.VEYF.....LMRGVLNYIG.....SVDV..........................................
D0NH97_PHYIT/1-769EVSLEDSSDDLAAR.....FLDALLTALI.....EFPP..........................................
T1FYR2_HELRO/1-642.TNQLEARDALMEE.....FLNRLVYILI.....DVPQ..........................................
Q4DJF1_TRYCC/1-725PEQMLPFLP.GQNTTLSKFVGRLLVDCCF.IRGLTLA.......ASSLP....AKESESHPCVDE.......SLLWYPGV
I3KNU8_ORENI/1-782......GRP.LAES.....LLLAIADLLF.CPDFTIQ....SH.KKNSP.....DTADDIRAIDS......CEYIWEAGV
I3JCX3_ORENI/1-776LDDDEGARP.LAES.....LLLAIADLLF.CPDFTVH....SH..KRGP.....DSVESMQSIDS......CEYIWEAGV
Q01H67_OSTTA/38-724SGASTRARS.PFDD.....LMLACANTLG.....KKRV..........................................
Q38FE7_TRYB2/1-706TVFMNRWLSTGIGK.....LCIALEKFIV.....FVPL..........................................
Q8RWV1_ARATH/1-679PHGFVMDQD.IQNF.....VMHSVLSFIG.....SNEV..........................................
I1MHZ5_SOYBN/1-671PKNILRDQT.IENL.....VMRNVLNFIA.....SIDV..........................................
B0WBZ3_CULQU/1-681TALAKLIDGTKFET.....FLEALVNIIV.....VIPV..........................................
F0Y4A0_AURAN/723-1436EEEDGGAEP.LARL.....IVHAALHLLF.LPAFTVDATAFEGEAEDAP....................VPARALWAPGL
D7T740_VITVI/12-678QNNFPADQN.IENF.....VMHGVLSFIG.....TLDV..........................................
E1ZEP5_CHLVA/1-748TGRGSGGGEPEFSRLHNGSLVQTLVREAMLTLADDKLL..........................................
M4BPB3_HYAAE/1-729EEATGAGES.LAKQ.....MLHAIMGLLF.LPEFTVSIHAYKGYGEERRSATRSGESTTSGVLVF......PSLLWHSGV
Q5CRW2_CRYPI/1-755LLASFEDLS.VFEQ.....IFLNIPSFLV.CSQKYIDQSNSLSEI...................................
A0A087VXA6_ECHMU/1-876NPDTADSVP.LAQT.....LVSSLCDLLF.CPDFTVH....SL.TKSGP.....ENAEDIHTIDS......CEYIWEAGV
DYM_DROME/1-676AAVPVIVDGSKFET.....FIDALVNLIV.....VIPV..........................................
H0VNU2_CAVPO/1-646..SYSSDSEDLLEE.....LLCCLIQLIT.....DIPL..........................................
E9ICM4_SOLIN/1-654..........ALPAYRLAYFIEALIELIT.....DVPL..........................................
L9KZV5_TUPCH/1-826......ARP.LAES.....LLLAIADLLF.CPDFTVQ....SH.RRSTV.....DLAEDVHSLDS......CEYIWEAGV
E9G1Z8_DAPPU/1-633........ESLLEN.....LAVQLVEILV.....DVPL..........................................
D7FT96_ECTSI/1-808QQQQQQQQP.DARVALGSAMVSATMRLLF.TRQLTVDVYSSCESVDADA..............DNPLEIHDPRALWSGGL
H2MFX7_ORYLA/1-772......ARP.LAES.....LLLAVADLLF.CPDFTVQ....SH.KKSGT.....DPAEEIRSIDS......CEYIWEAGV
B7S488_PHATC/1-694......QEP.LALL.....VVHAAMHMLF.LPQFTCDYYEDSSSTVAQRRRERVETKDD............KELKADAGL
W1NV48_AMBTC/1-680PSEIPKGQN.LVNL.....LTRNLFSFIG.....TADI..........................................
B6A9V3_CRYMR/1-794MITHNSDNS.VIGE.....LMIEICCYCI.CSQLYIDKISESNGKNYNM...............................
H2KSV6_CLOSI/110-1035......CVP.LAHS.....LISALCDLLF.CPDFTVH....SI.AKSGP.....EGPEDMHTIDS......CEYIWQAGV
M4AQZ4_XIPMA/1-781......ARP.LAES.....LLLTIADLLF.CPDFTVQ....SH.KKNNP.....DASEEMRSIDS......CEYIWEAGV
E0VG76_PEDHC/1-766......SAP.LAQS.....LINAVCDLLF.CPDFTVI....GN.RKSGP.....DKAEDLSAIDS......CEYIWEAGV
B4MQL1_DROWI/1-832......TMP.LAQS.....LLNAICDLLF.CPDFTVT....SSTRRAGP.....EKAEELANLDS......CEYIWEAGV
HID1_DICDI/1-880DESSFDTTP.LAVK.....LMDSLLDLLF.FPGFTVT.......ESLGLKSPKEASPDAIPVLFS..........WAGGF
W4XTN1_STRPU/1-721......SLP.LAQS.....LLAALSDLLF.CPDFTVV....AA.KKAGP.....EKPEDPQSIDS......CEYIWDAGV
T1K251_TETUR/1-842......NLP.LAQS.....LILALCDLLF.CPDFTVASLPSSRNKSSGPFGSPDCPPEDLQSIDS......CEYIWESGV
T1I7V2_RHOPR/1-802......SSP.LAHS.....LLNAISDLLF.CPDFTVA....S..KKSGP.....DKAEDLQSIDS......CEYIWEAGV
Q7QGJ8_ANOGA/1-825G.....SVP.LAQS.....LLNAICDLLF.CPDFTVV....GY.RKSGP.....EKAEELNSIDS......CEYIWEAGV
A0A068YEV3_ECHMU/1-732.....NSPS.LAEY.....TVHLLFLLVI.....EIIP..........................................
J9KB63_ACYPI/1-736......PIP.LAHS.....LCSAICDLLF.CPDFTVA....SN.RKNGP.....DKAEDLHAVDS......CEYIWEKGV
Q17L03_AEDAE/1-819......ATP.LAQS.....LLNAICDLLF.CPDFTVV....GL.RKSGP.....EKAEELNSIDS......CEYIWEAGV
W4Z6Q3_STRPU/1-667ENGDADGDESLLER.....FIQTLIQLLI.....EVPV..........................................
W5JW75_ANODA/1-876GAGGGAAVP.LAQS.....LLNAICDLLF.CPDFSVV....GY.RKSGP.....EKAEELNSIDS......CEYIWEAGV
DYM_XENTR/1-646..NYESDTENLFEE.....LLFCLIQLIV.....EIPL..........................................
A8WTE9_CAEBR/1-690TKEAQIVFQNTAEE.....FTYELVSILF.....NISV..........................................
M4C137_HYAAE/1-768.VIDGNSTDNLAAR.....FLDALLSVLI.....EFCP..........................................
B9HUR0_POPTR/1-672PNGFKTDQN.IESL.....VMHNVLNFIG.....SVEV..........................................
F6TGV4_CIOIN/1-683SVFEGTENVNYAHE.....LLSALMDIII.....HVPI..........................................
H3AL71_LATCH/1-849......ARP.LAES.....LLLAIADLLF.CPDFTVQ....SH.KKGGP.....ETAEDIHSIDS......CEYIWEAGV

PF12722

C4XYD9_CLAL4/17-927CVPG----KYHSP..NPIHDSNRTEVLRVLLVLA--STTFYEKVSDTV.R-------------------TGSRFLT----
A3LX71_PICST/1-905GTSS----KYLAP..NLIIDSNRAEVLKLLLTLC--SSTFYNTPSEVV.S-------------------AGSKFMT----
Q6BSE0_DEBHA/1-924GTTA----KYQTP..NLIIDSNRMEVLKLMLVLM--TTSVYSVPSQVV.S-------------------NGSKFLT----
C3Z701_BRAFL/1-784GFAH----SPAQ...YPHHDQNRSEILKLLLTCF--SETMYQPPG...DP-------------------LPNQWLT----
Q0E9B5_DROME/1-834GFAQ----SPPH...NAHMERRRTELLKLLLTCF--SEPMYRSPQ..QSE-------------------EPNKWIA----
B0WUT2_CULQU/1-851GFAQ----SPPR...NGHMDARRTELLKLLLTCF--SETMYRVPN..MSD-------------------EPNKWIV----
A7RKV1_NEMVE/1-693GFAT----SPPS...NAQFDCNRAELLKLLLTCF--SEAMYLPPTPENHT-------------------RPNKWLC----
A8WRZ4_CAEBR/1-727GSGN----KPPM...VALHYQNRSEILKLLLTCF--SEVIYAPV...SDE-------------------NRLRWIC----
A8NNK7_BRUMA/1-721GFAT----KPPQ...VAEHDQRRTEILKLLLTCF--SEVIYVSI...SDE-------------------NRMRWIA----
C5K8E7_PERM5/1-865GTAK----ELPV.NQNNEIMSARCEVLKCLLTVL--SEPLFQPISS.YSS-------------------NPSRVLL----
B6JW01_SCHJY/1-778GCNT----LLTS...KHSYEQNKIEILLLLLVLF--SETMYRE.....RS-------------------HSSSYLA----
YIOC_SCHPO/1-796VYHP----TMLK...ERSYELHRVEVLRLLLSLF--SEEIYRT.....DG-------------------NGSSCCA----
Q2GWB4_CHAGB/1-825GCNT----SIPT...TREHESNRCEILRLLLTLA--GHSLYLSPSV.LPQ-------------------QGTKALT----
Q0UAJ2_PHANO/1-733GCNT----PVAS...TKEFESNRTEILRLLLTFA--SKSMYMSS......-------------------.......----
B8M9N3_TALSN/1-838GCNT----SMVS...TKEHENNRMEILRLLLTLT--GKSMYMSPTL.LPV-------------------KGVKAIT----
C5FVH3_ARTOC/1-827GCNT----AMGS...NKELESNRTEVLRLLLTIT--GQSMYMQPNL.LPV-------------------KGVKSLT----
C0NTS7_AJECG/1-843GCTT----AMGS...NKELESNRCEILRLLLTLS--SQSMYMPLSL.LPV-------------------KGVKTIT----
B6HUK2_PENCW/1-841GCNT----AMGS...NKTFESNRCEILRLMLTLT--GKAMYLPSNT.LPV-------------------QGVKAIT----
Q5ASC1_EMENI/1-732GCNT----SMGS...TRELEDNRCEVLRLLLTIT--GKAMYMSSSL.LPV-------------------QGVRAIT----

PF09742

F4WRP0_ACREC/1-730GFAY.....SPPRYPI..LDSNRTELLKLLLTCF..SETMYNPPMDLSIT...................P.NRWIE....
E9H938_DAPPU/1-832GFAH.....AAPHDPR..LDNNRNEILKLLLTCF..SQAMYHPPGSESEA...................P.NKWVQ....
T1JUN4_TETUR/1-644...............SDSTYALHCECINLLLVLL..SVQMYSV.KPASKS.............V.....IYRCIMK....
J9F5Y0_WUCBA/1-661...............NDSTETIHIEAVKCLMVLL..SSQLYDD.DVMRPN.............I.....FYRYLMQ....
B4JW54_DROGR/1-859GFAQ.....SPPRNAQ..MERRRTELLKLLLTCF..SEPMYRTPQQSEEP.....................NKWIA....
I1EYR3_AMPQE/506-1206VAPLIIEWMEHLLYPDPFTYDVLTEAANLSIVLM..SGQLFNKDDLFSTS.............V.....IINELMD....
E0VAE1_PEDHC/1-723...............DFQTYSLHLEVVNCLLVFL..SAQMYTR.KPAAKL.............I.....IFKTLMQ....
C1FEV8_MICSR/1-964...............GCHVYALRVACCRSLEAIA..DEYSTADDSKADSSSPLSTPSAPFANETDGEFDAFDVLMDAVDG
G1MRD7_MELGA/1-648...............LVISKHLHLPASATMYVFL..LCVLHAK.D.LRKG.............F.....SLSYSVQ....
D6WWB7_TRICA/1-769GFAH.....SPPRSPV..LDSNRTELLKLLLTCF..SETMYQPPTDISQN...................P.NKWIA....
H3BX91_TETNG/1-768GFAH.....SPPYNHV..HDMNRTELLKLLLTCF..SEAMYLPPSPDRKS...................T.NPWVS....
F7D5K7_XENTR/1-770GFAH.....SPPLNQT..HDLNRTELLKLLLTCF..SEAMYLPPSPESSN...................TSNPWVQ....
H2SJN1_TAKRU/1-774GFAH.....SPPYNHV..HDTNRTELLKLLLTCF..SEAMYLPPSADRKS...................V.NPWVS....
B3RQA8_TRIAD/1-734GFAT.....STPANPQ..FDRNRTEILKLLLTCF..SESLYMLPSADSGN.....................NQWLD....
I3JLL2_ORENI/1-646...............LDITYSILFEAVTVLLVFF..SYQLFHK.DILRDG.............I.....IYQHIMK....
G7DXH4_MIXOS/12-858GTSV.....SAGATRE..LESNRLELLRLLLVLI..AKTMYMPTTGEHRV...................Q.NKWTE....
U1M0X7_ASCSU/1-660...............SDTTEPIHIEAVKCVMAIL..SSQLYHD.SVLTSS.............I.....FFGYLMQ....
H2XV68_CIOIN/1-762GFPR.....SPPAYGY..IDQNRTEILKLLLTCF..SETIYTPPGAGDDS...................AANKWIE....
Q5ZBZ3_ORYSJ/1-682...............SLESCYLHHELLNLMLVLM..STQLCSGPSPEPKD....................VHPFID....
D0NH97_PHYIT/1-769...............NDRTYDLHVEAVNTLLVLL..SPVAYPR.DHSKQA.GDLLTHNPFLYML.....MASALPD....
T1FYR2_HELRO/1-642...............TDVTYSIHIECINIILSLL..SIQLFQM.SPASES.............M.....LHRCFMQ....
Q4DJF1_TRYCC/1-725GGKQVEGTSTQPMNGT..MHALRQELLYTLTALL..SYPLFSPPGTRDTL...................FSEPLLN....
I3KNU8_ORENI/1-782GFAQ.....APPLNYL..HDLNRTELLKLLLTCF..SEAMYLPPSPENKV...................L.NPWIS....
I3JCX3_ORENI/1-776GFAQ.....SPPLNYI..HDLNRTELLRLLLTCF..SEAMYLPPSSDNTI...................L.NPWVT....
Q01H67_OSTTA/38-724...............TTQTMALHTACARVLLITC..SSQLAFD..........................LTDVEAREMGH
Q38FE7_TRYB2/1-706...............TVSTVEAHGEVVSLLLCMC..STALYHS.TACDTN...................FTDPFTRLI..
Q8RWV1_ARATH/1-679...............SPNSYVLHQELLNFMLVTM..STQLLSGPSHGPTD....................ANPFID....
I1MHZ5_SOYBN/1-671...............SPNTYFLHLELLNFMIIAM..STQLLRGPSPGPND....................VNPFLD....
B0WBZ3_CULQU/1-681...............KEFTYHLHLEAVNCLIVLL..SVSQFTQQGTEKSN...................IFRTIYK....
F0Y4A0_AURAN/723-1436GCPP.....DVVPTSSVAFDRNRVEVLRLLLAAS..CEPLYESADGFDRW...................S.SRWLG....
D7T740_VITVI/12-678...............NPETHLLHHELLNFMLIVM..STQLLSGPSPGPKD....................VNPFID....
E1ZEP5_CHLVA/1-748...............PSTSYMLLLECSQLLLALC..SSALYSASPRGQLG....................QHPFLD....
M4BPB3_HYAAE/1-729GYP......DASVVNSSTYDKNRKEVLALLLTCF..SSILYQKAETCSKW...................K.DRFLE....
Q5CRW2_CRYPI/1-755...............CNLLISLQNTLMDIMLVLFLPNVE.........................................
A0A087VXA6_ECHMU/1-876GFAQ.....SPPQNAQ..HDANRTEIIRLLLVCF..SETMYLTQAEARSE...................I.NKWIA....
DYM_DROME/1-676...............KEFTYHLHLEAVNMLITLL..SVHLFAQ.QPTDKS.............I.....VFRTVFK....
H0VNU2_CAVPO/1-646...............LDITYEISVEAISTMVVFL..SCQLFHK.EVLRQS.............I.....SHKYLMQ....
E9ICM4_SOLIN/1-654...............CEFTYVVHLEAINCLLVLL..SVQLFSQTAAEYST...................VYRIAMH....
L9KZV5_TUPCH/1-826GFAH.....SPQPNYV..HDMNRMELLKLLLTCF..SEAMYLPPALESGS...................T.NPWVQ....
E9G1Z8_DAPPU/1-633...............KEETALLHRESVQTLMLLLFVAASSYLI...NNKS.............I.....IFKCLMH....
D7FT96_ECTSI/1-808DVGR.....KARIQRSRELEANRIEVMRLLLVLM..CEPLFQRNVGFDPT...................A.SRFAE....
H2MFX7_ORYLA/1-772GFAQ.....SPPLNYV..HDLHRTELLKLLLTCF..SEAMYLPPSSDSKV...................I.NPWVA....
B7S488_PHATC/1-694KVKTVDWGVTL.......YDKNRIEVLRLVLTAC..CDPLFSPADEYNPL...................A.SRWLA....
W1NV48_AMBTC/1-680...............SPRMYLLHHEVLNLVLVAM..STQLRAGPSRGPKD....................VHPFID....
B6A9V3_CRYMR/1-794...............IHSIYALQAIVMDILIVFFLNSTSEFSISRSISSL..............................
H2KSV6_CLOSI/110-1035GFAQ.....NPVHNTA..HDSNRTEILKLLLTCF..SETMYMERDEAQQT...................Q.NKWVS....
M4AQZ4_XIPMA/1-781GFAQ.....SPPLNYI..HDLNRTELLKLLLTCF..SEAMYLSPLSDSQV...................L.NPWVS....
E0VG76_PEDHC/1-766GFAH.....SPPRLPQ..YDLARTELLKLLLTCF..SETIYQPPVELKIS...................P.NKWIQ....
B4MQL1_DROWI/1-832GFAQ.....SPPKNAQ..MERRRTELLKLLLTCF..SEPMYRSPQQSEEP.....................NKWIA....
HID1_DICDI/1-880GVDS.....VPTVHNKQ.FWINRLSVLQCLITCL..SEQLYVPQDSVSTF...................K.SKWLD....
W4XTN1_STRPU/1-721GCAT.....APPHFAH..LDQNRTEILKLLLTCF..SETMYLAPASDAHS...................LPNQWIS....
T1K251_TETUR/1-842GFTS.....PTSSSTT..YDKHRTELLRLILTCF..STTMYKTPNEARLT...................P.NRWIT....
T1I7V2_RHOPR/1-802GFAH.....SPPHYTT..YDSARTELLKLLLTCF..SETMYQPPVDLQSA...................P.NKWVE....
Q7QGJ8_ANOGA/1-825GFAQ.....SPPRNGS..MDARRTELLKLLLTCF..SETMYRPPTASDEP.....................NRWIV....
A0A068YEV3_ECHMU/1-732...............SDITYGLLYESLSSLLILL..SAQVSGY.GGDEIP.............A.....TCKYFTS....
J9KB63_ACYPI/1-736GFAQ.....SPIKNAT..FESNRTELLRLLLTCF..SQAIYSPNQNG........................NRWVQ....
Q17L03_AEDAE/1-819GFAQ.....SPPRNGN..MDSRRTELLKLLLTCF..SETMYRVPTMSDEP.....................NKWIV....
W4Z6Q3_STRPU/1-667...............LNFTYVIHLETINTLLVLL..SVQMYIP.RISHKS.............L.....ITEYIMH....
W5JW75_ANODA/1-876GFAQ.....SPPRNGH..LDARRTELLKLLLTCF..SETMYRPPTASDEP.....................NRWIV....
DYM_XENTR/1-646...............LDLTYSILLEAVTALIVLL..SYQLFRK.DILHES.............P.....IHRHLMK....
A8WTE9_CAEBR/1-690...............NDTTLAIHVEAVRCLLTLL..SSQLYNE.SIVNTS.............I.....VFRFFID....
M4C137_HYAAE/1-768...............NDKTYNLHVEVVNTLLVLL..SPVVYSQ.DGFKHASGDVRSHNPFLYML.....MESALPD....
B9HUR0_POPTR/1-672...............SPKTYLLHHELLNFMLVAM..STQLLYGPAPGPTD....................MNPFID....
F6TGV4_CIOIN/1-683...............LDFTYSLHIEALNTILVLL..SVQMFVP.SPGDNG.............P.....IYRILMT....
H3AL71_LATCH/1-849GFAH.....SPPLNYN..HDLNRTELLKLLLTCF..SEAMYLLPSSETSS...................L.NPWVQ....

PF12722

C4XYD9_CLAL4/17-927-------FLVAGLASSEINTLTANLTNILCRSART---------------------------------GLDD.SGLKY.D
A3LX71_PICST/1-905-------LLVTSTPRVELLTLVCSLTNLVCRSTRS---------------------------------SPED.NALSYPS
Q6BSE0_DEBHA/1-924-------LLVATTPRVELLILVCSLMNLLCRSARS---------------------------------PVEE.NMLFY.R
C3Z701_BRAFL/1-784-------YFASSENRH.ALPLFTSLLNIVCAYDPI---------------------------------G....YGMPY.N
Q0E9B5_DROME/1-834-------YFTSADNRH.ALPLFTSFLNTVCSYDPV---------------------------------G....FGVPY.N
B0WUT2_CULQU/1-851-------HFTSADNRH.ALPLFTSLLNTVCAYDPV---------------------------------G....IGVPY.N
A7RKV1_NEMVE/1-693-------YFASSENRH.ALPLFTSILNTVCSYDPL---------------------------------G....YGVPT..
A8WRZ4_CAEBR/1-727-------HFTAVTNPH.VLPIFTSLLNIVCAYDPV---------------------------------G....YGLPY.N
A8NNK7_BRUMA/1-721-------RFTSAENRH.VLPLFTSLLNIVCAYDPV---------------------------------G....FGVPY.N
C5K8E7_PERM5/1-865-------TFCSGDLPY.TANLYCSLMSTVVAYDPR---------------------------------G....YGVPY.G
B6JW01_SCHJY/1-778-------YVISHNNSDLSLSLLCSLLNTAMQFNTS---------------------------------FWKPRSVMSA.H
YIOC_SCHPO/1-796-------YVASIANRRLVLCLLSSLINTAMRFNTM---------------------------------FWKP.EFLPLDN
Q2GWB4_CHAGB/1-825-------YMCTNSDKQVVLSVLCSLLNTTLKYNPA---------------------------------S....WRVPY.N
Q0UAJ2_PHANO/1-733-------............................---------------------------------............
B8M9N3_TALSN/1-838-------YLATCSDKQIVLTLLCSLLNTTIKYNPA---------------------------------I....WRVPY.D
C5FVH3_ARTOC/1-827-------YLVTCGEKKLVMSLLCSLLNTTIKYNPT---------------------------------P....WRLPY.D
C0NTS7_AJECG/1-843-------YLVTCPDKQVVLSLLCSLLNTTIKYNPT---------------------------------P....WRLPY.D
B6HUK2_PENCW/1-841-------YITTCQDKQAVLTLLCSLLNTAMKYNPA---------------------------------S....WRVPY.D
Q5ASC1_EMENI/1-732-------YITTSQEKQAVLTLLCSLLNTAIKYNPA---------------------------------S....WRVPY.D

PF09742

F4WRP0_ACREC/1-730.......HLTS.SENRHALPMFTSLLNTVCAYDPV.....................................GYGVPY-N
E9H938_DAPPU/1-832.......HFTS.PENRHALPLFTSLLNVLCAYDPV.....................................GLGLPY-N
T1JUN4_TETUR/1-644........KCA.IHSL...LLTKCLINNFIRQDLP.......................P.........REDGGSVI..-.
J9F5Y0_WUCBA/1-661.......GKCS.TRSL...ELSRALISNYLQRYTP............................CVVKHDKEPESIV..-.
B4JW54_DROGR/1-859.......YFTS.ADNRHALPLFTSFLNSVCSYDPV.....................................GFGVPY-N
I1EYR3_AMPQE/506-1206............IPLDVSSSLVQSLVSFFISQPIP.......................PPDTLRVQP...........-.
E0VAE1_PEDHC/1-723.......GRPS.IHSP...LLIKTLLGHFIKQEKP................................YERGGGSIV..-.
C1FEV8_MICSR/1-964CTAVDAGGDGR.SGESIYRDVVAETLRLWSRRPPL.......................PRGSDAWMHDPNDASGKP..-.
G1MRD7_MELGA/1-648.......SSCA.ARSS...DCVLCLPHNNTXKTTP.......................KSSSAYSFPQIFDSKKTK..-.
D6WWB7_TRICA/1-769.......HLTS.SENRHALPMFTSLLNTVCAYDPV.....................................GLGVPY-N
H3BX91_TETNG/1-768.......FFCS.SENRHALPLFTSLLNVVCAYDPV.....................................GYGIPY-N
F7D5K7_XENTR/1-770.......FFCS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPY-N
H2SJN1_TAKRU/1-774.......FFCS.SENRHALPLFTSLLNVVCAYDPV.....................................GYGIPY-N
B3RQA8_TRIAD/1-734.......YFTS.TNNRHALPLFTSLLNTVCSYDPV.....................................GYGVPY-N
I3JLL2_ORENI/1-646.......GRCM.CLTS...RLVKTLLYNFIRQEKC.......................PPPSTHIFEPKAE.GGLL..-.
G7DXH4_MIXOS/12-858.......ALVSLSDRKVVLSLLCSLLNTSLNNANP.....................................GL.LNY-D
U1M0X7_ASCSU/1-660.......GKCS.SRSM...ELTKALLTNYLQRNTP............................YVTKREKEPESIV..-.
H2XV68_CIOIN/1-762.......CFCS.SDNRQALPLFTSLLNVFCAYDPV.....................................GLGVPY-N
Q5ZBZ3_ORYSJ/1-682.......AAML.QDSSIVSSVVQKLLLNFVKRPRI.......................PLNS.SHPAFSDDGGPGV..-.
D0NH97_PHYIT/1-769.......GKKS.YWAS...AIVRRLLQNSIEQIQATGASSASNTAVIALRKARETSLIAMSGMSDQAYELEQFSYL..-.
T1FYR2_HELRO/1-642.......GKCS.RNSC...KLVKNLLETFTSQCRT................................NNNTPHGAL..-.
Q4DJF1_TRYCC/1-725.......V....DENPLLPTLVASTLNAILAYKPF.....................................G.SIPY-T
I3KNU8_ORENI/1-782.......FFCS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPY-N
I3JCX3_ORENI/1-776.......FFCS.TENRHALPLFTSLLNVVCAYDPV.....................................GYGIPY-N
Q01H67_OSTTA/38-724PLAMSLLKLGA.SDSKMTGTLMCSLLRQIVAR..........................PPNSGDICALPANRDDEK..-.
Q38FE7_TRYB2/1-706............LASGDLHALVLVLLQRLMDWGEG.......................................RLPK-T
Q8RWV1_ARATH/1-679.......AAMT.QEKSLVSLVVRRLLLNYISRHRT.......................PPNAKSY.MYSDGDSQGI..-.
I1MHZ5_SOYBN/1-671.......AAMA.QDSHLVTSVVCKLLLNYITRPRV.......................PFSRASYSIFYDGSQNSV..-.
B0WBZ3_CULQU/1-681.......C....QHAN...TLMSALLHFLSRMTQV.......................P....ATMFGFGSGGSFV..-.
F0Y4A0_AURAN/723-1436.......VATA.PDAPNAKLLLYSLLNVVCGYDPI.....................................GLGVPY-G
D7T740_VITVI/12-678.......AAMA.QESSLVGLVVRRLLINYINRPRI.......................PLNDVSYSIFSEGSQPGV..-.
E1ZEP5_CHLVA/1-748.......AAM..QQKDLANTTVEALLRLFIAAPPV.......................PLSLKIFTYMPTDTRSM...-.
M4BPB3_HYAAE/1-729.......VATA.PECPFVPTLFYSLLNIVVAYDPV.....................................GWGVPY-A
Q5CRW2_CRYPI/1-755............NHQHIDNGDIYTFITCFQVHSSI.......................KSVKLIYCEDDSDLFQDNRY-L
A0A087VXA6_ECHMU/1-876.......FFSG.PENRHVLPLFTSLLNVVCAYNPA.....................................SSSLPY-N
DYM_DROME/1-676.......C....QHAN...VLMSALLHFVARIVEV.......................P....HTMFGSSSAGSFV..-.
H0VNU2_CAVPO/1-646.......GPCL.PYTS...KLVKTLLYNFIRQEKP.......................PPPGSHVFSQQSDGGGLL..-.
E9ICM4_SOLIN/1-654.......AHLN.QHAP...AMVCTLLHNFVQQEHA.......................P....PGLLTQQSGGSIV..-.
L9KZV5_TUPCH/1-826.......FFCS.TENRHALPLFTSLLNTVCAYDPV.....................................GYGIPY-N
E9G1Z8_DAPPU/1-633.......GPGA.LHAG...LLTRTLLQHYCQQQSV.......................P...VRWLRKPEQGGSIV..-.
D7FT96_ECTSI/1-808.......EVCK.ADAPFAAELFFSLLSVIATYDPV.....................................GWGVPY-A
H2MFX7_ORYLA/1-772.......FFCS.AENRHTLPLFTSLLNVVCGYDPV.....................................GYGVPY-N
B7S488_PHATC/1-694.......VATA.ADAPNACCLFFSLLNTILHYDPR.......................................GLPV-A
W1NV48_AMBTC/1-680.......AAMA.QESALVGSVVRRLLLTYITHPRI.......................PLNSASYNSFLEGSQTGV..-.
B6A9V3_CRYMR/1-794.......TKIE.NKTNILLPSFLDIFQILSVHLMN.........................PSLIIQRDDSENTETIPY-S
H2KSV6_CLOSI/110-1035.......FFTS.TNNRHALPLFASLLNVVCAYDPV.....................................GFGVPY-N
M4AQZ4_XIPMA/1-781.......FFCS.AENRHALPLFTSLLNVVCSYDPV.....................................GYGIPY-N
E0VG76_PEDHC/1-766.......YVTS.AENRHALPMFTSLLNTVCAYDPV.....................................GLGVPY-N
B4MQL1_DROWI/1-832.......YFTS.ADNRHALPLFTSFLNTVCSYDPV.....................................GFGVPY-N
HID1_DICDI/1-880.......WITH.TQEYYTEALLFSLINTFATFDPI.....................................GWGIPY-N
W4XTN1_STRPU/1-721.......FFCS.SDNRHALPLFTSMINIACAYDPV.....................................GYGMPY-N
T1K251_TETUR/1-842.......FFTS.PDNRHALPLFTSLINTVFSYDPA.....................................GY.LPF-N
T1I7V2_RHOPR/1-802.......YLTS.TENRHALPMFTSLLNTVCAYDPV.....................................GLGLPY-N
Q7QGJ8_ANOGA/1-825.......HFTS.ADNRHALPLFTSLLNTVCAYDPV.....................................GIGVPY-N
A0A068YEV3_ECHMU/1-732.......NKCL.ADAP...AFIHRLVLNVAENLPC.......................P....PNMLAESHAPGML..-.
J9KB63_ACYPI/1-736.......YVTS.AENRHALPMLTSLLNTVCGYDPI.....................................GMGVPY-N
Q17L03_AEDAE/1-819.......HFTS.AENRHALPLFTSLLNTVCAYDPV.....................................GMGVPY-N
W4Z6Q3_STRPU/1-667.......GKCS.SDAH...VLVKILLDQFIKREDC.......................P...AELLRDSPKPASFL..-.
W5JW75_ANODA/1-876.......HFTS.ADNRHALPLFTSLLNTVCAYDPV.....................................GMGVPY-N
DYM_XENTR/1-646.......GPCL.PYTS...RLVKTLLYNFIRQEKS.......................PPPGSHIFPQQQDGGGLL..-.
A8WTE9_CAEBR/1-690.......GACA.QHAA...KLTKTLLLNYLIHNSE............................YHMTVAKPQESIV..-.
M4C137_HYAAE/1-768.......GSRS.YWAS...SLIHRLLRNSIDQLQATGLNAMANTAVVAIRKAQEMSLGTMSGISEQTREPEESSYLSR-Y
B9HUR0_POPTR/1-672.......AAMA.QESSLVGLVVRRLLLNYIIRPRI.......................PYNSASYPVFSGGSQPGV..-.
F6TGV4_CIOIN/1-683.......GQCA.AKAN...NFMRALLQNFIEQRPS.......................P....EAGSRENGGGSFV..-.
H3AL71_LATCH/1-849.......FFCS.TDNRHALPLFTSLLNIVCAYDPV.....................................GFGIPY-N

PF12722

C4XYD9_CLAL4/17-927NSSL--VEGR------------------------------------------------------------------HLCV
A3LX71_PICST/1-905NSQL--TEMR------------------------------------------------------------------HLTV
Q6BSE0_DEBHA/1-924NIEL--TEMR------------------------------------------------------------------HLCV
C3Z701_BRAFL/1-784HLLF--SDYR------------------------------------------------------------------EPTV
Q0E9B5_DROME/1-834HLLF--ADTT------------------------------------------------------------------EPLV
B0WUT2_CULQU/1-851HLLF--TDTL------------------------------------------------------------------EPLV
A7RKV1_NEMVE/1-693....--.DFK------------------------------------------------------------------EPMV
A8WRZ4_CAEBR/1-727YLLF--NDSR------------------------------------------------------------------EPLV
A8NNK7_BRUMA/1-721YLLF--TDTR------------------------------------------------------------------EPLV
C5K8E7_PERM5/1-865SAFS--SGSQ------------------------------------------------------------------EALV
B6JW01_SCHJY/1-778LATH--A...------------------------------------------------------------------.TLV
YIOC_SCHPO/1-796SVAH--M...------------------------------------------------------------------.SLI
Q2GWB4_CHAGB/1-825ALVL--KDPK------------------------------------------------------------------EILV
Q0UAJ2_PHANO/1-733..VF--KDQR------------------------------------------------------------------QILV
B8M9N3_TALSN/1-838HVVW--KDSK------------------------------------------------------------------QILV
C5FVH3_ARTOC/1-827HVVW--KDPK------------------------------------------------------------------QILV
C0NTS7_AJECG/1-843HVVW--KDPK------------------------------------------------------------------QIFV
B6HUK2_PENCW/1-841HVVW--KDPK------------------------------------------------------------------QILV
Q5ASC1_EMENI/1-732HVVW--KDPR------------------------------------------------------------------QIL.

PF09742

F4WRP0_ACREC/1-730HLLF..TDSL..................................................................EPLV
E9H938_DAPPU/1-832HLLF..TDSR..................................................................EPLV
T1JUN4_TETUR/1-644......LDLA.....SGL...................WSALTLGYGKNNNDETLK.....................PVLS
J9F5Y0_WUCBA/1-661..LG....LA.....ASV...................WSAVQIVTGMDDSNSLSSDSEITPP..............VSLG
B4JW54_DROGR/1-859HLLF..ADTT..................................................................EPLV
I1EYR3_AMPQE/506-1206..SGVFSSFA.....SGL...................LSLVLPQHDILENT.........................SPLA
E0VAE1_PEDHC/1-723..IG....LA.....SNI...................WHILSLAYKNSTNLEPPKG....................ITLA
C1FEV8_MICSR/1-964..RGGFLGAM.....AALLLGDDDDDDDNGDDDKGKDWDVSVF.................................SPLG
G1MRD7_MELGA/1-648..YYEVIGVS.....PSL...................WKVFNEVGLCSQETAPSQL.V..................VPVA
D6WWB7_TRICA/1-769HLLF..NDSL..................................................................EPLV
H3BX91_TETNG/1-768YLLS..SDQR..................................................................EQLV
F7D5K7_XENTR/1-770HLLF..WDSR..................................................................EPLV
H2SJN1_TAKRU/1-774YLLS..SDQR..................................................................EQLV
B3RQA8_TRIAD/1-734HLMF..QDAR..................................................................EPLV
I3JLL2_ORENI/1-646..YGLASGVA.....SGL...................WSVFTLGGAGSRAGIDQEHDP..................LPLS
G7DXH4_MIXOS/12-858TLVLRREDTK..................................................................SQLA
U1M0X7_ASCSU/1-660..LG....LA.....ASV...................WSVMQIAAGYDEANGYDEDANLIPP..............ASLG
H2XV68_CIOIN/1-762HLLF..HDYR..................................................................EPLV
Q5ZBZ3_ORYSJ/1-682..LQRVGSVA.....ANF............VLLPYYTFNYLVSSNAEGAS..........................SQLA
D0NH97_PHYIT/1-769.TLEGVGSIA.....ASIFR............FP...WSFIRYFTTREDTA.........................SPLA
T1FYR2_HELRO/1-642..YGVACRFI.....SSL...................WSVVTLGLANQKTEHVVNESR..................AMLA
Q4DJF1_TRYCC/1-725SHWV...GPE..................................................................EMVV
I3KNU8_ORENI/1-782HLLF..SDYR..................................................................EQLV
I3JCX3_ORENI/1-776HLLF..SDYR..................................................................EQLV
Q01H67_OSTTA/38-724..CGVTRGLV.....SAF...................SALFPSRSDKSAQSCRSKRVAHNLVRCTHSTQ.......SPLA
Q38FE7_TRYB2/1-706PVLYRCAQYS.........................SLWTLYNMFAGGTENESITCG....................NHLG
Q8RWV1_ARATH/1-679..LERVGSAA.....ASL............VLLP...LNYLVSNSG.GSK..........................NPLA
I1MHZ5_SOYBN/1-671..LKKVGSEA.....ANI............VLLP...FSYLISSSSEGSR..........................NPIA
B0WBZ3_CULQU/1-681..FG....IA.....ESL...................WSILTFA.......RKQPDVLTAH......DLPAAFKDHYPLA
F0Y4A0_AURAN/723-1436GHLS..DEAP..................................................................TQAV
D7T740_VITVI/12-678..LQRVGSAA.....ANF............VLLP...FNYLVSSGGEGPR..........................SPLA
E1ZEP5_CHLVA/1-748..LKIVRSAA.....ASM............LWLPYQAYTLLLRPSRPGGGGEGTGGAAAAPSN.............SPLG
M4BPB3_HYAAE/1-729GSIV..SDDR..................................................................EVLV
Q5CRW2_CRYPI/1-755FLQYLIKKSLNFEKKCQLF.........................................................ELNK
A0A087VXA6_ECHMU/1-876HLMF..TDSR..................................................................EPLV
DYM_DROME/1-676..FG....IA.....ESL...................LSIFTF........RKQPDILKAGQAAGGGELSQRFRTHYPLA
H0VNU2_CAVPO/1-646..YGLASGVA.....TGL...................WTVFTLGGVGSKAAASAELP...................SPLA
E9ICM4_SOLIN/1-654......FSIA.....AGL...................WNVIRMGIGSSSKNIQVAHNGTAEEEERKRDTE......TPLA
L9KZV5_TUPCH/1-826HLLF..SDYR..................................................................EPLV
E9G1Z8_DAPPU/1-633..LGLASKFVIFVYLAGL...................WSLISRNSSTAESVDAV......................SDFA
D7FT96_ECTSI/1-808GSFT..TDLP..................................................................ARQL
H2MFX7_ORYLA/1-772HLLF..SDSR..................................................................EQLV
B7S488_PHATC/1-694AGFS..ENSH..................................................................VKLV
W1NV48_AMBTC/1-680..LQKVGSAA.....ATF............VLLPYYTFNYIVNSSSDGSR..........................SPLA
B6A9V3_CRYMR/1-794FFFFLTRTTINGKKHSPTP.........................................................IGIK
H2KSV6_CLOSI/110-1035HLMF..SDSR..................................................................EPLV
M4AQZ4_XIPMA/1-781HLLF..SDYR..................................................................EQLV
E0VG76_PEDHC/1-766HLLF..SDTA..................................................................EPLV
B4MQL1_DROWI/1-832HLIF..VDTT..................................................................EPLV
HID1_DICDI/1-880HLMY..SDDH..................................................................EICS
W4XTN1_STRPU/1-721HLLF..SDTR..................................................................EPLV
T1K251_TETUR/1-842HLLF..SDSR..................................................................ESLV
T1I7V2_RHOPR/1-802HLLF..SDTA..................................................................EPLV
Q7QGJ8_ANOGA/1-825HLLF..TDTL..................................................................EPLV
A0A068YEV3_ECHMU/1-732..WNAASTIA.....SGL...................MTVVTLGYSRRAASTRAEAKLESGSPGGGVL........HPLA
J9KB63_ACYPI/1-736HLLF..ADTS..................................................................EPLV
Q17L03_AEDAE/1-819HLLF..TDTL..................................................................EPLV
W4Z6Q3_STRPU/1-667..YGISAAIA.....AGI...................WAVLTLGYGTRSKPDDREDR...................ALLA
W5JW75_ANODA/1-876HLLF..TDTL..................................................................EPLV
DYM_XENTR/1-646..YGLASGVA.....SGI...................WTVLTLGGVGSKPTPQQEQS...................SPLA
A8WTE9_CAEBR/1-690..FG....LA.....SSM...................WSMVQMATGLDSAEEDNKPP...................LTLG
M4C137_HYAAE/1-768FTLEGVGSIA.....VSIFR............SP...WSFVRHCTTREETA.........................SPLA
B9HUR0_POPTR/1-672..LQRVGSAA.....ATL............VLLP...FNYLVSSTGDGSR..........................NPLA
F6TGV4_CIOIN/1-683..IGIASAVA.....SGL...................WSALKLGGKKDSGVSKELTSELGP...............PTIG
H3AL71_LATCH/1-849HLLF..SDYR..................................................................ENLV

PF12722

C4XYD9_CLAL4/17-927SYSA................ELLA-------CMVVCPMPSSAHTAFMTNLGLCS..........................
A3LX71_PICST/1-905TYSI................QLLT-------AMVVYPLPSPEKLDFLKETELIST.........................
Q6BSE0_DEBHA/1-924TYAT................QLLT-------LMIVYPLPSQPNLQFLYDLNLLTT.........................
C3Z701_BRAFL/1-784EVAL................QLLI-------VVLDHD.NGQSAISVDGTTTGTAMDQGAE....................
Q0E9B5_DROME/1-834EACL................QLLI-------VTLDHDMVVQQQLTQPGQASYDEG.........................
B0WUT2_CULQU/1-851EVCL................QILI-------VTLDHDITSNTSSNSPTGGAQSAQSYSHDDT..................
A7RKV1_NEMVE/1-693EVAA................QLLV-------VLLDHDGGDGQNPINDDLANDMMEP........................
A8WRZ4_CAEBR/1-727EIAL................QVLI-------VCLDKESQPKTDDSGY.................................
A8NNK7_BRUMA/1-721QTAL................QVLI-------VCLDNETQSSDKKNEY.................................
C5K8E7_PERM5/1-865DLSLQVKVPGSNPGAGTCTVQVLC-------ALLDFNPSPDNTGSEMVKTHRTGTGSEDGSNNSISESSNQEESAAARRR
B6JW01_SCHJY/1-778ELCF................TVFL-------TLITDPVIGSSSRFLEFARTRN...........................
YIOC_SCHPO/1-796EYCF................SVLL-------ILMSEENNNGTPCYNNYRSSKN...........................
Q2GWB4_CHAGB/1-825TYTL................QLLL-------ATLLYPIPEQTGV....................................
Q0UAJ2_PHANO/1-733TYCL................QLLL-------VLILYPIPEAGNG....................................
B8M9N3_TALSN/1-838IYCL................QLLL-------VILLYPIPEDGRG....................................
C5FVH3_ARTOC/1-827IYCL................QFLL-------ALLLYPIPEDGRG....................................
C0NTS7_AJECG/1-843IYCL................QFLL-------VLLLYPIPEDGRG....................................
B6HUK2_PENCW/1-841IYCV................QLLL-------VLLMYPIPEDGRG....................................
Q5ASC1_EMENI/1-732........................-------.................................................

PF09742

F4WRP0_ACREC/1-730DVAL-------------...QILI.......VTLDHDTTGGIPME...................................
E9H938_DAPPU/1-832ETAL-------------...QLLI.......VTLDWDSSAQCSQLNTIDEQ.............................
T1JUN4_TETUR/1-644KLSL-------------...FLLL.......VLTYHCTTDS.......................................
J9F5Y0_WUCBA/1-661SLSV-------------...LLLL.......NLACHQDPEAKL.....................................
B4JW54_DROGR/1-859EACL-------------...QLLI.......VTLDHDMVIQQQQQQQQHQHQPQQQQHQQQQQLTHAGGVLVTPYD....
I1EYR3_AMPQE/506-1206LSSL-------------...LFLL.......ILVHQHSRGH.......................................
E0VAE1_PEDHC/1-723NQSL-------------...LLIL.......VLVSHCTAEKNLL....................................
C1FEV8_MICSR/1-964DAAG-------------...AALT.......RLLHRPARYDGVAEVGRCVANESASTAVVSTAGKVVRREPNVAGSSPGR
G1MRD7_MELGA/1-648ASEL-------------...MIVL.......ICSQYRSLSDHP.....................................
D6WWB7_TRICA/1-769EAAL-------------...QILI.......VTLDHDTSSSSPAEGE.................................
H3BX91_TETNG/1-768VQAI-------------...QVLV.......VTLEHEGGAVARAALQVLDGTAPTEAMGEQ...................
F7D5K7_XENTR/1-770EVSA-------------...QLLI.......VTLDSDLTVTSSP...SMDGTTTSTAMDET...................
H2SJN1_TAKRU/1-774VHVI-------------...QVLI.......IALEHEG..VARASLQVLGGISPSAAVGQQ...................
B3RQA8_TRIAD/1-734EIAV-------------...QLLV.......VVLDHEPSTITIDRSAEHD..............................
I3JLL2_ORENI/1-646NQSL-------------...LLLL.......VLANLTDGPEWP.....................................
G7DXH4_MIXOS/12-858SLSL-------------LALDILL.......VCQDGRADSTSVPSTPMPSLKRNTSFLSDASFSSMA.............
U1M0X7_ASCSU/1-660SLSV-------------...LLLL.......NLACHQNADNNKA....................................
H2XV68_CIOIN/1-762EAAC-------------...QILI.......VALDHNAAEKEDEPVDSSSLSPSILS.......................
Q5ZBZ3_ORYSJ/1-682DNSL-------------...LVLL.......ILIHYRKCITMSESFPSSNVYTSDLNTNVKDAPAFHD............
D0NH97_PHYIT/1-769DRSV-------------...LLLL.......ILLQS...................CRDSDSPVAS...............
T1FYR2_HELRO/1-642NQSL-------------...LLLL.......VLCNQFCSNGSFI....................................
Q4DJF1_TRYCC/1-725LMSA-------------...RFLSALICYPGALLDGSTQTRHTKSPEESDKNEPKENVEAKDRE................
I3KNU8_ORENI/1-782EQAV-------------...QILI.......VTLEHEAGSAASAALQALDPSTSPSAEEEQE..................
I3JCX3_ORENI/1-776EQAV-------------...QILI.......VTLEHDGGIPHPP........ASPSSIEEQ...................
Q01H67_OSTTA/38-724DEFS-------------...NLFL.......ALCAQGAFDPNVK....................................
Q38FE7_TRYB2/1-706RHCA-------------...QLLS.......VLVSYGKGYRP......................................
Q8RWV1_ARATH/1-679ECSL-------------...HVLL.......ILINYHKSIMSDESMTDKSDDSATSESVSKVHVFSSD............
I1MHZ5_SOYBN/1-671DSSL-------------...QVLL.......VIIHYEKCLVSEGYSVLKNQVSTSLDSLPKENTYFSE............
B0WBZ3_CULQU/1-681NQSL-------------...LLIL.......ILTNHYTTKD.......................................
F0Y4A0_AURAN/723-1436YAAA-------------...QVLI.......ALLDYGESPKVGPHPEGRR..............................
D7T740_VITVI/12-678DSSL-------------...QVLL.......ILIHYRKCILVDESIADRKSGGATSDSLSKENTYFSE............
E1ZEP5_CHLVA/1-748DSAL-------------...LLLL.......VLLFHAPPQDAPFG...................................
M4BPB3_HYAAE/1-729DLSL-------------...QVLL.......VLLDFGQTLETTTGAMSLKPQLGSLTPVIKRRSSSVTLRPSNPLFDGVP
Q5CRW2_CRYPI/1-755KKSI-------------...ILLS.......TILFNPPELKF......................................
A0A087VXA6_ECHMU/1-876EAAL-------------...QMLC.......VILEADTSNLDGGKTLSDSTT............................
DYM_DROME/1-676NQSL-------------...LLIL.......ILTNHCTAQD.......................................
H0VNU2_CAVPO/1-646NQSL-------------...LLLL.......VLTNLTDAPDAP.....................................
E9ICM4_SOLIN/1-654SQSL-------------...LLLL.......VLTNHCTATQ.......................................
L9KZV5_TUPCH/1-826EEAA-------------...QVLI.......VTLDHDCASSASP...TVDGTTTGTAMDDA...................
E9G1Z8_DAPPU/1-633SQSL-------------...LLLL.......VLTNHCSTEKNWS....................................
D7FT96_ECTSI/1-808EMSA-------------...QLLI.......VLLDHGKPPLPVVTSSAGPDGESPDQQTAVREDPPTPGDVGY.......
H2MFX7_ORYLA/1-772EQAL-------------...QVLV.......VALEHEAGSAASSALQALDASASPTADEEEK..................
B7S488_PHATC/1-694ELSA-------------...QVLC.......VLLDCGIPGSPEPVMDQNGNPCVEFEVASRGGF................
W1NV48_AMBTC/1-680DISL-------------...LVLL.......VLVHYQKRIIVDDNFMDKSEDGVEMNGFLKESSYFQD............
B6A9V3_CRYMR/1-794NRSL-------------...CILS.......MLIFHSPFFKE......................................
H2KSV6_CLOSI/110-1035EVAL-------------...QVLC.......IVLETELTASYPTHSSQGYRNLVGRMSSEAE..................
M4AQZ4_XIPMA/1-781EQAL-------------...QVLI.......VTLEHETGSAVSAALQALDSSSSNPPEELE...................
E0VG76_PEDHC/1-766DTAL-------------...QILI.......VTLDHDTSLGD......................................
B4MQL1_DROWI/1-832EACL-------------...QLLI.......VTLDHDMVMHQQQQQQLLLNQSQSGLASYE...................
HID1_DICDI/1-880KLSI-------------...QILN.......VLLTYDPIENNDQQPQQQHHHHQQQHHQQQQQQQQ..............
W4XTN1_STRPU/1-721EIAS-------------...QILV.......VTLDHANPHNVASSVDGAEEVH...........................
T1K251_TETUR/1-842EVCL-------------...QILI.......VTLDHDFITESLPGGNSAERTPI..........................
T1I7V2_RHOPR/1-802DTAL-------------...QILI.......VTLDHDTSSSQTY....................................
Q7QGJ8_ANOGA/1-825EVCL-------------...QILI.......VTLDHDITSNGPAQSSAYIHD............................
A0A068YEV3_ECHMU/1-732KQSC-------------...HLLL.......VLTTQ...................STGFISAASAAPITDGKDGATSPPN
J9KB63_ACYPI/1-736DMCL-------------...QIII.......VALDSDVQQN.......................................
Q17L03_AEDAE/1-819EVCL-------------...QILI.......VTLDHDITSNSPTQSASYSHD............................
W4Z6Q3_STRPU/1-667NQSL-------------...LLLQ.......VLTNHYTHEKGIH....................................
W5JW75_ANODA/1-876EVCL-------------...QLLI.......VTLDHDITGNAAGSGTPGSQQAGQSPVGYVHD.................
DYM_XENTR/1-646NQSL-------------...LLLL.......VLSNLTDAPDCP.....................................
A8WTE9_CAEBR/1-690NLCI-------------...LLLL.......NLSCHQPVNAS......................................
M4C137_HYAAE/1-768DRST-------------...LLLL.......VLLQS...................CRDTDSLVTS...............
B9HUR0_POPTR/1-672DSSL-------------...HVLL.......ILNYYHKCVVGDESLTDRSDDSATSDSLSKGKTYFSD............
F6TGV4_CIOIN/1-683RQSA-------------...LLIL.......ALINHQSYVDPTGQPFV................................
H3AL71_LATCH/1-849EVAA-------------...QVLI.......VNLDHDSSNSASP...SVDGTYTPPALYLHR..................

PF12722

C4XYD9_CLAL4/17-927...............HKPY------------------------------------------------------------N
A3LX71_PICST/1-905...............SKPG------------------------------------------------------------N
Q6BSE0_DEBHA/1-924...............AKPF------------------------------------------------------------N
C3Z701_BRAFL/1-784...............GEPQ------------------------------------------------------------N
Q0E9B5_DROME/1-834...............NCGD------------------------------------------------------------N
B0WUT2_CULQU/1-851...............TIAD------------------------------------------------------------N
A7RKV1_NEMVE/1-693...............PPMD------------------------------------------------------------N
A8WRZ4_CAEBR/1-727.................QD------------------------------------------------------------N
A8NNK7_BRUMA/1-721.................AD------------------------------------------------------------N
C5K8E7_PERM5/1-865FSSCAFPLAGPDDDASKPR------------------------------------------------------------N
B6JW01_SCHJY/1-778...............IALN------------------------------------------------------------N
YIOC_SCHPO/1-796...............TLPK------------------------------------------------------------N
Q2GWB4_CHAGB/1-825...............PTPK------------------------------------------------------------N
Q0UAJ2_PHANO/1-733...............PAPK------------------------------------------------------------N
B8M9N3_TALSN/1-838...............APPK------------------------------------------------------------N
C5FVH3_ARTOC/1-827...............ALPK------------------------------------------------------------N
C0NTS7_AJECG/1-843...............TPPK------------------------------------------------------------N
B6HUK2_PENCW/1-841...............SPPK------------------------------------------------------------N
Q5ASC1_EMENI/1-732...................------------------------------------------------------------.

PF09742

F4WRP0_ACREC/1-730...................EGAVGD......................................................N
E9H938_DAPPU/1-832...................SGMIHE......................................................N
T1JUN4_TETUR/1-644...............................................................................N
J9F5Y0_WUCBA/1-661...............................................................................N
B4JW54_DROGR/1-859...................EVGCGD......................................................N
I1EYR3_AMPQE/506-1206...............................................................................N
E0VAE1_PEDHC/1-723...............................................................................N
C1FEV8_MICSR/1-964SAGIVKSSREKWGGGLGEVETVMRRASMDVDDDPGSPVGSSRSPFAPPGFDSGADRSGLVFSKNYPPETPPATGSSIAAN
G1MRD7_MELGA/1-648...............................................................................N
D6WWB7_TRICA/1-769...................DSTVPD......................................................N
H3BX91_TETNG/1-768....................AAEPE......................................................N
F7D5K7_XENTR/1-770...................ESPPPD......................................................N
H2SJN1_TAKRU/1-774...................EPAEAE......................................................N
B3RQA8_TRIAD/1-734...................TVRIND......................................................N
I3JLL2_ORENI/1-646...............................................................................N
G7DXH4_MIXOS/12-858...................SPATSS......................................................N
U1M0X7_ASCSU/1-660...............................................................................N
H2XV68_CIOIN/1-762...................TSGSSS......................................................N
Q5ZBZ3_ORYSJ/1-682...............................................................................N
D0NH97_PHYIT/1-769...............................................................................N
T1FYR2_HELRO/1-642...............................................................................N
Q4DJF1_TRYCC/1-725...................DGTTTE......................................................Q
I3KNU8_ORENI/1-782.................VHTAGGPD......................................................N
I3JCX3_ORENI/1-776...................ESTGPE......................................................N
Q01H67_OSTTA/38-724...............................................................................N
Q38FE7_TRYB2/1-706...............................................................................N
Q8RWV1_ARATH/1-679...............................................................................N
I1MHZ5_SOYBN/1-671...............................................................................N
B0WBZ3_CULQU/1-681...............................................................................N
F0Y4A0_AURAN/723-1436...............................................................................N
D7T740_VITVI/12-678...............................................................................N
E1ZEP5_CHLVA/1-748...............................................................................N
M4BPB3_HYAAE/1-729...............................................................................N
Q5CRW2_CRYPI/1-755...............................................................................N
A0A087VXA6_ECHMU/1-876...................SDGKGS......................................................N
DYM_DROME/1-676...............................................................................N
H0VNU2_CAVPO/1-646...............................................................................N
E9ICM4_SOLIN/1-654...............................................................................N
L9KZV5_TUPCH/1-826...................DPPGPE......................................................N
E9G1Z8_DAPPU/1-633...............................................................................N
D7FT96_ECTSI/1-808...............................................................................N
H2MFX7_ORYLA/1-772...................GPAGPD......................................................N
B7S488_PHATC/1-694...............................................................................N
W1NV48_AMBTC/1-680...............................................................................N
B6A9V3_CRYMR/1-794...............................................................................N
H2KSV6_CLOSI/110-1035..E......ASSTTATSAGDGTIEM......................................................N
M4AQZ4_XIPMA/1-781....................PAGPD......................................................N
E0VG76_PEDHC/1-766...................ENVSSD......................................................N
B4MQL1_DROWI/1-832...................EANCGD......................................................N
HID1_DICDI/1-880...................STIECR......................................................N
W4XTN1_STRPU/1-721...................EGVLPE......................................................N
T1K251_TETUR/1-842...................DPTIHE......................................................N
T1I7V2_RHOPR/1-802...................DSNSPD......................................................N
Q7QGJ8_ANOGA/1-825...................DSTIAD......................................................N
A0A068YEV3_ECHMU/1-732SASASAVA.....................................................AAVAAATASRSIFRNIGSN
J9KB63_ACYPI/1-736...................DEAAID......................................................N
Q17L03_AEDAE/1-819...................DTTIAD......................................................N
W4Z6Q3_STRPU/1-667...............................................................................N
W5JW75_ANODA/1-876...................ESTIAD......................................................N
DYM_XENTR/1-646...............................................................................N
A8WTE9_CAEBR/1-690...............................................................................N
M4C137_HYAAE/1-768...............................................................................N
B9HUR0_POPTR/1-672...............................................................................N
F6TGV4_CIOIN/1-683...............................................................................N
H3AL71_LATCH/1-849..NRIMTRHKPNLIVTCYLLPPGPD......................................................N

PF12722

C4XYD9_CLAL4/17-927MVRFY-LGS.Q--------KNN-----------------------DL---------VFLVSHLLSILKHPFSVNRLENRG
A3LX71_PICST/1-905LARLY-MGKLH--------KDQ-----------------------EL---------VFLSTYLIAILKLPVVTSKDVESS
Q6BSE0_DEBHA/1-924MARVY-IGKLR--------KEN-----------------------EL---------LFLASYLINVLRAPMQSSKESENL
C3Z701_BRAFL/1-784LFVNY-LSRIH--------REE-----------------------DF---------HFILKGITNLLNNPLI........
Q0E9B5_DROME/1-834LFINY-LSRVH--------RDE-----------------------DF---------HFVLKGITRLLNNPLV........
B0WUT2_CULQU/1-851LFINY-LSRIH--------RDD-----------------------DF---------QFILRGITRLLNNPLV........
A7RKV1_NEMVE/1-693LFCNY-LSRIH--------REE-----------------------DF---------HFILHGLANLLNNPLI........
A8WRZ4_CAEBR/1-727YFINY-LSRIH--------REE-----------------------DF---------DFMLKGITRLLSNPIH........
A8NNK7_BRUMA/1-721FFINY-LSRIH--------REE-----------------------DF---------EFMLKGMTRLLTNPLV........
C5K8E7_PERM5/1-865VYRIM-ARGVQ--------KTG-----------------------EL---------DFMADGLVRIVTTVDD........
B6JW01_SCHJY/1-778FFSKS-ISQLH--------RKS-----------------------DF---------QFILDGFSRLLYSPIH........
YIOC_SCHPO/1-796YFSIL-LSKLQ--------PYS-----------------------DF---------QIILDGMSRLLYPPMQ........
Q2GWB4_CHAGB/1-825YYRHF-LGRLH--------RPQ-----------------------DF---------QFAVDGMTRILNQPLQ........
Q0UAJ2_PHANO/1-733FFRHF-LGRLH--------RPQ-----------------------DF---------QFLVDGMTRILNQPVW........
B8M9N3_TALSN/1-838YYRHY-FGRLH--------RPQ-----------------------DF---------QFLVEGMTRILNQPMQ........
C5FVH3_ARTOC/1-827YYRHF-LGRLH--------QPQ-----------------------DF---------QFLVEGMTRILNQPMQ........
C0NTS7_AJECG/1-843YYRHF-YGRLH--------RPQ-----------------------DF---------QFIVEGMTRILNQPMQ........
B6HUK2_PENCW/1-841YYRHY-FGRLH--------RPQ-----------------------DF---------QFLVDGMTRILNQPMQ........
Q5ASC1_EMENI/1-732.....-.....--------...-----------------------..---------..............MQ........

PF09742

F4WRP0_ACREC/1-730LFINY.LSRIH........RDE.......................DF.........QFVLKGITRLLNN..P--------
E9H938_DAPPU/1-832LFINY.LSRIH........REE.......................DF.........AFMLHGFTRLLKN..P--------
T1JUN4_TETUR/1-644PYREA.LFNCC........DLQ............VDSIGVAGLVSGF.........KMNFNQLFSTLCATQN--------
J9F5Y0_WUCBA/1-661PYKES.LSKFQ........NSQ............EVSSLNNSETDTF.........KLDYSLLYERLCATVN--------
B4JW54_DROGR/1-859LFINY.LSRVH........RDE.......................DF.........HFVLRGITRLLNN..P--------
I1EYR3_AMPQE/506-1206PYREA.LSLIC........DEN.................ESKDKASF.........QLNFNQLHEAICKQLN--------
E0VAE1_PEDHC/1-723PYRDF.LFTFI........HNS....PGHLSLGSNPEEIPVSSVSAL.........QINFDHLYVALCNTAA--------
C1FEV8_MICSR/1-964PFRDA.LFRLV........RLE......RSNKDDDSGESDALRVRVL.........RACVLAMHSADTAGAA--------
G1MRD7_MELGA/1-648PNANI.LMLKF........SVS............DSSAFSSSHPHVF.........QINFNSLYLKSCQKSV--------
D6WWB7_TRICA/1-769LFINY.LSRIH........RDE.......................DF.........EFILTGVTRLLNN..P--------
H3BX91_TETNG/1-768LFVNY.LSRIH........RDE.......................DL.........SFMLKGMTQLLNN..P--------
F7D5K7_XENTR/1-770LFVNY.LSRIH........REE.......................DF.........QFILKGLARLLLN..P--------
H2SJN1_TAKRU/1-774LFVNY.LSRIH........RDE.......................DL.........SFMLKGLTQLLNN..P--------
B3RQA8_TRIAD/1-734LFCNY.LSRIH........REE.......................DF.........TFILRGIILLLNN..P--------
I3JLL2_ORENI/1-646PYRQA.ITCFR........NTQ............DTSSLPVEQPHTF.........QINFNSLYTALCEQQR--------
G7DXH4_MIXOS/12-858TFLHY.LSKVH........RQP.......................DI.........RYLFSNIIASLNR...--------
U1M0X7_ASCSU/1-660VYKET.LSAFQ........NAR............EVSSVNSSTTRIF.........RLDYSALYDRLCATVD--------
H2XV68_CIOIN/1-762LFINY.LSRIH........RDE.......................DF.........AFILSGICRLLNN..P--------
Q5ZBZ3_ORYSJ/1-682PYYKA.LSNAK........DSQYDRADVEGNAQ.N..GLVV...............RLSFASLFDALGTCLK--------
D0NH97_PHYIT/1-769PFRGA.LCGITDGADTDTHDVS.EIEDPRAHLVQQSEATSSSSAEKL.........ELLYSDLFKVIGRHAP--------
T1FYR2_HELRO/1-642PYQTA.FLSLH........DDI............PNAIETPATRDHI.........SVKFLDLYTTICSTIK--------
Q4DJF1_TRYCC/1-725LNSPP.LRIVH........SAR.......................DLISAITPEEAKYVIERLKNTIGLKVY--------
I3KNU8_ORENI/1-782LFVNY.LSRIH........REE.......................DL.........SFVLKGLARLLNN..P--------
I3JCX3_ORENI/1-776LFVNY.LSRIH........REE.......................DF.........DFVLKGLARLLTN..P--------
Q01H67_OSTTA/38-724PFREA.VKGMR........DVS............ARSSVSSGKRDAT.........LVNFEKTCEALSESSS--------
Q38FE7_TRYB2/1-706EALHY.IASLG........DSS..................................QIQVKALLVTFNRHVL--------
Q8RWV1_ARATH/1-679TFSKA.LANAR........DVEFDRSDVEGNAHPA..GPHV...............RIPFASLFDTLGMFLA--------
I1MHZ5_SOYBN/1-671PYCRV.LVRAT........DCELDRVDKEGNAH.SDQDQHV...............KLPFAPLFDTLGMCLA--------
B0WBZ3_CULQU/1-681PYRVS.LFGCA........DSQ.......GAADSSGSSKEPEQAVTF.........KIDFSSLYNTLCRIVT--------
F0Y4A0_AURAN/723-1436VFREL.LGEID........DPD.......................YL.........EFLFEGLCRLLNNVHE--------
D7T740_VITVI/12-678PYCKA.LENAR........DIEFDRVDIEGNAH.S..GPLV...............RLPFASLFDTLGMFLA--------
E1ZEP5_CHLVA/1-748PYRSS.LQRLQ........DTD..................................DL...ALFDALGAALT--------
M4BPB3_HYAAE/1-729AYRAL.LSSLQ........RPE.......................DF.........KLIFSGISRLLNNYHQ--------
Q5CRW2_CRYPI/1-755IYSEW.INHFS........DPRFIPDNLILSDSNTDSDVDANKT............DFVDFPYFEQAYRSVT--------
A0A087VXA6_ECHMU/1-876LFLNY.MSRIH........RDE.......................DF.........SFVLDGITRLLNN..P--------
DYM_DROME/1-676AYRTS.LFSCA........DSK...............DSPKQGAVSF.........QIDFSAVYETLCTIVT--------
H0VNU2_CAVPO/1-646PYRQA.IMSFK........NTQ............DSSSFPSSIPHAF.........QINFNSLYTALCEQQT--------
E9ICM4_SOLIN/1-654PYRNA.LFSFI........DMQ...........EDHTISQGTAAETF.........KFNLNKLYTTICKIPN--------
L9KZV5_TUPCH/1-826LFVNY.LSRIH........REE.......................DF.........QFILKGIARLLSN..P--------
E9G1Z8_DAPPU/1-633PYRQA.LLSFT........DSQ...............VSPVHPSACF.........RLDYSVLYSTLCDRLG--------
D7FT96_ECTSI/1-808VFRNLVLHGLK........DEE.......................DF.........ELVYTGLSRLLNTLHR--------
H2MFX7_ORYLA/1-772LFVNY.LSRIH........REE.......................DL.........SFILRGLTQLLNN..P--------
B7S488_PHATC/1-694ILRTL.LARID........TGK.......................EL.........SMIFDGFARLLRNVYE--------
W1NV48_AMBTC/1-680PYCSA.LENAR........DIEFDRVDVEGNAH.S..GPLV...............RLPFASLFDTLGACLF--------
B6A9V3_CRYMR/1-794VYSDF.MRNIL........DPRFLPETSSLLIKDIQSEVDSDEDTS..........GITKFTYFDQICSTIS--------
H2KSV6_CLOSI/110-1035LFANY.MSRIH........RDE.......................DF.........AFILNGLTRLLNN..P--------
M4AQZ4_XIPMA/1-781LFVNY.LSRIH........REE.......................DL.........SFVLRGFAQLLNN..P--------
E0VG76_PEDHC/1-766LFINY.LSRIH........RDE.......................DF.........QFVLGGFTRLLNN..P--------
B4MQL1_DROWI/1-832LFINY.LSRVH........RDE.......................DF.........HFVLKGITRLLNN..P--------
HID1_DICDI/1-880KFIQY.IKTLK........RVR.......................DF.........KFFFNAFERIMNVPLI--------
W4XTN1_STRPU/1-721LFVNY.LSRIH........REE.......................DF.........HFILKGITRLLNN..P--------
T1K251_TETUR/1-842LFINY.LSRIH........REE.......................DF.........AFILKGFTRLLNN..P--------
T1I7V2_RHOPR/1-802LFINY.LSRIH........RDE.......................DF.........GFVLRGFTRLLNN..P--------
Q7QGJ8_ANOGA/1-825LFINY.LSRIH........RDD.......................DF.........QFILKGVTRLLNN..P--------
A0A068YEV3_ECHMU/1-732PYREA.LFALTPLGEVNAEAKQ....SGGQGKDLEKGGGNERGIIPP.........RIPFGRLCETLASTVN--------
J9KB63_ACYPI/1-736LFINY.LSRVH........RDE.......................DF.........SFILSGFTRLLMN..P--------
Q17L03_AEDAE/1-819LFINY.LSRIH........RDD.......................DF.........QFILKGVTRLLNN..P--------
W4Z6Q3_STRPU/1-667PYRKA.LCNFA........NSQ..........DGGMPIGPSGSLPPF.........KLNSANLYEAFCNHLK--------
W5JW75_ANODA/1-876LFINY.LSRIH........RDD.......................DF.........QFILKGVTRLLNN..P--------
DYM_XENTR/1-646PFRQS.VTFFR........NTQ............DSSVSPTPNPHSF.........QINFNSLYTALCEQQK--------
A8WTE9_CAEBR/1-690PFKET.LALFQ........NAQ.............EVSTLPTQVISF.........KIDYNGLYERLCATAG--------
M4C137_HYAAE/1-768PFRET.LCEMMKGADIHSSSVEMKDRDPRALSMEHDGMSTDSSTENM.........TISISDLFDIFGSRAS--------
B9HUR0_POPTR/1-672PYCKA.LENAR........DIEY....IEGNAH.S..GSHV...............RLPFASLFDTLGMCLA--------
F6TGV4_CIOIN/1-683PYKAA.LCCFR........HVQ.......GQLQGPSNGKQKGSLPSF.........HINLSRLYGTACSVQV--------
H3AL71_LATCH/1-849LFVNY.LSRIH........REE.......................DF.........HFILKGIARLLSN..P--------

PF12722

C4XYD9_CLAL4/17-927KF.......TKPHPSPW..AIEAIMILWELLQCNQYLR-SFVAE-.RLVVKL-VPYIAYHIFAFC-------DVP-HY--
A3LX71_PICST/1-905KF...NIIKSGNQPSLW..ATEATMLIWELIQCNKKFK-TLIYE-.QSLPEL-LVVLFYYIFAFH-------SNV-QH--
Q6BSE0_DEBHA/1-924KF..NLNTGRQNQVSIW..ATECIMLLWELFQCNKSFR-TLVGE-.RYLHEL-LVIMLYYVCTYH-------RNV-NH--
C3Z701_BRAFL/1-784....QTYLPNSCKKINF..HQEILVLFWKLCEFNKKFL-FYVLK-SSDVLDV-IAPILYHLNDSR-------QDQ-SR--
Q0E9B5_DROME/1-834....QNYLPNSTKRLHC..HQELLILFWKICDYNKKFL-YFVLK-SSDVLDI-LIPILYHLNYSR-------ADQ-SR--
B0WUT2_CULQU/1-851....QSYLPNSTKRLHC..HQELLVFFWKICDYNK...-.....-SSDVLDI-LVPILYHLNDSR-------ADQ-SR--
A7RKV1_NEMVE/1-693....QTYLPNSCKKISF..HQELLILFWKMCDQNKKFL-FYVLK-SSDVLDI-LVPILYHLNDAR-------SDQ-SR--
A8WRZ4_CAEBR/1-727..SSSSYLPNSTKKVNF..HQELLVLLWKCCEFNQKFM-FYVLK-TSDVLDI-LVPILYHISDAR-------NDS-AR--
A8NNK7_BRUMA/1-721....ATYLPSSTKKITC..HQELLVLLWKCCEYNQKFM-FYLLK-TSDVLEV-LVPILFHISASR-------NDP-AR--
C5K8E7_PERM5/1-865..AKRTYLPSSRKVVPF..YQEALILLWHLITINSTYR-KRLCI-.RHTEDI-LHPLLDLLVSSR-------NSQ-AK--
B6JW01_SCHJY/1-778.....FEKPNVVGVVMYDYYPLTLNLCKQMLHYNTRFF-HYLVD-TGRALDL-FVFILYLSFEYL-------SEA-ST--
YIOC_SCHPO/1-796.....STIPKRSSLIMFDYYPLVLIFCKLFIHYNERFF-HYLID-TDRAIDL-FIFLLYLSFEYL-------GDP-ST--
Q2GWB4_CHAGB/1-825..SNSSYIPGTQSSVRF..APETIMLFWEITQCNKRFR-SFIID-TERAHDF-IILILFYALEYK-------GDA-SK--
Q0UAJ2_PHANO/1-733..........SQKSLTW..APEMIMLFWEALQCNKRFR-SFIID-TDRAHDF-VVLVLYYAIDQR-------NDP-TK--
B8M9N3_TALSN/1-838..VTSSYLPGSQKSVKW..APEMLMLFWEALQCNKRFR-AFIIE-SNRSHDF-VILCIFYATEYR-------NDP-SK--
C5FVH3_ARTOC/1-827..ATSSYLPGSQKSIKW..APEMLMLFWEMVQCNKRFR-SFIVD-SNRAHDF-IVICTFYAIEYK-------TDP-SK--
C0NTS7_AJECG/1-843..ATTSYLPGSHKSVKW..APEMIMLFWEALQCNKRFR-SYMID-SSRALDF-VVLCIFYAIEYK-------TDA-SK--
B6HUK2_PENCW/1-841..ATASYLPGSQRSVKW..APEMLVLFWETLQCNKRFR-SFIID-SNRSHDF-LVLCIFYAMEYR-------MDA-SK--
Q5ASC1_EMENI/1-732..ATTAYLPGSQKSVKW..APEMLVLFWEALQCNKRFR-SFIID-SNRSHDF-IILCIFYSITYK-------SDP-AK--

PF09742

F4WRP0_ACREC/1-730--LMQTYLPNSTKKVHF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDVLEV.LVPILYHLNDSR.......ADQ.SR..
E9H938_DAPPU/1-832--LIQTYLPNSNKKVQN--HQELLVFFWKVCDFNKKFL.YYVLK.SSDVLDV.LVPILFHLNDSR.......ADQ.SR..
T1JUN4_TETUR/1-644--EDQS...........--....TLILYLLLYKNPSFR.AFLISRTSQLDDL.TIPILKILYHSG.......EKT.SH..
J9F5Y0_WUCBA/1-661--QQSP...........--....MLFLYILLHRNVGFR.NYILS.RINLEKL.VLPVLIVLSDGAQSSSMINSYN.AH..
B4JW54_DROGR/1-859--LVQNYLPNSTKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDVLDI.LIPILYHLNYSR.......ADQ.SR..
I1EYR3_AMPQE/506-1206--TEQT...........--....TLFFYQLLHNNLNFA.SFVFS.RSDINTL.LLPLLKELSSEG.......KKP.SH..
E0VAE1_PEDHC/1-723--NECS...........--....TLMLYLLLHRNENVK.NFILA.RADLEYL.VVPILKTLYNIT.......ESN.SH..
C1FEV8_MICSR/1-964--SGASGDKSHAASCQQ--AAVGVFLAYSLLYGNEGFY.RAVVADANAVRAL.VSALLRR................AH..
G1MRD7_MELGA/1-648--SSNS...........--....TVIVNFVLHLNS.LK.SFLLKCRTVTLVLKVLPILEILYHVE.......ERN.SH..
D6WWB7_TRICA/1-769--LVQTYLPNSTKKVHF--HQELLVFFWKMCDYNKKFL.YFVLK.SSDVLEV.LVPILYHLNDSR.......ADQ.SR..
H3BX91_TETNG/1-768--LVQTYLPHSTKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDVLDV.LVPILFYLNDAR.......ADQ.SR..
F7D5K7_XENTR/1-770--LSQTYLPNSIKKINF--HQELLVLFWKLCDYNKKFL.FFVLK.SSDVLDI.LVPILYFLNDAR.......ADQ.SR..
H2SJN1_TAKRU/1-774--LVQTYLPHSAKKIQF--HQELLLLFWKLCDINKKFL.FFVLK.SSDVLDV.LVPILFYLNDAR.......ADQ.SR..
B3RQA8_TRIAD/1-734--LLQTYLPNSCKKIGF--YQELLIFLWKVCDCNKKFL.YYVLK.SSDVLDI.LVPILYYLNDAR.......CDP.AR..
I3JLL2_ORENI/1-646--SDQA...........--....TLLLYTLLHQNANMR.TYVLS.RTDMDNL.VLPILEILYHVE.......ERN.SH..
G7DXH4_MIXOS/12-858--ELSSRLPTRKMNING--LVTSLIFLWKMFECNPKFR.EYALE.GDKPGSL.VVYLLGLSLECR.......GDP.AK..
U1M0X7_ASCSU/1-660--QQPP...........--....MLLLYLLLHTNCGFR.NYVLS.RINLENL.VIPVLRVLHDGTPSGSLNLSSN.SH..
H2XV68_CIOIN/1-762--LQQTYLPGSTKKVGF--HQELLVFFWKLCDTNKKFL.FFVLK.SSDVLDI.LVPILYHLNDAR.......ADQ.SR..
Q5ZBZ3_ORYSJ/1-682--DESS...........--....VLLLYSLVHGNCDFQ.EYVLV.RTDLDTL.LMPILEMLYNAS.......RKT.SN..
D0NH97_PHYIT/1-769--YEAS...........--....HLMLYTLLYSNPMIL.DTALS.DVDMERL.LLPLLETLYHAR.......SVE.PS..
T1FYR2_HELRO/1-642--TDTC...........--....TLLVYMLLHRVEPFK.TYCLS.RTNIEQL.VLPILEMLYNSH.......EGN.SQ..
Q4DJF1_TRYCC/1-725--SNRTVLPDSQRCFIT--QDEFMMLLWRLIELSPECQ.LAFAQ.QPAALNY.IVPFVDYALNAK.......RDP.KY..
I3KNU8_ORENI/1-782--LIQTYLPRSTKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDVLDM.LVPILFYLNDAR.......ADQ.SR..
I3JCX3_ORENI/1-776--LTQTYLPNSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDI.LVPILYYLNDAR.......ADQ.SR..
Q01H67_OSTTA/38-724--TDSG...........--....LLTLYTLLSTNSRFV.AYLGSKGSAAKRL.VENLIRELYEAE.......MDGITH..
Q38FE7_TRYB2/1-706--RCPA...........--...LCILLYTLLHDNPTFIHTVMTAYPDEFLGV.IQGVLRLSYTAS.......SEAWASGF
Q8RWV1_ARATH/1-679--DEGA...........--....VLLLYSLLQGNSDFK.EYVLV.RTDLDTL.LMPILETLYNAS.......KRTSSN..
I1MHZ5_SOYBN/1-671--DETA...........--....VLLLYSLLQGNSTFL.EYVLV.RTDLDTL.LMPILEALYDAR.......RRT.AN..
B0WBZ3_CULQU/1-681--IDQT...........--....TLLLYLLLHRNQRFY.KYVMA.QQNLQQL.VIPILQTLYNAP.......DST.SH..
F0Y4A0_AURAN/723-1436--ALNTTLPGSLSQIEC--YQEVLVILWKLLEENDHFA.PHALR.ECDVTRA.VVPVAFLMYEAR.......KDA.AR..
D7T740_VITVI/12-678--DETA...........--....ILLLYSLVHGNSDFL.EYVLV.RTDLDTL.LMPILETLYNAS.......RRT.SN..
E1ZEP5_CHLVA/1-748--SERA...........--....VLLLYVLLHTCPRFH.EYCLV.RSDLDTL.LLPLLELLYSAH.......ERT.AN..
M4BPB3_HYAAE/1-729--SMSTLLPNSIKQIKC--HQELLVLLWKMLDENAEFL.QYALK.KADANQL.VVPLLFLMYEGR.......QEP.AK..
Q5CRW2_CRYPI/1-755--FNGV........LVK--HNLFVFFLYSLVHSNSYFI.SYCLS.RADPDAL.ILALLEPVYIIS.......KDIDET..
A0A087VXA6_ECHMU/1-876--LTQTYLPGSAKKVHM--HQELLILFWRICDINKKFM.YYVLK.SSRVLDV.LVPILYYLNEAR.......KDK.SQ..
DYM_DROME/1-676--IDQA...........--....TLLLYLLLHRNERFY.RFVMQ.QQDLEQL.VIPILQTLYNAP.......DSN.SH..
H0VNU2_CAVPO/1-646--SDQA...........--....TLLLYTLLHQNSNVR.TYMLA.RTDMENL.VLPILEILYHVE.......ERN.SH..
E9ICM4_SOLIN/1-654--TDEV...........--....TLLLYMLLHRNSSVK.HDIMR.RPDIQLL.VTPILQILYHAP.......NNT.SH..
L9KZV5_TUPCH/1-826--LLQTYLPHSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDI.LVPILYFLNDAR.......ADQ.SR..
E9G1Z8_DAPPU/1-633--DERT...........--....TLLLYMLLHQHQQFR.NYVYT.HADIQRM.VIALLQELFNGD.......DQG.SH..
D7FT96_ECTSI/1-808--SRNTYMPGAATEVYC--YQEVLVLLWKLLEENPVFM.QYVLK.NCDINEI.LVPVCYLLVENR.......KDV.SK..
H2MFX7_ORYLA/1-772--LIQTYLPRSTKKIQF--HQELLILFWKFCDFNKKFL.FFVLK.SSDVLEM.LVPILFYLNDAR.......ADQ.SR..
B7S488_PHATC/1-694--AESNYIAGV..KLEC--FQELLVLFWKFLEENPLFM.PHILK.RCNVNEI.IVPICFLMYKSR.......RDP.AQ..
W1NV48_AMBTC/1-680--DETS...........--....VLLLYSLVHGNSDFL.EYVLV.RTDLDTL.LMPVLEMLYNAS.......RRT.SN..
B6A9V3_CRYMR/1-794--SEYG........LKN--HILESYIFYFLIHSNSNFR.LYCMS.RGDPEYL.IVPILEVLYILP.......IQK.QRN.
H2KSV6_CLOSI/110-1035--LQQTYLPGSTKKVQM--HQELLVLFWRMCEINKKFM.YYVLK.SSQVLDL.LVPILYHLNDAR.......SDP.AR..
M4AQZ4_XIPMA/1-781--LIQTYLPRSTKKIHF--HQELLILFWKCCDFNKKFL.FFVLK.SSDVLEM.LVPILFYLNDAR.......ADQ.SR..
E0VG76_PEDHC/1-766--LVQTYLPNSTKKVQF--HQELLVFFWKLCDYNKKFL.YYVLK.SSDVLEI.LVPILYHLNDSR.......ADQ.SR..
B4MQL1_DROWI/1-832--LVQNYLPNSTKRLHC--HQELLILFWKICDYNKKFL.YFVLK.SSDVLDI.LIPILYHLNYSR.......ADQ.SR..
HID1_DICDI/1-880--ASHTKLPNSTKKIEL--HQDLTYTMWLFLSYNHDFL.RSIVN.YENSPEF.LIPLLQYMDEGR.......KSQ.TT..
W4XTN1_STRPU/1-721--LIQTYLPGSTKKIAF--HQELLVLFWKMCDHNKKFL.FYVLK.SSDVLEV.LVPILYHLNDAR.......ADQ.SR..
T1K251_TETUR/1-842--LQQTYIPNSTKRIQF--HQELLVLFWKICDYNKKFM.FYVLK.SSHVLDI.LVPILYHLNDSR.......SDQ.SR..
T1I7V2_RHOPR/1-802--LVQTYLPNSTKKVQF--HQELLVFFWKMCDYNKKFL.YYVLK.SSDVLEI.LVPILYHLNDSR.......ADQ.SR..
Q7QGJ8_ANOGA/1-825--LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR..
A0A068YEV3_ECHMU/1-732--TDSS...........--....VLLLYLLLHRNDFFR.AFVME.TRAYEKF.TFSICSLLYQSP.......AEN.SH..
J9KB63_ACYPI/1-736--LRQTYLPHSTKKVQF--HQELLIFFWKICEFNKKFL.YFVLK.SSDVLDV.LVPILYHLNDSR.......ADQ.SR..
Q17L03_AEDAE/1-819--LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR..
W4Z6Q3_STRPU/1-667--DDQS...........--....TLLLYLLLHQNINFR.NYVLS.RTNIDTL.VIPLLKILYNAQ.......ERN.SH..
W5JW75_ANODA/1-876--LVQSYLPNSTKRLHC--HQELLVFFWKICDYNKKFL.YFVLK.SSDVLDI.LVPILYHLNDSR.......ADQ.SR..
DYM_XENTR/1-646--SDQA...........--....TLLLYTLLHQNSNVR.TYVLA.RSDMENL.VLPILEILYHVE.......DRN.SH..
A8WTE9_CAEBR/1-690--QEPP...........--....MLLLYMLLQANSGFR.NYVLS.RINLENL.VVPVLRILHDGVAT.....SNN.SH..
M4C137_HYAAE/1-768--YETS...........--....HLMLYTLLYSNPAIL.NTALS.DRDMERL.LLPLLKTLYHAR.......YVE.PR..
B9HUR0_POPTR/1-672--DETA...........--....VLLLYTLVHGNSDFL.EYVLV.RTDLDTL.LMPILETLYSAS.......KRT.SN..
F6TGV4_CIOIN/1-683--YESS...........--....TLLLYSLLHGNPDVK.AFVLS.KTDIDSL.VTPILQILYFAP.......SQN.SH..
H3AL71_LATCH/1-849--LVQTYLPNSTKKIQF--HQELLVLFWKLCDFNKKFL.FFVLK.SSDVLDV.LVPILYFLNDAR.......ADQ.SR..

PF12722

C4XYD9_CLAL4/17-927-----------------KVLVK---------------------LCAYFLLYISSQETWVQALVL--------P-------
A3LX71_PICST/1-905-----------------KNLVR---------------------ICAYLMLYCSSDKN.LDSIFE--------P-------
Q6BSE0_DEBHA/1-924-----------------KNSVR---------------------IFSYFILYLSSDCLIMDKLFE--------P-------
C3Z701_BRAFL/1-784-----------------VGLMH---------------------IGVFILLLLSGERNFGVRLNK--------P-------
Q0E9B5_DROME/1-834-----------------VGLMH---------------------IGVFILLLLSGERNFGVRLNK--------A-------
B0WUT2_CULQU/1-851-----------------VGLMH---------------------IGVFILLLLSGERNFGVRLNK--------P-------
A7RKV1_NEMVE/1-693-----------------LGLMH---------------------IGVFILLLLSGERNFGVRLNK--------P-------
A8WRZ4_CAEBR/1-727-----------------VGLIH---------------------MGVFIILLLSGERNFGVRLNK--------P-------
A8NNK7_BRUMA/1-721-----------------VGLIH---------------------MGVFIILLLSGERNFGVRLNK--------P-------
C5K8E7_PERM5/1-865-----------------IGLLH---------------------MCSFIILVLSSDRDFAVALNA--------P-------
B6JW01_SCHJY/1-778-----------------FDHLK---------------------ICLIILRRLTTSKQFCEKLNI--------P-------
YIOC_SCHPO/1-796-----------------YNHLK---------------------LCVILLKRLTAEKYFCKRLNK--------P-------
Q2GWB4_CHAGB/1-825-----------------QGVVR---------------------MCAFLLQTLSVEKNFGVNLNK--------S-------
Q0UAJ2_PHANO/1-733-----------------QGLVR---------------------MCVFVLQTLSVEPNFGKSLNK--------T-------
B8M9N3_TALSN/1-838-----------------QGMVK---------------------MCIFILQTLSVEVSFGKRLNM--------K-------
C5FVH3_ARTOC/1-827-----------------NGLVK---------------------M....................--------K-------
C0NTS7_AJECG/1-843-----------------LGVVK---------------------MCIFILQTLSVEPNFGKNLNK--------K-------
B6HUK2_PENCW/1-841-----------------QGVVR---------------------MCVFILQTMSAEPTFAKSLNN--------S-------
Q5ASC1_EMENI/1-732-----------------QGVVR---------------------MCIFILQTMSVEPTFGKSLNK--------K-------

PF09742

F4WRP0_ACREC/1-730.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
E9H938_DAPPU/1-832.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
T1JUN4_TETUR/1-644...................HIY.....................MAVIILLILSEDALFNESIHD........I.....TL
J9F5Y0_WUCBA/1-661...................HVY.....................LALIVILILSEDDFFCKVAHE........T.....MI
B4JW54_DROGR/1-859.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........A.......
I1EYR3_AMPQE/506-1206...................HSY.....................MLLIILLILSQDECFNKSVHE........IKSLFQTV
E0VAE1_PEDHC/1-723...................HIY.....................MSLIILLILSEDGGFGQTVHQ........I.....TI
C1FEV8_MICSR/1-964...................ATYAEVGGSSPRGTTQLNVSGVASVATATLAMLSQDPVVNRAVHS........LSTSQRLA
G1MRD7_MELGA/1-648...................HVY.....................MALIILLILTEDDGFNRSIHE........V.....IL
D6WWB7_TRICA/1-769.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
H3BX91_TETNG/1-768.................VGLVH.....................IGVFILLLLSGERNFGVRLNK........P.......
F7D5K7_XENTR/1-770.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
H2SJN1_TAKRU/1-774.................VGLVH.....................IGVFILLLLSGERNFGVRLNK........P.......
B3RQA8_TRIAD/1-734.................IGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
I3JLL2_ORENI/1-646...................HVY.....................MALIILLILTEDDAFNRSIHE........V.....IL
G7DXH4_MIXOS/12-858.................LGLIR.....................LCAFILHSLSADRRFGSRLNGSADPQGILP.......
U1M0X7_ASCSU/1-660...................HVY.....................LSLIVILILSEDDFFCKIVHE........T.....MI
H2XV68_CIOIN/1-762.................VGLIH.....................IGVFILLLLSGERNFGVRLNK........P.......
Q5ZBZ3_ORYSJ/1-682...................QIY.....................MLLIVLLILSQDSTFNASVHK........L.....VL
D0NH97_PHYIT/1-769...................RLY.....................MLVIVLLTFTQDPSFVRTAHT........Q....LVV
T1FYR2_HELRO/1-642...................HLY.....................MALIIILILSEDANFSLAVHD........I....PIS
Q4DJF1_TRYCC/1-725.................FPHLQ.....................LVLFLLLRLSETRAFCLQCNA........L.......
I3KNU8_ORENI/1-782.................LGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
I3JCX3_ORENI/1-776.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
Q01H67_OSTTA/38-724...................VSQ.....................LIITSLLILSQDVGFNRLMQT........Q.....KC
Q38FE7_TRYB2/1-706NSSDDDIDGGQCAIPIVEDAITPEAVASIVRRMTAFSYPFISFMTGTLVLVCSQDQVINKRMSN..............TI
Q8RWV1_ARATH/1-679...................QIY.....................MMLIVLLILSQDSSFNSSIHK........M.....IL
I1MHZ5_SOYBN/1-671...................QIY.....................ILLIILLILSQDSSFNAGIHK........L.....IL
B0WBZ3_CULQU/1-681...................HIY.....................MSLIVLLILSEDDNFNKSVHE........I.....IL
F0Y4A0_AURAN/723-1436.................VGLVH.....................ICTFVLLKLSGERSFCVALNK........P.......
D7T740_VITVI/12-678...................QIY.....................MLLIILLILSQDSSFNASIHK........L.....IL
E1ZEP5_CHLVA/1-748...................QMY.....................MLLIILLMLSQDTAFAQNVHK........I.....GL
M4BPB3_HYAAE/1-729.................VGMIH.....................ICTFILLLLSGERDFGVNLNK........P.......
Q5CRW2_CRYPI/1-755................NLCQLI.....................ALLSIILRLTNDLNMCKVLSY........T.....YI
A0A087VXA6_ECHMU/1-876.................LGLMH.....................IGVFIILLLSGERNFGVRLNK........P.......
DYM_DROME/1-676...................HIY.....................MSLIVLLILSEDEGFNKNVHT........I.....ML
H0VNU2_CAVPO/1-646...................HVY.....................MALIILLILTEDDGFNRSIHE........V.....IL
E9ICM4_SOLIN/1-654...................HIY.....................MSLIILLILSEDETFNKRIHE........I.....ML
L9KZV5_TUPCH/1-826.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
E9G1Z8_DAPPU/1-633...................HLY.....................MSLIILLLLSEDEGFNSNIHN........V.....VV
D7FT96_ECTSI/1-808.................GGLIH.....................ICTFVLLKLSGERAFGVAINK................
H2MFX7_ORYLA/1-772.................VGLVH.....................IGVFILLLLSGERNFGVRLNK........P.......
B7S488_PHATC/1-694.................IGLVH.....................ICTFVLLKLSGERSFGVALNQ........K.......
W1NV48_AMBTC/1-680...................QIY.....................MLLIILLILSQDSSFNASIHK........L.....IL
B6A9V3_CRYMR/1-794.............VIIGTCHLI.....................PLLTILTKLTDEPNYCKALHR........T.....II
H2KSV6_CLOSI/110-1035.................LGLVH.....................VGVFILLLLSGERNFGVRLNK........P.......
M4AQZ4_XIPMA/1-781.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
E0VG76_PEDHC/1-766.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
B4MQL1_DROWI/1-832.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........A.......
HID1_DICDI/1-880.................HGIVQ.....................IGTFILLLLSGERDFSISLNK........P.......
W4XTN1_STRPU/1-721.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
T1K251_TETUR/1-842.................IGLIH.....................IGVFILLLLSGERNFGVRLNK........P.......
T1I7V2_RHOPR/1-802.................VGLMH.....................IGVFIILLLSGERNFGVRLNK........P.......
Q7QGJ8_ANOGA/1-825.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
A0A068YEV3_ECHMU/1-732...................LVY.....................MALIVLLILTENENFAKDVHD........I.....PV
J9KB63_ACYPI/1-736.................IGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
Q17L03_AEDAE/1-819.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
W4Z6Q3_STRPU/1-667...................HIY.....................MTLIILLILSEDDSFNKCVHE........L.....MV
W5JW75_ANODA/1-876.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......
DYM_XENTR/1-646...................HVY.....................MALIILLILTEDDGFNRSIHE........V.....IL
A8WTE9_CAEBR/1-690...................HVY.....................LALIVALILSEDDIFCKIIHE........T....VPI
M4C137_HYAAE/1-768...................RLY.....................MLIIVLLIFTQNPTFVRTAHT........L....LVV
B9HUR0_POPTR/1-672...................HIY.....................ILLIILLILSQDSSFNASIHK........I.....VL
F6TGV4_CIOIN/1-683...................HIY.....................MALIILLMFTEDDHFNKYVHD........I.....RL
H3AL71_LATCH/1-849.................VGLMH.....................IGVFILLLLSGERNFGVRLNK........P.......

PF12722

C4XYD9_CLAL4/17-927-------------------------MSENMNEVLP.......SEFRLT-------GGPHSTRDFLIVQLCSILSYVFSGF
A3LX71_PICST/1-905-------------------------MDHNLYESLP.......TNYKTN-------PAPTTTRDFLVTQICNLLIYMQTPQ
Q6BSE0_DEBHA/1-924-------------------------MDLTFYESLP.......TGYKIS-------PGPVTYRDFIVTQICKLLITLSSGS
C3Z701_BRAFL/1-784-------------------------YTV....RVP.........MDIP-------VFTGTHADFLIIVFHKII.......
Q0E9B5_DROME/1-834-------------------------YSA....TVP.........MDIP-------VFTGTHADLLITVFHKII.......
B0WUT2_CULQU/1-851-------------------------YTA....TVP.........MDIP-------VFTGTHADLLITVFHKII.......
A7RKV1_NEMVE/1-693-------------------------YAV....RVP.........MDIP-------VFTGTHADFLVVVFHKII.......
A8WRZ4_CAEBR/1-727-------------------------YTA....KAN.........INIQ-------TFTGTHADLLILVFHKLI.......
A8NNK7_BRUMA/1-721-------------------------YTP....RAA.........IDVQ-------SFTGTHADLLILVFHKLI.......
C5K8E7_PERM5/1-865-------------------------FRG...SRIQ..........DVP-------VFTGTWADLMTLSIYRVVSDALFVA
B6JW01_SCHJY/1-778-------------------------FEQ..LSSLP.......TNRRVP-------FSKGSYADFSVTAMTSII.......
YIOC_SCHPO/1-796-------------------------FQQ..QTALP.......ISMPVP-------FEGGTYADFTIIAISLLV.......
Q2GWB4_CHAGB/1-825-------------------------FDA..QDTLPLLSALLASGARMG-------TFSSSQSIYVLI.............
Q0UAJ2_PHANO/1-733-------------------------FEG..QESLP.......PSIRIP-------NFHGTYADYVIT.............
B8M9N3_TALSN/1-838-------------------------FEA..QDTLP.......TSIRIA-------GFRGTYADYLIISIHTLM.......
C5FVH3_ARTOC/1-827-------------------------FEA..QDTLP.......PSIRLE-------NFGGTYGDFLIISIHTLM.......
C0NTS7_AJECG/1-843-------------------------FES..QDTLP.......QSIRLQ-------NFRGSYADFLIISIHTLL.......
B6HUK2_PENCW/1-841-------------------------FEA..QETLP.......QSIRLP-------KFRGSYGDYLITSIHTLM.......
Q5ASC1_EMENI/1-732-------------------------FEA..QDTLP.......QSIRIP-------GFKGSYADFLLI.............

PF09742

F4WRP0_ACREC/1-730.........................Y.T---ATVP---------MDIP....VFT...GTHADLLVTVFHKII-------
E9H938_DAPPU/1-832.........................Y.T---ATVP---------MDIP....VFT...GTHADLLVVVFHKII-------
T1JUN4_TETUR/1-644KNIT....................WY.S---ERTL---------PEIS............LGGLIILMIIRTV-------
J9F5Y0_WUCBA/1-661KDTT....................WFNS---ERPL---------GEIS............LGGLIILVFVRII-------
B4JW54_DROGR/1-859.........................Y.S---ATVP---------MDIP....VFT...GTHADLLITVFHKII-------
I1EYR3_AMPQE/506-1206KNIT....................WA.S---EKSI---------PQTT............LGSLMIIVLVRTV-------
E0VAE1_PEDHC/1-723KNVT....................WY.H---EKVL---------TEIS............LGGLLLLVVIRTI-------
C1FEV8_MICSR/1-964SSSNDSQLNDSQLNDSQLNDRTDFWFNS---SASA---------KTLSGFKSIGKPPQQTLGSAWVLVLCRVA-------
G1MRD7_MELGA/1-648KNIT....................WY.A---ERVL---------TEIS............LGSLLILVVIRTI-------
D6WWB7_TRICA/1-769.........................Y.T---ATIP---------MDIP....VFT...GTHADLLIIVFHKII-------
H3BX91_TETNG/1-768.........................Y.I---LRVP---------MDIP....VFT...GTHADLLIVIFHKII-------
F7D5K7_XENTR/1-770.........................Y.S---VPFP---------MDIP....VFT...GTHADLLIVVFHKII-------
H2SJN1_TAKRU/1-774.........................Y.V---LRVP---------MDIP....VFT...GTHADLLIVIFHKIV-------
B3RQA8_TRIAD/1-734.........................F.S---AKVP---------MDLP....VFN...GTHIDFLVIVFHKVI-------
I3JLL2_ORENI/1-646KNVS....................WY.T---ERSL---------TEIS............LGSLLILVVIRTI-------
G7DXH4_MIXOS/12-858.........................A.R---HAVP---------..............GSTADFLVVSIAQLV-------
U1M0X7_ASCSU/1-660KNTS....................WYQA---ERPI---------GEVS............LGGLIILVFVRTI-------
H2XV68_CIOIN/1-762.........................F.S---AAAP---------TDVP....AFA...GTHADFLVLVFHRVI-------
Q5ZBZ3_ORYSJ/1-682PSVP....................WY.H---ERLM---------HQTS............LGSLMVVILIRTI-------
D0NH97_PHYIT/1-769PNVS....................WY.Q---EHYM---------LDVS............LGSLMMVIFTRLI-------
T1FYR2_HELRO/1-642KQIP....................WF.N---ERQL---------GEIS............LGGLMVLVLVRTI-------
Q4DJF1_TRYCC/1-725.........................F.H---ERIP---------FEFE....SFV...GTYNDLLIIMLCSFI-------
I3KNU8_ORENI/1-782.........................Y.A---LRVP---------MDIP....VFT...GTHADLLIVIFHKII-------
I3JCX3_ORENI/1-776.........................Y.S---LHVP---------MDIP....VFT...GTHADLLIVVFHKII-------
Q01H67_OSTTA/38-724SSTA....................WY.K---ERII---------EKSS............MGSLMFVVLSRAL-------
Q38FE7_TRYB2/1-706AETT.....................FKV---GRLV---------GRCP............VIAVCIVIIVHSI-------
Q8RWV1_ARATH/1-679PSVP....................WY.K---EHLL---------HQTS............LGSLMVIILIRTV-------
I1MHZ5_SOYBN/1-671PTVP....................WY.K---ERLL---------LQSS............LGSLMVIILIRTI-------
B0WBZ3_CULQU/1-681KNIT....................WY.T---ERSI---------SEIS............LGGLLILVVIRTI-------
F0Y4A0_AURAN/723-1436.........................Y.E---ARLP---------ADLP....LFS...GSHVDLLVVVLHKMV-------
D7T740_VITVI/12-678PSVP....................WY.K---ERLL---------HQTS............LGSLMVIILIRTV-------
E1ZEP5_CHLVA/1-748PSVP....................FY.R---ERSS---------TRTT............LGSLLVVLLLRTA-------
M4BPB3_HYAAE/1-729.........................F.T---NHLP---------LDLP....PFS...GNHADLLIVCLHKII-------
Q5CRW2_CRYPI/1-755ESLPHWLEDDSLKKVIHKCSGN.....K---EKSG---------FELS......ENHSISIGNILIAVLLRAM-------
A0A087VXA6_ECHMU/1-876.........................Y.S---NRAS---------FDIT....VFT...GNHADLLIIVFHKII-------
DYM_DROME/1-676KNIT....................WY.T---ERTI---------SEIS............LGGILILIVIRTI-------
H0VNU2_CAVPO/1-646KNIT....................WY.S---ERVL---------TEIS............LGSLLILVVIRTI-------
E9ICM4_SOLIN/1-654KSVT....................WY.T---ERSI---------SEIS............LGGLLILVVIRTI-------
L9KZV5_TUPCH/1-826.........................Y.S---VRVP---------MDIP....VFT...GTHADLLIVVFHKII-------
E9G1Z8_DAPPU/1-633RNPL....................WY.T---DRVL---------NEIS............LGGLAVLVIARTI-------
D7FT96_ECTSI/1-808.........................ACS---VRLP---------TDLP....LFY...GSHLDLLILTVHKLL-------
H2MFX7_ORYLA/1-772.........................Y.T---LRVP---------MDIP....VFT...GTHADLLIVIFHKVI-------
B7S488_PHATC/1-694.........................F.T---KKLP---------TDLP....LFR...GCHADLLTITLHKLV-------
W1NV48_AMBTC/1-680PSVP....................WY.Q---ERLL---------HHTS............LGSLMVVILIRTV-------
B6A9V3_CRYMR/1-794GSLPDWLKDSSLNKTIGMY........Q---GQNY---------YSNSTYEYAISDSIVSLGSLIILTLIKLL-------
H2KSV6_CLOSI/110-1035.........................Y.K---NRAA---------LDIP....VFT...GTHADVLIIVFHKLI-------
M4AQZ4_XIPMA/1-781.........................Y.T---LRVP---------MDIP....VFT...GTHADLLIVIFHKII-------
E0VG76_PEDHC/1-766.........................Y.T---ATVP---------MDIP....VFT...GTHADLLIVVFHKVI-------
B4MQL1_DROWI/1-832.........................Y.S---ATIP---------MDIP....VFT...GTHADLLITVFHKII-------
HID1_DICDI/1-880.........................F.V---GRIH---------IDIQ.QPQVYS.......DFVITVMYRLL-------
W4XTN1_STRPU/1-721.........................Y.S---VRVP---------MDIP....VFT...GTHADFLIIVFHKII-------
T1K251_TETUR/1-842.........................Y.A---ASIP---------MDLP....IFT...GTHADLLIIVFHKLI-------
T1I7V2_RHOPR/1-802.........................Y.T---ATIP---------MDIP.SHLFFTFCSGTHADLLITVFHKII-------
Q7QGJ8_ANOGA/1-825.........................Y.T---ATVP---------MDIP....VFT...GTHADLLITVFHKII-------
A0A068YEV3_ECHMU/1-732KKPP....................PN.V---ERQL---------TGVS............LGSLLVYVLTRTI-------
J9KB63_ACYPI/1-736.........................Y.T---TTIP---------MDIP....VFS...GTHADLLIIVFHKII-------
Q17L03_AEDAE/1-819.........................Y.T---ATVP---------MDIP....VFT...GTHADLLITVFHKII-------
W4Z6Q3_STRPU/1-667KQVT....................WY.T---DRTI---------TEIT............LGGLIVLVVIRTI-------
W5JW75_ANODA/1-876.........................Y.T---ATVP---------MDIP....VFT...GTHADLLITVFHKII-------
DYM_XENTR/1-646KNIT....................WY.T---ERVL---------TEIS............LGSLLILVVIRTI-------
A8WTE9_CAEBR/1-690KDLG....................WLDS---DFSV---------REIS............LGGLTALVFIRAI-------
M4C137_HYAAE/1-768PNVS....................WY.Q---EQYM---------LDIP............LGSLMMVIFTRLI-------
B9HUR0_POPTR/1-672PSIP....................WY.Q---EHLL---------HRTS............LGSLMVIILIRTV-------
F6TGV4_CIOIN/1-683PTVP....................WY.T---DRIL---------SDIS............LGDLIILVVIRTI-------
H3AL71_LATCH/1-849.........................Y.S---VRVP---------MDIP....VFT...GTHADLLIIVFHKII-------

PF12722

C4XYD9_CLAL4/17-927GSNPKSDTANEMKR-------------------------------FLVPTF-----------SEVLYN--IVPV.VNDSI
A3LX71_PICST/1-905STYTYGATLTPSP.-------------------------------LMVTTL-----------VEILYN--LIPPVATKSL
Q6BSE0_DEBHA/1-924N.....NTNNAKPS-------------------------------LLLTTL-----------VEILYN--LIPVVSSKDI
C3Z701_BRAFL/1-784......TTGHQRLQ-------------------------------PLFDCL-----------LTIIVN--VSPY......
Q0E9B5_DROME/1-834......ATGHQRLQ-------------------------------PLFDCL-----------LTILVN--VSPY......
B0WUT2_CULQU/1-851......ATGHQRLQ-------------------------------PLFDCL-----------LTILVN--VSPY......
A7RKV1_NEMVE/1-693......TTGHQRLQ-------------------------------PLFDCL-----------LTIIVN--VSPY......
A8WRZ4_CAEBR/1-727......TTGNYRLQ-------------------------------SLFDCF-----------LTIMVN--VSPY......
A8NNK7_BRUMA/1-721......TTGNHRLQ-------------------------------SLFDCL-----------LTIIVN--VSPY......
C5K8E7_PERM5/1-865ATAKSPTTGAE...-------------------------------SLIDMM-----------LTSLCN--ISAY......
B6JW01_SCHJY/1-778......TACKDYQS-------------------------------EAVLLL-----------TETLSY--LVKY......
YIOC_SCHPO/1-796......QYTKDYHS-------------------------------EIAQML-----------CCSLCY--LCLY......
Q2GWB4_CHAGB/1-825......TTSQGKLT-------------------------------AVYPAL-----------LAVINN--IAAY......
Q0UAJ2_PHANO/1-733..............-------------------------------......-----------......--..........
B8M9N3_TALSN/1-838......TSSKGKLD-------------------------------AVYPAL-----------MAILKN--IGPY......
C5FVH3_ARTOC/1-827......TTSKGKLD-------------------------------AVYPAL-----------LAIINN--VAAY......
C0NTS7_AJECG/1-843......TTSKGKLD-------------------------------AVYPAL-----------LAIINN--IGAY......
B6HUK2_PENCW/1-841......TTSKGNLD-------------------------------TVYPAL-----------LIILNN--IAPY......
Q5ASC1_EMENI/1-732..............-------------------------------......-----------......--..........

PF09742

F4WRP0_ACREC/1-730------TTGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
E9H938_DAPPU/1-832------TTGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
T1JUN4_TETUR/1-644------QYNISRTR................D.............KFLHTNL...........LATLAN..MSNH------
J9F5Y0_WUCBA/1-661------QLNTLKTK................D.............RYLHTNC...........LAALAN..MSSY------
B4JW54_DROGR/1-859------ATGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
I1EYR3_AMPQE/506-1206------HRNIQHLR................D.............KFLHTNC...........LATLAN..MSSH------
E0VAE1_PEDHC/1-723------HYNMLKMR................D.............KYLHTNC...........LAALAN..MSNN------
C1FEV8_MICSR/1-964------RGGGIEKG................DVTSGEGGIEPATSSFARACA...........LAALAN..SAPY------
G1MRD7_MELGA/1-648------QYNMTRTR................D.............KYLHTNC...........LAALAN..MSSQ------
D6WWB7_TRICA/1-769------TTGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
H3BX91_TETNG/1-768------SSGHQRLQ...............................PLFDCL...........LTVIVNTTVSPY------
F7D5K7_XENTR/1-770------TSGHQRLQ...............................PLYDCL...........LTIIVN..VSPY------
H2SJN1_TAKRU/1-774------SSGHHRLQ...............................PLFDCL...........LTVIVN..ISPY------
B3RQA8_TRIAD/1-734------TTGHQRLA...............................PIFDCL...........LTVLVN..VSPY------
I3JLL2_ORENI/1-646------QFNMTRTR................D.............KYLHTNC...........LAALAN..MSAQ------
G7DXH4_MIXOS/12-858------FTTKGSLN...............................TLYSTY...........AIILAN..TSPY------
U1M0X7_ASCSU/1-660------QLNTLKTR................D.............RYLHTNC...........LAALAN..MSSS------
H2XV68_CIOIN/1-762------TAGHQRLQ...............................PLYDCL...........LTIIVN..VSPY------
Q5ZBZ3_ORYSJ/1-682------KYNLSKLR................D.............VYLHTNC...........LAILAN..MAPH------
D0NH97_PHYIT/1-769------FRNITHFQ................D.............SFIHLNA...........FAALSN..LARS------
T1FYR2_HELRO/1-642------QYNMTRMR................D.............QYLHTNC...........LGALAN..MSSH------
Q4DJF1_TRYCC/1-725------LLRHELIR...............................PLHVTC...........SAIISN..IAPF------
I3KNU8_ORENI/1-782------SSGHQRLQ...............................PLFDCL...........LTIIVN..ISPY------
I3JCX3_ORENI/1-776------TTGHQRLQ...............................PLFDCL...........LTIIVN..VSPY------
Q01H67_OSTTA/38-724------KYNCSESTK............ISRD.................LSV...........LGVIAN..MAGV------
Q38FE7_TRYB2/1-706------ARALNDGN..............................EALAAVF...........IPCLAN..FAPF------
Q8RWV1_ARATH/1-679------QHNLSKLR................D.............VYLQTTC...........LATLAN..MAPH------
I1MHZ5_SOYBN/1-671------QYNLSKLR................D.............VYLHTTC...........LATLAN..LAPH------
B0WBZ3_CULQU/1-681------QYNMLKMR................D.............KYLHTNC...........LAALAN..MSGQ------
F0Y4A0_AURAN/723-1436------VNGGDRLA...............................PLYNCF...........LTVLCN..LSPY------
D7T740_VITVI/12-678------KYNLSKLR................D.............VYLHTNC...........LATLAN..MAPH------
E1ZEP5_CHLVA/1-748------HYNLAKLR................D.............VYLHTNT...........LAALAN..LAPH------
M4BPB3_HYAAE/1-729------VSGYEKLN...............................SVYNCF...........LTIICN..ISPY------
Q5CRW2_CRYPI/1-755------FYNYKFGK................D.............IYLCSII...........YSIIEN..ISIY------
A0A087VXA6_ECHMU/1-876------TTGHQCLQ...............................PLFDCL...........ITIIDN..VSPY------
DYM_DROME/1-676------QYNMLKMR................D.............KYLHTNC...........LAALAN..MSGH------
H0VNU2_CAVPO/1-646------QYNMTRTR................D.............KYLHTNC...........LAALAN..MSAQ------
E9ICM4_SOLIN/1-654------QYNMFKMR................D.............KYLHTNC...........LAALAN..MSAQ------
L9KZV5_TUPCH/1-826------TSGHQRLG...............................PLFLRLPAHHRGQRSEPLPHLPT..VSPY------
E9G1Z8_DAPPU/1-633------QRNIVKAS................D.............KYLHTNC...........LATLAN..MAAH------
D7FT96_ECTSI/1-808------VAGSDRLS...............................TLYHCF...........LTVLCN..VSPY------
H2MFX7_ORYLA/1-772------TSGHQRLH...............................PLFDCL...........LTIIVN..ISPY------
B7S488_PHATC/1-694------VNGAYKLV...............................PLYSCF...........LTIITN..ISPY------
W1NV48_AMBTC/1-680------KYNMSKLR................D.............VYLHTNC...........LATLAN..MAPH------
B6A9V3_CRYMR/1-794------LWNSKTHS................D.............IFLCELA...........CVIIQN..LSSS------
H2KSV6_CLOSI/110-1035------TTGHRRLQ...............................PLFDCL...........LTIIVN..VSPY------
M4AQZ4_XIPMA/1-781------TCGHQRLH...............................PLFDCL...........LTIIVN..ISPY------
E0VG76_PEDHC/1-766------TTGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
B4MQL1_DROWI/1-832------ATGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
HID1_DICDI/1-880------VDTPDRLE...............................SIYECV...........LTILSN..LSPY------
W4XTN1_STRPU/1-721------TSGHQRLQ...............................PLYDCL...........LTIIVN..VSPY------
T1K251_TETUR/1-842------TAGHQRLQ...............................PLFECL...........LTIIVN..VSPY------
T1I7V2_RHOPR/1-802------TTGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
Q7QGJ8_ANOGA/1-825------ATGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
A0A068YEV3_ECHMU/1-732------RHHLNQLR................D.............KYLHINS...........LAALAN..LSPK------
J9KB63_ACYPI/1-736------TTGHNRMQ...............................PLFDCL...........LTILVN..VSPY------
Q17L03_AEDAE/1-819------ATGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
W4Z6Q3_STRPU/1-667------QYNMTRMR................D.............KYLHTNC...........LAALAN..MSSQ------
W5JW75_ANODA/1-876------ATGHQRLQ...............................PLFDCL...........LTILVN..VSPY------
DYM_XENTR/1-646------QYNMTRTR................D.............KYLHTNC...........LAALAN..MSAQ------
A8WTE9_CAEBR/1-690------QKNALKTKVSSVFLFPNTIPLIKQD.............RYLHTNC...........LAALAN..MSAF------
M4C137_HYAAE/1-768------FRNITHFQ................D.............NFIHLNA...........FAALSN..LARS------
B9HUR0_POPTR/1-672------KYNLSKLR................D.............LYLHTTC...........LATLAN..MAPH------
F6TGV4_CIOIN/1-683------QFNMSRMR................D.............RYLHTNC...........LAALAN..MSAH------
H3AL71_LATCH/1-849------TSGHQRLQ...............................PLFDCL...........LTIIVN..VSPY------

PF12722

C4XYD9_CLAL4/17-927VGTDDTSKRMNNVNSKGGLSYQACSALLQLMSTLSSKQALA---ESYR--------------------------------
A3LX71_PICST/1-905EATNDPAKKLTNSNPNGGLSYSTCSVINLLIGKYSSRTFLQ---EKSI--------------------------------
Q6BSE0_DEBHA/1-924EVKDDPEKKLGNSNPRGGLSYGACSSITQLILKFSTRPFLL---DASF--------------------------------
C3Z701_BRAFL/1-784...............LKSLSMVASTKLLHLLEAFSTPWFLF---SNPS--------------------------------
Q0E9B5_DROME/1-834...............LKTLSMVASVKMLHLLEAFSTPWFLL---SAPS--------------------------------
B0WUT2_CULQU/1-851...............LKTLSMVASIKLLHLLEAFSTPWFLY---SAPS--------------------------------
A7RKV1_NEMVE/1-693...............LKSLSMVAANKLLHLLEAFSTPWFLF---ANPT--------------------------------
A8WRZ4_CAEBR/1-727...............MKSLSMVAANKLVHLVEAFSTPWFLF---SSPT--------------------------------
A8NNK7_BRUMA/1-721...............LKSISMIAANKLIHLIEAFSTPWFLF---SSPT--------------------------------
C5K8E7_PERM5/1-865...............VRTFCLESCIKILNLVERFSKPHWLF---KGPL--------------------------------
B6JW01_SCHJY/1-778...............VDNITIASSRRLVKLFVNVSDLGFLL---ANPT--------------------------------
YIOC_SCHPO/1-796...............AQNLNSHSSQSLFELFQSASYPGFLI---SNDV--------------------------------
Q2GWB4_CHAGB/1-825...............LEGLSGPTCSRIMQLFNSMSSPSFLL---ANDS--------------------------------
Q0UAJ2_PHANO/1-733.............................LFASMSSPSFLF---ANEN--------------------------------
B8M9N3_TALSN/1-838...............VERLSSTACSKILQLFASMSSPSFLL---ANET--------------------------------
C5FVH3_ARTOC/1-827...............AQRLSPACAFKILQLFVSMSSPSFLL---ANET--------------------------------
C0NTS7_AJECG/1-843...............CEHLSATTCSKIIQLFSLLSSPSFLL---ANES--------------------------------
B6HUK2_PENCW/1-841...............IERISPSACSKVIQLFTSMSSPSFLL---ANES--------------------------------
Q5ASC1_EMENI/1-732.............................LFTSMSAPSFLL---ANES--------------------------------

PF09742

F4WRP0_ACREC/1-730---------------LKTLSMVASTKLLHLLEAFSTPWFLF...SAPT................................
E9H938_DAPPU/1-832---------------LKTLSMVASTKLLHLLEAFSTPWFLF...SAPN................................
T1JUN4_TETUR/1-644---------------FRRLSPYVCQRLVTLFEKISKKLHKILNSQNAI................................
J9F5Y0_WUCBA/1-661---------------FKNLSSIVCQKLIGLLEVFTRRHAKL...IENM................................
B4JW54_DROGR/1-859---------------LKTLSMVASVKLLHLLEAFSTPWFLL...SAPS................................
I1EYR3_AMPQE/506-1206---------------FHSLSLEAAEKIVNLFRVLSRKYLKS.......................................
E0VAE1_PEDHC/1-723---------------FCNLNSYVSQRLLSLFETLAKKYHRLEITLKTNMVKINSETRENDDGEKENSFVEMGKNSTTSQS
C1FEV8_MICSR/1-964---------------FDGLTSAASQRLVAVFDVLHRRRRKR...VSAAMGRPGIE.........................
G1MRD7_MELGA/1-648---------------FRSLHQYAAQRIIRLFGIFSELHNKA...LASA................................
D6WWB7_TRICA/1-769---------------LKTLSMVASTKLLHLLEAFSTPWFLF...SSST................................
H3BX91_TETNG/1-768---------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ................................
F7D5K7_XENTR/1-770---------------LKSLSMVASNKLLHLLEAFSSTWFLF...SSPQ................................
H2SJN1_TAKRU/1-774---------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ................................
B3RQA8_TRIAD/1-734---------------SKTLSIVASNKLLHLLEAFSTPWFLF...SNNN................................
I3JLL2_ORENI/1-646---------------FRCLHQYAAQRIISLFALLSKKHNKV...LEQA................................
G7DXH4_MIXOS/12-858---------------WKATSVLASQRLLQLFMAMSAPSFLL...AEEG................................
U1M0X7_ASCSU/1-660---------------FKQLSSTVCQKLIGLLELFTKRHAKL...IKHM................................
H2XV68_CIOIN/1-762---------------LKSLSMTAASKLLHLLEAFSTPWFLF...SSPQ................................
Q5ZBZ3_ORYSJ/1-682---------------VHRLSAYASQRLVSLFDMLSRKYTKL...AELK................................
D0NH97_PHYIT/1-769---------------AENLHMYAAQGIVGLIDMLAKNEAKL.......................................
T1FYR2_HELRO/1-642---------------FMNLHPYVAQRLVSLFALLLKKHKKAADRLKEI................................
Q4DJF1_TRYCC/1-725---------------MIKISPVSSEKLGLVFTSVSTRYLAY...KALF................................
I3KNU8_ORENI/1-782---------------LKSLSMVAANKLLHLLEAFSTPWFLF...SSPQ................................
I3JCX3_ORENI/1-776---------------LKSLSMVAANKLLHLLEAFSTTWFLF...SAAQ................................
Q01H67_OSTTA/38-724---------------TRDISGYAAQRLVNILELLTKKRARL...LSAENKDLQE..........................
Q38FE7_TRYB2/1-706---------------VHDIDVYTSQRLVGLLLLTLRKVQRT...AEHA................................
Q8RWV1_ARATH/1-679---------------AHHLSAYASQRLVSLFYMLSRKYNKL...SDLT................................
I1MHZ5_SOYBN/1-671---------------VHRLSAYASQRLVSLFGMLSRKYNKL...ADLR................................
B0WBZ3_CULQU/1-681---------------FRSLHPYVAQRLVSLFETLAKKHARLDQQLRQP................................
F0Y4A0_AURAN/723-1436---------------AKCIDLVAAVKLVNLFELFTSPKFLY...AAEA................................
D7T740_VITVI/12-678---------------AHRLSAYASQRLVSLFDMLSRKYNKL...AELM................................
E1ZEP5_CHLVA/1-748---------------MSGLSTHAAQRLVSLFHLLARRYSRL...QAAA........EGMPPPPTPNDLLSPSLESPLTPW
M4BPB3_HYAAE/1-729---------------CKKLNMVSAVRLMRLFKLFAQPRYLF...DNEA................................
Q5CRW2_CRYPI/1-755---------------MKNFHWHVAEKITHYLIFLSSQIYCS...LNTY................................
A0A087VXA6_ECHMU/1-876---------------VKSLSMVSASKLMHLTEAFSQPWFLF...SSPN................................
DYM_DROME/1-676---------------FRALHPYVAQRLVSLFETLARKHTRLDAQLKEP................................
H0VNU2_CAVPO/1-646---------------FRSLHQYAAQRIISLFSLLSKKHNKV...LEQA................................
E9ICM4_SOLIN/1-654---------------FTSLHPYVSQRLLSLFETLAKKHARLEARILEQ................................
L9KZV5_TUPCH/1-826---------------LKSLSMVTANKLLHLLEAFSTPWFLF...SAAQ................................
E9G1Z8_DAPPU/1-633---------------FRRLHPYTCQRLVSLLCTLNKRRIRV...VQQI................................
D7FT96_ECTSI/1-808---------------AKGLSLIASVKLLSLFELFTSPGNLY...ASEA................................
H2MFX7_ORYLA/1-772---------------LKSLSMVAANKLLHLLEAFSAPWFLL...SAQR................................
B7S488_PHATC/1-694---------------WKSMSLVAAVKLVNLFELFASPKFLY...SGEF................................
W1NV48_AMBTC/1-680---------------VHRLSAYASQRLVSLFDMLARKYTKL...AELR................................
B6A9V3_CRYMR/1-794---------------VENFHWIVSEKTLQYCNILISRINGI...LSLQ................................
H2KSV6_CLOSI/110-1035---------------LKSMSMVTANKLLHLLEAFSQPWFLY...SGQT................................
M4AQZ4_XIPMA/1-781---------------LKSLSMVAANKLLHLLEAFSMPWYLL...SAPQ................................
E0VG76_PEDHC/1-766---------------LKTLSMVSSTKLLHLLEAFSTPWFLL...SAPS................................
B4MQL1_DROWI/1-832---------------LKTLSMVASVKLLHLLEAFSTPWFLL...SAPS................................
HID1_DICDI/1-880---------------MKNLSMVTCVKLMKLFEYLSTPRFLF...ATNH................................
W4XTN1_STRPU/1-721---------------LKSLSMVSANKMLHLLEAFSTPWFLF...SSPS................................
T1K251_TETUR/1-842---------------LKTLSMVSANKLLHLLEAFSTPWFLY...SNPI................................
T1I7V2_RHOPR/1-802---------------LKTLSMVASTKLLHLLEAFSTPWFLF...SSPS................................
Q7QGJ8_ANOGA/1-825---------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS................................
A0A068YEV3_ECHMU/1-732---------------IANLHPYVSQALVDLLQKLVKRHKRL...VNEI................................
J9KB63_ACYPI/1-736---------------LKTLSMVSSTKLLHLVDAFTTPWFLF...SSPS................................
Q17L03_AEDAE/1-819---------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS................................
W4Z6Q3_STRPU/1-667---------------FHSLHPYVTQRIVSLFELLIKKHDKI...VEQL................................
W5JW75_ANODA/1-876---------------LKTLSMVASIKLLHLLEAFSTPWFLY...SAPS................................
DYM_XENTR/1-646---------------FRSLHQYAAQRIISLFSLLSKKHNKV...LEQA................................
A8WTE9_CAEBR/1-690---------------FKNLAPIVCQRLISLLDLLTKRHAKM...VDHM................................
M4C137_HYAAE/1-768---------------AENLHIYAAQGLIGLIEMLAKNEAKL...VAQMKYLKSTDK........................
B9HUR0_POPTR/1-672---------------FHHLSAYASQRLVSLFYMLSRKYNKL...AERI................................
F6TGV4_CIOIN/1-683---------------FRSLHPYAAQRIFSLVTLLTKKYRKL...TEKV................................
H3AL71_LATCH/1-849---------------LKSLSMVAANKLLHLLEAFSTTWFLF...SAPQ................................

PF12722

C4XYD9_CLAL4/17-927--------------------------------------------------------------NAEFLAL-----------
A3LX71_PICST/1-905--------------------------------------------------------------NSDLLAL-----------
Q6BSE0_DEBHA/1-924--------------------------------------------------------------NADLLAL-----------
C3Z701_BRAFL/1-784--------------------------------------------------------------NHHLVFF-----------
Q0E9B5_DROME/1-834--------------------------------------------------------------NHHLVFF-----------
B0WUT2_CULQU/1-851--------------------------------------------------------------NHHLVFF-----------
A7RKV1_NEMVE/1-693--------------------------------------------------------------NHHLVFF-----------
A8WRZ4_CAEBR/1-727--------------------------------------------------------------NPQLVFS-----------
A8NNK7_BRUMA/1-721--------------------------------------------------------------NHLLIFF-----------
C5K8E7_PERM5/1-865--------------------------------------------------------------NHNAVFF-----------
B6JW01_SCHJY/1-778--------------------------------------------------------------NFKSTKN-----------
YIOC_SCHPO/1-796--------------------------------------------------------------NHKILKY-----------
Q2GWB4_CHAGB/1-825--------------------------------------------------------------NHSLLRS-----------
Q0UAJ2_PHANO/1-733--------------------------------------------------------------NHTLLQS-----------
B8M9N3_TALSN/1-838--------------------------------------------------------------NNYLLSA-----------
C5FVH3_ARTOC/1-827--------------------------------------------------------------NHLLLSS-----------
C0NTS7_AJECG/1-843--------------------------------------------------------------NHILLHS-----------
B6HUK2_PENCW/1-841--------------------------------------------------------------NHTLLAS-----------
Q5ASC1_EMENI/1-732--------------------------------------------------------------NHALLAS-----------

PF09742

F4WRP0_ACREC/1-730..............................................................NHHLVFF...........
E9H938_DAPPU/1-832..............................................................NHHLVFF...........
T1JUN4_TETUR/1-644.............................NGNGGDSGEKLSDKDTDVASTVGPLDPTQDTSIYEEVLRM...........
J9F5Y0_WUCBA/1-661.....................................RVRAEYDIIQE..KESHNYHKDITALEEGIRT...........
B4JW54_DROGR/1-859..............................................................NHHLVFF...........
I1EYR3_AMPQE/506-1206.............................KGEPIPAITGAQPTSPTTPTSPTTPTELADTETLQEILLM...........
E0VAE1_PEDHC/1-723KPNEENSVKETIINGTHESDKEDMAIQIKSSTDLDVKNLSGDEAVINVDDNASSDIVQDLNVLEEVLRM...........
C1FEV8_MICSR/1-964..................................................PGSDGLRGRTGLPTAVAAL...........
G1MRD7_MELGA/1-648......................................VQSKPSSLTSNSIPCVSQAQDLN.IEEVIRM...........
D6WWB7_TRICA/1-769..............................................................NHHLVFF...........
H3BX91_TETNG/1-768..............................................................NHHLVFF...........
F7D5K7_XENTR/1-770..............................................................NHHLVFF...........
H2SJN1_TAKRU/1-774..............................................................NHYLVFF...........
B3RQA8_TRIAD/1-734..............................................................NHHLIFF...........
I3JLL2_ORENI/1-646......................................TQSLRGRQG.ESAALPDYAQDLSVIEEVIRM...........
G7DXH4_MIXOS/12-858..............................................................NPGTCLY...........
U1M0X7_ASCSU/1-660.....................................RISAEYDLEHE..KQTHNYHQDITALEEGIRT...........
H2XV68_CIOIN/1-762..............................................................NHHLVFF...........
Q5ZBZ3_ORYSJ/1-682..................................NDKAIKVISDQIEAD.NISDDTSTELHIYTDFLRI...........
D0NH97_PHYIT/1-769......................................................VLAQKQSAYVEFIRL...........
T1FYR2_HELRO/1-642.........................................AEIARTNENKIFIPLLQELAVIEEVIRM...........
Q4DJF1_TRYCC/1-725..............................................................ASNEVILDDAEIKAEQVV
I3KNU8_ORENI/1-782..............................................................NHHLVFF...........
I3JCX3_ORENI/1-776..............................................................NHHLVFF...........
Q01H67_OSTTA/38-724..................................................QALHTPRSEIAVCEDFIRI...........
Q38FE7_TRYB2/1-706.................................RSGAGDCLGTLEGTTPAGGCSSADTSIQMFLRQLLA...........
Q8RWV1_ARATH/1-679..................................GDKLQSIKINLSGEDVGVSEDLAAELQIFTDFLRL...........
I1MHZ5_SOYBN/1-671..................................DGKLNNAGSNSIERS.SLVEDMSAELQIYTDFLRL...........
B0WBZ3_CULQU/1-681..............................AAVAANGDAAAVVAVPIVAGSNPDDMLQDLSVLEEVLRM...........
F0Y4A0_AURAN/723-1436..............................................................NHVYVSL...........
D7T740_VITVI/12-678..................................DDKMHIDKANSPEGD.SIAEDVSTELHIYTDFLRI...........
E1ZEP5_CHLVA/1-748TPAASPAPGPDAPAAAPQQQQGQQGAAGAEAAGQGAGVTGAAGGSGEAPAGASEAAELELQLYADFLRI...........
M4BPB3_HYAAE/1-729..............................................................NHHLIFF...........
Q5CRW2_CRYPI/1-755...........................................NGDRSNLRFFNRFYCGILMHKSLLKL...........
A0A087VXA6_ECHMU/1-876..............................................................NFQLVLF...........
DYM_DROME/1-676........................................ADSAVFVNVSTTPEDMLQDLSVLEEVLRM...........
H0VNU2_CAVPO/1-646......................................TQSLRGSLSSNDVPLPDYAQDLNVIEEVIRM...........
E9ICM4_SOLIN/1-654...................................TQVTTLSSKDSIVLNTANDTTIQDLTILEEVLRM...........
L9KZV5_TUPCH/1-826..............................................................NHHLVFF...........
E9G1Z8_DAPPU/1-633.......................................KSDVKGDSATGASREELEQDLSILEEVLRM...........
D7FT96_ECTSI/1-808..............................................................NQTYVSL...........
H2MFX7_ORYLA/1-772..............................................................HHHLVFF...........
B7S488_PHATC/1-694..............................................................AHRHLAL...........
W1NV48_AMBTC/1-680..................................NDKIQNFKANLAEGN.TIGDDMPTELHIYTDFLRI...........
B6A9V3_CRYMR/1-794...............................................YDKKSEISFSNTIYCTSLTLRN...........
H2KSV6_CLOSI/110-1035..............................................................HYQLVFL...........
M4AQZ4_XIPMA/1-781..............................................................NHNLVFF...........
E0VG76_PEDHC/1-766..............................................................NHHLIFF...........
B4MQL1_DROWI/1-832..............................................................NHHLVFF...........
HID1_DICDI/1-880..............................................................NYRYVGF...........
W4XTN1_STRPU/1-721..............................................................NHHLVFF...........
T1K251_TETUR/1-842..............................................................NHHLVFF...........
T1I7V2_RHOPR/1-802..............................................................NHHLVFF...........
Q7QGJ8_ANOGA/1-825..............................................................NHHLVFF...........
A0A068YEV3_ECHMU/1-732.....................RTLNDQLKEQKNTTGTKVPPYPDVRLNMMSSSDALLQDLSLLEEVIRM...........
J9KB63_ACYPI/1-736..............................................................ANHLAFF...........
Q17L03_AEDAE/1-819..............................................................NHHLVFF...........
W4Z6Q3_STRPU/1-667.................................RASSALEPNGDLTQDAEVEHDDLLSDLSVLEEVIRM...........
W5JW75_ANODA/1-876..............................................................NHHLVFF...........
DYM_XENTR/1-646......................................TQSLRGSLGSDESPLPDYAQDLNVIEEVIRM...........
A8WTE9_CAEBR/1-690.....................................RVSSQNDVAG...GQPINFHDDITALEEGIRT...........
M4C137_HYAAE/1-768..................................................EENDVLAQKHAAYIEFIRL...........
B9HUR0_POPTR/1-672..................................DDKM..GKSGSLGQD.SLAEDLSAELHIYTDFLRI...........
F6TGV4_CIOIN/1-683......................LAIMATSDTPGTVSDASATSSEQAEIDMEPERDYASNLKVLEEVLRM...........
H3AL71_LATCH/1-849..............................................................NHHLVFF...........

PF12722

C4XYD9_CLAL4/17-927---ILRALCSAAT---KNPV--P................SRMLLFSFVKNE-------KIYDSIWTSIYSLESENINGEP
A3LX71_PICST/1-905---LIRAVCTAAL---KYPK--S................SRMLLFSILKNA-------KVYDQVWNTIYSFRTEYFNGNK
Q6BSE0_DEBHA/1-924---IFRSVCTAII---KYPK--P................SRMLLFSMLKNE-------KVYDQVWSTIYSFSTEYFSGDT
C3Z701_BRAFL/1-784---LLEVFNNIIQ---YQFD--G................NANLVYTIIRKR-------NVFHQLANLPTDRASIEKAVSR
Q0E9B5_DROME/1-834---LLEIFNNIIQ---YQFD--G................NSNLVYTIIRKR-------HVFHAMANLPTDMAGIAKCLSG
B0WUT2_CULQU/1-851---LLEIFNNIIQ---YQFD--G................NSNLVYTIIRKR-------QVFHALANLPTDAAGIARCMSN
A7RKV1_NEMVE/1-693---LLEIFNNIIQ---YQFD--G................NSQLVYAIIRKR-------NIFHQLANLPTDPATIQKPKRK
A8WRZ4_CAEBR/1-727---LLEVFNNVIQ---YQFD--G................NSNLIYTIIRKR-------NVFYQLSNLSVDSASIAKTLSG
A8NNK7_BRUMA/1-721---LLEVLNNIIQ---YQFD--G................NSNLVYTIIRKR-------QVFYQLANLSSDSAYIMKMLQG
C5K8E7_PERM5/1-865---LVESLNNVIQ---YQYE--G................NHQLVYSVLRHK-------EVFDSLKQLRLPKSS.......
B6JW01_SCHJY/1-778---VYKIFGNLLR---RRFS--Q................NPKFVYTVLRAH-------ETLCSTIPANFSRAKEIVTQNQ
YIOC_SCHPO/1-796---VIGAINNAIQ---YAQK--Y................NAPLLYFFSMHK-------DYIEAVSALSFDAIMSVRNSSA
Q2GWB4_CHAGB/1-825---LLEAINAIVE---HQFS--R................NPNFIFAILRNR-------KRFEALRSLTLESGQEEVERRN
Q0UAJ2_PHANO/1-733---LLEVLNAMIE---HQYQ--RKYITNDTILVSDTTPDNPNLIYAIVRSR-------KRFQALRDFTLESGQEEIERQN
B8M9N3_TALSN/1-838---LLEFMNVVLE---HQFT--R................NPFLVYGILKTR-------KKFESLRTFTLESGQQEIERQN
C5FVH3_ARTOC/1-827---LLEFINTVLE---HQFS--K................NAYMVYVVLKSR-------HRFESLRAFTLESGQQEIEQQN
C0NTS7_AJECG/1-843---LLEFFNSVLE---HQYS--N................NPLLVYSILKSA-------KRFEALRAFTLESGQEEIERLN
B6HUK2_PENCW/1-841---LLDFINIMLE---HKFT--D................NPYLVYSILKYR-------QRFEAVRAFTLESGQQEIERQN
Q5ASC1_EMENI/1-732---VLESINAILE---HKF.--....................MIYAILKYR-------RRFEAVREFTLESGQQEIERQN

PF09742

F4WRP0_ACREC/1-730...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHALANLPSDCNTIAKSLSK
E9H938_DAPPU/1-832...LLEIFNNIIQ...YQFD..G----------------NANLVYTIIRKR.......HVFHALASLPTDCGTINRSLSR
T1JUN4_TETUR/1-644...LLEIMNSTLS...SQLI..H----------------NPNLVYTLLYNR.......HVFEPFQSHPS.FQD.......
J9F5Y0_WUCBA/1-661...LLEICNSCLS...SNLR..S----------------NPHFIYTILYKR.......DLFDAFQNHPM.FQD.......
B4JW54_DROGR/1-859...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......HVFHAMANLPTDMAGISKCLSG
I1EYR3_AMPQE/506-1206...LLEIINSSLT...YTLH..V----------------NPHFVYSLLYQR.......EIFTPYHGRPG.FID.......
E0VAE1_PEDHC/1-723...ILEIINSCLS...NQIQ..H----------------NPNLVYALLYKK.......DIFDPFRTHQN.FND.......
C1FEV8_MICSR/1-964...VSAALASALV...TSAS..K----------------CPELVYAALQRRD......EVFAPFLDE...FLD.......
G1MRD7_MELGA/1-648...MLEIINSCLT...NSLH..H----------------NPNLVYALLYKR.......DLFEQFRTHPS.FQD.......
D6WWB7_TRICA/1-769...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHNLANLPSDYGTIAKSLNK
H3BX91_TETNG/1-768...LLEVFNNIIQ...YQFD..G----------------NSHLVYAIIRKR.......SIFHQLANLPSDTASIQKALQK
F7D5K7_XENTR/1-770...LLEVFNNIIQ...YQFD..G----------------NSSLVYAIIRKR.......AVFQQLANLPSDTSSIQHALQR
H2SJN1_TAKRU/1-774...LLEVFNNVIQ...YQFD..G----------------NSNLVYAIIRKR.......SIFHQLANLPSDMASIQKALQQ
B3RQA8_TRIAD/1-734...LLEVFNNIIQ...YQFD..G----------------NSHLVYTIIRKR.......NIFHQLANLPTDPSTVVKPNKK
I3JLL2_ORENI/1-646...MLEIINSCLC...NSLH..H----------------NPNLVYALLYKR.......ELFEQFRTHPS.FQD.......
G7DXH4_MIXOS/12-858...LLEAFNNVIH...YQLS..D----------------NSNLVYAILRGH.......RRFEDLGNFTLDWAVDEIQRSK
U1M0X7_ASCSU/1-660...LLEICNSCLT...ANLR..N----------------NPHFIYTILYKR.......ELFDGFQNHPM.FQD.......
H2XV68_CIOIN/1-762...LLEVFNNIIQ...YQFD..G----------------NANLIYTIIRKR.......QVFHQLANLPTDSASLSKGVNK
Q5ZBZ3_ORYSJ/1-682...VLEIINAILT...YALP..R----------------NPEVVYAILHRQ.......EVFQPFKNHPR.FNE.......
D0NH97_PHYIT/1-769...LLGVISSCLKA..RQLP..R----------------NPQLIYSLLHRA.......DTFAALQQHSE.FAA.......
T1FYR2_HELRO/1-642...TLEILNSCLC...HSLN..Y----------------NPNLVYTMLYQK.......EIFVQLSSHPS.FQD.......
Q4DJF1_TRYCC/1-725LLNIVEAVAGVLQ...YHEG..A----------------AATLLAAFIKHK.......SLVGEVSDIFL...........
I3KNU8_ORENI/1-782...LLEVCNNIIQ...YQFD..G----------------NFNLVYAIIRKR.......SVFHQLANLPSDTASIQRALQK
I3JCX3_ORENI/1-776...LLEAFNNIIQ...YQFD..G----------------NCNLVYAIIRKR.......NVFHQLANLPSDPSSIQKALQR
Q01H67_OSTTA/38-724...AFEILN.CLTTDLNSLE..Q----------------NPEIVYALMHKE.......ELVVGYRTDAA.FAE.......
Q38FE7_TRYB2/1-706...LTEAVGGLLQ...GDCR..N----------------NYSFIYELVYQRSHLEEGAKLLSTVSCHSSEAQT.......
Q8RWV1_ARATH/1-679...VLDILNAILT...YALP..R----------------NPEIVYAIMHRQ.......EVFQPFKNHPR.FHE.......
I1MHZ5_SOYBN/1-671...VLEIINAILT...YALP..R----------------NPEVVYEIMHKQ.......EVFQPFKNHPC.FNE.......
B0WBZ3_CULQU/1-681...VLEILNSCLS...HQLV..Y----------------CPNLVYTLLYKR.......NVFEAFRSHSA.FQD.......
F0Y4A0_AURAN/723-1436...LLELFNNVIQ...YQYG..G----------------NAHLVYAIVRRK.......PVFDALEQLTLPRAITAAVERE
D7T740_VITVI/12-678...VLEILNAILT...YALP..R----------------NPEVVYAIMHRQ.......EVFQPFKNHPR.FNE.......
E1ZEP5_CHLVA/1-748...VLEIINSILT...SALP..Q----------------NPELVYTLLHRQ.......EVFAPFGAHPR.YAE.......
M4BPB3_HYAAE/1-729...LLETFDNIIQ...YQYE..G----------------NQQVVYAMIQTK.......SVFYQLNDLQLPPIRAATSEGK
Q5CRW2_CRYPI/1-755...IIESLKD......ENLL..S----------------NSELIYIIIKFS........LITEIQKLNIFLKR.......
A0A087VXA6_ECHMU/1-876...LLEIFNNVIQ...YQFD..G----------------NSCLVYSIIRKR.......QVFYQLANLPTTDEEIREVLAK
DYM_DROME/1-676...VLEILNSCLT...NQLV..Y----------------CPNLVYTLLYKR.......SVFEGFRSHHA.FQD.......
H0VNU2_CAVPO/1-646...MLEIINSCLT...NSLH..H----------------NPNLVYALLYKR.......DLFEQFRTHPS.FED.......
E9ICM4_SOLIN/1-654...VLEIINSCLT...HRLA..H----------------NPNLIYTLLYKK.......DVFQPFRTHSA.FQD.......
L9KZV5_TUPCH/1-826...LLEVFNNIIQ...YQFD..G----------------NSNLVYAIIRKR.......SVFHQLANLPTDPPTIHKALQR
E9G1Z8_DAPPU/1-633...LLEILNAAFT...HQLG..C----------------NQNLIYSVLHKR.......EVLDVLRRQPA.FQD.......
D7FT96_ECTSI/1-808...LLEMFSNIIQ...YQYV..G----------------NAHLVYAIVRRQ.......EAFESLYELDLPAAVAAASKFA
H2MFX7_ORYLA/1-772...LLEVFNNIIQ...YQFD..G----------------NSNLVYAIIRKR.......NVFHQLANLPTDKESIQNALQR
B7S488_PHATC/1-694...LLEVFNNIIQ...YQYH..G----------------NSHLVYAIVRRK.......DAFGQIAALTLENAQAQC....
W1NV48_AMBTC/1-680...VLEILNAIMT...YALP..R----------------NPEVVYAIMHRQ.......EVFEPFKQHPR.FYE.......
B6A9V3_CRYMR/1-794...LLLIVGSCLA...TNNKVIS----------------NIQLAYAFIRIS............FSNEAKKLQEMINIDFK
H2KSV6_CLOSI/110-1035...LLEVFNNIIQ...YQFD..G----------------NSNLVYTLIRKR.......QVFYHLANLPTDQSTIQRILKR
M4AQZ4_XIPMA/1-781...LLEVFNNIIQ...YQFD..G----------------NFNLVYAIIRKR.......NVFHQLANLPTDEGSIQKTLQK
E0VG76_PEDHC/1-766...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHSLANLPTDYGSITKSLNK
B4MQL1_DROWI/1-832...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......HVFHAMANLPTDMAGIAKCLSG
HID1_DICDI/1-880...LLESLNNLLQ...HQYE..S----------------NTRLIYAILRCQ.......NQFSKLAYLKISPVTPSKPMEQ
W4XTN1_STRPU/1-721...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......TVFHQLANLPSDQASISKALAK
T1K251_TETUR/1-842...LLEVFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......NIFHNLANLATDYGTIQKSLNR
T1I7V2_RHOPR/1-802...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHSLANLPSDYGTIAKSLSR
Q7QGJ8_ANOGA/1-825...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHALANLPTDAAGIARCLSN
A0A068YEV3_ECHMU/1-732...TLEIFNSILT...HSLT..A----------------NTHLIYNLLYQR.......EYLAPIHNHPS.FSD.......
J9KB63_ACYPI/1-736...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHSLANLPTDYSTIIKSLTK
Q17L03_AEDAE/1-819...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHALANLPTDAAGIARCMSN
W4Z6Q3_STRPU/1-667...VLEIINSCLI...NMLP..H----------------NPHLVYTLLYKQ.......DLFTSFKSHPK.FQD.......
W5JW75_ANODA/1-876...LLEIFNNIIQ...YQFD..G----------------NSNLVYTIIRKR.......QVFHALANLPTDAAGIARCLSN
DYM_XENTR/1-646...MLEIINSCLT...NSLH..H----------------NPNMVYALLYKR.......ELFEQFRSHPS.FQD.......
A8WTE9_CAEBR/1-690...LLEIINSALC...GGLR..H----------------NTHLIYNLLYHR.......ALFDAYVQHPM.FQD.......
M4C137_HYAAE/1-768...SLGLLSSCLKT..EQLS..R----------------NPQLIYALLHRA.......NTFAALQRHSE.FAA.......
B9HUR0_POPTR/1-672...VLEILNAILT...YALP..R----------------NPEVVYAIMHRQ.......EVFEPFKNHPR.FSE.......
F6TGV4_CIOIN/1-683...LLEIVNSCLTG..GALR..H----------------NANLVYALLQRR.......EAFDQLRLHTV.YQD.......
H3AL71_LATCH/1-849...LLEVFNNIIQ...YQFDGIG----------------NSNLVYAIIRKR.......NVFHQLANLPTDPPSIQKALQR

PF12722

C4XYD9_CLAL4/17-927L................................................RLMNVQEDDEENEDSPVNFQERGNDSLQMNM
A3LX71_PICST/1-905L..................................................NRIDDGEEENENILSVVNSNNSE......
Q6BSE0_DEBHA/1-924L................................................VLNSIDDNEDENISPLQQIDSNRSDQVSISS
C3Z701_BRAFL/1-784K................................................RKGSEASQRPVPHSPAVTDPPSMEGSFPAQE
Q0E9B5_DROME/1-834RKTGGKFNLPRVPQRRTPAVSQELPSAHVPEEYNEEDEDEDEEEIINEEPKAEEDLESETESHERSQAGELQSDVLTAQP
B0WUT2_CULQU/1-851RKGGKLNNSSHGSRSSGREQLQNKEVLPSTSHAEDDSEEDITVRTG.QIQIQDRHSDEEESDSRSEIIEESMEGSHPALP
A7RKV1_NEMVE/1-693EH.................................................................IPNMREGEHSRSP
A8WRZ4_CAEBR/1-727RKSKS..........................................ANRDEMVDQLKSPTTANPPEFPAAGASSSTPPA
A8NNK7_BRUMA/1-721RK.............................................GRKSGAVAESKSIAVAKSVDDVENKANI.....
C5K8E7_PERM5/1-865.............................................................................PST
B6JW01_SCHJY/1-778P...........................DMSVYLSSSNKTYTKHIFERALLDEKLNAEKRQNGYSTRDRRHRRIEKLYRD
YIOC_SCHPO/1-796E...........................GDSAYWTRNGKTFS.....SKAFDSILLSRLRYVRSKSPTPYYPIESSEFGF
Q2GWB4_CHAGB/1-825QRRKDS.........................................GAPLDPLEPNSTRSSMESIMSPT.TQPSRAPTL
Q0UAJ2_PHANO/1-733QLRK...............................................EGASELQRTNSIDSIRSPT...VSRTPTL
B8M9N3_TALSN/1-838QLKK...........................................AASSTDGLTGSASQSMEDLRRSS...GARSS.L
C5FVH3_ARTOC/1-827QLRKAT.........................................SSSSGDFSTNSRTHARDSYEAGN....GRRP.L
C0NTS7_AJECG/1-843QRRKVNQI.......................................SGNSDALLSPTVSHSGDDNRGSG...AGRRQ.L
B6HUK2_PENCW/1-841ERRKA..........................................GSSSDVATSPTLSQSEDDLHTPS...GARSP.L
Q5ASC1_EMENI/1-732QRRK...........................................SENRDSIASPVLSASDEDPRLSS...GARSP.L

PF09742

F4WRP0_ACREC/1-730RQRRH...........................................................................
E9H938_DAPPU/1-832RGRK............................................................................
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859RKTG.................GKFNLPRVPQRKQTMPTTSTMSNQELPSAHAPEEYADDVEDDDDEEGEEDEDDLNVNRI
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769RTRS............................................................................
H3BX91_TETNG/1-768KRKS............................................................................
F7D5K7_XENTR/1-770KKKP............................................................................
H2SJN1_TAKRU/1-774KKRK............................................................................
B3RQA8_TRIAD/1-734EDSS............................................................................
I3JLL2_ORENI/1-646................................................................................
G7DXH4_MIXOS/12-858TAK.............................................................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762KRNR............................................................................
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725................................................................................
I3KNU8_ORENI/1-782KKRT............................................................................
I3JCX3_ORENI/1-776KKKS............................................................................
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436HARR............................................................................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729NPAK............................................................................
Q5CRW2_CRYPI/1-755................................................................................
A0A087VXA6_ECHMU/1-876HSGL.....................................HRRFEAPPDTDEEDEVEDRTEENGEGEGEGNEDIFKKEA
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826RRRT............................................................................
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808RSGA............................................................................
H2MFX7_ORYLA/1-772KKPG............................................................................
B7S488_PHATC/1-694................................................................................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794TSSSNIQETNRFVELEFCNKYTPEFTNQSPEKLKSCYFKINGIFF...................................
H2KSV6_CLOSI/110-1035RPTTLPN.........................................................................
M4AQZ4_XIPMA/1-781KKKK............................................................................
E0VG76_PEDHC/1-766KSRR............................................................................
B4MQL1_DROWI/1-832RKTG.................GKFNLPRVPQRK..LAASNSYSSQELPSAQVPDEYAEE.....................
HID1_DICDI/1-880ITQPSPISTSEEAFGKLN..............................................................
W4XTN1_STRPU/1-721RSKK............................................................................
T1K251_TETUR/1-842SSSSSSSASRRPRKLTLSSSQSTASASSIPPTSCQSPSANCKSAPTSPLSVDTCTSPNVTSPQPQQQFNEKVEKSEQQSA
T1I7V2_RHOPR/1-802RGSS............................................................................
Q7QGJ8_ANOGA/1-825RKGGAGGGGGAGGRMVGSSH....GSASSGSRSLAGHDDDAADYQQRKAALTAPGAAAAGG...................
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736KAKR............................................................................
Q17L03_AEDAE/1-819RKGGKLNNSSHGSRDGVRNPQNNEVLPSTANAGNESEEEITVRTSQLAL...............................
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876RKGG...SGAGGARISGSSHAGGQGGPGAGARGGVQRHDDEVDYQQRKAALTAPGRDSPGSGVADDSEDDISDRAGRVTL
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849KKKT............................................................................

PF12722

C4XYD9_CLAL4/17-927HAQR.ELPKSLLKSPDEYSISS..FTSTEEIASPL---------------------------------------------
A3LX71_PICST/1-905.....RFKPESETTDSESPQTR..KNSMFGIGTPP---------------------------------------------
Q6BSE0_DEBHA/1-924SIES.EANDSIFINNFTSPKSR..HGSNVSGSIPP---------------------------------------------
C3Z701_BRAFL/1-784AQPG.TLKATLAEMPGIERLTE..KMEASSLAEQA---------------------------------------------
Q0E9B5_DROME/1-834AEPG.TLKTSLLDTPGITQMTE..REQAHPNDKPQ---------------------------------------------
B0WUT2_CULQU/1-851AEPG.TLKVTLLETPDIAQMTE..RESAHPSSADA---------------------------------------------
A7RKV1_NEMVE/1-693EDPV.S.....RATPGPSHTQK..K..........---------------------------------------------
A8WRZ4_CAEBR/1-727SSGP.STTAGLAATPALASMT..............---------------------------------------------
A8NNK7_BRUMA/1-721.......KATLAETPLVSAMTE..K..........---------------------------------------------
C5K8E7_PERM5/1-865STVP.SIVDESSMESDNAAAGQ..EKSSQETSAQQ---------------------------------------------
B6JW01_SCHJY/1-778VDHS.SLESSVSVTHPEEKPFR..QGKDSETQNEQ---------------------------------------------
YIOC_SCHPO/1-796TNLK.DVTSKDEITDGFDKALR..SNSLRTHRDSR---------------------------------------------
Q2GWB4_CHAGB/1-825GDVP.EEDSTFAIGDDEDDSDD..EARPTPAASSP---------------------------------------------
Q0UAJ2_PHANO/1-733GNVP.EENSAFAIGDDDDSDAD..EPHPTEAPQSP---------------------------------------------
B8M9N3_TALSN/1-838THIP.EENSPFAIGGDDSEDEG..EIPTTPSQSSP---------------------------------------------
C5FVH3_ARTOC/1-827SHVPEEEDGTFAIGDDDSDEEG..DGGQPASQVTS---------------------------------------------
C0NTS7_AJECG/1-843SHVP..EDGAFAIGDDDSDEEE.QEPQNTPSQSP.---------------------------------------------
B6HUK2_PENCW/1-841TRIP.EENSPFAIGDDDSDDEREEEGTQTPSQSSF---------------------------------------------
Q5ASC1_EMENI/1-732GRIP.EENNPFAIGGDDSEDEG..DGRHTPPQDSA---------------------------------------------

PF09742

F4WRP0_ACREC/1-730...............................MPAS.............................................
E9H938_DAPPU/1-832....QLGRQPSVESVKEAPS...........MEGS.HPA.........LPAQPG..........................
T1JUN4_TETUR/1-644................................................................................
J9F5Y0_WUCBA/1-661................................................................................
B4JW54_DROGR/1-859RLDKQTIAEEDLESETESHERSQ........LGDTTQLPDTVAPPLSAQPAEPG..........................
I1EYR3_AMPQE/506-1206................................................................................
E0VAE1_PEDHC/1-723................................................................................
C1FEV8_MICSR/1-964................................................................................
G1MRD7_MELGA/1-648................................................................................
D6WWB7_TRICA/1-769.....RMSSTTSHENVAELA...........MEGS.HPA.........LPAEPG..........................
H3BX91_TETNG/1-768...GISRSVS.....VTSET...........GDHS.RVP.........VPADSS..........................
F7D5K7_XENTR/1-770.VEPISRTNS.....QDGAS...........MEGS.RPA.........APAEPG..........................
H2SJN1_TAKRU/1-774..SGLSRSGS.....VTSEA...........ADNS.RVP.........VAAEPR..........................
B3RQA8_TRIAD/1-734.DISVAQYQSGTESASDPNN...........ISGSESDT.........................................
I3JLL2_ORENI/1-646................................................................................
G7DXH4_MIXOS/12-858.SKGSSESEPLSRSASARTS...........SNGSLGAS.........................................
U1M0X7_ASCSU/1-660................................................................................
H2XV68_CIOIN/1-762.........PQSASNSERKD...........THGEVSTV.........EVAESG..........................
Q5ZBZ3_ORYSJ/1-682................................................................................
D0NH97_PHYIT/1-769................................................................................
T1FYR2_HELRO/1-642................................................................................
Q4DJF1_TRYCC/1-725...............................AEGSNA...........................................
I3KNU8_ORENI/1-782...GISRTNS.....VENES...........MEGS.RPA.........VPAEPG..........................
I3JCX3_ORENI/1-776.PDVISRTSS.....QETVS...........MEGS.HPA.........VPAEPG..........................
Q01H67_OSTTA/38-724................................................................................
Q38FE7_TRYB2/1-706................................................................................
Q8RWV1_ARATH/1-679................................................................................
I1MHZ5_SOYBN/1-671................................................................................
B0WBZ3_CULQU/1-681................................................................................
F0Y4A0_AURAN/723-1436..GAAKPAPSQTPPAPPANGDASDAPPAPPVPHGAEPDA.........................................
D7T740_VITVI/12-678................................................................................
E1ZEP5_CHLVA/1-748................................................................................
M4BPB3_HYAAE/1-729...............................KEGDSTEE.........................................
Q5CRW2_CRYPI/1-755................................................................................
A0A087VXA6_ECHMU/1-876KEEGLDFVSTDVDQFSQAASLINDKMDEVKNEKGNGVAS.........ETKNGG...............AVVAQGDSEEM
DYM_DROME/1-676................................................................................
H0VNU2_CAVPO/1-646................................................................................
E9ICM4_SOLIN/1-654................................................................................
L9KZV5_TUPCH/1-826.PEPLSRSGS.....QEGTS...........MEGS.RPA.........APAEPG..........................
E9G1Z8_DAPPU/1-633................................................................................
D7FT96_ECTSI/1-808.......AAAQKVRAAAAAAEAAAAEAAAEAGNGEAAHA.........................................
H2MFX7_ORYLA/1-772....VSRVNS.....ADSEA...........TEDS.KPA.........EPAEPG..........................
B7S488_PHATC/1-694.HKVYGEQTAVKRDIDAHLNVDNKGIPNMVGDDNASASS.........................................
W1NV48_AMBTC/1-680................................................................................
B6A9V3_CRYMR/1-794................................................................................
H2KSV6_CLOSI/110-1035.SDHSSPESSPTISAKSKSHSIKDNHDAQTTKEGARKKSQADIISPTSAVAPAGNRDVNGSAIDTPEVRFSQVLRDDVHS
M4AQZ4_XIPMA/1-781..SGISRLNS.....TDGES...........MEGS.RPA.........APAEPG..........................
E0VG76_PEDHC/1-766...SLQSTNLSDNSSPESPS...........MEGS.KPA.........LPAEPG..........................
B4MQL1_DROWI/1-832.DDQEEQEEDDFEGEDEEAKAEEDFESKTDIDRVTPQLPVAAVEVPTAQPAEPG..........................
HID1_DICDI/1-880.KLSISEEPSTLSNEKSDKT...........TDGGDHQD.........................................
W4XTN1_STRPU/1-721...IQTAQAVSPQSDTESHT...........SESSRVPP............QDG..........................
T1K251_TETUR/1-842PSNTIASKSTTPISNNNNDSNEVQQASLTDLNEGS.SPS........KTVNQES..........................
T1I7V2_RHOPR/1-802......RRHIPSQSGPESPS...........MEGS.KPA.........LPAEPG..........................
Q7QGJ8_ANOGA/1-825......DESGDARSDIVEES...........MEGS.HPA.........QEAEPG..........................
A0A068YEV3_ECHMU/1-732................................................................................
J9KB63_ACYPI/1-736..NMQATSSVSLTAATETPS...........MEGS.TPA.........LPAEPG..........................
Q17L03_AEDAE/1-819.DDRQPSDEEDSRSEIVEES...........MEGS.HPA.........QPAEPG..........................
W4Z6Q3_STRPU/1-667................................................................................
W5JW75_ANODA/1-876RDEDDSSASADARSDIVEES...........MEGS.RPA.........QEAEPG..........................
DYM_XENTR/1-646................................................................................
A8WTE9_CAEBR/1-690................................................................................
M4C137_HYAAE/1-768................................................................................
B9HUR0_POPTR/1-672................................................................................
F6TGV4_CIOIN/1-683................................................................................
H3AL71_LATCH/1-849.PEPISRTNS.....QD