Sequence alignment for CL0457

PF12729

B8GHQ6_METPE/6-186------------------------------------------------NK..KIRTKLIIA..FVIFMLALVVVG..IVG
A5MYV5_CLOK5/6-185------------------------------------------------NT..KVKVKLILS..FAIVAILITVVG..VIG
B2A037_OPITP/3-183------------------------------------------------HA..TIGQRIALG..FAALIAIVAIIG..AIA
A6LXN5_CLOB8/6-185------------------------------------------------NL..KLAQKLIFC..FLLISFLIGIIG..FRG
A6LXV4_CLOB8/6-186------------------------------------------------NL..KVGRKLAIL..IICSLVGLFAVG..ITG
B1YFV6_EXIS2/3-184------------------------------------------------NL..SVRKKIQLL..IATAIVAMILLA..SAG
YVAQ_BACSU/2-181------------------------------------------------RL..TISRKFSLV..FLTLILINLLVG..GIG
D1B8F4_THEAS/7-187------------------------------------------------DM..SIKGKMWVL..IGVGLLGLGVAS..ATG
A0KL92_AERHH/6-191------------------------------------------------NL..QVRTKLVFS..FSILMVLLVVLS..LTS
Q2FMT9_METHJ/4-184------------------------------------------------NV..KIGKKLIGG..FILTIIIMLIIA..GTG
A5N138_CLOK5/6-185------------------------------------------------NL..KIKVKLIVS..FIIVAVLIGVVG..IIG
B8GS53_THISH/3-186------------------------------------------------GIRLTIRMRLYLM..ITLALLFMVIVG..VMG
C4KYK6_EXISA/3-185------------------------------------------------NL..SMSKKFTVL..ISLFVVTLVMIS..MLS
C4L6Z3_EXISA/47-227------------------------------------------------NL..TIRQKLWGL..VLISLVLVIGVG..GYA
Q65NE7_BACLD/6-186------------------------------------------------NI..KIRSKLFVI..IIISALALSIVG..IQG
B3EAL3_GEOLS/4-184------------------------------------------------NM..KIGKRLAVG..FAAVLILLTIIA..VVS
Q2FP73_METHJ/6-186------------------------------------------------NL..KMSRKLMGS..FLVLIAILIIIA..LAG
B8I3W0_CLOCE/7-187------------------------------------------------NA..KIRVKLVLL..IFAMIIGMVLVG..SMG
B0TC96_HELMI/4-187------------------------------------------------RM..NVGTRILLV..ILFSCLVTAAVG..FYG
Q24U91_DESHY/6-186------------------------------------------------NL..KVSVKLVMS..FCLLALITFAVG..GLG
A0PY27_CLONN/6-189------------------------------------------------KI..SVKKKMIFS..YSALLMLMIISG..VIG
A6W0J9_MARMS/4-183------------------------------------------------NM..NIRSRLLMA..FTIIIFLLVCLG..GVT
Q97DG6_CLOAB/7-186------------------------------------------------NL..KVVHKLILC..FGIIITVIIMNG..IMS
B0UJP2_METS4/9-189------------------------------------------------PL..SIRTKLIAA..FTLLGLVIVGLG..ALG
Q97J99_CLOAB/6-185------------------------------------------------DM..RIFKKLILV..FGVISIFTIIVG..IVG
B8I1D9_CLOCE/4-184------------------------------------------------NL..KIVHKIIFL..PAVLLLLILIVG..FTG
Q820J9_NITEU/4-184------------------------------------------------NM..TIKSRLIFI..VGLLSLALISVG..SVG
D2QKC8_SPILD/2-187------------------------------------------------YMSKTYYNPLPVRSVLLVISLLGLILTSIFLS
C6XTP8_PEDHD/2-188------------------------------------------------RFAYSVKQKMKIA..VLLFCIMACTILIRLLE
B5EIZ2_GEOBB/6-186------------------------------------------------DL..KLGTKLISG..FISVAAIAAIIG..YFG
B3E7H2_GEOLS/7-187------------------------------------------------NL..GIKTKLVIA..FLVVAAFAGLLG..VVS
Q97MS1_CLOAB/6-186------------------------------------------------DM..KISSKILVG..FVVIIFISAVSG..VFG
C6VSG0_DYAFD/2-186------------------------------------------------KWSFVIQQKFKAA..ILLGGIMAMIVGGTLIS
Q97FH5_CLOAB/6-186------------------------------------------------DL..KIFTKLIIA..FIFVAVISTIAG..VVG
B0TE36_HELMI/6-185------------------------------------------------KL..KISNKLLLY..TLFVLGFLTVMG..SVN
A6LR72_CLOB8/6-186------------------------------------------------NL..SVKKKLVSV..FFVICIFIAAIG..TEG
A0Q228_CLONN/6-188------------------------------------------------KF..KVRSKLSFS..FGVLAFLIILSG..IVG
A1W7U5_ACISJ/3-184------------------------------------------------HF..KISTRLVFL..IGLMSVLQLIVG..GIG
B2TPM5_CLOBB/5-185------------------------------------------------DM..PIYKKLLVS..FIGIAIISIISG..SIG
A5I5R4_CLOBH/7-185------------------------------------------------.K..KVKTQLISA..FLIVALLIAIVG..AVG
Q24QB3_DESHY/6-185------------------------------------------------NL..KTASKINSL..VLLMAVFLGLVG..FVG
Q24YV4_DESHY/6-183------------------------------------------------NL..TTAKKIISI..ILLMSLFILSVG..GVG
Q250C4_DESHY/23-203------------------------------------------------NI..KTVYKLGIL..VIIAFFSLGSVG..FTG
Q81B11_BACCR/6-185------------------------------------------------NS..KVGTKLNIL..ITISSIACIVLS..LIG
Q81ZA3_BACAN/8-187------------------------------------------------.L..NVINRLILL..IAVPIISILIIS..VVN
V6F5X6_9PROT/6-184------------------------------------------------NL..RIGPRLAIL..TGFLAVLVLAVG..VKG

PF02203

L8BID0_ENTAE/1-177---------------------------------------------MFNRI--KVVTSLLLV--LVLFGALQLISG--GLF
MCPD_ENTAK/1-173---------------------------------------------MFNRI--RISTSLFLL--LISFCIMQLIST--GLS
B3HUP0_ECOLX/1-175---------------------------------------------MINRI--RVVTLLVMV--LGVFALLQLISG--SLF
A2S6U7_BURM9/1-177---------------------------------------------MLHNW--SIRTTLTAV--GFMLVLVAALVG--GLG
Q13QZ2_BURXL/1-174---------------------------------------------MLSRL--SISARLWAT--VALLGILIVLTG--LLG
A0K3D5_BURCH/1-177---------------------------------------------MLHNW--SIRTTLTAV--GLILVCLAAAVG--GLG
Q0K4P5_CUPNH/14-187---------------------------------------------FHNNI--QIKTLLRGA--MGMLSLLLLLVG--GAG
A7Z837_BACA2/7-146---------------------------------------------WCTKA--SISRKL..I--ISFIVILIIPIL--VLE
Q8XQ80_RALSO/1-174---------------------------------------------MFRGM--TIRLRLALM--MAGVAVLAVVIG--TTG
A3NJ34_BURP6/4-177---------------------------------------------FFSRF--SIRTRIFST--LGLVAALLTITG--VIG
J7JW03_BACIU/7-146---------------------------------------------TIRRS--SIARRL..I--ISFLLILIVPIT--ALS
A8FGS8_BACP2/7-147---------------------------------------------WLKKP--SISKRL..I--ISFTLVLVLPII--TLS
A8FGS7_BACP2/7-147---------------------------------------------WLKKP--SISKKL..I--MAFLVVLILPTT--ALT
A7Z836_BACA2/7-146---------------------------------------------KIARK--SIAKKL..I--ISFLLILLIPVA--VLA
A1JT77_YERE8/1-177---------------------------------------------MFKRM--KVVTSLLLV--LVLFGALQLVSG--GLF
Q46PJ2_CUPPJ/3-176---------------------------------------------FENNI--QIKTLLRGA--MATLSLLLILMG--GAG
A7MM72_CROS8/1-177---------------------------------------------MFKRI--KVITLLITV--LIVLGAMQLIAA--GVF
A7MEE5_CROS8/1-176---------------------------------------------MLNRI--RVVSLLMMV--LVVFALLQFISG--GMF
A8GG43_SERP5/1-173---------------------------------------------MFNRI--RVSTSLFLL--LMTFCVMQLATS--GLS
Q65FN3_BACLD/7-146---------------------------------------------WTKRP--SISKKL..I--FSFIFILTIPIL--VLS
A4WA05_ENT38/1-177---------------------------------------------MLKNL--HVITGIIFA--LTLFCLLQVVTG--GLF
A8GG44_SERP5/1-177---------------------------------------------MFNRM--KVVTSLLLV--LVLFGALQLVSG--GLF
I0UJV5_BACLI/7-146---------------------------------------------WLKRP--SISKRL..F--FSFILVLTLPIL--ALS
B2UHV2_RALPJ/1-174---------------------------------------------MFSKM--TIRLRLGLM--MAGIGVLAVIVG--LTG
A0A017LS69_ECOLX/11-181---------------------------------------------FLHHI--RLVPLFACI--LGGILVLFALSS--ALA
Q3JSN4_BURP1/10-181---------------------------------------------LLKNI--TIRARLAVT--MALLSVLLCAVG--ALG
B9BHH5_9BURK/6-179---------------------------------------------LFSRF--SIRTRIFST--LGLVAGLLVVSG--LIG
Q7N5T4_PHOLL/1-178---------------------------------------------MFNRM--KIVTGLMAV--IILFGALQFISG--GLF
A4TLJ4_YERPP/1-175---------------------------------------------MFGQI--RISTSFFLL--LMFLCAIQLISS--GLS
Q6D4S3_PECAS/57-232---------------------------------------------RRHRL--SILSGLLLI--IGLFSLLQLVSV--GVI
A8AGH6_CITK8/15-185---------------------------------------------FLHHI--RLVPLFSSI--LGGILLLFALSS--GLA
B5WVT2_9BURK/1-177---------------------------------------------MLSRW--SIRTSLTLV--GTLLVMLTVVVG--ALG
A7GNX1_BACCN/7-146---------------------------------------------WFQNM--KVAKKI..M--ISFFIILIVAIS--IIG
Q46ZP9_CUPPJ/1-174---------------------------------------------MFRNT--TIGARLWFL--IVVTNLLLLIVG--AFG
A7MPS2_CROS8/15-185---------------------------------------------PRTRF--GLMAGILCV--ITLFSALQILST--LML
A4JE67_BURVG/2-173---------------------------------------------VIANL--TIRARIGLT--MAFLAVLLAVIG--VLG
J7JYH6_BACIU/7-146---------------------------------------------LIKQR--SITRKL..L--VSFLSILIIPVV--ILA
E5W1J5_9BACI/7-146---------------------------------------------WFKHP--SLSKRL..A--VSFLLILTLPVL--ILS
B2TGA5_BURPP/1-171---------------------------------------------M.SKL--SIRARLGAA--ILFLCVLLTAIG--ALG
A8TNN7_9PROT/6-182---------------------------------------------KKLTG--TIRARLITL--IATLMGGLLVVG--AVG
Q0K9D3_CUPNH/1-174---------------------------------------------MFKNT--TIGARLWFL--TIVTNLLLLIVG--AVG
B2JWU0_BURP8/26-199---------------------------------------------FRMKL--TIKFRLLAT--LTLLGLLLMVSG--VLG
A4JSC9_BURVG/1-175---------------------------------------------MIRNL--SIRVRLALA--MGFLGVLLVIGG--FIG
A4WBP6_ENT38/1-175---------------------------------------------MLNRI--RVVTMLMMV--LVIFALLQLISG--GLF
A6T1W9_JANMA/1-174---------------------------------------------MFNNL--SIKMRLIGT--MAFMGIMLIVGG--AMG
A6SU23_JANMA/1-173---------------------------------------------MLKNL--TIKSLLLSV--MSILSVLLVGTG--ILG
A4W5T8_ENT38/1-177---------------------------------------------MFKRI--KVITLLVSV--LLVLGAMQIISA--SVF
A8AGR3_CITK8/15-185---------------------------------------------TPRQF--GLLTGIFCI--IALFSILQVASS--LML
A8FGS5_BACP2/6-146---------------------------------------------YFRKP--SISKKL..V--LSFLFILLCPII--VLA
A4G2W4_HERAR/1-175---------------------------------------------MLKNI--SIKFRLLLT--MVFMGMMLIVGG--AMG
C6BHT9_RALP1/1-173---------------------------------------------MSARL--TIRTRLVLS--VSILFLLALLIG--VAG
Q21SE1_ALBFT/1-173---------------------------------------------M.NRL--KISTRLALL--IGVLAMLLVLTG--SIG
B2T9U8_BURPP/1-172---------------------------------------------MFSKI--KVASGLLCV--LAAFCVFQLVTV--GLG
A9ALM0_BURM1/1-172---------------------------------------------MFGKI--KLASGLLGV--LTVFCVFLFAIE--ALG
B5BKZ4_SALPK/1-177---------------------------------------------MLKRI--KIVTSLLLV--LALFGLLQLTSG--GLF
B9BQN2_9BURK/16-188---------------------------------------------M.KAL--TVKTQLSLI--AGSMGISIVVIA--SSG
A3RYQ0_RALSL/33-207---------------------------------------------HMKTL--SIKARLALV--LFVLAVFLAGVG--ALG
Q0BFK7_BURCM/2-173---------------------------------------------VIGNL--TIRARIGLT--MAFLAVLLGLVG--VLG
B2T7C0_BURPP/1-177---------------------------------------------MLSRW--SIRTSLTIV--GIILVALTVVVG--VLG
A4WBP5_ENT38/1-173---------------------------------------------MLNRI--RISTTLFLI--LILCGVLQVGSN--GLS
B2JQ81_BURP8/1-172---------------------------------------------MFSKI--KVASGLLCV--LAAFCIFQLVTE--GLG
A8AFE7_CITK8/5-177---------------------------------------------MFNRI--RISTTLFLI--LILCGVLQIGSN--GLS
A0A014LTC5_YERPE/23-197---------------------------------------------SESRL--GILFGFTLV--ISLFSLLQIFSI--GYL
A4LLG2_BURPE/1-172---------------------------------------------MFSKI--KLASGLLGV--LVTFCLFLIAVE--GLG
O05244_BACIU/10-150---------------------------------------------WLKKP--SISKKL..I--VSFIAILIIPIL--ILE
A3RWP1_RALSL/1-174---------------------------------------------MLNRL--SIRFRLNAA--LVLLGALLAIIG--TIG
Q7N5T3_PHOLL/1-175---------------------------------------------MLGRL--RISTSLYLL--LMMFCVMQIISS--GLS
B1Y1L2_LEPCP/1-174---------------------------------------------MINNL--KVSTRLTIL--IGVLCTLLIGIG--GLG
Q6D6I9_PECAS/1-177---------------------------------------------MFNRI--KVVTGLMLV--LVLFGALQLISG--GLF
B2JJ40_BURP8/1-177---------------------------------------------MLSRW--SIRTTLTVV--GIILVALTVIVG--ALG
A7Z835_BACA2/7-146---------------------------------------------IIKQR--SLTRKL..L--ISFLAILILPIS--TLA
A0A021WSL7_SALET/1-175---------------------------------------------MFNRI--RVVTMLMMV--LGVFALLQLVSG--GLL
A0A017QUD1_SALET/1-176---------------------------------------------M.KNI--KVITGVIAT--LGIFSALLLVTG--ILF
Q4V270_BACCZ/7-146---------------------------------------------RLGQI--NLKTKL..S--MAFIAILIIPSL--IVG
B2UJN0_RALPJ/1-174---------------------------------------------MLNRL--SIRFRLNAA--LSLLAVLLLTTG--IVG
Q6D6J7_PECAS/17-188---------------------------------------------MLSNL--RLVPLFIII--LGGIMLLFAASI--GTS
A7MLF1_CROS8/14-184---------------------------------------------FWHHI--RLVPLFSVI--LGGILVLFALCG--GLA
B1G1I0_9BURK/49-221---------------------------------------------LRKAI--SLQQRIALT--MALLAALMIAIG--VLG
A4G5M7_HERAR/1-171---------------------------------------------M..NI--TLKTRLGLV--IGLLALISMAVG--LLG
Q65FN5_BACLD/7-146---------------------------------------------WVKRP--SIAKKL..I--LSFLLILTVPII--VLS
A2WA91_9BURK/3-174---------------------------------------------VFRNL--TIRARIGLT--MAFLAALLGVIG--VLG
Q2W2L9_MAGSA/182-357---------------------------------------------L..KN--SIAGRLSGV--LAVLGVLMLVVG--WLG
A0A016QE24_BACAM/7-146---------------------------------------------WIKQP--SISKPL..I--AAFLAVLVLPVG--ILA
B1G4F3_9BURK/1-177---------------------------------------------MLSRW--SIRTSLTLV--GIILVALTMVVG--VLG
D2AI77_SHIF2/1-173---------------------------------------------MFNRI--RISTTLFLI--LILCGILQIGSN--GMS
Q39GS1_BURS3/26-197---------------------------------------------VFKNL--TIRARIGFT--MAFLAVLLAVIG--GLG
A7MJ45_CROS8/1-177---------------------------------------------MIKNI--KVVSGIIII--LLTFTVLQMVTG--SLF
J7JR33_BACIU/7-146---------------------------------------------WIKQP--SISKPL..I--AAFLAVLILPVG--VLA

PF05227

Q7D0T0_AGRT5/40-179--------------------------------------------------------------------------------
A4G3M4_HERAR/45-184--------------------------------------------------------------------------------
Q2GAV2_NOVAD/48-187--------------------------------------------------------------------------------
B0UAM4_METS4/47-180--------------------------------------------------------------------------------
A9A170_NITMS/36-172--------------------------------------------------------------------------------
Q8P5A5_XANCP/43-175--------------------------------------------------------------------------------
A5VFJ7_SPHWW/35-172--------------------------------------------------------------------------------
Q2JP01_SYNJB/220-357--------------------------------------------------------------------------------
Q6MHV5_BDEBA/38-175--------------------------------------------------------------------------------
Q5ZYY1_LEGPH/54-192--------------------------------------------------------------------------------
Q01W36_SOLUE/41-175--------------------------------------------------------------------------------
Q12FH0_POLSJ/36-173--------------------------------------------------------------------------------
Q2YRH7_BRUA2/43-180--------------------------------------------------------------------------------
A1T505_MYCVP/45-183--------------------------------------------------------------------------------
A8KY69_FRASN/39-176--------------------------------------------------------------------------------
A4YTN4_BRASO/32-169--------------------------------------------------------------------------------
E0TGG9_PARBH/50-189--------------------------------------------------------------------------------
Q11QI5_CYTH3/36-172--------------------------------------------------------------------------------
Q092X8_STIAD/39-182--------------------------------------------------------------------------------
Q6LKE0_PHOPR/42-178--------------------------------------------------------------------------------
Q21RH2_ALBFT/39-176--------------------------------------------------------------------------------
Q1CX08_MYXXD/35-172--------------------------------------------------------------------------------
Q1LS98_RALME/38-174--------------------------------------------------------------------------------
A5FHH5_FLAJ1/41-178--------------------------------------------------------------------------------
A1TTX0_ACIAC/37-174--------------------------------------------------------------------------------
Q1QXY8_CHRSD/37-172--------------------------------------------------------------------------------
Q9RYV1_DEIRA/56-192--------------------------------------------------------------------------------
Q4KBM7_PSEF5/44-179--------------------------------------------------------------------------------
Q9K632_BACHD/54-193--------------------------------------------------------------------------------
A9BLH7_DELAS/47-184--------------------------------------------------------------------------------
Q2KBR3_RHIEC/40-179--------------------------------------------------------------------------------
Q5E1H0_VIBF1/40-177--------------------------------------------------------------------------------
Q2JGB4_FRASC/72-209--------------------------------------------------------------------------------
Q2SCK4_HAHCH/45-182--------------------------------------------------------------------------------
A4YTQ5_BRASO/41-178--------------------------------------------------------------------------------
A1T9E3_MYCVP/46-183--------------------------------------------------------------------------------
B0UBF8_METS4/41-180--------------------------------------------------------------------------------
Q213L8_RHOPB/42-179--------------------------------------------------------------------------------
F2G547_ALTMD/40-179--------------------------------------------------------------------------------
Q9A3Q7_CAUCR/39-176--------------------------------------------------------------------------------
A1K2Y0_AZOSB/48-183--------------------------------------------------------------------------------
Q6ARK4_DESPS/61-203--------------------------------------------------------------------------------
Q0KFB4_CUPNH/37-173--------------------------------------------------------------------------------
A4Y015_PSEMY/45-179--------------------------------------------------------------------------------
Q8YQQ8_NOSS1/215-351--------------------------------------------------------------------------------
A1WDW7_VEREI/55-192--------------------------------------------------------------------------------
A1TNK2_ACIAC/40-182--------------------------------------------------------------------------------
B9M3W8_GEODF/37-174--------------------------------------------------------------------------------
A2TZQ8_9FLAO/41-178--------------------------------------------------------------------------------
Q6N729_RHOPA/41-178--------------------------------------------------------------------------------
Q2RWM5_RHORT/121-258--------------------------------------------------------------------------------
A1SZ61_PSYIN/35-175--------------------------------------------------------------------------------
Q6LTH6_PHOPR/40-184--------------------------------------------------------------------------------
Q4KA09_PSEF5/46-179--------------------------------------------------------------------------------
Q2JDT7_FRASC/40-177--------------------------------------------------------------------------------
B2JPZ0_BURP8/44-179--------------------------------------------------------------------------------
A5V5G0_SPHWW/46-182--------------------------------------------------------------------------------
A4VFK8_PSEU5/48-186--------------------------------------------------------------------------------
A4XNM7_PSEMY/48-183--------------------------------------------------------------------------------
Q09DK9_STIAD/35-172--------------------------------------------------------------------------------
A0ZB66_NODSP/212-352--------------------------------------------------------------------------------
A5VGP5_SPHWW/47-184--------------------------------------------------------------------------------
Q6ARK4_DESPS/216-358--------------------------------------------------------------------------------
A1TQ31_ACIAC/40-182--------------------------------------------------------------------------------
Q11TC1_CYTH3/37-173--------------------------------------------------------------------------------
A1TUA0_ACIAC/47-184--------------------------------------------------------------------------------
Q1IKU6_KORVE/55-192--------------------------------------------------------------------------------
Q02D29_SOLUE/39-176--------------------------------------------------------------------------------
Q7UME9_RHOBA/68-205--------------------------------------------------------------------------------
A6W4I3_KINRD/50-190--------------------------------------------------------------------------------
Q7CY49_AGRT5/26-163--------------------------------------------------------------------------------
Q81H18_BACCR/42-172--------------------------------------------------------------------------------
B8I528_CLOCE/36-171--------------------------------------------------------------------------------
Q15N85_PSEA6/42-179--------------------------------------------------------------------------------
A2SJW7_METPP/38-175--------------------------------------------------------------------------------
A7HUQ5_PARL1/53-190--------------------------------------------------------------------------------
Q12AQ9_POLSJ/37-174--------------------------------------------------------------------------------
Q8YMN6_NOSS1/37-174--------------------------------------------------------------------------------
A3HS22_9BACT/52-190--------------------------------------------------------------------------------
Q5Z3J6_NOCFA/47-184--------------------------------------------------------------------------------
Q89IE7_BRADU/79-209--------------------------------------------------------------------------------
Q0RSX8_FRAAA/34-171--------------------------------------------------------------------------------
Q1GY35_METFK/46-181--------------------------------------------------------------------------------
A1W3R7_ACISJ/33-169--------------------------------------------------------------------------------
Q1QLB5_NITHX/64-201--------------------------------------------------------------------------------
Q091M3_STIAD/35-172--------------------------------------------------------------------------------
Q2RN36_RHORT/47-186--------------------------------------------------------------------------------
A1WBJ8_ACISJ/37-174--------------------------------------------------------------------------------
Q4KE98_PSEF5/39-182--------------------------------------------------------------------------------
Q67R65_SYMTH/44-180--------------------------------------------------------------------------------
A1TJ97_ACIAC/40-182--------------------------------------------------------------------------------
Q89MA4_BRADU/41-178--------------------------------------------------------------------------------
Q20XI7_RHOPB/40-176--------------------------------------------------------------------------------
A4YTN3_BRASO/32-169--------------------------------------------------------------------------------
A4VRA7_PSEU5/43-178--------------------------------------------------------------------------------
A1VKR0_POLNA/37-174--------------------------------------------------------------------------------
Q7NLV3_GLOVI/46-194--------------------------------------------------------------------------------
Q9KEH6_BACHD/36-170--------------------------------------------------------------------------------
Q9RD38_STRCO/40-177--------------------------------------------------------------------------------
A7IHT5_XANP2/49-186--------------------------------------------------------------------------------
Q13ME9_BURXL/44-179--------------------------------------------------------------------------------
A6X818_OCHA4/47-184--------------------------------------------------------------------------------
Q67RS7_SYMTH/36-171--------------------------------------------------------------------------------
A0R5B3_MYCS2/38-175--------------------------------------------------------------------------------
Q0RPK3_FRAAA/40-177--------------------------------------------------------------------------------
B0UPY1_METS4/41-180--------------------------------------------------------------------------------
Q123E2_POLSJ/37-173--------------------------------------------------------------------------------
Q98B44_RHILO/33-170--------------------------------------------------------------------------------
Q12F56_POLSJ/37-174--------------------------------------------------------------------------------
A5FEK4_FLAJ1/37-171--------------------------------------------------------------------------------
Q090G4_STIAD/56-193--------------------------------------------------------------------------------
A1VL62_POLNA/44-179--------------------------------------------------------------------------------
A4YR54_BRASO/22-157--------------------------------------------------------------------------------
B1HNT3_LYSSC/48-180--------------------------------------------------------------------------------
B2FUS1_STRMK/43-174--------------------------------------------------------------------------------
B2HEL5_MYCMM/56-188--------------------------------------------------------------------------------
C5AXA6_METEA/41-179--------------------------------------------------------------------------------
D0J5Y8_COMT2/40-170--------------------------------------------------------------------------------
D4ZMN6_ARTPN/39-173--------------------------------------------------------------------------------
E3FRV7_STIAD/35-168--------------------------------------------------------------------------------
J9ZC42_LEPFM/5-146--------------------------------------------------------------------------------
J9ZDH6_LEPFM/41-176--------------------------------------------------------------------------------
M1FHH2_9ALTE/40-178--------------------------------------------------------------------------------
Q3J1L2_RHOS4/40-170--------------------------------------------------------------------------------
Q63KK2_BURPS/60-192--------------------------------------------------------------------------------
Q8F6F9_LEPIN/38-173--------------------------------------------------------------------------------
Q8PAN4_XANCP/38-173--------------------------------------------------------------------------------
Q8PCA9_XANCP/46-176--------------------------------------------------------------------------------
Q8YVU1_NOSS1/40-175--------------------------------------------------------------------------------
U5LEK7_9BACI/48-180--------------------------------------------------------------------------------

PF16591

F2KIP4_PSEBN/23-277WFSLGKMIERTDRMTSITELGNRLDHLRRARLQYQLDRGDEQKGALIQASLDQFVAKQKSLANELRKPENLKKLALIEQA
A4VQJ2_PSEU5/57-311WGSLGSVIQRSGWMTEISQLNKTLTDLRIARLQFMLANGDAESTERLDKNLGIYLAQQTKLLDTFKNPINVAQLKEQAGY
A4VGE7_PSEU5/34-290VTSLNGLLERNQKQTRLSQVQEASYAVDTARTLFEQSGSDAHAQQ.VTGKIGEVRNHLQDIRTTLTAADDQRDIASALQY
F2KBS3_PSEBN/33-286WTSLGGLIDRSNWMSDITQLNAGLTKLRVTRLQYMLTNGDETAAQNVQTTLDGFVAQQNALLSSFKSPENVKLLKEQSAV
Q4KIL8_PSEF5/33-286WTSLGSLIDRSNWMSDITQLNSGLTKLRVTRLQYMLANGDETAAQGVQNTLDDFSAQQKKLLASFQSPENIKLLQGLGAT
F6A9D3_PSEF1/33-286WSSISGLSYRMDRMGAVNKLMDDMGDMRLARGDYLQSQGNVDNAKALGAKIETTAQTLAGLKAFFTTPFNLKHLDDMTQS
F6AH80_PSEF1/33-287WTSLGKVVERSERMTDVNELTHTLTDLRVARLQYLLSNGSATEADKVQQHIRTLSQLQQAIRPKFRSPENVRLINEQIEL
F6A9X7_PSEF1/33-287WTSLGSLVQRSDWTADIAHLNDTLTDLRITRLQYMLANGDETIAETVQKSLDGFKAQHGQVLAKFKSPENVRLLQAQGAQ
M4WQE7_PSEDE/33-284WINLGNVIDRGDKLGEISELAAVAKDLRVSRLKFQSTRSPQDAKL.VVDTLDQLDRSHGALYDKFSTAEDRRKMDQQREL
A4VRY2_PSEU5/1-255...MDALISRSDRAQSAARLLDEANRIRYAQVSFETRGDPLHVEA.VEQSVARIVELVQQQKGEFSDPQDLQRLQAIAAD
F2KDB6_PSEBN/37-285WNSLSSVISRADKQASIASLNELAKDLRISSLEYEMRRGEQGPAV.VSEFLGKLQDSIQAALKRFVRPADQELLNQQLAI
Q4KJM1_PSEF5/37-285WTGLGRVIDRGDKLGNISVIYALTKDLRIARLNYEMSRGEHGPAA.VNDFLKQLDDGLQDARAQLQQPESITMVDQQLDA
Q87UY2_PSESM/37-292WHGLYTMIDRSESLSDVSQLTSLTKDLRADRITDRVEKTPETTAQ.VIKKLDEMKTHLTSLHRQSTEQATITLLNGQLQA
Q88D08_PSEPK/37-294WRALDGAIVRSQQLSEIGLINDLTKDLRAERITYRVLNDDASKAR.ISNILDQLNSMLTTLQQRSNVDESRQLLTEKMAL
MCPS_PSEPK/33-286WTSLGSLIDRSNWMGDIGQLNKDLTDLRIARLQYMIANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDT

PF12729

B8GHQ6_METPE/6-186FVNMKNINDGMTTLYADHTVTIEHV---GVADSTLFKLRGDLFK---YIII...--PDE...RTQL-ELDI.NTDIATIN
A5MYV5_CLOK5/6-185MMSLKTISSNSDDMYNNKLKRIYML---TNMKQNFTEIKSDIFQ---LIYE.KD--SSK...RSEL-EKNI.KSDMALNE
B2A037_OPITP/3-183LTRISRIQAATQEVVDQSLPAIVLL---EQIEALVKENFINATQ---HVIS.GD--TDR...MRAI-EAEM.DAKSTKLT
A6LXN5_CLOB8/6-185ISEIKKINANSTSMYEDNLKHLKTV---EELKANFLQIHSDLLA---LLTT.KD--ATK...KQDI-ESEI.EKLTNEDM
A6LXV4_CLOB8/6-186YYFLQTSSKSMEVMYSERLLSSEWL---SESRVHARAISADIFR---IMVT.TD--KNE...NSNL-TKDI.NTRAEEFN
B1YFV6_EXIS2/3-184LYFLNQMSNASQAMYKENLIPVQEV---AQIRIDTRALDSFLVE---MMLT.KD--PAR...IEEL-GAQI.DQRQAQIR
YVAQ_BACSU/2-181VLNMQHIIQKTDEINTKWIDGIKGI---TSINYVTEHLSSKEKD---FLIY.TD--KSK...MDTL-DQEM.NQIMEDIN
D1B8F4_THEAS/7-187YRFLSQSNRNLEDMYQDQLLPIRWL---IDTKANAALIKGLVSE---IIVA.DS--DAE...RDEL-VQRI.GELVKAND
A0KL92_AERHH/6-191YYSTRTMVQLVSNMHANQLLPIKDI---ANANIYAVYQNRALYR---YIGE.VD--PDL...KAQA-LVNV.DKFEKGMW
Q2FMT9_METHJ/4-184FIFISDLAAKSEEMYNDRLIPIQQI---GVINGAFTQFRGDVYK---GMLI...--PEE...RTVN-LDSA.ASVLASVN
A5N138_CLOK5/6-185TLSLRTMNMNSKSMYNNELLGTYML---TDMNKNLIQCKSNIIE---LIYV.KD--ESR...KNYL-KNDI.ETNDNETE
B8GS53_THISH/3-186LRGMSQADEGLRTVYEDRLVPTGQI---SGIIESLMDNRIQLVT---VLRD.PT--PAN...IQAR-TRTI.EENIADID
C4KYK6_EXISA/3-185HMLIGRMADAGEKIYEERLIPIRAI---GQLRTDNRAIESHLLE---LMLT.TE--SAR...NEEL-QKNI.EERRESMA
C4L6Z3_EXISA/47-227LFSMSDANRQADDIVNNWNKGLDYA---HELNTLAANYRTLELD---HIVT.ED--AAQ...KEEL-MTRM.KEIRDEIN
Q65NE7_BACLD/6-186VGGLSKLSKGSEMIYQDQLIPNQLF---ARLKANNLDLDTYKFE---LMVT.KD--SDR...NETL-QKNI.KEKNEENN
B3EAL3_GEOLS/4-184YVNVTSLDNEMDSLIEDKIVKIDLL---TDIRISANVSARAIRN---MLLV.SE--PAE...RQKE-LARV.KEAGEKIT
Q2FP73_METHJ/6-186LLNMMTINDGMTAMYYDRLIPLSQI---ASVSDEVLAMRGDTIK---YALI...--PEE...RANI-KNAL.ETNQKEAE
B8I3W0_CLOCE/7-187WFQTRKAQRALDTMYNDNLNQVASL---SNAGTALMTDFTNILR---LIAS.DN--TSY...QMAV-LSDI.IEKEKNLD
B0TC96_HELMI/4-187LNSLADEKASLDGMYNNALLPVRYL---GEAKAKLQQYRVAVYN---HILS.SD--KRD...LDEW-EAKT.KEYAKSFE
Q24U91_DESHY/6-186VFNTLRLQEMDQELYTYQTLPLLEL---RVIHGSFEENRAYIRD---IILE.ED--PAQ...IETH-LKAI.EQNRHEID
A0PY27_CLONN/6-189VVSAKKLNDNSKQMYFKSLQSIEYI---QEIKNNIDEEATCILN---IIYN.ED--LNQN.DRNNI-YKHITVDLKNKNQ
A6W0J9_MARMS/4-183MSAMKDIRANSEMIETNILPAITSL---GDVNSNLMRVRIFTLR---LLNE.TN--EEN...KKNT-LAAL.ESIKKEVA
Q97DG6_CLOAB/7-186YEKMTQVNDNINTIYSESLMKLSIT---KDIRAHMADLTSGSLI---LVNP.DR--KSI...VDKT-ISDM.NGLIEKDN
B0UJP2_METS4/9-189LVSTQRMREQSAAVEKDWLPGVRAL---GEIDTRAARLNGVLFR---HILA.TD--PAL...TATI-EKDL.VRFGTWVE
Q97J99_CLOAB/6-185LTSLKTVFSNLQNIYKVDLKGTNDL---IQLKADFMETRADMLK---LKDK.NN--KDK...VDDL-IKEI.SDLENKDN
B8I1D9_CLOCE/4-184YYYLNNSHLEMERMYEDRLLPIEWL---SDSISKTNENEKNILY---LILYSND--ERS...QTQS-IKNI.ENSSKIID
Q820J9_NITEU/4-184LYGLYQSKTKLETIYQDRVVVLGHF---SQILDSLLQVRMYALL---VTNL.RD--TGV...ARQR-AAQV.VDEDAKIN
D2QKC8_SPILD/2-187RRSTHKIQEESVSIYKDRLVPTAIL---VNLMSTVYGKRMLLET---KLLT.IE--KPD...SGLV-GSSL.DQFNRRAD
C6XTP8_PEDHD/2-188DKSVKSMNKSFVSLYNDRLIPATDL---FYIAEYVDQKRSLVEE---VLYAAAT--HPF...NQAV-LEQKLGRINAAID
B5EIZ2_GEOBB/6-186IREMHAVEESGTALYEKITVPITEL---QDISTSFQRIRVNLRD---MILA.TT--PEE...AQDK-VKRI.TELRTELD
B3E7H2_GEOLS/7-187VVNIQKMKKADTFMYQEVAVPLAGL---RDITQAFLLNRISTRA---LIGA.TD--PDE...REEI-ADSL.QESLAALE
Q97MS1_CLOAB/6-186ILNLNKVNNSNTETYEKMLVPTGEL---VSISNDFGTMRARVRD---VVIE.TQ--MDK...MDKF-SSDF.NAASSDFD
C6VSG0_DYAFD/2-186RYNVEGIDESFSSIYQDRLVPATTI---LYLTENLYRKRLSLEN---YLYS.DE--RQL...PAHV-KAQL.RAHDRSVD
Q97FH5_CLOAB/6-186VLKINGVNKNLDNIYNVDMKGTNIL---YQIRGYVIEVRADILL---IMDP.MN--KSK...IDSI-VGDI.DDIVQKDN
B0TE36_HELMI/6-185YYFLSQINRNAQEMYRDRLLPVEWM---GEIRTLARDSEAKMWE---IIIT.SD--GER...KKAL-AQAI.DKNTSVIN
A6LR72_CLOB8/6-186ILSSAKINDNADVLYRNNLISIKDL---GEIKGNIHDMRATYNR---LVFE.RD--KTK...LDDY-LKVI.NDLDIKND
A0Q228_CLONN/6-188LINSNKINKGADTTYSKHLLAIRDI---ESVKAGLNDEKASLMK---LIYN.VN--MSDQDIHNEI-SK.I.GELKVSDV
A1W7U5_ACISJ/3-184LYGTDQTKEGLRTVYEDRAVPLGQL---SQIQSNLLENRLALTS---ALAN.FT--PEE...VTRT-ATEI.DRILAETS
B2TPM5_CLOBB/5-185LGFLIKTNKDYQYALTNYGFSQGDI---GKLGIEIQKSRAIVRD---VIFL.EN--KDE...LIES-QNLL.DECEKKID
A5I5R4_CLOBH/7-185GIALKNVAKYGEKMYSTDLQSVYMI---TDMKQNLTEIKGDILQ---LIYE.KN--KSK...KTEL-IKNI.EKNQDENS
Q24QB3_DESHY/6-185IYSANNLAASLEGMYQDNLLPIKWL---NAARGQSRAVEAMTLE---LFIT.QD--QDR...QQEI-LQDV.QERAAEVD
Q24YV4_DESHY/6-183YSYTHVVSSEITDMYSNNLLPVKWL---NQVRADNRLVEELSMK---IMLTDQD--QAT...EDEE-LKTI.NETIAEIQ
Q250C4_DESHY/23-203YYDLKIANDNLQTMYEDRLIPVKIA---YDTRSDIRALNGFLLE---LMLT.VD--RAK...NQTL-LDSI.QEKGQGIE
Q81B11_BACCR/6-185FWGLERGKSTSSNMYEDNLLPIEWI---GIVESNFYHVNMNFME---IMVS.KD--EKR...MNEL-IREM.DGIRQEND
Q81ZA3_BACAN/8-187YMNLQQMHKQLQTVYVDRLQPIKWL---GSIESSLYQEFSYVKE---LIIT.ED--ENR...RTTI-LNKL.NDTNKETE
V6F5X6_9PROT/6-184LTSLGQLADSLRTVYEDRAIPLVQL---SEIQDKLHRMRANAIL---ASTS.GN--TAE...AARL-TANT.AQLDRQTD

PF02203

L8BID0_ENTAE/1-177FSSLKSDKENF.TVLQTIRQQQLLL---SESRVDLLQARNSLNRAGIRYMMDTN.KIGSGATIDEL-LAKA.KEELARAE
MCPD_ENTAK/1-173YVALRADNHNL.ERITVSSQQRDAL---SLSWVSLLQARNTLNRAGTRAALKVP.QEQV....DAL-MGGA.RSSLQKAD
B3HUP0_ECOLX/1-175FSSLHHSQKSF.VVSNQLREQQGEL---TSTWDLMLQTRINLSRSAVRMMMDSS..NQQSNAKVEL-LDSA.RKTLAQAA
A2S6U7_BURM9/1-177LYALNHASRSLDAIAHGDLPTIHTL---DDASSYLLRSRVALDRFKTLSEAGNA..DEA....KKV-LARA.QELYAKST
Q13QZ2_BURXL/1-174QLGMKRANDELAYAYSNQLTASIAA---GEANLSLTVARLSLDR...ALLHPDS..PDV....PDL-IART.QRHLRDSD
A0K3D5_BURCH/1-177LYALNHASRSLDEIAHVDLPAIHTL---DDTAAYLLRSRVALDRFRTLTEAGNA..ADA....AKV-LDRA.QELYAKSN
Q0K4P5_CUPNH/14-187LHGISQSNDALRETYAHQLGSTVAL---SEAMQATTRMRLALDR...NVMQGEQ..DDP....KVH-VDRS.KVFVEASE
A7Z837_BACA2/7-146FSSYHTASNSLDDQISGNAKNN...---...................................IES-FNTTITNDIGAKA
Q8XQ80_RALSO/1-174LLGMRHANTRVQATYEMQLAGAVAL---AESDASMLSFRLVLDR...AAMDIKA..PSL....GKT-LERA.RMFLAKSD
A3NJ34_BURP6/4-177FFSMQNSNAALDDAYTRQLAAKTAL---ASASLNLAITRTTLDR...VILHPEV..PDA....ANT-IAKA.EQYLAASE
J7JW03_BACIU/7-146VSAYQSAVASLDVQMTQSAKEN...---...................................VQI-LDHIIDDKISTTE
A8FGS8_BACP2/7-147TISYQIAKEELDHEIMYGANAR...---...................................VNE-LNDMIQQKLVNKE
A8FGS7_BACP2/7-147ISAFFTSKTELDKQIMGSAMSQ...---...................................VNA-FDTLINENIGNKA
A7Z836_BACA2/7-146AGAYRSAASSVEKQMMESAEGN...---...................................VQI-LNNMIDDRIGMFT
A1JT77_YERE8/1-177FNSLKNDKENF.AVLQVIRQQQSVL---NESWVNLLQTRNTLNRAGIRYMMDVN.HTGSGPTVNDL-LASA.KGTLGVAA
Q46PJ2_CUPPJ/3-176LHGISQSNDALKETYSNQLASTMAL---SDAMLATVRMRLALDR...NVMQGEL..DDP....RVN-VDRS.RVFVEASD
A7MM72_CROS8/1-177ISALNNDKDNF.NVSQISSQNVAEF---TDAWISLNQTRVTLNRGMLRLQGNMA.NQINGGQLSQL-VDTA.NKLLAEAQ
A7MEE5_CROS8/1-176FSSLNENQQSF.AASHQLRLQQAQL---NQSWNLLLQTRINLSRSAARMMMNAN..NQQSSAKTDL-LNTA.KKVLAEAD
A8GG43_SERP5/1-173YTAFRSDNHNL.NLITLGSQQRDAL---SLSWVSLLQARNTLNRAGTRAALKLP.....QDQVNAL-MGNA.RSSLQKAD
Q65FN3_BACLD/7-146VTSYFTASSTLEDEILRSAKDN...---...................................IDE-LNDIIQQDIGSKE
A4WA05_ENT38/1-177YSAVSNDRQNF.QNSGNLNAQQESL---SDSVNTLVKTRVTVTRVAIRYLKNQR.DPASLAAINKL-LGNA.STSLGKAE
A8GG44_SERP5/1-177FSSLKNDKENF.TVLQTIRQQQSEL---NESWVNLLQARNTLNRAGIRHMMDTN.NIGSGATVAEL-LARA.KSNLVVAE
I0UJV5_BACLI/7-146YSAYQTAGSSLETEIMRSARDN...---...................................VEQ-LNEIIDQNIGEKE
B2UHV2_RALPJ/1-174LIGMRHANTRVQDGYAVQLAGTVAL---AESDSNLLSFRIVLDR...AAMAPNA..PGM....EKT-IERA.QMFLDKSD
A0A017LS69_ECOLX/11-181GYFLWQADRDQRDV.TAEIEIRTGL---ANSSDFLRSARINMIQAGAASRIAEM..EAM....KRN-IAQA.ESEIKQSQ
Q3JSN4_BURP1/10-181LFGMSRANDANEQTSSNQLPSAIDV---ASAELFAARERLVLDR...AALLAGT..PDV....APT-IERA.RQMRGVSD
B9BHH5_9BURK/6-179LAGMQSSNRALDEAYTRQLAAKTAL---AAATLNLTIVRTTLDR...AVLHPEA..PDL....PEL-VAKA.ENYLAKAN
Q7N5T4_PHOLL/1-178FHELKSNKENL.EILDKMREQQTFL---NDTWVNLLQARNNLNRAGIRYMMKKDEGVDNYYTLEQL-LTDA.RSNLSIAE
A4TLJ4_YERPP/1-175FTAFRSDYQNL.NRVELSSQQRDAL---SLSWVSLLQARNTLNRAATRSALNVP.....QEQVNAL-MGSA.RSALQKAE
Q6D4S3_PECAS/57-232SQTMTQVQQDI.SANESLRQQQALM---DKARMEVMNASDKLNRAGIYLLVDKE..TGSEGSWHSL-MDEA.EVSLKQAK
A8AGH6_CITK8/15-185GYFLLQADRDQRDV.TDEIQVRMGL---SNSSNHLRTARINMIHAGAASRIAEM..DDM....KAN-IAEA.EKRIKQSQ
B5WVT2_9BURK/1-177LTALNRATGSLDRIARGELVAIHAL---DDASAYLLRSRLAIDRYNTLTAAGNT..DEA....KKV-LDRA.QELLGKGK
A7GNX1_BACCN/7-146GISYQTAKKNFESQIMNSANEN...---...................................IQI-LDNLINQVIEEKF
Q46ZP9_CUPPJ/1-174MIGMSRSNDATHEIYEHQLTAAMRL---AEARSNQLLVRVLLDQ...ATLAKDP..ADA....RAR-AETA.QGFARDSE
A7MPS2_CROS8/15-185SSLLGDTQQQV.QHREAQRQQQAAM---DDARVTLLMASDLLNRAGIYFMQDKE..TGSVGSWNSL-MDEA.QAALKRSH
A4JE67_BURVG/2-173LYGMSTANDSMRELFTNQMPSAVDV---AVADTYAARERLALDR...AALLVGT..PDS....ATA-VERS.REMRAQSD
J7JYH6_BACIU/7-146IFAYQSASSSLDRQMMGSALEN...---...................................VQQ-LNEIINTSIGEKE
E5W1J5_9BACI/7-146GVSYYTAGGSIEDEIMRSARNS...---...................................VDQ-LNEMIDQNIEKKA
B2TGA5_BURPP/1-171VTGMARSNDANRETYTNRLASTRLI---GDAELAISRERTTVDR...IAFDPAA..PTV....EKD-IATY.RMLKGQGM
A8TNN7_9PROT/6-182LLTADYSNGKLRTVYDDRTVPLGQI---ADINNRMSANILALYQ...AASDGSA..GHAF.DPATV-SEKV.DRNISRIG
Q0K9D3_CUPNH/1-174WLGMSRSNEATHQIYGQQLSAAVNL---AEARSNQLLVRVLLDQ...ATFATDP..ADA....KAR-AATA.EGFARDSE
B2JWU0_BURP8/26-199IAGMHGSNSAVAQAYMSDVAAATSL---GKSNLNLTVVRTTLDR...VLLHPEA..PDT....GAL-IDKA.LNYLAVSD
A4JSC9_BURVG/1-175VIGVAISNDDVKTLYSERLASSEAL---GQANVALSRTRLWLYR...IALDPDS..PDV....AQE-SATA.RELLAASK
A4WBP6_ENT38/1-175FSSLKQNQESY.TAANDLRLQQREL---TSAWDLMLQTRINLSRSSARMMMDPN..NQQSSAKTDL-LKNA.RGTLADSA
A6T1W9_JANMA/1-174VFGLQSTNNSLQDVYGNQLASSQAI---NTAITRLFQARSTIDR...VLIKSSG..SKN....AEI-FARA.DTLRNESD
A6SU23_JANMA/1-173LSSLSATNDALKTVYEDRTVALGEL---NTVITLLTINQLDLA....ASIYGDP..NLV....LPK-MDAI.EKRTKTIA
A4W5T8_ENT38/1-177INALNNDKDNF.TVSQVSSKNVAEF---TDAWISLNQARVTLNRGMLRLQSSAA.SQINGGQLSEL-VATA.KNLLANAQ
A8AGR3_CITK8/15-185SFSVRDAQRNE.QRNQQALLQQTKV---DEARVALLSASDLLNRAGVYFMQDAA..TGSEGSWRPL-MDEA.QQALVQSK
A8FGS5_BACP2/6-146FSSYHTASTSLNDQIMQSAKEN...---...................................VEQ-LDKNITKVVKVKT
A4G2W4_HERAR/1-175ILGVQTTNNTLQNIYVNQMPSSEAI---HSMMTRLLQARAGLNL...VAMRPHE..EGS....ERI-LKRA.ENFYLQSE
C6BHT9_RALP1/1-173LLGLRDANRAHEQTFTNQFPSALAL---GESDLSLTRARTALDK...AMLYPED..KGA....MQL-LDRT.EELIARSD
Q21SE1_ALBFT/1-173LYGMGKSDEAMDIAYKDSTVQIANI---GNIKYLMLRNRLMIAN...AVIEQTP..ESI....KRA-GDEV.EADIAKIS
B2T9U8_BURPP/1-172FWSLTRTHDDVGDLSNIALKQVDAV---NETTQHLMDARINLSRAGTRMVRGGS.....E..PTDI-VQHA.REQLTAAD
A9ALM0_BURM1/1-172FWALASTRSGVDDLSNVAIAQVDSA---NQATERLLDARVNLSRAGTRMVRGGP.....K..PDDI-IRHA.SDSLVEAD
B5BKZ4_SALPK/1-177FNSLKNDKENF.TVLQTIRQQQSAL---NATWVELLQTRNTLNRAGIRWMMDQS.NIGSGATVAEL-MQGA.TNTLKLTE
B9BQN2_9BURK/16-188LYGMSQTGDALRTVYEDRTVCIQQL---AQVSNRLQDQLLALSR...ATLEPQT..NPP....AAA-IERA.DKDRSEFE
A3RYQ0_RALSL/33-207LIGNLRSNAALKETYSNNLASTRAL---GQAEAKLAQARTALDR...AIFETDP..AKT....TDA-ISRI.DAQLGNSE
Q0BFK7_BURCM/2-173VYGMTRSNDATREIFTNQMPSAVNV---AVAEMYAARERLALDR...AALLAGS..PDS....AAA-VERS.RAMRTQSD
B2T7C0_BURPP/1-177LSALNRASQSLDRIARGDLVAIHAL---DDASAYLLRSRLAVDRFNTLSAAGNA..DEA....KKA-IERA.QELLTKGN
A4WBP5_ENT38/1-173FWAFRDGYQNL.QEVETSNQQRSTL---AQTRAVLLQASTALNKAGTLTALSYP.....PDDIKAL-MTTA.RDSLKQAE
B2JQ81_BURP8/1-172FWSMTRTHDDVKDLANVALHQVNAV---NVTTQNLMDARINLSRAGTRMVRGGA.....E..PTEM-VQHA.REQLAAAD
A8AFE7_CITK8/5-177FWAFRDGFQSL.NQVEQSNQQRAAL---AQTRAVLLQASTALNKAGTLTALSYP.....PEDIKQL-MTTA.RESLAQSG
A0A014LTC5_YERPE/23-197SHILKSTKANV.EITHRNHQQEALM---DRARMELLIASDKLNRAGIYYMEDKE..TGSEGSWQSL-LNEA.LQSLQQSQ
A4LLG2_BURPE/1-172FWSLSASRRNVDALSNVAIKQTDAT---TVATQHMLDARTNLSRASTRMVKGDP.....M..PTET-LQHV.RDQLALAD
O05244_BACIU/10-150FSSYRSASGKLDQEIMGNAKNS...---...................................VDT-FNTTVTNDLGEKA
A3RWP1_RALSL/1-174VIGMRASDENIRDIYTNQLASTSLV---SKAHLSTAVIRTTLDR...AVLHPEA..ADV....PSL-IEKA.GTYRARSE
Q7N5T3_PHOLL/1-175LGIIHADQSYI.EQIDLGTQKRDTL---GLSWAALLQSRNTLNRIAVGKTLQQS.....EDHIGSM-VANV.KETLDRAE
B1Y1L2_LEPCP/1-174IYGIGESNDALRRVYEDRTEPAANL---AEIKGLLLRNRLAIAV...AQAHPTP..EVI....AER-TGQI.ERNIADIT
Q6D6I9_PECAS/1-177FSALKNDKDIF.SSTQVINQKRSEL---DSAWSYLLQTRNTLNRAGTRFALDVS.GTGAGVGGKEL-LTSA.EKQLAVAN
B2JJ40_BURP8/1-177LTALSRSADALDSMAHGDMVAIRTL---NDSASYLLRSRVSLDRVNALTAAGEI..EQS....KQV-LERA.AELLGKSN
A7Z835_BACA2/7-146FIAYQSAVSTLDRQMMGSALDN...---...................................VQQ-INDMINTSISQKE
A0A021WSL7_SALET/1-175FSSLQHNQQGF.VISNELRQQQSEL---TSTWDLMLQTRINLSRSAARMMMDAS..NQQSSAKTDL-LQNA.KTTLAQAA
A0A017QUD1_SALET/1-176YSAVSSDRLNF.QNASALSYQQQEL---GGSFQTLIETRVTINRVAIRMLKNQR.DPASLDAMNTL-LTNA.GASLNEAE
Q4V270_BACCZ/7-146VSSYNKAKTDLNEIILQSAKDN...---...................................ISI-LDKIVDDELENKH
B2UJN0_RALPJ/1-174VIGMRASDANINEIYTNQLVSASLL---GKAQLNAAIVRTTLDR...AVFHPDA..ADV....PAI-IDKA.NGYRAKSD
Q6D6J7_PECAS/17-188SYFLQSSNQSLDDV.TQEIDTRMGI---SNSSNHLRTARLLLIQAAAAARIGDS..QVF....NDN-LKQA.EQRLDQSK
A7MLF1_CROS8/14-184GYFLMQGDSALNNV.TQEIQIRSGL---ADSANQLRTARINMIHAGAASRVAEM..DAM....KRN-IADA.EKAIAQAN
B1G1I0_9BURK/49-221LAGAWRANQATRDTYENKLTAAVHI---GNAELLMARTRLVLGG...AMAATDT..ARA....GEQ-IRHA.ADFLKQSD
A4G5M7_HERAR/1-171LNGIGRSNGDLQQVYQHRTVALEKI---SRIDRLLLANRLALSE...ALHDPDA..EKT....ASH-TALI.AKNAAEIT
Q65FN5_BACLD/7-146YSAYQTASSTLDGEIMDNAREN...---...................................VNQ-LNEIINQNISQKT
A2WA91_9BURK/3-174LYGMTRTNASTREIFNNQMPSAVNV---AVAEMFAARERLALDR...AALLAGT..PES....AAA-IERS.RAMRAQSD
Q2W2L9_MAGSA/182-357ISGMRGIGEDMREVYLENTMPAIDL---AEVADLSQENYRQIAS...IAVQMLA..NQHWVPVSER-LAAI.ESNSQIIN
A0A016QE24_BACAM/7-146YFSYQTAGNSLESELTHSAQGN...---...................................VSE-LNSVLENMLEGKL
B1G4F3_9BURK/1-177LTALGSASRSLDRIARGDLVAIHAL---DDASAYLLRSRVSLDRFTALTAAGDT..ETA....KKV-LDRA.VELYGFSN
D2AI77_SHIF2/1-173FWAFRDDLQRL.NHGEQSNQQRAAL---AQTRAVMLQASTALNKAGTLTALSYP.....ADDIKTL-MTTA.RASLTQST
Q39GS1_BURS3/26-197VYGMTRANDTTRDIFTNQMPSAVDV---SVAEIYAARERLALDR...AALLAST..PDA....AAA-VERS.RAMRAQSD
A7MJ45_CROS8/1-177YSAVNNDRNNF.QNANLLNFQQEQL---GDSFQTLVKTRVTVNRVAIRFLKNQR.DPASLAAINKL-LATA.STSLGKAE
J7JR33_BACIU/7-146YFSYQSAWNALDRELISSAKGN...---...................................VEE-LNSTLQNKLEDKV

PF05227

Q7D0T0_AGRT5/40-179----------VTIENNRTKDIIQAV...DGATAAMLEQAVNQRG---FLLFRSD----------ST.YNDV-FAQRELML
A4G3M4_HERAR/45-184----------SSRLVEHTHLVIKQI...DQVVSDLKDAESTQRG---YLITGDG----------IF.LKTH-YDILAQLP
Q2GAV2_NOVAD/48-187----------QREQAARTSGILASL...DEIIRATMNGETGQRG---YFITSDT----------RY.LAPY-REGQERYS
B0UAM4_METS4/47-180----------AAAEAVRLNGVIAQS...ERVLSTLKDLETGLRG---YILTGDG----------AY.LDPY-AAALTHID
A9A170_NITMS/36-172----------FKSIAERDLLVIQNA...EKLQRLAVDSENGQRG---FIITGNE----------SF.LEPY-NRGVDEFF
Q8P5A5_XANCP/43-175----------AAVWVSHSQDVQETA...QRLEASMRDTESAAMM---RSHGVDR----------PVLVERM-RQGRTEAM
A5VFJ7_SPHWW/35-172----------AGDWAEHSLRVQVML...TGLTDHVRALESDHRG---YVLSRSR----------DI.RADF-RKQVDALP
Q2JP01_SYNJB/220-357----------LTERVAHTLKVIQNL...EGLLAETRAAEAGKRG---YLLTDNP----------RY.LGEY-QDSLEAIS
Q6MHV5_BDEBA/38-175----------TIALYEKTEALISMI...QNVEKSTLDLETGQRG---YVLTQNE----------QF.LKPY-LDANDAIE
Q5ZYY1_LEGPH/54-192----------ASNWVSHTHEVIQTI...DTCLYDIVEIESRQRF---YLIRGSS----------SQLMADI-DDMKSTLQ
Q01W36_SOLUE/41-175----------AADRATRSRAVMETS...QRLFSLLRDADSGHRS---YLLTGDS----------RY.LAAY-NGTLPKLQ
Q12FH0_POLSJ/36-173----------AMDDLSEAHVTRTHL...QRLLRDVLDAETGQRG---YLLTADT----------AY.LEPY-RTAIADLS
Q2YRH7_BRUA2/43-180----------QIVDISHNYALRQQV...DKVSRLANNIEMSRRG---YLLTLDD----------NY.LDLY-RRSILTVD
A1T505_MYCVP/45-183----------VDELSNEVVPIQGEV...EVLRRAFTDREAGQRS---YLLTGNP----------AS.LEPF-DAGAVTAD
A8KY69_FRASN/39-176----------IHVRSDVLAPAQTVT...VRLTSSLVDQETGMRG---YLLQGDP----------AF.LTPY-ETGRQSEA
A4YTN4_BRASO/32-169----------DEAWVTSSLDILQKT...SDLRLLLSEAEASSRG---FALTGAA----------PF.RTEF-DNVSTKIP
E0TGG9_PARBH/50-189----------AEDDVRRAFAIQRDI...YQVHALLAEAASGVRG---YLLTGQD----------RF.LEPF-RRAEGELP
Q11QI5_CYTH3/36-172----------ANHWVNHTNKVIISL...ESIYSDIKNAESGVRG---YALTKDA----------SY.LEQQ-DQSRTNIK
Q092X8_STIAD/39-182----------ARLLDVHSYDVLLEA...RALMKSVVDIETGKRG---FLLTGDE----------KF.LDSL-IHGRSAFT
Q6LKE0_PHOPR/42-178----------SNEWVEHTYVVIDKI...DYTLLNVVNMETGYRG---FMITNNE----------EF.LEPY-KGGVEAVK
Q21RH2_ALBFT/39-176----------AAHWVAHTHEVLDSL...AQTRANTLQIEFSTQS---YRISGDP----------AR.LAER-DATIATRE
Q1CX08_MYXXD/35-172----------STAGLLTAHENFRII...REVRALLMDAESGQRG---FILTGDE----------SY.LVPY-REAAVALQ
Q1LS98_RALME/38-174----------GYIEAIRSQQLQNDL...GDLIAELVNAEGGQRG---FLLTGKD----------SY.LDPY-YKALPRIN
A5FHH5_FLAJ1/41-178----------SSKLVMHTYEINIQL...ERLMSAIKDAETGQRG---YIITRNA----------RF.LTPY-IYSRDKVN
A1TTX0_ACIAC/37-174----------AVRALSSTYTTRAAL...NRMMQNMLDAETGLRG---YLLTGDD----------RY.LQPY-QKAAATID
Q1QXY8_CHRSD/37-172----------TARSVAQTLGVIADA...NHLMRLFMDAETAQRG---YALTRDG----------DY.LAPY-QRALSMFP
Q9RYV1_DEIRA/56-192----------SARFAQTSQGRLLTL...RLLLTDISNMENGERG---YVITGQP----------SF.LEPY-QRGQQNFA
Q4KBM7_PSEF5/44-179----------VIQWVQHTDRVINNL...NESARLTIDLETGMRG---FLITGDE----------HF.LDPY-EVAKPRIV
Q9K632_BACHD/54-193----------HSALINEKMTVLRNT...DDIQLQAMTQINSLRS---YLISGED----------EL.VEEL-EEANNQLV
A9BLH7_DELAS/47-184----------AVNAMDRTTLAMRQL...SQLNASLKDAETGQRG---FLLTGDQ----------AY.LQPY-QQARDVLQ
Q2KBR3_RHIEC/40-179----------ASAEQEKSELLVNQI...DDALQAMLEQAVNLRG---FILFRSD----------ST.YGDV-FANRERML
Q5E1H0_VIBF1/40-177----------KLAWVIHTHNVITKS...EKLLSSMKDAETGQRG---FLLTQEI----------NY.LQPY-YTGIAESK
Q2JGB4_FRASC/72-209----------LHTRSDVLAPALLSS...TELVSSLVDQETGMRG---YLLQGSE----------DF.LEPY-NEGRRAER
Q2SCK4_HAHCH/45-182----------IESSVSHTLQVIGII...KNTFSAIQGAETGQRG---YLITGDE----------AY.LEPF-HDAMNSLE
A4YTQ5_BRASO/41-178----------DSAWVVHTVEAENQI...NALLLEVRRAESAARA---YLLTQGE----------EF.LNDH-EAAVAAIR
A1T9E3_MYCVP/46-183----------SGQLIERIQPARVAA...LQMQAAIRDQETAVRG---YLITADL----------RF.LKPY-DEGRAAEQ
B0UBF8_METS4/41-180----------ANDWRDHTYQVLAQV...EVLTTAMVNQETGVRG---YLLAADA----------KF.LEPY-NAGGRAFT
Q213L8_RHOPB/42-179----------DAAWVAHTLEVENQI...SLSLLQMRRAESAERG---YLLTQQP----------GF.LEDY-EESAGGIL
F2G547_ALTMD/40-179----------LEARLFTTNRVINAI...NRLHVAVLRVESGQRG---YMLTDDE----------KY.LTDY-SESLSVIG
Q9A3Q7_CAUCR/39-176----------STESSNHSQQIHADA...LALETAILRQNSQFRG---YLVTGDS----------TY.LKSY-YEGRDEYD
A1K2Y0_AZOSB/48-183----------ALETMQLQAARTARL...DSMLIQLVDAESGARG---YLLSRNH----------DY.LAPY-LNSLATVE
Q6ARK4_DESPS/61-203----------TGESVNHSHEVVEHA...MDILAAAVDMETGMRG---YLLSGKE----------DF.LSPY-TNGYKTFK
Q0KFB4_CUPNH/37-173----------SYTDVIRSQRVQTEL...AALNGELVNAEAGQRG---FLLTGKE----------SY.LEPY-YKALPRIA
A4Y015_PSEMY/45-179----------VEDDVRRALRVQGDV...QAVHSLLAEAAASVRG---YLLVQRS----------DF.LPSY-RSALERID
Q8YQQ8_NOSS1/215-351----------NGNQVQTTQESINNL...EQLLSQMKDAETGQRG---YILTGKD----------PY.LQTY-QTALANID
A1WDW7_VEREI/55-192----------AVQQMSLGQSTRSDV...NSLLQSMLDAETGQRG---YLLTGAE----------TY.LEPY-DRAVATVQ
A1TNK2_ACIAC/40-182----------ASGMNIHTYRVLEEA...RRMLLGVVNMETGARG---YLLSGDA----------AF.LDPW-NQGREAFE
B9M3W8_GEODF/37-174----------ANNDVMRSYEVQKEL...ETILSVMKDAETGQRG---YIITGDE----------SY.LEPY-RSAQASIA
A2TZQ8_9FLAO/41-178----------ATDLVVHTYKLNVEL...EQILSYLKDAETGQRG---YILTTDS----------LY.LEPF-FSGREKIN
Q6N729_RHOPA/41-178----------DNAWVAHTLEVQNQI...ALAQLQLRRAESAERG---YVLTQQD----------DL.IAQF-EEAASDVV
Q2RWM5_RHORT/121-258----------YATSFDQTQEIYMRA...TRTFRGLQDAETGQRG---YLLTHDP----------AY.LQPY-HDALSRMS
A1SZ61_PSYIN/35-175----------KLGWVIHTHEVLNSA...QKLLSSMTDAETGQRG---FLLTGNP----------DY.LAPY-LKGILSSE
Q6LTH6_PHOPR/40-184----------TAKMVEHTYKVIGNS...NGLVNAMVDEETGLRG---FAIGGQD----------DY.LEPY-ISGKEKFQ
Q4KA09_PSEF5/46-179----------AEEDVRRVLLVQGDI...QAVHTLLAEAAASVRG---YLLTRRE----------DF.LPAY-LQARPQIE
Q2JDT7_FRASC/40-177----------ATERSRHLDPAATTT...AMLLADFVDQENALRG---YIITRDR----------GF.LVPY-NESARSIP
B2JPZ0_BURP8/44-179----------TISWVEHSERVIGHA...NEMLRLAVDRESALRG---FLITGDE----------AF.LAPY-QLGQPRFE
A5V5G0_SPHWW/46-182----------TRQALQSSFVYQREV...ERLFSLIKDAETGQRG---YLISGSP----------AF.LGPY-DDASAKID
A4VFK8_PSEU5/48-186----------TNRAVSHSLEVITSV...QAILSSLQDIETGSRG---FILTGDA----------SY.LEPY-ERGLNQLE
A4XNM7_PSEMY/48-183----------VIRWVEHTDQVLNRA...SEVYKLTLDLETGMRG---FLLSGRE----------DY.LAPY-ELARGKYR
Q09DK9_STIAD/35-172----------TSDDVVTSREQARYL...REVRTMLLDAETAQRG---FLLTGQE----------RY.LDPY-VRALPNIE
A0ZB66_NODSP/212-352----------YIDIINQQQKTLEKINLQEQLLSLLINAETGQRG---YIITGDQ----------SY.LEPY-KLAVNQID
A5VGP5_SPHWW/47-184----------ADKAIRHTHEVLIAL...DEVLSTAKDAETGQRG---YLLTGTN----------AY.LEPY-RTAVAALP
Q6ARK4_DESPS/216-358----------SAKWVNHTQIVIKEA...MNIEAAAVNMETGMRG---YLLAGKE----------EF.LDPY-KNGTQSFN
A1TQ31_ACIAC/40-182----------ADEMNQHTHVVLGVG...QEMLQSMVNMETGARG---FLLAGEE----------RF.LEPW-AAGIKSFD
Q11TC1_CYTH3/37-173----------TNEWVDHTHKVLYAL...EQILVTEIDAETSMRG---YVITGTS----------SF.LKPY-NRAIDNIY
A1TUA0_ACIAC/47-184----------AVRRINSAVESIVQI...QYVLSIIKDAETGQRG---YLLAGEP----------RY.LGPY-ETAEASLT
Q1IKU6_KORVE/55-192----------DSSWTSHTQDVITNL...DQLQSTLEHAESSQGR---YLITGDE----------TF.LKNY-ELDVRTTR
Q02D29_SOLUE/39-176----------SNQSAVESERVQDEV...NGLLAAMLDAETGQRG---YLVTGQE----------RY.LEPY-RRATQAIP
Q7UME9_RHOBA/68-205----------TRLKVGLTLKVLASL...AEIEGAVMDAERGQRD---YLITDDQ----------RH.LEPF-KEAVKRTR
A6W4I3_KINRD/50-190----------AQRLLVRVAVARQAT...ADLLTRYVDQETSLRG---YVITGEP----------DL.LSPY-QVAQRELP
Q7CY49_AGRT5/26-163----------YSQETAELRRFRAAV...LDVLTTMQDIETGQRG---YLLTNNR----------DY.LGPY-EEALRDLP
Q81H18_BACCR/42-172----------RNFIIDHDFKVLNLT...NQVEKELLTIENKAKG---FIISNNP----------TY.VQSL-NSAEKDYE
B8I528_CLOCE/36-171----------AENLITDAIPIGYAA...DGLLTALVNEETGVRG---YLVSGDE----------TF.LEPY-NSGKSDVR
Q15N85_PSEA6/42-179----------VQTDLDKTSNIIVRL...ESLHLSVVVAESGQRG---YLLTEYE----------EY.LNPY-HAELQTLD
A2SJW7_METPP/38-175----------AIQETNAAVDARIHV...GRVLRYMVDAETGQRG---YLLTGKE----------AY.LTPY-RNAVTQIK
A7HUQ5_PARL1/53-190----------NAEAVSQTIEVRADL...LTILNLLQGTETGQRG---FLLTRDS----------KY.LEPY-NETRFEIG
Q12AQ9_POLSJ/37-174----------ASDLRQHTYEVLSRL...AEMELLSADMQNGLRG---YVITGEE----------KY.LEPY-QTAVGKID
Q8YMN6_NOSS1/37-174----------NAQSVIHTREVLEKT...QELIAHVSDAETGQRG---YLLTGKP----------AY.LEPY-HRATDEIG
A3HS22_9BACT/52-190----------YTSALMETQDVLQRT...SELYASILERETNIRG---FVITGDE----------DF.LTNY-QQSLIDAQ
Q5Z3J6_NOCFA/47-184----------TDRLLEQTLPAAAEA...YRLQSTLVNQETGLRG---YAIAADP----------QF.LEPY-VEGRQEQE
Q89IE7_BRADU/79-209----------AHHFIEHSRQVLETL...DRLRAIVAELETERRG---YLMTLDP----------AY.LKAY-GVSDESVR
Q0RSX8_FRAAA/34-171----------IHTRSDIMAPALLGS...AQLVSSLVDQETGMRG---YLLQGHE----------EF.LEPY-NSGRRDES
Q1GY35_METFK/46-181----------SMNWVEHSERVIGKA...QEVSKLAVDMESGMRG---YLLSGDN----------SF.LQPY-LLSKPKIQ
A1W3R7_ACISJ/33-169----------AVDNLNATVERITQI...QMVWSHLKDAESAKRG---YLLSGQE----------QT.LGLF-TVAQAAVP
Q1QLB5_NITHX/64-201----------DAGSALHSMEVENEI...SLAQLEMRRAESAQRG---FLLTQHP----------DF.RSAF-ERAASHIP
Q091M3_STIAD/35-172----------TTEELVRSELTIEEL...RQLTAHLVDAEAFQRN---YIITGNE----------EF.LNRY-RAAATESR
Q2RN36_RHORT/47-186----------TNNWTNHTREVQTAV...EKMRLSQIDQETGVRG---FLISGEE----------SF.LEPY-RANQAVFR
A1WBJ8_ACISJ/37-174----------AVGDLARSHATRAAL...DRLLQNMLNAETGLRG---YLLTGDE----------RY.LQPY-EQAVATIN
Q4KE98_PSEF5/39-182----------SVKSTIHSHEVLNQS...DALLRSLINIETGMRG---YALTGRD----------SF.LEPL-EQGEKAFT
Q67R65_SYMTH/44-180----------FQERARLTQENVRRA...EQVATLYAEMTAALRG---YLFTGDE----------SM.LAPY-EPNLNRLH
A1TJ97_ACIAC/40-182----------AESWNEHTYQVLDRS...NALLRSMINMETGARG---FLLSGDE----------KH.LEPW-NGGAREFN
Q89MA4_BRADU/41-178----------DSKSVVHTIEVENQI...NTLLLEVRRAESSARG---FLLTQGP----------DF.QSDH-EKAVAAII
Q20XI7_RHOPB/40-176----------NSSWVRHTNDVLRLI...AGIERAVLQAESGERG---YLLTHVG----------EY.REAY-ENAKAALP
A4YTN3_BRASO/32-169----------DAILVEHTLEVLEKS...SELRLLLRQAEASSRG---FALSGAD----------RF.VTEF-QDSGRRTP
A4VRA7_PSEU5/43-178----------VSHWVDQSVKGVAHA...HEALRLVADLETGLRG---YLIAGEK----------PF.LDPY-RQGLEQIE
A1VKR0_POLNA/37-174----------AVSNMEQAQQTRSAI...TRLVRQVLDAETGQRG---YLLTGDP----------RY.LEPY-RSAVGDIT
Q7NLV3_GLOVI/46-194----------LRQSYRLSRELNINV...YRMQEGMTDQETGVRG---FLLARQE----------EF.LAPF-YQGRVQYL
Q9KEH6_BACHD/36-170----------YTTIIGEVEGARAAA...LQIESSVSQQSNHLRG---YLLSGER----------EL.LDRF-YQANQEVN
Q9RD38_STRCO/40-177----------TDRLADRLQPAQTET...YRLQAGLINQETGARG---YAIAGDR----------QF.LAPY-TQGKAEEA
A7IHT5_XANP2/49-186----------DADRVNHTLRVMNAI...SQFQIMIRRAESAERG---FLITGGE----------GF.LRFY-EESKARAL
Q13ME9_BURXL/44-179----------TMNWAEHSERVIGQA...NEMLRLAVDRESSMRG---FLITGDE----------SF.LTPY-EEGGPRFK
A6X818_OCHA4/47-184----------ANQKIVETHRAIVSL...KNLLLQLQDAETGQRG---YLLTGED----------GY.LGPY-LNARGAIA
Q67RS7_SYMTH/36-171----------YGEVVLDYQPAHQAA...TALNAAVHRMSASARG---YVLDPSA----------AH.REGF-ETAADDFS
A0R5B3_MYCS2/38-175----------SDELINEIQPARVAA...YQLQAALRDQETAVRG---YAIAADP----------QF.LAPY-DEGQQAEA
Q0RPK3_FRAAA/40-177----------ATERGKHLDPAATTT...AMLLADIVDQESALRG---YIVTRDR----------GF.LKPF-DDSRRSVP
B0UPY1_METS4/41-180----------KVGWTQHTYDVLGAT...TDLTAAMVDQETGIRG---YIITADT----------KF.LEPY-QAGRRAYG
Q123E2_POLSJ/37-173----------DAQQETQTRETVLLL...EEVVSQFKTAESLQRR---YLLTHTA----------ND.LMTY-RQARAGIQ
Q98B44_RHILO/33-170----------SFDDVIAARDTRTAA...VDVRNSLLSAESSQRG---FLLNGNE----------IY.LSPY-DTAKSSAL
Q12F56_POLSJ/37-174----------AAANIEEAQQTREAI...NQLLQRMLDAETGSRG---YLLTGDP----------RY.LEPY-NNATADIS
A5FEK4_FLAJ1/37-171----------SNFWVNHTQDVIYNL...NEGSSIITEAQTSMRG---YLLTGDE----------QF.VDRF-NDSEAKSN
Q090G4_STIAD/56-193----------TGELVTHTLEVVERL...EALLSLVKDAETGQRG---FLLTGVD----------SY.LDPY-SSAEMAIP
A1VL62_POLNA/44-179----------ALGGVEQTERAISNA...NQIGKLGADMETSMYG---YLVTGEE----------SL.LQPF-EIGKPRIA
A4YR54_BRASO/22-157----------.NQWTVHTYQVMEQA...KALVSAMVDAETGVRG---FLVGGTD----------NF.LEPY-RNSDAAFK
B1HNT3_LYSSC/48-180----------......YDSNVKTLT...NDIEKYILDMESSQRA---FIITGEP----------SY.LEPY-DNGAENWK
B2FUS1_STRMK/43-174----------AMAWVNHTQAVGVAL...QQLQADVRDVESAALT---LSKGVDA----------PG.LRER-MAAANDIP
B2HEL5_MYCMM/56-188----------....SDNIEPARVAA...FQLQSALRDQESGIRG---YVISSDS----------QF.LSPY-YDGRRTEE
C5AXA6_METEA/41-179----------TNRWRDHTYQVLLDL...DRLTASMVDRETGLRG---YLVSADP----------AF.LEPF-HAGTQHYA
D0J5Y8_COMT2/40-170----------...TLTKTQATRAKL...NLLMQQMLDAETGLRG---YLLTGEE----------RY.LEPY-NSASAAIS
D4ZMN6_ARTPN/39-173----------..EWEIHTKQVLRFL...EEISTDLSDAETGQRG---FLLTLEP----------EY.LEPY-NQAVKEID
E3FRV7_STIAD/35-168----------..RTMGHTYKVLAHL...ETVVSELNHVESSKRG---FVITGQE----------GF.LSTV-RTAEARIA
J9ZC42_LEPFM/5-146----------.DRWTHYSEEKLLLV....RLVSDLKDAETGQRG---YLITGNE----------EY.LSPY-RKARSRIQ
J9ZDH6_LEPFM/41-176----------.SDRVEHSWMVLTSI...DRLFSELQDAETGERG---YLITRNP----------SF.LSPY-QSAEKEVR
M1FHH2_9ALTE/40-178----------..NSVDHTHKVLAKA...SSIESAAVDMQTGMRG---FLLTGQE----------PF.LDPY-KLGEKQIN
Q3J1L2_RHOS4/40-170----------..QAIVEERATRRHA...ADLLSALQDIEIGQRG---YLITLDP----------TF.LEPY-EAALARIQ
Q63KK2_BURPS/60-192----------..ADIHRASEVISGL...ERLLALARDMETSQRG---YILTGKP----------DY.LQPY-KAALPEIR
Q8F6F9_LEPIN/38-173----------.RKWETHTQEVLLNL...EETLSSFRETHSVLRA---YILYRDK----------EL.IDSY-FKNKRIVL
Q8PAN4_XANCP/38-173----------AAAWVSHTQEVIASI...DEIQAGLLSAESSARG---FVLTDNE----------AF.LGVH-ADAIGRLP
Q8PCA9_XANCP/46-176----------.ENDVRQTLEVLSDL...YEAHALLAETAAGVRG---YRLVRRD----------EF.LTPY-RDAEPRLQ
Q8YVU1_NOSS1/40-175----------.SRKERHTYQVLRQI...ADLNSLLSTAESGQRG---YIITGEM----------RY.LEPY-QKATKSLD
U5LEK7_9BACI/48-180----------....IGHDMEFHKQL...QQMSKAYSDIETGERG---FVITGSE----------SF.LASY-GNGKNMVD

PF16591

F2KIP4_PSEBN/23-277STQYQVALNTMREAYRNDAAMRKEM---GVNAVKGAALIAKVIN---DVEAMPA--SD.....ERR-FELYRVILKAKED
A4VQJ2_PSEU5/57-311NAQYQNSLNDMRKAYNQANGSRQVI---DGAATRLSELTASVSN---HVIQLPE--YD.....EDR-FAQLLAISLIKED
A4VGE7_PSEU5/34-290AERIERSFQELKQARESREQSRGVM---VSSAGEALKALGELEE---QIYQTLE--QSA..DDPLV-VQQARALAELTRR
F2KBS3_PSEBN/33-286ISAYQVSLNKMRSAYRTGNTARDAM---GANAEIAYKLIETLDS---DVRKMGV--GD......ER-FAQFQAITQAKQD
Q4KIL8_PSEF5/33-286ISAYQDSLNKMRNAYRSGDAARLAM---NQNAERANDLINGINS---WVKQLPL--SD......ER-FTQFQAITQAKEA
F6A9D3_PSEF1/33-286LQAYRVGVDGLKAAYQQIDASRLVR---RTTGDKALQLLDGLDK---YVTESAD--V......ETQ-YKVYRAVKDVQMQ
F6AH80_PSEF1/33-287IDQYQKAYDKTNAVYASANKTRAEM---IEVAERALELVDKVRE---EVLRGAA--AD.....AAG-LTRYQAVARTKDD
F6A9X7_PSEF1/33-287IDAYQLSLNKMRGGFRASNDARQEM---TRNAVSAGEAIDEINA---AVMNLPP--YD.....DSR-AAQFQAITKAKED
M4WQE7_PSEDE/33-284ATEYRRLFGELLKSFDARDAAKQNL---IRNAALITGGLEKAEQ---TLVAGGA--.......TES-LRPLQQLADLGRQ
A4VRY2_PSEU5/1-255VQNYRQRFLDLAALWERKVKTRSSW---VEAGNTSDALIAALEA---RWAGTPD--APVLHEDTRS-AAIGLQAGEVSKH
F2KDB6_PSEBN/37-285LDEYKRAFADLTQATQNRESARSKL---GANADNAVAKVTEVEN---ALRQ...--.......GDS-VAQFNAVVEQSKL
Q4KJM1_PSEF5/37-285VAEYQKAFADMTRATANREAARSQL---GATADNAVARVAEVEN---SLLQ...--.......GDS-VAQFNSVIDLSKL
Q87UY2_PSESM/37-292VSELEKSFAEIRSNRQSRNQIRQRL---DQRSEQALQAVAQVEA---EVLKSVS--QEQ..DSSER-MEEFTNISQLRQQ
Q88D08_PSEPK/37-294LQRLRDNFSELQRSVASRVALREAL---QSQEHALSEAIDQLQT---QALLKMP--DD.....SQQ-SGVLGLMDTLSRH
MCPS_PSEPK/33-286ISAYKLSLNKMRQGYDATRAARVSM---DSSAIRADQAMDALSQ---EVMARPE--AD.....SVR-LAQYQLISKARQQ

PF12729

B8GHQ6_METPE/6-186TEMQVVR----SSPL--------SAE---.Q..QT.T----LAEFDKNWT--TY.QDGIKET---LNEVKT--------A
A5MYV5_CLOK5/6-185KNMLDYE----KFVM--------NNV---.E..KQ.I----WPTYRSQFN--EY.KNIINNI---INFINN--------E
B2A037_OPITP/3-183DLYGELE----KLLV--------GAE---.E..QK.L----YSTVKSNRP--PY.RDARVRL---LELSRA--------K
A6LXN5_CLOB8/6-185MISEEFK----NAGE--------TGE---.E..EK.L----LTNFIKLHE--EY.MMSRKDF---MDLINA--------N
A6LXV4_CLOB8/6-186NYMALYK----KLKL--------DDF---.E..AD.K----VSQIDSNLA--KY.REGRKVA---LDLANE--------N
B1YFV6_EXIS2/3-184SSLNKFE----RTSV--------PTK---.Q..SEKQ----VENLKDSVL--AY.DNGLSTI---QDLVTQ--------G
YVAQ_BACSU/2-181QKLDNYE----KTIS--------TDK---.E..QK.L----FEQLQTKVN--TY.MDIHAQI---IESGRT--------N
D1B8F4_THEAS/7-187SNLELYG----KTKL--------ESF---.E..VE.H----LRKVHEAMT--DW.RAKWRKV---LELSKE--------G
A0KL92_AERHH/6-191DFLASYR----KTYL--------TQR---.E..VD.L----LTRFDQAWA--TY.KQYASEI---LKLAQT--------P
Q2FMT9_METHJ/4-184DQIAIID----KLNL--------NEE---.E..RK.V----FESFKTAFQ--GY.KVESEKT---IALIKE--------N
A5N138_CLOK5/6-185KYVVSYE----KLSM--------DET---.Q..KQ.I----WNTYKSQFK--TY.KSLKENI---IGFVDE--------G
B8GS53_THISH/3-186RTWNAFM----ETYL--------TPR---.E..RE.L----ADAFIREEQ--AFVYQGLTPA---IQALRN--------G
C4KYK6_EXISA/3-185TDLKVFN----DSIS--------TEN---PE..LISR----IEKLNEETN--AY.LESIDVV---LQPALR--------N
C4L6Z3_EXISA/47-227TIAPKYE----KT..--------ASG---.EVDKE.L----FTNFSRQWE--MY.QRVSDNM---LTFSST--------G
Q65NE7_BACLD/6-186TLMEKID----QLKL--------MDN---.V..SE.K----YESFKSEYK--KL.QDISSQM---LSLAVK--------N
B3EAL3_GEOLS/4-184KGIEDFE----KMIK--------TDS---.G..RK.L----MAAVKDKRA--AM.QADQKQV---IDLSQS--------G
Q2FP73_METHJ/6-186ALISEYK----KSTL--------LES---.E..RA.E----LTKFDQYWN--SY.IAEIQKV---IELADK--------G
B8I3W0_CLOCE/7-187INIKKIS----TTNL--------GSD---.E..DK.I----YASIKENIT--AW.KEIKNKI---IELSTS--------G
B0TC96_HELMI/4-187QELRRYG----ETEI--------GAD---.E..KR.M----LSDIESSWS--TY.REVTQRI---IQSSAL--------G
Q24U91_DESHY/6-186QALATFE----QSLR--------TEE---.E..RL.Q----FTYLDNVLE--NF.DYHLDQV---MELCRN--------G
A0PY27_CLONN/6-189ELFEKYE----KIPF--------TEE---.E..KR.D----YNEFKHELE--NY.RNVRGDI---LTLVNN--------G
A6W0J9_MARMS/4-183QYRSEYE----STIY--------LDS---.E..RR.L----FEEFKKAEA--TY.YKLQGDV---SLLSVQ--------G
Q97DG6_CLOAB/7-186ELTQKYE----SLIN--------DEK---.D..KK.I----FTQYLENLN--GY.NNAKDKF---FETART--------G
B0UJP2_METS4/9-189EAKAKYE----RLIN--------APE---.E..RA.L----YDAYRRTAE--AF.EAERQIV---LDLSRR--------G
Q97J99_CLOAB/6-185KIINEYK----NTIV--------IAE---.D..RK.L----FNQVNIELK--KW.GIARSEF---VDAVNK--------G
B8I1D9_CLOCE/4-184ENWEKYK----KTTL--------DKF---.E..SD.N----IALFEKRRN--EF.RTARDKI---IAASLA--------G
Q820J9_NITEU/4-184ELWRKFT----QTYM--------TPE---.E..QS.L----AGRFTEQWK--VY.QAARNQT---LNHAIN--------G
D2QKC8_SPILD/2-187SLLTEFE----RTRL--------TTK---.E..AD.H----LQLFKRQLN--GY.DRLEAEL---AAKFTS--------L
C6XTP8_PEDHD/2-188SLIKDYE----KTFL--------VKQ---.E..KE.K----IAELKAWLL--GH.SAVENKL---LNTIAV--------Q
B5EIZ2_GEOBB/6-186KSTGQFE----KTVL--------TDE---.G..RK.L----FAEFKQAKD--AY.APVIDNM---IRLAKA--------G
B3E7H2_GEOLS/7-187AKTAAYV----KKMD--------GVE---.E..KA.A----FAEFKTSFD--AY.VPLLKQM---IDLSMA--------G
Q97MS1_CLOAB/6-186KVLESFS----QTIL--------TAD---.G..KT.I----LSEIKDAKK--EY.VQYAQQA---MELSKQ--------N
C6VSG0_DYAFD/2-186SLIRLFE----KTYL--------VDE---.E..AK.S----LQAFKSQIA--RY.SKLEEQV---LALCAS--------G
Q97FH5_CLOAB/6-186ELIKEYK----TTIF--------TDE---.D..RT.L----FYQFLDNLA--KW.RQSREKV---IAYAKA--------G
B0TE36_HELMI/6-185DLQERYK----QTKL--------DDY---.E..RQ.K----MDELETSLR--YT.RSVRNMV---IQLALE--------G
A6LR72_CLOB8/6-186KSMKEYE----NLIT--------VSD---.E..KQ.T----YNNLKNDLA--KY.IEVRNKA---IEFAKT--------G
A0Q228_CLONN/6-188NAMNHYD----NIPR--------EEE---.E..QN.L----YKYFKEKLD--EY.RKGRDNI---INFVEE--------K
A1W7U5_ACISJ/3-184KIWVAYA----ATSM--------TAA---.E..KV.L----ANKFEADHT--RFVNEALKPA---VAALQA--------G
B2TPM5_CLOBB/5-185ELLKVIE----NTST--------TDT---.E..KE.I----FNNLKDSSE--QY.NKIRKKV---VKLGLE--------N
A5I5R4_CLOBH/7-185KYLIEYD----KLPG--------TDE---.E..NK.K----FEVFKGQLN--QY.RTLREDV---MKLVEN--------N
Q24QB3_DESHY/6-185TLLSDYG----KTTM--------DTY---.E..QE.R----LPKLMDELQ--IY.RTERSKA---VDLALA--------G
Q24YV4_DESHY/6-183TLISQYK----GTAL--------DSF---.E..SE.K----LASITKNLD--AY.GTVHEKV---LNLAAS--------G
Q250C4_DESHY/23-203DKLSQLE----DLSL--------DPQ---.S..QE.L----FLKIKTSHK--QY.DQTKNQI---LAFAQA--------N
Q81B11_BACCR/6-185YLLKQFE----AKVI--------STK---.E..KE.L----YNTFYETFN--KL.RTQMKKA---QELGKS--------N
Q81ZA3_BACAN/8-187KLQAQYE----NTYI--------TGE---.E..KK.L----LSQYKEKLE--NY.KKHRAQM---LDFIKE--------N
V6F5X6_9PROT/6-184DIWSAYM----ATYL--------TPE---.E..KV.L----AQDFARHLL--AY.RSSRNIT---MKLSND--------G

PF02203

L8BID0_ENTAE/1-177RNYTAYE----KIPQ..------DPR---QD--PQ.A----TEKLKQQYG--I.LYGALSEL---IQLLGE--------G
MCPD_ENTAK/1-173LYFNQFL----DTPR..------ADE---QE--QQ.L----ADATRDSYE--N.LRGALREL---IVFLEN--------R
B3HUP0_ECOLX/1-175THYKKFK----SMAP..------.LP---EM--VA.T----SRNIDEKYK--N.YHTALTEL---IDYLDY--------G
A2S6U7_BURM9/1-177QNWQAYM----AASK..------EG.---ID--SA.L----TDELAARYA--TLAKEGVEPE---FAAAGA--------G
Q13QZ2_BURXL/1-174RAWRDYA----ALPH..------EG.---EE--RV.L----ADRVNAART--ALLQLGVQPS---IEALAK--------G
A0K3D5_BURCH/1-177QNWQTFQ----STPK..------LG.---VE--QA.L----VDELTARYA--TIMKEGVEPE---FAAARA--------G
Q0K4P5_CUPNH/14-187AAWKRYM----NLPQ..------NP.---EE--KA.L----ATELGKQRQ--AFMEQGVLPL---QAASLA--------G
A7Z837_BACA2/7-146KAIEFFS----ETLK..------GSS---FS--KK.N----ISALEEKFG--QYTSIH.KDV---ARIYGG--------T
Q8XQ80_RALSO/1-174ASWKRYR----ALPS..------TP.---DE--RK.L----ADEADALRT--VFLRDGAQAL---MQAIQA--------G
A3NJ34_BURP6/4-177RGWRDYE----ALPR..------GD.---DE--KT.L----AAQANAARR--ALADEALKPM---IDALKA--------G
J7JW03_BACIU/7-146KSLAYFS----DWAT..------AEK---FQ--DK.K----KTELKQEFK--QFIQMN.DNV---AAVFSS--------G
A8FGS8_BACP2/7-147NAVKLFT----ETSS..------AAD---FK--KN.N----QDELYEHFE--IYSKINDEDV---VGFYAA--------S
A8FGS7_BACP2/7-147DAVALFT----DSLK..------ASN---LQ--EK.N----RSATIKELQ--QFGKINEKDV---SAIYAG--------S
A7Z836_BACA2/7-146KSSAYFS----EWAT..------SAK---FK--EK.N----QTEMQERFK--QFIESN.DKA---SAVFSS--------S
A1JT77_YERE8/1-177ERFKSYE----QIPL..------DSQ---QD--PE.S----AKKLKQTYE--Q.YFGALTEL---IQLMEA--------A
Q46PJ2_CUPPJ/3-176SAWKRYA----SLPQ..------ND.---QE--KA.L----ADELARKRA--DFMTHGIEPL---QKASLA--------G
A7MM72_CROS8/1-177SHYDKYY----GLPE..------TPG---MD--ER.L----VDRLEEQYR--V.YSSTLAQM---NKFLAE--------G
A7MEE5_CROS8/1-176THFNAFK----AVTV..------DVP---EI--NA.A----AGDVEQSYR--D.YYQALSEL---VQYLET--------G
A8GG43_SERP5/1-173LYFNQFL----AVPR..------NSE---QE--QQ.L----TATTKASYD--R.LRNTLREL---IGFLEN--------D
Q65FN3_BACLD/7-146TSIAYFS----EWID..------QKA---YK--EK.G----QTAIKQRFE--QFAKQN.PDV---ELVFTG--------S
A4WA05_ENT38/1-177AYYSAWH----QMPP..------VNG---QS--QE.L----TAEMQKAYT--Q.MHEVMRLS---IEYLSA--------D
A8GG44_SERP5/1-177QHYAAYD----KIPL..------NAR---QD--LQ.S----AEKLKQQYG--I.LHGALTEL---TVLLGE--------G
I0UJV5_BACLI/7-146EAVSFFS----GLVN..------EKL---YQ--EK.E----NASLVERLE--QYAKLN.QDV---EAIYTG--------S
B2UHV2_RALPJ/1-174AAWKRYR----ALPT..------PA.---DE--RK.L----ADEAQGLRD--VFLRDGAQVL---MQAVQA--------H
A0A017LS69_ECOLX/11-181QGYRAYQ----NRPV..------KTP---AD--EA.L----DTELNQRFQ--AYI.TGMQPM---LKYAKN--------G
Q3JSN4_BURP1/10-181SWWKKYL----DLPR..------DA.---QE--DR.L----AQDLASKRQ--I.LQRELDAA---AALINA--------N
B9BHH5_9BURK/6-179AAWGTYA----AMPH..------DA.---DE--AP.L----ASRLDAARQ--ALIGQALKPL---ADAIRE--------G
Q7N5T4_PHOLL/1-178QRFEQYE----QTAK..------LPI---HE--SE.S----LNRLKKAYD--V.YISALHEL---IVLLEH--------D
A4TLJ4_YERPP/1-175LYFNQFQ----AVPRLD------ESE---SS--GQ.L----LDATKNSYQ--N.LRSALREL---IDFLEA--------G
Q6D4S3_PECAS/57-232EHYQLLE----TTTT..------.AE---AD--TT.A----FVDLKKGYN--Q.LYSGLVEL---AEGIKT--------T
A8AGH6_CITK8/15-185EGFNVFM----ARAV..------KTP---AD--EA.L----DAELNTRFK--AYI.DGLQPM---LKYARN--------G
B5WVT2_9BURK/1-177QSWQTYL----DAPK..------HG.---VD--QA.L----LDDVLAKHT--TVMHDGVDVE---FAALNA--------N
A7GNX1_BACCN/7-146NDVNNFA----RIMK..------SDL---YA--GE.N----HDELKKMLS--QYILLN.PEV---EEIYIA--------G
Q46ZP9_CUPPJ/1-174TAWKAYL----AVPR..------SA.---EE--SN.L----TQDVSAKRE--ALFSQGVAPM---VAALRA--------G
A7MPS2_CROS8/15-185AAFERYG----KLNR..------...---..--.A.K----DDPLKASYE--N.FYGALKEQ---ADGLVS--------T
A4JE67_BURVG/2-173AWWKKYL----DLPR..------GP.---EE--DR.I----AQDVAAKRQ--A.LQRNCDAF---GALVTA--------G
J7JYH6_BACIU/7-146NSADYFS----EWLT..------KEK---YN--AK.S----NASIAEKFS--QYISIN.KDV---ESIYTS--------D
E5W1J5_9BACI/7-146DAVTYFS----EEIK..------EKT---YK--EK.G----QTSLRQKFE--QYARQN.KDV---EAVFTG--------S
B2TGA5_BURPP/1-171DAWAQYL----ALPA..------TS.---DE--NR.L----SASVSARRS--Q.VQNQLDAF---ADSVKG--------M
A8TNN7_9PROT/6-182EIWKVYM----STYL..------TP.---EE--AV.I----AAAYQKARK--SFVENGLRPA---LVMLGA--------R
Q0K9D3_CUPNH/1-174KAWQAYL----ALPR..------SA.---DE--AR.A----VEDVTARRD--ALFKQGVAPM---ITALHA--------G
B2JWU0_BURP8/26-199AAWKEYR----ALPA..------SD.---AE--AE.L----SKAVADARA--AMLHGALEPM---VDAMRR--------G
A4JSC9_BURVG/1-175KAWDTYR----GLRL..------SGP---EE--AR.R----AADANTKFN--ALVEHGLEPM---FTAISA--------H
A4WBP6_ENT38/1-175KHYDAFK----QITP..------.QP---AM--EQ.A----SLNIDEKYK--N.YAAGLAEL---IQFLES--------G
A6T1W9_JANMA/1-174AAWKQYY----ALPM..------NA.---DE--KK.L----ADEVTANRD--TYLREGALPL---IKAIQA--------G
A6SU23_JANMA/1-173STFGAYE----QTQL..------TT.---EE--KA.L----AGKFSADYK--KFVDKALVPA---IAASRG--------G
A4W5T8_ENT38/1-177GHYDKYY----ALPE..------TPG---MD--EN.L----AKQLEEQYR--I.YSSTLAQM---NSLLAQ--------G
A8AGR3_CITK8/15-185TAWDAWL----AMAP..------...---..--.H.K----DDGLIESYQ--R.FYSGIQEQ---ADGLSQ--------T
A8FGS5_BACP2/6-146DAADFFS----KWIT..------EKK---LK--QK.G----TTDIQGRFE--QFMSMN.DDT---EGIFVA--------S
A4G2W4_HERAR/1-175EEWKKYL----SLPI..------ETL---EE--RK.V----ADEVTAKRI--RYLKEAEQGL---IAALRA--------G
C6BHT9_RALP1/1-173EAWKKYL----ALPR..------DD.---EE--ER.L----AKEVATKRE--A.ASATLRDI---IKALRA--------G
Q21SE1_ALBFT/1-173KIWDVYL----VGPK..------SS.---EE--AQ.L----AKAYADKRA--QYVQEGLRPA---VAALQA--------N
B2T9U8_BURPP/1-172QSFAAFM----SAPK..------TGD---DN--GT.R----AAALAERYK--K.LHDALAEL---VQFLDS--------N
A9ALM0_BURM1/1-172KAFAVLT----SARP..------VDE---AN--RA.R----VAALVERYR--A.LRGALGEL---VQFLDA--------D
B5BKZ4_SALPK/1-177KNWAQYE----SLPR..------DPR---QS--EA.A----FLEIKRTYD--I.YHGALAEL---IQLLGA--------G
B9BQN2_9BURK/16-188VLWKDYM----SSNL..------TP.---TE--KQ.L----ADAFRSNYD--TLEAKGFAPL---RAALAA--------N
A3RYQ0_RALSL/33-207KAWTEYL----NLPF..------STP---EE--EK.V----AGEAKKQRD--IIIKDNVAGA---VQALKR--------G
Q0BFK7_BURCM/2-173AWWQKYL----ALPR..------GP.---EE--DR.L----AQDVAAKRL--A.LQRSCDAF---GGAIAT--------G
B2T7C0_BURPP/1-177QSWQSYL----DAPK..------PG.---VD--QA.L----LDDVIAKRM--SVMREGVDPE---FAALNA--------N
A4WBP5_ENT38/1-173VQFKAFS----EQEA..------VSE---KG--KA.L----TAEMQKGYT--Q.WHSDLEHQ---ATWLEN--------N
B2JQ81_BURP8/1-172RSFTAFM----NAPK..------LND---DN--SA.R----ASALNEKYQ--K.IHTALGEL---AQYLDA--------G
A8AFE7_CITK8/5-177VVFKGFM----ATEA..------STE---EG--KA.L----QAATEKSYT--Q.WYSDLEHQ---ATWLES--------N
A0A014LTC5_YERPE/23-197DSYLQLQ----AVSA..------...---QD--SRQE----LNELKESYH--Q.LYQGLAEI---AQGLAQ--------K
A4LLG2_BURPE/1-172RAFAAFT----AAPT..------ISA---EN--TE.R----AAALTDRYR--K.YHAALVDL---VQFLES--------N
O05244_BACIU/10-150KAVTFFS----ESLK..------RSA---FK--GKSN----QEEIKAKFS--QYVSIN.QGV---ARIYGG--------A
A3RWP1_RALSL/1-174EAWKKYK----ALPM..------SA.---EE--AR.L----AADVDAKRT--VFFRDGVEPL---VAALRA--------R
Q7N5T3_PHOLL/1-175MHFAEFI----ALPKLN------DED---GS--SV.L----LASVETSYK--E.YINALREL---SAFLES--------G
B1Y1L2_LEPCP/1-174QIWEVFM----SNNL..------TP.---EE--DR.L----ATVFNADRK--RFVQEGLVPA---VTALRA--------N
Q6D6I9_PECAS/1-177DYFIRYE----KMPQ..------DAR---QD--DS.I----SRGVKENYV--A.LNAALTEL---IQFLNA--------G
B2JJ40_BURP8/1-177ENWQAFL----NTPK..------NG.---ID--QS.L----IDAVVAKRA--TVISDGVNPE---FTALRA--------S
A7Z835_BACA2/7-146DGTAYFS----DWLT..------KDR---YK--PK.N----QSQITDKFT--EYMKIN.KDV---ESIYTS--------D
A0A021WSL7_SALET/1-175AHYANFK----NMTP..------.LP---AM--AE.A----SANVDEKYQ--R.YQAALAEL---IQFLDN--------G
A0A017QUD1_SALET/1-176KHFNNYV----NSEA..------IAG---KD--PA.L----DAQAEASFK--Q.MYDVLQQS---IHYLKA--------D
Q4V270_BACCZ/7-146TDVTHFA----KVLT..------QGD---YN--PE.Q----SQNVQSKFD--QYIQLH.PEI---ETIYTA--------S
B2UJN0_RALPJ/1-174DAWKQYK----ALPM..------SA.---DE--SR.L----AAEVEARRN--ALFRDGIEPL---MSALRA--------R
Q6D6J7_PECAS/17-188KAFLVYE----ERPV..------KTP---QD--MA.L----DGDLRKSYD--AYVNQGLMLM---LTAAKQ--------G
A7MLF1_CROS8/14-184AGFKQYV----DRAS..------HED---AE--AA.L----DSELKARYD--AYI.SGLAPM---LKYAKN--------G
B1G1I0_9BURK/49-221EQWRSFV----NEPH..------EA.---GE--AS.L----IDAAGQRRD--A.MRVAMRAF---LDALQS--------G
A4G5M7_HERAR/1-171QAWNEYM----DGSL..------LP.---DE--RR.L----AENFASHRA--RMVQDGLFPA---AAALQK--------G
Q65FN5_BACLD/7-146NAMSYFS----GFIK..------ENS---FT--GK.E----SDALKVKFE--QFAKLH.PDV---EGIFTG--------S
A2WA91_9BURK/3-174AGWQKYL----ALPR..------NA.---EE--DR.L----AQAVAAKRQ--A.LQASCDAF---AGIVGS--------G
Q2W2L9_MAGSA/182-357RKWEHYA----QGSH..------PA.---EE--LA.L----IEKFAKART--AFRDQGLIPA---VDLVRK--------N
A0A016QE24_BACAM/7-146KAIDYYS----ESIT..------KEK---LE--TK.N----KSVLLDKMK--QYVTVN.DDV---ASIYAA--------S
B1G4F3_9BURK/1-177KNWQTYL----DAPK..------TG.---VD--QA.Q----MDELLARRT--TLVRDGMEPE---FAALRA--------N
D2AI77_SHIF2/1-173TLFKSFM----AMTA..------GNE---HV--RA.L----QKETEKSFA--R.WHNDLEHQ---ATWLES--------N
Q39GS1_BURS3/26-197TWWQKYL----ALPR..------GP.---EE--DR.L----AQDVAAKRQ--A.LQHECDAF---ASVVGA--------N
A7MJ45_CROS8/1-177KHFALYK----GSPR..------LNG---QD--EA.T----ASKITEKYQ--A.LHDTLQAS---IGYLSA--------N
J7JR33_BACIU/7-146KAIDYYS----ETVD..------KDI---LL--GK.N----KTLLKEKFK--QYTTLN.DDV---GAIYAA--------S

PF05227

Q7D0T0_AGRT5/40-179KKLSDAR--..ALA..A......GQP...DI--LK-S....IDDMEKSAT--VFFKELAEPQ...IAARKT....TE..A
A4G3M4_HERAR/45-184SQIATLR--..GLT..Y......DNP...AQ--RK-S....IDVFEGLID--KKI.AVMRSG...INALEE.....R..N
Q2GAV2_NOVAD/48-187IEIRRLR--..EKMGGE......LPE...EQ--AL-L....VGEISRLGD--AKW.AEMAGV...VRLVEE.....R..R
B0UAM4_METS4/47-180PELDRLD--.......G......FDR...DP--DT-R....ARRRRLIAD--QR..AYAARA...VAARRE.....Q..G
A9A170_NITMS/36-172VLLEEEK--..NLV..S......YNP...SQ--VE-K....LEHISQLFS--DWIESAGSPE...IELARQ.....IHSS
Q8P5A5_XANCP/43-175KAITHLI--..ALT..K......DNP...CQ--QV-R....MGRIQSTIE--RRL..LLAER...IAVTR..........
A5VFJ7_SPHWW/35-172PVLDRLQ--..YEV..R......DNP...AQ--SA-H....MEELRRAVQ--AKV.DYARQG...VSAVDA.....G..R
Q2JP01_SYNJB/220-357TRLRLLQ--..ELT..V......DNP...LQ--QE-R....LKRLELLLE--QRL.RVIQDL...IRLREQ.....E..G
Q6MHV5_BDEBA/38-175KEFELLE--.......K......SAPATLKA--SP-E....YQSMSALVR--QKM.EISENV...INQVRV.....G..K
Q5ZYY1_LEGPH/54-192LNLDKLE--..QLT..R......DNP...EQ--NK-R....IHRFIDLVK--QRL.NLLNQL...VQLKGS.....G..K
Q01W36_SOLUE/41-175DAMRDLT--..GAT..G............PA--AP-E....LTRFAAIIH--AKL.DELAQG...IRIRQQ.....G..D
Q12FH0_POLSJ/36-173QTQDQLV--..NLF..A......NKP...EQ--SA-A....LAVLGWTVQ--RKL.AEMDLS...IRMKNE.....D..K
Q2YRH7_BRUA2/43-180QTLADLV--..VLT..K......QNP...QQ--DA-R....VKQIRALVE--RQQ.EEVGET...VNLAAA.....G..R
A1T505_MYCVP/45-183RMLTHLR--..EEL..A......GDP...TG--SA-L....LDRIAAAAA--AWTTDAAEPQ...IAARRS.....G..P
A8KY69_FRASN/39-176RLSSVLV--..GRV..A......ARP...EL--ER-L....LGVLQARIA--DWHRDYADPS...IAAVRR........G
A4YTN4_BRASO/32-169SAVADLQ--..RAV..A......DSP...MP--TK-L....LGDTAALIV--RRI.DIAAEL...IRLRAA.....S..D
E0TGG9_PARBH/50-189ETYARLD--..IAI.........EDP...GV--RA-A....YDVFLDQAD--QKR.EGLDAL...LAQTRQ.......AG
Q11QI5_CYTH3/36-172NQLILLD--..SLL..A......DNP...EQ--HI-Y....IDTLQKTVN--DRF.FLFNGL...INLTNN........N
Q092X8_STIAD/39-182EHMAKSL--..VLA..A......ETP...QQ--KQ-R....LQKFQEAYQ--QWMNTHVEPM...LAARRLVTQGQA..D
Q6LKE0_PHOPR/42-178QSLSTLL--..TLT..A......DNK...TQ--TQ-R....FLEIEAKLE--SWVTNVLQPG...INLSKN.........
Q21RH2_ALBFT/39-176TLLSQVK--..QLT..S......DNA...RQ--QE-R....WMRLREVID--ERL.AISRRV...EFLRKT.....Q..G
Q1CX08_MYXXD/35-172NDLSRLR--..DAM..A......DHP...NQ--RA-R....LNRLEPIVT--QRV.NRLEEG...IRLRRQ.....E..G
Q1LS98_RALME/38-174ELMSRIR--..QHY..A......NDP...EG--LR-Q....FGEASQFVT--RKL.NEMALT...LVYGKR........D
A5FHH5_FLAJ1/41-178TSFITLK--..KLT..A......DNP...VQ--QE-N....LRKLFKLII--QRF.VSFENC...LKYSDP.....K..T
A1TTX0_ACIAC/37-174ANLEELR--..SIY..R......DSP...ED--QE-D....FTQLSRQIS--RKM.SELDLS...LRLRRQ.....N..N
Q1QXY8_CHRSD/37-172RTLGTLR--..DSV.........QGE...TQ--QQ-R....LARANRLFR--QWVKNVAN.....VSIVET.....Q..G
Q9RYV1_DEIRA/56-192EHLRRYE--..PLT..V......TD....RQ--RE-N....IGRVETLMA--QWELVAAQPE...IAARRV........S
Q4KBM7_PSEF5/44-179SELRSLQ--..ELV..A......DNP...QQ--VD-R....LKRLEALQV--EWN.NFAQGM...IDLRRQ.........
Q9K632_BACHD/54-193DLIEQTR--AFPLT..Q......EET...DH--LR-K....IEIMNQLFL--QAAQTAIPYQDSEAQVKLI.........
A9BLH7_DELAS/47-184KQLEALK--..ART..S......SDS...VQ--HR-L....LDQIEDIST--QKL.RELQET...IDLRKA.....G..D
Q2KBR3_RHIEC/40-179KAIAAAK--..QTA..A......GEP...QL--VE-M....IDGMQKAAD--LYFHELAEPQ...TKARKE.........
Q5E1H0_VIBF1/40-177QLFSALQ--..ELT..K......DNQ...KQ--QQ-A....LKHIEKSMN--LKF.EELAAT...IDFVQQ.....D..Q
Q2JGB4_FRASC/72-209TLLADLH--..RRL..V......ERP...DL--LA-R....LAVLEDRIR--AWHGDYADPA...INAVRV........G
Q2SCK4_HAHCH/45-182IYLNQLQ--..ATN..S......EIP...GQ--QE-R....FLRLRQVTQ--SKI.SEMREV...IQLRKN.....R..D
A4YTQ5_BRASO/41-178PVLDKLG--..TLV..A......DNR...TQ--VE-N....LATLRSVIE--TRL.SQFDRE...KLLVAR.....G..D
A1T9E3_MYCVP/46-183QASADIR--..QLE..Q......DRP...DL--LD-D....LDAIEQASG--SWRTNYAEPV...VADVRP........G
B0UBF8_METS4/41-180EAMARVR--..ALV..S......DNP...AQ--LQ-R....LDGLERHAQ--DWRGTIAERE...IALMRD....EQ..T
Q213L8_RHOPB/42-179PLLRKLQ--..EQT..R......DNP...SQ--QQ-A....VIEIMAMTE--ARL.AQFRRV...LELGHA.....N..K
F2G547_ALTMD/40-179ELMSEVE--VSSFS..S......DID...DQ--SV-R....IEELLDLTK--AKV.NEVIRV...VELIKE.....G..N
Q9A3Q7_CAUCR/39-176QVSAKLA--..STL.........TDP...EM--LK-H....IEDSRVATL--AWRKEWGDRL...IEVVKA.....G..Q
A1K2Y0_AZOSB/48-183YTLDEIR--..QDV..G......PDP...RD--QD-A....LARLTGLIT--LKLRVLADAV..............G..G
Q6ARK4_DESPS/61-203NEVGDLT--..ELV..S......DNP...AQ--VT-R....LTEVEQNIG--EWVKKVTEPT...IQLRREIG.NSK..N
Q0KFB4_CUPNH/37-173ELMAQIR--..AGY..A......NDP...EG--LK-Q....FSDTSKLIN--SKL.NEMALT...LVYGKR........D
A4Y015_PSEMY/45-179STLRRLD--..NDI.........RDP...QM--RG-S....LERLRPLIV--IKL.EGLEQL...KALASS.........
Q8YQQ8_NOSS1/215-351QKFDELR--..NAT..V......D.P...VR--QQ-R....LVILKPLIT--AKI.TELNQT...IKLRQN.....L..G
A1WDW7_VEREI/55-192THLDRLR--..SQL..S......GFP...ED--AQ-E....LALLSRRVV--RKL.AEMDLS...LRLRRQ.....G..N
A1TNK2_ACIAC/40-182SAWQSLR--..SLT..A......DNP...EQ--QK-R....LDVLRARQA--DFA.AVMQSL...QDMRRDVDAGKV..T
B9M3W8_GEODF/37-174TSLAMLE--..SLV..G......NRP...SQ--LD-N....FNRLKPLIA--AKF.DELNKT...IMLRKA.....A..G
A2TZQ8_9FLAO/41-178NTFAELK--..ELT..R......NDK...VQ--QE-N....LVALSKLID--NRM.ANFDKSATFILFDSL........K
Q6N729_RHOPA/41-178PRLKKLR--..DFV..A......DNT...AQ--VP-F....IDQAIASAN--SRI.ERFRQV...IALAQQ.....G..R
Q2RWM5_RHORT/121-258EQRRLMN--..ALI..Q......DTP...WE--SG-L....GAKLTPLID--AKL.AELART...VDLAQA.....G..R
A1SZ61_PSYIN/35-175QSFNNLS--..GLT..S......DNP...KQ--TK-R....LNDIKAFME--KKF.IELKLT...IELYQS.....G..N
Q6LTH6_PHOPR/40-184EHLKTAK--..HLT..S......DNP...AQ--QQ-R....FDAVATDAA--NWQ.AYAEKL...IALRKNIREGER..S
Q4KA09_PSEF5/46-179AALQRLD--..QNV.........QDP...RM--RD-Y....LQTITPLIR--TKL.DGLVAL...RNGSRD.........
Q2JDT7_FRASC/40-177VLTARLD--..ALL..A......DFP...AL--RA-Q....HGEVGQAYR--DWRREVVRPE...LVAMAR........G
B2JPZ0_BURP8/44-179TEIGSLI--..EMV..S......DNP...SQ--AD-Q....LKRIRAVQQ--RWD.QFAQQM...IDLRRR.........
A5V5G0_SPHWW/46-182AQVRQVE--..RLR..P......DYA...DD--MQ-.....FARLKQLIA--AKF.AEMRQV...IDMRDR.....T..G
A4VFK8_PSEU5/48-186GYRRSLE--..QLV..E......GRS...YP--DE-R...WFRTLDATIA--ERL.QVAAGN...VQARRD.....A..G
A4XNM7_PSEMY/48-183PLVEQMI--..TMV..K......DNP...PQ--AQ-R....LERLLAMQA--QWD.AFAQEV...IASRRN.........
Q09DK9_STIAD/35-172TDLEELK--..RAF..Q......NEP...QQ--EV-R....LTRLERQIR--EKL.AELAET...IRLRRE.....Q..G
A0ZB66_NODSP/212-352GTIQTLK--..NLT..A......NQL...NQ--QT-Q....FTTLESLIA--TRL.TVINQT...IELRQN.....Q..G
A5VGP5_SPHWW/47-184ARLAALK--..ALT..A......DNP...VQ--QA-S....LGPLNRHID--AKL.AELRET...IELRRT.....Q..G
Q6ARK4_DESPS/216-358ERLTSLK--..GTV..S......DNP...VQ--VR-L....LSEIQENIN--GWKNNVTEPA...IALRRVIG.DAQ..T
A1TQ31_ACIAC/40-182AAWNKAR--..SLT..S......DNP...AQ--QK-R....LEDMRIRKA--EFV.SIVEKM...QGLRREVNSGAV..S
Q11TC1_CYTH3/37-173FNIDIAK--..DLT..V......DNT...VQ--QK-R....IAMIQGLVD--QHM.THLDSC...IKLRHT........D
A1TUA0_ACIAC/47-184TELERLR--..GLV..G......DSP...RQ--LR-R....YEQLAPLAR--QKM.SELHET...IQLRLS.....G..Q
Q1IKU6_KORVE/55-192ELSRNLL--..QLT..S......DNA...TQ--QL-R....LKDLQGLIE--QKI.DHMNLT...LVLRRN.....N..G
Q02D29_SOLUE/39-176GRLANLE--..SAL..A......GRP...NE--TA-N....LRRLNQLVE--LKL.AELRRT...IELRRS.....A..G
Q7UME9_RHOBA/68-205ESLDQFE--..KLT..Q......DHA...VQ--RA-K....FNYLRENVE--ERI.KHLNAV...LDIRAE.....E..G
A6W4I3_KINRD/50-190GRTGEVR--..AHL..R......AVG...GP--AE-Q....LADVEAAHA--EW.DAYAREQ...VALV..........G
Q7CY49_AGRT5/26-163QRQSRLF--..DLL..K......EEE...QY--KQ-S....LSGLRQAID--AKL.AETRET...IDLQRS.....G..R
Q81H18_BACCR/42-172KHYQDLF--..ALL..E......DNP...SQ--QE-K....LKQINENIT--SWINKEIHPL...IANNNS.........
B8I528_CLOCE/36-171TRLKEIE--..SRL..D......KHP...IM--AQ-L....ITEAKPKID--AIE.NYFDSQ...ISLVKQ........G
Q15N85_PSEA6/42-179EKIALVK--..NIK..S......GVA...GQ--KE-R....IDELLILVN--EKI.TELTST...VDLALE.....D..R
A2SJW7_METPP/38-175ELLPSLS--..RYY..A......THP...AQ--LT-D....FETLARAIE--KKL.SEMSET...IQLHRE.....G..R
A7HUQ5_PARL1/53-190EKLTALE--..ARV..A......DNP...GQ--QK-R....IEALHDTVR--QRI.AILDGT...IAMARE.....G..D
Q12AQ9_POLSJ/37-174KILQEAR--..KLT..E......DNL...RE--QR-R....LDALEPLVK--SRI.DLARET...IDAIRT.....K..G
Q8YMN6_NOSS1/37-174QKVKLLS--..QLT..V......DNP...SQ--QE-R....ITTLKPLIS--RKL.TLLEQT...IKLRND.....E..K
A3HS22_9BACT/52-190MLLDKLN--..DLT..S......KND...TQ--QK-N....LEVLEELIK--DRV.NTFEST...VNYFNE....NG..S
Q5Z3J6_NOCFA/47-184RAVQRLR--..ELL..A......GRP...DL--LA-D....LDLIERTAQ--QWRTEYADPL...AATASP........G
Q89IE7_BRADU/79-209REAQALQ--..MLV..A......DDP...LQ--GL-R....AGHLALTVT--ATL.REIDEL...LKTAGT.....S..G
Q0RSX8_FRAAA/34-171AQLADLQ--..RRL..A......ERP...DL--LG-K....LRTLRERIL--AWHRDYADPS...ITAVRD........R
Q1GY35_METFK/46-181AEISGLA--..LLV..K......DSP...AQ--TD-R....LKRTQAYID--QWH.EYASQM...ISKRQA.........
A1W3R7_ACISJ/33-169VALEKLR--..GMT..R......GSL...LE--QQ-R....FDQLQGLAT--KRM.TELAHI...VALQRE.....G..R
Q1QLB5_NITHX/64-201SSFERLK--..ALT..V......DNP...HH--QQ-R....LKEMIPQAN--QRI.QQLRHS...IDLALA.....N..R
Q091M3_STIAD/35-172ETLQRLT--..KAA..S......SSE...LR--TR-Q....AANLPALIE--ARL.AFLEET...AELRRT.....K..D
Q2RN36_RHORT/47-186ELLQRAK--..TLT..A......DNP...EQ--QR-R....FDDIAAQAE--IWRTRVAERE...IALMNN....AE..T
A1WBJ8_ACISJ/37-174TNLDELR--..QTY..R......RAP...QD--LD-D....FSQLSQQIT--RKL.SELDLS...LKLRRQ.....D..N
Q4KE98_PSEF5/39-182DYYARIK--..SST..A......DNP...EQ--QA-R....LERLKALHD--QWLREDIQGN...LALRRAINAGTQ..P
Q67R65_SYMTH/44-180QVLSELE--..ESV..E......GDP...DQ--AE-Q....VHRLRELID--AWRTQVAEPE...IARMRQ........G
A1TJ97_ACIAC/40-182EAFADIK--..GMT..A......DNP...VQ--QQ-R....LEAMKARET--EFA.SVLSGL...IQARREVTAGSR..T
Q89MA4_BRADU/41-178PALDKLT--..RQI..G......DNP...AQ--RD-S....IEKLSAAIE--TRL.DQFSRE...MNFVKQ.....G..Q
Q20XI7_RHOPB/40-176HAIDELA--..TVI..G......DND...EQ--QH-N....LATVRSSIE--MRL.AQLQRV...VELAQD........D
A4YTN3_BRASO/32-169ATWADLV--..ALV..Q......DNP...TQ--SA-R....LHAIDEDVQ--RRI.ALSGEL...IRRQAA.....N..D
A4VRA7_PSEU5/43-178EELDALK--..RYA..G......NNP...LQ--LS-R....IQKVEAAHH--LWL.TFAEEG...IARRSA.........
A1VKR0_POLNA/37-174ENLNLLR--..QIF..V......SQP...AL--SG-D....FDTLSRHVS--RKM.AEMDLS...VRMRKE.....G..N
Q7NLV3_GLOVI/46-194RSLEEAR--..RVV..QLITVRIEDP...QM--RS-QMLSALDAAGQAAE--SWYEFVRAGE...IESLRR........G
Q9KEH6_BACHD/36-170RYIEEIE--..LLL.........SDE...EY--LE-T....VELIRENNR--SMV.DSANDV...VSKYRL........D
Q9RD38_STRCO/40-177RAAARLR--..ELI..G......DQP...RL--LA-D....LEAVERQAA--DWRRTYAEPL...VADVSS........G
A7IHT5_XANP2/49-186PTLDEIG--..TLT..L......DNP...VQ--QA-R....LAEARPLLQ--SRL.ESFERS...IAMRKS.....G..D
Q13ME9_BURXL/44-179TQIEALQ--..ELV..S......DNP...PQ--VE-K....LKQIEAIQQ--RWS.VYAEQM...IDARRR.........
A6X818_OCHA4/47-184IEFEKVA--..ERT..R......DNV...GQ--RD-R....LGFLKQRIA--AKL.DEMAQT...IDLRKT.....Q..G
Q67RS7_SYMTH/36-171AYIAQIR--..AHT.........DDP...VV--LQ-H....LEDAEALAG--QYV.QALQQM...MALRDE........G
A0R5B3_MYCS2/38-175DAAASIR--..DDL..D......GRD...EL--LA-D....LAVIEKAAA--AWRAAYADPM...IASIQP........G
Q0RPK3_FRAAA/40-177ALNARLD--..DLL..A......DFP...DL--RA-Q....RTRVDVAYG--TWRREVVEPE...LAAMAR........G
B0UPY1_METS4/41-180AAFDKAK--..SLT..S......DNP...AQ--QA-R....LGELDRLVQ--AWSREIAERE...IALTSE....PS..T
Q123E2_POLSJ/37-173QVLLRVS--..............SGQTPTGQ--WQ-D....MLALKNLIA--RRV.ELMEQT...IAARQQ.......AG
Q98B44_RHILO/33-170RRFEKLQ--..LLV..A......GEP...ET--AA-S....IDQLKAIIG--EKL.AEMDKT...VALKRQ.....R..K
Q12F56_POLSJ/37-174QNLDVLR--..QLF..I......PYR...NE--LA-E....FGVMSRHIS--RKL.AEMDLS...VRMRKE.....G..N
A5FEK4_FLAJ1/37-171AYFEKLD--..ELT..S......DNI...SQ--QK-L....LEQLRSKRS--GFFKYLNNQI...VKKRLS.........
Q090G4_STIAD/56-193GQLKHLQ--..ELL..S......DNP...LQ--QR-R....LVEVERIIV--GKM.GELNDT...IKLRQA.....G..K
A1VL62_POLNA/44-179AETVSLS--..ELV..K......GNR...EQ--VS-R....LRRIGALQK--QWN.EFAQAI...VALRRK.........
A4YR54_BRASO/22-157KALTEVK--..QLT..S......DNP...AQ--QR-R....FEQIEKAAA--GWRQDVAEKE...IALMRN....PQ..T
B1HNT3_LYSSC/48-180IDFNDLY--..QQM..K......DKP...TQ--QE-K....LKEIEETID--HWVETTGGPT...IQYKKD.....G..N
B2FUS1_STRMK/43-174GRLAELG--..RMT..R......DNP...DQ--LI-R....IGRLESMLE--GRM.ALAREL...ARSEPN.........
B2HEL5_MYCMM/56-188AAAQNIR--..RLL..G......RRG...DL--LA-D....LDAIEKAAR--AWRASYAEPL...IAQVNS........N
C5AXA6_METEA/41-179EALGRLR--..RLV..S......DNA...EQ--LR-R....LDALDTAAG--QWSRDVAERE...IALMRD....EA..T
D0J5Y8_COMT2/40-170SSMDDLR--..GIF..I......MDP...KE--LA-T....FTPLARQVE--RKT.SEMELS...LRLYRQ.....G..N
D4ZMN6_ARTPN/39-173QDLSVLI--..SLT..R......DNP...TQ--QK-H....LDDLSTLIS--QKL.EELQMT...IELAKS.....G..N
E3FRV7_STIAD/35-168GELETLR--..TLT..A......GSL...EQ--QR-H....LASVQQRVA--NRL.EEMQEV...IAARRN.....K..G
J9ZC42_LEPFM/5-146EDMRSVS--..GIE..K......MDE...RL--NG-L....RKVLLRLAH--QKM.GELEET...IRLRHV.....A..G
J9ZDH6_LEPFM/41-176GHLHDLE--..HLV..S......DRP...SQ--EM-R....AMELGKLID--KRL.FLLGNG...VALGRS.....G..A
M1FHH2_9ALTE/40-178ALIDELS--..VTV..E......KDP...PQ--VL-L....LSEIRETVA--TWKREIGEPN...IALRRQVG.VIR..T
Q3J1L2_RHOS4/40-170PELTALE--..SNE..........TS...AG--IV-G....GEELSGLVR--RRL.EIAAET...ITQAQA.....G..T
Q63KK2_BURPS/60-192KQFDALT--..TLV..Q......DDA...VQ--QQ-R....LATLRMLLE--KKQ.HELAAT...IELRKT.....E..G
Q8F6F9_LEPIN/38-173EKIQELR--..NKT..V......DNP...VE--QK-R....LLNIESNLK--EKF.SYMEDI...LLIKKY.....K..S
Q8PAN4_XANCP/38-173GRIARLE--..VLV..Q......DNP...LQ--LR-N....VAALDKLVD--MRL.VQINDL...LHSYRA.....T..G
Q8PCA9_XANCP/46-176RVAERLS--..QRI.........TDP...VQ--AQ-R....FARIKPLFA--EKM.QGWRRL...LAPDLS.........
Q8YVU1_NOSS1/40-175IRVKELQ--..KLT..S......DNP...QQ--HG-Y....ISRLEPLIN--ERR.AVMQTV...LDLRQA.....Q..G
U5LEK7_9BACI/48-180NNLKTLK--..ELS..A......GSK...AR--ME-K....ITEIENTYK--EWL.VWIDTV...IETRRD.....F..S

PF16591

F2KIP4_PSEBN/23-277LALVRYE..VRGYTGNPNSATELAAARQLEN--ALKG----IETLNGAFG..PTYADTIKQLETALIAYRR---------
A4VQJ2_PSEU5/57-311VQRAQYL..LRVYMAAPGNDAAKAIYTQLDA--AQAT----LGRHAGALD..DDSGAAVQQIRSVLGEYRG---------
A4VGE7_PSEU5/34-290VLESRYL..VRGYIFQHTEESAQLAYAGLDR--SREQ----ADLLRGLLP..VDQHSHLDRMTSALQRYRA---------
F2KBS3_PSEBN/33-286FMLARYE..VRGYTANSNADTERKAVTQLDA--AIAS----LKPLNEHFS..STRQDELRQLENALAQYRS---------
Q4KIL8_PSEF5/33-286FQLARYE..VRGYVTTNNPDTEQKAVTQLNA--AIAE----MDQLKSHFS..STQRDALQQLETALSGYRS---------
F6A9D3_PSEF1/33-286FLFARFE..TRAYTYSNNPKSFDAAAGAVDK--TLAS----LGVLRQALD..SADGAALAELGQVVQGYRD---------
F6AH80_PSEF1/33-287LQTLRYR..MLSYTADTNEQTERALSQQIEN--TDQG----LESLTSAFN..GDYRDLIQQLESAVGSYRA---------
F6A9X7_PSEF1/33-287WQLVRYQ..VRGYTGSPNADAERVAVAQIDT--TIKD----MDAFRQAFA..AEHPQRVNQVTAALDKYRD---------
M4WQE7_PSEDE/33-284VMLARFQ..VLAYTSNDNPALETPAVDALQQ--AIQA----VQTGMRGAP..VELAADYQNALDALSAYRA---------
A4VRY2_PSEU5/1-255NRMVRFM..VRGYLMTETEQSLQQLQQQFST--LQAA----VDRLDAQLA..GTPGVDLQPLRDSVATYIR---------
F2KDB6_PSEBN/37-285IQQARYQ..VRGYTYSGKADAEQPALDAIEN--VLKN----LESLPGKLP..EQHAANLQQASESMKAYRA---------
Q4KJM1_PSEF5/37-285IQQARFQ..VRGYTYSAKPEAKQPALDAIDN--ALNN----LTSLPSRLP..EQHVANLQQASDSLKAYRM---------
Q87UY2_PSESM/37-292IQVARYQ..VQAYTFTTKDADETAAITAIDE--ALKE----VEQIAQTQA..DDPLQGLVPATEALKGYRD---------
Q88D08_PSEPK/37-294VEGANQQSLVPAYTFVPVEDFAKVGDNALNA--ADSS----LAQLLEGLAPLGLPRAISEQPGVELSKYRT---------
MCPS_PSEPK/33-286LLQVRID..VRGYIAENSSANEQAALRQLDA--ALAD----TDNLKRQLP..S.EDARLQQFENAVLAYRD---------

PF12729

B8GHQ6_METPE/6-186-KS---S.....EISDAVKDGSPLMNTRA-----AVDTALE--TL-------SEQVNADAGKISRQGDTTF
A5MYV5_CLOK5/6-185-NF---D.....EAIKEYNKIL...TLRE-----IMVGNVD--KL-------MNKQVKSAEEANLKNNSLY
B2A037_OPITP/3-183-QK---T.....EAQQALEQQLY..QVYG-----TYITSLQ--AM-------VEHNRVASVEAGASAQAAI
A6LXN5_CLOB8/6-185-RY---D.....EAQTAFQKVT...EARD-----KTFDSIN--KI-------IDSNIKEAENANSANNLIF
A6LXV4_CLOB8/6-186-KN---Q.....EAYEYYEKNVE..LYAD-----AFLEELV--DL-------GEHNRQIAEKINAENKANF
B1YFV6_EXIS2/3-184-DK---E.....QGYRFYSESLE..KTRD-----EVANTAK--SL-------MMSMTKQSKDINALNQQEK
YVAQ_BACSU/2-181-DM---D.....KARGLLVQTE...ASFE-----DMKKTIT--QL-------VDLNQEGSNTAVKETKAVY
D1B8F4_THEAS/7-187-LK---E.....QAEDYFKAEAI..PAIK-----RLIGEIE--AL-------ANFNVEFAEKVKDQNDQSA
A0KL92_AERHH/6-191-GQ---DGVPERNAFRLMGDKGR..PAFD-----IADSLLS--DL-------VKVNAELATQSMDESQNIY
Q2FMT9_METHJ/4-184-KI---P.....EAISSLAAGTPLANYRT-----QCNEALK--TL-------METNLKVAEQIKKDNDNNA
A5N138_CLOK5/6-185-NL---E.....KAGEQYKQFL...LTTD-----LMISNLD--KL-------ITKNLNQAKEFNLDTNSTY
B8GS53_THISH/3-186-NL---T.....EASRLLETEVE..PRYR-----NFRAVAQ--DL-------LNLQLEVADQVYKDAVAHY
C4KYK6_EXISA/3-185-EN---E.....SAYRQYGTELR..PIRL-----ALVETAK--EV-------MDQLNADAETASDTMRSDR
C4L6Z3_EXISA/47-227-NT---G.....MARSYYDAQSK..STYE-----NFTQKLA--DL-------VDYNSEGSQRVGQDMEREF
Q65NE7_BACLD/6-186-EN---D.....KAYDVYLKEME..PQRE-----TVNQLIE--DI-------QTLNADNAKTIYQRDSKEA
B3EAL3_GEOLS/4-184-KR---D.....EAIQLLTSKLR..QSQA-----EYFKAIG--EF-------MDYQKKLVKESGKKGIALA
Q2FP73_METHJ/6-186-SD---L.....EVKKSIQTGGALAESRK-----PVEEAIA--NL-------YQINLKESEKINTNADATF
B8I3W0_CLOCE/7-187-NT---Q.....EASAIYSDNGD..TLFR-----KLEASVT--SL-------INANIKEASDVYAKSLESA
B0TC96_HELMI/4-187-TA---EG..NAKALEIARTEGR..TKAL-----ALDEKLE--RM-------VQLQVELSEKTKKNADDRY
Q24U91_DESHY/6-186-NK---T.....FAYTVLAQDGP..KLSA-----NFSAAID--KL-------SLIKEQTGHEVAAANKARA
A0PY27_CLONN/6-189-NI---N.....GAKQIFASKIK..PIRE-----KTESKLN--AI-------NDMNETQAKISDEENRKVF
A6W0J9_MARMS/4-183-NK---E.....AA.SALIADMN..QAAD-----DMVRLLK--AI-------VIANQEGANEASADSLKEY
Q97DG6_CLOAB/7-186-DY---N......AIKNQFSIFD..GYRA-----KINDLLD--EE-------ITYNQKVAKSKYEDSQKQY
B0UJP2_METS4/9-189-EK---A.....AAFQHYETKAI..GPRR-----AMSDALE--KL-------VAYTNDGAERAQAMSEGAY
Q97J99_CLOAB/6-185-DY---D.....KANEYFTKAS...SYRN-----TMFGYLD--KE-------IALNTKLAKSDYDNSKVVY
B8I1D9_CLOCE/4-184-NK---E.....EALDLLNNNI...SYLR-----GEQKTLE--DL-------SEYCRKVSSDINTKNNRNY
Q820J9_NITEU/4-184-NF---D.....AAVEVTLQDAG..PKYE-----AVHGSLM--QL-------IGLQESVTAQEYEQLQAMT
D2QKC8_SPILD/2-187-PK---D.....RQVKLTRTAS...TAFS-----QIIQTLN--EL-------STLQLTVGEELLERSRGQT
C6XTP8_PEDHD/2-188-GV---E.....KARLMYETFGR..NAPG-----EIIQKLS--EL-------MRIQRQVGEELTKDTAFMV
B5EIZ2_GEOBB/6-186-KH---D.....EALAHMRGDGA..VASR-----NEQNAIE--KL-------VDAKLKQAKLSSASNTALA
B3E7H2_GEOLS/7-187-KS---E.....EALQLAKGDAG..RHAN-----AMLRGLD--KM-------ATVSVKHAKETAANNAQLA
Q97MS1_CLOAB/6-186-KN---V.....EAMAIVRNQLT..VAHD-----KLATSIK--NV-------TDMKKELAKESTDQNSATA
C6VSG0_DYAFD/2-186-AF---A.....DAKQLFSAPGA..TTFE-----STILNLN--EL-------AGIQSTIGKDLMKASKVNV
Q97FH5_CLOAB/6-186-DY---M.....SASVEFKTHTT..PYRN-----AALQKLD--AD-------IKYNAKVAKNDYSSSKVQY
B0TE36_HELMI/6-185-RA---E.....EAAAVFRGNQ...DEFT-----KVISLRQ--EI-------AEYNQQVAKALYHEIDTLA
A6LR72_CLOB8/6-186-DY---D.....EAIKISNSDLT..TIKN-----SLLENIQ--KN-------IDANAKAAEQANLNNISQF
A0Q228_CLONN/6-188-KY---P.....EAQQIYDSQVK..IVRA-----DMEQVLN--KI-------SDMNISGARTEHENNKDSF
A1W7U5_ACISJ/3-184-DF---D.....KGKSLNDTMVR..PGYA-----PLREGIQ--AL-------VDLQLNETKAEFNAATSRY
B2TPM5_CLOBB/5-185-KN---Q.....EALDLFREEGK..PIME-----NITGLTD--EL-------LKTNIIDCNNVSNKLKVLS
A5I5R4_CLOBH/7-185-NY---T.....QAEEKYKEIS...KVRD-----DMFESID--KI-------IEINLNSAELSHDDINSIY
Q24QB3_DESHY/6-185-KQ---D.....EAYTYFAANAA..DDLD-----VVNALLE--EL-------ADYNAQIADDEGIKSKSL.
Q24YV4_DESHY/6-183-EK---T.....TAYAQFTENAA..PLMM-----DINSALN--EL-------ADYKSQKADQEMNNA....
Q250C4_DESHY/23-203-LN---D.....KAYNLYETSGG..HLSD-----QLVEDMR--AL-------GEYYSSLSHQASLDYEASF
Q81B11_BACCR/6-185-N.---E.....EAYAYYLKEIE..PNMQ-----KSIKSIR--EL-------ILYNSNNAELLQKENNNSA
Q81ZA3_BACAN/8-187-KL---N.....QAYSFYLTTVE..HNLS-----ATVGALK--NL-------SDYNEKLAEGLYNDSEHSY
V6F5X6_9PROT/6-184-QF---D.....DAGRNMRDDAG..PKFA-----KAMEAMA--AL-------TQLQARIAQAEYQSAQT..

PF02203

L8BID0_ENTAE/1-177.KI---N-----AFFDQPTQKYQ--DDFE-----QTYNAYL--Q.-------...QNGKL-----------
MCPD_ENTAK/1-173.NL---Q-----AFMDQPTQKIQ--DRFE-----ADFVQYL--Q.-------...LAKAT-----------
B3HUP0_ECOLX/1-175.NT---G-----AYFAQPTQGMQ--NAMG-----EAFAQYA--L.-------...SSEKL-----------
A2S6U7_BURM9/1-177.DL---A-----AYHAIADTKIS--PMFV-----AYDKAAA--AV-------IAAYSKRA-----------
Q13QZ2_BURXL/1-174.EH---E-----RADAIVMKTMS--PLSL-----ALTNSAD--AL-------DTWQKAHG-----------
A0K3D5_BURCH/1-177.DM---A-----AYHAIADAKIS--PMFV-----AFDQTAA--AV-------IAALQKRA-----------
Q0K4P5_CUPNH/14-187.NQ---E-----EALRLAKKVLP--DLQR-----SMSSVHE--KL-------QKFQMTAG-----------
A7Z837_BACA2/7-146EDG---G-----.YAQAPKENTP--ADYD-----PRTRTWY--K.-------...DAVKA-----------
Q8XQ80_RALSO/1-174.DA---E-----RTSQTVMEAMP--ALYR-----PLGDKVT--AL-------SRMQMEIA-----------
A3NJ34_BURP6/4-177.RH---D-----EADRLMMTVAP--PLSV-----AWTKATN--AL-------DDARAAYG-----------
J7JW03_BACIU/7-146KDG---D-----.FTRYPYADMP--SDFN-----ALERDWY--K.-------...EAMAN-----------
A8FGS8_BACP2/7-147KKR---D-----.FIQFPKVDMP--KGYD-----PTTRDWY--Q.-------...LAMQD-----------
A8FGS7_BACP2/7-147EKG---L-----.FMQYPVQKMP--DGYD-----PRERPWY--Q.-------...EALKA-----------
A7Z836_BACA2/7-146KEG---T-----.FTRYPHADMP--ADFN-----PLERSWY--Q.-------...EAMEN-----------
A1JT77_YERE8/1-177.KI---N-----EFFDQPTSSFQ--NAFE-----HDYNTYL--T.-------...QNDRL-----------
Q46PJ2_CUPPJ/3-176.NQ---E-----EAVRLASKVLP--ELQR-----AMSSAHE--AL-------QKFQLTAG-----------
A7MM72_CROS8/1-177.NL---E-----GMFKQNAEQKQ--NAMQ-----VVYREWR--A.-------...EQAKL-----------
A7MEE5_CROS8/1-176.NM---D-----AYFAQATQGKQ--NALE-----KAVMRYD--D.-------...VNVRL-----------
A8GG43_SERP5/1-173.NL---Q-----AFMDQPTQKTQ--DLFE-----ADFVQYL--Q.-------...LVSAN-----------
Q65FN3_BACLD/7-146EDS---V-----.YAQYPNAPLP--DGYD-----PVERDWY--K.-------...QAVQE-----------
A4WA05_ENT38/1-177.NY---Q-----AYGDLDAQEAQ--DKME-----AVYTRWR--A.-------...ENNTL-----------
A8GG44_SERP5/1-177.KI---N-----AFFDQPTQSYQ--DAFE-----DIYNTYL--A.-------...QNDKL-----------
I0UJV5_BACLI/7-146KDG---K-----.FIRYPAEKMA--KGYN-----PADRDWY--K.-------...QAVEN-----------
B2UHV2_RALPJ/1-174.DE---A-----RINKTVMDVMP--ALYR-----PLGDKVA--AL-------NRLQMDVA-----------
A0A017LS69_ECOLX/11-181.MF---E-----AIINHESEQIR--PLDN-----AYTDILN--K.-------....AVKI-----------
Q3JSN4_BURP1/10-181.DR---D-----RI.LESAKRMQ--NVFN-----DFSLASE--AL-------RAFQLKQA-----------
B9BHH5_9BURK/6-179.RR---D-----DADRLLMSVAP--PLSV-----ALTRATD--AL-------DTFQAARG-----------
Q7N5T4_PHOLL/1-178.RA---V-----EFFNQPTGKYQ--SAFE-----EEYNFYL--T.-------...QNDHL-----------
A4TLJ4_YERPP/1-175.DL---Q-----AFMDQPTQKTQ--DLFE-----ADFIQYL--Q.-------...YANEV-----------
Q6D4S3_PECAS/57-232NQI---D-----IFFAVPVQAYQ--SDFT-----QKYSHYL--Q.-------...DTDAL-----------
A8AGH6_CITK8/15-185.MF---E-----AIINHENEQAR--PLDT-----AYNTVLL--K.-------....AIEL-----------
B5WVT2_9BURK/1-177.NL---D-----AYHAVADTKIS--PMFI-----AYDTAAA--AV-------IQALRQSV-----------
A7GNX1_BACCN/7-146NDK---T-----.FVQEPDVQMP--ADYD-----PTTRPWY--K.-------...DAISK-----------
Q46ZP9_CUPPJ/1-174.DR---E-----AVMTSVMKTIP--KLDI-----ALTAASG--DL-------SRAQIASA-----------
A7MPS2_CROS8/15-185NSI---D-----AFFAVPVQAFQ--ADFN-----DNFARYQ--S.-------...ANAQR-----------
A4JE67_BURVG/2-173.DR---D-----RL.GEGAKQLQ--VKYN-----DLTTASE--AL-------RNFQFSDA-----------
J7JYH6_BACIU/7-146TKG---H-----.FTRYPDLPMP--SGYN-----PVERDWY--K.-------...KAVAN-----------
E5W1J5_9BACI/7-146EDG---V-----.YVQHPYTKMP--DGYN-----PAERPWF--K.-------...EAVEK-----------
B2TGA5_BURPP/1-171.DN---A-----AV.KVALKKIA--LANT-----DYVTVSA--DL-------KQFQRDQA-----------
A8TNN7_9PROT/6-182.NY---A-----ELDDFVTKTVV--PLYE-----VAKPEAE--KL-------MVLQTDVA-----------
Q0K9D3_CUPNH/1-174.DR---D-----GVMKAVLETIP--QLDI-----AFTAVNA--EL-------NKLQVASA-----------
B2JWU0_BURP8/26-199.DH---P-----SADHLAMVDMP--PLAA-----SLTQKTA--AL-------DKFRTAQG-----------
A4JSC9_BURVG/1-175.DP---A-----NIPNVWRHIPP--SLFI-----DASDSMD--AL-------GRIQMSAS-----------
A4WBP6_ENT38/1-175.NT---D-----AYFAQPTQGMQ--NALG-----TALKEYD--T.-------...ASSQQ-----------
A6T1W9_JANMA/1-174.LF---E-----EAELLMLEKAT--PLFI-----KMTQSAE--KL-------QEFQMKAA-----------
A6SU23_JANMA/1-173.NV---L-----RVTEIVNETME--GLIL-----PVRADVT--SL-------IDIQLQEA-----------
A4W5T8_ENT38/1-177.NL---D-----DMFKQNAEKKQ--QAMQ-----KVYREWR--E.-------...AQAKL-----------
A8AGR3_CITK8/15-185NAI---D-----AFFAVPVQAFQ--TDFN-----ENYARFQ--Q.-------...ESGRQ-----------
A8FGS5_BACP2/6-146SDG---K-----VFSRYPNKKMP--ADYV-----ATERDWY--K.-------...DGWAK-----------
A4G2W4_HERAR/1-175.RN---E-----EVEDILVNKMP--PLFQ-----SLTKSTD--EL-------VELQMKSA-----------
C6BHT9_RALP1/1-173.DR---A-----TADKIMEKGVS--KAFR-----DANDSSL--AL-------SKKQLAFS-----------
Q21SE1_ALBFT/1-173.EL---P-----TTRQLVVEKIR--PAFD-----AARDAAD--AL-------QKFQLDEA-----------
B2T9U8_BURPP/1-172.NI---Q-----AFLDQPTQSFQ--DAYL-----GESHNFV--Q.-------...FGNAA-----------
A9ALM0_BURM1/1-172.NI---Q-----AFLDQPTQRFQ--DAYV-----AELRRFA--D.-------...YGAAS-----------
B5BKZ4_SALPK/1-177.KI---N-----EFFDQPTQSYQ--DAFE-----KQYMAYM--Q.-------...QNDRL-----------
B9BQN2_9BURK/16-188.EQ---E-----QASTVLHQNVD--AVMP-----QAMTAMS--NL-------RQLQVDVA-----------
A3RYQ0_RALSL/33-207.DK---D-----AARQLAVDQLP--MNFR-----TYAAQSD--RL-------NAIQMEVS-----------
Q0BFK7_BURCM/2-173.DH---D-----RI.GEGAKQLQ--MLYN-----ELSISGE--AL-------RNFQFSSA-----------
B2T7C0_BURPP/1-177.DM---A-----AYHAIADTKIS--PMFI-----AYDGAAA--AV-------IKGLQQSA-----------
A4WBP5_ENT38/1-173.QL---S-----DFLTAPVQDSQ--AAFD-----KSFNAWQ--Q.-------...DINQF-----------
B2JQ81_BURP8/1-172.NI---Q-----AFLDQPTQGMQ--DAYL-----TELHNFT--E.-------...FGDAT-----------
A8AFE7_CITK8/5-177.QL---S-----DFLTAPVQASQ--DAFD-----ANVTTWQ--Q.-------...DINRV-----------
A0A014LTC5_YERPE/23-197HNI---D-----TFFDVPIQGFQ--SDFT-----EKYYRYL--Q.-------...ESEKG-----------
A4LLG2_BURPE/1-172.NM---Q-----AFLDQPTQQIQ--DAYL-----GELRTFS--E.-------...FSGRT-----------
O05244_BACIU/10-150DNG---T-----.YVQAPKEKLP--EGYD-----PRQRPWY--Q.-------...DAMKA-----------
A3RWP1_RALSL/1-174.DA---A-----AIDKVVMTAIP--PMFV-----SLSAAVE--AL-------DRDQAEQA-----------
Q7N5T3_PHOLL/1-175.NY---D-----AFLDQPTEKYQ--QQLE-----SDFNHYM--Q.-------...YIGEV-----------
B1Y1L2_LEPCP/1-174.DL---P-----GVERLVLEKIR--PLFE-----PVESGIE--AL-------VQLELAEA-----------
Q6D6I9_PECAS/1-177.EF---K-----KFIEQPTQRFQ--DNFE-----KAYYVYK--A.-------...ENDKL-----------
B2JJ40_BURP8/1-177.DL---S-----GYHAIADTKIS--PMFV-----NYDNAAS--PV-------VKALQAHA-----------
A7Z835_BACA2/7-146TEG---H-----.FTRYPDLQMP--KGYN-----PIERDWY--K.-------...KAVEN-----------
A0A021WSL7_SALET/1-175.NM---D-----AYFAQPTQGMQ--NALG-----EALGNYA--R.-------...VSENL-----------
A0A017QUD1_SALET/1-176.NY---A-----AYGNLDAQKAQ--DDME-----QVYDKWL--S.-------...QNAQL-----------
Q4V270_BACCZ/7-146SNN---Q-----.FIHAPVGKIP--EGFS-----PLESSWY--K.-------...DAVKA-----------
B2UJN0_RALPJ/1-174.DA---A-----AADKVVMNTIP--PLSV-----ALTSAAD--AL-------DRSQAEQA-----------
Q6D6J7_PECAS/17-188.LF---E-----EVITLESEETR--ILDL-----AYNKFLL--E.-------....AVSY-----------
A7MLF1_CROS8/14-184.MF---E-----AIIEHENETAR--KLDD-----DYNQVLA--K.-------....ALAS-----------
B1G1I0_9BURK/49-221.DR---S-----TAQRIGVSQLS--TLFN-----DMSAAND--TL-------KRSLYANA-----------
A4G5M7_HERAR/1-171.QV---V-----EAMQL.QQQFQ--KLVP-----AVRNSID--AL-------RKLQVDEA-----------
Q65FN5_BACLD/7-146KDG---K-----.FIRYPDQKMP--SGYN-----PVERDWY--K.-------...KAAEH-----------
A2WA91_9BURK/3-174.DH---E-----RI.GAGAKELQ--ARYN-----DLAVASE--AL-------RTFQFSDA-----------
Q2W2L9_MAGSA/182-357.DA---A-----ALSKHFGEAMR--PLYN-----ANHVALK--GL-------IDYQSKDA-----------
A0A016QE24_BACAM/7-146RDK---A-----.FVKYPSVDMP--SDYN-----PLTREWY--T.-------...KAVEK-----------
B1G4F3_9BURK/1-177.DM---A-----AYHAIADTKIS--PMFV-----VYDNAAS--AV-------IKSLQQQA-----------
D2AI77_SHIF2/1-173.QL---S-----DFLTAPVQGSQ--NAFD-----VNFEAWQ--L.-------...EINHV-----------
Q39GS1_BURS3/26-197.QA---D-----RI.GEGAKQLQ--ARYN-----DLATASE--AL-------RNFQFTDA-----------
A7MJ45_CROS8/1-177.NY---E-----AYGNLDAQKAQ--DEME-----EIYTTWR--A.-------...QNTTL-----------
J7JR33_BACIU/7-146EDK---K-----.LYKYPDSGVP--KGFD-----PTGRDWY--K.-------...QAVAE-----------

PF05227

Q7D0T0_AGRT5/40-179-PI...S-----EIIEIGRNQAK--GQLD.....GFRAAAA..KI.......KEQLNGLSTVYAAE-----
A4G3M4_HERAR/45-184-AFH.SD-----EIAALVGGEGR--LAMD.....QLREQSS..LM.......IMVEEKLLLQRAQE-----
Q2GAV2_NOVAD/48-187-IP...D-----AHARLLSDEGQ--LAMN.....GLRRAVA..KL.......EDIERIRLEQAVQR-----
B0UAM4_METS4/47-180-PE...A-----ASALVRSGEGK--RIMD.....ALRTLTA..AV.......QDRAVADLDRIAAR-----
A9A170_NITMS/36-172-QD...D-----ALESILSNESD--IILD.....EIYQIIL..LL...........EGNLRDSENV-----
Q8P5A5_XANCP/43-175-.....A-----PEQIRALIEEM--TVSN.....PIRELIG..DL.......QTAEGRLLSVRNAR-----
A5VFJ7_SPHWW/35-172-RD...E-----EIARMGLGEGA--RRMD.....AALAVIH..RM.......VTEEEWLLADRRAT-----
Q2JP01_SYNJB/220-357-LL...A-----TQEALESSEGP--RLVE.....QIADLIL..VL.......QQEENRLLQQRSQE-----
Q6MHV5_BDEBA/38-175-LS...S-----AIALVKSGQGK--GVMD.....QLREAVN..TV.......ITNERARVLALKKE-----
Q5ZYY1_LEGPH/54-192-LD...T-----QEGYDLLNQSQ--DMSH.....QVKSLGQ..EI.......KSVELVLLSERNTG-----
Q01W36_SOLUE/41-175-AA...A-----AMEIVRSDRGR--QSMD.....ELRAFSA..QI.......VQNEYPRLEGWRAS-----
Q12FH0_POLSJ/36-173-ED...A-----WKFVLTTDVGK--KQMD.....DIRVSSA..QL.......IDASLTQTTQRHAD-----
Q2YRH7_BRUA2/43-180-VN...E-----AVKKVRGDEGK--VLMD.....QLADTVT..QF.......IDAEEQQLAERNER-----
A1T505_MYCVP/45-183-VP...A-----DEQASMTLESG--RVFD.....RLRTELR..AL.......AAHTDAMTEAQLMQ-----
A8KY69_FRASN/39-176-GT...D-----SPGILDPVLGK--TRFD.....AVRAAAA..DF.......DDAVRIAALAARED-----
A4YTN4_BRASO/32-169-TA...G-----LQALGSRGEGP--ATMH.....TITENLD..RF.......VTDQRALLAQRSIT-----
E0TGG9_PARBH/50-189-NDRNGT-----AEILQMLIDNK--TVLD.....DLRAQID..VI.......QALEGALLDERRER-----
Q11QI5_CYTH3/36-172-AD...Q-----AEVLPLMQKGK--ASTE.....HIYNLVK..KM.......KNNEGILLLQRNEK-----
Q092X8_STIAD/39-182-FS...T-----IVDKVRVTEGK--RFVD.....DMRTLSA..EI.......EQEESALLVQRTAT-----
Q6LKE0_PHOPR/42-178-NG...N-----TIEYVNSGTGK--QYVD.....SIRQILA..AA.......KSDEIVLKSERSQA-----
Q21RH2_ALBFT/39-176-LE...A-----ASAFVASAPLQ--ETRE.....RTYGLLR..EM.......NEEERRLLEDRNAE-----
Q1CX08_MYXXD/35-172-LE...A-----GAKFIQAGQGR--EVML.....QVKQIID..EM.......LVAEQERWDEHATA-----
Q1LS98_RALME/38-174-FD...V-----ALDMVRTDFGK--QTME.....NARRSLE..HL.......QVRESGTVTHNLEA-----
A5FHH5_FLAJ1/41-178-YD...K-----RKLDNHMFGGR--ILME.....NIRFKVD..EM.......NDIEKTYLKNRLKI-----
A1TTX0_ACIAC/37-174-DD...A-----WKFVLSTDVGK--ENMD.....AIRTLSG..RL.......AQRSADRSTHHTDE-----
Q1QXY8_CHRSD/37-172-NG...S-----GLPGAATPASK--RLVD.....EFRVIMG..NF.......IDTEEASLHVRQSD-----
Q9RYV1_DEIRA/56-192-LE...S-----AVARVSAGTGR--HLTD.....EARETLN..IM.......IGFENERLSNALKA-----
Q4KBM7_PSEF5/44-179-SG...D-----YRGAVQAGRGK--RLTD.....EIRKEYD..DA.......VAMEQQLRLERNEN-----
Q9K632_BACHD/54-193-.....A-----SYADLASDMSH--AIVD.....ESQELSE..VT.......QHRVDREIVENEKM-----
A9BLH7_DELAS/47-184-LD...A-----AMALVRLDVGK--NAMD.....RLRELID..DL.......YTRQTRELEQRRQL-----
Q2KBR3_RHIEC/40-179-TDMPIE-----EVVKIGVNATK--GQLD.....GFRQASA..KI.......KATAREKSNALAAI-----
Q5E1H0_VIBF1/40-177-LP...K-----ALSLVKEDKGK--AYMD.....DLREDLN..QF.......TNIELLLLEQRKGD-----
Q2JGB4_FRASC/72-209-GP...A-----AARLLSPEFGK--TRFE.....AVRAAAG..DL.......EADLRAREVRARQH-----
Q2SCK4_HAHCH/45-182-LE...S-----ATEIVNTDKGR--RLMD.....IISKLVE..EM.......EAEEYALLTQRRHE-----
A4YTQ5_BRASO/41-178-LA...A-----AIALVRDAGST--SSSK.....TMRETAE..AM.......RLEEERLLSLRTAN-----
A1T9E3_MYCVP/46-183-DP...G-----SVDPELTAIGQ--ADFD.....ALRVLFD..TQ.......NENLAQARDADIAE-----
B0UBF8_METS4/41-180-RA...E-----ARQLEISGAGK--VLMD.....AVRAKAA..EI.......ARIERTLLEERSRT-----
Q213L8_RHOPB/42-179-LD...E-----ATEILRVNTGR--DTMN.....RIRVLSE..EM.......SAEEHRLFRERTIA-----
F2G547_ALTMD/40-179-EQ...Q-----AIESLNSDKGI--ALYR.....RFETVFN..DI.......HNSERDMQGTHLAN-----
Q9A3Q7_CAUCR/39-176-RD...A-----AQQEVRDAGKK--VLVS.....AAVLPLR..EI.......RNAEVKNIAQNGAR-----
A1K2Y0_AZOSB/48-183-AGAGEE-----APRRAGVSDGV--RYMD.....TIRTTLA..GL.......KSRMAAEGQALLEE-----
Q6ARK4_DESPS/61-203-MD...D-----MADLVSESRGK--VYFD.....KFRAQIA..TF.......IEREETLLAKREKK-----
Q0KFB4_CUPNH/37-173-LE...V-----ALDLIRTDYGK--ETMD.....NARRGLD..QL.......QAREAGAVSHRLEG-----
A4Y015_PSEMY/45-179-DD...R-----AAMTRILVDNK--HVLD.....ALRQEIQ..QM.......LEREQTLLDERNAE-----
Q8YQQ8_NOSS1/215-351-FQ...A-----ALQVIQSDQGQ--TLMD.....DIRKVMR..EM.......ETENKVRLQQQLQA-----
A1WDW7_VEREI/55-192-ED...A-----WKFILNTDVGQ--EHMQ.....AIRRHAQ..VL.......SERSDQRVQHGQRQ-----
A1TNK2_ACIAC/40-182-ME...A-----FVSEFGKARDK--AAMD.....DFRTMQT..EF.......SKAERDLLDVRLAD-----
B9M3W8_GEODF/37-174-FA...T-----AQQMVLLGSGK--ESMD.....NIRWITG..QM.......GRAESDLLQERISK-----
A2TZQ8_9FLAO/41-178-TE...D-----FAEVFL..EGK--HMMD.....AIRDKIA..SM.......IALERAQLSYRQKA-----
Q6N729_RHOPA/41-178-IE...D-----ARQLLRDTDGR--RAMD.....TLTTSLT..AM.......RQEENRLFSERTTE-----
Q2RWM5_RHORT/121-258-WD...E-----ALALVLAGSGK--TTMD.....QARTVLE..DT.......LAELRSALQTQSEE-----
A1SZ61_PSYIN/35-175-TEDKRK-----AIEIVEQNTGK--KMMD.....EIRLQIT..LF.......TNHEHLLLERRKAD-----
Q6LTH6_PHOPR/40-184-NQ...A-----LKELIASGIGK--QKMD.....GMRAEIAFGEL.......GKTGDEILSAMINM-----
Q4KA09_PSEF5/46-179-.D...A-----ATVTAILIDNK--QVLD.....VLREQIS..AM.......RVREDALLAERSAA-----
Q2JDT7_FRASC/40-177-DT...A-----TAQDIVRTKAR--QDFD.....LLRREVA..EL.......AAAIDREQVEASGR-----
B2JPZ0_BURP8/44-179-NL...D-----YTDSVKSGRGK--IEFD.....ETRRLFA..QF.......VTVEEALRQQRSSD-----
A5V5G0_SPHWW/46-182-PE...A-----AAVRLRQGLGK--RQMD.....SIRSIIG..EM.......EAQADREVAELQRH-----
A4VFK8_PSEU5/48-186-LQ...A-----AAERLRGAGGN--LLMD.....RLRALLN..AV.......EQQERRELKAASSA-----
A4XNM7_PSEMY/48-183-GR...D-----ILEEVGSGRGK--NLTD.....GMRGELD..AF.......ISSERDLRRHRNAQ-----
Q09DK9_STIAD/35-172-FE...A-----AQKVVLTDKGK--LLMQ.....DIRQTID..EM.......LVVGDERWVQAADS-----
A0ZB66_NODSP/212-352-FE...A-----SLQVIKTNQGK--NLMD.....DIREIIY..EM.......EQEEQIQLQQQSLA-----
A5VGP5_SPHWW/47-184-LT...A-----AMGIVTSDRGK--GEMD.....AIRAQLD..GM.......AREEVRLREERMGD-----
Q6ARK4_DESPS/216-358-MN...D-----MAKIVGEARGK--VYFD.....KFRSQIA..TF.......IDIELSLMEVRRQN-----
A1TQ31_ACIAC/40-182-WE...D-----FLAEFRKGLDK--AAMD.....GFRALEG..GF.......SKMERDLLAVRAAA-----
Q11TC1_CYTH3/37-173-YD...K-----AQSLVASENGK--RIMD.....KIRDNIE..LA.......KDEEFRLLEIRKKD-----
A1TUA0_ACIAC/47-184-AD...A-----ALSVVRTDRGR--ATMD.....AIRSLVR..EM.......IAAEREELEERRAM-----
Q1IKU6_KORVE/55-192-LT...E-----DVQRRVATEGK--RRMD.....EIQTKVS..EG.......VALETRLLSVRIEA-----
Q02D29_SOLUE/39-176-LQ...P-----ALDVVLSDQGQ--RTMD.....EIRALVL..AL.......ESRESAVRAAASAE-----
Q7UME9_RHOBA/68-205-PE...A-----ARAAVIQNLDQ--NLMG.....KIDDLAI..SM.......RKIEEDLLVVREAM-----
A6W4I3_KINRD/50-190-NDDRAA-----AATIGATMYGK--NLFD.....AVRDEVE..QVD....GWLVQEQQRSQDRTEQ-----
Q7CY49_AGRT5/26-163-IT...E-----AVEVVRNNDGK--RFMN.....EIRIILS..DL.......QSDTDDRLRIIVAD-----
Q81H18_BACCR/42-172-.....N-----NVQTIDTTQIQ--.........SLQSQLT..NF.......RNTEEQLTKKRAAQ-----
B8I528_CLOCE/36-171-D....L-----EEARSKAGDGK--QLFD.....DFRKSHD..KI.......KDDVYKLTNDAWNE-----
Q15N85_PSEA6/42-179-EK...S-----ALRQIMTNRGR--DLYR.....EIRKSMQ..QL.......IDSEYQHRQALYTQ-----
A2SJW7_METPP/38-175-ED...A-----WRSLLQLDVGL--EMQQ.....TIRVVVD..RL.......IGVEMQRLADHQSQ-----
A7HUQ5_PARL1/53-190-FE...G-----ASKIVGNDRGK--ALMD.....ESRRLVD..EA.......ISEENALLAARQES-----
Q12AQ9_POLSJ/37-174-EA...A-----GVELIKTGKGR--TLTS.....EIRKVID..EM.......EREEKDLLKQRAEA-----
Q8YMN6_NOSS1/37-174-LE...A-----ALKIVQTDEGQ--QLMD.....KIRLVIK..AI.......ENEENNLLQQRSIQ-----
A3HS22_9BACT/52-190-LE...G-----FVDQSRVSNAL--VGYR.....SIKQTVT..AI.......NDEENRVFVERNRS-----
Q5Z3J6_NOCFA/47-184-AA...R-----ELAANTTVRAK--AVFD.....ELRAAFT..IQ.......NERLAAAVAADNEA-----
Q89IE7_BRADU/79-209-L....A-----ALAMIRS....--..MD.....EIRSQID..QM.......VDHERFRLAGREAR-----
Q0RSX8_FRAAA/34-171-GP...K-----AATALSPEVGK--RRFD.....AVRAASD..DL.......ESALRTKAIKARNN-----
Q1GY35_METFK/46-181-SE...D-----FMPILRQGNGK--MQFD.....AIRNELA..AF.......VAEEERILKTRSDS-----
A1W3R7_ACISJ/33-169-RE...E-----ALEAMRGD.GQ--ATME.....TTRTLVR..EM.......LNTEQQQLQAQREV-----
Q1QLB5_NITHX/64-201-HD...E-----IVEIARQEAGR--DAMG.....QIRDLGS..EM.......RAEEDRVFAERTAS-----
Q091M3_STIAD/35-172-RD...V-----AIANVEKGTGN--TQMA.....QIRRITS..EM.......LEQERELWSRSHED-----
Q2RN36_RHORT/47-186-IE...A-----ARALEASGAGK--VPMD.....AIRRLSG..EI.......AGAEEALLKQRTAE-----
A1WBJ8_ACISJ/37-174-DD...A-----WKFVLSTDVGK--ENMD.....AIRAIAA..RL.......VARSAQQTERSTQE-----
Q4KE98_PSEF5/39-182-AT...A-----MAEQISAGRDK--AKMD.....AMRQLTN..EL.......REAEKSLQDARSQA-----
Q67R65_SYMTH/44-180-A....P-----DVGSLLMTEGV--KYGE.....LIKEQRD..HF.......IREETKRMDQDVDK-----
A1TJ97_ACIAC/40-182-LQ...D-----LLPQFGQGKDK--AAMD.....AFRALQK..EL.......DQAESGLLAERKAG-----
Q89MA4_BRADU/41-178-PD...K-----ATALIREAAAG--NTTT.....TISNLAN..AM.......TREEERLFRIRTAN-----
Q20XI7_RHOPB/40-176-LQ...T-----SLAILEQARVD--LLTQ.....RIEQGLS..TM.......TKLEQALLKERQRN-----
A4YTN3_BRASO/32-169-RA...G-----VASLVAGAAGP--TAMA.....TINGVLD..SF.......TEEERRLLNVRTAT-----
A4VRA7_PSEU5/43-178-GE...S-----IVEYVRTRRGL--DLTN.....QRRTLLN..EF.......IATERQLRAERTDT-----
A1VKR0_POLNA/37-174-DD...G-----WKFVLTTDVGK--EEME.....AIRIQSD..KL.......SASSIQQMEQGQAQ-----
Q7NLV3_GLOVI/46-194-DV..AA-----ALDLGRSRQGK--ERFD.....RFRQAAA..EV.......RRRNDLLFAQLEAR-----
Q9KEH6_BACHD/36-170-PEGAIE-----QANSEVVPLGT--VINS.....QASQFVM..AM...........EDIIQEAETQ-----
Q9RD38_STRCO/40-177-ES...R-----KSVRATVERGK--KVFD.....EIRDAWE..TQ.......NADLAEAVADGKED-----
A7IHT5_XANP2/49-186-VQ...G-----AQADLKSDRSE--GAMT.....RLGTLLI..EM.......KAAEAQLLESRDTA-----
Q13ME9_BURXL/44-179-NQ...D-----FESAVASGRGK--IEFD.....ETRREFG..DF.......LDVELRLRQERAEA-----
A6X818_OCHA4/47-184-LS...A-----ALDLVRSDRGK--VEMD.....AIRGLVD..AM.......SQTENEVRTSRLAE-----
Q67RS7_SYMTH/36-171-WI...S-----QASAVLKNDVI--PVTE.....QIVDLSG..KV.......TLRLQVLAEQATRE-----
A0R5B3_MYCS2/38-175-RP...H-----IGNDMVAERGK--AQFD.....QLRGLFD..VQ.......NRHLSEARNVGIED-----
Q0RPK3_FRAAA/40-177-DV...A-----GAAGIVRANAR--RDFD.....ELRRQTA..RL.......AGQIDREQVEASGR-----
B0UPY1_METS4/41-180-RD...E-----ARASVGSGAGK--AAMD.....RIRAKVA..EI.......ERAETDLMSVRAGE-----
Q123E2_POLSJ/37-173-LE...A-----AAALVGSDLNR--QLHQ.....EIDGLAQ..RI.......KSAETLTLGRSKEE-----
Q98B44_RHILO/33-170-DD...A-----VAAIVASNRGK--TLMD.....QANVYFN..GI.......ILAADDRLTARVAE-----
Q12F56_POLSJ/37-174-ED...A-----WKFVLTTDVGK--EHME.....AIRVQSS..KL.......AASSIRKMELGQAQ-----
A5FEK4_FLAJ1/37-171-.....K-----ETLIFDLNEGR--NMMN.....EIKAIIK..KV.......ENTEQRLLEERNAN-----
Q090G4_STIAD/56-193-SE...A-----ALALVRTDKGK--VLMD.....RIRGTIE..EM.......EREERGLLSTRNLE-----
A1VL62_POLNA/44-179-DL...N-----YQEPVRSAGGR--SLTN.....EIRREFS..EF.......IGIEERLLQQRNEQ-----
A4YR54_BRASO/22-157-VA...E-----ARNLEASAAGK--KYMD.....GLRGLVK..EV.......IDAEASLLQTR...-----
B1HNT3_LYSSC/48-180-TK...A-----LTEFFKVDNGR--QDME.....KMRKLFD..AF.......RATENTYTQAKAAQ-----
B2FUS1_STRMK/43-174-.S...D-----QRELVK.....--...DLSTRYPIRGLVE..EL.......QASEQQLLTLRAEQ-----
B2HEL5_MYCMM/56-188-AP...V-----MLNGAATAIGK--AQFD.....QLRTLFE..DQ.......NRHLGAARAQAAE.-----
C5AXA6_METEA/41-179-RE...Q-----ARRIEASGAGK--SAMD.....TVRKVAG..TI.......ADTERALLETRTR.-----
D0J5Y8_COMT2/40-170-DE...A-----WRFVMFTDVGM--ENMD.....AIRGHIK..TL.......MDSIDQRVKS....-----
D4ZMN6_ARTPN/39-173-TQ...T-----AIELVKTHHGK--NLMN.....EIRQILD..TM.......KDEEERLFEIRSD.-----
E3FRV7_STIAD/35-168-FE...A-----AQAIITADEAR--RASD.....TLRSSVD..EM.......RATEERLLQEQE..-----
J9ZC42_LEPFM/5-146-FR...A-----ARDMVMSDYGK--QVMD.....QIRAISL..QMGTLLSRKRDFERQLLLARER.-----
J9ZDH6_LEPFM/41-176-FPH.RD-----ALLMVML.RGK--EVMD.....QIRHLTQ..SM.......KSSEYRRLRRRS..-----
M1FHH2_9ALTE/40-178-LY...D-----IANVVGQAKGK--EHFD.....KFRKQVA..TF.......KEREESLMVTRM..-----
Q3J1L2_RHOS4/40-170-VE...A-----GRAIVARGEGR--AAMD.....RIRELLT..ET.......IDRSDARNVQA...-----
Q63KK2_BURPS/60-192-FD...A-----AQAIVSSDAGK--IFMD.....RARVMVN..EM.......EATVQQQLRTL...-----
Q8F6F9_LEPIN/38-173-FQ...D-----YVELYRSPNGF--TLSE.....KIKFLLQ..EI.......KDEELRLLNIRKH.-----
Q8PAN4_XANCP/38-173-LD...G-----ARASIAKGVFQ--.TSS.....ALRRQVQ..LM.......GELERRQLVSRTQ.-----
Q8PCA9_XANCP/46-176-.....R-----EEEIRQLWDGK--YKLD.....ILRAELR..EL.......RNYETAQLQVRTA.-----
Q8YVU1_NOSS1/40-175-FE...A-----AQKSILSDRGR--AVMA.....QIRNISQ..QM.......NAEELKLLEQRTA.-----
U5LEK7_9BACI/48-180-KE...E-----ASQLVESAKGK--ETMD.....KLKSQIQ..SF.......EEDELKASEERIA.-----

PF16591

F2KIP4_PSEBN/23-277-SV---Q-----DFTASNQAIGKAVQDTI-----DLGETIT--RL-------SDEMYASQLVSRDEDGAQA
A4VQJ2_PSEU5/57-311-AI---E-----SLETATQAIAKARQEMT-----DQQKEIV--RI-------SDSLYQFQLDQLDVESAAA
A4VGE7_PSEU5/34-290-AI---E-----TFKVGMDATIQARTALA-----SEIGGLL--EI-------NGNLYRNQQTKMLGETQQA
F2KBS3_PSEBN/33-286-AV---Q-----AFKLTTADAVQARKEMT-----DQGASIV--TL-------SEQLYQIQLDRRDAESAQA
Q4KIL8_PSEF5/33-286-SL---Q-----AFKVAFTNAVEARKEMT-----DQGADIV--SR-------SDALYQIQLDRRDIESAQA
F6A9D3_PSEF1/33-286-SL---Q-----THQAALQQINASSAEVQ-----KQGDNML--HI-------SQELYANQMQLRAEDTDMA
F6AH80_PSEF1/33-287-LV---D-----TYRTAVAERVQLRDAMT-----EQVLEIV--KG-------SDALLAMQVKLRDSDSAFA
F6A9X7_PSEF1/33-287-AV---M-----AFKAAIDTIAVARKELT-----DEGYEIV--RI-------SKELTAIQMERRNSETASA
M4WQE7_PSEDE/33-284-AL---D-----SYRHEVNASQAARDRMR-----DGGVQIE--KI-------SNELTLSETAKRDAGVGQA
A4VRY2_PSEU5/1-255-QF---G-----QLPPIVAAQVQARQEMQ-----EIFDSIY--RN-------TNEIVQSQTERRSAEAGE.
F2KDB6_PSEBN/37-285-AV---S-----QFRDSQVASASALKKMA-----DQDSRLH--EL-------NNHLTTSQIEKRDQETAQA
Q4KJM1_PSEF5/37-285-AV---S-----AYSDAEEASAAALKRMA-----AQGDRLM--DL-------SKQLTVAQTTKRDSDAAQA
Q87UY2_PSESM/37-292-SL---S-----EFKQIQTKAEADQESME-----SLGEKLL--ES-------VAALTLLQTAQRDSEAAN.
Q88D08_PSEPK/37-294-SL---D-----QYRRAAVRVEQLQNNME-----IMGNELR--TV-------SLDLGKRKVEQRDREALAA
MCPS_PSEPK/33-286-AV---R-----QFRDAVANITTSRAEMT-----VQGADIV--KR-------SDALYQIQLERRDIESTQA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window