Sequence alignment for CL0458

PF12745

B2VUI6_PYRTR/1224-1477WMPRRCDCLVASFDP----------SVLR-----STGVKMVADLISHG-------------YTAELAVDAR.NTE--ELL
B2B7B1_PODAN/1374-1619FSMKRCDVLIASFDP----------SVLR-----SSGIELLQMLWAHN-------------ISAELARDTR.SPE--DLL
Q2U916_ASPOR/1345-1593WKTRRCDVLVASFDS----------KILR-----KKGIEVVQDLWAND-------------ISAELAVDAS.SLE--ELL
A6ZYN2_YEAS7/1387-1658WKPSRCDVLISSFSN----------SLLD-----TIGVTILNTLWKQN-------------IKADM.LRDCSSVD--DVV
Q6FSE4_CANGA/1377-1647WKPSRCDVLVSSFSN----------SIFD-----TIGVNILNQLWKNG-------------IKADF.LRNCYTVD--DVV
Q0UGA3_PHANO/1143-1398WMPRRCDCLVASFDS----------NVLR-----SAGVKLVAELIAHG-------------YTAELAVDAH.SVE--DIL
B5RUH6_DEBHA/1464-1741WKKSRCDVLVTSLNE----------SYIR-----LSGYEIVKSLWAHD-------------ISSDI..FTSTSLE--DIA
C5MFL8_CANTT/1436-1709WKGSRCKVVIGSTQQ----------QFLS-----QCGYSLLASLWNRN-------------ISADI.NLGSKSQD--EIY
Q5BB34_EMENI/1298-1547WKTRRCDVLVASFDP----------TILR-----EMGVQLTQDLWSNS-------------ISAELAVDAS.SLE--ELL
C1GPN0_PARBA/1276-1530WRSRRCDVLVASFDA----------TVLR-----TVGVGVIQELWAHG-------------ISAELSVDTS.SLE--EIL
C5DM71_LACTC/1436-1709WKPMRCEVLVSSFSK----------TILN-----TIGVETLNQLWKAG-------------ISADF.VHSCYTVD--DVV
A7TGA0_VANPO/1397-1666WKPRRCDVLISSFSN----------PLLN-----TIGVNILNQLWKKG-------------INADM.LRNCNSIE--DVV
B6QG71_PENMQ/1331-1582WRSRRCDVLVASFDP----------TVLR-----TVGVRIVQDLWAHD-------------IIAELAVDAS.SFE--ELI
A5DLN9_PICGU/1351-1611WRGTRCDVLITSTNK----------SLVR-----LAGFEIAQSLWKNR-------------ISCDF..AYSASQT--DIM
A3LWI3_PICST/1404-1670WRGVRCDVIITSPSA----------AYMD-----QSIYEIAKELWAHN-------------INCDT..FVFSSQE--ELS
Q6CTQ8_KLULA/1399-1671WKPKRCEVLVSSFSN----------SILN-----TVGIEVVSKLWKAG-------------ISADI.VRGCFSVE--DVI
C5FVW9_ARTOC/1335-1588WRRNKCDVLVASFDP----------SVLR-----TVGVGIVSTLWAND-------------ISAELAADTTPSLE--DLL
GCN2_SCHPO/1326-1576WAPRRVDVLVTSIGK----------DSI.-----LEKCSLLQELWALN-------------IQADIVLRGASSLE--EIV
C4YBZ4_CLAL4/1388-1652WRKSRCDVLVTSSQE----------SIIK-----DSGFKVLNELWAHG-------------ISSDW..FFAKSNE--ELN
C4YTJ1_CANAW/1463-1762WKGNRCKVLISSTQQ----------QFLS-----QVGYQLVSKFWNKN-------------ISADITSVAAKTQD--EIF
C5E0Y7_ZYGRC/1387-1656WRPSRCDVLVSCFSN----------SILN-----TTGVNILNTLWKNG-------------ISTDF.LRHCYTVD--DVV
Q2GWD3_CHAGB/1350-1553FSAKR..........----------....-----...VSLTTSLPS..-------------..............--...
A7E5P7_SCLS1/1343-1585WSTKRCDVLVASHDA----------AILR-----STGVELVSNLWSHD-------------ISAELARDSR.SPE--DLL
Q6CEK5_YARLI/1380-1640WYPSRCDALVTSFNS----------NTLR-----TVCLDVLKDLWGAG-------------IRADL.CRDCSSSE--ELV
B6HND6_PENCW/1330-1577WATRRCDVLVASFDP----------TVLR-----TTGVKLIEELWSNN-------------ISAELAVDAS.SLE--ELL
B6JXM9_SCHJY/1324-1574WIPRRLDVIVASIGK----------DSL.-----TEKCAVLRILWALN-------------IKADVLHKGATSLE--EVV
O74297_NEUCS/1372-1645FNIKRCDVLVASFDP----------EVLR-----SSGIELVQTLWAHS-------------ISAELARDAR.SPE--DLL
C4R5R6_PICPG/1424-1692WSASRVDVLVCSFTS----------SLLR-----SIGIDLLQQLWSCE-------------IRADL.LKNCLTTD--DVI
Q75F11_ASHGO/1426-1697WKPKRCDILVASFSD----------AILN-----SLGVRIVNKLWKLG-------------ISVDL.VRNCYSVE--DVI
A5E786_LODEL/1546-1804AGGSRCDVIIASTDL----------ENIS-----KIGYELAGRLWTRK-------------FSVDI.LPKAAPQD--ELI

PF03129

SYG_YEAST/570-662------KVLLVPLSNH........KD.LV.....PVTTEVAKILRKSQ.............IPFKIDD.SGVSIG..KRY
SYP_ZYMMO/346-439------HVGLINLRID........DENCR.....AIADSLYQRLEAAG.............IDTLYDD.RNERGG..AKF
SYH_BORBU/349-448------KVLIVNLDS...........ALQ.....NYYYELATRFRNHDYSKV.....KNISCEVYFKNKNGKNIK..EQI
SYTM_SCHPO/361-469------HAVILPVNQ.........TDRIL.....TYAKQVQKELSNQEVNESEFLPLNKNTYYVDINA.EAQSIG..KRL
DPOG2_MOUSE/356-452------KVALDVGKGP........TVELR.....QVCQGLLNELLENGI...........SVWPGYSETVHSSLE..QLH
SYG_HUMAN/615-709------KCSVLPLSQN........QE.FM.....PFVKELSEALTRHG.............VSHKVDD.SSGSIG..RRY
SYEP_HUMAN/1303-1404------QVVIIPCGITNAL.SEEDKEALI.....AKCNDYRRRLLSVN.............IRVRADLRDNYSPG..WKF
SYT2_BACSU/542-632------QVQIIPVSH...........VHL.....DYCRKVQAELKQAG.............IRAGIDE.RNEKLG..YKI
SYT2_AERPE/318-408------QSAVIPVDS...........ESE.....GYAQRIAEDLAASG.............VRVSIV..RGSGLG..RRV
SYT1_AERPE/340-442------QFAVIAVKTGG.....EVDREIE.....DLASSIAKGLLDKG.............FRVAVKG.SSKTGLSSDVR
SYH_AERPE/342-432------QVAVVVLDR...........RYY.....RYAWEAARILRRGG.............LNVRIDL.SRASGQ..VQR
SYH_ORYSJ/696-784------EVLVSIIGK...........DLI......LAAELVSELWNAG.............IKAEFKL..TTRIQ..NHL
SYH_HAEIN/329-422------DIYVVYQGEG.......ATLAAF.....ELAEKVRSELPHLN...............TMLHC.SSGNFK..KQF
SYH_STREQ/330-420------DVYIAVLGA...........DAN.....VAALALTQAIRRQG.............FTVERDY.LGRKIK..AQF
SYP_ARCFU/285-379------QIVIIPILYKG......KEEAVM.....EACRKLAEKLK.A..............FRVVLDE.GEDRPG..AKY
SYP_SYNY3/503-595------EVVIVVPNVG........DEEQM.....QVAEQIYTEFQAAE.............VDVLLDD.RNERAG..VKF
SYG_THET8/401-503------KVAVIPLVKN........RPEIT.....EYAKRLKARLLALG.............LGRVLYE.DTGNIG..KAY
SYTM_ARATH/614-704------QAIVCPISE...........KSQ.....QYAEKVQKQIKDAG.............FYVDADL.TDRKID..KKV
SYT_METTH/495-584------QVRVLPIAE...........RHM.....EYASDLVSELIAAD.............VRADLDD.RSETLG..KKI
SYH_METTH/334-424------DVFVIPIQD...........STV.....PEAIRITQELRAAG.............VSADLEV.SGRKLR..KAL
SYH_PYRHO/339-428------EVFVIPLKD............ME.....KVAINIAVKLRREK.............IKTDIEL.SGRKLG..KAL
SYH_PYRAB/339-428------DVFVIPVGD............SR.....DVATAIVTRLRKAG.............IRSDIEL.SGRKLR..KAL
SYP_SULSO/290-388------KVVVIPIPAKNE....EETQQVM.....KYSIEICEMFNKNN.............ITCLTDQDTEKTPG..EKF
SYP_HELPY/480-573------DVVIVVSNWKDEA.QKKLAF............EVYERLLQKG.............VDALLDD.RDARFG..AKM
SYG_MYCGE/355-444------QIIVLPLVN..........K.LK.....KEAFSVFETLAKTR.............W.RVCFE.TTGSIG..KRY
SYT_METJA/503-598------QVRVIPVAE...........RHY.....DYALKVAEKLRENN.............IRADFDD.REESVS..KKI
SYP_METJA/280-374------QVVIVPLIFKG......KEDIVM.....EKAKEIYEKLK.GK.............FRVHIDD.RDIRPG..RKF
SYG_ARCFU/462-553------EVAVLPLLSR........EP.FE.....SKGMEIVQMLREEG.............I.FTDYD.DSGSIG..RRY
SYTC_SCHPO/599-693------QVCIIPVSA...........AAY.....NYADKVHNILSEAD.............IFVDTDK.SDNTLP..KKI
YHY6_SCHPO/500-600------QSVVVPCGITNKT.TDQERNEIE.....GFCSKLADRLNAAD.............IRTEADLR.AYTPG..YKF
SYH_SYNY3/327-417------DLYLISKGE...........KAE.....PQALILAQKLRNQG.............LAVALDL.SASAFG..KQF
SYG2_YEAST/505-597------KVFVTTISNN........DG.FP.....AILKRISQALRKRE.............IYFKIDD.SNTSIG..KKY
SYG_METJA/483-574------KAYVLPLVNK........DD.MP.....KIAKEIEQMLRENG.............I.IAEYD.DSGAIG..RRY
SYP_CHLPN/475-566------SITIAFNG.GDTV.SQELAE............TIYHELQSQG.............YEPLLDD.RDERLG..FKL
Q22620_CAEEL/378-475------QVIVVPVGFKT.....ENKQSLF.....DAVDKVTKDLVADG.............VKAEHDLRENYNAG..WKF
SYH_PORPU/327-417------DCYIVSKGI...........KAR.....KIGIIITQFLRNQL.............VKTELDI.SSSNFG..KQL
SYG_AERPE/475-567------QAVVLPLVEN........DEKLV.....ERARMVYETLVEAG.............F.TVYYD.DSGSIG..RRY
SYG_DEIRA/402-504------KVAVIPLARN........REEIT.....DVAKAIKAELQGLG.............LGRVLYE.DSGNIG..KAY
SYTC_YEAST/629-723------QVLVVPVGV...........KYQ.....GYAEDVRNKLHDAG.............FYADVDL.TGNTLQ..KKV
SYH_THEMA/326-416------LVYIATLGE...........KAF.....MDGVRLAGELRKKG.............LSVDVDI.MDRKLS..GQL
SYG_MYCPN/355-444------QIVVLPLVN..........K.LK.....ETAQTLFEALSQTH.............W.RIGFE.SAGSIG..KRY
Q9VZY9_DROME/330-430------DVCLIGPKQGSKEQPEAEVIENELLLNVGEICGHQELLHDDR.....................KELTIG..KRL
SYP_BACSU/472-564------DLHILALNMKNDG.QRELAE............KLYADLKAEG.............YEVLYDD.RAERAG..VKF
SYP_MYCGE/302-392------QVKLYLFDKNNNPKTRALAFLVK.....DFLEKLKIRFSFIE.....................INNQLG..KQL
SYH_HELPJ/347-438------KVLIACMHE...........EYF.....SYANRLAESLRQSG.............IFSEVYP.EAQKIK..KPF
Q9X6E6_PSEFL/61-151------QAVVMNITD...........KQA.....DFALEVEKTLNQSG.............FRAKSDL.RNEKIG..FKI
SYP_BORBU/287-387------EIIVIPIFKKED....EINKKIL.....DYSDCVVDALKKAE.............FRVEIDKDVRSSPG..FRF
O94025_CANAX/346-450------QALIVPINESHVPVAEELQKKLSG..DIVSCDNAIAPLTGFT.............FHVDIDK.RGETVG..ART
SYP_MYCTU/487-579------DVHLVIAN.KDAQ.ARAGAT............ALAADLDRLG.............VEVLLDD.RQASPG..VKF
SYP_HAEIN/474-568------TVAIVPMNMHKSEAVQKYAE............ELYRTLQSQG.............VDVIFDD.RKERPG..VMF
SYT_SYNY3/506-596------QVRLLAVSD...........EFL.....PFAQSIVQQMQSLG.............LRAEVDT.SGDRLG..KMI
SYG_BOMMO/559-652------KCVVLPLSGN........AE.FQ.....PFVRDLSQELITVD.............VSHKVDD.SSGSIG..RRY
SYP_TREPA/517-607------AVVLIPIP.HTQA.PYAAAE............ALYVQLRTRG.............VEVLFDD.RAERPG..VKF
Q9SBK5_WHEAT/340-428------EVLVSILGK...........DLI......LAAELVNELWSAG.............IKAEFK..LTTRVQ..NHI
SYG_SCHPO/538-630------KALIVPLSRN........AE.FA.....PFVKKLSAKLRNLG.............ISNKIDD.SNANIG..RRY
Q9VJV8_DROME/256-358------QCGIACVESDS.....ELSADLS.....DLCQHLKHVLNHAGLRLS.....EGDGIRTTK...NASHLA..EHL
SYT_MYCGE/471-563------QAVIIPVNI..........QKHL.....KAAKKLYNKLLKEN.............IRVNLDD.NQDRLA..KKV
SYT_TREPA/495-584------QAVVIPVAP...........AFL.....EYAQHVARELCARS.............LRVQADV.SAERMN..AKI
SYT_ARCFU/502-597------QVRVIPVSE...........RFV.....DAAIKIADDIARNG.............IRVDVDD.RNETLG..KKI
SYT_DEIRA/551-644------QVMIIPIAD...........RHN.....AYAEELREELHRAG.............LRAEVDD.SSNRMQ..AKV
SYT_CHLTR/535-625------HVRIITVAD...........RHE.....ARAQELAKHFSQMG.............IIVSVDS.SNESVS..KKI
SYH_THET8/330-420------DLYLIPLTE...........EAV.....AEAFYLAEALRPR..............LRAEYAL.APRKPA..KGL
SYHC_TAKRU/425-516------QVMVAAAQK...........NLL.....EERLRLITELWNAG.............IKAELMYKKSPKLL..SQL
SYP_DEIRA/304-400------QVVVIPVG.RK.....DNFDQMV.....QEGEKLAAELRAQG.............LRVKVDGRDGVTNG..FKY
SYGM1_ARATH/617-705------KCTVFPLVQN........QQ.FE.....EVAKVISKELASVG.............ISHKIDI.TGTSIG..KRY
SYG_MYCTU/369-459------KAAVLPLSRH........AD.LS.....PKARDLGAELRKC..............W.NIDFD.DAGAIG..RRY
SYH_SCHPO/434-534------DVFVMAFGG...........GKEWTGFLKERMSVCKDLWANG.............IKAEFLYKVKPKPR..QQF
SYP_ECOLI/475-569------QVAILPMNMHKSFRVQELAE............KLYSELRAQG.............IEVLLDD.RKERPG..VMF
Q9VUK8_DROME/648-741------KCSILPLSNN........TD.FQ.....PYTQKLSSALTKAE.............LSHKVDD.SSGSIG..RRY
SYHM_HUMAN/411-502------QVFVATPQK...........NFL.....QERLKLIAELWDSG.............IKAEMLYKNNPKLL..TQL
SYG_PYRHO/476-567------EVAVLPLVAK........EP.LT.....TIAYEIYRTLQKEG.............F.IVVYD.EKDSIG..KRY
DPOG2_XENLA/360-456------K...VAVDMGK.....GPTGELR.....LVCQGLSSELREQGV...........YVWPGYQETLHGSLE..QLY
SYT_HELPJ/516-606------QIALIPINE..........EHHV......FALKLKEALKKCD.............IFVEVLD.KNDSLN..KKV
SYT_BUCAP/541-631------QVVILSITD...........SHI.....NYVKKIVQHFSDIN.............IRVESDL.RNEKIG..FKI
SYHC_MESAU/409-500------QVLVASAQK...........KLA.....GGETKACLQLWDAG.............IKAELLYKKNPKLL..NQL
SYH_BACSU/331-421------DCYIVTLGE...........KAK.....DYSVSLVYKLREAG.............ISSEIDY.ENKKMK..GQF
SYT_THET8/559-649------QAVVVPVSE...........KQE.....DYAREVAGRLKEAG.............LRAEADT.RPERMQ..ARI
SYP_AQUAE/472-564------ELDIILLNTKDEE.MKNVAE............KLYLEAEEKG.............IDVIFDD.REESPG..FKF
SYT_CHLPN/535-625------QVRIITVAD...........RHI.....PRAKELEEAWKRLG.............LVVTLDD.SSESVS..KKI
SYH_CHLPN/334-424------KLRLIPMEP...........DAD.....QFCLEWSQHLRRLG.............IPTEVDW.SHKKVK..GAL
SYH_CAEEL/426-517------EVYVASAQK...........NLV.....RDRKKLVKMLRSAG.............IKTEMALKANPKLL..TQF
SYPM_SCHPO/330-423------KVLVVPTSDNHIQ.SAETVYDAT.....ANVVGFDNVLLEDR.....................QNRAFG..YKM
SYT_MYCLE/592-682------QVVGIPVTG...........EHV.....SYLEEVAAQLKSCG.............VRTEVDV.SDDRMA..KKI
SYT1_BACSU/549-640------QFQVIPVSP..........AVHL.....DYAKKVQERLQCEG.............LRVEVDS.RDEKIG..YKI
SYT_RICPR/540-630------QVAIATITN...........DLN.....DYALEVQKTLIDNG.............VRTDINI.SPDKIN..YKI
Q9VKB0_DROME/645-736------QVMVVPVGP...........AYD.....QYAQSVRDQLHDAG.............FMSEADCDAGDTMN..KKI
SYP_RICPR/336-429------KVSLINLNIHDNK.CVELAA............KTDKELSHQN.............IEVLYDD.TDARPG..SKF
SYT_AQUAE/543-633------QVMIIPIAD...........RHH.....EYAKKVYEFLKENG.............IRAEMDL.REERMN..AKI
SYTC_CAEEL/619-710------QCKIITVHE...........SVR.....DYANDVKKQIFEAG.............FEIEYEENCGDTMN..KQV
SYT_BORBU/485-575------QVVIIPVNN...........IVE.....DYAIKVFNKFKNEG.............IRIKLDN.SSSRMN..AKI
SYTM_YEAST/349-457------QAVIIPVNTKNVQ.QLDMCTALQKKLRNELEADDMEPVPLNDW...........HFNVDLDI.RNEPVG..YRI
SYP_MYCLE/290-387------QVVIVPITTGN......KASEVG.....HAAADLARRLQAAG.............VRTHVDARPQLTPG..WKY
SYP_THEMA/470-562------TVVVDILNMNDAE.QKQVGE............KIYQVLSEKG.............EEVVLDD.REVSPG..FKF
SYT_HAEIN/541-631------QAVVMNITD...........SQA.....DYVQKVAKQLSDVG.............LRVKTDL.RNEKVG..FKI
SYP_MYCPN/302-392------QVKLYLFDKKGDTKTVELAQKVQ.....TLLEQLAIRFQFIK.....................VENQLG..KQL
O45869_CAEEL/324-427------DAVIIVKKS............LMSNVIVEMASSSASRYLKGG...............ILLDDRVEMSAG..KRI
Q9VWT1_DROME/426-517------EVYVASAHK...........GLH.....EQRLKVLNLLWDAG.............VKAEHSYKLNPKLL..VQL
YHI0_YEAST/475-576------QSVVIPVGITKKT.SEEQRKHIH.....ETARSVESRLKKVG.............IRAFGDYNDNYTPG..WKF
SYH_MYCLE/333-423------DVFGVSLGE...........AAK.....LKVAMLAGQLRAAG.............VRVDLIY.GDRGIR..GAM
SYT_MYCPN/471-563------QVVVIPVNI..........DKHE.....KAAKKLYQKLLKEN.............IRVSLDE.SEDRLG..KKV
SYP_METTH/296-391------QVVIVPIIFKK......AAEEVM.....EACRELRSRLEAAG.............FRVHLDD.RDIRAG..RKY
SYH_YEAST/427-527------QVFVMAFGG...........GKDWTGYLPERMKVTKQLWDAG.............IEAEYVYKAKANPR..KQF
SYT_PYRAB/512-602------QVRVIPVSE...........EYL.....DYALYVAGKLEGAK.............IRVDVDD.EDERLN..KKI
SYG_BORBU/345-435------KIAIFPLVKK........VE.LT.....EIARRIYMELCDD..............F.HIFYD.DSGTIG..KRY
SYTC_HUMAN/620-711------QVMVVPVGP...........TCD.....EYAQKVRQQFHDAK.............FMADIDLDPGCTLN..KKI
SYPC_CANAX/439-539------EVTVVEVS.KQKQ.LKNVNDNNHHNNPQDNFQEIYNILNQAN.............IDYRLDN.RSDSMG..KKL
SYG_METTH/472-563------EVTVLPLVNR........EE.MV.....MTALEIERNLRRSG.............F.IAEFD.SSGTIG..RRY
SYP_AERPE/292-390------QVVVIPITPGDE....EKRGKVL.....TYTAKAAEALEKAG.............LRVHVDDREWERPG..AKF
SYP_CHLTR/475-566------SITILYNG.GDTE.GEATAL............QLYQSLNTEG.............FEPLLDD.RNERLG..FKL
SYT_SHIFL/541-631------QVVIMNITD...........SQS.....EYVNELTQKLSNAG.............IRVKADL.RNEKIG..FKI
SYT_THEMA/538-628------QVAVIPISE...........KHN.....DGAEKVARRISQEG.............FRVFFDN.RRETLG..YRI
SYG_TREPA/365-455------TVAFLPLVKK........DG.LV.....DLARAVRDELRED..............F.ACDFD.AAGAIG..KRY
SYG_CAEEL/625-719------KCSVLPISAN........DT.LI.....PVMDAVKEELSRFE.............MSYKVDD.SSGTIG..RRY
SYP_PYRHO/288-383------QVVIVPIPKKG......SEEEVY.....SYAKGIEEELRDAG.............IRVYLDL.RDKRPG..WKF
SYH_MYCTU/330-420------DVFGVPLGE...........AAK.....LRLAVLAGRLRAAG.............VRVDLAY.GDRGLK..GAM
SYEP_DROME/1503-1604------QAIVVPCGITVNTKDDERAQ.LL.....DACKALEKRLVGGG.............VRCEGDYRDNYSPG..WKF

PF12745

B2VUI6_PYRTR/1224-1477RHYRDDRHSWVIVIKQGV...............................GPD------------KPE..LKVKSI----S
B2B7B1_PODAN/1374-1619SSYREESYSWIVIIKQ...................................D------------NM...VKVKSM----G
Q2U916_ASPOR/1345-1593TKYKDHNHSWIVIVKQ...................................D------------SQERGFKVRCL----V
A6ZYN2_YEAS7/1387-1658TGAQQDGIDWILLIKQQA...........................YPLTNHK------------RKYKPLKIKKL----S
Q6FSE4_CANGA/1377-1647SGAQQDGVDWIVLIKQQS...........................YTVNSQK------------RKYKPLKVKHL----G
Q0UGA3_PHANO/1143-1398RHYRDDRHSWVIVIKHGL...............................APD------------KPE..LKVKSI----G
B5RUH6_DEBHA/1464-1741HKTDIDGANWVVLIKQPNSLQK.......................SKQKRST------------GKFKPLRVKNV----I
C5MFL8_CANTT/1436-1709HNATTDGATWVVIIRQLPSNVGG......................RKVRKSG------------SIFKPLKAKNI----I
Q5BB34_EMENI/1298-1547TKYKEHNHSWIVIAKQ...................................D------------SKERGFKVRCL----V
C1GPN0_PARBA/1276-1530SRYRNDSHSWVVIVKQ...................................D------------SMERGLKVKNI----S
C5DM71_LACTC/1436-1709SAAQRDGVNWIILIKQQK...........................YSAPSNK------------RKYKPLKVKKL----G
A7TGA0_VANPO/1397-1666SGAQRDGVDWIILVKQQS...........................YAVTGHN------------RKFKPLKVKRL----T
B6QG71_PENMQ/1331-1582SHYKEDNHSWVVLVKA...................................D------------SNERGLKIRSL----V
A5DLN9_PICGU/1351-1611DQAAQDGCGWIVFIKQTNSSSR.......................VKSRRGP------------SNFKPLRVRSV----Q
A3LWI3_PICST/1404-1670HKVQTDGANWIVVTKQPNTL............................QKRN------------RNFKPLRVKTL----H
Q6CTQ8_KLULA/1399-1671TSAQKDGVDWIVLIKQQS...........................YSIANTK------------RKYKPLKIKNL----S
C5FVW9_ARTOC/1335-1588TRYVDDNYSWVVIVKQ...................................D------------SIERGLRVKSV----Q
GCN2_SCHPO/1326-1576THYRSEGINWVLVVRQKN.................................T------------QMEHSVKARNI----L
C4YBZ4_CLAL4/1388-1652NRAIEDGCDWIVQLKQKNTG.........................SGRRSKK------------SSFKPIRVKSI----E
C4YTJ1_CANAW/1463-1762QNGNSEGAIWIVIIRSLPTTIGNSFSSLNGGSGGSSSTTTTSTSIRRSKKSG------------SGFKPLKLRNI----I
C5E0Y7_ZYGRC/1387-1656SGAQKDGVDWIILIKQQT...........................YTLPNHK------------RKYKPLRVKNL----Q
Q2GWD3_CHAGB/1350-1553....NHG............................................D------------NQ...LKIKTM----G
A7E5P7_SCLS1/1343-1585SKYRDDSYSWIVIIKQ...................................D------------SV...VRCKTT----G
Q6CEK5_YARLI/1380-1640ARAQSEGINWIIIVKQHS............................GYSSAA------------AAYKPLRVKNV----A
B6HND6_PENCW/1330-1577AKYKDSNHRCIVIAKQ...................................D------------SKERGFKVRNL----M
B6JXM9_SCHJY/1324-1574TRFRNDGINWVLVVRQKN.................................T------------AMQNSIKVRNI----S
O74297_NEUCS/1372-1645SKYRDESYLWVVIIKQ...................................D------------NM...LKIKSM----A
C4R5R6_PICPG/1424-1692NRAQLDGATWVILIKQQQQEPNQ......................YGTINTK------------KRYKPLRLKNF----E
Q75F11_ASHGO/1426-1697SAAQIDGCDWIILIKQQN...........................FSASSHK------------RKYKPLRIRKL----D
A5E786_LODEL/1546-1804HQALDAGAQLIVLIRAGEI..........................HKKSKKG------------SSYKPLRVKNL----C

PF03129

SYG_YEAST/570-662ARNDELGTPFGVTIDFES---------------------------------A..K.........D..HSVTLRER....D
SYP_ZYMMO/346-439ATMDLIGLPWQVVIGPKG---------------------------------A..E.........K..GVVELKNR....A
SYH_BORBU/349-448EYALSKEIRFLVFVGQEE---------------------------------Y..K.........E..NKMKVRDL....T
SYTM_SCHPO/361-469RESRLLNYNYEIVIGEDE---------------------------------V..D.........K..EILSVSSRH.NHN
DPOG2_MOUSE/356-452SKYDEMSVLFSVLVTETT---------------------------------L..E.........N..GLIQLRSR....D
SYG_HUMAN/615-709ARTDEIGVAFGVTIDFDT---------------------------------V..N.........KTPHTATLRDR....D
SYEP_HUMAN/1303-1404NHWELKGVPIRLEVGPRD---------------------------------M..K.........S..CQFVAVRR....D
SYT2_BACSU/542-632RESQVQKIPYVLVLGDHE---------------------------------E..Q.........E..NAVNVRRF....G
SYT2_AERPE/318-408REAGRSWASLVIVVGKRE---------------------------------E..E.........T..GTVVVRRR...WE
SYT1_AERPE/340-442HIESTAKPAVNVFIGAKE---------------------------------V..R.........E..KVLDVRVFDLESM
SYH_AERPE/342-432RKASRLGIPVLAFVGAKE---------------------------------A............E.GGFLTLYSA....A
SYH_ORYSJ/696-784KYATQSGIPWMVLVGESE---------------------------------I..S.........S..GKVKLKNL....A
SYH_HAEIN/329-422KRADKSGATLALVIGESE---------------------------------V..Q.........N..KQVVVKHL....Q
SYH_STREQ/330-420KSADTFKAKVVITLGESE---------------------------------I..K.........A..GQAVLKHN....Q
SYP_ARCFU/285-379YKWELKGVPIRFEIGPRD---------------------------------A..E.........K..GVAVVSFR....D
SYP_SYNY3/503-595KDSELIGIPYRVVTG.KS---------------------------------L..K.........Q..GQLEVVKR....A
SYG_THET8/401-503RRHDEVGTPFAVTVDYDT---------------------------------I..GQSKDGTTRLK..DTVTVRDR....D
SYTM_ARATH/614-704REAQLAQYNYILVVGETE---------------------------------A..A.........T..GQVSVRVR....D
SYT_METTH/495-584RNAAQDWVPYVVVIGDSE---------------------------------M..E............GKLTVNVR....E
SYH_METTH/334-424SHADNLGARFAVLTGERE---------------------------------I............Q.DGKVTVKDM....E
SYH_PYRHO/339-428DYANRVGAKLVIIVGKRD---------------------------------V............E.RGVVTIRDM....E
SYH_PYRAB/339-428DYANRIGVRLSIIVGKRD---------------------------------L............E.RGVVTIRDL....E
SYP_SULSO/290-388YIWEIKGVPIRLEIGPRE---------------------------------L..I.........S..GTVFIKRR....D
SYP_HELPY/480-573RDFELIGERLALIIGKQT---------------------------------L..E.........S..KEFECIKR....A
SYG_MYCGE/355-444RKADAIGIKYAVTFDFES---------------------------------L..E.........D..NAVTIRDR....D
SYT_METJA/503-598RNAGKEWVPYVVVIGDEE---------------------------------M..E.........S..DKLTVTIR....E
SYP_METJA/280-374NDWEIKGVPLRIEVGPKD---------------------------------I..E.........N..KKITLFRR....D
SYG_ARCFU/462-553RRFDEIGTPFCVTVDHQT---------------------------------F..E.........D..ETVTIRDR....D
SYTC_SCHPO/599-693RNAQLAQYNFIFVVGAEE---------------------------------E..S.........T..NSVNVRNR....D
YHY6_SCHPO/500-600SHWEMKGVPLRLEYGPND---------------------------------A..K.........K..NQVTAVRR....D
SYH_SYNY3/327-417KRADKSGAIACLVLGDGE---------------------------------I............A.TGTVQLKWL....A
SYG2_YEAST/505-597ARNDELGTPFGITIDFET---------------------------------I..K.........D..QTVTLRER....N
SYG_METJA/483-574MRADEIGVPFCITVDGQT---------------------------------L..E.........D..RTVTVRER....N
SYP_CHLPN/475-566KDSDLIGIPYKLILGKSY---------------------------------Q..S.........S..GIFEIESR.....
Q22620_CAEEL/378-475NHWELKGVPIRFEVGPND---------------------------------L..A.........K..NQVTAVIR....H
SYH_PORPU/327-417KQAHKKRAIACLILGDNE---------------------------------I............Q.QETITIKWM....Y
SYG_AERPE/475-567ARADEIGVPAAVTIDYQT---------------------------------L..E.........D..GTVTLRDR....D
SYG_DEIRA/402-504RRHDEVGTPYCVTVDFDT---------------------------------V..GLGENTDESLK..DTVTVRDR....D
SYTC_YEAST/629-723RNGQMLKYNFIFIVGEQE---------------------------------M..N.........E..KSVNIRNR....D
SYH_THEMA/326-416KHASRMGSRYAVIIGDEE---------------------------------L............E.KGIVILRDL....E
SYG_MYCPN/355-444RKADAIGTKFAITFDFES---------------------------------L..E.........D..QAVTIRER....D
Q9VZY9_DROME/330-430LEAKRLGHPLTIVVGAKS---------------------------------A............R.LDSPKLEVH....T
SYP_BACSU/472-564ADSDLIGLPIRITVGKRA---------------------------------...D.........E..GIVEVKIR....Q
SYP_MYCGE/302-392LKGEIEGIPLQMIVD...---------------------------------.............N.EKTINIFNR....L
SYH_HELPJ/347-438SYANHKGHEFVAVIGEEE---------------------------------F............K.SETLSLKNM....H
Q9X6E6_PSEFL/61-151REHTLLKVPYLLVIGDRE---------------------------------V..E.........M..QTVAVRTR....E
SYP_BORBU/287-387SSAEFKGIPIRLEVGIND---------------------------------V..L.........L..NSVTISRR....D
O94025_CANAX/346-450KDAIQKGYSYLIMIGDKD---------------------------------I............A.NGTFAVRSR....D
SYP_MYCTU/487-579KDAELLGMPWIVVVGRGW---------------------------------...A.........D..GVVELRDR....F
SYP_HAEIN/474-568ADMELIGVPHMVVIGEKN---------------------------------L..D.........N..GEIEYKNR....R
SYT_SYNY3/506-596RNAEKQKIPVMAVIGAKE---------------------------------V..E.........A..NALNIRTR....A
SYG_BOMMO/559-652ARTDELGVPYAVTVDFDT---------------------------------I.KE.........P..HTVTLRER....D
SYP_TREPA/517-607ADADLIGIPLRVVLSAKT---------------------------------L..P.........R....VECTTR....C
Q9SBK5_WHEAT/340-428KYATQTGIPWMVLVGESE---------------------------------L............R.DGKVKLKDI....R
SYG_SCHPO/538-630ARNDELGTPFGLTVDFET---------------------------------L..Q.........N..ETITLRER....D
Q9VJV8_DROME/256-358LETDMLGIPYTLVINEQT---------------------------------L............R.NGLMQLRSR....D
SYT_MYCGE/471-563RQAIIEKIPLQLIVGDKE---------------------------------I..E.........N.LEKLTCRGF....K
SYT_TREPA/495-584RTAQTQKVPYLLIVGERE---------------------------------L..R.........A..QQVAVRPR....T
SYT_ARCFU/502-597RDAQTEWIPYIAVVGEKE---------------------------------I..E.........S..GKLAVTVR....A
SYT_DEIRA/551-644RDAELHKIPVMLIVGDKE---------------------------------Q..E.........A..REVSVRER....T
SYT_CHLTR/535-625RNAQNMQVNYMITIGDKE---------------------------------L..E.........T..HLLAVRTR....D
SYH_THET8/330-420EEALKRGAAFAGFLGEDE---------------------------------L............R.AGEVTLKRL....A
SYHC_TAKRU/425-516QHCEESGIPLVAILGEQE---------------------------------L............K.NGVVKLRNV....A
SYP_DEIRA/304-400NDWELKGVPVRIELGPRD---------------------------------L..E.........S..GVLVVKNR....H
SYGM1_ARATH/617-705ARTDELGVPFAITVDSD.---------------------------------................TSVTIRER....D
SYG_MYCTU/369-459RRQDEVGTPFCVTVDFDS---------------------------------L..Q.........D..NAVTVRER....D
SYH_SCHPO/434-534DAADKFDVPFAVILGQDE---------------------------------F..A.........K..GSVRIKQMGLKEN
SYP_ECOLI/475-569ADMELIGIPHTIVLGDRN---------------------------------L..D.........N..DDIEYKYR....R
Q9VUK8_DROME/648-741ARTDEIAIPYGITVDFDT---------------------------------L.KE.........P..HTVTLRDR....N
SYHM_HUMAN/411-502HYCESTGIPLVVIIGEQE---------------------------------L............K.EGVIKIRSV....A
SYG_PYRHO/476-567MRYDEIGTPYCVTVDNQT---------------------------------P..E.........D..GTVTIRDR....D
DPOG2_XENLA/360-456TKYDKMGVLFTVLVSEST---------------------------------L..E.........N..GLLQVRSR....D
SYT_HELPJ/516-606RLAEKQKIPMILVLGNEE---------------------------------V..E.........T..EILSIRDR....E
SYT_BUCAP/541-631REHTLRQIPYILICGEKE---------------------------------I..K.........S..KKISVRTR....N
SYHC_MESAU/409-500QYCEETGIPLVAIIGEQE---------------------------------L............K.DGVIKLRSV....A
SYH_BACSU/331-421KTADRLKARFIAILGEDE---------------------------------L............A.QNKINVKDA....Q
SYT_THET8/559-649RDAEVQKVPYILVVGERE---------------------------------K..A.........E..GAVSVRRR....K
SYP_AQUAE/472-564ADADLVGFPYRIVVGKKV---------------------------------...K.........E..GKVEVQSR....H
SYT_CHLPN/535-625RNAQNMQVNYMITLGDHE---------------------------------I..N.........E..NVLAVRTR....D
SYH_CHLPN/334-424KAASTEQVSFVCLIGERE---------------------------------L............I.SQQLVIKNM....S
SYH_CAEEL/426-517QYAEERRIPLAIVIGEQE---------------------------------L..K.........D..GVVKLRNV....V
SYPM_SCHPO/330-423RDAELIGYPFVIVVGSRF---------------------------------Q............E.EGICEIIVR....S
SYT_MYCLE/592-682VRHTNQKVPFMLLAGDRD---------------------------------V..R.........T..GSVSFRFG....D
SYT1_BACSU/549-640REAQMQKIPYMLVVGDQE---------------------------------A..E.........N..GAVNVRKY....G
SYT_RICPR/540-630REFSNQKIPIIAVIGKQE---------------------------------Q..A.........N..KQVTIRKL....G
Q9VKB0_DROME/645-736RNAQLAQFNFILVVGDKE---------------------------------R..S.........S..NTVNVRTR....D
SYP_RICPR/336-429ATHDLIGSPYQIIIGPKK---------------------------------A..A.........N..NIVELKDR....K
SYT_AQUAE/543-633RDAELKKIPVILVVGDRE---------------------------------A..Q.........N..NTVSVRTK....K
SYTC_CAEEL/619-710RKAQLAQFNFILVIGAKE---------------------------------K..E.........N..GTVNVRTR....D
SYT_BORBU/485-575REYQAKKIPYMFIIGERE---------------------------------A..T.........E..ERISIRTR....T
SYTM_YEAST/349-457KSAILKNYSYLIIVGDEE---------------------------------V............Q.LQKYNIRER....D
SYP_MYCLE/290-387NEWELRGVPIRLELGPRD---------------------------------L..E.........A.GTTVMVRRI....G
SYP_THEMA/470-562KDADLIGFPIRINVGRSL---------------------------------...K.........E..GVVELKKR....Y
SYT_HAEIN/541-631REHTLRRVPYMLVCGDKE---------------------------------I..A.........E..GKVAVRTR....K
SYP_MYCPN/302-392GQGEVNGIPFQLIVD...---------------------------------.............N.PQTVNIFNR....L
O45869_CAEEL/324-427HDANRLGIPFILVIANET---------------------------------E...............RSLATQKPVIEVF
Q9VWT1_DROME/426-517QHCEEHQIPLVVVLGDAE---------------------------------L............A.QGLVKLREV....T
YHI0_YEAST/475-576SQYELKGIPIRIELGPKD---------------------------------I..E.........K..NQVVVVRR....N
SYH_MYCLE/333-423RAAGRSGARIALIVDDCA---------------------------------I............K.ADGVGVRDL....A
SYT_MYCPN/471-563RTAIVNKIPLQIIVGDKE---------------------------------M..Q.........D.LTRITCRGF....K
SYP_METTH/296-391YEWEMRGVPLRVEIGPRD---------------------------------L..E.........K..GAAVISRR....D
SYH_YEAST/427-527DAAEKAGCHIAVILGKEE---------------------------------Y..L.........E..GKLRVKRLGQEFA
SYT_PYRAB/512-602RRAEKEWIPYIVVVGARE---------------------------------K..E.........N..GTITVRRR....E
SYG_BORBU/345-435RRQDEIGTPYCVTIDYNT---------------------------------I..E.........D..ETVTVRER....N
SYTC_HUMAN/620-711RNAQLAQYNFILVVGEKE---------------------------------K..I.........S..GTVNIRTR....D
SYPC_CANAX/439-539KQSDLLGIPLSIILGNQY---------------------------------................PIIEIEVR.....
SYG_METTH/472-563ARADEIGVPFAVTVDHET---------------------------------L..E.........D..GTVTLRNR....D
SYP_AERPE/292-390YYWEAKGVPIRVEIGLRE---------------------------------A..E.........Q..DTLTIARR....D
SYP_CHLTR/475-566KDSDLLGIPYKLIIGKSF---------------------------------Q..S.........T..GLLEIESR.....
SYT_SHIFL/541-631REHTLRRVPYMLVCGDKE---------------------------------V..E.........S..GKVAVRTR....R
SYT_THEMA/538-628RQAQTQKIPYMIIIGDKE---------------------------------L..E.........S..GKISVRTR....T
SYG_TREPA/365-455RRQDEVGTPFCVTVDYQS---------------------------------K..E.........D..DTVTVRLR....D
SYG_CAEEL/625-719ARTDEIGIPFGITVDFDS---------------------------------LKTT.........P..FTVTIRHA....E
SYP_PYRHO/288-383YDWELKGVPVRVEVGPID---------------------------------V..Q.........N..STVVLARR....D
SYH_MYCTU/330-420RAAARSGARVALVAGDRD---------------------------------I............E.AGTVAVKDL....T
SYEP_DROME/1503-1604NHWELKGVPLRLEVGPKD---------------------------------L..K.........A..QQLVAVRR....D

PF12745

B2VUI6_PYRTR/1224-1477KKE..DT--------DMR.SAELLNYLRNEF.....RD.RE..EREETAA..RLIKAITQPTNTANT.............
B2B7B1_PODAN/1374-1619RKDASDA--------DIS.ATDLLNWLKSEI.....RE.RD..SRVLAKTRSMPTAAHVDSANAIEG.............
Q2U916_ASPOR/1345-1593PKE..EF--------DLR.SSELIPWLRNEI.....RA.RN..QREGAVD.FRQSRLPSQPDPGIDG.............
A6ZYN2_YEAS7/1387-1658TNV..DI--------DLD.LDEFLTLYQQET.....GN.KSLINDSLTLGDKA...DEFKRWDENSS........AGSSQ
Q6FSE4_CANGA/1377-1647SDI..DV--------DVT.LEEFLVLYRQET.....TR.KLGVENQLLASEKY...EETKRWDDGSS........AGSSQ
Q0UGA3_PHANO/1143-1398KKE..DT--------DLR.TGDLLNYLRNEL.....RD.RE..AREGSAAQRLTKAVPTASSSAPAS.............
B5RUH6_DEBHA/1464-1741TNK..VS--------DIE.YEELVQFLQSEI...EERN.NDDEFDNLAGSGSTESTREGLKSDHNED........SESDK
C5MFL8_CANTT/1436-1709NGK..EI--------DLE.FDELVTYLVGEL.GESE.Q.EDDQDEAN......PVPSSAANNINGNT........TNNSE
Q5BB34_EMENI/1298-1547PKE..EL--------DIR.GSELIPWLRSEI.....RA.RN..QREGAPENPRFARLPSQSEVNTPA.............
C1GPN0_PARBA/1276-1530TKE..EF--------EVR.SSELAGWLRGEI.....GA.RN..QREHQTGTGKPLKHLNHQECSFST.............
C5DM71_LACTC/1436-1709SEL..DV--------DLD.FDEFLAIYQQEA.....ES.KFISSDFPQILESNPVSPDDKRWEDFTS........TEESQ
A7TGA0_VANPO/1397-1666TNT..DI--------DMD.LDEFFTIYQHDT.....EG.IPFVKDKLSSIEL....DDSKHWDDISS........ASSSQ
B6QG71_PENMQ/1331-1582KKE..EI--------DVR.ASDLVPWLRAEI.....RA.QH..HREILVDNPKVLRNPSQPDTGGPS.............
A5DLN9_PICGU/1351-1611SEK..DT--------DLE.YEELVPFLAEEI........NGSNEDESERHDMNY.....................TDSSL
A3LWI3_PICST/1404-1670PNK..EV--------DLG.YDELVDYLESEI........EERNTEFEVECGDNSNDHGKAPEDNNNH........MESDT
Q6CTQ8_KLULA/1399-1671TNF..DA--------DMD.IDEFLSLYEDSF......N.REANNDLPMKDDFFSEHDDRNKWDDNSS........QERSQ
C5FVW9_ARTOC/1335-1588RKE..DF--------DVR.SSDLVPWLRNEM.....RA.RKKFKHDRPPESPKLIKHPSQSEAILSS.............
GCN2_SCHPO/1326-1576KNE..DD--------EIR.FDEVGMWLLGEI.....NE.R...KRNESMLQSKRILDSAQQDVAKFV.............
C4YBZ4_CLAL4/1388-1652ANK..DT--------DLD.YDELLHFLLNEI........EERNAEANEGSSYIDRKEDL................SQTND
C4YTJ1_CANAW/1463-1762TGK..DI--------DLD.YDEVIDYLVTELLEDSEHE.ENDQDNGTMTNSTTLLTSSSL.....SS........KTNQE
C5E0Y7_ZYGRC/1387-1656TAL..DI--------DLD.LDEFLHLYHQER.....QP.KHLNDKMLGPVDAV...EDSKKVDDGSS........AGSSR
Q2GWD3_CHAGB/1350-1553RKDASDA--------DIS.AKELLNWLKSEI.....RD.RD..SRSGTRLRTTGLPHSDSGGALPTT.............
A7E5P7_SCLS1/1343-1585RKDIPDS--------DIP.STQLVSWLRGEM.....RE.RD..QREGTYNRAKLPRHHSQPDTGPSE.............
Q6CEK5_YARLI/1380-1640RND..DT--------DID.RDGIVGHMMTEL.....NE.RGGSYSNTNALAPPSLSVPHDPSPPASI........VDTSD
B6HND6_PENCW/1330-1577RKE..EF--------DIR.TAELVMWLRSEV.....QA.R...HREGTVD.PRQSRQMSQQEALGFH.............
B6JXM9_SCHJY/1324-1574KGE..DY--------EIR.TEEIGLWMLSEI.....NE.R...KRLKNTKQTTELSRTSSQEAFSQM.............
O74297_NEUCS/1372-1645RKDAPDA--------DIP.AKELLNWLKAEM.....RENRDALMRGTGSGSISSGAAIKFRGGGGSGGGGGLSSFGTNNS
C4R5R6_PICPG/1424-1692KQT..DT--------DLD.FEEVIPYIKNEM.....RE.RNEVEETTIAPATLPLRSLSEESQLRDL........STAEN
Q75F11_ASHGO/1426-1697SEI..DV--------DMD.LDEFIQLYQQET......G.IRSTAEILPSSENSQIEEGTSKWEEFSS........ADGSQ
A5E786_LODEL/1546-1804TGK..ET--------NWDNYDDVVQHLHEEI........HGDQFDEESSVNKQD.....................DDFDD

PF03129

SYG_YEAST/570-662ST.--KQ.....V..RGS-VENVIKA.IRDI-------------------------------------------------
SYP_ZYMMO/346-439NG.--EK.....Q..TIS-VENAFNL.LTAG-------------------------------------------------
SYH_BORBU/349-448KK.--EE.....L..LLS-FEESINL.IKCN-------------------------------------------------
SYTM_SCHPO/361-469SR.--DT.....R..KMT-IQQLKKE.FIEN-------------------------------------------------
DPOG2_MOUSE/356-452TT.--MK.....E..MMH-ISKLRDF.LVKY-------------------------------------------------
SYG_HUMAN/615-709SM.--RQ.....I..RAE-ISELPSI.VQDL-------------------------------------------------
SYEP_HUMAN/1303-1404TG.--EK.....L..TVA-ENEAETK.LQAI-------------------------------------------------
SYT2_BACSU/542-632HQ.--QN.....E..HVP-FQTFKDK.LVKQ-------------------------------------------------
SYT2_AERPE/318-408PG.--KQ.....E..VLT-LDELSSE.AKKL-------------------------------------------------
SYT1_AERPE/340-442KR.--RR.....L..AIA-YGDAADA.VENL-------------------------------------------------
SYH_AERPE/342-432KG.--ER.....V..AVP-LGEAVKA.VERL-------------------------------------------------
SYH_ORYSJ/696-784AS.--QE.....E..EVD-RTEFAQV.LKQK-------------------------------------------------
SYH_HAEIN/329-422GGT--DQ.....Q..TLD-LVNIIDY.LQTQ-------------------------------------------------
SYH_STREQ/330-420TR.--QE.....M..TVS-FDQIQTD.FASI-------------------------------------------------
SYP_ARCFU/285-379EK.--RK.....F..EVP-LDEVDEGKVLEW-------------------------------------------------
SYP_SYNY3/503-595DK.--SV.....Q..NLA-IAAVVPT.LTAW-------------------------------------------------
SYG_THET8/401-503TM.--EQ.....I..RLH-VDELEGF.LRER-------------------------------------------------
SYTM_ARATH/614-704NA.--AH.....S..VKS-IEDLLEE.FKAK-------------------------------------------------
SYT_METTH/495-584TG.--EK.....L..QMG-LDELIER.IRAE-------------------------------------------------
SYH_METTH/334-424RN.--SQ.....E..TLP-RDEMVDK.IKGR-------------------------------------------------
SYH_PYRHO/339-428SG.--EQ.....Y..NVS-LNEIVDK.VKNL-------------------------------------------------
SYH_PYRAB/339-428SG.--NQ.....V..EVP-VDNVVTK.VREL-------------------------------------------------
SYP_SULSO/290-388NF.--KS.....Y..TVR-KEEAINK.IKEL-------------------------------------------------
SYP_HELPY/480-573NL.--EK.....Q..TIK-DIELEEK.ILEM-------------------------------------------------
SYG_MYCGE/355-444TL.--VQ.....Q..RIA-IKELPQW.FMKN-------------------------------------------------
SYT_METJA/503-598KS.--TLKKPYKE..KMT-LDELIER.IKKE-------------------------------------------------
SYP_METJA/280-374TM.--EK.....F..QVD-ETQLMEV.VEKT-------------------------------------------------
SYG_ARCFU/462-553TT.--AQ.....V..RVK-LGELPSI.LKEL-------------------------------------------------
SYTC_SCHPO/599-693DP.--KKQS.KGS..TVA-VEEVVKK.LLKL-------------------------------------------------
YHY6_SCHPO/500-600TF.--EK.....I..PVP-LNNLEKG.VSDL-------------------------------------------------
SYH_SYNY3/327-417DK.--AQ.....E..TLQ-LQDLMGN.ITEL-------------------------------------------------
SYG2_YEAST/505-597SM.--RQ.....V..RGT-ITDVIST.IDKM-------------------------------------------------
SYG_METJA/483-574TR.--EQ.....V..RVK-IDELVDY.LKER-------------------------------------------------
SYP_CHLPN/475-566SG.--EK.....Y..TVS-PEAFPTW.CQNH-------------------------------------------------
Q22620_CAEEL/378-475NG.--EK.....K..QLS-LEGLSKT.VKSL-------------------------------------------------
SYH_PORPU/327-417TQ.--EQ.....E..NMS-IIEFKNK.ISYL-------------------------------------------------
SYG_AERPE/475-567TW.--RQ.....V..RIG-ADEVVDK.LRRF-------------------------------------------------
SYG_DEIRA/402-504TL.--AQ.....E..RVK-ISELAGW.IQAK-------------------------------------------------
SYTC_YEAST/629-723VM.--EQQG.KNA..TVS-VEEVLKQ.LRNL-------------------------------------------------
SYH_THEMA/326-416TG.--DQ.....V..EID-RDFAADY.IAER-------------------------------------------------
SYG_MYCPN/355-444SL.--KQ.....V..RVP-IKELKAW.FAQH-------------------------------------------------
Q9VZY9_DROME/330-430SKG--ET.....Y..ELD-FSETLKL.VAEH-------------------------------------------------
SYP_BACSU/472-564TG.--ES.....T..EIS-VDELSAF.ISKQ-------------------------------------------------
SYP_MYCGE/302-392TR.--LK.....T..SLT-FANLQTE.FVNL-------------------------------------------------
SYH_HELPJ/347-438SGM--QL.....N..CLS-FLKALEI.IGEN-------------------------------------------------
Q9X6E6_PSEFL/61-151GE.--DL.....G..SMP-VAQFSAF.LAQA-------------------------------------------------
SYP_BORBU/287-387KD.--RK.....FKYQIS-LDSLISK.VKVE-------------------------------------------------
O94025_CANAX/346-450DRK--IK........NMT-SDEIYKM.FIAL-------------------------------------------------
SYP_MYCTU/487-579SG.--QT.....R..ELV-AGASLATDIAAA-------------------------------------------------
SYP_HAEIN/474-568TG.--EK.....E..MIS-KDKLLSV.LNEK-------------------------------------------------
SYT_SYNY3/506-596SG.--EL.....G..EIP-VTEVLEK.LQAT-------------------------------------------------
SYG_BOMMO/559-652SM.--RQ.....V..RLP-MADVPTV.VRDL-------------------------------------------------
SYP_TREPA/517-607GA.--HT.....Y..FFT-QEEASEH.IARL-------------------------------------------------
Q9SBK5_WHEAT/340-428ANQ--EE........EVP-RKDFVEV.LKQR-------------------------------------------------
SYG_SCHPO/538-630ST.--KQ.....V..RGS-QDEVIAA.LVSM-------------------------------------------------
Q9VJV8_DROME/256-358TR.--LA.....E..TIH-ISDVPDY.LLNI-------------------------------------------------
SYT_MYCGE/471-563GE.--KI.....T..RIS-FNNFVKR.VRRD-------------------------------------------------
SYT_TREPA/495-584GP.--Q......H..SMG-LSAFSTF.LLAK-------------------------------------------------
SYT_ARCFU/502-597ES.--TQKEQKRV..EMS-AEELAER.VRSE-------------------------------------------------
SYT_DEIRA/551-644GE.--GTK..ERK..GVK-FDELKAE.LLER-------------------------------------------------
SYT_CHLTR/535-625NR.--VL.....N..DIA-VEQFSHV.ILEE-------------------------------------------------
SYH_THET8/330-420TG.--EQ.....V..RLS-REEVPGYLLQAL-------------------------------------------------
SYHC_TAKRU/425-516TRD--EV........DIS-RADLIAE.IKKR-------------------------------------------------
SYP_DEIRA/304-400SE.--DK.....E..TLP-RAEAVSG.MSAR-------------------------------------------------
SYGM1_ARATH/617-705SK.--DQ.....V..RVT-LKEAASV.VSSV-------------------------------------------------
SYG_MYCTU/369-459AM.--TQ.....D..RVA-MSSVADY.LAVR-------------------------------------------------
SYH_SCHPO/434-534SD.--EG.....Q..LVP-REEMVSV.LKKL-------------------------------------------------
SYP_ECOLI/475-569NG.--EK.....Q..LIK-TGDIVEY.LVKQ-------------------------------------------------
Q9VUK8_DROME/648-741TM.--KQ.....V..RVG-LEEVVGV.VKDL-------------------------------------------------
SYHM_HUMAN/411-502SRE--EV........AIK-RENFVAE.IQKR-------------------------------------------------
SYG_PYRHO/476-567TR.--EQ.....I..RVK-IEELPRK.LKEL-------------------------------------------------
DPOG2_XENLA/360-456TT.--LK.....E..TIH-VSKVKDF.LVRY-------------------------------------------------
SYT_HELPJ/516-606KQ.--AQ.....Y..KMP-LKEFLNM.VESK-------------------------------------------------
SYT_BUCAP/541-631GY.--NL.....G..IID-IDCFIKK.LQKE-------------------------------------------------
SYHC_MESAU/409-500SRE--EV........DVR-REDLVEE.IRRR-------------------------------------------------
SYH_BACSU/331-421TG.--EQ.....I..EVA-LDEFIHV.MKAN-------------------------------------------------
SYT_THET8/559-649KG.--NL.....G..TMP-LAAFLEG.ALRE-------------------------------------------------
SYP_AQUAE/472-564TG.--EK.....W..DVE-IEKAIDF.VKEK-------------------------------------------------
SYT_CHLPN/535-625NR.--VI.....N..DVS-VERFLNT.ILEE-------------------------------------------------
SYH_CHLPN/334-424LRK--EF........FGT-KEEVEQR.LLYE-------------------------------------------------
SYH_CAEEL/426-517TRD--EQ........TIK-LDQLITA.VRDT-------------------------------------------------
SYPM_SCHPO/330-423SG.--ER.....Y..KLD-KDSLHQV.LLGN-------------------------------------------------
SYT_MYCLE/592-682RT.--QI.....N..GVA-RDSAVEA.IVCW-------------------------------------------------
SYT1_BACSU/549-640EQ.--NS.....E..TIS-LDEFVKK.AVAE-------------------------------------------------
SYT_RICPR/540-630TI.--EQ.....E..ILS-IEQLIAM.IKKE-------------------------------------------------
Q9VKB0_DROME/645-736NK.--VH.....G..EVS-VAELITK.LQKI-------------------------------------------------
SYP_RICPR/336-429TG.--VL.....E..DIE-VENIINY.IKNI-------------------------------------------------
SYT_AQUAE/543-633EG.--NL.....G..SME-LNKFLDW.IKEK-------------------------------------------------
SYTC_CAEEL/619-710NA.--VR.....G..EVA-LDKLISK.FRRF-------------------------------------------------
SYT_BORBU/485-575NE.--QI.....N..GMK-LDEALKF.ILFK-------------------------------------------------
SYTM_YEAST/349-457NRK--SF.....E..KLT-MSQIWEK.FIEL-------------------------------------------------
SYP_MYCLE/290-387EK.--AK.....Q..PIA-IAAAPTE.LPGI-------------------------------------------------
SYP_THEMA/470-562SK.--EL.....V..KVN-IKNGFGA.LLET-------------------------------------------------
SYT_HAEIN/541-631GA.--DL.....G..TFT-VEEFAEI.LKNQ-------------------------------------------------
SYP_MYCPN/302-392TR.--VK.....T..AYS-FEQLASR.FVEL-------------------------------------------------
O45869_CAEEL/324-427TTH--AKSAEPMSQGSMS-LDRFVTF.VQST-------------------------------------------------
Q9VWT1_DROME/426-517TRE--ET........NVK-LEDLAAE.IRRR-------------------------------------------------
YHI0_YEAST/475-576DS.--KK.....Y..VVS-FDELEAR.IPEI-------------------------------------------------
SYH_MYCLE/333-423TG.--EQ.....I..SVA-VDSVVAE.VISR-------------------------------------------------
SYT_MYCPN/471-563GE.--KV.....Q..KLY-WANFVKK.VRKD-------------------------------------------------
SYP_METTH/296-391TG.--EK.....V..TAD-LQGIEET.LREL-------------------------------------------------
SYH_YEAST/427-527DD.--DG.....E..LVS-AADIVPI.VQEK-------------------------------------------------
SYT_PYRAB/512-602DG.--KQ.....Y..ETR-IEELIKE.IKEK-------------------------------------------------
SYG_BORBU/345-435SM.--TQ.....K..RIF-INDLYSY.IKTE-------------------------------------------------
SYTC_HUMAN/620-711NK.--VH.....G..ERT-ISETIER.LQQL-------------------------------------------------
SYPC_CANAX/439-539.G.--NK.....K..NNN-NNSWLQSYTENK-------------------------------------------------
SYG_METTH/472-563DC.--SQ.....V..RVK-IEELVPT.LEKL-------------------------------------------------
SYP_AERPE/292-390TL.--EK.....T..EVP-LGEAGNR.IREL-------------------------------------------------
SYP_CHLTR/475-566SG.--EK.....C..NVS-PENLLDW.CSKN-------------------------------------------------
SYT_SHIFL/541-631GK.--DL.....G..SMD-VNEVIEK.LQQE-------------------------------------------------
SYT_THEMA/538-628GK.--EI.....K..DVD-PEHFVET.LRNE-------------------------------------------------
SYG_TREPA/365-455SM.--AQ.....R..RVS-RAFLAEF.LRTE-------------------------------------------------
SYG_CAEEL/625-719TM.--SQ.....I..RLE-VSELGRL.ISDL-------------------------------------------------
SYP_PYRHO/288-383KL.--EK.....I..TVK-REELVDK.VREL-------------------------------------------------
SYH_MYCTU/330-420TG.--EQ.....V..SVS-MDSVVAE.VISR-------------------------------------------------
SYEP_DROME/1503-1604TV.--EK.....I..TIP-LADVEKK.IPAL-------------------------------------------------

PF12745

B2VUI6_PYRTR/1224-1477.............PKSSVDVLIAQHRSK.KSNKWSIV.EA...AQSRSAELLSAFQ.....SAPIAAIES.KEEVMTLIK
B2B7B1_PODAN/1374-1619............DREQEVHILVAQTKSK.KFNRHAVV.EQ...AQTSASRLVKGFL.....EGPIAAIET.SDTVMDMIK
Q2U916_ASPOR/1345-1593............ERSSDVRILVPQHRSK.KTNRRNIV.EN...ALFRSREVIEDAL.....NGPIAAIDT.RDDLLEAIR
A6ZYN2_YEAS7/1387-1658EGDIDDVVAGSTNNQKVIYVPNMATRSK.KANKREKW.VYEDAARNSSNMILHNLS.....NAPIITVDALRDETLEIIS
Q6FSE4_CANGA/1377-1647EDDNDEPLNGNA.NRKITYVPNMATRSK.KASKREKW.VYEDGARHASQAIINDLS.....NAPIIAVDALRDEAMDIIA
Q0UGA3_PHANO/1143-1398.............AKNNVDVLMAQHRSK.KSNKWSIV.EA...AQTRSSELLSSFN.....SAPIAAIET.KEEVMNLIR
B5RUH6_DEBHA/1464-1741LSIRSGPIFTVDIDQKVVVVPNAAPRGR.KNNKKEKW.EIENDSKLASASLIKNVA.....NSPIITIDA.RDEVLDMIS
C5MFL8_CANTT/1436-1709QTELSGPVSTVDIDQKIIVVNNDAPRGR.K.NKRDKW.ESENDAKLCGQSAIKELS.....LGPVIVIDA.RDEILDMIS
Q5BB34_EMENI/1298-1547...........NDRSNDVRILVSQHRSK.KTNRRNIV.EQ...ALTRAREVVENAL.....NGPIAAIDT.RDDLLEAIR
C1GPN0_PARBA/1276-1530...........REKDPDVRILTALHRNK.KTNRRNII.ETVFLAIRESRNVMDRAL.....EGPIAAIDT.RDEVLEVLR
C5DM71_LACTC/1436-1709DGASDTSAIGKT.AQKVVYIPNMATRAK.KSNKKDKW.VYEDSARNASRAIISSLS.....TAPIFAVDAVRDETLEIIS
A7TGA0_VANPO/1397-1666GGDLDEGLNYLS.RQKIVYVPNQATRSK.KSNKRDKW.VYEEGARAASQNIVNSMM.....SAPIIAVDTLREETLQIIS
B6QG71_PENMQ/1331-1582...........GERGNDVRILVAQHRSK.KTNRRNII.ES...ALLRSRELVDKAL.....NGPIAAVDT.RDDLLDAIR
A5DLN9_PICGU/1351-1611DSMPTGPLFSTDINNRVIVVPNDAPRGR.KNNKREKW.ELENDSKMASANFIKTLS.....NAPVIDLDV.QDEVLDMIS
A3LWI3_PICST/1404-1670SHHELNPLFSVDIEQKAIVVPNEAPRGR.KNNKREKW.ELENDSKIASAQALKDLA.....TSPVITVDA.RDEVLDMIA
Q6CTQ8_KLULA/1399-1671DGESDTISAAG..PQKVIFIPNPATRAKGKPSKKDKW.VFEESARNASRQLIHSLS.....SVPIFAVDAIHDETLEIIS
C5FVW9_ARTOC/1335-1588...........KERDPEVRILTPLHKNK.KTNRRNIV.EF...ALRRSREVLDKGL.....DGPIAAIDI.RDDVLESIR
GCN2_SCHPO/1326-1576.............DTSQSNLDVQLISLKDVNDRKYKW.KHKQNAMNKVYDLVQSAIRESSEDAIALAVDC.DSEAMEKLR
C4YBZ4_CLAL4/1388-1652DSRIGEPLFNLDIDQRVIVVSNSAPRGR.KNNKKEKW.ELENDSKLAGADLMKSLA.....KAPIVTVDS.NDSTLDMIS
C4YTJ1_CANAW/1463-1762EELLNGPIDSVEIDQKIIVVKNDAPRGR.K.NKRDKW.ESENDAKLAGQQCIKNLS.....GGPVVVIDA.RDEILDMIS
C5E0Y7_ZYGRC/1387-1656ESDEDAVPSST..NQKVVFVPNPATRSK.KLSKREKW.VYEDGARAASNSIVNSLV.....SAPVVTVDALRDETLEMIS
Q2GWD3_CHAGB/1350-1553........ATAEHGPQEVHVLVAQTKSK.KFNRHAVV.EQ...AHASASRLVQTFL.....DGPVAAIET.SDAVVDLIR
A7E5P7_SCLS1/1343-1585.............HEQDVRVLFAGTKSK.KSNRRSIV.DQ...AQGRAATLVQSFL.....DGPIAAIET.TDHVMDLIR
Q6CEK5_YARLI/1380-1640IYA..........TNKVSVITNEWNKSK.SSKRTNQWNDEEERALRHTRSLVHDIQ.....EAPIFTIDV.KEDILDAIS
B6HND6_PENCW/1330-1577............ERANDVRILIPQHRSK.KTNRRNIV.ES...ALLSSREVAENAR.....NGPVAAIDT.RDEVLDAIR
B6JXM9_SCHJY/1324-1574.............EGQDLNLDVQLVSLKDVNDRKYKW.KHKMNAMNKVYDLVKNAISDCSTDAVALAVDC.STEVMHNLR
O74297_NEUCS/1372-1645ELNSGLFLGADGEREQEVHVLVAQTKSK.KFNRRQVV.EQ...AQMSAAKLLQSFL.....DGPIAAIET.SDSVMDMIR
C4R5R6_PICPG/1424-1692DSG..........QQKVILVPNDATRANRKSNRKDRW.AMEDASRNAAIQVTNEIS.....NCPIFPIDA.RDEVLDMLS
Q75F11_ASHGO/1426-1697DGGSGIAPIG...QQKVVHIPNNSARAKAKQNKKDKW.VFEESARNASKAIVHSLS.....SAPVFSVDAIRDEVLEIIS
A5E786_LODEL/1546-1804VGNLPEDQVTIDINQKVIVVNNEAPRGR.K.NKRDKW.EVEGKGRSAGTKTVQSLA.....NGPVLVFDI.RDETLDMIG

PF03129

SYG_YEAST/570-662--------------------------------------------------------------------------------
SYP_ZYMMO/346-439--------------------------------------------------------------------------------
SYH_BORBU/349-448--------------------------------------------------------------------------------
SYTM_SCHPO/361-469--------------------------------------------------------------------------------
DPOG2_MOUSE/356-452--------------------------------------------------------------------------------
SYG_HUMAN/615-709--------------------------------------------------------------------------------
SYEP_HUMAN/1303-1404--------------------------------------------------------------------------------
SYT2_BACSU/542-632--------------------------------------------------------------------------------
SYT2_AERPE/318-408--------------------------------------------------------------------------------
SYT1_AERPE/340-442--------------------------------------------------------------------------------
SYH_AERPE/342-432--------------------------------------------------------------------------------
SYH_ORYSJ/696-784--------------------------------------------------------------------------------
SYH_HAEIN/329-422--------------------------------------------------------------------------------
SYH_STREQ/330-420--------------------------------------------------------------------------------
SYP_ARCFU/285-379--------------------------------------------------------------------------------
SYP_SYNY3/503-595--------------------------------------------------------------------------------
SYG_THET8/401-503--------------------------------------------------------------------------------
SYTM_ARATH/614-704--------------------------------------------------------------------------------
SYT_METTH/495-584--------------------------------------------------------------------------------
SYH_METTH/334-424--------------------------------------------------------------------------------
SYH_PYRHO/339-428--------------------------------------------------------------------------------
SYH_PYRAB/339-428--------------------------------------------------------------------------------
SYP_SULSO/290-388--------------------------------------------------------------------------------
SYP_HELPY/480-573--------------------------------------------------------------------------------
SYG_MYCGE/355-444--------------------------------------------------------------------------------
SYT_METJA/503-598--------------------------------------------------------------------------------
SYP_METJA/280-374--------------------------------------------------------------------------------
SYG_ARCFU/462-553--------------------------------------------------------------------------------
SYTC_SCHPO/599-693--------------------------------------------------------------------------------
YHY6_SCHPO/500-600--------------------------------------------------------------------------------
SYH_SYNY3/327-417--------------------------------------------------------------------------------
SYG2_YEAST/505-597--------------------------------------------------------------------------------
SYG_METJA/483-574--------------------------------------------------------------------------------
SYP_CHLPN/475-566--------------------------------------------------------------------------------
Q22620_CAEEL/378-475--------------------------------------------------------------------------------
SYH_PORPU/327-417--------------------------------------------------------------------------------
SYG_AERPE/475-567--------------------------------------------------------------------------------
SYG_DEIRA/402-504--------------------------------------------------------------------------------
SYTC_YEAST/629-723--------------------------------------------------------------------------------
SYH_THEMA/326-416--------------------------------------------------------------------------------
SYG_MYCPN/355-444--------------------------------------------------------------------------------
Q9VZY9_DROME/330-430--------------------------------------------------------------------------------
SYP_BACSU/472-564--------------------------------------------------------------------------------
SYP_MYCGE/302-392--------------------------------------------------------------------------------
SYH_HELPJ/347-438--------------------------------------------------------------------------------
Q9X6E6_PSEFL/61-151--------------------------------------------------------------------------------
SYP_BORBU/287-387--------------------------------------------------------------------------------
O94025_CANAX/346-450--------------------------------------------------------------------------------
SYP_MYCTU/487-579--------------------------------------------------------------------------------
SYP_HAEIN/474-568--------------------------------------------------------------------------------
SYT_SYNY3/506-596--------------------------------------------------------------------------------
SYG_BOMMO/559-652--------------------------------------------------------------------------------
SYP_TREPA/517-607--------------------------------------------------------------------------------
Q9SBK5_WHEAT/340-428--------------------------------------------------------------------------------
SYG_SCHPO/538-630--------------------------------------------------------------------------------
Q9VJV8_DROME/256-358--------------------------------------------------------------------------------
SYT_MYCGE/471-563--------------------------------------------------------------------------------
SYT_TREPA/495-584--------------------------------------------------------------------------------
SYT_ARCFU/502-597--------------------------------------------------------------------------------
SYT_DEIRA/551-644--------------------------------------------------------------------------------
SYT_CHLTR/535-625--------------------------------------------------------------------------------
SYH_THET8/330-420--------------------------------------------------------------------------------
SYHC_TAKRU/425-516--------------------------------------------------------------------------------
SYP_DEIRA/304-400--------------------------------------------------------------------------------
SYGM1_ARATH/617-705--------------------------------------------------------------------------------
SYG_MYCTU/369-459--------------------------------------------------------------------------------
SYH_SCHPO/434-534--------------------------------------------------------------------------------
SYP_ECOLI/475-569--------------------------------------------------------------------------------
Q9VUK8_DROME/648-741--------------------------------------------------------------------------------
SYHM_HUMAN/411-502--------------------------------------------------------------------------------
SYG_PYRHO/476-567--------------------------------------------------------------------------------
DPOG2_XENLA/360-456--------------------------------------------------------------------------------
SYT_HELPJ/516-606--------------------------------------------------------------------------------
SYT_BUCAP/541-631--------------------------------------------------------------------------------
SYHC_MESAU/409-500--------------------------------------------------------------------------------
SYH_BACSU/331-421--------------------------------------------------------------------------------
SYT_THET8/559-649--------------------------------------------------------------------------------
SYP_AQUAE/472-564--------------------------------------------------------------------------------
SYT_CHLPN/535-625--------------------------------------------------------------------------------
SYH_CHLPN/334-424--------------------------------------------------------------------------------
SYH_CAEEL/426-517--------------------------------------------------------------------------------
SYPM_SCHPO/330-423--------------------------------------------------------------------------------
SYT_MYCLE/592-682--------------------------------------------------------------------------------
SYT1_BACSU/549-640--------------------------------------------------------------------------------
SYT_RICPR/540-630--------------------------------------------------------------------------------
Q9VKB0_DROME/645-736--------------------------------------------------------------------------------
SYP_RICPR/336-429--------------------------------------------------------------------------------
SYT_AQUAE/543-633--------------------------------------------------------------------------------
SYTC_CAEEL/619-710--------------------------------------------------------------------------------
SYT_BORBU/485-575--------------------------------------------------------------------------------
SYTM_YEAST/349-457--------------------------------------------------------------------------------
SYP_MYCLE/290-387--------------------------------------------------------------------------------
SYP_THEMA/470-562--------------------------------------------------------------------------------
SYT_HAEIN/541-631--------------------------------------------------------------------------------
SYP_MYCPN/302-392--------------------------------------------------------------------------------
O45869_CAEEL/324-427--------------------------------------------------------------------------------
Q9VWT1_DROME/426-517--------------------------------------------------------------------------------
YHI0_YEAST/475-576--------------------------------------------------------------------------------
SYH_MYCLE/333-423--------------------------------------------------------------------------------
SYT_MYCPN/471-563--------------------------------------------------------------------------------
SYP_METTH/296-391--------------------------------------------------------------------------------
SYH_YEAST/427-527--------------------------------------------------------------------------------
SYT_PYRAB/512-602--------------------------------------------------------------------------------
SYG_BORBU/345-435--------------------------------------------------------------------------------
SYTC_HUMAN/620-711--------------------------------------------------------------------------------
SYPC_CANAX/439-539--------------------------------------------------------------------------------
SYG_METTH/472-563--------------------------------------------------------------------------------
SYP_AERPE/292-390--------------------------------------------------------------------------------
SYP_CHLTR/475-566--------------------------------------------------------------------------------
SYT_SHIFL/541-631--------------------------------------------------------------------------------
SYT_THEMA/538-628--------------------------------------------------------------------------------
SYG_TREPA/365-455--------------------------------------------------------------------------------
SYG_CAEEL/625-719--------------------------------------------------------------------------------
SYP_PYRHO/288-383--------------------------------------------------------------------------------
SYH_MYCTU/330-420--------------------------------------------------------------------------------
SYEP_DROME/1503-1604--------------------------------------------------------------------------------

PF12745

B2VUI6_PYRTR/1224-1477ETRLS.DQESW.RSFIQR.MPLAERKYLQELHDLLLGYRSKWLESKGLEGGGEGAVGKAFVYNFRTGGCLLYDLE
B2B7B1_PODAN/1374-1619STNIA.DAESW.RKVEQN.VGTAEKKYVREIHEMLKGWRWEWETKK........GPGHAFVYNFRTGKCIYYDLG
Q2U916_ASPOR/1345-1593DTRLS.DPESW.RTVIQS.APLTERKYLSQVHELLVDLAHENH.VN...DGADNFS.NAFIYNYRTGSCVYYDLG
A6ZYN2_YEAS7/1387-1658ITSLA.QKEEWLRKVFGSGNNSTPRSFATSIYNNLS..KEAHKGNR...........WAILYCHKTGKSSVIDLQ
Q6FSE4_CANGA/1377-1647ITSLA.QKDEWLRKVFGSGNNSTPRSFATSIYNNLS..KEASKGHK...........WAILYCHKNNKSCVVDLQ
Q0UGA3_PHANO/1143-1398ETRLS.DPDSW.RQAIQK.MPIAERKYLQELHDLLLGYRARWNEMKNEEGRGSGEGGKAFVYNFRTGGCLLYDLE
B5RUH6_DEBHA/1464-1741ITSLN.QPDEWIRKVIFS.NNNLPKSFATNIYNTLK..KEASKGTR...........WVILHSSKTDKTCIIDLQ
C5MFL8_CANTT/1436-1709ITSIH.QQDEWIRKVVFT.TNNFPKSFAINIQNTLI..KEYNKGHK...........WCILVSSRTQHTTIVDLR
Q5BB34_EMENI/1298-1547DTRLS.DPDSW.RAVIQN.APLTERKYLQQVYDLLAEFASESH..G...DSADYPG.NAFIYNFRTGSCLYYDLG
C1GPN0_PARBA/1276-1530HTRLS.DADSW.RAVIQN.GPLTERKYMAQLHELLNDLANERRDPQ...DGKENYR.NAFIYNYRTGSCIYYDLS
C5DM71_LACTC/1436-1709VTSLA.QKDEWLRKIFGVGNNSAPRSFATSIYNNLA..KEASKGGK...........WAIVHCDKTGKSCVVDLQ
A7TGA0_VANPO/1397-1666ITSLA.QKDEWLRKVFGSSNNSAPRSFATSIYNNLS..KEASKGHR...........WAILYSNKTNQSCVVDLQ
B6QG71_PENMQ/1331-1582DTRLC.DPDSW.RAVIQN.APLTERKYLGQVHELLRDLASEYA.PG...GGKEHESNNAFIYNLRTGTCIYYDLG
A5DLN9_PICGU/1351-1611ITPLR.QQDEWVRKIVYF.SNNFPKSFGVNIYNTLK..KEANKGTQ...........WAMLHSSKTDKTCVIDLQ
A3LWI3_PICST/1404-1670ITSIS.QQEEWLRKVIFS...NLPRSYAINIHNSLS..KEASKGHR...........WAVIYSPKTQKTNIVDLQ
Q6CTQ8_KLULA/1399-1671ITSLS.QKDEWLRKVFGSAANSAPRSFATNIYNNLS..KEAAKGGR...........WAIVHCNKTGKSCVVDLQ
C5FVW9_ARTOC/1335-1588DTRLS.DPDSW.RNAIQS.APLVERKYLGNIHELLMDLASESV.AQ...DGTVKYS.NAFVYNYRTGNCIYYDLK
GCN2_SCHPO/1326-1576STTTL.DEESW.KRLIES.CPASQREYMQRLQKKLV..TLAEQDKK...........RVWICSFRTNEIYLYGLK
C4YBZ4_CLAL4/1388-1652SMSLNTSQEEWHKKLFFT.DNKLPRSYAAAIYETLN..KEAARGVR...........WALLHSPKTDKTTIVDLQ
C4YTJ1_CANAW/1463-1762ITSIH.QQDEWIRKVVYT.TNNFPKSFAMNIYNTLI..KEFNKGSI...........WCILVSSRTQHTTIVDLR
C5E0Y7_ZYGRC/1387-1656ITSLG.QKDEWLKRVFGSGNNSVPRSFATGIYNTLS..KEASKGNK...........WAILYCHRTGKSCVIDLQ
Q2GWD3_CHAGB/1350-1553GTSLS.DPESW.RRVEHG.VGTAEKKYVRELHDMLLQWRWAWEARK......EGSAPNAFVYNFRTGKCVYYDLG
A7E5P7_SCLS1/1343-1585ETKLS.DPDSW.RKVTHS.VPTTERRYIGEIHDLMSTLAFQNKDIT..........RNAFVYNFRTGTCIYYDLG
Q6CEK5_YARLI/1380-1640VTSLA.SFDEWRRKVIGI.QPS.HKPYLAKIYNQLVKLKETRS..............TALLYSPKADKLILYNLR
B6HND6_PENCW/1330-1577GTRLS.DTESW.RSVIQN.APLTERKYLSQVHELLMDLAVENR.TS...DNTESYT.NAFIYNYRTGSCVYYDLG
B6JXM9_SCHJY/1324-1574STTLQ.NEESW.KRFIDS.SPASQRQYLEQLHQKLL..AFKEEGKQ...........RVWVASFRTNELCLYELN
O74297_NEUCS/1372-1645RTSLS.DAESW.RRVEHN.VGTSEKKYVKEIHDMLKGWRWEWEAKK........GSEHAFVYNFRTGRCIYYDLS
C4R5R6_PICPG/1424-1692ITSLD.QPEEWKRKVGGA.SNATPRSYVVNLYNALS..KESAKGTR...........WAIVHSTKTGKICICDLQ
Q75F11_ASHGO/1426-1697ITSLA.QKDEWLRKVFGSGANSAPRSFATSIYNSLS..KEAAKGTK...........WAILHCHKTGSSCVVDLQ
A5E786_LODEL/1546-1804ITSIN.QQEEWIRKVVYS.TNNLPKSFALNIYNTLV..KEAAKGSR...........WCILVASRTQHSTIVDLQ

PF03129

SYG_YEAST/570-662---------------------------------------------------------------------------
SYP_ZYMMO/346-439---------------------------------------------------------------------------
SYH_BORBU/349-448---------------------------------------------------------------------------
SYTM_SCHPO/361-469---------------------------------------------------------------------------
DPOG2_MOUSE/356-452---------------------------------------------------------------------------
SYG_HUMAN/615-709---------------------------------------------------------------------------
SYEP_HUMAN/1303-1404---------------------------------------------------------------------------
SYT2_BACSU/542-632---------------------------------------------------------------------------
SYT2_AERPE/318-408---------------------------------------------------------------------------
SYT1_AERPE/340-442---------------------------------------------------------------------------
SYH_AERPE/342-432---------------------------------------------------------------------------
SYH_ORYSJ/696-784---------------------------------------------------------------------------
SYH_HAEIN/329-422---------------------------------------------------------------------------
SYH_STREQ/330-420---------------------------------------------------------------------------
SYP_ARCFU/285-379---------------------------------------------------------------------------
SYP_SYNY3/503-595---------------------------------------------------------------------------
SYG_THET8/401-503---------------------------------------------------------------------------
SYTM_ARATH/614-704---------------------------------------------------------------------------
SYT_METTH/495-584---------------------------------------------------------------------------
SYH_METTH/334-424---------------------------------------------------------------------------
SYH_PYRHO/339-428---------------------------------------------------------------------------
SYH_PYRAB/339-428---------------------------------------------------------------------------
SYP_SULSO/290-388---------------------------------------------------------------------------
SYP_HELPY/480-573---------------------------------------------------------------------------
SYG_MYCGE/355-444---------------------------------------------------------------------------
SYT_METJA/503-598---------------------------------------------------------------------------
SYP_METJA/280-374---------------------------------------------------------------------------
SYG_ARCFU/462-553---------------------------------------------------------------------------
SYTC_SCHPO/599-693---------------------------------------------------------------------------
YHY6_SCHPO/500-600---------------------------------------------------------------------------
SYH_SYNY3/327-417---------------------------------------------------------------------------
SYG2_YEAST/505-597---------------------------------------------------------------------------
SYG_METJA/483-574---------------------------------------------------------------------------
SYP_CHLPN/475-566---------------------------------------------------------------------------
Q22620_CAEEL/378-475---------------------------------------------------------------------------
SYH_PORPU/327-417---------------------------------------------------------------------------
SYG_AERPE/475-567---------------------------------------------------------------------------
SYG_DEIRA/402-504---------------------------------------------------------------------------
SYTC_YEAST/629-723---------------------------------------------------------------------------
SYH_THEMA/326-416---------------------------------------------------------------------------
SYG_MYCPN/355-444---------------------------------------------------------------------------
Q9VZY9_DROME/330-430---------------------------------------------------------------------------
SYP_BACSU/472-564---------------------------------------------------------------------------
SYP_MYCGE/302-392---------------------------------------------------------------------------
SYH_HELPJ/347-438---------------------------------------------------------------------------
Q9X6E6_PSEFL/61-151---------------------------------------------------------------------------
SYP_BORBU/287-387---------------------------------------------------------------------------
O94025_CANAX/346-450---------------------------------------------------------------------------
SYP_MYCTU/487-579---------------------------------------------------------------------------
SYP_HAEIN/474-568---------------------------------------------------------------------------
SYT_SYNY3/506-596---------------------------------------------------------------------------
SYG_BOMMO/559-652---------------------------------------------------------------------------
SYP_TREPA/517-607---------------------------------------------------------------------------
Q9SBK5_WHEAT/340-428---------------------------------------------------------------------------
SYG_SCHPO/538-630---------------------------------------------------------------------------
Q9VJV8_DROME/256-358---------------------------------------------------------------------------
SYT_MYCGE/471-563---------------------------------------------------------------------------
SYT_TREPA/495-584---------------------------------------------------------------------------
SYT_ARCFU/502-597---------------------------------------------------------------------------
SYT_DEIRA/551-644---------------------------------------------------------------------------
SYT_CHLTR/535-625---------------------------------------------------------------------------
SYH_THET8/330-420---------------------------------------------------------------------------
SYHC_TAKRU/425-516---------------------------------------------------------------------------
SYP_DEIRA/304-400---------------------------------------------------------------------------
SYGM1_ARATH/617-705---------------------------------------------------------------------------
SYG_MYCTU/369-459---------------------------------------------------------------------------
SYH_SCHPO/434-534---------------------------------------------------------------------------
SYP_ECOLI/475-569---------------------------------------------------------------------------
Q9VUK8_DROME/648-741---------------------------------------------------------------------------
SYHM_HUMAN/411-502---------------------------------------------------------------------------
SYG_PYRHO/476-567---------------------------------------------------------------------------
DPOG2_XENLA/360-456---------------------------------------------------------------------------
SYT_HELPJ/516-606---------------------------------------------------------------------------
SYT_BUCAP/541-631---------------------------------------------------------------------------
SYHC_MESAU/409-500---------------------------------------------------------------------------
SYH_BACSU/331-421---------------------------------------------------------------------------
SYT_THET8/559-649---------------------------------------------------------------------------
SYP_AQUAE/472-564---------------------------------------------------------------------------
SYT_CHLPN/535-625---------------------------------------------------------------------------
SYH_CHLPN/334-424---------------------------------------------------------------------------
SYH_CAEEL/426-517---------------------------------------------------------------------------
SYPM_SCHPO/330-423---------------------------------------------------------------------------
SYT_MYCLE/592-682---------------------------------------------------------------------------
SYT1_BACSU/549-640---------------------------------------------------------------------------
SYT_RICPR/540-630---------------------------------------------------------------------------
Q9VKB0_DROME/645-736---------------------------------------------------------------------------
SYP_RICPR/336-429---------------------------------------------------------------------------
SYT_AQUAE/543-633---------------------------------------------------------------------------
SYTC_CAEEL/619-710---------------------------------------------------------------------------
SYT_BORBU/485-575---------------------------------------------------------------------------
SYTM_YEAST/349-457---------------------------------------------------------------------------
SYP_MYCLE/290-387---------------------------------------------------------------------------
SYP_THEMA/470-562---------------------------------------------------------------------------
SYT_HAEIN/541-631---------------------------------------------------------------------------
SYP_MYCPN/302-392---------------------------------------------------------------------------
O45869_CAEEL/324-427---------------------------------------------------------------------------
Q9VWT1_DROME/426-517---------------------------------------------------------------------------
YHI0_YEAST/475-576---------------------------------------------------------------------------
SYH_MYCLE/333-423---------------------------------------------------------------------------
SYT_MYCPN/471-563---------------------------------------------------------------------------
SYP_METTH/296-391---------------------------------------------------------------------------
SYH_YEAST/427-527---------------------------------------------------------------------------
SYT_PYRAB/512-602---------------------------------------------------------------------------
SYG_BORBU/345-435---------------------------------------------------------------------------
SYTC_HUMAN/620-711---------------------------------------------------------------------------
SYPC_CANAX/439-539---------------------------------------------------------------------------
SYG_METTH/472-563---------------------------------------------------------------------------
SYP_AERPE/292-390---------------------------------------------------------------------------
SYP_CHLTR/475-566---------------------------------------------------------------------------
SYT_SHIFL/541-631---------------------------------------------------------------------------
SYT_THEMA/538-628---------------------------------------------------------------------------
SYG_TREPA/365-455---------------------------------------------------------------------------
SYG_CAEEL/625-719---------------------------------------------------------------------------
SYP_PYRHO/288-383---------------------------------------------------------------------------
SYH_MYCTU/330-420---------------------------------------------------------------------------
SYEP_DROME/1503-1604---------------------------------------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window