Sequence alignment for CL0464

PF09293

Q6WIF0_BPKVM/188-310----------------------------------------------------------------GSPEMDIMYKCIKGD-
RNH_BPT4/183-305----------------------------------------------------------------GSAEIDCMTKILKGD-

PF01367

R5SWC5_9GAMM/176-272----------------------------------------------------------------VYPNQVIDYKGLRGD-
Q2LQV1_SYNAS/177-273----------------------------------------------------------------VDPEKVPEILGLTGD-
R5YT97_9CLOT/175-276----------------------------------------------------------------VVPKQLIEVKGLMGD-
F2NXS9_TRES6/179-272----------------------------------------------------------------IPPEKILDYLSLVGD-
A5VKY0_LACRD/175-271----------------------------------------------------------------ITPRQIIDMKALMGD-
Q2KDW0_RHIEC/177-273----------------------------------------------------------------VPPEKMIDLQAMTGD-
R5DYD4_9BURK/169-267----------------------------------------------------------------VPPEKIIDFLALMGD-
B0U7F3_METS4/201-297----------------------------------------------------------------LSPAQIGDALALIGD-
D3EEN5_GEOS4/180-271----------------------------------------------------------------LSPRQVIDVKGLMGD-
W0EP68_9PORP/176-269----------------------------------------------------------------..PEQVIDILGLMGD-
I5AQC8_EUBCE/173-264----------------------------------------------------------------VTPAQIIELKALMGD-
F4Q2H1_DICFS/962-1057----------------------------------------------------------------VPSHLITSFQALAGD-
G2TPH2_BACCO/170-266----------------------------------------------------------------LTPHQIIDMKGLMGD-
D0MID0_RHOM4/174-270----------------------------------------------------------------LEPHQFIDVLALMGD-
K9VJC5_9CYAN/188-283----------------------------------------------------------------ILPEQVIDYKALCGD-
E4N9G7_KITSK/168-263----------------------------------------------------------------VRPDQYPDLAALRGD-
A8FEE0_BACP2/174-268----------------------------------------------------------------ISPKALIDMKALMGD-
K1Q5L6_CRAGI/93-188----------------------------------------------------------------VPPEKIVDYLALIGD-
A0LTV0_ACIC1/192-287----------------------------------------------------------------LRPEQYPDFAALRGD-
Q47QP2_THEFY/203-297----------------------------------------------------------------VPPERYCDLAALVGE-
Q8Y621_LISMO/177-272----------------------------------------------------------------ISPRQFIDVKALMGD-
E6S9H3_INTC7/172-267----------------------------------------------------------------VPPARYSDLAAMVGE-
B9DNB2_STACT/171-262----------------------------------------------------------------LKPSQIIDMKGLMGD-
I3ZYR1_ORNRL/181-274----------------------------------------------------------------..PKQIIDYLGMMGD-
Q8NQS1_CORGL/193-288----------------------------------------------------------------LTPRQYPEFAALRGD-
D4J8E3_9FIRM/172-267----------------------------------------------------------------VTPTEFIDMKALMGD-
Q2GD93_NEOSM/165-259----------------------------------------------------------------VFPTQMTDFLSLVGD-
X4ZAJ5_9BACL/170-265----------------------------------------------------------------LTPQQIIDLKGLMGD-
G8TCH4_NIAKG/181-274----------------------------------------------------------------..VHQVIDILGLMGD-
K9YI75_HALP7/185-279----------------------------------------------------------------IQPQQVIDYKALCGD-
I0DTG6_PROSM/171-273----------------------------------------------------------------VPPELIIDFLALMGD-
Q1INX5_KORVE/166-266----------------------------------------------------------------VTPESIADYLALVGD-
D1BS47_XYLCX/186-281----------------------------------------------------------------VPPEQYPDLAALVGE-
H1XRH0_9BACT/172-268----------------------------------------------------------------VQPEQIIDWLALMGD-
R7L509_9CLOT/175-274----------------------------------------------------------------IKPKQLIEVKGLMGD-
F6B2R8_DESCC/172-267----------------------------------------------------------------VTPNQIVDLKALQGD-
K9TV30_9CYAN/199-293----------------------------------------------------------------VSPSQVVDFKALCGD-
D1A6Z3_THECD/189-284----------------------------------------------------------------VPPERYRELAALVGE-
R6EDC7_9BACT/173-266----------------------------------------------------------------..SGQVIDMLALMGD-
R5HQP6_9FIRM/173-268----------------------------------------------------------------VTPIEFIDVKALMGD-
D7WD34_9CORY/175-270----------------------------------------------------------------LTPAQYPDFAALRGD-
D2S6F3_GEOOG/174-275----------------------------------------------------------------.PGRAYADFAVLRGD-
A8F3J2_PSELT/173-267----------------------------------------------------------------VEPSKIVDLLALMGD-
B3L0W4_PLAKH/323-416----------------------------------------------------------------LLPAQYSDYLIMAGD-
E4N2Z9_KITSK/206-303----------------------------------------------------------------.TGAEYADMAALRGD-
W6SG53_9CLOT/169-260----------------------------------------------------------------VTPTEFIDVKGLMGD-
I3VXA4_THESW/170-265----------------------------------------------------------------VTPLQFIDLKGLMGD-
A6VZB4_MARMS/168-259----------------------------------------------------------------VEPEQLTDYWALVGD-
Q82UL6_NITEU/166-261----------------------------------------------------------------VTPAQIIDFLALVGD-
R5AYC7_9BACT/174-268----------------------------------------------------------------.EPERVIDLLALEGD-
R6MWE6_9FIRM/167-264----------------------------------------------------------------VTPKQLIEIKAIQGD-
C1DG03_AZOVD/169-271----------------------------------------------------------------.GPELIIDYLALMGD-
R6CF35_9FIRM/166-263----------------------------------------------------------------LEPIQLIELKALMGD-
Q1GVH6_SPHAL/178-271----------------------------------------------------------------VTPDLVGDVLALMGD-
R7I8N2_9BURK/168-264----------------------------------------------------------------VPPSRIIDYLALMGD-
G2KS25_MICAA/178-273----------------------------------------------------------------VTPDKVVDVQSLAGD-
R7FXD3_9FIRM/168-265----------------------------------------------------------------VDPSQFVDMKALMGD-
Q5ZZB2_LEGPH/167-262----------------------------------------------------------------VTPEQIIDYLTLIGD-
Q98GJ5_RHILO/193-289----------------------------------------------------------------VPPEKMVDLQALTGD-
A1ASW3_PELPD/169-264----------------------------------------------------------------VEPRLVTDILGLAGD-
Q023U2_SOLUE/166-265----------------------------------------------------------------VSPESIPDYLALVGD-
G2TMH4_BACCO/176-267----------------------------------------------------------------VTPRQFIDVKALMGD-
D1AV04_STRM9/174-268----------------------------------------------------------------.KSYQIKDLFGLIGD-
R7HJY2_9MOLU/173-267----------------------------------------------------------------.DPINMIDLKALMGD-
C5CIW2_KOSOT/174-269----------------------------------------------------------------LPPEKIYELLSLCGD-
R6Y3D3_9FIRM/176-271----------------------------------------------------------------INPCQITDYKGLVGD-
V9R7T6_9MOLU/176-271----------------------------------------------------------------.LPLQIPLFKALSGD-
Q3A0K8_PELCD/170-266----------------------------------------------------------------VPPELVADVLGLAGD-
R5TRB1_9FIRM/173-267----------------------------------------------------------------VTPTEFIDVKALMGD-
W5UTK3_9MOLU/175-270----------------------------------------------------------------ILPSQVVDFKVLAGD-
A8HWS2_AZOC5/214-309----------------------------------------------------------------.GPEQVVDVQALAGD-
K4IP25_BIFAP/183-278----------------------------------------------------------------VTPEQYPDLAAMRGE-
R7NRK3_9FIRM/171-267----------------------------------------------------------------VTPRQLIDIKAIQGD-
R6N122_9CLOT/57-156----------------------------------------------------------------IEPQQLIDVKGLQGD-
Q83AT5_COXBU/178-273----------------------------------------------------------------VPPEKIIDYLTLTGD-
R7JGN4_9BACT/174-265----------------------------------------------------------------..PQLVRDILALWGD-
R5VJV7_9FIRM/170-264----------------------------------------------------------------I...SMIDLKALMGD-
E3FUM2_STIAD/168-265----------------------------------------------------------------VPPASVPDLLALVGD-
F3ZQR4_9BACE/179-271----------------------------------------------------------------...SQIIDLLGLMGD-
H8GMI8_METAL/169-264----------------------------------------------------------------VRPDQIVDYLALIGD-
F2IBB7_FLUTR/199-292----------------------------------------------------------------..PLQVIDILGLWGD-
R6CJM3_9CLOT/172-268----------------------------------------------------------------.TPIHLIDIKALMGD-
Q65I94_BACLD/174-264----------------------------------------------------------------IEPKALIDIKALMGD-
E0RYK7_BUTPB/254-365----------------------------------------------------------------VKPEQIPDLKGIQGD-
W0EBH6_9FIRM/170-266----------------------------------------------------------------LRPAQVIDLKGLMGD-
R7P845_9CLOT/173-265----------------------------------------------------------------IEPIKMIDLKALMGD-
R7EW33_9BACT/177-270----------------------------------------------------------------..TAQVIDLLALMGD-
Q8EQJ7_OCEIH/175-265----------------------------------------------------------------LSPKQIIDLKGLMGD-
D2R075_PIRSD/181-277----------------------------------------------------------------IRPDQVVDFQSLVGD-
R6XBC6_9CLOT/175-274----------------------------------------------------------------VIPKQLIEVKGLMGD-
Q2IK12_ANADE/168-270----------------------------------------------------------------IQPQSVPDWLALVGD-
A6VKA6_ACTSZ/171-273----------------------------------------------------------------IPPELIIDYLALMGD-
I1XLL1_METNJ/169-264----------------------------------------------------------------LTPQQIVDYLALMGD-
B3E7J4_GEOLS/168-262----------------------------------------------------------------.GPEGVIDILGLAGD-
I1YKC7_METFJ/170-265----------------------------------------------------------------LKPDQIIDYLALMGD-
A1SZF8_PSYIN/171-273----------------------------------------------------------------IPPELIIDYLGLMGD-
Q160A2_PSEA6/179-276----------------------------------------------------------------IPPELVIDFLALKGD-
E6U1T8_BACCJ/174-266----------------------------------------------------------------ITPPQMVDLKALMGD-
A6WC76_KINRD/200-295----------------------------------------------------------------VPPERYPDLAALVGE-
I0IKW7_LEPFC/192-288----------------------------------------------------------------VLPSQIPDLLALMGD-
G2PJF0_MURRD/178-271----------------------------------------------------------------..PEQVIDYLGMMGD-
C4K4U0_HAMD5/202-304----------------------------------------------------------------VPPDLIVDLLALMGD-
Q5WEG6_BACSK/170-266----------------------------------------------------------------LEPKQIIDLKGLMGD-
E8UZ74_TERSS/196-290----------------------------------------------------------------VPPRQVVDVMALRGD-
B9KH35_ANAMF/180-276----------------------------------------------------------------VTPDKLLDVLALTGD-
W5WP40_9CORY/169-264----------------------------------------------------------------VTPKQYPDLAALRGD-
J9Z7L6_LEPFM/194-290----------------------------------------------------------------VEPWQIPDLLALTGD-
A0LIP7_SYNFM/171-267----------------------------------------------------------------VPPGRMVDYLALVGD-
Q1H4F8_METFK/166-261----------------------------------------------------------------IPPSLIIDYLTLIGD-
Q9A2U2_CAUCR/194-290----------------------------------------------------------------VYPEKVVDVQALCGD-
Q5NIG1_FRATT/166-261----------------------------------------------------------------ISPHQMIDYLALMGD-
Q5FIV7_LACAC/176-272----------------------------------------------------------------ITPTEFIDMKALMGD-
Q88AP3_PSESM/173-275----------------------------------------------------------------.GPEHIIDYLALMGD-
F2IVF5_POLGS/191-285----------------------------------------------------------------.GPDKVIEVQALAGD-
C5B5M0_METEA/198-291----------------------------------------------------------------.PPERLGDVLALMGD-
S6A494_9SPIO/177-270----------------------------------------------------------------VEPELMLDFLSLIGD-
R6F8K0_9BACT/173-266----------------------------------------------------------------..PTQVIDLLALMGD-
C6X916_METGS/172-267----------------------------------------------------------------VPPSLMVDYLILIGD-
L7VMI6_CLOSH/176-272----------------------------------------------------------------VLPHQLIDVKGLMGD-
Q8P3P9_XANCP/166-261----------------------------------------------------------------VRPNQIVDLLALMGD-
Q67R60_SYMTH/173-268----------------------------------------------------------------LTPSQIIDLKALMGD-
D2RIE4_ACIFV/171-263----------------------------------------------------------------LQPRQIIDLKGLMGD-
H6L094_SAPGL/177-269----------------------------------------------------------------...EQVIDVLGLQGD-
R5XPF4_9CLOT/175-274----------------------------------------------------------------IAPRELIEVKGLMGD-
G2LJI6_CHLTF/177-273----------------------------------------------------------------VPPEQVVDVLALWGD-
X5D9C6_9BACT/180-273----------------------------------------------------------------..ADQVIDILGLMGD-
K9VXK3_9CYAN/203-298----------------------------------------------------------------ITPAQVVDYKALCGD-
R7BVU6_9FIRM/169-260----------------------------------------------------------------.TVEQFIDYKALRGD-
F2JXA5_MARM1/173-265----------------------------------------------------------------VFPQQMTDYWAFVGD-
E8N7K3_MICTS/187-280----------------------------------------------------------------.HAAQYADFAVLRGD-
C8WIT6_EGGLE/172-267----------------------------------------------------------------VRPDQFIDFLGLKGD-
B1YKA1_EXIS2/171-265----------------------------------------------------------------LKPIQMIDLKGLMGD-
F5YDN9_TREAZ/194-289----------------------------------------------------------------VNPDKVLDLLSLTGD-
B9JYU7_AGRVS/177-273----------------------------------------------------------------VPPEKMIDLQSLTGD-
M4VA87_9DELT/167-263----------------------------------------------------------------VHPLQFIDYLALTGD-
K9QFS2_9NOSO/193-288----------------------------------------------------------------VLPTQIVDFKALCGD-
F7YID5_VIBA7/212-314----------------------------------------------------------------IPPELIIDYLALMGD-
Q6AF56_LEIXX/178-273----------------------------------------------------------------IEPHQYPEIAALVGE-
B2FND3_STRMK/166-261----------------------------------------------------------------VRADQIIDLLALMGD-
F0S8A7_PSESL/176-268----------------------------------------------------------------...HQVIDILGLWGD-
I3ZMU2_TERRK/166-264----------------------------------------------------------------VKPESIPDYLALVGD-
D2B8D1_STRRD/181-276----------------------------------------------------------------LTPAQYPDFAAIRGD-
Q0SIH0_RHOJR/190-285----------------------------------------------------------------...EAYAELALLRGD-
A4J4X4_DESRM/172-267----------------------------------------------------------------VTPSQVVDLKGLQGD-
K7S3E4_PROA4/176-271----------------------------------------------------------------VRPDRYPELAALVGE-
D7DM74_METV0/172-267----------------------------------------------------------------IPPSLMVDYLVLIGD-
R4KNA5_9FIRM/172-267----------------------------------------------------------------VSPTQIIDIKGLMGD-
R5C8D2_9FIRM/174-270----------------------------------------------------------------LRPEQIIDLKALMGD-
A4X757_SALTO/189-288----------------------------------------------------------------VPAARYADFAALRGD-
B9L837_NAUPA/167-260----------------------------------------------------------------VHPKDFINFQALVGD-
U5Q619_9BACT/175-266----------------------------------------------------------------..PEQVIDILTIWGD-
D9RYG6_THEOJ/170-265----------------------------------------------------------------IPPQAIPDMKGLMGD-
E8X0D7_GRATM/200-296----------------------------------------------------------------VPPERVIDVMALRGD-
Q1G9A2_LACDA/175-271----------------------------------------------------------------VTPTEFIDMKALMGD-
E0WSC2_9ENTR/171-273----------------------------------------------------------------VPPELMIDFLALMGD-
DPO1_BACSU/173-269----------------------------------------------------------------LTPEQIIDMKGLMGD-
R5Z3S4_9FIRM/180-273----------------------------------------------------------------LQPLQIIDLKGLMGD-
M1P6Q9_9CORY/178-273----------------------------------------------------------------LTPIQYPDFAALRGD-
DPO1_HAEIN/171-273----------------------------------------------------------------IPPELIIDYLALMGD-
C5D2Y8_GEOSW/177-267----------------------------------------------------------------ILPSQWVDVKALMGD-
D9T585_MICAI/176-271----------------------------------------------------------------VTPDRYRDLAALVGE-
E1QKI3_DESB2/169-258----------------------------------------------------------------LPPELQVDMQALTGD-
D8P8J4_9BACT/166-262----------------------------------------------------------------VEPARVVEIMGLMGD-
C7N5Z1_SLAHD/172-267----------------------------------------------------------------VTPEQFPDFLGLKGD-
V4JMK2_9GAMM/169-264----------------------------------------------------------------VPPERIVDYLSLVGD-
D6YA50_THEBD/181-276----------------------------------------------------------------LRPAQYPDFAALRGD-
F8ABH8_THEID/180-271----------------------------------------------------------------IEPKKLLDVRALAGD-
I4C6R5_DESTA/170-266----------------------------------------------------------------VFPEQMLDFLALVGD-
R6DFU1_9CLOT/173-269----------------------------------------------------------------ITPKQVIDMKGLMGD-
M1E7L2_9FIRM/177-272----------------------------------------------------------------IRPNQIADMKALSGD-
K0J3A9_AMPXN/173-269----------------------------------------------------------------IKPEQVIDMKALMGD-
D5XDV8_THEPJ/172-267----------------------------------------------------------------LKPAQIIDMKGLMGD-
F7XXM7_MOREP/172-272----------------------------------------------------------------VPPALIIDYLALMGD-
R5JY06_9FIRM/172-268----------------------------------------------------------------VTPEEFIDMKGLMGD-
R5IQ46_9PORP/177-270----------------------------------------------------------------..PKQVIDILGLMGD-
R6W464_9FIRM/168-263----------------------------------------------------------------LTPSQLIDLKAVMGD-
D3ENG2_ATETH/191-284----------------------------------------------------------------..SFQVVDYKALCGD-
Q0C2B4_HYPNA/180-275----------------------------------------------------------------.GPEGVVDVQSLSGD-
B7JXA2_CYAP8/188-281----------------------------------------------------------------IKPVQVVDYKALCGD-
D0LQ66_HALO1/171-268----------------------------------------------------------------VPPAKLRDYLALVGD-
R6PW02_9CLOT/173-268----------------------------------------------------------------VTPEEFIDLKALMGD-
R6S4N0_9FIRM/185-279----------------------------------------------------------------LKPDQIRDYKGLMGD-
R6IQD2_9PROT/167-263----------------------------------------------------------------VYPDRVVDVQALAGD-
Q02DA6_SOLUE/178-273----------------------------------------------------------------VPPVQVADLLALMGD-
Q5QXJ2_IDILO/172-274----------------------------------------------------------------VKPNQIIDYLALMGD-
Q6KHF6_MYCMO/176-271----------------------------------------------------------------.FPNQIPDFKALAGD-
C7LWZ0_DESBD/177-270----------------------------------------------------------------LQPDQWADFQAMTGD-
Q87TG2_VIBPA/171-273----------------------------------------------------------------IPPELIIDYLALMGD-
R5J363_9FIRM/188-283----------------------------------------------------------------LSPDQFIDLKGLMGD-
R6QCV3_9FIRM/171-268----------------------------------------------------------------IEPKQLIEVKSLMGD-
G0AF33_COLFT/407-500----------------------------------------------------------------VPPERIVDYLTLIGD-
B1HWJ8_LYSSC/177-269----------------------------------------------------------------IEPAQFAQVKAFMGD-
Q7VGK4_HELHP/166-260----------------------------------------------------------------VNPKNFIDYQSLVGD-
D6ZZF0_STAND/182-277----------------------------------------------------------------.GPEKVVDVQSLAGD-
H8MNL4_CORCM/175-271----------------------------------------------------------------ILPGQVRDFLALVGD-
R5PJ21_9CLOT/172-268----------------------------------------------------------------VTPLIFIDMKGLMGD-
G8UQK3_TANFA/174-266----------------------------------------------------------------...GQMIDLLGLMGD-
R5IZP9_9FIRM/173-266----------------------------------------------------------------..PIHLIDLKALMGD-
C0Z7Y9_BREBN/170-261----------------------------------------------------------------LKPLQIIDLKGLMGD-
C5ARA6_METEA/202-298----------------------------------------------------------------LAPEQIGDALALIGD-
G8M1J6_CLOCD/177-273----------------------------------------------------------------IEPVQFIDVKALMGD-
W0BAJ6_9GAMM/167-262----------------------------------------------------------------VRPDQIIDYLTLTGD-
Q037Z0_LACC3/177-273----------------------------------------------------------------ITPAQIIDLKGLMGD-
M5DN76_9GAMM/168-270----------------------------------------------------------------VPPEHIIDYLALMGD-
F9ZYR5_METMM/171-266----------------------------------------------------------------VKPEQIIDYLALMGD-
U5QFF5_9CYAN/185-280----------------------------------------------------------------ITPRQVVDYKALCGD-
A8GLI9_SERP5/171-273----------------------------------------------------------------IPPELIIDFLALMGD-
K9UJT1_9CHRO/184-279----------------------------------------------------------------VTAAQIIDYKALCGD-
G8PDR9_PEDCP/176-272----------------------------------------------------------------VTPTQVIDLKGLMGD-
A6LG66_PARD8/173-266----------------------------------------------------------------..TEQVIDLLGLMGD-
Q7VB64_PROMA/188-294----------------------------------------------------------------VIPTKVIDLKALTGD-
A1R6E7_ARTAT/162-257----------------------------------------------------------------VKPGLYSDLAALVGE-
Q8G5M4_BIFLO/182-277----------------------------------------------------------------VTPAQYPDLAALRGE-
Q6F883_ACIAD/166-261----------------------------------------------------------------VWPNQIIDYLTLMGD-
R5ZB65_9CLOT/178-272----------------------------------------------------------------..ADQIVDFKALAGD-
Q3ABL3_CARHZ/170-265----------------------------------------------------------------LKPKQLVDVKGLMGD-
XNI_SHEFN/163-253----------------------------------------------------------------..QYQMLDFIALAGD-
R5CL99_9BACT/174-267----------------------------------------------------------------..TSQVIDLLGLMGD-
R6QV00_9FIRM/172-265----------------------------------------------------------------VTPEEFIDLKALMGD-
Q3IZ22_RHOS4/176-268----------------------------------------------------------------VYPERVVDVQALAGD-
D9R358_CLOSW/216-337----------------------------------------------------------------VRPEQIADLKGIQGD-
S5XSV3_PARAH/184-280----------------------------------------------------------------VTPDKVVDIQALAGD-
G0LBX7_ZOBGA/178-271----------------------------------------------------------------..PEQVIDYLGMMGD-
F8GFG9_NITSI/166-261----------------------------------------------------------------VTPERILDYLMLIGD-
Q2IQJ9_ANADE/171-273----------------------------------------------------------------VRPEQVIEYQSILGD-
F9YSB3_CAPCC/176-270----------------------------------------------------------------.TPEQVIDFLGMMGD-
D6Z501_DESAT/169-265----------------------------------------------------------------VSPQQLLDYFALIGD-
A2SN70_METPP/168-256----------------------------------------------------------------ITPAQVSAYIGLVGE-
Q0A4N7_ALKEH/170-265----------------------------------------------------------------VPPERIIDYLALVGD-
J7IX63_DESMD/170-266----------------------------------------------------------------LRPHQIIDLKGLMGD-
Q9CLY4_PASMU/171-273----------------------------------------------------------------LPPELIIDYLALMGD-
B9E796_MACCJ/172-267----------------------------------------------------------------.EPEKIIDLKGLMGD-
DPO1_RICPR/170-265----------------------------------------------------------------.TPDKLREVMALIGD-
Q4FP67_PELUB/181-276----------------------------------------------------------------.GPEKVIDVQSLAGD-
F6FUA3_ISOV2/181-276----------------------------------------------------------------VPPEQYPDLAALVGE-
B9DW03_STRU0/179-275----------------------------------------------------------------ITPEQFIDLKALMGD-
E3J1J7_FRASU/257-355----------------------------------------------------------------..GRAYGDFATLRGD-
E1SR02_FERBD/177-278----------------------------------------------------------------.GPELIIDLLAMMGD-
E6SGJ7_THEM7/179-274----------------------------------------------------------------IAPAQFLDVKALMGD-
Q6APA8_DESPS/167-263----------------------------------------------------------------VYPHQLLDTFALMGD-
D0LWK7_HALO1/170-273----------------------------------------------------------------VPPASIPDYLALVGD-
C7R9B2_KANKD/174-269----------------------------------------------------------------VKPEQIIDYLALVGD-
Q11BB3_CHESB/177-273----------------------------------------------------------------VPPEKMIDLQALTGD-
D3R1W1_MAGIU/172-263----------------------------------------------------------------.TPKSFITYKALLGD-
D8MKA1_ERWBE/171-273----------------------------------------------------------------IPPELIIDFLALMGD-
F0SQM1_RUBBR/167-263----------------------------------------------------------------VRPDQVIDFQSLVGD-
R6UF71_9FIRM/171-264----------------------------------------------------------------IVPSQIIDLKALMGD-
R7DDZ0_9PORP/177-269----------------------------------------------------------------..PEQVIDILGLMGD-
D4M514_9FIRM/173-269----------------------------------------------------------------VTPKEFIDVKALMGD-
A5IXV4_MYCAP/182-277----------------------------------------------------------------INPNQIPDYKGLAGD-
D4IYH1_BUTFI/172-268----------------------------------------------------------------VTPKQFIDVKALQGD-
I7HEA7_9HELI/166-260----------------------------------------------------------------VYPKNFIDYQSLVGD-
B7GGU2_ANOFW/171-267----------------------------------------------------------------LTPAQIVDLKGLMGD-
A5N5Z2_CLOK5/172-265----------------------------------------------------------------VTPTEFIDVKGLMGD-
O96139_PLAF7/456-549----------------------------------------------------------------ILPSQYSDYLILTGD-
Q1MS67_LAWIP/175-270----------------------------------------------------------------LLPSQWPDVQAIIGD-
R5W9B4_9BACT/175-268----------------------------------------------------------------..PRLVIDILALWGD-
E3GJN4_EUBLK/172-267----------------------------------------------------------------VTPRELIDVKALMGD-
L0K7A8_HALHC/173-265----------------------------------------------------------------LDPEQLVDKKALMGD-
Q6MEQ2_PARUW/168-263----------------------------------------------------------------VMPAQMIDYLAIIGD-
R7FD16_9FIRM/169-264----------------------------------------------------------------..PLSLIDLKALMGD-
E6K1L6_PARDN/187-282----------------------------------------------------------------VTPGQYPDLAAMRGE-
R5AMR1_9CLOT/178-273----------------------------------------------------------------LTPDRMRDLKGLMGD-
Q31RU3_SYNE7/187-282----------------------------------------------------------------VPPEQVIDFKALCGD-
W5Y0Y8_9CORY/180-275----------------------------------------------------------------LTPEQYPDYAALRGD-
C3PGL5_CORA7/175-270----------------------------------------------------------------LSPEQYPDFAALRGD-
F2LX06_HIPMA/164-259----------------------------------------------------------------VYPEQVADFLALVGD-
G7ZEH8_AZOL4/188-284----------------------------------------------------------------VPPEKVVDVQALAGD-
F8B0K0_FRADG/200-297----------------------------------------------------------------.PGRAYADFAVLRGD-
C8WRU1_ALIAD/184-280----------------------------------------------------------------LKPAQVIDLKGLMGD-
Q7VRJ4_BLOFL/173-275----------------------------------------------------------------VPPTLIADYLALVGD-
Q9RIC9_YERPE/174-286----------------------------------------------------------------.TPRAFLEAKALQGD-
H6LBF6_ACEWD/148-243----------------------------------------------------------------LTPKDLIDLKALMGD-
B9KYZ1_THERP/178-273----------------------------------------------------------------.PPERLPEYKALVGD-
F0P321_WEEVC/179-272----------------------------------------------------------------..PIQVIDLLGMMGD-
R5QIS4_9PROT/172-268----------------------------------------------------------------VTPDKVVDVQSLAGD-
A5UYS0_ROSS1/179-274----------------------------------------------------------------LRPDQLADLRGLKGD-
C4L471_EXISA/169-263----------------------------------------------------------------LQPIQMIDLKGLMGD-
R5XS55_9CLOT/172-266----------------------------------------------------------------.TPTQFIDLKGLMGD-
F9UNP5_LACPL/175-271----------------------------------------------------------------ITPAQIIDMKGLTGD-
R6XYH3_9CLOT/176-270----------------------------------------------------------------.EPLDLIEVKGLMGD-
R5D7S1_9FIRM/173-264----------------------------------------------------------------..PIHIVDLKALMGD-
D5C0V6_NITHN/169-263----------------------------------------------------------------VSPEQIVDYLALVGD-
Q2NQR5_SODGM/171-273----------------------------------------------------------------VPPELIIDYLALMGD-
L0IYF7_MYCSM/180-275----------------------------------------------------------------LTPQQYPDFAALRGD-
A9NF42_ACHLI/178-269----------------------------------------------------------------L....FIDFKALVGD-
H9UMJ8_SPIAZ/172-268----------------------------------------------------------------VYPEQILDYLSLVGD-
F2I663_AERUA/176-272----------------------------------------------------------------ISPEQLIDVKGLMGD-
R7LG65_9BACT/175-268----------------------------------------------------------------..TEQVIDLLGLMGD-
Q4KKJ9_PSEF5/168-271----------------------------------------------------------------VAPEQIIDYLALMGD-
L0EVN9_LIBCB/177-273----------------------------------------------------------------VPPEKMICLQALTGD-
XNI_SHEON/164-256----------------------------------------------------------------...SQFLDLMALAGD-
R6KBA3_9FIRM/172-268----------------------------------------------------------------VTPQEFIEMKALMGD-
Q21LK9_SACD2/170-272----------------------------------------------------------------VWPEQVVDLLALVGD-
K9Q3P1_9CYAN/182-277----------------------------------------------------------------VLPEQVIDFKALAGD-
Q2VZG0_MAGSA/170-266----------------------------------------------------------------VSPDKVVDVQALCGD-
V4J6J8_9DELT/138-234----------------------------------------------------------------VVPARLLDCFALIGD-
R6MII8_9BACE/175-268----------------------------------------------------------------..PLQVIDMLGLMGD-
R6QAF8_9FIRM/171-268----------------------------------------------------------------VTPEELIQVKALQGD-
B3EMM5_CHLPB/200-295----------------------------------------------------------------VPPECFIDFLTLTGD-
A1WZS2_HALHL/167-262----------------------------------------------------------------VPPELIRDYLALVGD-
G8QPL7_AZOSU/169-264----------------------------------------------------------------VEPGRIVDYLALIGD-
C6WB59_ACTMD/177-272----------------------------------------------------------------VPPSLYADYAAIRGD-
EX53_BUCAI/172-274----------------------------------------------------------------IKPKEFIDFLALMGD-
Q3IJF9_PSEHT/172-266----------------------------------------------------------------.GPELIIDYLALMGD-
A4G1I4_HERAR/166-256----------------------------------------------------------------VPPEMLADLLALMGD-
A6LP98_THEM4/175-270----------------------------------------------------------------VFPEQFGDYLSLVGD-
E0UAJ6_CYAP2/188-281----------------------------------------------------------------VKPNQVVDFKALCGD-
R7N312_9FIRM/172-266----------------------------------------------------------------VNPVQFIDLKALMGD-
H6N2L0_GORPV/209-306----------------------------------------------------------------....AYAEMSILRGD-
D3PXU6_STANL/185-280----------------------------------------------------------------VSPQRYRDLAALVGE-
F4CVY8_PSEUX/190-286----------------------------------------------------------------...EAYAEMAMLRGD-
E3PRM3_CLOSD/182-277----------------------------------------------------------------LTPQQFIDLKGLMGD-
S6B9L3_9GAMM/170-265----------------------------------------------------------------VAPEQIVDYLTLVGD-
B6YQQ9_AZOPC/171-265----------------------------------------------------------------ISPIQMIDFLGLMGD-
K0AXU1_CLOA9/173-267----------------------------------------------------------------.TPKQFIDLKGLMGD-
D1BHM6_SANKS/184-279----------------------------------------------------------------VEPHQYPELAALVGE-
G2IKI1_9SPHN/173-267----------------------------------------------------------------VPPEKLRDVLALMGD-
M9X5P1_MANHA/171-273----------------------------------------------------------------IPPELIIDFLALMGD-
A5WH47_PSYWF/217-309----------------------------------------------------------------IKPNQIIDLLTLMGD-
I6ZED3_MYCWM/176-271----------------------------------------------------------------.SPFQIPLLKALAGD-
D2NTK8_ROTMD/185-275----------------------------------------------------------------VPPHMYPDLAALTGE-
L0GZC9_9GAMM/169-262----------------------------------------------------------------VAPERIVDLLSLTGD-
I7CEP7_MYCHA/169-259----------------------------------------------------------------.LPCQIPLYKALSGD-
R7K1U1_9CLOT/173-269----------------------------------------------------------------ITPPQIIDLKGLMGD-
EX53_AQUAE/166-258----------------------------------------------------------------VEPQKIPDYLALVGD-
F1A1K6_DICPU/435-530----------------------------------------------------------------IEPNKLVTLQSLIGD-
M1PQ39_DESSD/167-261----------------------------------------------------------------VKPEQLLDCYSLMGD-
I3YTZ8_AEQSU/177-270----------------------------------------------------------------..PIQVIDFLGMMGD-
Q16D72_ROSDO/178-274----------------------------------------------------------------VYPERVVDVQALAGD-
Q2JPZ4_SYNJB/179-274----------------------------------------------------------------IWPWQVVDYKALCGD-
M4RCF9_9BIFI/194-289----------------------------------------------------------------VTPQQYPDLAALRGE-
E3FFI6_STIAD/174-270----------------------------------------------------------------IEPRQMRDYLSLIGD-
Q5NR03_ZYMMO/177-273----------------------------------------------------------------VVPEKLGDLLALMGD-
B1GZ14_UNCTG/167-262----------------------------------------------------------------VAPKQLSDIFALMGD-
Q31JN2_THICR/176-271----------------------------------------------------------------VKPEQIIDYLALMGD-
E0TER0_PARBH/193-287----------------------------------------------------------------..PERMIDMQALMGD-
F7V5J2_CLOSS/173-269----------------------------------------------------------------VTPEEFIDVKALMGD-
A8FG44_BACP2/173-269----------------------------------------------------------------LRPDQIIDMKGLMGD-
XNI_EDWI9/160-250----------------------------------------------------------------VAPQQLTDFWGLAGI-
R6ELL6_9FIRM/174-267----------------------------------------------------------------VTPLQFIELKALMGD-
R5HTX0_9FIRM/212-322----------------------------------------------------------------VYPEQIPVLLAITGD-
J7TPK9_MORMO/171-273----------------------------------------------------------------VPPSLIIDYLALMGD-
A5CDT3_ORITB/192-288----------------------------------------------------------------VRPSQVRDFLSLTGD-
G8PJG2_PSEUV/191-285----------------------------------------------------------------.GPEKVVEVQSLAGD-
R7FJM3_9CLOT/175-274----------------------------------------------------------------IEPKQLIEVKGLQGD-
Q7VLZ7_HAEDU/171-273----------------------------------------------------------------IPPELIIDYLALQGD-
R5N950_9FIRM/173-267----------------------------------------------------------------.KPINIVDLKALMGD-
I3TQL1_TISMK/174-270----------------------------------------------------------------VAPDKVVDVQALAGD-
H2J333_MARPK/175-267----------------------------------------------------------------.EPKKIQDFLALTGD-
F2I018_PELSM/179-275----------------------------------------------------------------VYPDKVIDVQSLAGD-
Q88RK6_PSEPK/169-271----------------------------------------------------------------.GPEHIIDFLALMGD-
E6VUY6_DESAO/178-268----------------------------------------------------------------.EPSQWPDFQAIIGD-
K0NC96_DESTT/176-272----------------------------------------------------------------.DPIQFIDILGLAGD-
I2EZX2_EMTOG/177-270----------------------------------------------------------------..PEQVVDILGLMGD-
I0AJT1_IGNAJ/175-270----------------------------------------------------------------.EPKYMIDYLALVGD-
C7PIM1_CHIPD/176-269----------------------------------------------------------------..VHQVIDILGLMGD-
C4LIB4_CORK4/182-277----------------------------------------------------------------VTPTQYPDLAALRGD-
C6WIF4_ACTMD/224-320----------------------------------------------------------------.....YAGMAVLRGD-
Q2N5T3_ERYLH/177-270----------------------------------------------------------------VPPELVGDVLALMGD-
K4IIV0_PSYTT/178-271----------------------------------------------------------------..PEQVIDFLGMMGD-
F2JQB5_CELLD/174-264----------------------------------------------------------------.SPIAFVDVKGLMGD-
K9TRE8_9CYAN/187-282----------------------------------------------------------------IPPELVVDYKALCGD-
C1F7K7_ACIC5/199-295----------------------------------------------------------------VPPERVIDVMALRGD-
R7GC82_9CLOT/175-274----------------------------------------------------------------IEPKQLIEVKGLQGD-
R6LP39_9FIRM/172-264----------------------------------------------------------------.EPKRLIDLKSLMGD-
K0P2A0_9BACT/177-271----------------------------------------------------------------.RPEQVKDILALEGD-
B3ERA5_AMOA5/181-273----------------------------------------------------------------...DQIRDLLALQGD-
B0RET1_CLAMS/178-273----------------------------------------------------------------VQPGMYPDIAALVGE-
R7CBS4_9CLOT/173-269----------------------------------------------------------------VTPSQIIDLKGLMGD-
H0PRU4_9RHOO/166-261----------------------------------------------------------------VTPERIVDYLALVGD-
U3GZ53_9CORY/176-269----------------------------------------------------------------LTPQQYPDFAALRGD-
J3YSZ2_9ENTR/171-272----------------------------------------------------------------VPPQLISDYLALIGD-
R5QUL8_9FIRM/173-264----------------------------------------------------------------LEPDQMRDLLGLMGD-
R5LC84_9FIRM/172-266----------------------------------------------------------------VTPVEFIDVKALMGD-
M4NJY5_9GAMM/175-274----------------------------------------------------------------VHPHQVADYLALCGD-
K7W024_9NOST/191-286----------------------------------------------------------------VFPTQVVDFKALCGD-
Q2RNI7_RHORT/169-265----------------------------------------------------------------VAPDKVIDVQALAGD-
B0S404_FINM2/171-270----------------------------------------------------------------ITPKQMIDLKGLMGD-
C7N051_SACVD/183-278----------------------------------------------------------------LSPAQYPDFAALRGD-
F5YMP5_TREPZ/203-295----------------------------------------------------------------VNPTQVLDLLSLIGD-
C5CBM1_MICLC/181-276----------------------------------------------------------------VAPAQYPELAALVGE-
I2F4A9_9BACT/174-269----------------------------------------------------------------LEPERLHALLSLAGD-
W8ETE5_9BACT/199-292----------------------------------------------------------------..PEQVIDILGLQGD-
K9V8S4_9CYAN/202-297----------------------------------------------------------------ILPSQVVDYKALCGD-
B0JWF3_MICAN/189-283----------------------------------------------------------------VTPKQVVDFKALCGD-
R6MD53_9CLOT/174-267----------------------------------------------------------------..PIHMIDLKALMGD-
D5UIK3_CELFN/200-296----------------------------------------------------------------...RAYADMAVLRGD-
E3D9A0_GARV3/189-284----------------------------------------------------------------VTPKQYSDLAALRGE-
A7HJZ2_FERNB/180-275----------------------------------------------------------------ITSEQIKDYLALVGD-
R5K4V0_9CLOT/172-266----------------------------------------------------------------VTPVQFIDMKGLMGD-
I5B001_9DELT/169-264----------------------------------------------------------------LEPEQFIDVLGLAGD-
E4T6I9_PALPW/175-267----------------------------------------------------------------...EQVIDLLGLMGD-
T0V5M9_9STRE/54-150----------------------------------------------------------------LTPEQFIDLKALMGD-
D3PLE6_MEIRD/183-277----------------------------------------------------------------.SVAQWVDYRSLVGD-
W0F3Z1_9SPHI/177-269----------------------------------------------------------------...SQVIDVLGLMGD-
R7GCW0_9CLOT/93-187----------------------------------------------------------------KVP.QFIDLKALMGD-
E3DNP8_HALPG/178-274----------------------------------------------------------------LTPEKLIDRKGLMGD-
C6C0R6_DESAD/177-272----------------------------------------------------------------LEPEQWADFQALVGD-
Q8EWK4_MYCPE/176-272----------------------------------------------------------------LQPAQIPDYKGISGD-
D9QA32_CORP2/176-271----------------------------------------------------------------LTPAQYPDFAALRGD-
M1FGF1_9ALTE/171-266----------------------------------------------------------------VTPAQIIDYLALVGD-
B0TER6_HELMI/172-265----------------------------------------------------------------LTPRQVVDWKGLMGD-
I1YTV8_PREI7/172-266----------------------------------------------------------------.TPAQVIDLLALMGD-
D7GES4_PROFC/175-270----------------------------------------------------------------VSPTHYPELAALVGD-
F8ED14_RUNSL/179-271----------------------------------------------------------------...SQVVDMLGLQGD-
G8R2X9_OWEHD/180-272----------------------------------------------------------------...DQVVDYLGMMGD-
D7DVE6_NOSA0/199-294----------------------------------------------------------------VLPTQIVDFKALCGD-
F4KQP4_HALH1/178-270----------------------------------------------------------------...DQVIDLLGLMGD-
F5XRP8_MICPN/175-270----------------------------------------------------------------VPPTRYPELAALVGE-
R6TEL9_9STAP/176-269----------------------------------------------------------------..AKQLTDYKGLIGD-
Q73M72_TREDE/173-267----------------------------------------------------------------.YPDGMLDLLSLIGD-
R5BEA4_9CLOT/169-259----------------------------------------------------------------LEPKRMIDLKALMGD-
W0E5X0_MARPU/169-264----------------------------------------------------------------VPPARIVDYLSLMGD-
K6YT30_9ALTE/176-271----------------------------------------------------------------VRPDQIIDYLALMGD-
I4EZI8_MODMB/169-264----------------------------------------------------------------LTPTQYPDFAALRGD-
R6RUP1_9CLOT/172-268----------------------------------------------------------------VTPEQFIDVKALMGD-
F4HEL1_GALAU/173-275----------------------------------------------------------------VPPELIIDLLALMGD-
U5LD81_9BACI/171-267----------------------------------------------------------------LSPGQIIDMKGLMGD-
F5XGU5_MICPN/193-287----------------------------------------------------------------IPAAHYVDFAVLRGD-
Q9X1V4_THEMA/174-269----------------------------------------------------------------VEPQQIPDLLALTGD-
G0J2E4_CYCMS/180-272----------------------------------------------------------------...DQVRDILGLMGD-
F7YV74_9THEM/173-267----------------------------------------------------------------VEPSQIVDLLALIGD-
F0QQW3_MYCSL/158-251----------------------------------------------------------------LLPSQIPLLKALSGD-
R6J384_9PROT/167-262----------------------------------------------------------------VYPEQVADVQALSGD-
B7GFD9_ANOFW/173-266----------------------------------------------------------------IQPQQLIDVKALMGD-
K3XCE0_PYTUL/229-321----------------------------------------------------------------..ARLIPDFLALIGT-
E8R2K2_ISOPI/172-268----------------------------------------------------------------.GPERVVDALALTGD-
R6EAU9_9FIRM/173-269----------------------------------------------------------------VTPTEFIDVKALMGD-
C7NHH1_KYTSD/172-267----------------------------------------------------------------VPPERYSDLAALVGE-
R6U8Y4_9FIRM/167-264----------------------------------------------------------------VTPRQMIEVKALMGD-
Q24XW3_DESHY/170-266----------------------------------------------------------------LRPAQIIDLKGLMGD-
Q11NX3_CYTH3/176-268----------------------------------------------------------------...DQVRDILGLQGD-
Q3AU68_CHLCH/162-256----------------------------------------------------------------VPPKQFTNFLTLTGD-
R5VPM4_9FIRM/172-267----------------------------------------------------------------IQPKQIIDVKALMGD-
R6NS01_9FIRM/173-265----------------------------------------------------------------VTPLQFIDVKALMGD-
J7Q7K7_METSZ/195-293----------------------------------------------------------------VTPDKVVDVQALAGD-
R7G673_9FIRM/172-263----------------------------------------------------------------.CPQQIIDLKALMGD-
U5LBK9_9BACI/178-273----------------------------------------------------------------ITPRQMIDLKAFMGD-
R7KEQ4_9CLOT/173-265----------------------------------------------------------------.TPIHMIDLKALMGD-
M4U1M4_9GAMM/171-273----------------------------------------------------------------VPAELIIDYLALMGD-
D4K0Z3_9FIRM/171-271----------------------------------------------------------------VTPRQLIDVKSLMGD-
R7F578_9CLOT/175-275----------------------------------------------------------------LEPKQLIEVKGLQGD-
R7C0B0_9BURK/166-261----------------------------------------------------------------VAPDRIIDYLALMGD-
R6UGN2_9CLOT/167-264----------------------------------------------------------------VTPHQLIDIKAIQGD-
E6U0L1_BACCJ/170-266----------------------------------------------------------------IKPEQIIDMKGLMGD-
E3I1L3_RHOVT/219-315----------------------------------------------------------------VPPSKVVDVQSLAGD-
G7US80_PSEUP/166-260----------------------------------------------------------------VRPEQIVDLLSLMGD-
B8ESM1_METSB/197-295----------------------------------------------------------------VPPEKVVDVQALAGD-
D4ZRD9_ARTPN/182-277----------------------------------------------------------------IKPEQVVDYKALCGD-
V5WDN6_9SPIO/172-266----------------------------------------------------------------VHPDQIIDYLALLGD-
Q8EPE5_OCEIH/171-267----------------------------------------------------------------ITPDQIIHLKALMGD-
C8W0H1_DESAS/180-275----------------------------------------------------------------VHPNQITDYKGLTGD-
C0QU83_PERMH/167-261----------------------------------------------------------------IYPEQFVDYLSMIGD-
Q5YUY4_NOCFA/203-299----------------------------------------------------------------....AYADMATLRGD-
XNI_TOLAT/168-258----------------------------------------------------------------LQPSQLVDFWALTGI-
R5EKW2_9GAMM/171-272----------------------------------------------------------------.GPELIIDYLALKGD-
O84500_CHLTR/167-258----------------------------------------------------------------VPPEQIADYLALVGD-
B2FPZ4_STRMK/173-274----------------------------------------------------------------VHAHQIADYLALCGD-
XNI_VIBCH/165-255----------------------------------------------------------------VTPAQLTDYWGLTGV-
R5IBR3_9FIRM/173-269----------------------------------------------------------------VTPSQIIELKALMGD-
I3Y5S4_THIV6/169-264----------------------------------------------------------------VPPERIVDYLSLMGD-
E6WVL3_PSEUU/185-285----------------------------------------------------------------VHAHQIADYLALTGD-
L0EEC2_THECK/170-265----------------------------------------------------------------LTPLQIIDLKGLMGD-
A1SL23_NOCSJ/173-268----------------------------------------------------------------VPPARYPELAAIVGE-
R5TEB2_9FIRM/173-265----------------------------------------------------------------VTPKEFIDVKALMGD-
D5UF67_CELFN/184-279----------------------------------------------------------------LPPARYPDLAALVGE-
T2G8I4_DESGI/186-281----------------------------------------------------------------LSPEQWPDVQALVGD-
E8RQH2_ASTEC/173-269----------------------------------------------------------------VPPELVVDAQALIGD-
F2F6K3_SOLSS/175-268----------------------------------------------------------------IAPKQFAEVKAFMGD-
A3QJD2_SHELP/186-287----------------------------------------------------------------.GPELIIDLLALQGD-
V5RWD4_9BACT/175-268----------------------------------------------------------------V..DQFLDLKSLKGD-
B0SKP9_LEPBP/174-267----------------------------------------------------------------ITKEQVTDYMALLGD-
R7ABN5_9FIRM/171-265----------------------------------------------------------------LMPKQIIDLKGIMGD-
K9ZHK4_ANACC/197-291----------------------------------------------------------------ILPTQIVDYKALCGD-
Q0ATS5_MARMM/180-275----------------------------------------------------------------.GPDKVIDIQSLAGD-
H8KN11_SOLCM/177-269----------------------------------------------------------------...DQVIDILGLWGD-
M4CRQ1_BRARP/278-374----------------------------------------------------------------LKPAQFVDIIALAGD-
R7P9N0_9BACT/190-283----------------------------------------------------------------..PEQVIDLLGLMGD-
R4T218_AMYOR/194-288----------------------------------------------------------------.....YADMAALRGD-
K9RZ96_SYNP3/185-277----------------------------------------------------------------VWPRQVVDYKALCGD-
F0S258_DESTD/171-265----------------------------------------------------------------IEPEQIPDFFGLVGD-
Q2YBJ5_NITMU/166-261----------------------------------------------------------------VPPERMLDYLALVGD-
R6RI51_9FIRM/174-269----------------------------------------------------------------.SPLQIIELKALMGD-
F6CPB6_DESK7/172-267----------------------------------------------------------------ITPAQFPDYKGLVGD-
R6DD71_9FIRM/176-269----------------------------------------------------------------..PIHMIDLKALAGD-
D6GPI6_FILAD/170-265----------------------------------------------------------------LTPKQFIDLKGLMGD-
R5FXK7_9ACTN/172-267----------------------------------------------------------------VTPSQFTDFLGLKGD-
C7N982_LEPBD/177-272----------------------------------------------------------------VTPDKIPDLFGLMGD-
Q38VS4_LACSS/177-273----------------------------------------------------------------LAPSQIVDLKGLMGD-
I6Y5E6_PROPF/172-267----------------------------------------------------------------VPPQRYPELAALVGE-
D3DHF4_HYDTT/166-258----------------------------------------------------------------VKPHLIPHLLALVGD-
C5BC85_EDWI9/171-273----------------------------------------------------------------VPPSLIIDFLALMGD-
Q5KWC1_GEOKA/173-269----------------------------------------------------------------LTPEQIVDLKGLMGD-
Q3B2D2_PELLD/198-293----------------------------------------------------------------VPPEQFTAFLTLTGD-
Q8DJ89_THEEB/183-277----------------------------------------------------------------VWPEQIVDYKALCGD-
F6FW43_ISOV2/196-291----------------------------------------------------------------....AYADMAILRGD-
D5WSS1_KYRT2/174-267----------------------------------------------------------------LRPEQIVDLKGLMGD-
F8IBU6_SULAT/171-265----------------------------------------------------------------VYPEEIPDLKGLMGD-
G0GCU2_SPITZ/170-265----------------------------------------------------------------VRADQIVDFLALVGD-
Q1LTX9_BAUCH/164-266----------------------------------------------------------------VLPELIIDYIALVGD-
Q30VQ3_DESAG/177-272----------------------------------------------------------------LSPSQWPDFQAVIGD-
D5CPR3_SIDLE/166-261----------------------------------------------------------------VEPARIVDYLALVGD-
Q9PEC5_XYLFA/166-261----------------------------------------------------------------VAPDQIIDFLALMGD-
A3HU84_9BACT/181-273----------------------------------------------------------------...DQVIDMLGLMGD-
B4EZ66_PROMH/171-273----------------------------------------------------------------VPPELIIDFLALMGD-
Q04G12_OENOB/189-285----------------------------------------------------------------ITPSQVIEMKSLTGD-
F4H8B8_CELFA/197-292----------------------------------------------------------------....AYADMAVLRGD-
Q07W46_SHEFN/172-273----------------------------------------------------------------.GPDRIIDFLALMGD-
B8I3Y7_CLOCE/178-274----------------------------------------------------------------VTPGQLIDVKGLMGD-
G2SP45_LACRR/177-273----------------------------------------------------------------ISPSQITDLKGLAGD-
R5TJ55_9CLOT/172-267----------------------------------------------------------------IEPIRMIDLKGLEGD-
I6ZUV3_MELRP/174-270----------------------------------------------------------------IKPSQMVDYLALVGD-
Q03GC3_PEDPA/176-272----------------------------------------------------------------VTPKQIIDIKGLAGD-
R6WE37_9FIRM/173-269----------------------------------------------------------------VTPLEFIDLKALMGD-
D6ZD58_SEGRD/176-271----------------------------------------------------------------LTPAQYPDFAALRGD-
D3SBR3_THISK/179-274----------------------------------------------------------------VAPEQIVDYLALMGD-
A1S1P9_SHEAM/172-273----------------------------------------------------------------.GPELIIDLLAMMGD-
K4KZZ9_SIMAS/167-269----------------------------------------------------------------LPPSLIIDFLALMGD-
D3IBX4_9BACT/174-267----------------------------------------------------------------..PSQVIDILALMGD-
Q1AUF6_RUBXD/180-272----------------------------------------------------------------VSPEQIPDYKALVGD-
D4LAD7_RUMC1/169-264----------------------------------------------------------------..PVHLIDLKALMGD-
K9SVR3_9SYNE/185-280----------------------------------------------------------------VMPNQIIDYKALCGD-
R5TX51_9CLOT/215-337----------------------------------------------------------------VWPEQITDLKGIQGD-
R7G2L8_9FIRM/173-267----------------------------------------------------------------VTPKEFIDLKALMGD-
XNI_COLP3/181-275----------------------------------------------------------------VKTSQLIDFWTLTGD-
Q1WUN8_LACS1/179-274----------------------------------------------------------------I.PEQIVDMKALVGD-
B1MBS5_MYCA9/183-278----------------------------------------------------------------LTPSQYPDFAALRGD-
R5FRW3_9BACT/173-266----------------------------------------------------------------..PHQVIDLLALMGD-
R6A8W8_9BACT/175-268----------------------------------------------------------------..TDQVIDLLGLMGD-
D2QFD0_SPILD/180-272----------------------------------------------------------------...EQVTDMLGLMGD-
R7AJW0_9BACE/172-268----------------------------------------------------------------VTPAEFIDMKALMGD-
D7B0J6_NOCDD/191-285----------------------------------------------------------------VTPERYRDLAALVGE-
Q0AVE2_SYNWW/171-267----------------------------------------------------------------VEPEKMVEIKGLMGD-
Q2S8M8_HAHCH/174-269----------------------------------------------------------------VPPELIVDYLALIGD-
W5WWD0_BDEBC/166-262----------------------------------------------------------------VPPHQFIDYLSIVGD-
R5PV85_9BACT/173-266----------------------------------------------------------------..PQRVIDLLALMGD-
Q6A9N6_PROAC/216-311----------------------------------------------------------------VPPARYPELAALVGE-
D1AJI6_SEBTE/174-269----------------------------------------------------------------VRPDQVIDLFGLMGD-
A9B4G4_HERA2/177-272----------------------------------------------------------------LAPNQLADLRGLKGD-
R7MRJ4_9FIRM/169-264----------------------------------------------------------------..PIKLIDLKALMGD-
Q8F071_LEPIN/175-270----------------------------------------------------------------.DVKQIPDYMGIVGD-
R6YML3_9CLOT/175-274----------------------------------------------------------------LEPAQLIEVKALQGD-
R7BQN1_9ACTN/176-271----------------------------------------------------------------VTPAQVPDFLGLKGD-
M5A121_9ACTN/173-264----------------------------------------------------------------VRPEMYVQYAALRGD-
D3VCL0_XENNA/159-249----------------------------------------------------------------VSPNQLPDYWGLAGI-
C7M492_CAPOD/176-269----------------------------------------------------------------..PLQVIDFLGMMGD-
F0RC33_CELLC/177-270----------------------------------------------------------------..PEQVIDYLGMMGD-
G4RBR0_PELHB/177-273----------------------------------------------------------------VTPDKVVDVQSLCGD-
Q1QR04_NITHX/205-301----------------------------------------------------------------VPPEKVVEVQALAGD-
R5SPL0_9FIRM/173-265----------------------------------------------------------------..PIHIIDLKALMGD-
B8FKR7_DESAA/166-262----------------------------------------------------------------LPPDKVIEIMALSGD-
D5UR61_TSUPD/196-291----------------------------------------------------------------LTPSQYPDYAALRGD-
A6TSU6_ALKMQ/172-268----------------------------------------------------------------VTPEQFIDLKGLMGD-
R5K144_9CLOT/173-269----------------------------------------------------------------VSPTAFIDVKGLMGD-
L0DJS8_SINAD/169-265----------------------------------------------------------------IRPDQVVDLLALTGD-
R7J3M2_9BACT/178-271----------------------------------------------------------------..PSQVIDLLALEGD-
EX53_BUCBP/173-271----------------------------------------------------------------I.PKLIPDLLGLMGD-
F2NP76_MARHT/174-270----------------------------------------------------------------VTVAQWVDFRALTGD-
D6XST5_BACIE/171-267----------------------------------------------------------------LKPEQIIDMKGLMGD-
R5HHS2_9SPIR/177-273----------------------------------------------------------------VYPDQVIDYKALRGD-
C4Z982_EUBR3/173-264----------------------------------------------------------------VTPKEFIDVKALQGD-
D5V8Q1_MORCR/195-290----------------------------------------------------------------VTSEQIADYLALMGD-
I0GJV5_CALEA/171-260----------------------------------------------------------------.EPTHLVDYKALLGD-
R5B6X3_9BACE/178-273----------------------------------------------------------------..PSQVIDLLALEGD-
R5P3Y5_9FIRM/173-269----------------------------------------------------------------VTPIEFIDVKALMGD-
F3YVK4_DESAF/178-272----------------------------------------------------------------.EPGHWPDYQALIGD-
R5MHI5_9MOLU/173-267----------------------------------------------------------------.TPIHMIDYKALAGD-
R6AWK3_9CLOT/168-259----------------------------------------------------------------LEPARMVDLKGLMGD-
B3DZC7_METI4/167-258----------------------------------------------------------------VKPSQIPDVLALIGD-
F9VG78_LACGL/181-277----------------------------------------------------------------LTPQQFIDLKGLMGD-
K0BZB8_CYCSP/168-263----------------------------------------------------------------VSPDMIIDYLALMGD-
D5AMD4_RHOCB/176-272----------------------------------------------------------------VRPNRVIDVQALAGD-
Q83GI7_TROWT/179-271----------------------------------------------------------------IEPHVYPDMAALVGE-
F6A9H5_PSEF1/169-271----------------------------------------------------------------.GPELIIDYLALMGD-
F0T2Q8_SYNGF/170-266----------------------------------------------------------------LKPEQIIDLKGLMGD-
F9D3A1_PREDD/173-266----------------------------------------------------------------..AAQVIDLLALMGD-
EX53_MYCPN/175-270----------------------------------------------------------------LTPKQVIEYKGLVGD-
I4AQ61_FLELS/183-274----------------------------------------------------------------..PMQLTDILGLQGD-
R7XY86_9ACTN/179-276----------------------------------------------------------------VLPQQYADFATLRGD-
F6DP11_DESRL/172-267----------------------------------------------------------------IHPHQIIDLKALQGD-
XNI_VIBPA/165-259----------------------------------------------------------------VKPSQLADYWGLTGI-
F4KKR4_PORAD/175-269----------------------------------------------------------------..PLQMIDYLGLVGD-
K9R8S6_9CYAN/200-295----------------------------------------------------------------VLPTQVVDFKALCGD-
Q1II21_KORVE/221-317----------------------------------------------------------------VPPERVVDVMALRGD-
C7QC87_CATAD/185-275----------------------------------------------------------------LTPQQYPDFAALRGD-
Q3Z6P9_DEHM1/176-271----------------------------------------------------------------.GPEHIADYKALMGD-
F4EUN0_SELS3/172-263----------------------------------------------------------------.PPKGLIDMKGLMGD-
K8E381_CARML/177-273----------------------------------------------------------------IEPHQIIDMKGLAGD-
R7R8R0_9FIRM/172-264----------------------------------------------------------------VTPLQFIELKALMGD-
G4SXN1_META2/171-266----------------------------------------------------------------VTPEQIIDYLALMGD-
B5HG67_STRPR/191-286----------------------------------------------------------------LTPQQYPDFAALRGD-
R6WCY3_9FIRM/173-269----------------------------------------------------------------LTPAQIIELKALMGD-
B2GGW1_KOCRD/218-313----------------------------------------------------------------VAPQNYPDLAALTGE-
Q8RBE6_CALS4/170-265----------------------------------------------------------------ITPQQFVDLKGLMGD-
Q97K23_CLOAB/170-262----------------------------------------------------------------VTPVQFIDVKGLMGD-
D6CZ53_9BACE/177-270----------------------------------------------------------------..PAQVIDMLGLMGD-
E3EEQ3_PAEPS/170-265----------------------------------------------------------------LKPLQIIDLKGLMGD-
B3QYB9_CHLT3/183-277----------------------------------------------------------------VYPEQFLDMLALMGD-
A8ZWP5_DESOH/169-265----------------------------------------------------------------IQPAQVIDAMALSGD-
R6PLU5_9FIRM/173-269----------------------------------------------------------------VTPKEFIEVKALMGD-
A7MMU7_CROS8/171-273----------------------------------------------------------------VPPELIIDFLALMGD-
R5QU87_9FIRM/173-269----------------------------------------------------------------VTPREFIDVKALMGD-
D2VA69_NAEGR/259-352----------------------------------------------------------------LPPKLIPEFLALVGD-
R6GTZ3_9FIRM/173-267----------------------------------------------------------------VSPTEFIDMKGLMGD-
I3Z482_BELBD/181-273----------------------------------------------------------------...DQVRDILGLMGD-
R5QGN0_9FIRM/173-264----------------------------------------------------------------VNPQQFIELKALMGD-
R5E1H7_9CLOT/172-267----------------------------------------------------------------VTPKEFIDMKGLMGD-
Q1D7R1_MYXXD/175-271----------------------------------------------------------------IEPGQMRDYLALIGD-
R6ML54_9FIRM/172-267----------------------------------------------------------------VTPTEFIDVKALMGD-
EX53_UREPA/175-270----------------------------------------------------------------ILPYQIIEYKGLVGD-
I0I4S4_CALAS/191-287----------------------------------------------------------------LTPQQFIDFKALTGD-
R6SZC1_9CLOT/173-267----------------------------------------------------------------.DPIKMIDLKSLMGD-
F4GYX9_CELFA/191-286----------------------------------------------------------------VPPERYPDLAALVGE-
K1Q3B5_CRAGI/89-175----------------------------------------------------------------.GPEQIVDLLALVGD-
C7LZ56_ACIFD/184-275----------------------------------------------------------------VPPARYGDLASLRGD-
Q8XIW9_CLOPE/170-262----------------------------------------------------------------VTPTQFIDVKGLMGD-
R5ABK9_9FIRM/173-269----------------------------------------------------------------VTPAEFIDMKALMGD-
F3ZVL4_MAHA5/171-267----------------------------------------------------------------IKPEQLIDVKGLMGD-
B4S5F3_PROA2/204-299----------------------------------------------------------------IAPDQFIDLLTLTGD-
C6XL49_HIRBI/183-290----------------------------------------------------------------VAPDRVTHVQALAGD-
K9YMP1_CYASC/178-273----------------------------------------------------------------VKTKQIVDFKALCGD-
R7B3Q5_9ACTN/172-267----------------------------------------------------------------VTPSQFTDFLGLKGD-
V9TSW6_9PROT/181-277----------------------------------------------------------------VFPERVVDVQALAGD-
C6CWL9_PAESJ/173-265----------------------------------------------------------------IHPFQVIEMKGLTGD-
D5MI10_9BACT/168-264----------------------------------------------------------------VPPGQVVEVMGLMGD-
A8MF83_ALKOO/171-267----------------------------------------------------------------VTPTQFIDLKGLMGD-
H2IYC1_RAHAC/171-273----------------------------------------------------------------VPPSLIIDFLALMGD-
B2GDC1_LACF3/175-271----------------------------------------------------------------VTPRQYIDVKALMGD-
R5WLK6_9FIRM/173-269----------------------------------------------------------------VTPSQIIELKALMGD-
Q47UA6_COLP3/181-276----------------------------------------------------------------VRPDQIIDYLALMGD-
R5H1M0_9FIRM/173-269----------------------------------------------------------------VTPAGFIELKALMGD-
W0AFR7_9SPHN/183-276----------------------------------------------------------------VPPVQLGEVLALMGD-
A6VRZ2_MARMS/163-265----------------------------------------------------------------IPPELIIDYLALMGD-
R6DQ24_9CLOT/172-267----------------------------------------------------------------LTPEKMIDIKALQGD-
Q3SG50_THIDA/175-268----------------------------------------------------------------VAPDRIIDYLTLVGD-
W0JJJ7_DESAE/162-254----------------------------------------------------------------VKPQQISDLLALAGD-
Q604H0_METCA/172-267----------------------------------------------------------------VPPERIVDYLALVGD-
C3MC14_RHISN/213-309----------------------------------------------------------------VPPEKMIDLQAMTGD-
S6C0E6_9ACTN/172-266----------------------------------------------------------------VTPAQFIDYLGLMGD-
M9SCH8_9EURY/174-267----------------------------------------------------------------VTPQAFIELKALMGD-
F2NBZ3_DESAR/181-277----------------------------------------------------------------LPPAALVDLRALTGD-
D6DK98_CLOSC/172-267----------------------------------------------------------------VTPKEFIDVKALMGD-
Q2S226_SALRD/182-278----------------------------------------------------------------LDPAQFVDMLALMGD-
F9Z4L6_ODOSD/179-270----------------------------------------------------------------...DQVIDILGLMGD-
R6Y137_9CLOT/172-267----------------------------------------------------------------IKPIRMIDLKGLMGD-
D0L1E0_HALNC/187-282----------------------------------------------------------------ITAAQFIDYLTLVGD-
B5EAT7_GEOBB/170-265----------------------------------------------------------------VAPERVVDVLALWGD-
A7ILD7_XANP2/181-276----------------------------------------------------------------VPPAGVLDLLALAGD-
Q2GI23_EHRCR/168-258----------------------------------------------------------------.SSNQLLDFLSLTGD-
B1WPN5_CYAA5/189-282----------------------------------------------------------------IKPTQVIDYKALCGD-
D1C458_SPHTD/180-275----------------------------------------------------------------.PPERIPEYKALVGD-
F8B4C6_FRADG/214-309----------------------------------------------------------------LTPTQYPDFAALRGD-
Q10PN9_ORYSJ/286-383----------------------------------------------------------------LKPSQFVDVVALSGD-
D2UBT4_XANAP/175-276----------------------------------------------------------------VHAQQIADYLALSGD-
F4LWF3_TEPAE/170-265----------------------------------------------------------------IRPEAVADMKGLMGD-
E1VX01_ARTAR/161-256----------------------------------------------------------------VRPERYSDLAALVGE-
D6YBH1_THEBD/191-285----------------------------------------------------------------..GRSYADFALLRGD-
R6Q7W3_9CLOT/182-278----------------------------------------------------------------IYPDQVIDYKALRGD-
R5YNJ9_9PROT/173-269----------------------------------------------------------------VYPERVTDVQALAGD-
R6B6I7_9CLOT/177-277----------------------------------------------------------------VKPVQLIQVKGLMGD-
C7RQV3_ACCPU/169-264----------------------------------------------------------------VPPERIVDYLALIGD-
R7MEF4_9CLOT/172-267----------------------------------------------------------------LKPIRMIDLKALMGD-
A7IHX7_XANP2/195-291----------------------------------------------------------------VPPEKVTDVQALAGD-
F2RGV7_STRVP/197-291----------------------------------------------------------------LTPSQYPDFAALRGD-
R5VV23_9CLOT/173-269----------------------------------------------------------------ITPPQIIDLKGLMGD-
J7TD20_MORMO/159-249----------------------------------------------------------------VTSQQLPDFWGLSGI-
Q817G4_BACCR/185-281----------------------------------------------------------------LSPKQIIDMKGLMGD-
A7HE72_ANADF/169-269----------------------------------------------------------------IRPESVPDYLALVGD-
A9G0B1_SORC5/180-276----------------------------------------------------------------VPPEQVRDLLALVGD-
Q4YB74_PLABA/221-314----------------------------------------------------------------IYPNQYSDYLILAGD-
B2UNN5_AKKM8/181-274----------------------------------------------------------------..ADQVVDILALMGD-
E4U7R3_OCEP5/180-275----------------------------------------------------------------.GPEQWVDYRALTGD-
R6CTN0_9CLOT/177-273----------------------------------------------------------------VTPTRFIDLKALMGD-
D8K3A7_DEHLB/187-283----------------------------------------------------------------VPPRLVADFKALVGD-
I0JPM8_HALH3/171-267----------------------------------------------------------------VRPDQIIDLKALMGD-
DPO1_TREPA/174-269----------------------------------------------------------------VMPTQLLDLFSLMGD-
R6MJV0_9FIRM/172-268----------------------------------------------------------------VTPTEFIDVKALMGD-
V5RTQ4_9BACT/170-265----------------------------------------------------------------.PPDKIADYKGLRGD-
D9QJ42_BRESC/214-310----------------------------------------------------------------VTPDKMIDLQALIGD-
R7NGM3_9MOLU/172-267----------------------------------------------------------------IEPIRIIDLKGLAGD-
R7EZZ9_9BACI/174-267----------------------------------------------------------------.APIRMIDLKGLMGD-
E8T6I3_THEA1/170-265----------------------------------------------------------------IEPETVPDLFGLSGD-
A5G8D3_GEOUR/172-265----------------------------------------------------------------..SERVIDILGLAGD-
G9WGJ9_9LACT/181-277----------------------------------------------------------------ITPAQVIEMKALTGD-
H6NCC7_9BACL/177-272----------------------------------------------------------------LKPLQIIDLKGLMGD-
R6ZL83_9ACTN/184-279----------------------------------------------------------------ITPELVPDFYGLKGD-
D5EWK7_PRER2/174-267----------------------------------------------------------------..PMAVIDLLALMGD-
R5YEV4_9MOLU/172-264----------------------------------------------------------------IEPIKMIDLKALMGD-
D2Q328_KRIFD/184-279----------------------------------------------------------------VTPRLYPDLAALVGE-
R6VG94_9BACT/172-266----------------------------------------------------------------.TTAQVIDLLALMGD-
W5Y092_9CORY/168-263----------------------------------------------------------------LTPAQYPDFAALRGD-
M4S4Y4_9SPHN/172-266----------------------------------------------------------------VPPEQLGDVLALMGD-
A6GWD1_FLAPJ/177-270----------------------------------------------------------------..PEQVIDFLGMMGD-
K9Z365_CYAAP/182-277----------------------------------------------------------------VKPSQIVDFKALCGD-
D9QU94_ACEAZ/174-270----------------------------------------------------------------LEPRKLIDKKGLMGD-
F2F8Z4_SOLSS/172-268----------------------------------------------------------------LTPEQIIDMKGLMGD-
W8SQH1_9RHOB/177-272----------------------------------------------------------------.GPDRVIDVQALAGD-
V6F4M9_9PROT/173-269----------------------------------------------------------------VAPDKVVDVQALCGD-
B8IZN9_DESDA/177-272----------------------------------------------------------------LTPAQWPDVQALVGD-
B9M4P2_GEODF/169-264----------------------------------------------------------------VPPERVVDILALAGD-
C7JE74_ACEP3/169-263----------------------------------------------------------------VPPTKVVDVQALMGD-
D5BTB4_PUNMI/181-273----------------------------------------------------------------VTPDKVVDVQALAGD-
A0A068NU24_9BACT/174-267----------------------------------------------------------------..PEFVPDFKALKGD-
D4JVV9_9FIRM/167-264----------------------------------------------------------------VTPKQMIEVKALMGD-
R5JEC4_9FIRM/173-267----------------------------------------------------------------.KPINVIDLKALMGD-
F7XW86_MIDMI/167-262----------------------------------------------------------------.GPKQLTDALALIGD-
M1WRG6_DESPC/178-272----------------------------------------------------------------.EPSTWPDFQALIGD-
R5GTA0_9BACT/174-267----------------------------------------------------------------..TSQIIDLLALMGD-
R7HKQ5_9FIRM/174-267----------------------------------------------------------------..PIHMIDLKALMGD-
C8W7U1_ATOPD/198-293----------------------------------------------------------------ITPELVPDFYGLKGD-
B6IUP1_RHOCS/198-294----------------------------------------------------------------VPPEKVVDVQALAGD-
E8N2R0_ANATU/175-270----------------------------------------------------------------IRPDQVVDFKALAGD-
R5Q6K5_9CLOT/177-276----------------------------------------------------------------IKPVQLIQVKGLMGD-
S0EX70_CHTCT/178-272----------------------------------------------------------------VWPEQIPDFKALTGD-
R7K4X5_9FIRM/163-253----------------------------------------------------------------LKAEQVVEYKALRGD-
Q74FR5_GEOSL/169-263----------------------------------------------------------------.GPGQVIDILGLAGD-
R5LH77_9FIRM/173-268----------------------------------------------------------------.TPSEFIDLKALMGD-
R5NRR7_9CLOT/178-277----------------------------------------------------------------..PCGLIELKALMGD-
Q03RJ7_LACBA/176-272----------------------------------------------------------------VTPAQIIDIKGLQGD-
D2PMW3_KRIFD/179-273----------------------------------------------------------------VPAGRYADFATLRGD-
W8TJN0_EUBAC/172-265----------------------------------------------------------------.APLQLIDLKGLMGD-
E4RIV0_HALHG/178-274----------------------------------------------------------------IPPEKLIDMKGLMGD-
R6ZV43_9FIRM/172-268----------------------------------------------------------------VTPEQIIDLKGLMGD-
A0KER4_AERHH/171-273----------------------------------------------------------------VPPELIIDYLALMGD-
C6CWY0_PAESJ/170-265----------------------------------------------------------------LKPMQIIDLKGLMGD-
U6B909_9RHIZ/175-269----------------------------------------------------------------VKPEQMVCLQALAGD-
F6IHB6_9SPHN/179-274----------------------------------------------------------------VPPEKVGDVLALMGD-
D5ELW9_CORAD/177-269----------------------------------------------------------------...DQVIDMLGLCGD-
R6B421_9BACT/173-266----------------------------------------------------------------..PLQVIDLLALMGD-
R5IS59_9CLOT/172-267----------------------------------------------------------------IMPNKIIDLKGLQGD-
R5PTX2_9FIRM/168-265----------------------------------------------------------------VLPAQFIDVKALMGD-
K4LVG7_THEPS/166-261----------------------------------------------------------------IDPAQVPDLKGLKGD-
A7HD60_ANADF/171-273----------------------------------------------------------------VRPDQVIEYMAILGD-
C5BKS8_TERTT/168-270----------------------------------------------------------------IPPELIIDYLALMGD-
F4D0A4_PSEUX/204-299----------------------------------------------------------------LTPEQYPDFAALRGD-
A3DDU1_CLOTH/175-271----------------------------------------------------------------IKPEQFVDVKALAGD-
R6DLT8_9FIRM/171-267----------------------------------------------------------------LTPTQFIDLKGLMGD-
C6XX99_PEDHD/176-268----------------------------------------------------------------...EQVIDILGLWGD-
R5A326_9CLOT/173-268----------------------------------------------------------------VEPIKMIDLKSLMGD-
F2G1R7_ALTMD/171-273----------------------------------------------------------------IPPELVIDFLALKGD-
N0B4P7_9BACI/171-267----------------------------------------------------------------LSPNQIIDMKGLMGD-
B2KCD2_ELUMP/177-272----------------------------------------------------------------....YLTDYLAIVGD-
X5H4G9_9RICK/166-259----------------------------------------------------------------.FPIQIADFLALIGD-
R6VEW7_9CLOT/177-274----------------------------------------------------------------IEPYQVIEVKSLMGD-
R7M7V2_9CLOT/175-274----------------------------------------------------------------VTPKQLIEVKGLQGD-
Q72ES3_DESVH/177-272----------------------------------------------------------------LTPAQWPDVQAVIGD-
DPO1_LACLA/179-275----------------------------------------------------------------LTPAQFIDLKALMGD-
C4L967_TOLAT/171-273----------------------------------------------------------------VPPELIVDYLALMGD-
R6GUR9_9FIRM/172-266----------------------------------------------------------------IEPIKVIDLKALMGD-
A5FYN0_ACICJ/167-262----------------------------------------------------------------VTPEQMVDAQALMGD-
C7R425_JONDD/173-268----------------------------------------------------------------VRPEQYPDLAALVGE-
F6FFJ8_MYCHI/182-272----------------------------------------------------------------LSPSQIPQLKAMAGD-
D5UZU3_ARCNC/175-267----------------------------------------------------------------VHPNQFTDYQSLLGD-
R6NDB5_9CLOT/174-269----------------------------------------------------------------..PKLLIDVKALMGD-
M4NDJ8_9GAMM/165-260----------------------------------------------------------------VMPAQIIDFLALTGD-
E8RDR5_DESPD/168-264----------------------------------------------------------------LPPSLLLDYFALTGD-
B8HWT3_CYAP4/201-296----------------------------------------------------------------ILPSQVVDYKALCGD-
D3HMT0_LEGLN/168-263----------------------------------------------------------------IMPSQVIDYLTLIGD-
D4Z6C6_SPHJU/172-265----------------------------------------------------------------VRPEQLGDVLALMGD-
Q21PP2_SACD2/170-272----------------------------------------------------------------IPPSLIIDFLALMGD-
EX53_MYCTU/194-291----------------------------------------------------------------....AYAELALLRGD-
A4VFS0_PSEU5/186-288----------------------------------------------------------------.GPELIIDFLALMGD-
E1VG45_9GAMM/169-264----------------------------------------------------------------LPPEQIVDYLTLVGD-
R6EQY9_9FIRM/172-268----------------------------------------------------------------LTPKQFIDLKGLMGD-
I0DWU9_PROSM/159-249----------------------------------------------------------------VKPCQLPDYWGLAGI-
D5DMV6_BACMD/171-267----------------------------------------------------------------ITAAQIIDMKGLMGD-
F8L459_SIMNZ/168-264----------------------------------------------------------------VKPEQIVDYLAIMGD-
R6XEK2_9FIRM/176-269----------------------------------------------------------------..ASQMTDYKALIGD-
F7WZI7_9ENTR/168-270----------------------------------------------------------------VYPKSIADFLSLVGD-
C7RDU0_ANAPD/171-267----------------------------------------------------------------LSPKQLIEVKGLEGD-
A9H4T5_GLUDA/171-267----------------------------------------------------------------VTPDKVIDVQALIGD-
X4QSD9_9ACTO/173-268----------------------------------------------------------------VKPALYSDLAALVGE-
B3PG24_CELJU/196-296----------------------------------------------------------------..PELMIDYLALMGD-
Q8I7W9_DICDI/460-554----------------------------------------------------------------.EPNKFVTFQSLIGD-
R7KQ60_9FIRM/167-266----------------------------------------------------------------LEPKQLIDLKGLMGD-
XNI_PECAS/160-250----------------------------------------------------------------VSPQQLTDYWGLAGI-
H6NGE7_9BACL/177-268----------------------------------------------------------------LTPQQFIDLKGLIGD-
H8L222_FRAAD/192-287----------------------------------------------------------------VRPDQIIDFLSLTGD-
Q4FUR1_PSYA2/176-266----------------------------------------------------------------INPDQMIDFLTLMGD-
R7KB09_9FIRM/168-262----------------------------------------------------------------.STDQFIDFKALMGD-
R5REF2_9FIRM/173-267----------------------------------------------------------------VTPPQIIELKALMGD-
F5WTI9_ERYRF/171-264----------------------------------------------------------------IEPKQIVDMKALMGD-
B3R095_PHYMT/178-269----------------------------------------------------------------....QMIDFKSMVGD-
G4QEE7_GLANF/172-274----------------------------------------------------------------VPAELIIDYLAMKGD-
W0DTZ0_9GAMM/171-266----------------------------------------------------------------IRPDQIIDYLALMGD-
R4PN03_9BACT/174-268----------------------------------------------------------------.RVDQFLDLKALKGD-
D2ATT3_STRRD/181-278----------------------------------------------------------------.PGRSYADFATLRGD-
Q8D2U6_WIGBR/179-279----------------------------------------------------------------..PCSIADYLALVGD-
D3ECK2_GEOS4/170-265----------------------------------------------------------------LTPDQIIDLKGLMGD-
R5R9A1_9PROT/167-263----------------------------------------------------------------VYPEQVVDVQALAGD-
A1B356_PARDP/179-274----------------------------------------------------------------.GPERVVDVQALAGD-
K4L3F9_9FIRM/189-284----------------------------------------------------------------LKPAQIIDLKGLMGD-
Q6LLQ4_PHOPR/187-288----------------------------------------------------------------.GPELIIDYLALMGD-
R6BH57_9CLOT/173-268----------------------------------------------------------------IKPIRMIDLKALMGD-
B2V602_SULSY/167-263----------------------------------------------------------------IHPQQFIDYLTMIGD-
E4TVZ2_MARTH/183-275----------------------------------------------------------------...EQVIDILGLQGD-
Q0BQN9_GRABC/179-275----------------------------------------------------------------VTPEKMIDVQALMGD-
A0LCQ8_MAGMM/168-264----------------------------------------------------------------VAAERIPDLLGLAGD-
R6HVX5_9FIRM/169-266----------------------------------------------------------------VEPIKLIDIKALMGD-
B8DM15_DESVM/177-272----------------------------------------------------------------LAPARWPDFQAVIGD-
R7A1V8_9FIRM/172-268----------------------------------------------------------------VTPGQFIDLKALMGD-
B1VH62_CORU7/182-277----------------------------------------------------------------VTPKQYPDLAALRGD-
G8X579_FLACA/178-271----------------------------------------------------------------..PLQVIDFLGMMGD-
K7XLR1_MYCHR/177-269----------------------------------------------------------------LLPKQIPDFKALSGD-
Q03Y99_LEUMM/178-274----------------------------------------------------------------LTPAQIIDKKALTGD-
F8A527_CELGA/177-272----------------------------------------------------------------VPPQRYSDLAALVGE-
K4KJ67_SIMAS/186-284----------------------------------------------------------------VWPEQMVDYLALVGD-
A6Q488_NITSB/167-260----------------------------------------------------------------IPPKLIKDYLALVGD-
XNI_YERPE/160-250----------------------------------------------------------------VLPRQLPDYWGLAGI-
DPO1_MYCLE/186-281----------------------------------------------------------------VTPAQYPDLAALRGD-
Q7MTY3_PORGI/175-268----------------------------------------------------------------..PGQMIDYLGLVGD-
S6AAN0_9PROT/168-263----------------------------------------------------------------VPATRIVDYLSLVGD-
A5D0T5_PELTS/172-267----------------------------------------------------------------ITPRQYADFKGLTGD-
R7JVL1_9FIRM/173-267----------------------------------------------------------------LLPKQIIDLKALMGD-
EX53_MYCPU/170-267----------------------------------------------------------------LEPDQIVDFKAIAGD-
Q8DVZ5_STRMU/178-274----------------------------------------------------------------LTPKQFIDLKALMGD-
J9SHU6_9ACTN/203-298----------------------------------------------------------------LTPAQYPDYAALRGD-
G2KW59_LACSM/176-272----------------------------------------------------------------INPEQIIDIKGLQGD-
R6IE66_9FIRM/172-266----------------------------------------------------------------.EPKHIIDLKALMGD-
L0FW82_ECHVK/180-273----------------------------------------------------------------..PDQVRDILGLMGD-
G0VQ78_MEGEL/172-265----------------------------------------------------------------.TPAQVIDMKALMGD-
R5UIS1_9FIRM/173-265----------------------------------------------------------------VTPKEFIDVKALMGD-
C7MCM1_BRAFD/179-274----------------------------------------------------------------IPPERYPDLAALVGE-
B2VFX3_ERWT9/159-249----------------------------------------------------------------VEPAQLTDYWGLAGI-
E1V9Z8_HALED/168-271----------------------------------------------------------------LPPSLIIDFLALMGD-
C8X5I9_DESRD/180-272----------------------------------------------------------------..PTIWPDYQALVGD-
W8GG65_9MOLU/181-275----------------------------------------------------------------.SPIQIPDFKSIAGD-
Q6MPP6_BDEBA/166-262----------------------------------------------------------------VRPDQFIDYLAIVGD-
R5TI96_9CLOT/172-267----------------------------------------------------------------IEPARMVDLKALMGD-
B0BZV5_ACAM1/179-274----------------------------------------------------------------VTVEQIVDYKALCGD-
A0PZF5_CLONN/172-263----------------------------------------------------------------VTPTEFIDVKGLMGD-
F8HXX6_WEIKK/177-273----------------------------------------------------------------LTPKQVIEVKGLQGD-
K9WHF3_9CYAN/205-298----------------------------------------------------------------F.PHQVVDYKALCGD-
D7GWW6_9FIRM/172-266----------------------------------------------------------------VTPEQFIEVKALMGD-
K9S3V1_9CYAN/180-275----------------------------------------------------------------ILPSQVVDYKALCGD-
C5BV65_BEUC1/196-290----------------------------------------------------------------.APALYPDLAALVGE-
J3VTH2_9ENTR/171-271----------------------------------------------------------------VPPELIVDYLALMGD-
R6QNU4_9FIRM/173-266----------------------------------------------------------------VTPKEFIDMKALMGD-
F8J6A0_HYPSM/193-289----------------------------------------------------------------VPPEKVIDVQALAGD-
A6W984_KINRD/198-293----------------------------------------------------------------....AYADVAVLRGD-
Q1GCX0_RUEST/180-275----------------------------------------------------------------.GPDRVVDVQALAGD-
R5LK80_9MOLU/172-267----------------------------------------------------------------VEPARMVDLKALMGD-
G4KS27_OSCVS/173-264----------------------------------------------------------------..PIHMIDLKALMGD-
R6JNI3_9CLOT/171-264----------------------------------------------------------------ITPQALIQVKALQGD-
B8D217_HALOH/171-267----------------------------------------------------------------LEPQQLIDMKGLMGD-
B5YG86_THEYD/167-263----------------------------------------------------------------VPPEKLNDFMALVGD-
R4I184_9ENTR/171-273----------------------------------------------------------------VPPKLIIDLLALVGD-
K9T2G4_9CYAN/196-291----------------------------------------------------------------IKPYQVVDYKALCGD-
Q7N9F1_PHOLL/171-273----------------------------------------------------------------VPPELIIDFLALMGD-
C4XH89_DESMR/177-272----------------------------------------------------------------IAPASWPDLQALVGD-
C1A3H5_GEMAT/186-282----------------------------------------------------------------VPPERVIDYLAIVGD-
B7KLM9_CYAP7/188-283----------------------------------------------------------------VKPNQVVDYKALCGD-
R7HB65_9FIRM/173-265----------------------------------------------------------------VTPLEFIDMKALMGD-
Q2RHE8_MOOTA/174-270----------------------------------------------------------------LEPEQLIDVKALMGD-
R5FEB5_9CLOT/172-265----------------------------------------------------------------VTPEEFIDVKALMGD-
D3SLF7_THEAH/167-259----------------------------------------------------------------VPPEKLADYLALVGD-
A7HP95_PARL1/191-287----------------------------------------------------------------VPPEKVVDVQALAGD-
C4Z0G0_EUBE2/173-269----------------------------------------------------------------VTPHEFIDVKALMGD-
U3U5A1_9ENTR/131-223----------------------------------------------------------------VAPAQLADYWGLCGI-
C6XHK7_LIBAP/174-269----------------------------------------------------------------IPPEKMVCLQALTGD-
R5NWZ1_9BACT/176-269----------------------------------------------------------------..PMQVIDILGLMGD-
R6M389_9CLOT/173-269----------------------------------------------------------------VTPVQIIDMKGLMGD-
Q0VL41_ALCBS/208-309----------------------------------------------------------------.GPELIIDFLALMGD-
Q7NBN5_MYCGA/178-273----------------------------------------------------------------LKPEDVIQYKALVGD-
C6W4A8_DYAFD/180-272----------------------------------------------------------------...DQVIDILGLMGD-
B4SDW3_PELPB/197-292----------------------------------------------------------------VPPELFIPFLTLTGD-
R5VP85_9FIRM/174-267----------------------------------------------------------------..PIHMIDYKALAGD-
K9XA05_9CHRO/196-291----------------------------------------------------------------VLPSQIVDFKALCGD-
W8URD4_YEREN/237-338----------------------------------------------------------------.TVQQIIDFLALMGD-
D7BIB7_MEISD/187-281----------------------------------------------------------------V..EQWVDYRALIGD-
B1XL22_SYNP2/182-277----------------------------------------------------------------VKPEQVVDFKALAGD-
F4C3A2_SPHS2/175-267----------------------------------------------------------------...EQVIDILGLWGD-
D7CP18_SYNLT/172-268----------------------------------------------------------------VSPYQLPDVKGLMGD-
Q8Y6W6_LISMO/170-267----------------------------------------------------------------LTPEQIIDMKGLMGD-
J9R7I6_RIEAN/180-273----------------------------------------------------------------..PKQIIDYLGMMGD-
R5EPJ5_9FIRM/172-268----------------------------------------------------------------.EPKKLIDLKALMGD-
E3EXJ4_KETVY/182-278----------------------------------------------------------------VAPDRVVDVQALAGD-
W0RH33_9BACT/192-288----------------------------------------------------------------VPPERTTDYLALVGD-
C7MNN5_CRYCD/172-267----------------------------------------------------------------VSPEQIPDFLGLMGD-
R6JGR6_9CLOT/216-334----------------------------------------------------------------VWPEQITDLKGIQGD-
B8GTD1_THISH/169-264----------------------------------------------------------------VAPEQIVDYLALIGD-
Q74IB4_LACJO/176-272----------------------------------------------------------------VTPTEFIDMKALMGD-
R6TL82_9STAP/174-266----------------------------------------------------------------IKPNLYADYKSLVGD-
E6UDL6_RUMA7/167-264----------------------------------------------------------------VTPRQMIEVKALMGD-
J9W1J9_LACBU/176-272----------------------------------------------------------------VKPSQIIEIKGLKGD-
Q8KBW5_CHLTE/205-299----------------------------------------------------------------.PPEQFIDLLTLTGD-
Q18AY7_PEPD6/172-266----------------------------------------------------------------.TPTQFIDLKGLMGD-
A8L881_FRASN/190-289----------------------------------------------------------------.PGRAYADFAVLRGD-
D3FAX3_CONWI/194-290----------------------------------------------------------------IPPELVPDFIGLKGD-
E8NFP6_MICTS/178-273----------------------------------------------------------------LPPEQYPDIAALVGE-
R5T0H5_9CLOT/174-266----------------------------------------------------------------VTPKEFIDMKALMGD-
K7SF32_GLUOY/170-265----------------------------------------------------------------VRPDQVVDVQALMGD-
C5D650_GEOSW/171-267----------------------------------------------------------------LTPEQIIDLKGLMGD-
XNI_VIBVY/165-255----------------------------------------------------------------VKPQQLSDYWGLTGI-
Q9K854_BACHD/170-266----------------------------------------------------------------ITPEQIIDMKGLMGD-
U5T5J5_9GAMM/170-265----------------------------------------------------------------VPPEQIIDYLALVGD-
D9TB96_MICAI/181-280----------------------------------------------------------------VPADRYADFAALRGD-
Q2GLW1_ANAPZ/170-265----------------------------------------------------------------.SSDKLLDAMALTGD-
R7HS44_9BACT/177-270----------------------------------------------------------------..PIQVIDILALMGD-
Q46JT9_PROMT/187-293----------------------------------------------------------------VNPNKVIDLKALTGD-
R6GSU5_9CLOT/171-267----------------------------------------------------------------VVPKQLIDIKAIQGD-
Q118S8_TRIEI/182-276----------------------------------------------------------------ILPTQVVDYKALCGD-
XNI_VIBF1/165-255----------------------------------------------------------------LKPEQLADYWGLAGI-
R5G5D5_9FIRM/174-267----------------------------------------------------------------..PNQLIEYKGIVGD-
F8E1A6_CORRG/174-269----------------------------------------------------------------VTPQQYPDLAALRGD-
D3BGU4_POLPA/455-544----------------------------------------------------------------.....VTTFQSLVGD-
I0IC96_PHYMF/175-271----------------------------------------------------------------ITPAQAIDYQALIGD-
Q2FXN9_STAA8/171-267----------------------------------------------------------------LTPNQIIDMKGLMGD-
R7J5Y7_9FUSO/177-268----------------------------------------------------------------VYPDQVIDYKGLRGD-
A0JWM3_ARTS2/237-332----------------------------------------------------------------VSPAQYSDLAALVGE-
R5PMH5_9BACT/172-266----------------------------------------------------------------.TPEQVKDLLALMGD-
A0LXN4_GRAFK/178-271----------------------------------------------------------------..PEQVIDFLGMMGD-
Q7V0W2_PROMP/191-297----------------------------------------------------------------VYPERVVDLKALTGD-
E9SZY4_RHOHA/193-288----------------------------------------------------------------LTPQQYPDYAALRGD-
C5C2Q9_BEUC1/197-292----------------------------------------------------------------....AYADMAALRGD-
L0E265_THIND/169-264----------------------------------------------------------------VDPERIVDLLTLVGD-
J7LGT6_NOCAA/189-283----------------------------------------------------------------VPPERYRDLAALVGE-
A5EWG4_DICNV/174-269----------------------------------------------------------------LTAAQVIDFLALVGD-
R7HWZ1_9CLOT/214-324----------------------------------------------------------------VLPELIVPLLAIQGD-
R7BJT3_9FIRM/172-266----------------------------------------------------------------VTPAEFIDMKALMGD-
B2IW22_NOSP7/193-287----------------------------------------------------------------VLPSQIIDFKALCGD-
G7LZM9_9CLOT/170-261----------------------------------------------------------------VTPHQFIDVKGLMGD-
D3FWX7_BACPE/170-266----------------------------------------------------------------IKPHQIIDMKGLMGD-
M5DR79_9GAMM/162-253----------------------------------------------------------------LPPHQLVDFWAMTGD-
D6ZH82_MOBCV/174-269----------------------------------------------------------------VWPQQYPEIAALVGE-
D7CT14_TRURR/197-292----------------------------------------------------------------.RVDQWVDFRALTGD-
A7AUC4_BABBO/227-319----------------------------------------------------------------IPPSRFSEYLALVGD-
B1VB35_PHYAS/177-269----------------------------------------------------------------...YQMIDYKALMGD-
R5HWP5_9MOLU/172-265----------------------------------------------------------------IEPINIIDLKALMGD-
D5SSA9_PLAL2/184-280----------------------------------------------------------------IRPDQVVDFQGLVGD-
A5GAH5_GEOUR/170-266----------------------------------------------------------------VPPELVPDVLGLAGD-
K9PHH0_9CYAN/193-288----------------------------------------------------------------ILPSQVVDFKALCGD-
R7M4V1_9CLOT/172-267----------------------------------------------------------------IEPIKMIDLKALMGD-
X2H0R8_9GAMM/169-271----------------------------------------------------------------VPPEKIIDYLALRGD-
B5EE62_GEOBB/170-266----------------------------------------------------------------VPPELVADVLGLAGD-
S6AEA3_PSERE/161-263----------------------------------------------------------------.GPEHIIDYLALMGD-
H2G117_OCESG/173-275----------------------------------------------------------------VPPESIIDLLALVGD-
K9SJ15_9CYAN/178-273----------------------------------------------------------------ITPEQVVDYKALCGD-
E6WWT2_PSEUU/173-268----------------------------------------------------------------VPAGRIVDLLALMGD-
Q3A700_PELCD/171-266----------------------------------------------------------------.TPDKVVEVQALAGD-
C0QM43_DESAH/167-264----------------------------------------------------------------LTPIQVIDMLGLAGD-
V5XPV5_ENTMU/177-273----------------------------------------------------------------LTPKQIIDMKGLAGD-
DPO1_CHLAA/176-271----------------------------------------------------------------LEPDQLADLRGLKGD-
B2IJU1_BEII9/217-314----------------------------------------------------------------.GPDKVIDVQALAGD-
R6U959_9FIRM/169-266----------------------------------------------------------------VEPEQFVDVKALMGD-
R5CJ97_9FIRM/172-265----------------------------------------------------------------VTPAEFIQVKALQGD-
A4XKY8_CALS8/172-266----------------------------------------------------------------.FAHQVVDYKALVGD-
A1BDW6_CHLPD/199-294----------------------------------------------------------------VRPEQFTDFLALAGD-
Q7UI29_RHOBA/292-388----------------------------------------------------------------IRPDQVVDYQALVGD-
E8SIU8_STAPH/171-267----------------------------------------------------------------LKPSQIIDLKGLMGD-
K9XQH6_STAC7/195-290----------------------------------------------------------------ITPQQVIDYKALCGD-
R5DQF1_9FIRM/173-264----------------------------------------------------------------VTPLEFIDMKALMGD-
X4ZWB2_9BACL/178-269----------------------------------------------------------------LTPSQVIDLKGFMGD-
U5RVC8_9CLOT/172-265----------------------------------------------------------------VTPTQFIDVKGLMGD-
D7BNX2_ARCHD/173-268----------------------------------------------------------------VRPDQYSDLAALVGE-
K8GU33_9CYAN/186-281----------------------------------------------------------------ILPSQVVDFKALCGD-
R7GMP2_9FIRM/173-268----------------------------------------------------------------LKPDQFRDFLGLMGD-
R4LEX1_9ACTN/178-273----------------------------------------------------------------VPPQRYRDKAALVGE-
DPO1_SYNY3/187-282----------------------------------------------------------------VTPAQIVDFKALCGD-

PF00867

Q7QCK4_ANOGA/128-215---------------------------------------------------SAMGLVCVQAP..GEAEALCAYLNRDNL.
Q7PQB9_ANOGA/138-226---------------------------------------------------RKRGVDCIVAP..YEADAQLAYLNRTDI.
FEN1_CRYNJ/147-234---------------------------------------------------SLMGIPVVTAP..GEAEAQCAELARAGK.
O44737_CAEEL/477-566---------------------------------------------------TNAGIPWIESP..GEAEAQCVELERLGL.
Q755Y1_ASHGO/139-228---------------------------------------------------IGAGFKYVVAP..YEADPQLVYLEKSGL.
FEN1_ASPCL/146-233---------------------------------------------------KLMGVPYIDAP..TEAEAQCAVLARAGK.
FEN1B_DANRE/118-203---------------------------------------------------HLMGVPCIKAP..GEAEALCAHLAKIGT.
GEN_HUMAN/122-208---------------------------------------------------ECLGIPWVQAA..GEAEAMCAYLNAGGH.
Q0UPI5_PHANO/62-154---------------------------------------------------KQFGYPIHLAP..GEAEAECALLQREGI.
A5DD91_PICGU/135-235---------------------------------------------------NESRIEYVRAP..GEAEAECAMLQRCGV.
Q6BNW3_DEBHA/141-239---------------------------------------------------RVNKIDFIQSP..GEAEAECAMLQKFGV.
Q0U159_PHANO/154-242---------------------------------------------------KHHNIQYVVAP..YEADSEMAYLERKGI.
A5DK76_PICGU/189-278---------------------------------------------------DARKVKYVVAP..YEADPQMVYLEKIGA.
EXO1_ARATH/138-226---------------------------------------------------RQENVDYVVAP..YEADAQMAFLAITKQ.
FEN1_DEBHA/147-234---------------------------------------------------ELMGVPYVNAP..CEAEAQCAELARGGK.
FEN_METTP/138-234---------------------------------------------------DAMGIPYVQAP..SEGEAQAAFMAIRGD.
FEN_ARCFU/139-235---------------------------------------------------SYMGIPFVDAP..SEGEAQAAYMAAKGD.
FEN_METBU/140-236---------------------------------------------------ELMGIPYVKAP..SEGEAQASYMVQKGD.
FEN_METAR/139-235---------------------------------------------------GYMGIPFIVAP..SEGEAQAAYMVSRGA.
A4YD87_METS5/93-189---------------------------------------------------EYMGVPTVQAP..SEGEAEAAYLNAKGI.
FEN_THEPD/142-238---------------------------------------------------RYMGVPYVEAP..SEGEAQAAYMVKKGD.
FEN_HYPBU/143-239---------------------------------------------------DAMGVPWVQAP..AEGEAQAAFMARRGD.
FEN_STAMF/144-240---------------------------------------------------DAMGIPWIQAP..AEGEAQAAYIVSKGD.
FEN_IGNH4/144-240---------------------------------------------------EAMGVPWVQAP..SEGEAQAAYMAAKGD.
FEN_CALMQ/144-241---------------------------------------------------DSMGVPWVQAP..SEGEAQAAYMASKGI.
FEN_METKA/137-234---------------------------------------------------DLMGIPWVQAP..SEGEAQCAYMARCGD.
FEN_METMJ/141-235---------------------------------------------------DLLGIPWVQAP..SEGEAQAAYMARQGK.
FEN_METB6/141-235---------------------------------------------------DLLGIPYVQAP..SEGEAQAAFMVQRGD.
FEN_METHJ/141-235---------------------------------------------------QLMGLPVVDAP..SEGEAQGAYMVLKGD.
FEN_PICTO/140-236---------------------------------------------------NLMGLPYVQAP..SEGEAQASYMTLKGD.
FEN_METS3/140-226---------------------------------------------------TMMGIPYIEAY..GEGEAQAAYLVENGD.
FEN_METTH/140-226---------------------------------------------------ELLGIPYVQAP..GEGEAQASYMVKMGD.
FEN_METST/140-227---------------------------------------------------DLMGIPYVQAR..TEGEAQASYMVSQND.
FEN_CENSY/140-236---------------------------------------------------KLFGIPYIDAP..SEGEATAAYLTQTGD.
FEN_NANEQ/141-237---------------------------------------------------EAMGIPYVQAP..SEGEAEAAYLTKKGV.
FEN_METLZ/141-235---------------------------------------------------SALGIAWIQAP..EEGEAQSSFMTKNGD.
A1RXA5_THEPD/141-237---------------------------------------------------RLMGFPVVDAV..HDAEAQAAYLVKRGE.
Q22418_CAEEL/121-212---------------------------------------------------TELGIKVIIAP..GDGEAQCARLEDLGV.
A0E7S1_PARTE/570-654---------------------------------------------------ALFGIPWIIAP..GEAEAQCAYLQQNGL.
A4S5U0_OSTLU/10-94---------------------------------------------------TLFGIPYIIAP..QEAEAQCAYLNQHKL.
A1CT40_ASPCL/828-912---------------------------------------------------RLFGLPYVTAP..MEAEAQCAELVSLGL.
A0A0D1DU59_USTMA/1043-1127---------------------------------------------------RLFGLPYITAP..MEAEAQCAELVSRRL.
RAD13_SCHPO/765-849---------------------------------------------------RLFGLPYIVAP..QEAEAQCSKLLELKL.
Q6C8E7_YARLI/828-915---------------------------------------------------QLFGIPFITAP..TEAEAQCATLVNLDL.
A3LTL9_PICST/737-821---------------------------------------------------RRFGIPYITAP..MEAEAQCAELVKIGL.
Q6CXC7_KLULA/759-843---------------------------------------------------SRFGIPYITAP..MEAEAQCATLLQLKL.
Q754D7_ASHGO/718-802---------------------------------------------------SIFGIPYLTAP..MEAEAQCAELLRLKL.
Q7PWJ6_ANOGA/899-983---------------------------------------------------QIFGVPFIVAP..MEAEAQCAFLNQLDM.
A7RTI4_NEMVE/134-218---------------------------------------------------RLFGVPFLVSP..MEAEAQCAFLDMTGQ.
A5KBK9_PLAVS/1143-1227---------------------------------------------------NMFGIPYVQSP..CEAEAQCSYLNCKNY.
Q17PA8_AEDAE/141-228---------------------------------------------------SSMGLVCVQAP..GEAEALCAYLNHDGM.
GEN_DROPS/130-222---------------------------------------------------LSMGIQCVQGP..GEAEAYAAFLNKHGL.
A7SEH4_NEMVE/44-150---------------------------------------------------VSEKVQYVVAP..YEADAQIAYLMKSGV.
Q6C4Y6_YARLI/64-176---------------------------------------------------ASLRIPVVDAA..GEGEAQCAHMQRHGP.
A6R917_AJECN/114-209---------------------------------------------------DLFHFPHHTAP..GEAEAECARLQSSGV.
Q2GUV9_CHAGB/63-155---------------------------------------------------RHFGFAIHDAP..GEAEAECALLEQQGV.
Q0U9L2_PHANO/119-219---------------------------------------------------THFGIPYIDAP..GEAEAECCNLQKLRI.
Q0UD35_PHANO/119-219---------------------------------------------------RCFGIAFHEAP..GEAEAECARLQILGL.
A7ETI3_SCLS1/117-215---------------------------------------------------RLLGVKWHDAP..GEAEAECAVLQRRGT.
A3LZR2_PICST/140-242---------------------------------------------------HDLKIDYLQSP..GEGEAQCAFLQKFGI.
A5DRR0_LODEL/135-236---------------------------------------------------RLNSILYCQAP..GEGEAQCAHFQRLGV.
Q59QM2_CANAL/131-233---------------------------------------------------SNNKIEYVQAP..GEGEAQCAYLQKLGI.
A7TQ75_VANPO/165-269---------------------------------------------------KDFKISYIDAC..GEAEAQCSWLQVNGY.
Q6CYD2_KLULA/131-230---------------------------------------------------KLFNIQTINAP..GEGEAQCAFLQLVGQ.
Q753T8_ASHGO/145-247---------------------------------------------------RAFNVDYITAA..GEGEAECAALQVAGS.
Q6FWX0_CANGA/163-268---------------------------------------------------NLLKVNYTFAY..GEGESHCAWLQISDH.
A0C3W1_PARTE/138-236---------------------------------------------------RELEVQYIIAP..YEADAQIAHMCLSGQ.
A5KC30_PLAVS/169-265---------------------------------------------------RTKNIDYIISP..FEADAQLSYLCRMGY.
Q4Y0F0_PLACH/142-239---------------------------------------------------KKKNIYYIISP..YEADAQLSYLCRMGF.
Q4N340_THEPA/152-254---------------------------------------------------KKVNVSVVVSP..YEADAQISYLCRTGI.
A4RSV6_OSTLU/113-212---------------------------------------------------RKRGFVYVVAP..NESDHQLKYMESSGL.
FEN11_PARTE/150-234---------------------------------------------------KLMGCPVIIAP..CEAEAQCAELCRAGK.
FEN1_TETTS/150-234---------------------------------------------------QLVGVPVILAP..CEAEAQCAALAKAKK.
FEN1_SCHPO/147-234---------------------------------------------------ELMGIPFVNAP..CEAEAQCAALARSGK.
FEN1_YARLI/158-245---------------------------------------------------TLMGIPIVEAP..CEAEAQCAKLAEAGK.
A0A0D1CGS8_USTMA/147-234---------------------------------------------------KLMGIPCVIAP..SEAEAQCAELARAGK.
FEN1_PICST/147-234---------------------------------------------------ELMGIPYVNAP..CEAEAQCAELARTGK.
FEN1_KLULA/144-231---------------------------------------------------SLMGIPYVVAP..AEAEAQCAELAKSGK.
FEN1_OSTLU/147-234---------------------------------------------------SLLGVPVFEAP..CEAEASCAAMCKAGL.
FEN1_LEIBR/150-237---------------------------------------------------QLMGVPVIQAP..SEAEAQCAELVKKGK.
FEN1_NEMVE/146-233---------------------------------------------------KLMGIPYVEAP..CEAEAQCAALVKSGK.
FEN1_DICDI/147-234---------------------------------------------------TLMGVPIVKAP..CEAEAQCAEIVKKGK.
FEN1_AEDAE/146-233---------------------------------------------------KLMGVPYVDAP..CEAEAQCAALVKGGK.
FEN1_CAEBR/146-233---------------------------------------------------GLMGIPVVEAP..CEAEAQCANLVKAGK.
FEN1_HUMAN/146-233---------------------------------------------------SLMGIPYLDAP..SEAEASCAALVKAGK.
FEN1_XIPMA/146-233---------------------------------------------------TLMGVPYIEAP..CEAEASCAALVKEGK.
Q4A3A7_EHV8U/144-231---------------------------------------------------TLMGIPVVQAP..CEAEATCAAYVKTGK.
FEN1_ENCCU/145-232---------------------------------------------------GLMGIPFETAP..SEAEAYCALLCKKKA.
FEN1_PLAVS/148-247---------------------------------------------------TLMGIPVVEAP..CEAESQCAFLTKYNL.
A2GNP0_TRIVA/115-201---------------------------------------------------ECLGVPYVDAP..CEAEAECAALNKAGL.
FEN1_BABBO/148-232---------------------------------------------------RLVGVPVIEAA..EEAEAQCAYLCQRGF.
FEN1_THEPA/148-233---------------------------------------------------RLMGVPVIEAL..EEAEAQCAYLVTKNL.
FEN1_CRYPI/148-246---------------------------------------------------GFLGMPCIDAP..SEAEAQCAELCKDGL.
FEN1_GIAIC/147-232---------------------------------------------------DTLGIPYVVAA..GEAEAQCVAMAKERV.
YL386_MIMIV/145-238---------------------------------------------------DLMGIPYIIAP..GEADVICSWLCARHDS
YAGG_SCHPO/286-375---------------------------------------------------KILGIPASFSPIGVEAEAFASAISQNNL.
VF369_IIV6/186-277---------------------------------------------------KIMNTPFIQAP..MEAEAFCAYLYKKKI.
FEN1_COPC7/147-234---------------------------------------------------RLMGVPCVIAP..SEAEAQCAELARGGK.
B4NVE4_DROSI/18-102---------------------------------------------------RLFGIPYIVAP..MEAEAQCAFLNATDL.
E7Q983_YEASB/138-227---------------------------------------------------KLNGIRYIVAP..FEADSQMVYLEQKNI.
E7QD45_YEASZ/92-180---------------------------------------------------.LHSIPYIVAP..FEADPQMVYLEKMGL.
F6VCF8_XENTR/56-142---------------------------------------------------.AEGIDCIVAP..FEADSQLAYLNKNEF.
H3C7J3_TETNG/104-188---------------------------------------------------RLFGVPFLIAP..MEAEAQCAALDRADH.
H3CFH1_TETNG/139-225---------------------------------------------------.ARGVDCIVAP..YEADAQLAYLTKCHL.
I1L6P9_SOYBN/130-214---------------------------------------------------.LLGMPVLKAK..GEAEALCAQLNSEGH.
J8PZZ4_SACAR/145-231---------------------------------------------------.LMGIPYIIAP..TEAEAQCAELAKKGK.
YEN1_YEAST/181-288---------------------------------------------------DLMNISYVIAC..GEGEAQCVWLQVSGA.
Q22AM9_TETTS/143-231---------------------------------------------------...NVECIVAP..YEADAQLAYLSQIDY.
Q4WYJ5_ASPFU/97-191---------------------------------------------------DLFKFPRHDAP..GEAEAECARLQRAGV.
Q5KPE3_CRYNJ/956-1040---------------------------------------------------RHFGIPYITAP..MEAEAQCAKLAQLGL.
FEN_METAC/142-236---------------------------------------------------..MGIPWIQAP..CEGEAQAAHMVLKKD.
FEN_PYRAE/145-239---------------------------------------------------.YMGVPWVQAP..SEGEAQAAYMARKGH.
FEN_SULTO/142-238---------------------------------------------------KAMGIPVVQAP..SEGEAEAAYINILGL.
FEN_THEAC/140-234---------------------------------------------------.YMGIPYVDAP..SEGEAQASYMTKK.N.
FEN11_ORYSJ/147-234---------------------------------------------------RLMGVPVVEAP..CEAEAECAALCINDM.

PF12813

C1G081_PARBD/159-450APAFMIPTVIEDLKYRWSREEVMKCTARVPE.......LHEIASRQTRNIDNIFAGLVEVVL--GEADEYCAATA.KNY-
B0WBM3_CULQU/114-373IPLLMREVFVEALR......................................VAKVPFMRCL--FEADNEIAVLA.RKL-
Q172X9_AEDAE/114-375IPLLVREVFVDAMW......................................AAKVSFMRCL--FEADNEVAILA.RKL-
A4IBP8_LEIIN/634-887VIPFELLNVVELLD......................................CCGVPYVLSP--AEADAQCAFLARCGL-
AST1_SCHPO/106-344YINLCVPIAQHVLMG.....................................LAKAKVIVCN--EEADKYCAFQA.KKL-
B6JV48_SCHJY/105-341LPHFCVPIAQHILKN.....................................ELSGNVIVCN--QEADKFCAVRA.HKL-
A7EV33_SCLS1/56-293ASSFLVPSIIEALQNSN...................................KYKDIVEIVP--GEADTFCASYV.SQH-
B2WEJ4_PYRTR/126-352SYAFLAPALREALQAS....................................NFSDKTHVVP--GEADDWCALHAKDNA-
Q7S890_NEUCR/144-377PPAFFVPSIIDTLRQSE...................................HYASQTSVVP--GEADVFCAQYV.REH-
Q2H0B7_CHAGB/227-481VPPFLVPAVIDALRNSP...................................KFGPLISLVP--GEADGFCAQHV.REH-
B2AZK0_PODAN/153-395PPAFLVPAVLDALRGS....................................KYGPITEVMG--GEADGYCAVHV.RKS-
B6QTN7_PENMQ/157-437GNPFMVSAVVEDLKSRWTHSEMSLYLPRN..........LIDIYKANNNQYHPWSDITEIIT--GEADVFCAALASQNP-
B8MNV0_TALSN/157-440GNPFMVSAVAEDLKSRWTCSEMHSYLPDS...........LNGIYETTDSRLPWSDIVEIIP--GEADGFCAALAAQNP-
Q0CPY4_ASPTN/160-425ENPFMVPAVFEDLKTRWNRENILQVSKN............VISTQSLTLDDFPWADITVMVP--GEADIHCAHVA.RAT-
B6H5R2_PENCW/156-425ENPFMVSAVFEDLRSRWNKEQIRKEVDD.............DISCLVADTDYPWADITVMVP--GEADVECARVA.KLT-
B8NL71_ASPFN/103-372ENPFMVPAVFEDLKYRWNKEKIFTVARD............ALCMQSIEIKDFPWADITVMVP--GEADAYCAYIA.KYA-
C5FGT6_ARTOC/109-380DNPLMVATVAEDLKYRWDWESIKPYYSS............DSLGENSGPVGFLWANITEVVL--GEADVFCAEIA.RER-
C4JGQ5_UNCRE/49-313DNPFMVQTVIEDLKTRWTVNAIREIVPH.............VGDILPCSGPYVWENITEVVP--GEADNYCADVA.KRS-
C0NYW8_AJECG/160-458ETAFVVPTVIEDLKYRWSPEEVVRCTAGAPELQN.VIAACGDYGIGGGAGPSIFAGRTQVVP--GEADPYCAIAA.RET-
C5GYC5_AJEDR/159-459ESAFVVPTVIEDLKYRWSPEEVLRCTAGVPELQKVIITACGNTENDNENDGSIFAEITEVVP--GEADVYCAIAA.RDS-

PF09293

Q6WIF0_BPKVM/188-310-----KKDGIAPLKAPSDHY.THGDGRRAPSV------------------------RKEELRTLMTSTP-EELKKLL---
RNH_BPT4/183-305-----KKDNVASVKVRSDFWFTRVEGERTPSM------------------------KTSIVEAI.ANDR-EQAKVLL---

PF01367

R5SWC5_9GAMM/176-272-----SSDNIPGI----------------KGI------------------------GEKTAQKLL.SRY.NNLEEIL---
Q2LQV1_SYNAS/177-273-----MSDNIPGI----------------PGI------------------------GPKGALRLV.EEY.GSIEEIL---
R5YT97_9CLOT/175-276-----SSDNIPGV----------------PGV------------------------GEKTAYKLI.KEY.KTIDNLY---
F2NXS9_TRES6/179-272-----ASDNVPGV----------------KGV------------------------GDKTAIKLL.TQY.GTLDEIY---
A5VKY0_LACRD/175-271-----SSDNYPGV----------------TKI------------------------GEKTAIKLV.KQF.GSVEELY---
Q2KDW0_RHIEC/177-273-----SVDNVPGI----------------PGI------------------------GPKTAAQLL.EEY.GDLDTLL---
R5DYD4_9BURK/169-267-----KIDNVPGV----------------PKC------------------------GEKTAAKWI.TEF.GSVDGVI---
B0U7F3_METS4/201-297-----TSDNVPGV----------------PGI------------------------GLKTAAALL.KEF.GSLEALL---
D3EEN5_GEOS4/180-271-----TSDNYPGV----------------RGI------------------------GEKTAVKLI.QEY.ESVEGIL---
W0EP68_9PORP/176-269-----SSDNIPGC----------------PGV------------------------GEKTAVKLI.ADF.GGIENLL---
I5AQC8_EUBCE/173-264-----TADNIPGL----------------PGV------------------------GPKTATKIL.LDY.GTIENAH---
F4Q2H1_DICFS/962-1057-----SVDNIPGV----------------PSL------------------------GPKSASAII.NSL.GHIDNVL---
G2TPH2_BACCO/170-266-----SSDNIPGV----------------PGI------------------------GEKTAIKLL.KQF.PTVEELL---
D0MID0_RHOM4/174-270-----PSDNVPGV----------------PGI------------------------GEKTAVQLI.QQY.GSVENLL---
K9VJC5_9CYAN/188-283-----KSDNIPGV----------------KGI------------------------GDKTALQLL.EAY.NSLDGIY---
E4N9G7_KITSK/168-263-----PSDNLPGI----------------PGV------------------------GEKTAAKWV.NQY.GSFAALV---
A8FEE0_BACP2/174-268-----ASDNYPGV----------------KGI------------------------GEKTALKFI.QTY.KTIDGLL---
K1Q5L6_CRAGI/93-188-----KSDNIPGV----------------LGI------------------------GKVTASKLL.KTY.DSLESIY---
A0LTV0_ACIC1/192-287-----PSDNLPGI----------------PGI------------------------GEKTAAKLI.RDF.GSLQELV---
Q47QP2_THEFY/203-297-----KSDNLPGV----------------PGV------------------------GPKTAAKWL.AKY.GSLDALV---
Q8Y621_LISMO/177-272-----TSDGYPGV----------------RGI------------------------GEKTAIKLI.QEY.ESIEGVL---
E6S9H3_INTC7/172-267-----SSDNLPGV----------------PGV------------------------GPKTAAKWI.TQF.GGLEGIV---
B9DNB2_STACT/171-262-----TSDNIPGI----------------AGV------------------------GEKTAIKLL.NQF.ETVENLY---
I3ZYR1_ORNRL/181-274-----SADNIPGI----------------PGI------------------------GPKTAQKFI.EKY.GSMEGLY---
Q8NQS1_CORGL/193-288-----PSDNLPNI----------------PGV------------------------GEKTATKWI.AQY.ETLDNLL---
D4J8E3_9FIRM/172-267-----TSDNIPGV----------------PGI------------------------GEKTASKII.STW.HSIEEAH---
Q2GD93_NEOSM/165-259-----TSDNIPGV----------------PGI------------------------GVKTAAKLL.NTF.GAIENF.---
X4ZAJ5_9BACL/170-265-----ASDNIPGV----------------PGV------------------------GEKTALKLL.HQF.GSVEGVL---
G8TCH4_NIAKG/181-274-----AVDNIPGI----------------AGV------------------------GEKTAAKLL.AEY.GTLENVL---
K9YI75_HALP7/185-279-----KSDNIPGV----------------NGI------------------------GEKTAVKLL.QQY.GTLENIY---
I0DTG6_PROSM/171-273-----SSDNIPGV----------------PGV------------------------GEKTALALL.QGI.GSLKEIY---
Q1INX5_KORVE/166-266-----AADGYPGL----------------KGW------------------------GAKSSSAVL.AKF.LHLESIP---
D1BS47_XYLCX/186-281-----SSDNLPGV----------------PGV------------------------GPKTAAKWV.TQF.GGLEPLL---
H1XRH0_9BACT/172-268-----KSDNIPGV----------------PKV------------------------GEVTAAKLL.QQF.GSIDNLY---
R7L509_9CLOT/175-274-----TSDNIPGV----------------SGI------------------------GEKTALELI.KTY.KTIDNLY---
F6B2R8_DESCC/172-267-----ASDNIPGV----------------PGI------------------------GAKTAAALI.KEH.GSVEQII---
K9TV30_9CYAN/199-293-----PSDNIPGV----------------RGI------------------------GEKTAIQLL.STY.DNLDNVY---
D1A6Z3_THECD/189-284-----TSDNLPGV----------------PGV------------------------GPKTAAKWL.TQY.GDLDGLV---
R6EDC7_9BACT/173-266-----TADNYPGC----------------PGV------------------------GEVTARKLI.NQF.GSIEELL---
R5HQP6_9FIRM/173-268-----TSDNIPGV----------------PGI------------------------GEKTATALI.AQY.GSIENCY---
D7WD34_9CORY/175-270-----PSDNLPNI----------------PGV------------------------GEKTATKWI.VEN.GDLEALI---
D2S6F3_GEOOG/174-275-----PSDGLPGV----------------AGI------------------------GAKTAAALI.TEF.GDLAGIR---
A8F3J2_PSELT/173-267-----SVDNVPGV----------------KGI------------------------GMKTAAELI.EKF.GNLDEIY---
B3L0W4_PLAKH/323-416-----KTDGITGI----------------PNI------------------------GDKTSKNLL.KQF.HTIDNIL---
E4N2Z9_KITSK/206-303-----PSDGLPGV----------------KGI------------------------GEKTATQLI.REY.GDLAGIR---
W6SG53_9CLOT/169-260-----SSDNIPGV----------------PGI------------------------GEKTAYKLI.KEY.KSIENLL---
I3VXA4_THESW/170-265-----KSDNIPGV----------------PNI------------------------GEKTAIKLI.KEF.GSIENLL---
A6VZB4_MARMS/168-259-----TTNRIPGV----------------KGI------------------------GPKTALSII.SLF.PTVEEIY---
Q82UL6_NITEU/166-261-----SVDNIPGV----------------EKV------------------------GPKTAVKWL.DQY.GTLDDLI---
R5AYC7_9BACT/174-268-----TSDNVPGC----------------PGV------------------------GEKTARRLI.EEW.GTVENLI---
R6MWE6_9FIRM/167-264-----SSDNIPGV----------------AGI------------------------GPKGASDLI.SRF.GSVDYIY---
C1DG03_AZOVD/169-271-----KVDNIPGV----------------PGV------------------------GEKTALGLL.QGLGGGLDTIY---
R6CF35_9FIRM/166-263-----SSDNISGV----------------KGI------------------------GEKTAAVLI.KEQ.GNVEQLY---
Q1GVH6_SPHAL/178-271-----SVDNVPGV----------------RGV------------------------GPKTATKLI.QEY.GSLTAAL---
R7I8N2_9BURK/168-264-----KVDNVPGI----------------NKC------------------------GPKTAAKWI.SEY.GSLDGVR---
G2KS25_MICAA/178-273-----PSDNVPGV----------------PGI------------------------GIKTAAQLI.NEY.GSLDELL---
R7FXD3_9FIRM/168-265-----SSDNIPGA----------------AGI------------------------GEITAGKLI.AEY.GSIDALY---
Q5ZZB2_LEGPH/167-262-----SVDNIPGV----------------EKC------------------------GPKTAVKWL.TEY.QTLDNLL---
Q98GJ5_RHILO/193-289-----SVDNVPGV----------------PGI------------------------GPKTAAQLL.EQF.GDLDGLL---
A1ASW3_PELPD/169-264-----ASDNIPGV----------------PGI------------------------GEKTAMKLI.REY.GSLDQLL---
Q023U2_SOLUE/166-265-----AADGYPGL----------------PGW------------------------GAKSSAAVL.AKF.RHLESIP---
G2TMH4_BACCO/176-267-----ASDGYPGV----------------KGI------------------------GEKTAFKLV.SRF.GNISGIL---
D1AV04_STRM9/174-268-----SSDGIPGV----------------LGI------------------------GPKTGAKLI.AEY.DNIDNIY---
R7HJY2_9MOLU/173-267-----SSDNIPGV----------------KGI------------------------GEKGAIKLL.KEY.QTIENLY---
C5CIW2_KOSOT/174-269-----TSDNIPGV----------------PGI------------------------GIKTALKLL.KEY.GSIDEIY---
R6Y3D3_9FIRM/176-271-----SSDNFKGI----------------PGI------------------------GEKTAIKLL.NTY.NDLDEII---
V9R7T6_9MOLU/176-271-----SSDNYSGI----------------PGI------------------------GEKNANKLV.KEY.QTKERLV---
Q3A0K8_PELCD/170-266-----TSDNIPGV----------------PGV------------------------GEKTASELV.QRF.GSLEGVL---
R5TRB1_9FIRM/173-267-----TADNIPGV----------------PGV------------------------GEKTATKII.VEY.GSLENAY---
W5UTK3_9MOLU/175-270-----KSDNIKII----------------EGL------------------------GEKGAQKLL.KEF.NNLNNII---
A8HWS2_AZOC5/214-309-----STDNVPGV----------------PGI------------------------GIKTAATLI.KDY.GDLDTLL---
K4IP25_BIFAP/183-278-----GADNIPGV----------------PGV------------------------GDGYAAKWI.NKY.GSLDSIL---
R7NRK3_9FIRM/171-267-----SSDCIPGV----------------PGI------------------------GPKGAGDLI.QRF.NNLDYIY---
R6N122_9CLOT/57-156-----TSDNIPGV----------------PGV------------------------GEKTALSLI.QRY.GSIENLY---
Q83AT5_COXBU/178-273-----TTDNIPGV----------------PKV------------------------GPKTAVKWL.SQY.DSVENLI---
R7JGN4_9BACT/174-265-----ASDNIPGV----------------PGI------------------------GEKTACKLV.QEW.GTVENIL---
R5VJV7_9FIRM/170-264-----ASDNISGV----------------SGI------------------------GPKTASTLI.RSW.GTVENVY---
E3FUM2_STIAD/168-265-----EADGIPGL----------------TGF------------------------GEKGAATLL.TAY.GHLEAIP---
F3ZQR4_9BACE/179-271-----SADNIPGC----------------PGV------------------------GIKTAQKLL.KEF.GSIENLI---
H8GMI8_METAL/169-264-----TVDNIPGV----------------PKV------------------------GPKTAAKWL.EQY.GTLDNLV---
F2IBB7_FLUTR/199-292-----AADNIPGI----------------PGV------------------------GEKTAKKLI.ADY.GSMEGVF---
R6CJM3_9CLOT/172-268-----SSDNIPGV----------------AGI------------------------GEKTALKLI.GQY.GNIETIY---
Q65I94_BACLD/174-264-----TSDNYPGV----------------KGI------------------------GEKTAYKLI.KEY.STVDRLL---
E0RYK7_BUTPB/254-365-----TSDNIPGV----------------KGV------------------------SS.AAIPLL.AEY.GTIEKIY---
W0EBH6_9FIRM/170-266-----ASDNIPGV----------------PGV------------------------GEKTALKLL.GEF.ETIENVL---
R7P845_9CLOT/173-265-----QSDNIPGV----------------KGI------------------------GEKTALKLL.QEY.KSLENLY---
R7EW33_9BACT/177-270-----KIDNIPGC----------------PGV------------------------GEKTAVKLI.QQF.GSVENLL---
Q8EQJ7_OCEIH/175-265-----SSDNYPGV----------------KGI------------------------GEKTAIKLL.QEY.ETIDDLL---
D2R075_PIRSD/181-277-----SVDNVPGV----------------PLI------------------------GPKIAQELL.AKY.ETLEGVL---
R6XBC6_9CLOT/175-274-----SSDNIPGV----------------PGI------------------------GEKTALDLV.KKY.GSIENLY---
Q2IK12_ANADE/168-270-----AADGIPGL----------------PGF------------------------GERSASALL.AVY.GHLEDVP---
A6VKA6_ACTSZ/171-273-----SSDNIPGV----------------AGV------------------------GEKTALGLL.QGI.GSMSEVY---
I1XLL1_METNJ/169-264-----KVDNIPGV----------------DSV------------------------GPKTATKLL.QQY.GSLQGVI---
B3E7J4_GEOLS/168-262-----SSDNIPGV----------------PGI------------------------GEKTAIKLV.QQF.GSMDNLL---
I1YKC7_METFJ/170-265-----KVDNIPGV----------------ESV------------------------GPKTASKLL.NQY.HSLQGVI---
A1SZF8_PSYIN/171-273-----KVDNIPGV----------------PGV------------------------GEKTALAML.QGL.GSMDDIY---
Q160A2_PSEA6/179-276-----KVDNIPGV----------------PGV------------------------GDKSALGLL.QGI.GSINDIY---
E6U1T8_BACCJ/174-266-----SSDNYPGV----------------KGI------------------------GEKTALQLL.KKY.GTIEGIL---
A6WC76_KINRD/200-295-----SSDNLPGV----------------PGV------------------------GAKTAAKWI.NLY.DGLDGVI---
I0IKW7_LEPFC/192-288-----TSDNIPGV----------------PGV------------------------GPVTAAKLLGQSG.DGVEELL---
G2PJF0_MURRD/178-271-----ASDNIPGL----------------PGV------------------------GDKTAKKFL.DQF.DSMEGLL---
C4K4U0_HAMD5/202-304-----SADNIPGV----------------PGI------------------------GEKTAQALL.QGM.GGLDKLF---
Q5WEG6_BACSK/170-266-----SSDNIPGV----------------PGV------------------------GEKTALKLL.AEF.RDVETVL---
E8UZ74_TERSS/196-290-----SIDNIPGA----------------PGI------------------------GDKGSVELI.QAF.GSVENAL---
B9KH35_ANAMF/180-276-----ASDNIPGV----------------PSI------------------------GVKTAARLI.NQF.GSLDNVL---
W5WP40_9CORY/169-264-----TSDNMPGV----------------PGV------------------------GPKTAQKWI.HTY.GSLQGVI---
J9Z7L6_LEPFM/194-290-----TADNIPGV----------------PGI------------------------GQKTAAKLLGNQG..TIDTLY---
A0LIP7_SYNFM/171-267-----SSDNVPGV----------------KGI------------------------GDKTARQLL.QEW.GSLDRIY---
Q1H4F8_METFK/166-261-----SVDNVPGV----------------EKV------------------------GPKTAVKWL.TQH.GSLDNII---
Q9A2U2_CAUCR/194-290-----SVDNVPGA----------------PGI------------------------GIKTAAQLI.TEY.GDLDTLL---
Q5NIG1_FRATT/166-261-----SSDNIPGI----------------PKV------------------------GPKTAVKWL.QDY.QNIDGII---
Q5FIV7_LACAC/176-272-----NSDNYPGV----------------EGI------------------------GPKTASNLI.QKY.GSVENLY---
Q88AP3_PSESM/173-275-----KVDNIPGV----------------PGV------------------------GEKTAVGLL.VGVGGGIKELY---
F2IVF5_POLGS/191-285-----SIDNVPGV----------------PGI------------------------GIKTAAQLI.GEF.GDLEALL---
C5B5M0_METEA/198-291-----QTDNVPGV----------------PGI------------------------GMKTAAKLV.AEY.GDLETLL---
S6A494_9SPIO/177-270-----SSDNVPGV----------------KGI------------------------GPKTAAALL.EEY.GDLDGIF---
R6F8K0_9BACT/173-266-----SADNFPGC----------------PGV------------------------GPKTATKLI.AEF.GSIDSIL---
C6X916_METGS/172-267-----SSDNVPGV----------------EKV------------------------GPKTAVKWL.TQY.GSLENII---
L7VMI6_CLOSH/176-272-----SSDNIPGV----------------PGV------------------------GEKTALSLI.SAY.GTLEGVY---
Q8P3P9_XANCP/166-261-----TVDNVPGV----------------EKC------------------------GPKTAAKWL.AEY.DSLDGVI---
Q67R60_SYMTH/173-268-----ASDNIPGV----------------PGV------------------------GEKTALKLL.ADY.GTVDGVY---
D2RIE4_ACIFV/171-263-----TSDNIPGV----------------PGV------------------------GPKTALKLI.TEY.RTVENVL---
H6L094_SAPGL/177-269-----AVDNIPGI----------------PGI------------------------GPKTAQKLL.AKY.GSIENLL---
R5XPF4_9CLOT/175-274-----TSDNIPGV----------------PGV------------------------GEKTALSLV.KEY.KTIENLY---
G2LJI6_CHLTF/177-273-----SSDNIPGA----------------PGI------------------------GEKGAVQLI.RQF.GSLDEAL---
X5D9C6_9BACT/180-273-----SADNIPGC----------------PGI------------------------GPKTAQKLI.AEY.GSIEELY---
K9VXK3_9CYAN/203-298-----PSDNIPGV----------------KGI------------------------GDKTAVKLL.NEY.GSLEQIY---
R7BVU6_9FIRM/169-260-----TSDNVPGI----------------PGV------------------------GEKTAKQLL.DKY.GSLESIL---
F2JXA5_MARM1/173-265-----TTNHIPGI----------------KGI------------------------GPKTAASIF.QAE.QSIESVF---
E8N7K3_MICTS/187-280-----PSDGLPGV----------------AGI------------------------GEKSAAALL.TAH.GDLDGIL---
C8WIT6_EGGLE/172-267-----SSDNIPGV----------------PGI------------------------GDKTAAKLL.QTY.GNLEGIY---
B1YKA1_EXIS2/171-265-----KSDNIPGV----------------PGI------------------------GEKTAIKLI.SAY.GSVEGLY---
F5YDN9_TREAZ/194-289-----SSDNVPGV----------------KGV------------------------GEVTAVKLM.SRY.GSLDEIY---
B9JYU7_AGRVS/177-273-----STDNIPGI----------------PGI------------------------GPKTAAQLL.EEY.GDLDTLM---
M4VA87_9DELT/167-263-----SSDNIPGV----------------AGI------------------------GPKGAQKLI.EQF.GTLEAIY---
K9QFS2_9NOSO/193-288-----KSDNIPGV----------------RGI------------------------GEKTAVQLL.STY.GSLENIY---
F7YID5_VIBA7/212-314-----KVDNIPGV----------------PGV------------------------GEKTAIALL.QGI.GSLEQIY---
Q6AF56_LEIXX/178-273-----TSDNLIGI----------------DKV------------------------GEKTAVKWV.QRY.GTVANIV---
B2FND3_STRMK/166-261-----TVDNVPGV----------------EKC------------------------GPKTAAKWL.AEY.QHLDGVM---
F0S8A7_PSESL/176-268-----AVDNIPGI----------------PGI------------------------GEKTAKALV.KQF.GSVEQII---
I3ZMU2_TERRK/166-264-----AADGFPGL----------------RGW------------------------GAKGAAAVL.AKY.SHFEAIP---
D2B8D1_STRRD/181-276-----SSDNLKNI----------------PGV------------------------GEKTAAKWI.REF.GSLEELV---
Q0SIH0_RHOJR/190-285-----SSDGLPGV----------------KGI------------------------GEKTASSLI.MQY.GSLAALR---
A4J4X4_DESRM/172-267-----TSDNIPGV----------------AGI------------------------GEKTASVLI.KEY.GSVEEIL---
K7S3E4_PROA4/176-271-----SADNLPGV----------------PGV------------------------GPKTAAKWL.AAH.DGLENLI---
D7DM74_METV0/172-267-----TSDNVPGV----------------EKV------------------------GPKTAVKWL.KEY.GSLDNIV---
R4KNA5_9FIRM/172-267-----TSDNIPGV----------------PGI------------------------GEKTALKLI.QEH.GTLEDVI---
R5C8D2_9FIRM/174-270-----SSDNIPGI----------------PGV------------------------GEKTATKIL.LAY.ENVENAY---
A4X757_SALTO/189-288-----PSDGLPGV----------------PGV------------------------GEKTAARLV.DRH.GDIAGVL---
B9L837_NAUPA/167-260-----SSDNIPGV----------------KGV------------------------GVKTAAKLI.NQY.KTLENLY---
U5Q619_9BACT/175-266-----ASDNVPGV----------------RGV------------------------GEVGSKKLI.QKY.GSVENIY---
D9RYG6_THEOJ/170-265-----SSDNIPGI----------------PGV------------------------GEKTALKLL.QEY.GSLENIL---
E8X0D7_GRATM/200-296-----AIDNIPGA----------------PGI------------------------GDKGSVELI.QQF.GTVEGAL---
Q1G9A2_LACDA/175-271-----PSDNYPGV----------------AKV------------------------GPKTASKLI.QEY.GSVENLY---
E0WSC2_9ENTR/171-273-----SSDNIPGV----------------PGV------------------------GEKTAQALI.QGL.GGLDCLF---
DPO1_BACSU/173-269-----SSDNIPGV----------------PGV------------------------GEKTAIKLL.KQF.DSVEKLL---
R5Z3S4_9FIRM/180-273-----SSDNIPGV----------------KGV------------------------GEKTAMKLL.STY.PSVEEVY---
M1P6Q9_9CORY/178-273-----PSDNLPNI----------------PGV------------------------GEKTATKWI.AQY.GSLDNLL---
DPO1_HAEIN/171-273-----SADNIPGV----------------AGV------------------------GEKTALGLL.QGI.GSMAEIY---
C5D2Y8_GEOSW/177-267-----ASDNYPGV----------------RGI------------------------GEKTALKLV.RQY.GSIEGIL---
D9T585_MICAI/176-271-----TSDNLPGV----------------PGV------------------------GPKTAAKWI.NLY.GGVEGVV---
E1QKI3_DESB2/169-258-----ASDNVPGV----------------PGV------------------------GPKTAVKLL.AEH.PGLEAVL---
D8P8J4_9BACT/166-262-----TSDNIPGV----------------KGI------------------------GEKTAVKLI.TQF.GTIEELL---
C7N5Z1_SLAHD/172-267-----SADNIPGV----------------PGI------------------------GDKTAAKLL.QNY.GTMDGIY---
V4JMK2_9GAMM/169-264-----PVDNIPGV----------------PKC------------------------GPKTAVKWI.NDY.GNLDAII---
D6YA50_THEBD/181-276-----PSDNLPGI----------------PGV------------------------GEKTAARWI.KEF.GSLDELV---
F8ABH8_THEID/180-271-----SIDNVPGV----------------PGI------------------------GEKTALRLI.KEY.GSLEEVL---
I4C6R5_DESTA/170-266-----SSDNIPGV----------------PGI------------------------GPKRAIALL.QEF.GSLEGIY---
R6DFU1_9CLOT/173-269-----SADNIPGV----------------PGI------------------------GEKTAGKIL.AAF.PSVEEAY---
M1E7L2_9FIRM/177-272-----SSDEIPGV----------------KGI------------------------GKKTAIEIL.RQF.NTVEELL---
K0J3A9_AMPXN/173-269-----SSDNIPGV----------------TGV------------------------GEKTAIKLL.NQF.GTLENIY---
D5XDV8_THEPJ/172-267-----TSDNIPGV----------------PGI------------------------GEKTAAKLV.REY.GSVEELL---
F7XXM7_MOREP/172-272-----RADNIPGV----------------MGI------------------------GKKTAQILL.HEI.GGLETIY---
R5JY06_9FIRM/172-268-----TSDNIPGV----------------PKI------------------------GEKTASKII.SAY.GSIENAY---
R5IQ46_9PORP/177-270-----ASDNIPGC----------------PGI------------------------GEKTATKLI.QEF.GSIEELL---
R6W464_9FIRM/168-263-----SSDNISGV----------------PGI------------------------GEKGALELM.HQY.GSLDGIY---
D3ENG2_ATETH/191-284-----KSDNIPGV----------------KGI------------------------GEKTAVKLL.TEY.KTIESIY---
Q0C2B4_HYPNA/180-275-----SVDNVPGA----------------PGI------------------------GIKTAAQLL.GEY.GTVEALL---
B7JXA2_CYAP8/188-281-----KSDSIPGI----------------DGI------------------------GEKTAVKLL.KEY.GTIQEVY---
D0LQ66_HALO1/171-268-----VSDNVPGM----------------PGV------------------------GAKTAAKLL.GSY.DSIDGIL---
R6PW02_9CLOT/173-268-----TSDNIPGV----------------PSI------------------------GEKTATKII.TEY.GSIENAY---
R6S4N0_9FIRM/185-279-----PSDNIKGI----------------PGV------------------------GEKTALKLI.QTY.GSLENII---
R6IQD2_9PROT/167-263-----STDNIPGV----------------PGI------------------------GLKTAAELV.NQF.GSLEEVL---
Q02DA6_SOLUE/178-273-----SVDNIPGA----------------PGI------------------------GDKGAKQIL.EKF.GSIEAAL---
Q5QXJ2_IDILO/172-274-----SSDNIPGL----------------PKV------------------------GEKTAQALL.QSI.PSIDAIY---
Q6KHF6_MYCMO/176-271-----ASDNYLGI----------------SGI------------------------GPKTAINLL.SEF.QIIENLY---
C7LWZ0_DESBD/177-270-----AADNIPGI----------------PKV------------------------GPKTAMGFL.RRF.PSLDLLK---
Q87TG2_VIBPA/171-273-----KVDNIPGV----------------PGV------------------------GDKTATALL.QGI.GGLTKLY---
R5J363_9FIRM/188-283-----KSDNIPGI----------------PGI------------------------GEKTGIKLL.LEY.GSVEGVL---
R6QCV3_9FIRM/171-268-----TSDNIPGV----------------RGI------------------------GEKTALNLV.QKF.GTLENVY---
G0AF33_COLFT/407-500-----TVDNIPGV----------------AKV------------------------GPKTAVKWL.AQY.DTVDQVI---
B1HWJ8_LYSSC/177-269-----TSDGYPGV----------------KGI------------------------GPKQALTLI.QTY.GSIDSVL---
Q7VGK4_HELHP/166-260-----TSDNIVGI----------------KGI------------------------GAKSAQKLI.THF.GSIESLY---
D6ZZF0_STAND/182-277-----SVDNVPGV----------------PGI------------------------GIKTAAQLL.AEY.GDLDTLL---
H8MNL4_CORCM/175-271-----AVDNVAKV----------------PGV------------------------GDKTAVELL.HQF.GDVETLL---
R5PJ21_9CLOT/172-268-----TSDNIPGV----------------PGI------------------------GEKTAAKLL.AEY.GDLDGVY---
G8UQK3_TANFA/174-266-----SSDNIPGC----------------PGV------------------------GEKTAQKLL.AEF.GSVEALL---
R5IZP9_9FIRM/173-266-----SSDNIPGV----------------AGV------------------------GPKTATQLL.LDY.GTLDGVY---
C0Z7Y9_BREBN/170-261-----SSDNIPGV----------------PGV------------------------GEKTALKLL.HEY.GSVEQVL---
C5ARA6_METEA/202-298-----TSDNVPGV----------------PGI------------------------GLKTAAALI.KEY.GSLEQLL---
G8M1J6_CLOCD/177-273-----TSDNIPGV----------------PGI------------------------GEKTALDLI.QNY.GTIENLY---
W0BAJ6_9GAMM/167-262-----PSDNVPGV----------------KKC------------------------GPKTAVNWL.NEY.KTLDNLI---
Q037Z0_LACC3/177-273-----TSDNYPGV----------------TKV------------------------GEKTALKLL.NQY.GSMENLY---
M5DN76_9GAMM/168-270-----KVDNIPGV----------------PKV------------------------GEKTAVGLV.AGL.GSLEDIY---
F9ZYR5_METMM/171-266-----AVDNIPGV----------------PKV------------------------GPKTAAKWL.QQY.GTLDNLV---
U5QFF5_9CYAN/185-280-----SSDRIPGV----------------KGI------------------------GAKTAVKLL.EEY.GSLEQLI---
A8GLI9_SERP5/171-273-----ASDNIPGV----------------PGV------------------------GEKTAQGLL.QGL.GGLDMLY---
K9UJT1_9CHRO/184-279-----KSDSIPGV----------------RGI------------------------GDKTAVKLL.NEY.GDLATIY---
G8PDR9_PEDCP/176-272-----SSDNYPGV----------------TKV------------------------GEKTALKLI.DQF.GSVENLY---
A6LG66_PARD8/173-266-----ASDNIPGC----------------PGV------------------------GEKTAQKLL.TEF.GSIENLL---
Q7VB64_PROMA/188-294-----SSDNIPGI----------------RGV------------------------GPKTAINLL.KEN.GDLDGIF---
A1R6E7_ARTAT/162-257-----TADNLPGV----------------PGV------------------------GPKTAAKWI.NLY.GGLEGIL---
Q8G5M4_BIFLO/182-277-----TADNIPGV----------------PGV------------------------GDGFAAKWI.NQF.GSLDGIC---
Q6F883_ACIAD/166-261-----ASDGIMGV----------------PGI------------------------GAKTAAKLL.TEY.GSIGGIL---
R5ZB65_9CLOT/178-272-----PSDNYKGV----------------PGI------------------------GDKTAFKLL.SEY.NHLEDIL---
Q3ABL3_CARHZ/170-265-----PSDNIPGV----------------PGI------------------------GEKTALDLI.KTY.GSVEEVL---
XNI_SHEFN/163-253-----SGNKIPGI----------------MGI------------------------GPKSAADLL.NKF.RTLANLY---
R5CL99_9BACT/174-267-----SADNIPGC----------------PGV------------------------GEKTAVKLI.NEF.GSVEQLL---
R6QV00_9FIRM/172-265-----SSDNIPGV----------------PGI------------------------GEKTATAII.TKY.KSIEAAY---
Q3IZ22_RHOS4/176-268-----SIDNVPGA----------------PGI------------------------GIKTAALLI.QEY.GDLESLL---
D9R358_CLOSW/216-337-----PSDNIPGV----------------KGV------------------------SS.AVPPLL.REY.GTVEEIY---
S5XSV3_PARAH/184-280-----SVDNVPGA----------------PGI------------------------GIKTAALLI.NEY.GDLETLL---
G0LBX7_ZOBGA/178-271-----ASDNIPGL----------------PGV------------------------GDKTAKKFI.EQF.GSMEELL---
F8GFG9_NITSI/166-261-----TADNVPGV----------------HKV------------------------GPKTAVKWL.TQY.GSLDNII---
Q2IQJ9_ANADE/171-273-----KIDNVPGI----------------PGV------------------------GEVTAAALV.RHF.GTTEAML---
F9YSB3_CAPCC/176-270-----TADNIPGL----------------PGV------------------------GEKTAKKLL.ADF.GSLENLL---
D6Z501_DESAT/169-265-----SSDNVPGV----------------PGV------------------------GPKTAAKLI.DQF.GSLEQLF---
A2SN70_METPP/168-256-----EKKSVPGV----------------AGV------------------------GPKTAAKLL.AQH.GDLDGVL---
Q0A4N7_ALKEH/170-265-----SSDNIPGV----------------PRV------------------------GPKTAAKWL.NQF.GSLDALK---
J7IX63_DESMD/170-266-----TSDNIPGV----------------PGI------------------------GEKTALKLL.WEF.ETVENVL---
Q9CLY4_PASMU/171-273-----SSDNIPGI----------------PGV------------------------GEKTALGLL.QGI.GSMAEIY---
B9E796_MACCJ/172-267-----KSDNIPGV----------------PGV------------------------GEKTALKLL.HEY.GTVEAVL---
DPO1_RICPR/170-265-----RSDNIPGV----------------PSI------------------------GPKTASSLI.TKF.GSVENIF---
Q4FP67_PELUB/181-276-----SSDNVPGV----------------PGI------------------------GVKTAAELI.NKY.GTLEKLL---
F6FUA3_ISOV2/181-276-----TSDNLPGV----------------AGV------------------------GPKTAAKWI.TTY.GSLEGLL---
B9DW03_STRU0/179-275-----KSDNIPGV----------------TKI------------------------GEKTGLKLL.QEY.GSLEGIY---
E3J1J7_FRASU/257-355-----PSDGLPGV----------------AGI------------------------GAKTAAALL.TRF.GSLAGAL---
E1SR02_FERBD/177-278-----KVDNIPGL----------------PGV------------------------GEKTALAML.QGI.GSLEAIY---
E6SGJ7_THEM7/179-274-----PSDNIPGV----------------PGI------------------------GEKTALKLI.QQF.GDLETVL---
Q6APA8_DESPS/167-263-----SADNIPGV----------------PGV------------------------GPKTAEKLI.NAH.GSLEGLY---
D0LWK7_HALO1/170-273-----SADGIPGL----------------PRW------------------------GAKSTATVL.AHY.GDLDAIP---
C7R9B2_KANKD/174-269-----KVDNIPGV----------------DKC------------------------GPKTAVKWL.EQY.GSLQGVI---
Q11BB3_CHESB/177-273-----TIDNVPGV----------------PGI------------------------GPKTAAQLL.EEY.GDLDTLL---
D3R1W1_MAGIU/172-263-----TSDAVPGV----------------PGI------------------------GKVSASKIV.GQF.SSLDEIY---
D8MKA1_ERWBE/171-273-----ASDNIPGV----------------PGV------------------------GEKTAQALL.QGL.GGIKDIY---
F0SQM1_RUBBR/167-263-----SVDNVPGV----------------PLV------------------------GPKKAAALL.EQF.GDLDSVL---
R6UF71_9FIRM/171-264-----TADNIPGV----------------KGI------------------------GEKTALKLL.SEY.ETVDNVY---
R7DDZ0_9PORP/177-269-----ASDNIPGC----------------PGV------------------------GEKTAIKLV.NEF.GSIENLL---
D4M514_9FIRM/173-269-----TADNIPGV----------------PGV------------------------GEKTATKII.QQY.QTIENAY---
A5IXV4_MYCAP/182-277-----SSDKLKGV----------------AGI------------------------GPKKAISLL.NEF.GTLEAIY---
D4IYH1_BUTFI/172-268-----SSDNIPGV----------------EGI------------------------GPKTAEKWI.AEY.GSIEECH---
I7HEA7_9HELI/166-260-----SSDNVMGV----------------KGI------------------------GAKSAQKLI.QRF.GSIESLY---
B7GGU2_ANOFW/171-267-----ASDNIPGV----------------PGV------------------------GEKTALKLL.KEY.GTVEHVL---
A5N5Z2_CLOK5/172-265-----ASDNIPGV----------------PGI------------------------GEKTALKLI.KEY.KSIENVL---
O96139_PLAF7/456-549-----KTDGISGV----------------PYI------------------------GDKTSKCLL.KEY.HNIENIL---
Q1MS67_LAWIP/175-270-----SSDNIPGI----------------PGI------------------------GLKTAKKIF.QDF.PSLESIK---
R5W9B4_9BACT/175-268-----AADNIPGV----------------PGI------------------------GEKSAVKLV.NEF.GTVENIL---
E3GJN4_EUBLK/172-267-----PSDNIPGV----------------AGV------------------------GEKTAIKLI.KEY.HNIDTLY---
L0K7A8_HALHC/173-265-----KSDNIPGV----------------DGI------------------------GDKTSTKLL.KEF.GGLEEVL---
Q6MEQ2_PARUW/168-263-----ASDNIPGL----------------TGF------------------------GPKTAADLL.EKF.GSLDYIL---
R7FD16_9FIRM/169-264-----SSDNIAGV----------------AGV------------------------GQKTASRLI.QAW.GTVENLY---
E6K1L6_PARDN/187-282-----QADNIPGV----------------PGV------------------------GDGYAAKWI.KEY.GGLAGIV---
R5AMR1_9CLOT/178-273-----TSDHIPGI----------------PGV------------------------GEKTALRLL.GEY.GTLNAVL---
Q31RU3_SYNE7/187-282-----SSDNIPGV----------------KGI------------------------GPKTAVDLL.QAW.GDLDRIY---
W5Y0Y8_9CORY/180-275-----SSDNLPGV----------------PKV------------------------GEKTALKWI.LQY.NDLDNLL---
C3PGL5_CORA7/175-270-----PSDNLPSV----------------PKV------------------------GEKTATKWI.TQY.GSLDALI---
F2LX06_HIPMA/164-259-----SIDNIPGV----------------KSI------------------------GPKTAASLL.AQY.KNIEGIL---
G7ZEH8_AZOL4/188-284-----SVDNVPGV----------------PGI------------------------GVKTAAQLI.TEY.GDLEALL---
F8B0K0_FRADG/200-297-----PSDGLPGV----------------PGI------------------------GVKTAAALL.RTF.GSLAAVR---
C8WRU1_ALIAD/184-280-----PSDNIPGV----------------PGV------------------------GEKTALKLL.ASF.GTVEGVY---
Q7VRJ4_BLOFL/173-275-----RADNIPGV----------------PGI------------------------GKKTAQIVL.NQI.GNLNILY---
Q9RIC9_YERPE/174-286-----TSDNIKGV----------------GGI------------------------GDGGAKELL.HEW.GSVAAMV---
H6LBF6_ACEWD/148-243-----KSDNIPGI----------------AGI------------------------GEKTAIKLL.QQY.GTLEKIY---
B9KYZ1_THERP/178-273-----PSDNIPGV----------------PGI------------------------GEKTATRLI.QRF.SSLEEML---
F0P321_WEEVC/179-272-----SVDNIPGI----------------PGV------------------------GEKTAIKFI.KTY.GSLEGLL---
R5QIS4_9PROT/172-268-----STDNVPGV----------------AGI------------------------GLKTAAQLI.NEY.GSLENLL---
A5UYS0_ROSS1/179-274-----PSDNIPGV----------------KGI------------------------GEAGAIALL.NQF.GSIENLY---
C4L471_EXISA/169-263-----KSDNIPGI----------------PGV------------------------GEKTALKLI.ATY.GTVEALY---
R5XS55_9CLOT/172-266-----KSDNIPGV----------------PGV------------------------GEKTGIKLL.KQY.STIENLI---
F9UNP5_LACPL/175-271-----TSDNYPGV----------------TKV------------------------GEKTALKLL.KQY.GTMEGIY---
R6XYH3_9CLOT/176-270-----TSDNIPGV----------------PGV------------------------GEKTALNLI.KQY.KSIDEVY---
R5D7S1_9FIRM/173-264-----SSDNIPGV----------------AGV------------------------GEKTAMDLI.QRY.TSVDYIY---
D5C0V6_NITHN/169-263-----PIDNIPGI----------------PGI------------------------GPKTAAKLL.DQY.HDLDQIM---
Q2NQR5_SODGM/171-273-----SSDNIPGV----------------PGV------------------------GEKTAQALL.QGL.GGLESLY---
L0IYF7_MYCSM/180-275-----PSDNLPGI----------------PGV------------------------GEKTATKWI.AEF.GSLQSLV---
A9NF42_ACHLI/178-269-----KSDNIPGV----------------PGV------------------------GEVTAKKLI.AEY.GTLENIL---
H9UMJ8_SPIAZ/172-268-----SSDNIPGV----------------KGI------------------------GAKTAVALL.ERF.TTLDGIY---
F2I663_AERUA/176-272-----NSDNYPGV----------------TGI------------------------GEKTALKLV.QEF.GSMEEVY---
R7LG65_9BACT/175-268-----TADNVPGC----------------PGV------------------------GEKTAAKLI.AQF.GSIDQML---
Q4KKJ9_PSEF5/168-271-----SSDNIPGV----------------PGI------------------------GPKTASGLL.VGVNGGLKELY---
L0EVN9_LIBCB/177-273-----SIDNIPGI----------------PGI------------------------GPKTAALLL.EEY.GNLDNIL---
XNI_SHEON/164-256-----SGNKIPGI----------------PGI------------------------GPKSAAELL.RTF.RTLATLF---
R6KBA3_9FIRM/172-268-----TSDNIPGA----------------PGI------------------------GPKTASALI.VQY.HDINNIF---
Q21LK9_SACD2/170-272-----VGDDIPGV----------------PGV------------------------GVKTAAQLL.THM.PSWAEVR---
K9Q3P1_9CYAN/182-277-----SSDNYKGV----------------KGI------------------------GEKTAIKLI.KEF.GTLDNIY---
Q2VZG0_MAGSA/170-266-----SSDNVPGV----------------PGI------------------------GVKTAAQLI.EEY.GDLDTLL---
V4J6J8_9DELT/138-234-----SSDNVPGV----------------PGV------------------------GVKTAAALI.GEY.ATLENLY---
R6MII8_9BACE/175-268-----TADNIPGC----------------PGV------------------------GEKTAQKLI.AQF.GSIENLL---
R6QAF8_9FIRM/171-268-----ASDNIPGV----------------AGV------------------------GAKTALDLI.ARF.HNLDNIY---
B3EMM5_CHLPB/200-295-----SSDNIPGA----------------KGI------------------------GPKTASKLL.TTY.GTLENVL---
A1WZS2_HALHL/167-262-----TSDNIPGV----------------PKV------------------------GPKTAAKWL.NAY.GSLDALR---
G8QPL7_AZOSU/169-264-----TVDNVPGV----------------AKV------------------------GPKTALKWL.EQY.GTLDNIM---
C6WB59_ACTMD/177-272-----SSDNLPNT----------------PGV------------------------GPKTIVKLL.GQF.GDLSGLV---
EX53_BUCAI/172-274-----ATDNIPGV----------------PKI------------------------GIKTALFLI.NKF.SNIENIY---
Q3IJF9_PSEHT/172-266-----KVDNIPGV----------------EGC------------------------GPKTAVKWL.EKY.GSLQGVM---
A4G1I4_HERAR/166-256-----VSDSIPGV----------------SKV------------------------GVKTAAKLL.QSY.GNIERIM---
A6LP98_THEM4/175-270-----QIDNIPGV----------------KGI------------------------GKKTAVSLL.KKY.GTIDEVL---
E0UAJ6_CYAP2/188-281-----KSDSIPGI----------------LGI------------------------GEKTAATLL.KEY.GSLEGIY---
R7N312_9FIRM/172-266-----TADNIPGV----------------PKV------------------------GEKTATDLM.VQF.GSLDGIY---
H6N2L0_GORPV/209-306-----PSDGLPGV----------------SGI------------------------GEKTAAKLI.TEY.GGLDELE---
D3PXU6_STANL/185-280-----KSDNLPGV----------------PGV------------------------GPKTAAKWI.TTY.EGLDGVI---
F4CVY8_PSEUX/190-286-----PSDGLPGV----------------PGV------------------------GAKTAATLV.SRF.ESWDQLR---
E3PRM3_CLOSD/182-277-----QSDNIPGV----------------AGI------------------------GEKTGIKLL.KEY.GSIENIY---
S6B9L3_9GAMM/170-265-----TSDNIPGV----------------PKV------------------------GPKTAAKWL.QQY.GSLDELV---
B6YQQ9_AZOPC/171-265-----SSDNIPGC----------------PGI------------------------GEITAKKLI.ARF.GSIENLL---
K0AXU1_CLOA9/173-267-----KSDNIPGV----------------PGI------------------------GEKTGVKLL.KEF.KTIEGIY---
D1BHM6_SANKS/184-279-----TSDNLPGV----------------PGV------------------------GPKTAAKWI.NQF.GSLEQIL---
G2IKI1_9SPHN/173-267-----SVDNVPGV----------------PGV------------------------GAKTAAKLI.LEY.GDLDTVL---
M9X5P1_MANHA/171-273-----SADNIPGV----------------KGV------------------------GEKTALALL.QGI.GSLEQIY---
A5WH47_PSYWF/217-309-----ASDGIKGI----------------PSV------------------------GQKTAVKWL.NQY.QTVDNIL---
I6ZED3_MYCWM/176-271-----SSDNYSGI----------------PGI------------------------GPKNATKLI.TDY.QTKERLL---
D2NTK8_ROTMD/185-275-----QADNLPGV----------------PGV------------------------GPGFAAKWL.GEY.GSLQGVL---
L0GZC9_9GAMM/169-262-----SVDNIPGV----------------AGC------------------------GPKTAAKWL.AAY.GDLDGVI---
I7CEP7_MYCHA/169-259-----SADNYPGV----------------PGI------------------------GKINAVKLI.QTY.KTVDRLI---
R7K1U1_9CLOT/173-269-----ASDNIPGV----------------AGV------------------------GEKTAVKVL.TAF.PTVEEAY---
EX53_AQUAE/166-258-----KVDNVPGI----------------EGV------------------------GPKTAINIL.KKY.GSVENIL---
F1A1K6_DICPU/435-530-----KVDNIPGI----------------PKI------------------------GPKTATEII.KQY.GTLHEII---
M1PQ39_DESSD/167-261-----SSDNVPGV----------------PGV------------------------GPKTAEKLI.NEH.GTLEGVY---
I3YTZ8_AEQSU/177-270-----SSDNIPGL----------------PGV------------------------GEKTAKKFL.AEF.GSMEGLL---
Q16D72_ROSDO/178-274-----SVDNVPGA----------------PGI------------------------GIKTAALLI.NEF.GDLDALL---
Q2JPZ4_SYNJB/179-274-----PSDNIPGV----------------KGI------------------------GPKRAVELL.ERY.GSLDEIF---
M4RCF9_9BIFI/194-289-----TADNIPGV----------------PGV------------------------GDGYAAKWI.GQY.GSLQGII---
E3FFI6_STIAD/174-270-----AVDNVPKV----------------PGI------------------------GDKTAAALL.QQF.GDVDTML---
Q5NR03_ZYMMO/177-273-----TADNIPGV----------------PGV------------------------GPKTASRLI.NEY.GNLSEIL---
B1GZ14_UNCTG/167-262-----ASDNIPGI----------------KGI------------------------GEKTAVKLI.EKF.GNLENVL---
Q31JN2_THICR/176-271-----SSDNIPGI----------------PKC------------------------GPKTAAKWI.SEY.GSIDNLI---
E0TER0_PARBH/193-287-----STDNVPGV----------------PGI------------------------GPKTAAQLL.EDY.GSLDALL---
F7V5J2_CLOSS/173-269-----SSDNIPGV----------------PGI------------------------GEKTATKLI.VRY.HSIENAY---
A8FG44_BACP2/173-269-----SSDNIPGV----------------PGV------------------------GEKTAIKLL.KQF.ETVENLL---
XNI_EDWI9/160-250-----GSSKIPGI----------------SGI------------------------GAKTAAALL.KEF.GSLEALY---
R6ELL6_9FIRM/174-267-----TADNIPGV----------------PKV------------------------GEKTAQALM.VEY.GSLDNIY---
R5HTX0_9FIRM/212-322-----PGDGIPGC----------------KGV------------------------.SSAAAPLV.EEY.RSLDAIY---
J7TPK9_MORMO/171-273-----SSDNIPGV----------------PGV------------------------GEKTAQALL.QGL.GSLDDIY---
A5CDT3_ORITB/192-288-----VSDNIPGI----------------PGI------------------------GPKTAIKLL.EQF.DSLNNIL---
G8PJG2_PSEUV/191-285-----SVDNVPGV----------------PGI------------------------GLKTAALLI.NEF.GDLDTLL---
R7FJM3_9CLOT/175-274-----ASDNIPGV----------------PGI------------------------GEKTALSLV.QKY.ETIDNLY---
Q7VLZ7_HAEDU/171-273-----ASDNIPGV----------------KGI------------------------GEKTALALL.QGI.GSLQTIY---
R5N950_9FIRM/173-267-----SSDNIPGV----------------KGI------------------------GEKGALKLL.QEY.KTLDGIY---
I3TQL1_TISMK/174-270-----STDNVPGV----------------PGI------------------------GVKTAAQLI.GEY.GDLDTLL---
H2J333_MARPK/175-267-----TADNIPGV----------------KGI------------------------GEKTATKLI.KEY.GTLEEIY---
F2I018_PELSM/179-275-----SSDNIPGV----------------PGI------------------------GIKTAAELI.NQF.GSLEKVL---
Q88RK6_PSEPK/169-271-----KVDNIPGV----------------PGV------------------------GEKTAVGLL.TGIGGGLSDLY---
E6VUY6_DESAO/178-268-----SADNIPGI----------------PKV------------------------GPVTARKIM.ETC.PTLEALR---
K0NC96_DESTT/176-272-----SSDNIPGV----------------RGV------------------------GPKTAIKLI.AQF.GSIENLY---
I2EZX2_EMTOG/177-270-----AVDNIPGV----------------PGV------------------------GEKTAAKLI.ATY.GSIENMY---
I0AJT1_IGNAJ/175-270-----SSDDIPGV----------------PGI------------------------GPKTAVPLI.QQF.GTIENIY---
C7PIM1_CHIPD/176-269-----AVDNIPGI----------------PGV------------------------GEKTAMKLL.SQY.HSVEEVI---
C4LIB4_CORK4/182-277-----TSDNMPGV----------------PGV------------------------GPKTAQKWI.NKY.GSLSNLI---
C6WIF4_ACTMD/224-320-----PSDGLPGV----------------AGI------------------------GEKTAAKLI.TEF.GSLEALL---
Q2N5T3_ERYLH/177-270-----SVDNIPGI----------------FGV------------------------GPKTASKLI.DEH.GSLTAAL---
K4IIV0_PSYTT/178-271-----AADNIPGL----------------PGV------------------------GEKTAKKFL.QQF.GSMEVLL---
F2JQB5_CELLD/174-264-----ASDNIKGV----------------PGI------------------------GEKTAIKLI.KEY.GSIENLL---
K9TRE8_9CYAN/187-282-----TSDNIPGV----------------KGI------------------------GDKTAIKLL.TSY.GSLDQIY---
C1F7K7_ACIC5/199-295-----AIDNVPGA----------------PGI------------------------GEKGSVDLI.QQF.GSVEAAL---
R7GC82_9CLOT/175-274-----TSDNIPGV----------------PGI------------------------GEKTALSLI.QKY.GTIENLY---
R6LP39_9FIRM/172-264-----SSDNIPGV----------------AGV------------------------GPKTATGLL.LQY.GTLDGIY---
K0P2A0_9BACT/177-271-----PSDFIPGI----------------PSI------------------------GKKTARKLI.KEF.DNLENIL---
B3ERA5_AMOA5/181-273-----AVDNIPGI----------------PSI------------------------GIKTAQKLI.QQF.GTLENLL---
B0RET1_CLAMS/178-273-----TSDNLIGV----------------DKV------------------------GPKTAVKWL.NQY.GSLDAVL---
R7CBS4_9CLOT/173-269-----ASDNIPGV----------------PGI------------------------GEKTAVKIL.TMF.GTVENAI---
H0PRU4_9RHOO/166-261-----TVDNVPGV----------------EKC------------------------GPKTAVKWL.TEY.GTLDNLV---
U3GZ53_9CORY/176-269-----PSDNMPGI----------------PGV------------------------GEKTAQKWI.VGY.GSLAQLL---
J3YSZ2_9ENTR/171-272-----KTDNIPGV----------------PGI------------------------GRKTAQILL.EKI.GGVKILY---
R5QUL8_9FIRM/173-264-----SADNIPGI----------------PGI------------------------GEKTALKLL.NQY.GTIENLK---
R5LC84_9FIRM/172-266-----SSDNIPGV----------------PGI------------------------GEKGATTII.EQF.GSIENAY---
M4NJY5_9GAMM/175-274-----SVDNIPGV----------------PGV------------------------GAKTAAALL.SHF.GSLDALL---
K7W024_9NOST/191-286-----KSDNIPGV----------------KGI------------------------GEKTAVQLL.NTY.NSLEEIY---
Q2RNI7_RHORT/169-265-----AVDNVPGV----------------PGI------------------------GVKTAAQLI.GEY.GDLETLL---
B0S404_FINM2/171-270-----KSDNIPGI----------------DGV------------------------GEKTALKYI.QKY.GSIEGLY---
C7N051_SACVD/183-278-----PSDNLPGI----------------PGV------------------------GEKTAAKWI.RQF.GSLGELI---
F5YMP5_TREPZ/203-295-----TSDNVPGV----------------KGV------------------------GEKTAVKLM.ARY.SSLDEIY---
C5CBM1_MICLC/181-276-----AADNLPGV----------------PGV------------------------GPGFAAKWL.KQY.GDLDGVL---
I2F4A9_9BACT/174-269-----SSDNIPGV----------------PGI------------------------GIKTAQKLL.KEY.GDIEGIY---
W8ETE5_9BACT/199-292-----ASDNIPGI----------------PGI------------------------GEKTAKALI.QKY.GSVENLI---
K9V8S4_9CYAN/202-297-----TSDNIPGV----------------KGI------------------------GDKTAVQLL.NTY.GSLENIY---
B0JWF3_MICAN/189-283-----KSDNIPGV----------------RGI------------------------GEKTAIDLL.KKY.DNLDDIY---
R6MD53_9CLOT/174-267-----ASDNIPGV----------------KGI------------------------GEKGAIKLV.SEY.KTIDNIY---
D5UIK3_CELFN/200-296-----PSDGLPGV----------------PGI------------------------GEKTAASLL.ARY.GTLEGVL---
E3D9A0_GARV3/189-284-----TSDNIPGV----------------PGV------------------------GDGYAAKWI.NQF.GGLEGII---
A7HJZ2_FERNB/180-275-----VSDNIPGV----------------SGI------------------------GEKTAAKIL.NEF.GSVENAL---
R5K4V0_9CLOT/172-266-----TSDNIPGV----------------PGI------------------------GEKTAAKLM.IEY.GSMENIL---
I5B001_9DELT/169-264-----TSDNIPGV----------------KGV------------------------GMKTAVALI.AEY.GSINNIY---
E4T6I9_PALPW/175-267-----ASDNIPGC----------------PGV------------------------GEKTAVKLL.KEF.GSIDTLL---
T0V5M9_9STRE/54-150-----KSDNIPGV----------------TKI------------------------GEKTGIKLL.LEY.GSLDGIY---
D3PLE6_MEIRD/183-277-----SSDNLPGA----------------KGI------------------------GEKTAAKLL.QEW.GSLEGLY---
W0F3Z1_9SPHI/177-269-----AVDNIPGI----------------AGV------------------------GEKTAAKLL.AEY.DTLENVV---
R7GCW0_9CLOT/93-187-----KSDNISGV----------------PGI------------------------GIKKAVKYL.CEY.KSVEGIL---
E3DNP8_HALPG/178-274-----SSDNIPGV----------------PGI------------------------GKKTALKLL.KEF.GTMEEIL---
C6C0R6_DESAD/177-272-----SADNIPGV----------------PGV------------------------GKVTATKIM.AEY.PTLEDIR---
Q8EWK4_MYCPE/176-272-----SSDNLPGI----------------KGL------------------------GNKTAIDLL.QKY.KSLESIY---
D9QA32_CORP2/176-271-----PSDNLPNI----------------PGV------------------------GPKTATKWI.VEY.GSLDELL---
M1FGF1_9ALTE/171-266-----KVDNIPGV----------------NKC------------------------GPKTAVKWL.QEY.HDIDNLM---
B0TER6_HELMI/172-265-----PSDNIPGV----------------PGV------------------------GEKRAFKLL.EQF.GDMDSLY---
I1YTV8_PREI7/172-266-----SADNFPGC----------------PGV------------------------GEKTAAKLI.NQF.GSIDNML---
D7GES4_PROFC/175-270-----TSDNLTGV----------------PGV------------------------GPKTAAKWL.AKY.GDLANLL---
F8ED14_RUNSL/179-271-----AVDNIPGI----------------PGV------------------------GEKTAQKLI.EEF.GSIENLL---
G8R2X9_OWEHD/180-272-----SADNIPGF----------------PGV------------------------GPKTASKLL.KQY.GSMENML---
D7DVE6_NOSA0/199-294-----KSDNIPGV----------------RGI------------------------GEKTAVKLL.NTY.NSLDGIY---
F4KQP4_HALH1/178-270-----AVDNIPGI----------------PGV------------------------GEKTAAKLL.DRF.DTIEGVI---
F5XRP8_MICPN/175-270-----SSDNLPGI----------------PGV------------------------GPKTAAKWL.AAY.DGLDNLI---
R6TEL9_9STAP/176-269-----KSDNLPGI----------------SGV------------------------GDKTAIKLL.HEY.QTLENII---
Q73M72_TREDE/173-267-----SADNVPGI----------------KGV------------------------GPKTAVKLL.EEY.KSLDGIY---
R5BEA4_9CLOT/169-259-----NSDNIPGI----------------PGV------------------------GEKTALKLL.AKY.GTVENTL---
W0E5X0_MARPU/169-264-----SVDNVPGV----------------PKC------------------------GPKTAVKWL.AAH.GDLDGVI---
K6YT30_9ALTE/176-271-----KVDNIPGV----------------DKC------------------------GPKTAAKWL.AEH.GTLEQVM---
I4EZI8_MODMB/169-264-----PSDNLPSI----------------PSV------------------------GEKTAAKWV.REY.GSLDALV---
R6RUP1_9CLOT/172-268-----TSDNIPGV----------------PSI------------------------GEKTATNLI.LQF.GSMGGVY---
F4HEL1_GALAU/173-275-----SSDNIPGV----------------PSV------------------------GNKTAIALL.QGL.GGIADIY---
U5LD81_9BACI/171-267-----SSDNIPGV----------------PGV------------------------GEKTAIKLL.KEF.ETLENLL---
F5XGU5_MICPN/193-287-----PSDGLPGV----------------AGI------------------------GEKTAASLI.NSY.GGLSEII---
Q9X1V4_THEMA/174-269-----EIDNIPGV----------------TGI------------------------GEKTAVQLL.EKY.KDLEDIL---
G0J2E4_CYCMS/180-272-----AVDNIPGI----------------PGI------------------------GAKTAVKLL.KQF.GSIEELV---
F7YV74_9THEM/173-267-----SVDNVPGV----------------KGI------------------------GEKTAVELV.TKY.GSIENIK---
F0QQW3_MYCSL/158-251-----ASDNYSGI----------------PKI------------------------GPKTATKLI.QQF.KTENIFL---
R6J384_9PROT/167-262-----SIDNVPGV----------------PGI------------------------GPKTAAELV.NQF.GSLEGVL---
B7GFD9_ANOFW/173-266-----PSDNYPGV----------------RGI------------------------GEKQAVKLI.QQY.GSIEGII---
K3XCE0_PYTUL/229-321-----RWGKIKKV----------------DHM------------------------TEERAVELL.TEY.GSLPKLL---
E8R2K2_ISOPI/172-268-----AVDNVPGV----------------PGI------------------------GLKTAVKLL.NEF.GTLDQLL---
R6EAU9_9FIRM/173-269-----TSDNIPGV----------------PGI------------------------GEKTATKLI.TEY.KTIENVY---
C7NHH1_KYTSD/172-267-----SADNLPGV----------------PGV------------------------GPKTAAKWL.GLY.GDLGGVV---
R6U8Y4_9FIRM/167-264-----TSDNISGV----------------KGI------------------------GEKTALSLI.KQE.GDVKTLY---
Q24XW3_DESHY/170-266-----ASDNIPGV----------------PGV------------------------GEKTALKLL.WEY.GSVENVL---
Q11NX3_CYTH3/176-268-----TVDNIPGI----------------PGI------------------------GEKTAQKLI.ADF.GSVENLI---
Q3AU68_CHLCH/162-256-----TSDNIVGA----------------KGI------------------------GPKTAATLL.EKY.QTLDKLY---
R5VPM4_9FIRM/172-267-----ASDNIPGV----------------KGI------------------------GEKTAFDLI.IRF.GSVQEVY---
R6NS01_9FIRM/173-265-----TADNIPGV----------------PGI------------------------GEKTATNLI.VAY.GSIENAY---
J7Q7K7_METSZ/195-293-----STDNVPGA----------------KGI------------------------GVKTAAQLI.NEY.GDLETLL---
R7G673_9FIRM/172-263-----SADNIPGV----------------KGI------------------------GEKTAIKLL.KEY.QSVDNVY---
U5LBK9_9BACI/178-273-----PSDNYPGV----------------KGI------------------------GEKTALKLL.QQF.EHVDGVI---
R7KEQ4_9CLOT/173-265-----ASDHIQGV----------------KGI------------------------GEKTAINLL.TKY.QSLDNVY---
M4U1M4_9GAMM/171-273-----TADNIPGV----------------PGV------------------------GSKTALAML.QGI.GSMDLIY---
D4K0Z3_9FIRM/171-271-----TSDNIPGV----------------KGI------------------------GEKSAFALI.QKY.GSLEGVY---
R7F578_9CLOT/175-275-----TSDNIPGV----------------PGI------------------------GEKTALKLI.QEY.KNVENLY---
R7C0B0_9BURK/166-261-----KVDNVPGI----------------NKC------------------------GPVTAAKWI.NEW.GSLDNLV---
R6UGN2_9CLOT/167-264-----TSDNIPGV----------------KGI------------------------GQKGASELI.EKY.GSLDYIY---
E6U0L1_BACCJ/170-266-----ASDNIPGV----------------PGV------------------------GEKTALKLL.KQF.GTVEKLY---
E3I1L3_RHOVT/219-315-----SVDNVPGV----------------PGI------------------------GIKTAAELI.REY.GDLENLL---
G7US80_PSEUP/166-260-----SVDNVPGV----------------DKC------------------------GPKTAAKWL.SQY.GSLEGVI---
B8ESM1_METSB/197-295-----STDNVPGA----------------RGI------------------------GLKTAAQLI.GEY.GDLDTLL---
D4ZRD9_ARTPN/182-277-----KSDCIPGV----------------RGI------------------------GEKTAVKLL.AEY.GSLDSIY---
V5WDN6_9SPIO/172-266-----SADNVPGV----------------KGI------------------------GQKTAEKLL.GQY.ESLDGIY---
Q8EPE5_OCEIH/171-267-----SSDNIPGV----------------PGV------------------------GEKTATKLL.KQY.ENLENVY---
C8W0H1_DESAS/180-275-----PSDNIPGV----------------PGI------------------------GPKTATKLL.QDF.DSVENIL---
C0QU83_PERMH/167-261-----TVDNIIGV----------------RGV------------------------GPKTAEKLL.NQY.GNLKNIL---
Q5YUY4_NOCFA/203-299-----ASDGLPGV----------------PGI------------------------GDKSAATLI.SRF.GSLEALC---
XNI_TOLAT/168-258-----SGMNIKGV----------------PGI------------------------GEKTAQQLL.SEY.GTLTQLL---
R5EKW2_9GAMM/171-272-----DSDNIPGM----------------KGA------------------------GEKTAICLL.NEI.GGVEEIL---
O84500_CHLTR/167-258-----SSDNIPGV----------------SGC------------------------GPKKAQALL.KEF.QSVEELV---
B2FPZ4_STRMK/173-274-----AVDNIPGI----------------SGV------------------------GSKSAAVLL.AHF.GSMDALY---
XNI_VIBCH/165-255-----SSSQIPGV----------------AGI------------------------GPKAAKEIL.NQF.SSIEEAY---
R5IBR3_9FIRM/173-269-----SADNISGI----------------PGV------------------------GEKNATRLI.KEY.GTVENAY---
I3Y5S4_THIV6/169-264-----SADNVPGV----------------PKC------------------------GEKTAVKWI.AEY.GGLEGVI---
E6WVL3_PSEUU/185-285-----AVDNIPGV----------------GGI------------------------GAKTAAILL.SHF.GSLDELL---
L0EEC2_THECK/170-265-----ASDNIPGI----------------PGV------------------------GEKTALKLL.HEY.GSVENVL---
A1SL23_NOCSJ/173-268-----TSDNLPGV----------------PGV------------------------GQGYAAKWI.NQF.DGLDNVI---
R5TEB2_9FIRM/173-265-----SSDNIPGV----------------PGI------------------------GEKTATNLI.VAY.KSIENAY---
D5UF67_CELFN/184-279-----TSDNLPGV----------------PGV------------------------GPKTAAKWI.TQY.DGLAGVL---
T2G8I4_DESGI/186-281-----TSDNIPGV----------------SGI------------------------GPKTALAIF.KEH.PTLEAVQ---
E8RQH2_ASTEC/173-269-----STDNVPGA----------------PGI------------------------GIKTAAQLI.LEY.GSLDALL---
F2F6K3_SOLSS/175-268-----TSDGYPGV----------------KGI------------------------GPKTALQLI.QNH.GSIDGVL---
A3QJD2_SHELP/186-287-----KADNIPGL----------------PGV------------------------GEKTALAML.QGV.GGVEAIL---
V5RWD4_9BACT/175-268-----SSDNIPGV----------------PGV------------------------GEKTGIQLL.QQY.ETLDGIY---
B0SKP9_LEPBP/174-267-----ASDNIPGV----------------KGI------------------------GEKGAAKLI.QEF.GDLETIY---
R7ABN5_9FIRM/171-265-----SSDNIPGV----------------TGI------------------------GEKGATKLL.VQY.GSLENVY---
K9ZHK4_ANACC/197-291-----PSDNIPGV----------------KGI------------------------GEKTAVKLL.NTY.NSLDNVY---
Q0ATS5_MARMM/180-275-----SVDNVPGV----------------PGI------------------------GVKTAALLI.NEY.GDLDTLL---
H8KN11_SOLCM/177-269-----AVDNIPGV----------------PGI------------------------GEKTAKTLI.QKY.GSMENIF---
M4CRQ1_BRARP/278-374-----KSDNIPGI----------------DGI------------------------GNVHAVELL.SRF.GTLENLL---
R7P9N0_9BACT/190-283-----TADNIPGC----------------PGV------------------------GEKTAVKLI.GQF.GSIEQLL---
R4T218_AMYOR/194-288-----PSDGLPGV----------------AGI------------------------GEKTAAKLI.TQF.GSLQELI---
K9RZ96_SYNP3/185-277-----TSDNIPGV----------------RGI------------------------GPKTAVQLI.EQF.ETLDNIY---
F0S258_DESTD/171-265-----SVDNIPGV----------------PSI------------------------GEKTAQKLI.AEF.GNLENLY---
Q2YBJ5_NITMU/166-261-----AVDNIPGV----------------AKV------------------------GPKTAVKWL.NQY.GTLDNLL---
R6RI51_9FIRM/174-269-----TADNIPGL----------------PGV------------------------GEKTATKLL.LEY.KNVENAY---
F6CPB6_DESK7/172-267-----PSDNIPGV----------------PGI------------------------GPKTAKALL.KEY.GCLEELV---
R6DD71_9FIRM/176-269-----SSDNIPGV----------------PGI------------------------GEKTAMALV.QQY.GSIDAVY---
D6GPI6_FILAD/170-265-----SSDNIPGV----------------AGI------------------------GEKTGIKLL.KEY.DSIENLI---
R5FXK7_9ACTN/172-267-----KSDNIPGV----------------PGI------------------------GDKKAASML.QSY.GNLEGIY---
C7N982_LEPBD/177-272-----KSDGIPGV----------------AGI------------------------GPKNGVKLI.TTY.GNLEGIY---
Q38VS4_LACSS/177-273-----TSDNYPGV----------------TKV------------------------GEKTALKLL.TEF.GSIEGVY---
I6Y5E6_PROPF/172-267-----TSDNLPGV----------------PGV------------------------GPKTAAKWI.NTY.DGLANII---
D3DHF4_HYDTT/166-258-----QTDNIEGV----------------KGI------------------------GKKTAIKVL.EKY.GSIENIL---
C5BC85_EDWI9/171-273-----ASDNIPGV----------------PGV------------------------GEKTAQALL.QGI.GSLKTIY---
Q5KWC1_GEOKA/173-269-----KSDNIPGV----------------PGI------------------------GEKTAVKLL.RQF.GTVENVL---
Q3B2D2_PELLD/198-293-----TSDNIPGA----------------EGI------------------------GPKTATSLL.ARF.GSLEEVY---
Q8DJ89_THEEB/183-277-----ASDRIPGI----------------KGI------------------------GPKTAVQLL.SQY.PTLEDIY---
F6FW43_ISOV2/196-291-----PSDGLPGV----------------PGI------------------------GEKTAVKLL.TTF.GDLDAIR---
D5WSS1_KYRT2/174-267-----TSDNIPGV----------------PGV------------------------GERTAAKLL.QAY.GNVEGVY---
F8IBU6_SULAT/171-265-----SSDNIPGI----------------PGI------------------------GAKTAVALI.ERY.HHIDALY---
G0GCU2_SPITZ/170-265-----ASDNIPGV----------------EGI------------------------GEKTARRLL.AEY.GSLEGVY---
Q1LTX9_BAUCH/164-266-----KSDNIPGV----------------PGI------------------------GKKTAKILL.QQF.GGLKFLY---
Q30VQ3_DESAG/177-272-----SSDNIPGV----------------PGV------------------------GPKTAAQIF.AEF.PTLEAIQ---
D5CPR3_SIDLE/166-261-----TVDNVPGV----------------AKC------------------------GPKTAVKWL.TQY.GTLDNLL---
Q9PEC5_XYLFA/166-261-----AVDNVPGV----------------DKC------------------------GPKTAAKWL.AEY.GSLDAVI---
A3HU84_9BACT/181-273-----SVDNIPGI----------------PGI------------------------GQKTAVKLL.KQY.GSVEELI---
B4EZ66_PROMH/171-273-----SSDNIPGV----------------PGV------------------------GEKTALGLL.QGL.GSLEDIY---
Q04G12_OENOB/189-285-----TSDHYPGV----------------TKV------------------------GLKTAIKLL.NEF.GSLDGIY---
F4H8B8_CELFA/197-292-----PSDGLPGV----------------AGI------------------------GEKTAATLV.HRY.GSLDGIL---
Q07W46_SHEFN/172-273-----KSDNIPGL----------------PGV------------------------GEKTALAML.LGM.GSVENIL---
B8I3Y7_CLOCE/178-274-----TSDNIPGV----------------PGI------------------------GEKTALALI.KKF.NSLEELY---
G2SP45_LACRR/177-273-----TSDNYPGV----------------SKV------------------------GEKTALKLL.NQY.GTIENLY---
R5TJ55_9CLOT/172-267-----ASDNIKGV----------------KGI------------------------GEKTALKLL.KEY.DTIENLY---
I6ZUV3_MELRP/174-270-----SSDDIPGV----------------AGI------------------------GPKTAAPLI.RKF.GSLEKIY---
Q03GC3_PEDPA/176-272-----TSDNYPGV----------------TKV------------------------GEKTAIKLL.KQF.DSLENLY---
R6WE37_9FIRM/173-269-----TSDNIPGV----------------PSI------------------------GEKTAARII.TEY.HSIENAY---
D6ZD58_SEGRD/176-271-----PSDNLPKI----------------PGV------------------------GEKTAASWV.RAY.NSLDELL---
D3SBR3_THISK/179-274-----SVDNIPGV----------------DKV------------------------GPKTAAKWI.AKY.GDLDTIL---
A1S1P9_SHEAM/172-273-----KADNIPGL----------------PGV------------------------GEKTALAML.TGA.GGVAKLL---
K4KZZ9_SIMAS/167-269-----KVDNIPGV----------------PGV------------------------GEKTALGLL.QGL.GSLDSIY---
D3IBX4_9BACT/174-267-----SADNFPGC----------------PGV------------------------GEKTAIKLI.NDF.KSINNLL---
Q1AUF6_RUBXD/180-272-----PSDNIPGV----------------RGI------------------------GPKSAAALL.RRF.GSLEALY---
D4LAD7_RUMC1/169-264-----SSDNIKGV----------------PGI------------------------GPKTATGLI.QTY.GTIEELY---
K9SVR3_9SYNE/185-280-----NSDNISGV----------------RGI------------------------GEKTAVKLL.DEY.GSLENIL---
R5TX51_9CLOT/215-337-----TSDNIPGV----------------KGV------------------------SS.AVPPLL.AEY.GTVEAMY---
R7G2L8_9FIRM/173-267-----TADNIPGV----------------PSI------------------------GEKTATKII.TQY.HSIEEAH---
XNI_COLP3/181-275-----NTNKIEGV----------------SGI------------------------GQVTAAKLL.NQY.GSLKAIL---
Q1WUN8_LACS1/179-274-----TSDNYPGV----------------TKI------------------------GEKTAIKLL.KQY.GTLDGIY---
B1MBS5_MYCA9/183-278-----PSDNLPGI----------------PGV------------------------GEKTASKWI.LEY.GSLQELV---
R5FRW3_9BACT/173-266-----SADNYPGC----------------PGV------------------------GEKTAVKLI.NQF.GSCEGLL---
R6A8W8_9BACT/175-268-----TADNVPGC----------------PGV------------------------GEKTAVKLI.TQF.GSIDNLL---
D2QFD0_SPILD/180-272-----SVDNIPGI----------------PGI------------------------GEKTAQKLI.ADF.GSVENLI---
R7AJW0_9BACE/172-268-----SSDNIPGA----------------PGI------------------------GEKTAGAII.QKF.GSVENAY---
D7B0J6_NOCDD/191-285-----KADNLPGV----------------PGV------------------------GPKTAAKWI.TKY.GSLDELV---
Q0AVE2_SYNWW/171-267-----ASDNIPGV----------------PGV------------------------GPKTAMKLV.QEF.TSLENLY---
Q2S8M8_HAHCH/174-269-----TVDNIPGV----------------NKC------------------------GPKTAVKWL.GEF.GSLAQVI---
W5WWD0_BDEBC/166-262-----ASDNVPGV----------------KGV------------------------GEKGAVKLL.QQF.PTLEAIY---
R5PV85_9BACT/173-266-----SADNFPGC----------------PGV------------------------GEKTAAKLI.AQF.GDVDNML---
Q6A9N6_PROAC/216-311-----SADHLLGV----------------PGV------------------------GPKTAVKWL.TAY.DGLENLI---
D1AJI6_SEBTE/174-269-----KSDGIPGI----------------QGI------------------------GPKTGVELI.SKY.GNLETLY---
A9B4G4_HERA2/177-272-----TSDNIPGV----------------KGI------------------------GEAGAISML.NEW.GSVENIY---
R7MRJ4_9FIRM/169-264-----SSDNIKGV----------------AGI------------------------GEKTAKSLV.ANY.GTIENLY---
Q8F071_LEPIN/175-270-----TSDNIPGV----------------KGI------------------------GDKGASKLL.QEY.KSLDGVY---
R6YML3_9CLOT/175-274-----TSDNIPGV----------------PGV------------------------GPKTAISLI.QRY.HSVKELY---
R7BQN1_9ACTN/176-271-----KSDNIPGV----------------PGI------------------------GEKKAASML.KEY.GTLEGIY---
M5A121_9ACTN/173-264-----NSDNLPGV----------------PGV------------------------GEKTAAKLI.NKY.GGLDGIF---
D3VCL0_XENNA/159-249-----SSSKIPGI----------------QGI------------------------GPKTAATLL.QQT.GSLDNLF---
C7M492_CAPOD/176-269-----AVDNIPGL----------------PGV------------------------GEKTAKKLL.ADF.GSMENLL---
F0RC33_CELLC/177-270-----SVDNIPGL----------------PGV------------------------GEKTAKKFL.ATY.GSMENLL---
G4RBR0_PELHB/177-273-----PVDNVPGI----------------PGI------------------------GVKTAALLI.NEY.GDLETLL---
Q1QR04_NITHX/205-301-----SVDNVPGV----------------PGI------------------------GVKTAAQLI.TEY.GDLETLL---
R5SPL0_9FIRM/173-265-----ASDNIPGV----------------PGI------------------------GEKTAMALV.QKY.RSIDEIY---
B8FKR7_DESAA/166-262-----SSDNIPGV----------------PGI------------------------GPKTAIALI.QEF.GSLEGVY---
D5UR61_TSUPD/196-291-----PSDNLPGI----------------PGV------------------------GEKTAAKWI.REY.GSLEGLV---
A6TSU6_ALKMQ/172-268-----NSDNIPGI----------------PGV------------------------GEKTAIKLL.KQF.GTVENLI---
R5K144_9CLOT/173-269-----ASDNIPGV----------------PGI------------------------GEKTATKII.EQY.QSIENAY---
L0DJS8_SINAD/169-265-----TADNVPGI----------------PGI------------------------GLKTGAKLL.EEF.GDLETLL---
R7J3M2_9BACT/178-271-----VSDNVPGC----------------PGV------------------------GEKTAVKLI.AQW.GNIDNML---
EX53_BUCBP/173-271-----NSDNIPGV----------------PTV------------------------GKKTALILL.KTF.GSLENIY---
F2NP76_MARHT/174-270-----ASDNIPGV----------------RGI------------------------GAKTAAKLL.AEW.GSLENLY---
D6XST5_BACIE/171-267-----SSDNIPGV----------------PGV------------------------GEKTALKLL.KEH.GSVEEVY---
R5HHS2_9SPIR/177-273-----TSDCIPGI----------------RGI------------------------GEKTAQKLL.SRY.STLAGVL---
C4Z982_EUBR3/173-264-----TSDNIPGV----------------PGI------------------------GEKTAGALI.AKY.HCIEAVH---
D5V8Q1_MORCR/195-290-----ASDGISGI----------------PKV------------------------G