Sequence alignment for CL0468

PF11721

Y1972_ARATH/435-593TNAASNQQFDYW..--..GVSN-TGDFTDDN-SDHD---EYY--------------------------------------
Y3148_ARATH/403-590YGLHINCGGNEI..--...TSN-ETKYDADT-WDTP---G..--------------------------------------
RKF1_ARATH/416-604SCLHVNCGGSDMY.--VKEKKT-KELYEGDG-NVEG---GAA--------------------------------------
Y1534_ARATH/364-548NALHINCGGDEM..--...SIN-GTIYESDK-YDRL---ESW--------------------------------------
Y5343_ARATH/408-592SSLFINCGGSRL..--...KIG-KDTYTDDL-NSRG---QST--------------------------------------
Y5614_ARATH/424-612SDFSINCGGPEI..--..RSVT-EAVFERED-E.DL---GPA--------------------------------------
Q29NS0_DROPS/68-230VVYAVNAGGEEH..--..TDRN-GITYEADP-LKNV---GIA--------------------------------------
A0C5E5_PARTE/21-187VLMAIDCGGQES..--.FNSKE-GFLYQDDQ-YFSG---DSR--------------------------------------
A0D555_PARTE/21-188VIYAINCGAPSN..--.YKSPS-GIQYEKDI-QTDP---ETV--------------------------------------
Q232Z6_TETTS/33-200VVHAINAGSHMA..--.KRSVE-GFVYTRDQ-GYDE---DTN--------------------------------------
Q22CM9_TETTS/26-197IVVALDCGSTAPY.--.KSSSD-GITYTADN-LYTQ---NTK--------------------------------------
A6H797_BOVIN/39-199VIWAVNAGGEAH..--..VDVH-GIHFRKDP-LEGR---VGR--------------------------------------
A7RLY6_NEMVE/27-185VVYAVNSGGPAH..--..TDLN-GVHYQADK-LT..---VGV--------------------------------------
Q17BA6_AEDAE/29-192VIYAINAGGEAH..--..VDSN-GIKYARDP-LMGK---TGT--------------------------------------
Q5DCB4_SCHJA/19-179VVWAVNCGGPKH..--..IDSH-GVKYKADF-LN..---IGT--------------------------------------
A8X3B8_CAEBR/29-187VVAAINCGGPEA..--..LGSY-GITYAADY-HD..---EGQ--------------------------------------
Q95QG1_CAEEL/43-202VVAAVNCGGPDA..--..LGAY-GIEYSADT-SE..---DGV--------------------------------------
Q231X5_TETTS/32-203KILAINCGENKFY.--.KDTSS-KILYKPDT-FRDG---GQV--------------------------------------
Q5CLI3_CRYHO/28-194VIYAVNCGGPRH..--.FSKSE-NILYEEDN-GYNG---GIS--------------------------------------
A0CEJ8_PARTE/2-159KYRSFN........--......-GINYKNDQ-FFQG---SSE--------------------------------------
A0DJ13_PARTE/493-661VIHAIDCGSYLE..--.TRTSA-GIKYKSDH-HHIG---TSE--------------------------------------
A0DRE8_PARTE/13-175HLLALSIRGQFN..--......-.TQHLKDH-HYIG---QSE--------------------------------------
Q1ENU6_MUSAC/379-561YNLFINCGGPKM..--..R.ID-DIEYEGDI-L.DL---GTS--------------------------------------
A5AX10_VITVI/334-521YSLHINCGGKET..--..SING-STKYEADL-E.PT---GAS--------------------------------------
A5B4N1_VITVI/273-458YSMHINCGGKEV..--..IVDG-NTTYEDDT-D.SG---GPS--------------------------------------
Q49N12_SOYBN/402-586YSLHINCGGKIV..--...TDN-GSTYDDDS-D.TG---GPA--------------------------------------
A5AYT9_VITVI/1-152MS............--......-........-....---...--------------------------------------
A5BAX3_VITVI/87-271YSLHINCGGGRT..--...IIG-DIVYEADE-D.LA---GPS--------------------------------------
A5ATV0_VITVI/23-211HSLYVNCGGEKEK.--VNEDKR-SITYEGDT-ARDN---SDA--------------------------------------
A5BDY5_VITVI/286-473CSFXINCGGNDLT.--IKERRG-KVVYQGDA-KIEG---GAA--------------------------------------
Q9C6G4_ARATH/381-569RSLHINCGGPDVT.--IENSRG-RFLYEGDN-YGLT---GSA--------------------------------------
A5AR95_VITVI/288-473YSLYINCGGDKI..--..T.LK-GDKYEKDD-G.IE---GAS--------------------------------------
A5C3D9_VITVI/359-541YSLFINCGGSEI..--..N.YE-GNDYERDL-D.GS---GAS--------------------------------------
Q94G99_SOLLC/19-203DHLYINCGGVSA..--...SVY-GNVYEADV-QEEG---GS.--------------------------------------
A2XXK2_ORYSI/347-534SSFAVDCGSNRL..--.ISGSD-NFRYQTDD-AS.L---GAA--------------------------------------
Q7XTR9_ORYSJ/429-616ASFAVDCGGSRT..--.ISGSD-NAMYQADN-AN.L---GAA--------------------------------------
Q6F2P3_ORYSJ/440-627YSFAVDCGSNSS..--.TRGSD-NTIYEADP-MN.L---GAG--------------------------------------
Q6ZKW6_ORYSJ/422-609YSFAVDCGSNKS..--.TRGSD-NTLYETDA-QN.I---GAA--------------------------------------
A5AGB3_VITVI/345-531YNFAIKCGGPQI..--..TSSD-QIVFERDN-ET.L---GPA--------------------------------------
Q0WPE8_ARATH/420-606FNFFVNCGGRDI..--..RSSS-GALYEKDE-GA.L---GPA--------------------------------------
A5BD31_VITVI/371-555TNVSIKCGGPEW..--..RTPD-GTVYEADN-SITT---GTA--------------------------------------
A5BV17_VITVI/4-191ANFSIKCGGSEM..--..RNAE-GIVYEAEN-ST.L---GAA--------------------------------------
A4AT33_MARSH/904-1052SLLGINAGGVLI..--...DQN-GTTFVADE-HFVG---GTP--------------------------------------
A4AUK4_MARSH/903-1051TAIRINSGGPQV..--...VHD-GNIFNADQ-HYVG---GQS--------------------------------------
A4CK29_ROBBH/1247-1419ALYRVNAGGPLTA.--.SNDAD-PKTWDEDQ-AVAN---ANA--------------------------------------
A4CK28_ROBBH/332-497FQLCIAAGNDAL..--...TAF-GRDFVGDP-NTTP---PTT--------------------------------------
A9W8Z4_METEP/828-973VVAAINTGGGAL..--...TQD-GIGFSADQ-YFTG---GAT--------------------------------------
B1ZHU8_METPB/1383-1558LVMAINSGGGAY..--..TRAD-GTVFEADT-AASP---HRF--------------------------------------
Q21PD3_SACD2/360-498LVIAINAGGGAT..--...SLD-GVNFVADV-HSLG---GST--------------------------------------
B9M0U3_GEODF/207-345KSFAANSGGAAF..--..TDAT-GLIYGADS-AFSG---GSA--------------------------------------
B9M0U3_GEODF/432-570VQFAVNSGGTGF..--..TDST-GAVYQADG-RFSG---GSS--------------------------------------
Q01NB6_SOLUE/205-356DDLRIIVGAVNP..--.FMDRS-GRTWGPDR-FFSG---GSV--------------------------------------
Q021C7_SOLUE/211-363NPLEVRILAGRQNG--DYTDRL-GRIWQSDR-YFQG---GSV--------------------------------------
Q026G9_SOLUE/209-373GEVRIAAGHTGPP.--.YVDVF-GRRWEADR-YFEG---GIP--------------------------------------
Q01RD0_SOLUE/183-344VPHPIRILAGSSTD--KSVDRF-GVEWAGDR-YFAG---GEQ--------------------------------------
Q7UIV5_RHOBA/6-153LCLCIILIATPAIR--GQDIPL-NVAEQPDT-....---...--------------------------------------
Q7UIV6_RHOBA/184-340LMVALDKRTGETIW--KTKPPT-AASAPGDT-APGR---SGD--------------------------------------
A5FCJ0_FLAJ1/725-892YIYRVNCGGSEL..--..TDSA-GNTWLTDT-HKNG---QNT--------------------------------------
A6L3S6_BACV8/1081-1251YLYRLNCGGDTY..--..TDTY-GQVWAQDN-SRYS---HSW--------------------------------------
A7LQW1_BACO1/1065-1228YLYRLNCGGDDY..--..TDSF-GQLWLQDN-TNYS---CSW--------------------------------------
B1KJF7_SHEWM/58-198TVWALNLGGPEY..--..QGID-GVRYQADS-LSPP---DEI--------------------------------------
A4CKE5_ROBBH/1275-1442TTWRINAGGEEV..--.TATDD-GTNWRYNG-ASGA---YTG--------------------------------------

PF12819

Y5573_ARATH/35-359----LDCGLSPNEP.PYVDAAT.DLTYTTDN.DFVQ...SGK...TGTI...DK.ELESTYN.KPILQLRYFP.....EG
Y4291_ARATH/31-359----IDCGSPPNIN..YVDTDT.GISYTWDA.PFIN...AGV...NLNVSEEYG.YPKNPVLPFPLADVRSFP.....QG
MEE39_ARATH/34-356----LDCGLPLNEP.PYIESET.GIQFSSDE.NFIQ...SGK...TGRI...PK.NLESENL.KQYATLRYFP.....DG
Q0DGL3_ORYSJ/34-370----IDCGLPEKTS..YVDDAT.KLKFTSDD.AFTD...AGT...IHNV.SSEF.ATPTTTTDRSLYNVRSFP.....AG
Y5169_ARATH/27-358----LDCGLPSNEP.PYIEPVT.GLVFSSDA.DHIP...SGI...SGRI...QK.NLEAVHI.KPYLFLRYFP.....DG
Y5189_ARATH/28-350----LDCGLVPTEI.TYVEKST.NITYRSDA.TYID...SGV...PGKI....N.EVYRTQFQQQIWALRSFP.....EG
Y1756_ARATH/33-356----LDCGLQADES.PYTEPLT.KLTFTSDA.DFIK...SGK...SGKI...QN.VPGMEYI.KPYTVLRYFP.....DG
Y4245_ARATH/33-374----LDCGMPRNES.SYTDEST.GLNFSSDA.DFIS...SGK...SGTI.KTED.SDSGVKYIKPYKQLRYFP.....EG
Y1518_ARATH/32-355----LDCGLVPKET.TYTEKST.NITYKSDV.DYID...SGL...VGKI....N.DAYKTQFQQQVWAVRSFP.....VG
Q0JIC9_ORYSJ/48-385----IDCGYTDSAG..YDDKNT.MLPYVSDK.GYIK...GGK...TFSI...LS.QYMKEAANKQEETLRSFP.....DG
Q0J2D5_ORYSJ/28-372----IDCGLEANSS..YQD.DN.RILYVPDG.PYVD...GGE...NHKVAAEYA.....SSFQRPDQTLRSFP.....SG
Y1677_ARATH/29-363----IDCGCS..SN..YTDPRT.GLGWVSDS.EIIK...QGK...PVTL.......ANTNWNSMQYRRRRDFP.....TD
Y1755_ARATH/32-354----LDCGLASNES.PYNEANS.NLTYISDA.DFIQ...GGK...TGNV...QK.DLLMKLR.KPYTVLRYFP.....DG
PAM74_ARATH/32-354----LDCGLPMTEPSSYTESVT.GLRFSSDA.EFIQ...TGE...SGKI...QA.SMENDY.LKPYTRLRYFP.....EE
Q9C8I6_ARATH/32-353----LDCGS.PRET.SFREKTT.NITYISDA.NFIN...TGV...GGSI...KQ.GY.RTQFQQQTWNLRSFP.....QG
Q6ERN3_ORYSJ/27-359----IDCGLEADDS..YPDDLT.GITYVPDG.HYTD...AGE...NHKVTTVYR.NAWWGPD.RTLYTVRSFPS...AEG
B9RQ86_RICCO/32-352----LDCGL.QANS.SYTDEKT.GLKYISDA.AFIE...TGV...TKSI...AP.EF.LGSFNQQLRQVRSFP.....KG
Q65X94_ORYSJ/35-368----VDCGLPGKTS..YVDDKT.KISYAADD.GFTD...GGS...FHNISAEYI.TPA.LS..ARYHNVRSFP.....DG
RLK6_ARATH/36-358----LDCGSLPNEP.PYNDPST.GLTYSTDD.GFVQ...SGK...TGRI...QK.AFESIF.SKPSLKLRYFP.....DG
Q5VQN2_ORYSJ/40-388----IDCGLTNRST..YNDTDT.TLTYVSDR.EFVEG.GNGK...SYDIMA....QYIADATNEQEKTLRSFP.....DG
B9RQ88_RICCO/35-358----IDCGL.PANS.SYTDATT.GLNYVSDA.AFID...TGI...INNL...AP.GLNTSSIDRQQLSVRSFP.....EG
Q5QL24_ORYSJ/29-348----IDCGLEANYSG.YKDTDT.GIVYVSDD.PYVD...TGK...NHRISAD...STYQRFY...Q.TIRSFP.....TG
B9RQ82_RICCO/34-356----IDCGL.PANS.SYTDETT.SLNYISDA.SFID...VGI...ITTI...TP.KVTTNSTDRQQLSVRSFP.....EG
Y2451_ARATH/32-355----LDCGLPSKES..YIEPSS.NLTFISDV.NFIR...GGK...TGNI...QN.NSRTNFIFKPFKVLRYFP.....DG
Y5188_ARATH/32-354----LDCGLVPKNA.TYTEKTT.NITYKSDA.NYID...SGL...VGRI...SA.EY.KAQLQQQTWTVRSFP.....EG
B9RQ90_RICCO/31-355----LDCGL.PANT.TYTDETT.SLNYNSDA.SFID...TGI...SKSL...AP.GFTTDNLRRQLWYIRSFP.....EG
RLK7_ARATH/31-354----LDCGLPANETSPYTETQT.GLLFSSDA.TFIQ...SGK...TGRV...QA.NQESKF.LKPYRTLRYFP.....EG
B9RQ85_RICCO/33-355----LDCGL.PGNT.SYSDATT.TLNFISDA.SYIE...IGI...SKSL...AP.EFSTNSIFRPLWYVRSFP.....QG
Q6EQQ3_ORYSJ/24-352----IDCGLDQDSR..TDSLVG.GITYVSDG.AYVD...AGE...NRRVTTVYK.DDWKGPRYQTLYTLRSFPT..SVTG
Q67UW6_ORYSJ/28-358----IDCGIPEKSS..YQDPTS.SIIYVSDY.GFIS...TGA...NHNISSAYI.KPS.LA..QRNYNVRFFP.....DG
B9RQB2_RICCO/34-359----IDCGLSEDSS..STEVKT.GMHYISDT.LYTN...TGV...NKKISSNFS...SDAQFPVSLMTVRSFS.....QG
Y2923_ARATH/33-360----IDCGI.PEDS.SYYDEKT.DIKYISDA.AFVE...SGT...IHSI...DS.KFQKKNLEKQFQKVRSFP.....EG
Y5181_ARATH/29-348----LDCGLSIQGS.PYKESST.GLTYTSDD.GFVQ...SGK...IGKI...TK.ELESLY.KKPERTLRYFP.....DG
Y3463_ARATH/35-357----LDCGLPPNEVSPYIEPFT.GLRFSSDS.SFIQ...SGK...IGKV...DK.SFEATT.LKSYMTLRYFP.....DG
Q6EQK1_ORYSJ/34-368----IDCGLPSGFS..YVDEKT.NITYISDD.QYID...TGE...NHNISS....QLQGAEQFRSGLNLRSFP.....TG
B9RQ87_RICCO/35-359----IDCGIEDGSS..YVDENT.GINYVSDA.PYIS...SGV...SERISS....EINTKNIDKQYLTLRSFS.....EG
Q9SN97_ARATH/32-354----VDCGLSPNEVSPYIEPFT.GLQFTTDS.NFIE...TGK...LGRI...QA.SLEPKY.RKSQTTLRYFP.....DG
Y5596_ARATH/32-354----LDCGLPANEPSPYTEPRT.GLQFSSDA.AFIQ...SGK...IGRI...QA.NLEADF.LKPSTTMRYFP.....DG
B9RQ89_RICCO/61-383----IDCGI.SENA.TYTDSTT.SIDYVSDA.AFID...TGK...SKSI...AA.EYTRYNINQQLQNVRSFA.....EG
Y2921_ARATH/34-359----IDCGI.PEDS.SYNDETT.DIKYVSDA.AFVE...SGT...IHSI...DP.EFQTSSLEKQFQNVRSFP.....EG
Y2899_ARATH/28-349----LDCGLPSDES.PYDDSFN.GLTFTSDS.TFIQ...TGK...IDSV...DK.DLNINL.SKQYLTLRYFP.....EG
B9H626_POPTR/24-339----VDCGAS..DS..YAD.EN.SIVWIGDD.DLFK...NGQ...SEVV......QP.SNPASHVMSTLRVFT.....TL
B9H6K7_POPTR/19-375----ISCGSDTNST......AS.GRTFIGDL.TSGN...SGSFTFTRQS.SPVKDSNKSTATPPLYQTARIFR.......
B9HLB9_POPTR/28-361----IDCGGT..SN..YTDPRT.GLAWVSDNGTIMK...YGK...SSEA......QV..SNGNTQYQRRRDFP....IDS
B9HS06_POPTR/28-348----LNCGASEDIT......HG.NLKYIPDK.GFIS...VGN...KSAI........KTADVLPVLSTLRFFP.....DT
D7U071_VITVI/66-391----IDCGLPEDCK..YIDAET.GLQYTSDA.SFIR...SGI...NKNI.S..S.KFSSTTLHKSLTNVRSFP.....QG
F4HWL3_ARATH/31-365----ISCGARKNVR....TPPT.YALWFKDI.AYTG....GV...PANA.......TTPTYITPPLKTLRYFPI...SEG
F4I065_ARATH/33-357----LDCGLLPDGS.PYTNPST.GLTFTSDS.SFIE...SGK...NGRV...SK.D.SERNFEKAFVTLRYFP.....DG
F4IB60_ARATH/32-356----IDCGLQPENS.SYTETST.DIKYVSDS.SYTD...TGT...SYFV.A..P.EN.RQNMKQSMWSVRSFP.....EG
F4IB63_ARATH/29-347----VDCGLLPRDS.PYNALGT.GLVYTSDV.GLVS...SGK...TGKI.AKEF.E...ENNSTPNLTLRYFP.....DG
F4IB71_ARATH/32-354----LDCGLVPKET.TYVETST.NITYKSDA.NYTD...SGL...VGKI.N....DAHKTLVQQPLWALRSFP.....EG
F4IB76_ARATH/32-354----LDCGLIPKDT.TYTEQIT.NITYISDA.DYID...SGL...TERI....S.DSYKSQLQQQTWTLRSFP.....EG
F4ICJ5_ARATH/32-364----IDCGSPETST....D.VF.NRTWLPDQ.FYSG....GS...TAVV......SEPLRFHLIAEKTIRYFPL...SFG
F4J801_ARATH/31-354----IDCGTT..GS..YVD.SN.NVTWVGDK.GFVT...TGE...SINI.........TDVVKKPINTLRYFP.....TG
F4JB46_ARATH/25-347----LNCGSSSSTN..L....N.EIEYTPDE.GFIS...VGN...TTTI........KQKDLVPILSTLRYFP.....DK
F6H477_VITVI/48-422----VDCGASGNLK..AWD....NRIWIGDTNSRFSL.IEKN...KASIISKAA.KTSPSVDPVPFATARLS........
F6HY53_VITVI/28-350----IDCGVDED....YIDNTT.KLFYSSDA.NFID...SGE...NKNI...PY.DFTSTIYEKQLTNVRSFP.....KG
I1MCW6_SOYBN/32-358----IACGAPAGVN..FTVPKT.GLNYTSDA.NFIN...TGV...SRTIVPELR.....DQFQRYVWNLRSFP.....EG
I1PTQ3_ORYGL/76-415----IDCGYITRPS..YPDFKT.NLTYVADV.GFTN...TGF...IHTV...DV.GNLQRDLAQRYTTVRYFP.....NG
I1PXF6_ORYGL/34-366----VDCGLPGKTS..YIDDKT.KISYASDD.GFTD...GGK...HYNVSPEYI.K...PAVTARYYNVRSFP.....DG
I1QAW3_ORYGL/40-375----ISCGSFDDIR....TAPT.NTLWYRDF.GYTG...GRF..........AN.ATRPSFIIPPLKTLRHFPL...SDG
K4B910_SOLLC/3-338----ISCGARHDVH....TAPT.KTLWHKDF.AYTG...GIP..........FN.GTAPSFIAPQLTTLRYFPL...SEG
M0S6H3_MUSAM/43-370----IDCGIAAGST..YVDPTT.NIPYVSDT.PYID...AGV...NQNISAAYV....TNLMGRRYLNVRSFP.....NG
SIRK_ARATH/33-359----IDCGIPDDSS..YNDETT.GIKYVSDS.AFVD...SGT...TKRI.AAQF...QSSGFDRHLLNVRSFP.....QS
Q0DGL2_ORYSJ/34-367----IDCGLEGKTG..YLDDKT.NLSYVPDD.GFTD...AGT...NHNI.SV...EFMTPLISRRNYNLRSFP.....DG
Q0J2E4_ORYSJ/17-347----IDCGLEGDDS..YPDDQT.GITYVPDG.PYVD...SGE...NHRVTTVYR.NYW.GQDYRTLKTLRSFPS...ASG
Q0J2E5_ORYSJ/9-345----IDCGLEGDKN.GYTDNSN.GIVYTPDGAPYVD...TGV...TNNVSAQYV.NT...W.DRALNTLRSFPL..TLFG
Q2QNF5_ORYSJ/41-399----IDCGIPDGGG..YSDESTRGLRYVPDA.GFLD...AGAG.LSAGI...NP.PYTDRDLAARYLTVRYFPGAASAAG
Q5JNB7_ORYSJ/47-383----IDCGGSGN....YTD.EV.GLEWTGDE.AYVG...GGAG.TTASI......SSISGQGRRPYRTVRYFP....ADG
Q5VQN4_ORYSJ/8-346----VDCGLTNRST..YNDTDT.TLTYVSDR.EFVE...SGK...SYDIMA....QYMADATNEQEKTLRSFP.....DG
Q5ZCA6_ORYSJ/34-370----IDCGIQPNTS..YVHNTT.KISYVADD.DFTD...GGS...NYNVSP....EYIKPQLSQRYYNLRAFP.....DG
Q5ZDH7_ORYSJ/38-375----IDCGGAADFV.SV....F.GRRWLADQ.FFSA...GGQ...AGMV.A.....EPHRFPQPQERTLRFFPP..SSAG
Q65X96_ORYSJ/43-376----VDCGLPGKTG..FVDDKT.KISYAADD.GFTD...GGA...CHNISAEYI.T...PGLAKRYHTLRSFP.....DG
Q67TV6_ORYSJ/37-371----IDCGLSGKAG..YVDNAT.KLSYSPDA.AFTD...AGT...NNNISAEYL.S...PANSRIFDNVRSFP.....AG
Q6EQM5_ORYSJ/33-373----IDCGREANYS.DYKDPKT.GIVYVSDE.PYIDA.GAGE...NHRI.SATA.T.ATAADSYLLQTLRSFP.....SG
Q6ERZ1_ORYSJ/29-346----IDCGMDPNYG.SYKNPDD.GIVYEPDG.QYVD...GGE...NHMV.A..P.EHQ.SGTFRPYSTVRSFP.....SG
Q94HA8_ORYSJ/46-404----LSCGAPAAVQ..LDD....GRTFRSDP.DSASFLSTPV...DIKI.TAKNSLASGAPSSQLYLTSRVF........
Q9M0D8_ARATH/30-359----IDCGIPPYDT..PEDTMT.NINYVSDE.AFIT...TGV...NFKVSEEYG.YPKNPVLLSTLAEVRAFP.....QG
Q9SZV2_ARATH/30-354----IDCGIPDDSS..YTDEKT.NMKYVSDL.GFVE...SGT...SHSI...VS.DLQTTSLERQFQNVRSFP.....EG

PF11721

Y1972_ARATH/435-593---.-.............................----------------------------------------------
Y3148_ARATH/403-590---.-..YYDSKNGWVSSNTGNFLDDDRTNNGKS----------------------------------------------
RKF1_ARATH/416-604---.-.KYFLKPDANWG......FSSTGDFMDDN----------------------------------------------
Y1534_ARATH/364-548---.-...YESRNGWFS......NNVGVFVDDKH----------------------------------------------
Y5343_ARATH/408-592---F-SSVSERWGYSS.........SGVWLGKED----------------------------------------------
Y5614_ARATH/424-612---.-.SFVVSAGQRWAA....SSVGLFAGSSNN----------------------------------------------
Q29NS0_DROPS/68-230---.-SDYGKH.......................----------------------------------------------
A0C5E5_PARTE/21-187---V-SDYTYN...................D...----------------------------------------------
A0D555_PARTE/21-188---V-ADYSLN...................SE..----------------------------------------------
Q232Z6_TETTS/33-200---A-VDYSDD...................EN..----------------------------------------------
Q22CM9_TETTS/26-197---I-ADYTYN...................QS..----------------------------------------------
A6H797_BOVIN/39-199---A-SDYGMK.......................----------------------------------------------
A7RLY6_NEMVE/27-185---S-SDYGKM.......................----------------------------------------------
Q17BA6_AEDAE/29-192---E-SDYGKQ.......................----------------------------------------------
Q5DCB4_SCHJA/19-179---A-SDYGRS.......................----------------------------------------------
A8X3B8_CAEBR/29-187---A-SDVGVQ.......................----------------------------------------------
Q95QG1_CAEEL/43-202---S-SDHGMQ.......................----------------------------------------------
Q231X5_TETTS/32-203---A-RREDVR...................FQ..----------------------------------------------
Q5CLI3_CRYHO/28-194---T-DSG..........................----------------------------------------------
A0CEJ8_PARTE/2-159---F-VDYYDE...................QQ..----------------------------------------------
A0DJ13_PARTE/493-661---F-VDYYES...................VE..----------------------------------------------
A0DRE8_PARTE/13-175---I-VDYYER...................AQ..----------------------------------------------
Q1ENU6_MUSAC/379-561---.-.EFYDSESGKWAY....SSTGDFVDNQNP----------------------------------------------
A5AX10_VITVI/334-521---.-.MFYLGQNWAFS......STGNFMDNDVD----------------------------------------------
A5B4N1_VITVI/273-458---.-.KFYQSRTNWAFS.....STGHFMDDDRP----------------------------------------------
Q49N12_SOYBN/402-586---.-.RFHRSGTKNWAY....INTGNFMDNDAG----------------------------------------------
A5AYT9_VITVI/1-152---.-......DNWGFS......STGHFWDHSIS----------------------------------------------
A5BAX3_VITVI/87-271---.-.KFVPTRDNWGFS.....STGDFWDRDRT----------------------------------------------
A5ATV0_VITVI/23-211---.-.KYYLSADNNWGF....SSSGDFMDDNKE----------------------------------------------
A5BDY5_VITVI/286-473---.-.NYYTSNSYWGLS.....SSGDFMDDNNF----------------------------------------------
Q9C6G4_ARATH/381-569---.-.TNYYRKNWGYS......NTGDFMDDAIT----------------------------------------------
A5AR95_VITVI/288-473---.-.QFSIDSTNKWAY....SSTGAFIGKTDH----------------------------------------------
A5C3D9_VITVI/359-541---.-.HF.SDYSEKWGY....SSTGVFTNNDDA----------------------------------------------
Q94G99_SOLLC/19-203---.-.TFFMSNNLNWGY....SSMGTSLWAKRD----------------------------------------------
A2XXK2_ORYSI/347-534---.-.SYSVTGEPTWGV....SNVGKFMDAPNG----------------------------------------------
Q7XTR9_ORYSJ/429-616---.-.SYYVAGTPTWGV....STTGRFMDPPNG----------------------------------------------
Q6F2P3_ORYSJ/440-627---.-.SYFVTGEKRWGI....SNVGKFDQATNG----------------------------------------------
Q6ZKW6_ORYSJ/422-609---.-.SYYVSDNARWGV....SSVGKFNEASNG----------------------------------------------
A5AGB3_VITVI/345-531---.-.TYYVTDTNRWAV....SNVGLFSGSNNP----------------------------------------------
Q0WPE8_ARATH/420-606---.-.TFFVSKTQRWAV....SNVGLFTGSNSN----------------------------------------------
A5BD31_VITVI/371-555---S-TSYYVSRLENWGV.....SNVGLYSDR..----------------------------------------------
A5BV17_VITVI/4-191---.-.SYYVTSTEKWAV....SNVGLFSDRSNP----------------------------------------------
A4AT33_MARSH/904-1052---.-.............................----------------------------------------------
A4AUK4_MARSH/903-1051---.-.............................----------------------------------------------
A4CK29_ROBBH/1247-1419---G-ATTGTPSP..............YVNSGAE----------------------------------------------
A4CK28_ROBBH/332-497---.-......T................LFSRTN----------------------------------------------
A9W8Z4_METEP/828-973---.-.............................----------------------------------------------
B1ZHU8_METPB/1383-1558---.-...........................YV----------------------------------------------
Q21PD3_SACD2/360-498---.-.............................----------------------------------------------
B9M0U3_GEODF/207-345---.-.............................----------------------------------------------
B9M0U3_GEODF/432-570---.-.............................----------------------------------------------
Q01NB6_SOLUE/205-356---.-.............................----------------------------------------------
Q021C7_SOLUE/211-363---.-.............................----------------------------------------------
Q026G9_SOLUE/209-373---.-...........................QP----------------------------------------------
Q01RD0_SOLUE/183-344---.-............................N----------------------------------------------
Q7UIV5_RHOBA/6-153---.-...........................QD----------------------------------------------
Q7UIV6_RHOBA/184-340---.-.........................EPRR----------------------------------------------
A5FCJ0_FLAJ1/725-892---W-GSLSWT..................DNFEK----------------------------------------------
A6L3S6_BACV8/1081-1251---A-ESFIHPS.................DSVQL----------------------------------------------
A7LQW1_BACO1/1065-1228---A-ENF........................KD----------------------------------------------
B1KJF7_SHEWM/58-198---.-.............................----------------------------------------------
A4CKE5_ROBBH/1275-1442---.-......GI..............YSVNTGV----------------------------------------------

PF12819

Y5573_ARATH/35-359V..R.NCYTLNVT...LGT.NYLIRASFVYGNYD....GL..N.KE...LE.FDLYLGPNLWANVNTAV.YLM.......
Y4291_ARATH/31-359N..R.NCYTLTPSDG.KGN.LYLIRASFMYGNYD....GK..N.AL...PE.FDLYVNVNFWTSVKLRNASEN.......
MEE39_ARATH/34-356I..R.NCYDLRVE...EGR.NYLIRATFFYGNFD....GL..N....VSPE.FDMHIGPNKWTTIDLQIVPDG.......
Q0DGL3_ORYSJ/34-370A..R.NCYTVPSV.V.PGS.KYLVRAKFLYGNYD....GL.NK......PPVFDLHLGVNFWQTVTVPSADWL.......
Y5169_ARATH/27-358L..R.NCYTLDVL...QNR.RYMIKAVFVYGNYD....GY..N.DY...PS.FDLYLGPNKWVRVDLEGKVNG.......
Y5189_ARATH/28-350Q..R.NCYNFSLT...AKR.KYLIRGTFIYGNYD....GL..N.QL...PS.FDLYIGPNKWTSVSIPGVRNG.......
Y1756_ARATH/33-356V..R.NCYTLIVI...QGT.NYLIVAMFTYGNYD....NL..N.TH...PK.FDLYLGPNIWTTVDLQRNVNG.......
Y4245_ARATH/33-374A..R.NCYNLTVM...QGT.HYLIRAVFVYGNYD.........LKQ...RPKFDLYLGPNFWTTINLQDPSGGFYYRIWL
Y1518_ARATH/32-355Q..R.NCYNVNLT...ANN.KYLIRGTFVYGNYD....GL..N.QF...PS.FDLHIGPNKWSSVKILGVTNT.......
Q0JIC9_ORYSJ/48-385Q..R.NCYTLPTNRS.K...KYLIRATFTYGNYD....GR..NSSESGSPFLFGLHIGINFWTMVNLTKLPSS.......
Q0J2D5_ORYSJ/28-372V..R.NCYTLPTA...AGS.KYLVRLVFVYGNYDGKNISS.SSSSAAAAALRFDLYLGLSRWTTVQGGTGSGG.......
Y1677_ARATH/29-363N..KKYCYRLSTK...ERR.RYIVRTTFLYGG...........LGSEEAYPKFQLYLDATKWATVTIQEVSRV.......
Y1755_ARATH/32-354I..R.NCYSLNVK...QDT.NYLIRVMFRYGNYD....GL.NN......SPRFDLYLGPNIWTTIDMGKSGDG.......
PAM74_ARATH/32-354R..R.NCYSLSVD...KNR.KYLIRARFIYGNYD....GR..N.SN...PI.FELHLGPNLWATIDLQKFVNG.......
Q9C8I6_ARATH/32-353I..R.NCYTLNLT...IGD.EYLIRANFLHGGYD....DK..P.ST....Q.FELYLGPNLWSTVTTTNETEA.......
Q6ERN3_ORYSJ/27-359Q..R.NCYSLPND...VRS.KYLVRLKFLYGNYD..........GLDSSSLKFNLTLGVKHWDTVSIDTTDGN.......
B9RQ86_RICCO/32-352D..R.NCYKVELV...KNT.RYLIRATFLYANYD....GL..N.KL...PA.FDLHIGPNKWVNVQITNPLIY.......
Q65X94_ORYSJ/35-368A..R.NCYTLRS.LV.AGL.KYLIRATFMYGNYD....GL..S.KL...PI.FDVYIGVNFWMMVNIS..DPS.......
RLK6_ARATH/36-358F..R.NCYTLNVT...QDT.NYLIKAVFVYGNYD....GL..N.NP...PS.FDLYLGPNLWVTVD..MNGRT.......
Q5VQN2_ORYSJ/40-388Q..R.NCYTLPT....NSSKKYLIRATFTYGNYD....GL.NS.SEKGSLFLFGLHIGVNFWATVNLTNWGSS.......
B9RQ88_RICCO/35-358D..R.NCYQVELT...RGT.KYLIRAIFLYRNYD....GL..S.KL...PH.FDLHLGPNKWITVKILNATIP.......
Q5QL24_ORYSJ/29-348E..R.NCYALPTV...YGD.KYIVRVMISRNSQM....IS.LL.WPTLP..QFALHLGANYWDTVQD.............
B9RQ82_RICCO/34-356D..R.NCFNVELA...KNT.KYLIRAIFAHGDYD....GS..N.EL...PE.FDLHLGPNKWVTVKILNASIP.......
Y2451_ARATH/32-355I..R.NCYSLSVK...QGT.KYLIRTLFYYGNYD....GL..N.TS...PR.FDLFLGPNIWTSVDVLIADVG.......
Y5188_ARATH/32-354E..R.NCYNFNLT...AKS.RYLIRATFTYGNYD....GL..R.QV...PK.FDIHIGPSKWTSVKLDGVGNG.......
B9RQ90_RICCO/31-355D..R.NCYNLTLA...KDT.EYLIRATFMYGNYD....GL..N.QL...PE.FDLHIGPNKWVSVKILNASTS.......
RLK7_ARATH/31-354V..R.NCYNLSVF...KER.KYLIAASFLYGNYD....GH..N.IA...PV.FDLYLGPNLWAKIDL.QDVNG.......
B9RQ85_RICCO/33-355S..R.NCYNVTLT...KDT.EYLIRATFMYGNYD....GI..N.QR...PS.FDLYLGPNKWVSVQILNGSIP.......
Q6EQQ3_ORYSJ/24-352E..R.SCYSLPTK...KGD.KYNVRLEFLYGNYD..........GLDSASLTFNLTLGVNHWDTVILDTTI.H.......
Q67UW6_ORYSJ/28-358T..R.NCYTLRS.LQ.EGN.KYFVRAVFYYANYD....SL..N.KL...PV.FDLYLGANYWHEVKFSNADAV.......
B9RQB2_RICCO/34-359I..R.NCYTLRPPEG.KAS.IYLIRASFMYGNYD....NL..N.QL...PQ.FSLYLGVNLWDTVKFD..NAS.......
Y2923_ARATH/33-360K..K.NCYDVQPPQG.KGF.KYLIRTRFMYGNYD....NL..G.KA...PD.FDLYLGVNLWDSVTLENSTTI.......
Y5181_ARATH/29-348V..R.NCFSLNVT...RGT.KYLIKPTFLYGNYD....GR..N.VI...PD.FDLYIGPNMWITVN......T.......
Y3463_ARATH/35-357K..R.NCYNLIVK...QGK.TYMIRATALYGNYD....GL..N.IS...PK.FDLYIGANFWTTLDAGEYLSG.......
Q6EQK1_ORYSJ/34-368G..R.NCYTLYPA...IKGQKYLIRGMFMHGNYD....NK.GQ.DLVSSPVTFDIRIGLNFWNRLNIINATMT.......
B9RQ87_RICCO/35-359K..K.SCYTLNATQG.KNN.KHLIRAGFLYGNYD..........EQGNIPR.FDLYLGPNWWETVILEGASSF.......
Q9SN97_ARATH/32-354I..R.NCYNLTVT...QGT.NYLIRARAIYGNYD....GL..N.IY...PK.FDLYIGPNFWVTIDLGKYVNG.......
Y5596_ARATH/32-354K..R.NCYNLNVE...KGR.NHLIRARFVYGNYD....GR..D.TG...PK.FDLYLGPNPWATIDLAKQVNG.......
B9RQ89_RICCO/61-383V..R.NCYKIGLK...KGA.KYLIRAEFLYGNYD....GQ..N.KA...PI.FDLYLGSSKWETVDTINSTMI.......
Y2921_ARATH/34-359N..R.NCYDVKPPQG.KGF.KYLIRTRFMYGNYD....NL..G.KA...PD.FDLYLGFNIWDSVTIDNATTI.......
Y2899_ARATH/28-349K..R.NCYSLDVK...RGT.TYLIVVSFVYGNYD....GL..N.RD...PN.FDIHLGPNKWKRID..LDGEK.......
B9H626_POPTR/24-339K..K.NCYSITAD...KGS.LVLVRASFFYGNYD....KR.......SSPPSFDLLFDGNNWATVKTSL.DQL.......
B9H6K7_POPTR/19-375E..R.SSYEF.VISSAG...TYLVRLHFFSFSYSA.NLST.ALFNV....LASEISLVGNFS..VPLRS...N.......
B9HLB9_POPTR/28-361N..K.YCYTLGTK...ERR.RYLVRATFQYGS...........SENEDAYPKFDLYLDTTKWSTMVVLDASRV.......
B9HS06_POPTR/28-348S.AKKYCYVLPVI...KGG.KYLVRTTYYYGGYD....GG..K.....EPPVFDQIIQGTKWSTVNTTEDYAN.......
D7U071_VITVI/66-391K..R.NCYTLRPPEG.HGT.MYLIRASFMYGNYD....EL..N.QV...PQ.FDLYIGVNMWDSVKLDNASHL.......
F4HWL3_ARATH/31-365P..N.NCYNIVRVPK.G...HYSVRIFFGLVD.......Q.PSFDK...EPLFDISIEGTQISSLKSGWSSQD.......
F4I065_ARATH/33-357E..R.NCYNLNVT...QGT.NYLIRAAFLYGNYD....GL..N.TV...PN.FDLFIGPNKVTTVNFNATGG........
F4IB60_ARATH/32-356I..R.NCYTIAVN...SST.KYLIRADFMYGNYD....SR..N.EI...PG.FDLHLGPNKWDTVELVS..PL.......
F4IB63_ARATH/29-347A..R.NCYNLNVS...RDT.NYMIKATFVYGNYD....GH..K.DE...PN.FDLYLGPNLWATVSRS............
F4IB71_ARATH/32-354E..R.NCYNFNLT...VNS.TYLIRGTFLYGNYD....GL..N.Q....SPSFDLHIGASKWTSVNIVGVT.........
F4IB76_ARATH/32-354Q..R.NCYNFNLK...ANL.KYLIRGTFVYGNYD....GL..N.QM...PK.FDLHIGPNKWTSVILEGVANA.......
F4ICJ5_ARATH/32-364K..K.NCYVVPL.PP.G...RYYLRTFTVYDNYD....GKSHSPSFDVSVEGTLVFSWRSPW..........PES...LL
F4J801_ARATH/31-354Q..T.NCYTNIPA.T.KGR.TTLVRTKFYYKNYD....EN.......YSPPSFDVVYDGKHRNSIAMTV.DSLFS...DE
F4JB46_ARATH/25-347S.SRKHCYNFPVA...KTS.KYLIRTTYYYGNFD....GK..N.....NPPVFDQIIGGTKWSVVNTSEDYAK.......
F6H477_VITVI/48-422R.FQ.FAYIFPVT...TGQ.K.FIRLHFYPSSVAGFDRSK.AFFSV.KIGGYT.LLNNFSAALAADA...HGD.......
F6HY53_VITVI/28-350V..K.NCYTLPADQG.KDN.KYLIRAVFMCGNVQ....EY..NNQL...PE.FKLYLGVEEWDSVTFNSSYNI.......
I1MCW6_SOYBN/32-358K..R.NCYKINIT...RGS.KYLIRASFLYGNYD....GL..N.M....LPQFDLLLGANRWRTVNINNAS.V.......
I1PTQ3_ORYGL/76-415T..R.NCYTLKQLT..RGG.KYLVRATFGYGNYD....AF..N.....SPPAFDLYLGANYWVKVNITNSSRA.......
I1PXF6_ORYGL/34-366A..R.NCYTLRSL.V.AGL.KYLIRATFMYGNYD....GL..N.KL...PVSFDLHIGVNFWTVVNITD..PI.......
I1QAW3_ORYGL/40-375P..E.NCYYINNVPN.G...HYQVRLFFALVA.D....PN.LD.....SEPIFDVSVEGTLFSSLLLGWSSED.......
K4B910_SOLLC/3-338P..E.NCYNIKRVPH.G...HYSVRIFFGMIE.......E.PSFDN...EPLFDVSVEGTLVYTLPSGW.SNHD......
M0S6H3_MUSAM/43-370T..R.NCYTINSITP..SS.KYLIRASFFYGNYD....GL..G.SQ...SRLFDLYLGVNLWKTINITDPGSG.......
SIRK_ARATH/33-359K..R.SCYDVPTPRG.KGF.KYLIRTRFMYGNYD....DL..G.RV...PE.FDLYLGVNFWDSVKLDDATTI.......
Q0DGL2_ORYSJ/34-367E..R.NCYTLRSL.T.AGL.KYLIRAAFVYGNYD....GL..K..K...PPVFDLYIGVNFLTMVNITGLDGA.......
Q0J2E4_ORYSJ/17-347K..R.NCYSLPTN...VGD.KYLVRLEFLYGNYD....SM......DSSLLKFNLSLGVNHWNTVNLDTTDDQ.......
Q0J2E5_ORYSJ/9-345E..R.NCYALPTV...PGA.IYLVRLRFAYGNYD....NM..N.SE...SVQFDLFLGVNKWDEVYIANKDKE.......
Q2QNF5_ORYSJ/41-399E..RGGCYTLRQLSP..GG.RYLVRATFYYGNYD....GA.IA....MLPVVFDLHLGANRWTAVNVTAADAI.......
Q5JNB7_ORYSJ/47-383R..K.YCYRVSVK...ART.RYLVRASFLYGNFD....GS..R....VFPE.FDLYVGASRWSTIVIYDESKV.......
Q5VQN4_ORYSJ/8-346Q..R.NCYTLPTNSS.K...KYLIRATFTYGNYD....GL..NSSEKGSLFIFGLHIGVNFWTTVNLTKWDPS.......
Q5ZCA6_ORYSJ/34-370A..R.NCYTARSLA..PGI.KYLIRASFLYGNYD....GL..N.KL...PV.FHLYIGVNFWTMVNITSLGLG.......
Q5ZDH7_ORYSJ/38-375...KSSCYSLPL.PP.G...RYYLRLFSVYDNYDS.KLR...TPSFDVSAAATLVLSFRSPW.....PEPASR.......
Q65X96_ORYSJ/43-376K..R.NCYTLRSL.V.AGL.KYLFRTTFFYGNYD....GL..N.KL...PV.FDLYVGVNYWTMVNITGPG.........
Q67TV6_ORYSJ/37-371AAPR.SCYTLRSL.V.PGL.KYLVRASFMYGNYD....GL.RR......PPVFDLYAGVNFWRTVNITDAA.........
Q6EQM5_ORYSJ/33-373P..R.NCYALPTV...AGT.KYLVRLGFLYGNYD....GE.NSSSSSASSLRFDLHLGAQRWATVDDVVVQTG.......
Q6ERZ1_ORYSJ/29-346V..R.NCYALPTV...AGA.KYLVRVRSAYGNYD....GK..N.S..SSTIQFDLYLGVNYWATVKD....PW.......
Q94HA8_ORYSJ/46-404S..DISTYSFFIS.QPG...HHWIRLHFLPIPDDHYNLTT.ATFSV.STDDMV.LLHDFSFIAT.......PP.......
Q9M0D8_ARATH/30-359N..R.NCYTLKLSQG.KDH.LYLIRASFMYGNYD....GK..K.AL...PE.FDLYVNVNFWSTVKFKNASDQ.......
Q9SZV2_ARATH/30-354K..R.NCYDIRPQQG.KGF.KYLIRTRFMYGNYD....GF....SK..TPE.FDLYIGANLWESVVLINETAI.......

PF11721

Y1972_ARATH/435-593----------------.........TS.--TN-LTLSGDYP.....DLY-------------------KT----------
Y3148_ARATH/403-590----------------KWS.....NSS.--EL-KITNSSID....FRLY-------------------TQ----------
RKF1_ARATH/416-604----------------NFQ.....NTR.--FT-MFVPASNQ....SDLY-------------------KS----------
Y1534_ARATH/364-548----------------VPER..VTIES.--NS-SELNVVDF.....GLY-------------------TQ----------
Y5343_ARATH/408-592----------------AGY....LATD.--RF-NLINGSTP.....EYY-------------------KT----------
Y5614_ARATH/424-612----------------IYI.....STS.--QS-QFVNTLDS.....ELF-------------------QS----------
Q29NS0_DROPS/68-230----------------.........LL.--MI-GRTHEHDE.....MLY-------------------RT----------
A0C5E5_PARTE/21-187----------------.........VV.--YA-GIAYTFTP.....RVY-------------------FT----------
A0D555_PARTE/21-188----------------.........VA.--SQ-QIKYTREP.....EIY-------------------LT----------
Q232Z6_TETTS/33-200----------------.........LK.--GL-VIKYAKEP.....TIY-------------------MT----------
Q22CM9_TETTS/26-197----------------.........IM.--KK-TIKYTDDQ.....QLY-------------------KT----------
A6H797_BOVIN/39-199----------------..........L.--PI-LRSNPEDQ.....ILY-------------------QT----------
A7RLY6_NEMVE/27-185----------------..........L.--TI-GRVAPPDQ.....ILY-------------------QT----------
Q17BA6_AEDAE/29-192----------------.........LL.--MI-NRVKPNDE.....LLY-------------------QT----------
Q5DCB4_SCHJA/19-179----------------..........F.--AI-NRVVPEDY.....ILY-------------------QT----------
A8X3B8_CAEBR/29-187----------------..........Y.--SF-NNAENDDV.....EIY-------------------QT----------
Q95QG1_CAEEL/43-202----------------..........Y.--SF-NNAEVDDM.....EIY-------------------QT----------
Q231X5_TETTS/32-203----------------.........QR.--KT-IFDEIYDW.....NIH-------------------RT----------
Q5CLI3_CRYHO/28-194----------------.........KQ.--LS-PFPYVEDD.....FVY-------------------LS----------
A0CEJ8_PARTE/2-159----------------............--SV-KVRKTVDQ.....ELY-------------------MT----------
A0DJ13_PARTE/493-661----------------............--NR-KIRFTDDQ.....SLY-------------------IT----------
A0DRE8_PARTE/13-175----------------............--RR-KIKFTDDQ.....SLY-------------------LT----------
Q1ENU6_MUSAC/379-561----------------K.F.....ITA.--NT-TAL.DITK....PELY-------------------MT----------
A5AX10_VITVI/334-521----------------GDA....YIEA.--NT-SSL..SNVSVLDVELY-------------------KK----------
A5B4N1_VITVI/273-458----------------MDS....FIGT.--NV-SRL.TMEN....SGLY-------------------TT----------
Q49N12_SOYBN/402-586----------------AYY.....IVQ.--NK-TLL.STDN....VDLY-------------------MD----------
A5AYT9_VITVI/1-152----------------IND....YIAQ.--NV-SVL.RMNN....SGLY-------------------TR----------
A5BAX3_VITVI/87-271----------------TKN....YIAX.--NV-SML.GMND....SELY-------------------TR----------
A5ATV0_VITVI/23-211----------------LNKD...YIIT.--SK-SQI.SE.......TLY-------------------NN----------
A5BDY5_VITVI/286-473----------------QNTR...YI...--.E-TLS.SGNI....SGVY-------------------TT----------
Q9C6G4_ARATH/381-569----------------EDT....YTVS.--SE-SAV.SAKY....PDLY-------------------QN----------
A5AR95_VITVI/288-473----------------S.Y.....LAK.--NT-SAL.NSED....AEIY-------------------QT----------
A5C3D9_VITVI/359-541----------------A.Y.....VAT.--NT-FSL.NITG....PEYL-------------------QT----------
Q94G99_SOLLC/19-203----------------RY......TLN.--DV-CEV.HTGE....AELY-------------------GT----------
A2XXK2_ORYSI/347-534----------------SY......IIY.--SS-RQFQNTLD....SELF-------------------QT----------
Q7XTR9_ORYSJ/429-616----------------SY......IIY.--SS-RQFDKTLD....SGLF-------------------QT----------
Q6F2P3_ORYSJ/440-627----------------ID......IIY.--SS-DHFQNTVD....SKLF-------------------ET----------
Q6ZKW6_ORYSJ/422-609----------------SY......AIY.--SP-QQFQSALN....SELF-------------------QT----------
A5AGB3_VITVI/345-531----------------QY......TSR.--SS-SQFTNTLD....SELF-------------------QT----------
Q0WPE8_ARATH/420-606----------------QY......IAL.--SA-TQFANTSD....SELF-------------------QS----------
A5BD31_VITVI/371-555----------------.........IA.--YK-TEVSGTNH....PELF-------------------KT----------
A5BV17_VITVI/4-191----------------SY......VDS.--NL-MQVTGTNT....PELF-------------------QS----------
A4AT33_MARSH/904-1052----------------............--..-....YTNPSALVPDMY-------------------KT----------
A4AUK4_MARSH/903-1051----------------............--..-....YVNGNAQVPELF-------------------QS----------
A4CK29_ROBBH/1247-1419----------------DVTYGVVPLPA.--GF-TNTTGYPD.....AIF-------------------QT----------
A4CK28_ROBBH/332-497----------------GKAYKGYSSAI.--AG-TTPGSPEE.....LLF-------------------QK----------
A9W8Z4_METEP/828-973----------------..FI...DSTG.--GN-GLQSAFTN.....TVY-------------------QT----------
B1ZHU8_METPB/1383-1558----------------AGQDGNATYSD.--VD-PIAGTTDD.....ALY-------------------QN----------
Q21PD3_SACD2/360-498----------------........GST.--TD-SIAGATSS.....TLY-------------------QT----------
B9M0U3_GEODF/207-345----------------........AKT.--TA-AIGGTTDD.....TLY-------------------QS----------
B9M0U3_GEODF/432-570----------------........AKT.--TA-TIAGTTND.....VLY-------------------QS----------
Q01NB6_SOLUE/205-356----------------..L.....LHP.--SE-RIVRTLDP.....DLY-------------------RH----------
Q021C7_SOLUE/211-363----------------..F.....ETH.--DH-AIFGTREP.....RIY-------------------QG----------
Q026G9_SOLUE/209-373----------------GPKHFFPPVPD.--DG-LFKNMREAISADMTVP-------------------QS----------
Q01RD0_SOLUE/183-344----------------RWEFGGKEMGVP--VR-TIRYAPDQ.....LYF-------------------RS----------
Q7UIV5_RHOBA/6-153----------------KSQLTGLDTDK.--EL-DSTATLDE.....FLV-------------------NS----------
Q7UIV6_RHOBA/184-340----------------QPPPRASSEGS.--TP-TITGSKNP.....ELF-------------------VS----------
A5FCJ0_FLAJ1/725-892----------------LPDFFASQRTT.--FD-PINGTKDP.....ELF-------------------QS----------
A6L3S6_BACV8/1081-1251----------------LSPYQASQRTT.--ND-PIHGTRDW.....ELF-------------------QT----------
A7LQW1_BACO1/1065-1228----------------LNPYLASQRTT.--ND-PIHGTRDW.....TLF-------------------QH----------
B1KJF7_SHEWM/58-198----------------.........RR.--MN-KVFGTQYQ.....HLY-------------------QT----------
A4CKE5_ROBBH/1275-1442----------------ALESGLEFSQR.--DA-SIPAYIDETV.YESLF-------------------AT----------

PF12819

Y5573_ARATH/35-359.NGVTTEEIIHSTKS.KVLQVCLIKTGE..SI.PIINSLELRPLINDTY..................NTQ.SGS..LKYL
Y4291_ARATH/31-359...VIKE.ILSFAES.DTIYVCLVNKGK..GT.PFISALELRPMNSSIY..G..............T.EF.GRNVSLVLY
MEE39_ARATH/34-356...TVKE.IIHIPRS.NSLQICLVKTGA..TI.PMISALELRPLANDTY.................I.AK.SGS..LKYY
Q0DGL3_ORYSJ/34-370...GNAEVIAVVP.D.DFLQVCLVNTGA..GT.PFISGLDLRPLPSSLY.................A.PA.NATQGLVLL
Y5169_ARATH/27-358...SVEE.IIHIPSS.NSLQICLVKTGN..SL.PFISALELRLLRNDTY.................V.VQ.DVS..LKHL
Y5189_ARATH/28-350...SVSE.MIHVLRQ.DHLQICLVKTGE..TT.PFISSLELRPLNNNTY.................V.TK.SGS..LIVV
Y1756_ARATH/33-356...TRAE.IIHIPRS.TSLQICLVKTGT..TT.PLISALELRPLRNNTY.................I.PQ.SGS..LKTL
Y4245_ARATH/33-374QDGTVEE.VIHMPKS.NNLDICLVKTGT..TT.PFISSLELRPLRDDTY.................T.TT.TGS..LKLI
Y1518_ARATH/32-355...SMHE.IIHVVPQ.DSLEVCLVKTGP..TT.PFISSLEVRPLNNESY.................L.TQ.SGS..LMLF
Q0JIC9_ORYSJ/48-385.NTIWKE.LIMVAPG.NSVSVCLINNEL..GT.PFISTLDLRPLQDTMY.P.................FV.NVSVAVSYF
Q0J2D5_ORYSJ/28-372...EVHE.AVFVAWA.SWAPVCLVNTGS..GT.PFVSTVELRPLVDSLY.PA..............V.MA.NQS..LAML
Y1677_ARATH/29-363...YVEELIVRAT.S.SYVDVCVCCAIT..GS.PFMSTLELRPLNLSMY..A..............T.DY.EDNFFLKVA
Y1755_ARATH/32-354...VLEE.IIHITRS.NILDICLVKTGT..ST.PMISSIELRPLLYDTY.................I.AQ.TGS..LRNY
PAM74_ARATH/32-354...TMEE.ILHTPTS.NSLNVCLVKTGT..TT.PLISALELRPLGNNSY..L..............T.DG...S..LNLF
Q9C8I6_ARATH/32-353...SIFE.MIHILTT.DRLQICLVKTGN..AT.PFISALELRKLMNTTY..L..............T.RQ.G.S..LQTF
Q6ERN3_ORYSJ/27-359.DGYNVHEAVFVAWA.SWAPVCLINIGQ..GT.PFMSMVELRPLGILPY.PA..............V.MG.NVS..LSLY
B9RQ86_RICCO/32-352...PIKE.IIHAPTF.NNIYVCLVRTGP..WT.PFISALEIRPLHNSTY..V..............A.QS.G.S..LSLF
Q65X94_ORYSJ/35-368.GATLLE.AIVVVPD.DFVQVCLVNTGT..GT.PFISGLDLRPLEKKLY.PQ..............A.ND.KRGLSLF..
RLK6_ARATH/36-358.NGTIQE.IIHKTIS.KSLQVCLVKTGT..SS.PMINTLELRPLKNNTY..N..............T.QS.G.S..LKYF
Q5VQN2_ORYSJ/40-388.DTMYKE.VITVAPD.KFISVCLINLGS..GT.PFVSTLDLRELDGAMF.PF..............L.NL.SVSISHLAR
B9RQ88_RICCO/35-358...VITE.IIYTPIL.NYIHVCLVNTGL..GT.PFISALELRPLKNTTY.EI..............R.SE.G.A..LAKF
Q5QL24_ORYSJ/29-348.DSTEVYEALFMAWA.SWAPVCLVNTDQ..GT.PYASAIELRPLGNELY.PA..............V.MA.NQS..MRMS
B9RQ82_RICCO/34-356...VIKE.IIHTPTL.NYIHICLVNTDS..GM.PFISALELRPLKNTTY..V..............A.QS.G.A..LVKS
Y2451_ARATH/32-355.DGVVEE.IVHVTRS.NILDICLVKTGT..ST.PMISAIELRPLRYDTY..T..............A.RT.G.S..LKSM
Y5188_ARATH/32-354...AVLE.MIHVLTQ.DRLQICLVKTGK..GI.PFISSLELRPLNNNTY..L..............T.QS.G.S..LIGF
B9RQ90_RICCO/31-355...VTEEIIIGSPKS.KYIHVCLVTKDT..GT.PFISALETRPLKNGTY..V..............T.ES.G.SLGLALF
RLK7_ARATH/31-354...TGEE.ILHIPTS.NSLQICLVQTGE..TT.PLISSLELRPMRTGSY..T..............T.VS.G.S..LKTY
B9RQ85_RICCO/33-355...VRKE.IIHHPKR.KYIHVCLVNTNS..GT.PFISALELRPLKNGTY..V..............S.ES.G.S..LALF
Q6EQQ3_ORYSJ/24-352.YGYKAYAAVFVAWA.MSAPVCLVNTGG..GT.PFVSTVELRPFESLAY.PT.................D.NQS..LSLY
Q67UW6_ORYSJ/28-358.NW..MD.IIVVAPA.DYLQVCLVNKGT..GT.PFISGLDLRPLKSTLY.PE..............A.NT.TQSLVLINS
B9RQB2_RICCO/34-359.HVVIKE.IIHVPAL.NDIYVCLLNTGS..GT.PFISALELRHFHNSTY.R...............T.ES.G...SLVLF
Y2923_ARATH/33-360...VTKE.IIYTLRS.DKVHVCLVDKER..GT.PFLSVLELRLLKNNIY..E..............T.AS.D.S..LMLY
Y5181_ARATH/29-348.DNTIKE.ILHVSKS.NTLQVCLVKTGT..SI.PYINTLELRPLADDIY..T..............N.ES.G.S..LNYL
Y3463_ARATH/35-357...VVEE.VNYIPRS.NSLDVCLVKTDT..ST.PFLSLLELRPLDNDSY..L..............T.GS.G.S..LKTF
Q6EQK1_ORYSJ/34-368...YTSE.AIVVAIV.NSVSVCLVDNGE..GT.PFISSLEMRPMKSSNY.PA..............A.TP.NHP..LLLQ
B9RQ87_RICCO/35-359...FTVE.IIHVPSS.NHIDICLVNTGF..GT.PFISVLELRPLYNDIY..V..............M.SA.SGS..LQNF
Q9SN97_ARATH/32-354...TWEE.IIYIPKS.NMLDVCLVKTGP..ST.PLISSLVLRPLANATY..I..............T.QS.G.W..LKTY
Y5596_ARATH/32-354...TRPE.IMHIPTS.NKLQVCLVKTGE..TT.PLISVLEVRPMGSGTY..L..............T.KS.G.S..LKLY
B9RQ89_RICCO/61-383...ITKE.IIHLINT.SYIDVCLVNTGS..GT.PFMSKLELRPIRISAY..S..............T.SL.G.S..LARF
Y2921_ARATH/34-359...VTKE.IIHTLRS.DHVHVCLVDKNR..GT.PFLSALEIRLLKSNTY..E..............T.PY.D.S..LILF
Y2899_ARATH/28-349.EGTREE.IIHKARS.NSLDICLVKTGE..TL.PIISAIEIRPLRNNTY..V..............T.QS.G.S..LMMS
B9H626_POPTR/24-339...VYYE.VMYVVKS.DTTSICLAQTQP..NQFPFISALEVRNLDSKMY.G.................DV.DPNYALFLR
B9H6K7_POPTR/19-375.SPLIKEFFINITV..GKFPIYFIPQG...SSFAFVNAIELFLAPENFI.PSSALLVS.PAGSEGKN.ED.ILSMVLLTI
B9HLB9_POPTR/28-361...YVKEMIIRAP.S.SSIDVCICCATT..GS.PFISTLELRPLNLSMY..A..............T.DF.EDNFFLEVA
B9HS06_POPTR/28-348GMSSYYE.IIVASLA.KTLSVCLARNVH.TTSSPFISALEIEYLGNSVY.NS................TD.FSKYALVTV
D7U071_VITVI/66-391...VMKE.ILHAPSD.DDIYVCLVNIGY..GE.PFISSLEVRHFHDSSY.................K.TE.SGS..LALY
F4HWL3_ARATH/31-365.DQVFAEALIFLLG..GTATICFHSTGH..GD.PAILSIEILQVDDKAY.SF..............G.EGWGQGVILRTA
F4I065_ARATH/33-357..GVFVE.IIHMSRS.TPLDICLVKTGT..TT.PMISTLELRPLRSDTY.................I.SAIGSS..LLLY
F4IB60_ARATH/32-356.QTVSKEIIYYVL.T.DTIQVCLVNTGN..GT.PFISVLELRQLPNSSY.................A.A...QSESLQLF
F4IB63_ARATH/29-347..ETVEE.IIHVTKS.DSLQVCLAKTGD..FI.PFINILELRPLKKNVY.................V.TE.SGS..LKLL
F4IB71_ARATH/32-354.DTVMPE.IIHVLTQ.KRLQVCLVKTGK..TT.PFISSLELRPLINNIY.................I.AE.SGS..MVLQ
F4IB76_ARATH/32-354...TIFE.IIHVLTQ.DRLQVCLVKTGQ..TT.PFISSLELRPLNNDTY.................V.TQ.GGS..LMSF
F4ICJ5_ARATH/32-364RDGSYSDLFAFIG.D.GELDLCFYSIAT..DP.PIVGSLEVLQVDPSSY.DA..............D.GT.GQNVLLVNY
F4J801_ARATH/31-354ETFHYSE.VIFAPAN.ENISVCLVRTSP..SDNPFISSIEVYRFDAGMY.D.................DL.GPEEGFILY
F4JB46_ARATH/25-347GQSSYYEIIVGVPG..NRLSVCLAKNAHTLSSSPFISSLDVQSLEDTMY.NS..............T..D.LGSYKLSLI
F6H477_VITVI/48-422.ETVSKEFCVNVKQGDQMLNITFTPTASDPDAYAFINGIEIVSMPDYLYYTSPQNGGIQFIGQKNVF.WI.EIEYALEMV
F6HY53_VITVI/28-350...VRRE.IIYVPKT.DEIYVCLVNTDS..GT.PFISALELRPIDDSIY...................NK.TQSGSLVLF
I1MCW6_SOYBN/32-358..SRDFE.IIYVPSL.DYVHICMVDTGL..GT.PFISAIELRSLRNDIY.................E.TE.FGS..LEKY
I1PTQ3_ORYGL/76-415...YVHE.TIAVSPS.EFLQVCLVNTGS..GT.PFISGLDLRSLPANFY.PE..............A.NV.AQSLVLLSF
I1PXF6_ORYGL/34-366.QPVNREAIVVVP.D.DSVQVCLVNTGA..GT.PFISGLDLRPLMNKLY.PQ..............V.NA.TQG..LLQL
I1QAW3_ORYGL/40-375.EKTFAEALVFVQ.D.SSLSICFHSTGH..GD.PSILSIEVLQIDDNAY.KF..............G.PSWGKGTILRTA
K4B910_SOLLC/3-338DEQVFVETLIFLD.D.GTASLCFHSTGH..GD.PAILAIEILQVDDRAYYFG..............A.DF.GLGTIIRTV
M0S6H3_MUSAM/43-370...YRTD.VITVAAS.GSFSVCLVNTGH..GT.PFISGLDVRPLKEILY.PA..............V.NA.SRS..LVLT
SIRK_ARATH/33-359...LNKE.IITIPLL.DNVQVCVVDKNA..GT.PFLSVLEIRLLLNTTY...................ET..PYDALTLL
Q0DGL2_ORYSJ/34-367...ALEEAIVVVP.D.DFVQVCLVNTGT..GT.PFISGLDLRPLKSTLY.PQ..............V.TE.TQG..LSLF
Q0J2E4_ORYSJ/17-347.DGYNFYEAVFVAWA.SWAPVCLINIGQ..GI.PFVSTVELRLLGTLPY.PA..............I.IG.NQS..LSLY
Q0J2E5_ORYSJ/9-345...YSSE.AMFVAWA.SWASVCLVNTYQ..GT.PFVNTVELRQLDSMLHFRK..............I.MG.NSS..IYLY
Q2QNF5_ORYSJ/41-399...YIFEAVVSPP.A.DFLQVCLVNIGK..GT.PFISGLDLRPLKPELY.PE..............A.TA.NQSLLLLNH
Q5JNB7_ORYSJ/47-383...VTREMVALAQSG.PSLSVCLANATT..GH.PFISTLELRPLNASLY.H...............T.AF.EAAFFLSLA
Q5VQN4_ORYSJ/8-346.STVWKE.VITVAPD.KSVSVCLINMGS..GT.PFISTLDLRPLQDTMY.PF..............V.NA.STS..VSYF
Q5ZCA6_ORYSJ/34-370.GSRYEEAIVVVP.D.DFVQVCLINTGT..GT.PFISSLELRPLDKRLY.PQ..............V.NA.T..LGLLQL
Q5ZDH7_ORYSJ/38-375.YGAYSDLIFPSATS.PTSDICFYSLST..DA.PVVASIEVAPVHPLAY.DG..............A.TT.GADLILVNY
Q65X96_ORYSJ/43-376.DAVIVEAIVVVP.D.DFVQVCLVNTGA..GT.PFISGLDLRPLKNTLY.PQ..............S.NA.T..QGLVLL
Q67TV6_ORYSJ/37-371.ASITAEAIIVVP.E.DSMQVCLLNTGA..GT.PFISSLDLRPLKNSLY.PQ..............A.NA.TQ..GLVMV
Q6EQM5_ORYSJ/33-373GISRMYE.VVFMGWA.RWAPACLVNVGG..GT.PFVSSVELRPIDDELY.PS..............V.KT.SES..LSLF
Q6ERZ1_ORYSJ/29-346..NEFHE.ALFVAWA.SWVPVCLLNTGR..GT.PFASSVVLRRLSSELY.PV..............I.NA.KQS..MRMI
Q94HA8_ORYSJ/46-404.NPVLREYIVATQG..DTLKIIFTPKKD..SI.AFINAIEVVSAPPSLI.PNTTTG.....MAPQGQ.LD.ISNNALQVV
Q9M0D8_ARATH/30-359...VTKE.ILSFAES.DTIYVCLVNKGK..GT.PFISGLELRPVNSSIY..G..............T.EF.GRNVSLVLY
Q9SZV2_ARATH/30-354...MTKE.IIYTPPS.DHIHVCLVDKNR..GT.PFLSVLEIRFLKNDTY.D....................TPYEALMLG

PF11721

Y1972_ARATH/435-593---------------------------ARR....----------------------------------------------
Y3148_ARATH/403-590---------------------------ARL....----------------------------------------------
RKF1_ARATH/416-604---------------------------ARI....----------------------------------------------
Y1534_ARATH/364-548---------------------------ARI....----------------------------------------------
Y5343_ARATH/408-592---------------------------ARL....----------------------------------------------
Y5614_ARATH/424-612---------------------------ARL....----------------------------------------------
Q29NS0_DROPS/68-230---------------------------ERY....----------------------------------------------
A0C5E5_PARTE/21-187---------------------------ERH....----------------------------------------------
A0D555_PARTE/21-188---------------------------ERH....----------------------------------------------
Q232Z6_TETTS/33-200---------------------------ERH....----------------------------------------------
Q22CM9_TETTS/26-197---------------------------ERH....----------------------------------------------
A6H797_BOVIN/39-199---------------------------ERY....----------------------------------------------
A7RLY6_NEMVE/27-185---------------------------ERY....----------------------------------------------
Q17BA6_AEDAE/29-192---------------------------ERY....----------------------------------------------
Q5DCB4_SCHJA/19-179---------------------------ERY....----------------------------------------------
A8X3B8_CAEBR/29-187---------------------------ERW....----------------------------------------------
Q95QG1_CAEEL/43-202---------------------------ERW....----------------------------------------------
Q231X5_TETTS/32-203---------------------------YVY....----------------------------------------------
Q5CLI3_CRYHO/28-194---------------------------ERY....----------------------------------------------
A0CEJ8_PARTE/2-159---------------------------QRL....----------------------------------------------
A0DJ13_PARTE/493-661---------------------------QRQ....----------------------------------------------
A0DRE8_PARTE/13-175---------------------------QRQ....----------------------------------------------
Q1ENU6_MUSAC/379-561---------------------------ARL....----------------------------------------------
A5AX10_VITVI/334-521---------------------------ARV....----------------------------------------------
A5B4N1_VITVI/273-458---------------------------ARL....----------------------------------------------
Q49N12_SOYBN/402-586---------------------------ARV....----------------------------------------------
A5AYT9_VITVI/1-152---------------------------ARL....----------------------------------------------
A5BAX3_VITVI/87-271---------------------------ARL....----------------------------------------------
A5ATV0_VITVI/23-211---------------------------ARI....----------------------------------------------
A5BDY5_VITVI/286-473---------------------------ARL....----------------------------------------------
Q9C6G4_ARATH/381-569---------------------------ARR....----------------------------------------------
A5AR95_VITVI/288-473---------------------------ARL....----------------------------------------------
A5C3D9_VITVI/359-541---------------------------ART....----------------------------------------------
Q94G99_SOLLC/19-203---------------------------ARL....----------------------------------------------
A2XXK2_ORYSI/347-534---------------------------SRM....----------------------------------------------
Q7XTR9_ORYSJ/429-616---------------------------ARM....----------------------------------------------
Q6F2P3_ORYSJ/440-627---------------------------ARM....----------------------------------------------
Q6ZKW6_ORYSJ/422-609---------------------------ARM....----------------------------------------------
A5AGB3_VITVI/345-531---------------------------ARI....----------------------------------------------
Q0WPE8_ARATH/420-606---------------------------ARL....----------------------------------------------
A5BD31_VITVI/371-555---------------------------SRI....----------------------------------------------
A5BV17_VITVI/4-191---------------------------SRI....----------------------------------------------
A4AT33_MARSH/904-1052---------------------------ERS....----------------------------------------------
A4AUK4_MARSH/903-1051---------------------------EHT....----------------------------------------------
A4CK29_ROBBH/1247-1419---------------------------ERYN...----------------------------------------------
A4CK28_ROBBH/332-497---------------------------EIYGG..----------------------------------------------
A9W8Z4_METEP/828-973---------------------------ERY....----------------------------------------------
B1ZHU8_METPB/1383-1558---------------------------QRFGWAS----------------------------------------------
Q21PD3_SACD2/360-498---------------------------ERY....----------------------------------------------
B9M0U3_GEODF/207-345---------------------------ERW....----------------------------------------------
B9M0U3_GEODF/432-570---------------------------ERW....----------------------------------------------
Q01NB6_SOLUE/205-356---------------------------LRT....----------------------------------------------
Q021C7_SOLUE/211-363---------------------------RRE....----------------------------------------------
Q026G9_SOLUE/209-373---------------------------QRQ....----------------------------------------------
Q01RD0_SOLUE/183-344---------------------------FRF....----------------------------------------------
Q7UIV5_RHOBA/6-153---------------------------EHW....----------------------------------------------
Q7UIV6_RHOBA/184-340---------------------------EHW....----------------------------------------------
A5FCJ0_FLAJ1/725-892---------------------------FRY....----------------------------------------------
A6L3S6_BACV8/1081-1251---------------------------FRF....----------------------------------------------
A7LQW1_BACO1/1065-1228---------------------------FRF....----------------------------------------------
B1KJF7_SHEWM/58-198---------------------------YRV....----------------------------------------------
A4CKE5_ROBBH/1275-1442---------------------------ERYD...----------------------------------------------

PF12819

Y5573_ARATH/35-359FRNYF.STSRRI...............IRYPNDV......NDRHWY.......PF...FD.......EDAWTELTTNLN.
Y4291_ARATH/31-359QRWDT.GYLNGT...............GRYQKDT......YDRIWS.......PY...S........PVSWNTTMTTGY.
MEE39_ARATH/34-356FRMYL.SNATVL...............LRYPKDV......YDRSWV.......PY...I........QPEWNQISTTSN.
Q0DGL3_ORYSJ/34-370DRRNF.GASGST..............VIRYPDDT......YDRVWW.......PW..SNP.......PAEWSDISTADK.
Y5169_ARATH/27-358FRRYY.RQSDRL...............IRYPDDV......YDRVWS.......PF...F........LPEWTQITTSLD.
Y5189_ARATH/28-350ARLYF.SPTPPF...............LRYDEDV......HDRIWI.......PF...L........DNKNSLLSTELS.
Y1756_ARATH/33-356FRVHL.TDSKET...............VRYPEDV......HDRLWS.......PF...F........MPEWRLLRTSLT.
Y4245_ARATH/33-374SRWYF.RKPFPTLE...........SIIRHPDDV......HDRLWD.......VY...HA.......DEEWTDINTTTP.
Y1518_ARATH/32-355ARVYFPSSSSSF...............IRYDEDI......HDRVWN.......SF...T........DDETVWISTDLP.
Q0JIC9_ORYSJ/48-385SRQRY.GQVNDV..............ITRYPEDV......YDRFWE......GAF..HTR.......SYPWINLNTTQE.
Q0J2D5_ORYSJ/28-372RRRNMAANNFIRRHLVWSSCKNHAYRKNMYPDDP......YDRYWW.......PM...NA.......DPAWANLSTTST.
Y1677_ARATH/29-363ARVNF.GAPNMD..............ALRYPDDP......YDRIWESDINKRPNYL.VGV.......APGTTRINTSKT.
Y1755_ARATH/32-354NRFYF.TDSNNY...............IRYPQDV......HDRIWV.......PL...I........LPEWTHINTSHH.
PAM74_ARATH/32-354VRIYL.NKT..DG.............FLRYPDDI......YDRRWH.......NY...FM.......VDDWTQIFTTLE.
Q9C8I6_ARATH/32-353IRADV..GA..TVN...........QGYRYGIDV......FDRVWT.......P....YN.......FGNWSQISTNQS.
Q6ERN3_ORYSJ/27-359VRSNV.GSSPDDD............KLVRYPDDQ......YDRFWS.......TD............EAHPLSTNISTQ.
B9RQ86_RICCO/32-352NRVDV..GS..LTN...........QTIRYPDDV......YDRMWL.......P....FH.......FDKGTDISTKEN.
Q65X94_ORYSJ/35-368GRWNF.GPISTTE.............FIRYPDDP......HDRIWM.......PW...VS.......PSYWVEVSTTRP.
RLK6_ARATH/36-358FRYYF.SGS..GQ.............NIRYPDDV......NDRKWY.......PF...FD.......AKEWTELTTNLN.
Q5VQN2_ORYSJ/40-388QR.........YGSV........DDYITRYPTDP......FDRFWE...........AAL.......RYKFPFLNMTTN.
B9RQ88_RICCO/35-358ARLDF..GS..VTN...........KTVRYPDDV......YDRIWT.......P....DH.......YYKWTDLSTPET.
Q5QL24_ORYSJ/29-348IRCRM.GQTDSS...............ITRFPDD......QHDRYW.......WTT.PT........NPMWAN.LSTTS.
B9RQ82_RICCO/34-356TRLDL..GS..LTN...........KTVRYPDDV......FDRIWT.......P....DH.......FHKWTDLSTPDT.
Y2451_ARATH/32-355AHFYF.TNS..DE.............AIRYPEDV......YDRVWM.......PY...S........QPEWTQINTTRN.
Y5188_ARATH/32-354ARVFF...S..ATP...........TFIRYDEDI......HDRVWV.......R....QF.......GNGLKSISTDLL.
B9RQ90_RICCO/31-355TREDV..GS..LNN...........RIVRYPNDV......YDRRWF.......P....YH.......FKRGTDISTTLT.
RLK7_ARATH/31-354RRLYF.KKS..GS.............RLRYSKDV......YDRSWF.......PR...F........MDEWTQISTALG.
B9RQ85_RICCO/33-355DRADI..SS..ITN...........QTVRYPDDV......YDRRWS.......P....FH.......FVEWTDISTTET.
Q6EQQ3_ORYSJ/24-352ERKSM.RSG..FH.............KYRFPDDQ......YDRYWY.......AWE.LT........GNDPYS.NISTQ.
Q67UW6_ORYSJ/28-358NRFNM.GPTDNS..............ITRYPLDP......HDRLWS.......TY...DT.......IPDWTEISATSV.
B9RQB2_RICCO/34-359QRLDF.GSTTNE..............IVRYHDDA......YDRIWF.......PY...NC........PQYAALSTSFA.
Y2923_ARATH/33-360RRWDL..GA..TGD...........LPARYKDDI......FDRFWM.......P....LM.......FPNFLILNTSLM.
Y5181_ARATH/29-348FRVYY.SNL..KG.............YIEYPDDV......HDRIWK.......QI...LP.......YQDWQILTTNLQ.
Y3463_ARATH/35-357RRYYL.SNS..ES.............VIAYPEDV......KDRIWE.......PT...F........DSEWKQIWTTLK.
Q6EQK1_ORYSJ/34-368DRRSM.GAS..R..............IIRYPDDP......YDRVWW.......LP...QI.......TSGLIKISTRSL.
B9RQ87_RICCO/35-359GRYDC.GSTSDR..............AIRFPRDI......YDRIWS.......P....NN.......SPYWEVLSTTST.
Q9SN97_ARATH/32-354VRVYL.SDS..ND.............VIRYPDDV......YDRIWG.......SY...F........EPEWKKISTTLG.
Y5596_ARATH/32-354YREYF.SKS..DS.............SLRYPDDI......YDRQWT.......SF...F........DTEWTQINTTSD.
B9RQ89_RICCO/61-383SRSDV..GS..TTN...........RTLRYADDV......YDRIWT.......P....NH.......FFKWAEISTSET.
Y2921_ARATH/34-359KRWDL..GG..LGA...........LPVRYKDDV......FDRIWI.......P....LR.......FPKYTIFNASLT.
Y2899_ARATH/28-349FRVYL.SNS..DA.............SIRYADDV......HDRIWS.......PF...N........GSSHTHITTDLN.
B9H626_POPTR/24-339SRIAY.GANT.T...............VRFPDDG......YDRIWV.......PE............RVGSGLVSVASD.
B9H6K7_POPTR/19-375HRINV.GGPT.................LSPENDT......LWRYWVP....DDSF..LYS.......PDTAKNISSLSS.
B9HLB9_POPTR/28-361ARVNFGALSKDA...............IRYPDDP......YDRIWGSD...LEK.....RQNYLVGVAPGTVRINTSRY.
B9HS06_POPTR/28-348ARDNF.GADEEI...............IGFPDDQ......FNRLWQ.......PY..IDQ.......NP.....VVECQ.
D7U071_VITVI/66-391RRLDA.GSTTNE..............IVRFKDDA......YDRIWF.......PY...NL.......PDCE.SLNTTVP.
F4HWL3_ARATH/31-365TRLTCGTGKSRF..............DEDYRGDHW....GGDRFWNR....MRSF...G........KSADSPRSTEET.
F4I065_ARATH/33-357FRGYL.NDSGVV...............LRYPDDV......NDRRWF.......PF...S........YKEWKIVTTTLN.
F4IB60_ARATH/32-356QRLDF.GSTTNL..............TVRYPNDV......FDRIWF.......PA...T........PNGTKPLSDPST.
F4IB63_ARATH/29-347FRKYF.SDSGQT...............IRYPDDI......YDRVWH.......AS...FL.......ENNWAQVSTTLG.
F4IB71_ARATH/32-354NRVYFPSDSTSI...............VRYDEDI......HDRVWN.......PV...S........DDDSSSISTDLQ.
F4IB76_ARATH/32-354ARIYF.PKTAYF...............LRYSDDL......YDRVWV.......PF...S........QNETVSLSTNLP.
F4ICJ5_ARATH/32-364GRLSC.GSDQWGP.............GFTNHTDN......FGRSWQS....DEDF...RSE....DSRSVARSLSTLEK.
F4J801_ARATH/31-354KRNAY.GATK.L...............ISYPLDP......YGRLWS.......PK..GSQ.......DYPGLIDLT.TS.
F4JB46_ARATH/25-347ARNSF.GGDGEI...............ISYPDDK......YNRLWQ.......PF...SD.......QKHLTV....TS.
F6H477_VITVI/48-422YRLNV.GGRF.................VSPMEDT.....GMFRTWDE....DDDYC.VKL.......AFVPANSSIDLK.
F6HY53_VITVI/28-350NRYNFGSETSET...............VRYGDDV......LDRIWG.......PY...SW.......SSGESI.KAPYS.
I1MCW6_SOYBN/32-358IRRDL.GSNK.G...............YRYDDDV......YDRYWSYD..DADTW..YDN.......VDKWRKLNFPID.
I1PTQ3_ORYGL/76-415FRETV.SFGFNRFHFG......TDEHHIRYPVDR......YDRFWQ.......RY...ED.......IPGWEDVPDKIN.
I1PXF6_ORYGL/34-366ARLNF.GPSDET..............SIRYPDDP......HDRVWF.......PW...FD.......AAKWNEISTTNR.
I1QAW3_ORYGL/40-375KRLTC.GSGK.................PAFDEDLNGIHWGGDRFWLG.....VKT..LS........SSSDDQPISTEN.
K4B910_SOLLC/3-338KRLSC.GAQESMF.............DVDYSGDHW....GGDRFWS.......SIK.TFG.......QNSDRRISTKNS.
M0S6H3_MUSAM/43-370RRLNM.GPTDTF...............IRYPDDS......HDRIWD.......PF...NN.......IPFWAETSTNST.
SIRK_ARATH/33-359RRLDY.SKTGKL..............PSRYKDDI......YDRIWT.......PR...IV.......SSEYKILNTSLT.
Q0DGL2_ORYSJ/34-367GRWNF.GPTSNTE.............IIRYPDDP......HDREWV.......PW...IN.......PFDWTVISTTTM.
Q0J2E4_ORYSJ/17-347VRRSI.GSSADD..............DMRYPDDQ......YDRYWIM.....GET...TG.......AADMSNISTP...
Q0J2E5_ORYSJ/9-345ERRNM.GPSSRDN............PIIRYPNDT......YDRFWY.......PWG.SED.......DPTYSNLSAPST.
Q2QNF5_ORYSJ/41-399DRPPA.RFAFNRYQFWRP...ASYYKLFRYPFDP......YDRLWQ.......PY...GD.......DPSWTNITVAAA.
Q5JNB7_ORYSJ/47-383ARINFGAPTADP...............VRYPDDP......YDRVWESDM.ARRP.....NF....LVDAAPGTIRVATD.
Q5VQN4_ORYSJ/8-346SRIRF.GSVDEY..............ITRFPTDQ......YDRFWE.......GWVFTMH.......TFPWVNKSSNGK.
Q5ZCA6_ORYSJ/34-370NRLNF.GPTDNS..............LVRYPDDP......HDRFWG.......NWD.SYT.......SSLWKEISTASR.
Q5ZDH7_ORYSJ/38-375GRLTC.GNNL.F..............GPGFTNDSD....AFSRVWQS....DIDF...RN.......NDLNYDAITAGGR
Q65X96_ORYSJ/43-376GRLNF.GPTDYTD.............VIRYPDDP......HDRIWF.......PW...VD.......STKWSQISSTKK.
Q67TV6_ORYSJ/37-371SRVNF.GPTDTF...............IRYPDDP......RDRGWR.......PW...ID.......TMRYVEVSTTKT.
Q6EQM5_ORYSJ/33-373KRSDM.GADTTT..............LTRYPADE......HDRIWK.......GT...G........NPGSTDISTQEK.
Q6ERZ1_ORYSJ/29-346SRKNV.GSDIST...............LSYPYDR......YDRHWW......GQI...AP.......DPTCKNLSTAST.
Q94HA8_ORYSJ/46-404YRLNM.GGPL.................VTAFNDT......LGRIWLP....DAPF..LKLQA...AANAAWVPPRT.IK.
Q9M0D8_ARATH/30-359RRWDI.GYLNGT...............GRYQDDR......FDRIWS.......PY...SS.......NISWNSIITSGY.
Q9SZV2_ARATH/30-354RRWDF.GTATNL..............QIRYKDDF......YDRIWM.......PY...K........SPYQKTLNTSLT.

PF11721

Y1972_ARATH/435-593-...SAL.S..LVYYA......F....CLENGN..--------------------------------------YNVKLHF
Y3148_ARATH/403-590-...SAI.S..LTYQA......L....CLGKGN..--------------------------------------YTVNLHF
RKF1_ARATH/416-604-...APV.S..LTYFH......A....CLENGN..--------------------------------------YTINLDF
Y1534_ARATH/364-548-...SAI.S..LTYYA......L....CLENGN..--------------------------------------YNVNLHF
Y5343_ARATH/408-592-...SPQ.S..LKYYG......L....CLRRGS..--------------------------------------YKLQLHF
Y5614_ARATH/424-612-...SAS.S..LRYYG......L....GLENGG..--------------------------------------YTVTLQF
Q29NS0_DROPS/68-230-...HTT.T..FGYDF......P....TDGDGD..--------------------------------------YALIMKF
A0C5E5_PARTE/21-187-...GNS....FDYNL......P....INKNGQ..--------------------------------------YTIILQF
A0D555_PARTE/21-188-...AYK.S..FSYQI......P....LQKEGT..--------------------------------------YTLILKF
Q232Z6_TETTS/33-200-...GYN.S..FGYQL......A....LDIEQT..--------------------------------------YTLILKF
Q22CM9_TETTS/26-197-...SDE.N..FAYSL......P....VKEFGT..--------------------------------------YTLILKF
A6H797_BOVIN/39-199-...NEE.T..FGYEV......P....IKEEGD..--------------------------------------YVLVLKF
A7RLY6_NEMVE/27-185-...HLS.N..FGYTV......P....IKENGE..--------------------------------------YVLVLKF
Q17BA6_AEDAE/29-192-...HHD.S..FGYEL......P....IAGDGE..--------------------------------------YVLILKF
Q5DCB4_SCHJA/19-179-...HND.D..FSYPI......P....VISDGE..--------------------------------------YILTLKF
A8X3B8_CAEBR/29-187-...SKE.S..FDYEV......P.....VGDGE..--------------------------------------YVIILKF
Q95QG1_CAEEL/43-202-...SKE.S..FSYDV......P....ISEDGE..--------------------------------------YVIILKF
Q231X5_TETTS/32-203-...DQK.A..FSYLL......P....LKRSGE..--------------------------------------YSLIMIF
Q5CLI3_CRYHO/28-194-...STDRT..LQYMLNLNKLTP........GV..--------------------------------------FTIVLKF
A0CEJ8_PARTE/2-159-...GLN....FFYKL......PLNKDSPETQN..--------------------------------------YILTLYF
A0DJ13_PARTE/493-661-...GQS....FAYTI......PIGNEVPENQT..--------------------------------------YVLVLKF
A0DRE8_PARTE/13-175-...GQS....FAYTI......PIGNDIPENQT..--------------------------------------YVLVLKF
Q1ENU6_MUSAC/379-561-...SPL.S..LKYYG......R....CLYKGN..--------------------------------------YTVNLHF
A5AX10_VITVI/334-521-...SPL.S..LTYYG......L....CLGNGN..--------------------------------------YTVKLHF
A5B4N1_VITVI/273-458-...SAL.S..LTYYG......F....CLENGN..--------------------------------------YTVKLHF
Q49N12_SOYBN/402-586-...SPI.S..LTYYG......F....CLGNGN..--------------------------------------YTVNLHF
A5AYT9_VITVI/1-152-...SPL.S..LTYYG......R....CLANGN..--------------------------------------YTVKLHF
A5BAX3_VITVI/87-271-...SPL.S..XTYYG......R....CLADGX..--------------------------------------YTVKLHF
A5ATV0_VITVI/23-211-...SPL.S..LTYFR......Y....CLQNGS..--------------------------------------YSVRLHF
A5BDY5_VITVI/286-473-...SPL.S..LTYFG......Y....CLENGI..--------------------------------------YTLQLHF
Q9C6G4_ARATH/381-569-...SPL.S..LAYYA......F....CFENGS..--------------------------------------YNVKLHF
A5AR95_VITVI/288-473-...API.S..LKYYG......L....CLRKGS..--------------------------------------YKVRLYF
A5C3D9_VITVI/359-541-...SPI.S..LKYYG......L....CMRKGS..--------------------------------------YRVQLHF
Q94G99_SOLLC/19-203-...SSI.S..LKYYG......F....CLVPGT..--------------------------------------YKVILHF
A2XXK2_ORYSI/347-534-...SPS.S..LRYYG......I....GLENGN..--------------------------------------YTVTLQF
Q7XTR9_ORYSJ/429-616-...SPS.S..LRYYG......I....GLENGN..--------------------------------------YTVTLQF
Q6F2P3_ORYSJ/440-627-...SAS.S..LRYYG......L....GLENGN..--------------------------------------YTVLLQF
Q6ZKW6_ORYSJ/422-609-...SPS.S..LRYYG......I....GLENGN..--------------------------------------YTVSLEF
A5AGB3_VITVI/345-531-...SAG.S..LRYYG......L....GLENGN..--------------------------------------YNLTLQF
Q0WPE8_ARATH/420-606-...SAS.S..LRYYG......L....GLENGG..--------------------------------------YSVTVQF
A5BD31_VITVI/371-555-...SPG.S..LRYYG......L....GLQNGH..--------------------------------------YTVSLQF
A5BV17_VITVI/4-191-...SPG.S..LRYYG......L....GLENGP..--------------------------------------YIVSLEF
A4AT33_MARSH/904-1052-...SPSKT..FQYSI......P.....ITDGD..--------------------------------------YTVVLHF
A4AUK4_MARSH/903-1051-...SSSLT..FDYQI......P.....VQNGD..--------------------------------------YTVILHF
A4CK29_ROBBH/1247-1419-.TLAVPDN..MQWDF......P.....VPNGD..--------------------------------------YTVNLLF
A4CK28_ROBBH/332-497-.AGGTNPS..YIYDI......P.....VENGN..--------------------------------------YQVELYF
A9W8Z4_METEP/828-973-...G...N..FSYAI......P.....VASTSQA--------------------------------------YTVELRF
B1ZHU8_METPB/1383-1558-TPTTDADDGRFGYAVKNADGSA.....LASGS..--------------------------------------YKVVLHF
Q21PD3_SACD2/360-498-...G...S..YSYAV......P.....VTNAT..--------------------------------------YSLKLHF
B9M0U3_GEODF/207-345-...G...N..FSYSI......P.....VANGN..--------------------------------------YSLTLKF
B9M0U3_GEODF/432-570-...G...N..FSYTI......P.....AANGN..--------------------------------------YLVTLKF
Q01NB6_SOLUE/205-356-...G...D..FRYAI......P.....LKPGT..--------------------------------------YELHLHF
Q021C7_SOLUE/211-363-...G...S..FAYDI......P.....LPAGV..--------------------------------------YELRLHF
Q026G9_SOLUE/209-373-..........IRYDI......P.....VRSGV..--------------------------------------YELRLYF
Q01RD0_SOLUE/183-344-...G...N..FSYRI......P.....LPEGK..--------------------------------------YDLRLYF
Q7UIV5_RHOBA/6-153-...GMR.S..FAQDV......A.......DGD..--------------------------------------YLVNLYF
Q7UIV6_RHOBA/184-340-...GMT.A..FSYVV......P.......NGK..--------------------------------------YLVKLYF
A5FCJ0_FLAJ1/725-892-...GVD.K..LRYEF......P.....APDGE..--------------------------------------YLVELYF
A6L3S6_BACV8/1081-1251-...GRH.K..LNFRF......P.....VPDGE..--------------------------------------YRVELYF
A7LQW1_BACO1/1065-1228-...GRH.Q..LKYRF......P.....VADGT..--------------------------------------YRIELYF
B1KJF7_SHEWM/58-198-...G...D..IKIRR......P.....MTNGL..--------------------------------------YDITFKF
A4CKE5_ROBBH/1275-1442-..APTAPE..MEYQV......P.....LENGD..--------------------------------------YILKVYV

PF12819

Y5573_ARATH/35-359.VN..SSN..GYDPPK------FVMASASTPISKN.AP...FNFTW......SL.IPSTAK............FYSYMHF
Y4291_ARATH/31-359.ID..IFQ.SGYRPPD------EVIKTAASPKSDD.EP...LELSW......TS.SDPDTR............FYAYLYF
MEE39_ARATH/34-356.VS..NKN..HYDPPQ------VALKMAATPTNLD.AA...LTMVW......RL.ENPDDQ............IYLYMHF
Q0DGL3_ORYSJ/34-370.VQ..NTIAPVFDVPS------VVMQTAITTRNSS.IP...IQFSWDT..KPNH.VYPDPG............SIFTLYV
Y5169_ARATH/27-358.VN..NSN..NYEPPK------AALTSAATPGDNG.TR...LTIIW......TL.DNPDEQ............IHLYVHF
Y5189_ARATH/28-350.VD..TSN..FYNVPQ------TVAKTAAVPLNAT.QP...LKINW......SL.DDITSQ............SYIYMHF
Y1756_ARATH/33-356.VN..TSDDNGYDIPE------DVVVTAATPANVS.SP...LTISW......NL.ETPDDL............VYAYLHV
Y4245_ARATH/33-374.VN.TTVN..AFDLPQ------AIISKASIPQVAS.DT...WSTTW......SI.QNPDDD............VHVYLHF
Y1518_ARATH/32-355.ID..TSN..SYDMPQ------SVMKTAAVPKNAS.EP...WLLWW......TL.DENTAQ............SYVYMHF
Q0JIC9_ORYSJ/48-385.VK.RLPGDEKFMVPN------TILQKASTINITF.SW...LNITVRG..ANNLLGLGDLE............LLPVFHF
Q0J2D5_ORYSJ/28-372.IK..TGS..TFAVPS------SVLQTAVTPSGNS.TV...LNVIS......WQ.DTTAKE............YVVYLHF
Y1677_ARATH/29-363.IN..TLT..REYPPM------KVMQTAVVGTQGL......ISYRL......NL.EDFPAN............ARAYAYF
Y1755_ARATH/32-354.VI.DSID..GYDPPQ------DVLRTGAMPANAS.DP...MTITW......NL.KTATDQ............VYGYIYI
PAM74_ARATH/32-354.VT..NDN..NYEPPK------KALAAAATPSNAS.AP...LTISW......PP.DNPGDQ............YYLYSHF
Q9C8I6_ARATH/32-353.....VNINNDYQPPE------IAMVTASVPTDPD.AA...MNISL......VG.VERTVQ............FYVFMHF
Q6ERN3_ORYSJ/27-359.TT..IQASTEFAVPS------PVLQKAIVPSGNSMKL...VFFSD......QV.DVLLHN............HFVILHF
B9RQ86_RICCO/32-352.IT..SGI.DYFQLPS------TVMNSATVPLNAS.EQ...IILNI......DT.QDNTFQ............AYVYIHF
Q65X94_ORYSJ/35-368.VQ..HTDEDVFDAPT------KVMQTAIAPLNAS.SN...IEFAWVP..YTQP.KDPAPG............YITVMHF
RLK6_ARATH/36-358.IN..SSN..GYAPPE------VVMASASTPISTF.GT...WNFSW......LL.PSSTTQ............FYVYMHF
Q5VQN2_ORYSJ/40-388QDVTKLPGNDDFQVPM------PILQKASTIS.........SNFSEFNVSVIFP.DNMKNIDNINNIDYRSLELLPIFHF
B9RQ88_RICCO/35-358.ID..AQFHNDFQPPS------IVMSTANVPTNAS.ED...MQFFI......DN.EDTSLQ............FYFYMHF
Q5QL24_ORYSJ/29-348.DI..QEESSLFGVPS------AILQKAVTVVGNGTM....LNVTW......ED.RLFI.E............FMVFLHF
B9RQ82_RICCO/34-356.VD..AQNHIDFQPPS------VVMRTANMPTNAS.EN...MEFYI......DI.DDTTSL............FYVYMHF
Y2451_ARATH/32-355.VS..GFSD.GYNPPQ------GVIQTASIPTNGS.EP...LTFTW......NL.ESSDDE............TYAYLFF
Y5188_ARATH/32-354.VD..T.S.NPYDVPQ------AVAKTACVPSNAS.QP...LIFDW......TL.DNITSQ............SYVYMHF
B9RQ90_RICCO/31-355.VD..LDDHNDFQPPS------IVMRSAVISINTS.SP...LEFYI.......N.NDTTYK............LYAYMHF
RLK7_ARATH/31-354.VI..NTN..IYQPPE------DALKNAATPTDAS.AP...LTFKW......NS.EKLDVQ............YYFYAHY
B9RQ85_RICCO/33-355.ID..LGKSNSYQLPS------TVMRSAGTPRNSS.SP...MEVTI......AA.EDPTLK............FYAYFHF
Q6EQQ3_ORYSJ/24-352.SA..IELNTTFMVPL------RVLQTAFVPVGNSNEL...VLRSK......RR.DRLPGD............HLVILHF
Q67UW6_ORYSJ/28-358.VQ..NYLTDVYDVPS------AVMQSAATV..NS.SR...INFTWDP..SDPS.VNISSK............YFFVLYF
B9RQB2_RICCO/34-359.VD..SLKTTDFNLPS------KVMQTAVEPMNAN.ES...LNFEF......DI.GTPNMN............FYIYMHF
Y2923_ARATH/33-360.ID..PTSSNGFLPPS------VVMSTAVAPMNSSIEQ...IMVYW......EP.RDPNWK............FYIYIHF
Y5181_ARATH/29-348.IN..VSN..DYDLPQ------RVMKTAVTPIKASTTT...MEFPW......NL.EPPTSQ............FYLFLHF
Y3463_ARATH/35-357.PN..NSN..GYLVPK------NVLMTAAIPANDS.AP...FRFTE......EL.DSPTDE............LYVYLHF
Q6EQK1_ORYSJ/34-368.IS..RYTDDVYEVPV------AVLKTAATTSSTS.TA...LNFLWAAPTGW....DATPG............YLIGLHF
B9RQ87_RICCO/35-359.VQ...HSRNKFQMPS------IVMETAVTVNDSYVG....LILSW......VR.DNPNSQ............FHIYFHL
Q9SN97_ARATH/32-354.VN..SSS..GFLPPL------KALMTAASPANAS.AP...LAIPG......VL.DFPSDK............LYLFLHF
Y5596_ARATH/32-354.VG..NSN..DYKPPK------VALTTAAIPTNAS.AP...LTNEW......SS.VNPDEQ............YYVYAHF
B9RQ89_RICCO/61-383.ID..ALAQNDYRPPS------IVMRTAGIPANDN.EP...MTVSI......DF.EDTTFR............FLVYMHF
Y2921_ARATH/34-359.ID..SNNNEGFQPAR------FVMNTATSPEDLS.QD...IIFSW......EP.KDPTWK............YFVYMHF
Y2899_ARATH/28-349.IN..NSN..AYEIPK------NILQTAAIPRNAS.AP...LIITW......DP.LPINAE............VYLYMHF
B9H626_POPTR/24-339.AILIDVANAPDNPPP------EVLQNAITTSNTS.AS...ITLNP......GF.PDQDVS............VYMNLYF
B9H6K7_POPTR/19-375.KPNSQGGVSKYIAPD------LVYQTAKEMNINNSRSSNNFNITW......SFNVSKNAM............HFVRVHF
B9HLB9_POPTR/28-361.VD....TRTREYPPV------KVMQTAVVGTEGI......LSYRL......NL.EDFPAN............ARAYAYF
B9HS06_POPTR/28-348.NN.ISSSEFWNFPPQ------RAFASAITTSRGK..T...IKIQW......PPVSLPSTK............YYIALYF
D7U071_VITVI/66-391.ID..SHAETEYKLPS------KVMTTAIRPMNSS.AS...LDFDF......DI.GDSTLE............FYVYMHF
F4HWL3_ARATH/31-365.IK..KASVSPNFYPE------GLYQSALVSTDDQ......PDLTY......SLDVEPNRN............YSVWLHF
F4I065_ARATH/33-357.VN..T..SNGFDLPQ------GAMASAATRVNDN.GT...WEFPW......SL.EDSTTR............FHIYLHF
F4IB60_ARATH/32-356SLT..SNSTGNFRLPQ------VVMRTGIVPDNPR.GF...VDFGW......IP.DDPSLE............FFFYLYF
F4IB63_ARATH/29-347.VN...V.TDNYDLSQ------DVMATGATPLNDS.ET...LNITW......NV.EPPTTK............VYSYMHF
F4IB71_ARATH/32-354.VQ....TNNLYDVPQ------FVMKTAAIPKDAS.AP...WSLVW......TI.DNTTAL............SYVYMHF
F4IB76_ARATH/32-354.VD...TSSNSYNVPQ------NVANSAIIPAEAT.HP...LNIWW......DL.QNINAP............SYVYMHF
F4ICJ5_ARATH/32-364.IK..GVDQAPNYFPM------KLYQTAVTVSGGG.......SLVY......ELEVDAKLD............YLLWFHF
F4J801_ARATH/31-354.APSIDITGALNKPPE------IVMTKAMSGD..G......FIMSG.....LNL.PSTLLP............VYLALYF
F4JB46_ARATH/25-347.RSRINPSNFWNIPPA------EAFVEGFTASKG..KP...LELQW......PPFPLPATK............YYVALYF
F6H477_VITVI/48-422.FT..QQ..PEYTAPP------DVYRTARTMGNNKTENM.GYNLTW......VLSVDSGFN............YLLRLHF
F6HY53_VITVI/28-350.SS..GLSENQFKLPA------KVMETAVKPVNGT..S...LDFYL......DG.IDSSQE............FYVYLHV
I1MCW6_SOYBN/32-358.AD..SLVQNKYQPPA------VVMSTAVTPANVS.AP...LVISW......EP.DDPKES............FYVYMHF
I1PTQ3_ORYGL/76-415.GTVKSPQNDTYGAPS------DLMRSASTAVNAS..R...MDLPWSS..DASMDVGIGPE............YIVVLYF
I1PXF6_ORYGL/34-366.VQ..NIDNDLFEAPT------AVMQTAVTPINAS.NN...IDFFWNS..QPQP.NDPAPG............YIAIFHF
I1QAW3_ORYGL/40-375.VI.AETLLAPNFYPQ------SIYQSAIVGTDRQ......PSLSF......EMDVTPNRN............YSVWLHF
K4B910_SOLLC/3-338.TK..STSKAPNFYPG------SIYQTALLSTDNE......PELTY......TMDIDPNKK............YSVWLHF
M0S6H3_MUSAM/43-370.VE..NFVDDKFEAPS------AVMQTAVIPVNST..K...LMISWE....PEL.GDVN.E............YYAVMYF
SIRK_ARATH/33-359.VD..QFLNNGYQPAS------TVMSTAETARNES.LY...LTLSF......RP.PDPNAK............FYVYMHF
Q0DGL2_ORYSJ/34-367.VQ..NIENDIFEAPS------RVMQTAITPRNAS.GN...IEFAWDA..YTQP.KDPTPG............YIANFYF
Q0J2E4_ORYSJ/17-347.T..IIPPSVPFAVPS------PILQKAVVPADNS.MK...LVFHS.....DQL.DAQLRD............HLVILHF
Q0J2E5_ORYSJ/9-345.LI..IPPSPSYAVPS------PVLETAVVPADNNKSV...LSIIQ......TN.DKEIHE............YLVLVHY
Q2QNF5_ORYSJ/41-399.VDVTNIS..RSDDPS------PILRSAATPANATVRR...LDFPW......SSDDAATTT............YLLLLYF
Q5JNB7_ORYSJ/47-383.NP..VFVASGERPPQ------KVMQTAVVGTLGA......LTYRL......DLNGFPGS.............GWACSYL
Q5VQN4_ORYSJ/8-346.VA.ELPNIDTFGLPP------AILGSASTINGNF.SW...LNISVS...ASNS.LATDLE............LLPVFHF
Q5ZCA6_ORYSJ/34-370.VD..NLDGDIFDAPT------AVMQTAVTPRNAS.GN...IYFFWEP..WPQP.NDPTPP............YTVIFHF
Q5ZDH7_ORYSJ/38-375KI..FGSNQPPNYFPT------KLYTSAITTGGDA..S...NEIEY......LMPVDTRMS............YMVWLHF
Q65X96_ORYSJ/43-376.VQ..DLDNDMYETPT------AVMQTAITPRNAS.RN...IEFSWD...PVPLPNDPTPG............YIAIFHF
Q67TV6_ORYSJ/37-371.VQ..NVEKDLFEAPS------AVMQTAITPRNAS.DS...IELYWTADPSAAA.GDPPPG............YIAIMHF
Q6EQM5_ORYSJ/33-373.IQ....SENSFEVPL------PVLQTAITTPGGNDTT...LTVAW......QD.TRSSSE............YMVFLHF
Q6ERZ1_ORYSJ/29-346.IK..N..NSMFSVPS------PVMQTAVEAANKS..S...LRIKW......EN.SAPIE.............YKVFMHF
Q94HA8_ORYSJ/46-404.YP.DDKTNTPLIAPA------NIYSTAQQMASTNTSDA.RFNITW......EMVTEPGFS............YFVRLHF
Q9M0D8_ARATH/30-359.ID...VFQNGYCPPD------EVIKTAAAPENVD.DP...LELFW......TS.DDPNVR............FYAYLYF
Q9SZV2_ARATH/30-354.ID..ETNHNGFRPAS------IVMRSAIAPGNES.NP...LKFNW......AP.DDPRSK............FYIYMHF

PF11721

Y1972_ARATH/435-593MEIQFSD..KEVYSRLG-------RRIFDVYVQG.KLFLRDFNINK..EANGNM.KPVIKEI.NA.TV.TNH-----MLE
Y3148_ARATH/403-590AEIMFNE..KNMYSNLG-------RRYFDIYVQG.KREVKDFNIVD..EAKGVG.KAVVKKF.PV.MV.TNG-----KLE
RKF1_ARATH/416-604AEIRFTN..DENYNRLG-------RRLFDIYIQE.KLVAKDFNIMD..EAKGAQ.TPIIKPL.TA.YV.TNH-----FLT
Y1534_ARATH/364-548AEIMFNG..NNNYQSLG-------RRFFDIYIQR.KLEVKDFNIAK..EAKDVG.NVVIKTF.PV.EI.KDG-----KLE
Y5343_ARATH/408-592AEIMFSN..DQTFNSLG-------RRIFDIYVQG.NLLERDFNIAE..RAGGVG.KPFIRQIDGV.QV.NGS-----TLE
Y5614_ARATH/424-612AEIQILGSTSNTWRGLG-------RRRFDIYVQG.RLVEKDFDVRR..TAGDSTVRAVQREY.KA.NV.SQN-----HLE
Q29NS0_DROPS/68-230CEVYFDA........PG-------RKVFDVLLNRKHTVIRQLDIYE..QVGRGS...AHDEIVYF.KI.NNG-----RLH
A0C5E5_PARTE/21-187VELYFEN........EG-------ERQFDIYIGT.KRVIQNLSIID..NKHQKG..SAKEVFIYI.DI.KED-----KVF
A0D555_PARTE/21-188AEMYFDT........KG-------KRVFHIKFGQ.QRVVEKLDVVA..KV.GKF..ASNDEYIEF.EY.VAG-----QVF
Q232Z6_TETTS/33-200CEMYFDK........PG-------RRVFHVKLGD.TRVITNLDIFA..KA.GRF..VAHDEYVEF.KY.QNG-----KIY
Q22CM9_TETTS/26-197CELYFTE........PN-------KRVFSILFGD.SLVVPEVDIVK..EV.GPF..AAYDLYIEF.EY.KSD-----QLF
A6H797_BOVIN/39-199AEVYFAQ........SQ-------QKVFDVRLNG.HVVVKDLDIFD..RV.GHS..TAHDEIIPM.SI.RKG-----KLS
A7RLY6_NEMVE/27-185CEVYFQA........PR-------LKVFDVSINS.HPVIQGLDIYE..KV.GRG..IAHDEYVPF.TI.RDN-----QLI
Q17BA6_AEDAE/29-192CEVYFNA........PN-------MKVFDVLLNSRHMVITDLDIFS..LV.GKG..TAHDEYVYF.TV.SRG-----RLY
Q5DCB4_SCHJA/19-179SEVWFTE........IY-------QKVFDVYVQHTIPIVQNLDIFG..QV.GFA..TAYDFHLQF.KI.KDR-----VLF
A8X3B8_CAEBR/29-187SEVYFQR........VQ-------EKVFNVRINS.YTAVKNLDIYE..AAGGRG..YAHDIYIPL.VI.KDK-----KIS
Q95QG1_CAEEL/43-202SEVYFQK........AG-------EKIFNIRINS.HLAVKNLDIFD..AAGGRG..FAHDVYIPV.VI.KGS-----SIS
Q231X5_TETTS/32-203AEINDIG........AK-------KRVFNIIVED.EVVIPNFDIYT..LAGGKQ..LPHFEIIEF.SF.QNR-----VLK
Q5CLI3_CRYHO/28-194SEIHFKE........PG-------KKVFSIAVGN.VIFKQSFDIYK..EV.GFG..VPMEEYIEC.TF.DGE-----NIS
A0CEJ8_PARTE/2-159AELQYQE........SN-------ARIFEVFFGN.KLVIENLDIYE..TVGMQT...AYSIDLSFQKI.GQQ-----ILY
A0DJ13_PARTE/493-661AELHYEE........SN-------SRVFNILLGK.KMILQNIDISQ..LVGPFT...AHTEYIEI.II.DGG-----AVY
A0DRE8_PARTE/13-175AELFYEE........SN-------SRIFNVMLGK.MMILQNIDIFQ..LVGTFT...AHTEYIEF.II.DEG-----TVY
Q1ENU6_MUSAC/379-561AEIMFTD..DETYSSNG-------RRLFDVSIQG.RKVLKDFNIAK..EANGTG.KEIIKSF.TV.MV.DG.-----TLE
A5AX10_VITVI/334-521AEIIFIN..DKSFNSLG-------ERIFDVYIQG.KLVLKDFNIEK..EAGGTG.KPIIKNF.TA.EV.TSH-----TLK
A5B4N1_VITVI/273-458AEITFTD..DKTYSSLG-------RRLFDVYVQD.ELVLKDFNIED..EAGGVS.KEILKYF.TA.VV.TNN-----TLE
Q49N12_SOYBN/402-586AEIMFID..DQTFNSLG-------RRVFDIYIQG.ALVKKDFDIVE..EAGGIG.KAVITSF.TA.VV.TSN-----TLE
A5AYT9_VITVI/1-152AEIIFRS..NRSFYSLG-------RRIFDVYIQD.KLELKDFDIEH..AARGVD.KTIVKEF.KA.VV.RNK-----TLE
A5BAX3_VITVI/87-271AEIVIRX..NKSFHSLG-------RRIFDVYIQE.KLELQDFNIVQ..AAQGVD.KVVVREF.KA.VV.RNK-----TLD
A5ATV0_VITVI/23-211AEIEFTN..DSTYGSLG-------KRMFDIYAQD.ELVKKDFNIED..HAKGAL.KPYTLPF.NA.TV.TNN-----VLE
A5BDY5_VITVI/286-473TEIYFTD..DKTYNSLG-------KRLFDIYIQE.KLVHKNFNIED..EAHGAR.KPVMKQF.NA.SV.INN-----ILE
Q9C6G4_ARATH/381-569AEIQFSD..VEPYTKLA-------KRVFNIYIQG.KLIWEDFSIRE..EANGTH.KEVIREV.NT.TV.TDN-----TLE
A5AR95_VITVI/288-473AEIMFSN..NQTFGSLG-------RRLFDVSIQG.TVVLSDFNVMEEAEAEGAG.NGIYRDF.DA.SV.DGS-----TLE
A5C3D9_VITVI/359-541AEIMFSD..DETFSSLG-------KRIFDVSIQG.VTVLKDFNIVE..EAKGVG.KAITKDF.ET.SV.NGS-----TLE
Q94G99_SOLLC/19-203ADISKRK..HRLSHGKT-------RRVFDIEIQG.IKVEPNFNIEAEGEGQAVN.EPITKEY.SA.EV.HNN-----LLE
A2XXK2_ORYSI/347-534AEFGIED..TQSYKSLG-------RRVFDIYLQG.ERQEKNFDIRK..AAGDKSYTVVKKSY.KV.PV.TKN-----FLE
Q7XTR9_ORYSJ/429-616AEVDFPD..VQSWRSRG-------RRIFDIYIQG.ERKEQNFDIRK..AAGGKSFTVVKKQY.VV.PV.TKN-----FLE
Q6F2P3_ORYSJ/440-627AEFAFPD..SQGWQSLG-------KRIFDIYVQG.ALKEKDFNIKK..TAGGKSFTVVNRNY.TA.TV.SKN-----FLE
Q6ZKW6_ORYSJ/422-609AEFVYPN..SLTSNSIG-------RRVFDIYVQG.ELKEKNFNIRK..MAGGKSLIAVNKRY.TA.TV.SKN-----FLE
A5AGB3_VITVI/345-531AETAIVN..SNSWKSLG-------RRVFDIYIQG.DLVLKDFDIRK..EAGGVSFQAVKKEF.TA.QV.LEN-----YIE
Q0WPE8_ARATH/420-606AEIQIQG..SNTWKSLG-------RRIFDIYVQG.KLVEKDFDMQK..AANGSSIRVIQRVY.KA.NV.SEN-----YLE
A5BD31_VITVI/371-555AEMELKDQSAQTWESIG-------RRVFDIYIQG.TLQLKDFDITK..EAGGVE.RAIERKF.NA.VV.SQN-----YLE
A5BV17_VITVI/4-191AETVFKDRDTQTWESLG-------RRVFDIYIQG.ALQFKDFDISK..EAGGVE.RALEKKF.NA.TV.SEN-----YLE
A4AT33_MARSH/904-1052AEIYWGA.TGGGPGGSG-------QRVFDVTVEG.NLVLDNYDIFS..EVGA...EVAQQKSFDV.TV.NDG-----SLN
A4AUK4_MARSH/903-1051AEIYWGA.TGGGSGATG-------IRVFDVSLEG.SLVLDDYDIYD..DVGA...ETEVSKSFDI.TV.LDG-----SVD
A4CK29_ROBBH/1247-1419AEIWTGA......QDPG-------IRVFDVQIEG.NPVLTNFD.....QTAAYGWATAGVESFPV.TV.SDG-----NLD
A4CK28_ROBBH/332-497AEVFHPG........PN-------GRVFDVFLDG.NLILDEYDLVNPIKDGLSSNQTAITRTYNV.NV.TDG-----NIS
A9W8Z4_METEP/828-973GELWWSN........PG-------QRVFDVTLEG.QTILNDLDILA..QTGSFN.TPYTYVSGPI.TAGANG-----TLD
B1ZHU8_METPB/1383-1558AEIYNQPDDPGGLTGAG-------QRQFNVGIEG..TTVANYDIWA..AAGAGATATTLTRTVSV....TDG-----TLN
Q21PD3_SACD2/360-498AEIYHTE........AG-------ARSFNLAVEG.QQEMASVDLYS..LSGHDGAYTYEVNDFPV....DDG-----EVT
B9M0U3_GEODF/207-345AEIYFSA........AG-------QRVFSVTVNG.QTVISNLDIFA..KVGK...NVAYDVVIPI.NV.TTG-----AVT
B9M0U3_GEODF/432-570AEIYFSA........AG-------RRVFNVAING.QTVISNLDIYA..KVGK...NVAYDVVIPV.TA.TNG-----AIT
Q01NB6_SOLUE/205-356AETGLADFISAESSGEG-------QRVFHVSANG.KRLLDFFDVVA..DANGVN.TSDERVFRNIAPA.EDG-----FLH
Q021C7_SOLUE/211-363AETLYGE.NNVAGGGES-------SRVFNVSING.KEALHEFDVTS..EVGPST..ADVRAFKDISPE.ADG-----KLH
Q026G9_SOLUE/209-373ADPLRQPEVDQKEDAQN-------RRHFQINLNG.HLLLRDFDAVA..DGGSAA..VTVRVFKDVYPA.PDG-----KLH
Q01RD0_SOLUE/183-344SEVIFLP.TEFGDGVEN-------RRIFDVLMNG.QPLLSSFDIAA..DAGGAN.TAIIRAFSNVSPV..NG-----YLT
Q7UIV5_RHOBA/6-153AETFPRI......TGPG-------QRVFSFRVNG..IEFDEFDIWQ..KAGGSN.RVYVESV.PV.KI.NSG-----ILW
Q7UIV6_RHOBA/184-340AETYNGI......TDEG-------QRVFTFDVEG..HETTDFDIWK..KAGGPR.KAIVESVPAV..V.DDG-----ELN
A5FCJ0_FLAJ1/725-892TEPWYGT..GGGLDCKG-------WRLFDVAIND.NVVLKDFDIWA..EAGHDN...ALKKTFKV.KS.TNG-----KIV
A6L3S6_BACV8/1081-1251TEPWHGTGGGVQTDCEG-------LRIFDVAVND.KVLLNDLDVWA..EAGHDG...ACKKVVNA.VV.KGG-----VLK
A7LQW1_BACO1/1065-1228TEPWHGTGGSASADCEG-------LRIFDVAVND.SVVLDDLDIWA..ESGHDG...VCKKVVYA.TV.KGG-----MLK
B1KJF7_SHEWM/58-198AEPEDIP........IG-------ARVFDVLAQG.KPVIENLDVRQ..ARDGKHSSALSRTVTDV.EI.TSG-----QLD
A4CKE5_ROBBH/1275-1442GNFFNGT......DEVG-------ERVFDINVEG.VLVEDDFDPVA..AFGHLSGGALSYPV....TV.TDG-----VMN

PF12819

Y5573_ARATH/35-359ADIQTLQ------ANET........REFDMMLNGNLAL..E..RYR--P.KTFATGTIYFIKPQICE..GGQ.....CII
Y4291_ARATH/31-359AELENLK------RNES........REIKIFWNGSPVS..G..AFN--P.SPEYSMTVSNSRAFTGK..........DHW
MEE39_ARATH/34-356SEIQ..V------LKAN......DTREFDIILNGETIN..T.RGVT--P.KYLEIMTW..LTTNPRQCNGGI.....CRM
Q0DGL3_ORYSJ/34-370TELELLA------GNAV........RQFNVTINGVIWT..K.APYK--P.VYLSTDAMYNGDRPYRGI..TR.....YNF
Y5169_ARATH/27-358AELEPVG------ENTDEALRTLFTRTFYFVVNGKISY.DE..SIT--P.LDLAVSTV...ETVVNKCDGGN.....CSL
Y5189_ARATH/28-350AEIENLE------ANET........REFNITYNGGENW.FS..YFR--P.PKFRITTV..YNPAAVSSLDGN.....FNF
Y1756_ARATH/33-356AEIQSL.------REND.......TREFNISAGQDVNY..G..PVS--P.DEFLVGTL..FNTSPVKCEGGT.....CHL
Y4245_ARATH/33-374AEIQALK------PSDT........REFSILWNKNTII..R.DYYS--P.LEFMADTVPI..RTSSKCGDDG.....FCS
Y1518_ARATH/32-355AEVQNL.------TANE.......TREFNITYNGGLRW.FS..YLR--P.PNLSISTI..FNPRAVSSSNGI.....FNF
Q0JIC9_ORYSJ/48-385AEIASNT------...........TRLFDIYSDSEELF..A..NFS--P.SPFQVDSMYQNGRFLPGVSSTF........
Q0J2D5_ORYSJ/28-372ADFQSSK------...........LREFDAYPDANQVV..Y..NYT--P.HYLLSSSV..YTPLFRAI.AGE.....YNI
Y1677_ARATH/29-363AEIEELG------ANET........RKFKLVQPYFPDY..SNAVVN--I.AENANGSYTLYEPSYMNVTLDF.....VLT
Y1755_ARATH/32-354AEIME.V------QANE.......TREFEVVVNNKVHF..D..PFR--P.TRFEAQVM..FNNVPLTCEGGF.....CRL
PAM74_ARATH/32-354SEIQD..------LQTN......DTREFDILWDGA..VVEE..GFI--P.PKLGVTTI..HNLSPVTCKGEN.....CIY
Q9C8I6_ARATH/32-353AEIQE..------LKSN......DTREFNIMYN..NKHIYG..PFR--P.LNFTTSSV..FTPTEVVADANG.....QYI
Q6ERN3_ORYSJ/27-359ADFQNNK------...........SREFTVSIDN......G.VQSS--P.YSTPYLKGLSVTGGWSSNSEGK.....YNF
B9RQ86_RICCO/32-352AEIVR..------LEPN......QSRRFNISLN..GKILYG..PVT--P.KHLEATTV..YSQSAIPG..GK.....FLF
Q65X94_ORYSJ/35-368SELQLR.------SSNA.......TRQFYINLNGNMVFSQ...GYT--P.AYLYADAIFNSN.PFLRYP..Q.....YNI
RLK6_ARATH/36-358AEIQT..------LRSL......DTREFKVTLNGK..LAYE..RYS--P.KTLATETI..FYSTPQQCEDGT.....CLL
Q5VQN2_ORYSJ/40-388ADIGGNN------QNR........TFDIYN..DGNLMF.P...NYI--P.PLFRAESTYQSGKFLRKRGLNF........
B9RQ88_RICCO/35-358AEIVK..------LEAN......QSRQFNISLN..GTIFFG..PVI--P.DYLYTSSV..YNGLPINA..GS.....NVF
Q5QL24_ORYSJ/29-348ADFQDSK------...........IRQFNVYFNN......D.SPLL--Y.TPLYLAADYVYSVVWYSSTNGK.....FNI
B9RQ82_RICCO/34-356AEIVE..------LQAN......QSRLFNISLN..GTIWYG..PVI--P.NHLSSGTV..YSQFPIIG..GN.....NMF
Y2451_ARATH/32-355AEIQQ..------LKVN......ETREFKILANGV..DYID...YT--P.WKFEARTL..SNPAPLKCEGGV.....CRV
Y5188_ARATH/32-354AEIQT..------LKDN......DIREFNITYN.GGQNVYS..YLR--P.EKFEISTL..FDSKPLSSPDGS.....FSL
B9RQ90_RICCO/31-355AEIVK..------LEAN......QSRQFNISLN..GKIWYG..PVT--P.TYLYTTTV..YSTSAITD..GM.....YEF
RLK7_ARATH/31-354AEIQD..------LQAN......DTREFNILLNGQNLSVTG..PEV--P.DKLSIKTF..QSSSPISCNGWA.....CNF
B9RQ85_RICCO/33-355AEIVK..------LDAN......QSREFNITLN..GDIWYG..PIT--L.HYLYSTTV..SSGYAISG..GT.....YDF
Q6EQQ3_ORYSJ/24-352ADFQDNK------...........TREFTVSIDS......G.MQSG--P.ISPPYLKGWSII.NWSSDSE.D.....LSI
Q67UW6_ORYSJ/28-358SELQSV.------PSNG.......LRQFDIIVNNNTWNTQ...PYT--P.PFLFADSLSGTV...QGLA..S.....YSV
B9RQB2_RICCO/34-359AEVESI.------QRNQ.......YRGFNIALNGKLFNEG....VV--L.KYLQSMTISTMQ.PMRGA...K.....ISI
Y2923_ARATH/33-360AEVEK..------LPSN......ETREFSVFLNKEQIDTTS..VFR--P.SYLYTDTL..YVQNPVSG..PF.....LEF
Y5181_ARATH/29-348AELQS..------LQAN......ETREFNVVLNGN..VTFK..SYS--P.KFLEMQTV..YSTAPKQCDGGK.....CLL
Y3463_ARATH/35-357SEVQS..------LQAN......ESREFDILWSGE..VAYE..AFI--P.EYLNITTI..QTNTPVTCPGGK.....CNL
Q6EQK1_ORYSJ/34-368TDFQQGQ------...........LREFDIYYNNDLWNYDN.KKTK--P.PYLLANYI..NGTTPYTSDNYL.....YNI
B9RQ87_RICCO/35-359AEIQELK------TTQ........YRGLDIYVNDELWY.G...PFS--P.TYLQTTTIYNTE....AMNATG.....YDV
Q9SN97_ARATH/32-354SEIQV..------LKAN......ETREFEIFWNKK..LVYN..AYS--P.VYLQTKTI..RNPSPVTCERGE.....CIL
Y5596_ARATH/32-354SEIQE..------LQAN......ETREFNMLLNGK..LFFG..PVV--P.PKLAISTI..LSVSPNTCEGGE.....CNL
B9RQ89_RICCO/61-383AEILK..------LEAN......ESRQFNISLN..GEHWFG..PLR--P.DYLYTTTV..FSPTVLSG..GQ.....YEF
Y2921_ARATH/34-359AEVVE..------LPSN......ETREFKVLLNEKEINMSS...FS--P.RYLYTDTL..FVQNPVSG..PK.....LEF
Y2899_ARATH/28-349AEIQT..------LEAN......ETRQFDVILRGN..FNHS..GFS--P.TKLKVFTL..YTEEPMKCGSEG.....CYL
B9H626_POPTR/24-339SEVTELD------ATQ........KRSFNAYIDNIKSS..E..PII--P.PYEAAKEVSA......NFTASA.....NTS
B9H6K7_POPTR/19-375CDFLSAS------PGA........LLRFNLYIYSNFSL.....PIS--PYETTGQLAAPFHVDYVVDSDDSG.....IMR
B9HLB9_POPTR/28-361AEIEDLG------ANE........TRKFKLQQPFLSDY..SNAVVN--I.AENANGSYTLYEPSYMNVSLDF.....VLS
B9HS06_POPTR/28-348QDNRTPS------PYSW........RVFSVSINGQ........NFY--K.DLNVTANG..VTVYGSEWPLSG.....QTE
D7U071_VITVI/66-391AELEGLQ------.ENQ.......TRNFSITLNGNPWG..E.ANIV--P.KYLHSRTVNN..KQPVR...GS.....KLK
F4HWL3_ARATH/31-365AEIDNTI------TAEG.......KRVFDVVINGDTFF..EDVDII--K..MSGGRYAALVLNATVTVS.GR.....TLT
F4I065_ARATH/33-357AELQTLL------ANE........TREFNVLLNGKVYY..G..PYS--P.KMLSIDTMSPQPDSTLTCKGGS.....CLL
F4IB60_ARATH/32-356TELQQPN------SG.TV.....ETREFVILLNGKSFG..E..PLS--L.NYFRTLAL..FTSNPLKAE..S......FQ
F4IB63_ARATH/29-347AELETLR------.AND.......TREFNVMLNGNDLF..G..PYS--P.IPLKTETE..TNLKPEECEDGA.....CIL
F4IB71_ARATH/32-354AEIQDLK------AND........LREFDITYNGGKLW.FS..QFR--P.NKLSILTM..FSQVPLTSSNGE.....YNF
F4IB76_ARATH/32-354AEIQNLK------.AND.......IREFNITYNGGQVW..E.SSIR--P.HNLSITTI..SSPTALNSSDGF.....FNF
F4ICJ5_ARATH/32-364SEIDSTV------KKAG.......QRVFDLVVNDNNV...S..RVD--V.FHEVGGFAAYSLNYTVKNLSST.....IVT
F4J801_ARATH/31-354SEPQSLG------RTQK........RSFTVFLDGM........QVG--S.HPIVPVFGKATQVVLRDIMASS.....ESQ
F4JB46_ARATH/25-347QDNRSPG------PMSW........RAFDVSVNGL........SFL--R.KLNVSTNGVM..VYSGQWPLSG.....QTQ
F6H477_VITVI/48-422CEFQPEI------TERQ.......DREFTIFIANQTAE..NHADVI--T..WSGGNGVPIYRDYAVMMPSQGSNKKQNLY
F6HY53_VITVI/28-350AEIETLV------QGQ........IREFTVSVNKKAIS..S..AIQ--P.RYMIADTYFT.QS....SLSGS.....ELN
I1MCW6_SOYBN/32-358TEIQVLA------KNQ........TREFNITLNGKLWY..E..NES--P.RYHSVNTI..YSTS..GI.SGK.....LIN
I1PTQ3_ORYGL/76-415AEVQAIS------DNL........LRQFLVSVDNTPLA..A..AFS--P.RHMLADVF..SG.TVL...GSD.....QHS
I1PXF6_ORYGL/34-366SELENLP------.NNA.......SRQFYININGILFD..D..GFT--P.SFLYAEAPYSSKPFVRH...PQ......YN
I1QAW3_ORYGL/40-375AEIENGI------TAEE.......ERVFDVLINGDTAF..KDIDII--R..MAGERFTALVLNKTIVVT.GT.....TLT
K4B910_SOLLC/3-338AEIDPSV------TSVG.......QRVMDISINGDTVF..PAVDIV--K..MAGGVNSALVLNTTILVS.GR.....TLT
M0S6H3_MUSAM/43-370SEFLTL.------TGNM.......SRQFYVYLNGQLWY..A.KPFT--P.DYLFSDAIFGTN..P..AEGYQ.....QYN
SIRK_ARATH/33-359AEIEVLK------.SNQ.......TREFSIWLNEDVIS..P..SFK--L.RYLLTDTF.VTPDPVSG....I.....TIN
Q0DGL2_ORYSJ/34-367TEVQLL.------PSNA.......LRQFYINLNGRLVY..N.ESYT--P.LYLYADLIYEKKPFLR.YP........EYN
Q0J2E4_ORYSJ/17-347ADFQNNK------...........SREFTVSIDSGVQS..G..PFS--P.PYLKVLSI..TTDW.SSDTEGK.....YNF
Q0J2E5_ORYSJ/9-345ADFQSTL------...........QRQFQAYSNGDPIQGTG.GPYV--A.DYTGQTVG..TIDWISAETSGK......YN
Q2QNF5_ORYSJ/41-399AELQRLP------AGA........ARRFDVLVDGDASAGGGRRGYT--P.RYLAAEVV...RSTVRAARPGQ.....RHV
Q5JNB7_ORYSJ/47-383AEIEDDA------AAT........ARRFKLYIPGLAEV..SKPTVD--I.GENAPGKYRVYQPGYDNISLPF.....VLP
Q5VQN4_ORYSJ/8-346VELGN..------.NGS.......KRIFDIYNVDEPQALFS..NFS--P.PSFLS..SMFHNWFLRK...GR.....RAY
Q5ZCA6_ORYSJ/34-370SELEILT------.NNA.......SRQFYINLNGEPLI..D.TAYE--P.TYLTARYL..YGLEPLERT..S.....RYN
Q5ZDH7_ORYSJ/38-375AEIDAGI------GSAG.......QRVFDVMLAGKNVT.....RID--I.FKQVGGFTAFKWTYIVENLTSS.....TMS
Q65X96_ORYSJ/43-376SELQLL.------PGNA.......VREFYINLNGKPWS..L.TAFK--P.EYLYNDATFNRNPFL.RYP........QYN
Q67TV6_ORYSJ/37-371SELQL.V------QGNA.......VRAFNISLNDQ.WL..D.IGMT--P.DYLYADAS..FNTVPFR..GSS.....RYN
Q6EQM5_ORYSJ/33-373ADFQKIQ------...........PRQFNVTLNDIPIG.SNGRSLM--F.SPSPLDSSSVYSSDGYRADDGN.....YNL
Q6ERZ1_ORYSJ/29-346ADFQNSQ------...........LRQFNVSFNELGSY.....QVS--P.PYL..DNGVLSNSQWYKAPGGV.....YTI
Q94HA8_ORYSJ/46-404CDIVS..------KALN.......SLYFNVYINGMMGV.LN.LDLS--S..LTVGLAVPYYRDFIIDSSSIIN...STLI
Q9M0D8_ARATH/30-359AELETLE------KNE........TRKIKILWNGSPVS..E.TSFE--P.SSKYSTTF..SN..PRAFT.GK.....DHW
Q9SZV2_ARATH/30-354AEVRELQ------RNE........TREFDIYINDVILA..E..NFR--P.FYLFTDTRSTVDPVGR.....K.....MNE

PF11721

Y1972_ARATH/435-593.......IRLYWAGKGTTLI-PKR.GNYG.PL.ISAI
Y3148_ARATH/403-590.......IRLQWAGKGTQAI-PVR.GVYG.PL.ISAV
RKF1_ARATH/416-604.......IRLSWAGKGTTRI-PTR.GVYG.PI.ISAI
Y1534_ARATH/364-548.......IRLYWAGRGTTVI-PKE.RVYG.PL.ISAI
Y5343_ARATH/408-592.......IHLQWTGKGTNVI-PTR.GVYG.PL.ISAI
Y5614_ARATH/424-612.......IHLFWAGKGTCCI-PIQ.GAYG.PL.ISAV
Q29NS0_DROPS/68-230Y.....LGEVSDVRNGQLRL-DFIKGALDNPK.INAF
A0C5E5_PARTE/21-187HQ...GQECNKGFINGKLKI-GFRKGAADLPK.VDGI
A0D555_PARTE/21-188HN...NVLCVDAVQEGKLQV-NLEKTKFDNPY.IHGI
Q232Z6_TETTS/33-200YK...NQVCNNGIVDGKLNI-SFEKTQNDNPF.IHGI
Q22CM9_TETTS/26-197YHNGKACENALDTAHQGLIV-EFRKIGKDLPK.VDAI
A6H797_BOVIN/39-199......VQGEVSTFTGKLYI-EFVKGYYDNPK.VCAL
A7RLY6_NEMVE/27-185......HNGNTMPFTGTVYV-EFIKGVYDNPK.INAM
Q17BA6_AEDAE/29-192F.....KEEDSEIRGGKVKL-EFLKGYKDNPK.INAI
Q5DCB4_SCHJA/19-179I.....GDSAAPIDADHFTV-DFIKTQFDNPK.INAI
A8X3B8_CAEBR/29-187......VNGHKKDYKGKIVI-EFAKGPHDNPK.VNGF
Q95QG1_CAEEL/43-202......VSGHSREYKGKVII-ELSKGPHDNPK.LNGY
Q231X5_TETTS/32-203NKSKDNVIKTYNATYQSLNV-TF.ESIRGSAK.LDAI
Q5CLI3_CRYHO/28-194LN..GMNITQGYSKEEKLLI-LAMFKQEDNPK.INAI
A0CEJ8_PARTE/2-159K....GEQINGALSKNQELI-IRFKAIKSQAA.IAGI
A0DJ13_PARTE/493-661YQ...GKPCIGALNNRNELV-VGFSASQDQAT.VAAL
A0DRE8_PARTE/13-175YQ...GEICIGALNSRNELI-VGFSASQDQAT.IAAL
Q1ENU6_MUSAC/379-561.......IHFYWAGKGTNSV-PLR.GVYG.PL.ISAI
A5AX10_VITVI/334-521.......VQFYWAGRGTTGI-PLR.GFYG.PL.ISAI
A5B4N1_VITVI/273-458.......IRFYWAGKGTTGI-PVR.GVYG.PL.ISAI
Q49N12_SOYBN/402-586.......IRLYWAGKGTTSL-PFR.SVYG.PL.ISAI
A5AYT9_VITVI/1-152.......IRFYWAGKGTTAL-PSR.GTYG.PL.ISAI
A5BAX3_VITVI/87-271.......IRFHWAGKGTTAA-PEG.GTYG.PL.ISAI
A5ATV0_VITVI/23-211.......IRFYFAGRGTTRI-PQR.GVYG.PL.ISAI
A5BDY5_VITVI/286-473.......IRFYWAGKGTTRI-PYR.GVYG.PL.ISAI
Q9C6G4_ARATH/381-569.......IRLYWAGKGTMII-PQR.GYYG.SL.ISAV
A5AR95_VITVI/288-473.......IHLYWTGKGTNSI-PEK.GVYG.PL.ISAI
A5C3D9_VITVI/359-541.......IHLYWAGKGTNAI-PSR.GVYG.PL.ISAI
Q94G99_SOLLC/19-203.......IHLYWSGKGSILY-PSD..NYG.PL.ISAI
A2XXK2_ORYSI/347-534.......IHLFWAGKGTCCI-PGQ.GYYG.PT.ISAL
Q7XTR9_ORYSJ/429-616.......IHLFWAGKGTCCI-PHQ.GYYG.PA.ISAL
Q6F2P3_ORYSJ/440-627.......IHLFWAGKGTCCV-PTQ.GYYG.PM.ISAL
Q6ZKW6_ORYSJ/422-609.......IHLFWAGKGTCCI-PTQ.GHYG.PT.ISAL
A5AGB3_VITVI/345-531.......IHLFWAGKGTCCV-PAQ.GTYG.PS.ISAI
Q0WPE8_ARATH/420-606.......VHLFWAGKGTCCI-PAQ.GTYG.PL.VSAI
A5BD31_VITVI/371-555.......IHLFWAGKGTCCI-PFE.GYYG.PS.ISAL
A5BV17_VITVI/4-191.......IHLFWAGKGTCCN-PIQ.GYYG.PS.ISAL
A4AT33_MARSH/904-1052.......IDFSALAAV....-....GGIDQPK.VSAI
A4AUK4_MARSH/903-1051.......IYFSALTST....-....GGANQPK.ISAI
A4CK29_ROBBH/1247-1419.......IDFI.........-....MGVQNPS.IKGI
A4CK28_ROBBH/332-497.......VQIGD........-....ATIDNGK.LAGI
A9W8Z4_METEP/828-973.......LQFA.........-....NGIDNAK.LSGI
B1ZHU8_METPB/1383-1558.......LAFWQ........-....GATENPT.VAAI
Q21PD3_SACD2/360-498.......ISLE.........-....SLTDNGT.LSGF
B9M0U3_GEODF/207-345.......IGFT.........-....STRDYGK.ISAI
B9M0U3_GEODF/432-570.......VKFT.........-....STKDYGK.VSAI
Q01NB6_SOLUE/205-356.......LAFS.........-....PVRGTAM.LSAI
Q021C7_SOLUE/211-363.......LKFE.........-....PSSNPPL.LCAI
Q026G9_SOLUE/209-373.......LEFL.........-....SSWGKPAFVSAL
Q01RD0_SOLUE/183-344.......LDFR.........-....PILSGAW.LNAI
Q7UIV5_RHOBA/6-153.......VTFS.........-....SEMDYPT.IKAI
Q7UIV6_RHOBA/184-340.......ITFK.........-....QQVQSPA.IKAI
A5FCJ0_FLAJ1/725-892.......ISFPN........-....VKASQAI.ISAI
A6L3S6_BACV8/1081-1251.......IDFPE........-....VKAGQAL.ICGI
A7LQW1_BACO1/1065-1228.......IHFPE........-....VKAGQAL.ISGI
B1KJF7_SHEWM/58-198.......IQLV.........-....STQGQPI.LNAI
A4CKE5_ROBBH/1275-1442.......IQFI.........-....HQVENPV.LNAI

PF12819

Y5573_ARATH/35-359-------.ELLKTSKS..TL.PPLCSALE----VFTV
Y4291_ARATH/31-359-------ISVQKTAES..TR.PPILNAIE----IFSA
MEE39_ARATH/34-356-------.QLTKTQKS..TL.PPLLNAFE----VYSV
Q0DGL3_ORYSJ/34-370-------.SLNAAGSS..TL.PPILNAAE----AFSV
Y5169_ARATH/27-358-------.QLVRSEASPGVR.VPLVNAME----AFTA
Y5189_ARATH/28-350-------.TFSMTGNS..TH.PPLINGLE----IYQV
Y1756_ARATH/33-356-------.QLIKTPKS..TL.PPLLNAIE----AFIT
Y4245_ARATH/33-374-------LDLTRTKSS..TL.PPYCNAME----VFGL
Y1518_ARATH/32-355-------.TFAMTGNS..TL.PPLLNALE----IYTV
Q0JIC9_ORYSJ/48-385-------.TLRKQPTS...Q.PPLINAFE----VYSL
Q0J2D5_ORYSJ/28-372-------.TLAATANS..AL.PPMLNAFE----IYFL
Y1677_ARATH/29-363-------FSFGKTKDS..TQ.GPLLNAIE----ISKY
Y1755_ARATH/32-354-------.QLIKTPKS..TL.PPLMNAFE----IFTG
PAM74_ARATH/32-354-------.QLIKTSRS..TL.PSLLNALE----IYTV
Q9C8I6_ARATH/32-353-------FSLQRTGNS..TL.PPLLNAME----IYSV
Q6ERN3_ORYSJ/27-359-------.TIAATATS..AL.PPILNAYE----VYGR
B9RQ86_RICCO/32-352-------.SFYGVGGS..TL.PPLLNALE----LYSV
Q65X94_ORYSJ/35-368-------.SINATANS..TL.PPIINAIE----VFSV
RLK6_ARATH/36-358-------.ELTKTPKS..TL.PPLMNALE----VFTV
Q5VQN2_ORYSJ/40-388-------.TLRKTPSS..EL.QPLINAFE----VYSL
B9RQ88_RICCO/35-358-------.SLFKIGGS..TL.PPLLNAIE----IYFF
Q5QL24_ORYSJ/29-348-------.TLVATAKS..LL.PPMLNAYE----IYTL
B9RQ82_RICCO/34-356-------.SLFKIEGS..TL.PPLLNAIE----IYFV
Y2451_ARATH/32-355-------.QLSKTPKS..TL.PPLMNAIE----IFSV
Y5188_ARATH/32-354-------.SFTKTGNS..TL.PPLINGLE----IYKV
B9RQ90_RICCO/31-355-------.SLSKVEGS..AL.PPLLNAIE----LYYV
RLK7_ARATH/31-354-------.QLIRTKRS..TL.PPLLNALE----VYTV
B9RQ85_RICCO/33-355-------.QIFKVGGS..TL.PPLLNAVE----VYYI
Q6EQQ3_ORYSJ/24-352-------.KLVATATS..SL.PPILNAYE----VYSR
Q67UW6_ORYSJ/28-358-------.SLVATKNA..TL.PPILNAME----MYLV
B9RQB2_RICCO/34-359-------.SLNKLPNS..TL.PPILNAME----IYLM
Y2923_ARATH/33-360-------.VLRQGVKS..TR.PPIMNAIE----TYRT
Y5181_ARATH/29-348-------.QLVKTSRS..TL.PPLINAME----AYTV
Y3463_ARATH/35-357-------.ELKRTKNS..TH.PPLINAIE----FYTV
Q6EQK1_ORYSJ/34-368-------.SLVATNAS..VL.PPMLNAIE----IYYQ
B9RQ87_RICCO/35-359-------.LINKTENS..TL.PPLLNAFE----IYFV
Q9SN97_ARATH/32-354-------.EMIKTERS..TL.PPLLNAVE----VFTV
Y5596_ARATH/32-354-------.QLIRTNRS..TL.PPLLNAYE----VYKV
B9RQ89_RICCO/61-383-------.SIYKTENS..TL.PPLLNAIE----IYYI
Y2921_ARATH/34-359-------.RLQQTPRS..TL.PPIINAIE----TYRV
Y2899_ARATH/28-349-------.QLVKTPNS..TL.PPLINAIE----AYSV
B9H626_POPTR/24-339-------ISLVSTTDS..TL.PPLINAME----VFF.
B9H6K7_POPTR/19-375-------ISIGPRQDS..GNHTAFLNGLE----IMEI
B9HLB9_POPTR/28-361-------FSFAKTRDS..TL.GPLLNAIE----ISK.
B9HS06_POPTR/28-348-------ITLTPGNNI..PV.GPVINAGE----IYHI
D7U071_VITVI/66-391-------FSIYKTLNS..SL.PPILNAME----IYMV
F4HWL3_ARATH/31-365-------VVLQPKAGG.....HAIINAIE----VFEI
F4I065_ARATH/33-357-------.QLVKTTKS..TL.PPLINAIE----LFTV
F4IB60_ARATH/32-356-------FSLRQTQSS..SL.PPLINAME----TYF.
F4IB63_ARATH/29-347-------.QLVKTSKS..TL.PPLLNAIE----AFTV
F4IB71_ARATH/32-354-------.TFEMTSNS..TL.PPLINALE----IYT.
F4IB76_ARATH/32-354-------.TFTMTTTS..TL.PPLINALE----VYT.
F4ICJ5_ARATH/32-364-------VKLSSVSGA......PIISGLE----NYA.
F4J801_ARATH/31-354-------LVFKSTDDS..GL.PTIISGLE----VYSI
F4JB46_ARATH/25-347-------ITLTPAKDA..PV.GPFINAGE----VFQI
F6H477_VITVI/48-422-------IQLHPNPDWRTRYNDAILNGIE----LFKV
F6HY53_VITVI/28-350-------FSLSQTNQS..TL.PPIMNALE----IYM.
I1MCW6_SOYBN/32-358-------FSFVMTETS..TL.PPIINAIE----IYRV
I1PTQ3_ORYGL/76-415-------ISLITTIIS..DL.PPLISAME----IF..
I1PXF6_ORYGL/34-366-------ITINATANS..TM.PPLINAVE----VYSV
I1QAW3_ORYGL/40-375-------IVLQPLKGT.....RATISAIE----VFEI
K4B910_SOLLC/3-338-------ITLQPKNGT.....YAIISAIE----IFEV
M0S6H3_MUSAM/43-370-------VTIQALDNS..TL.PPILNAME----VYS.
SIRK_ARATH/33-359-------FSLLQPPGE.FVL.PPIINALE----VYQV
Q0DGL2_ORYSJ/34-367-------ISINATSNS..TL.PPIINAIE----VFSV
Q0J2E4_ORYSJ/17-347-------.TLTATSTS..SL.PPILNAYE----VY..
Q0J2E5_ORYSJ/9-345-------ITLAATDSS..QL.PPIVNAFE----VY..
Q2QNF5_ORYSJ/41-399-------VSLVAAPDS..AL.PPIVNGLE----IYSV
Q5JNB7_ORYSJ/47-383-------FAFRKTDDS..AR.GPILNAME----IYS.
Q5VQN4_ORYSJ/8-346-------FQLRKTPDS..QL.PPLINAYE----VYS.
Q5ZCA6_ORYSJ/34-370-------ITINATANS..TL.PPLINAAE----IFSI
Q5ZDH7_ORYSJ/38-375-------VKLVPVVGR......PILCGLE----NYAM
Q65X96_ORYSJ/43-376-------ISINATANS..TL.PPLINAVE----VFSV
Q67TV6_ORYSJ/37-371-------LTFRATANS..TL.PPIINALE----IFSV
Q6EQM5_ORYSJ/33-373-------.VLRRTAAS..AL.PPMLNAME----IYTV
Q6ERZ1_ORYSJ/29-346-------.TLEPTAES..KL.PPMLNAYE----IYA.
Q94HA8_ORYSJ/46-404-------VQIGPGTTD.TSNPNAILNGLE----IMKI
Q9M0D8_ARATH/30-359-------ISIQKTVDS..TL.PPILNAIE----IFT.
Q9SZV2_ARATH/30-354-------IVLQRTGVS..TL.PPIINAIE----IYQI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window