Sequence alignment for CL0468

PF12819

Y5573_ARATH/35-359----LDCGLSPNEP.PYVDAAT.DLTYTTDN.DFVQ...SGK...TGTI...DK.ELESTYN.KPILQLRYFP.....EG
Y4291_ARATH/31-359----IDCGSPPNIN..YVDTDT.GISYTWDA.PFIN...AGV...NLNVSEEYG.YPKNPVLPFPLADVRSFP.....QG
MEE39_ARATH/34-356----LDCGLPLNEP.PYIESET.GIQFSSDE.NFIQ...SGK...TGRI...PK.NLESENL.KQYATLRYFP.....DG
Q0DGL3_ORYSJ/34-370----IDCGLPEKTS..YVDDAT.KLKFTSDD.AFTD...AGT...IHNV.SSEF.ATPTTTTDRSLYNVRSFP.....AG
Y5169_ARATH/27-358----LDCGLPSNEP.PYIEPVT.GLVFSSDA.DHIP...SGI...SGRI...QK.NLEAVHI.KPYLFLRYFP.....DG
Y5189_ARATH/28-350----LDCGLVPTEI.TYVEKST.NITYRSDA.TYID...SGV...PGKI....N.EVYRTQFQQQIWALRSFP.....EG
Y1756_ARATH/33-356----LDCGLQADES.PYTEPLT.KLTFTSDA.DFIK...SGK...SGKI...QN.VPGMEYI.KPYTVLRYFP.....DG
Y4245_ARATH/33-374----LDCGMPRNES.SYTDEST.GLNFSSDA.DFIS...SGK...SGTI.KTED.SDSGVKYIKPYKQLRYFP.....EG
Y1518_ARATH/32-355----LDCGLVPKET.TYTEKST.NITYKSDV.DYID...SGL...VGKI....N.DAYKTQFQQQVWAVRSFP.....VG
Q0JIC9_ORYSJ/48-385----IDCGYTDSAG..YDDKNT.MLPYVSDK.GYIK...GGK...TFSI...LS.QYMKEAANKQEETLRSFP.....DG
Q0J2D5_ORYSJ/28-372----IDCGLEANSS..YQD.DN.RILYVPDG.PYVD...GGE...NHKVAAEYA.....SSFQRPDQTLRSFP.....SG
Y1677_ARATH/29-363----IDCGCS..SN..YTDPRT.GLGWVSDS.EIIK...QGK...PVTL.......ANTNWNSMQYRRRRDFP.....TD
Y1755_ARATH/32-354----LDCGLASNES.PYNEANS.NLTYISDA.DFIQ...GGK...TGNV...QK.DLLMKLR.KPYTVLRYFP.....DG
PAM74_ARATH/32-354----LDCGLPMTEPSSYTESVT.GLRFSSDA.EFIQ...TGE...SGKI...QA.SMENDY.LKPYTRLRYFP.....EE
Q9C8I6_ARATH/32-353----LDCGS.PRET.SFREKTT.NITYISDA.NFIN...TGV...GGSI...KQ.GY.RTQFQQQTWNLRSFP.....QG
Q6ERN3_ORYSJ/27-359----IDCGLEADDS..YPDDLT.GITYVPDG.HYTD...AGE...NHKVTTVYR.NAWWGPD.RTLYTVRSFPS...AEG
B9RQ86_RICCO/32-352----LDCGL.QANS.SYTDEKT.GLKYISDA.AFIE...TGV...TKSI...AP.EF.LGSFNQQLRQVRSFP.....KG
Q65X94_ORYSJ/35-368----VDCGLPGKTS..YVDDKT.KISYAADD.GFTD...GGS...FHNISAEYI.TPA.LS..ARYHNVRSFP.....DG
RLK6_ARATH/36-358----LDCGSLPNEP.PYNDPST.GLTYSTDD.GFVQ...SGK...TGRI...QK.AFESIF.SKPSLKLRYFP.....DG
Q5VQN2_ORYSJ/40-388----IDCGLTNRST..YNDTDT.TLTYVSDR.EFVEG.GNGK...SYDIMA....QYIADATNEQEKTLRSFP.....DG
B9RQ88_RICCO/35-358----IDCGL.PANS.SYTDATT.GLNYVSDA.AFID...TGI...INNL...AP.GLNTSSIDRQQLSVRSFP.....EG
Q5QL24_ORYSJ/29-348----IDCGLEANYSG.YKDTDT.GIVYVSDD.PYVD...TGK...NHRISAD...STYQRFY...Q.TIRSFP.....TG
B9RQ82_RICCO/34-356----IDCGL.PANS.SYTDETT.SLNYISDA.SFID...VGI...ITTI...TP.KVTTNSTDRQQLSVRSFP.....EG
Y2451_ARATH/32-355----LDCGLPSKES..YIEPSS.NLTFISDV.NFIR...GGK...TGNI...QN.NSRTNFIFKPFKVLRYFP.....DG
Y5188_ARATH/32-354----LDCGLVPKNA.TYTEKTT.NITYKSDA.NYID...SGL...VGRI...SA.EY.KAQLQQQTWTVRSFP.....EG
B9RQ90_RICCO/31-355----LDCGL.PANT.TYTDETT.SLNYNSDA.SFID...TGI...SKSL...AP.GFTTDNLRRQLWYIRSFP.....EG
RLK7_ARATH/31-354----LDCGLPANETSPYTETQT.GLLFSSDA.TFIQ...SGK...TGRV...QA.NQESKF.LKPYRTLRYFP.....EG
B9RQ85_RICCO/33-355----LDCGL.PGNT.SYSDATT.TLNFISDA.SYIE...IGI...SKSL...AP.EFSTNSIFRPLWYVRSFP.....QG
Q6EQQ3_ORYSJ/24-352----IDCGLDQDSR..TDSLVG.GITYVSDG.AYVD...AGE...NRRVTTVYK.DDWKGPRYQTLYTLRSFPT..SVTG
Q67UW6_ORYSJ/28-358----IDCGIPEKSS..YQDPTS.SIIYVSDY.GFIS...TGA...NHNISSAYI.KPS.LA..QRNYNVRFFP.....DG
B9RQB2_RICCO/34-359----IDCGLSEDSS..STEVKT.GMHYISDT.LYTN...TGV...NKKISSNFS...SDAQFPVSLMTVRSFS.....QG
Y2923_ARATH/33-360----IDCGI.PEDS.SYYDEKT.DIKYISDA.AFVE...SGT...IHSI...DS.KFQKKNLEKQFQKVRSFP.....EG
Y5181_ARATH/29-348----LDCGLSIQGS.PYKESST.GLTYTSDD.GFVQ...SGK...IGKI...TK.ELESLY.KKPERTLRYFP.....DG
Y3463_ARATH/35-357----LDCGLPPNEVSPYIEPFT.GLRFSSDS.SFIQ...SGK...IGKV...DK.SFEATT.LKSYMTLRYFP.....DG
Q6EQK1_ORYSJ/34-368----IDCGLPSGFS..YVDEKT.NITYISDD.QYID...TGE...NHNISS....QLQGAEQFRSGLNLRSFP.....TG
B9RQ87_RICCO/35-359----IDCGIEDGSS..YVDENT.GINYVSDA.PYIS...SGV...SERISS....EINTKNIDKQYLTLRSFS.....EG
Q9SN97_ARATH/32-354----VDCGLSPNEVSPYIEPFT.GLQFTTDS.NFIE...TGK...LGRI...QA.SLEPKY.RKSQTTLRYFP.....DG
Y5596_ARATH/32-354----LDCGLPANEPSPYTEPRT.GLQFSSDA.AFIQ...SGK...IGRI...QA.NLEADF.LKPSTTMRYFP.....DG
B9RQ89_RICCO/61-383----IDCGI.SENA.TYTDSTT.SIDYVSDA.AFID...TGK...SKSI...AA.EYTRYNINQQLQNVRSFA.....EG
Y2921_ARATH/34-359----IDCGI.PEDS.SYNDETT.DIKYVSDA.AFVE...SGT...IHSI...DP.EFQTSSLEKQFQNVRSFP.....EG
Y2899_ARATH/28-349----LDCGLPSDES.PYDDSFN.GLTFTSDS.TFIQ...TGK...IDSV...DK.DLNINL.SKQYLTLRYFP.....EG
B9H626_POPTR/24-339----VDCGAS..DS..YAD.EN.SIVWIGDD.DLFK...NGQ...SEVV......QP.SNPASHVMSTLRVFT.....TL
B9H6K7_POPTR/19-375----ISCGSDTNST......AS.GRTFIGDL.TSGN...SGSFTFTRQS.SPVKDSNKSTATPPLYQTARIFR.......
B9HLB9_POPTR/28-361----IDCGGT..SN..YTDPRT.GLAWVSDNGTIMK...YGK...SSEA......QV..SNGNTQYQRRRDFP....IDS
B9HS06_POPTR/28-348----LNCGASEDIT......HG.NLKYIPDK.GFIS...VGN...KSAI........KTADVLPVLSTLRFFP.....DT
D7U071_VITVI/66-391----IDCGLPEDCK..YIDAET.GLQYTSDA.SFIR...SGI...NKNI.S..S.KFSSTTLHKSLTNVRSFP.....QG
F4HWL3_ARATH/31-365----ISCGARKNVR....TPPT.YALWFKDI.AYTG....GV...PANA.......TTPTYITPPLKTLRYFPI...SEG
F4I065_ARATH/33-357----LDCGLLPDGS.PYTNPST.GLTFTSDS.SFIE...SGK...NGRV...SK.D.SERNFEKAFVTLRYFP.....DG
F4IB60_ARATH/32-356----IDCGLQPENS.SYTETST.DIKYVSDS.SYTD...TGT...SYFV.A..P.EN.RQNMKQSMWSVRSFP.....EG
F4IB63_ARATH/29-347----VDCGLLPRDS.PYNALGT.GLVYTSDV.GLVS...SGK...TGKI.AKEF.E...ENNSTPNLTLRYFP.....DG
F4IB71_ARATH/32-354----LDCGLVPKET.TYVETST.NITYKSDA.NYTD...SGL...VGKI.N....DAHKTLVQQPLWALRSFP.....EG
F4IB76_ARATH/32-354----LDCGLIPKDT.TYTEQIT.NITYISDA.DYID...SGL...TERI....S.DSYKSQLQQQTWTLRSFP.....EG
F4ICJ5_ARATH/32-364----IDCGSPETST....D.VF.NRTWLPDQ.FYSG....GS...TAVV......SEPLRFHLIAEKTIRYFPL...SFG
F4J801_ARATH/31-354----IDCGTT..GS..YVD.SN.NVTWVGDK.GFVT...TGE...SINI.........TDVVKKPINTLRYFP.....TG
F4JB46_ARATH/25-347----LNCGSSSSTN..L....N.EIEYTPDE.GFIS...VGN...TTTI........KQKDLVPILSTLRYFP.....DK
F6H477_VITVI/48-422----VDCGASGNLK..AWD....NRIWIGDTNSRFSL.IEKN...KASIISKAA.KTSPSVDPVPFATARLS........
F6HY53_VITVI/28-350----IDCGVDED....YIDNTT.KLFYSSDA.NFID...SGE...NKNI...PY.DFTSTIYEKQLTNVRSFP.....KG
I1MCW6_SOYBN/32-358----IACGAPAGVN..FTVPKT.GLNYTSDA.NFIN...TGV...SRTIVPELR.....DQFQRYVWNLRSFP.....EG
I1PTQ3_ORYGL/76-415----IDCGYITRPS..YPDFKT.NLTYVADV.GFTN...TGF...IHTV...DV.GNLQRDLAQRYTTVRYFP.....NG
I1PXF6_ORYGL/34-366----VDCGLPGKTS..YIDDKT.KISYASDD.GFTD...GGK...HYNVSPEYI.K...PAVTARYYNVRSFP.....DG
I1QAW3_ORYGL/40-375----ISCGSFDDIR....TAPT.NTLWYRDF.GYTG...GRF..........AN.ATRPSFIIPPLKTLRHFPL...SDG
K4B910_SOLLC/3-338----ISCGARHDVH....TAPT.KTLWHKDF.AYTG...GIP..........FN.GTAPSFIAPQLTTLRYFPL...SEG
M0S6H3_MUSAM/43-370----IDCGIAAGST..YVDPTT.NIPYVSDT.PYID...AGV...NQNISAAYV....TNLMGRRYLNVRSFP.....NG
SIRK_ARATH/33-359----IDCGIPDDSS..YNDETT.GIKYVSDS.AFVD...SGT...TKRI.AAQF...QSSGFDRHLLNVRSFP.....QS
Q0DGL2_ORYSJ/34-367----IDCGLEGKTG..YLDDKT.NLSYVPDD.GFTD...AGT...NHNI.SV...EFMTPLISRRNYNLRSFP.....DG
Q0J2E4_ORYSJ/17-347----IDCGLEGDDS..YPDDQT.GITYVPDG.PYVD...SGE...NHRVTTVYR.NYW.GQDYRTLKTLRSFPS...ASG
Q0J2E5_ORYSJ/9-345----IDCGLEGDKN.GYTDNSN.GIVYTPDGAPYVD...TGV...TNNVSAQYV.NT...W.DRALNTLRSFPL..TLFG
Q2QNF5_ORYSJ/41-399----IDCGIPDGGG..YSDESTRGLRYVPDA.GFLD...AGAG.LSAGI...NP.PYTDRDLAARYLTVRYFPGAASAAG
Q5JNB7_ORYSJ/47-383----IDCGGSGN....YTD.EV.GLEWTGDE.AYVG...GGAG.TTASI......SSISGQGRRPYRTVRYFP....ADG
Q5VQN4_ORYSJ/8-346----VDCGLTNRST..YNDTDT.TLTYVSDR.EFVE...SGK...SYDIMA....QYMADATNEQEKTLRSFP.....DG
Q5ZCA6_ORYSJ/34-370----IDCGIQPNTS..YVHNTT.KISYVADD.DFTD...GGS...NYNVSP....EYIKPQLSQRYYNLRAFP.....DG
Q5ZDH7_ORYSJ/38-375----IDCGGAADFV.SV....F.GRRWLADQ.FFSA...GGQ...AGMV.A.....EPHRFPQPQERTLRFFPP..SSAG
Q65X96_ORYSJ/43-376----VDCGLPGKTG..FVDDKT.KISYAADD.GFTD...GGA...CHNISAEYI.T...PGLAKRYHTLRSFP.....DG
Q67TV6_ORYSJ/37-371----IDCGLSGKAG..YVDNAT.KLSYSPDA.AFTD...AGT...NNNISAEYL.S...PANSRIFDNVRSFP.....AG
Q6EQM5_ORYSJ/33-373----IDCGREANYS.DYKDPKT.GIVYVSDE.PYIDA.GAGE...NHRI.SATA.T.ATAADSYLLQTLRSFP.....SG
Q6ERZ1_ORYSJ/29-346----IDCGMDPNYG.SYKNPDD.GIVYEPDG.QYVD...GGE...NHMV.A..P.EHQ.SGTFRPYSTVRSFP.....SG
Q94HA8_ORYSJ/46-404----LSCGAPAAVQ..LDD....GRTFRSDP.DSASFLSTPV...DIKI.TAKNSLASGAPSSQLYLTSRVF........
Q9M0D8_ARATH/30-359----IDCGIPPYDT..PEDTMT.NINYVSDE.AFIT...TGV...NFKVSEEYG.YPKNPVLLSTLAEVRAFP.....QG
Q9SZV2_ARATH/30-354----IDCGIPDDSS..YTDEKT.NMKYVSDL.GFVE...SGT...SHSI...VS.DLQTTSLERQFQNVRSFP.....EG

PF11721

Y1972_ARATH/435-593TNAASNQQFDYW..--..GVSN-TGDFTDDN-SDHD---EYY--------------------------------------
Y3148_ARATH/403-590YGLHINCGGNEI..--...TSN-ETKYDADT-WDTP---G..--------------------------------------
RKF1_ARATH/416-604SCLHVNCGGSDMY.--VKEKKT-KELYEGDG-NVEG---GAA--------------------------------------
Y1534_ARATH/364-548NALHINCGGDEM..--...SIN-GTIYESDK-YDRL---ESW--------------------------------------
Y5343_ARATH/408-592SSLFINCGGSRL..--...KIG-KDTYTDDL-NSRG---QST--------------------------------------
Y5614_ARATH/424-612SDFSINCGGPEI..--..RSVT-EAVFERED-E.DL---GPA--------------------------------------
Q29NS0_DROPS/68-230VVYAVNAGGEEH..--..TDRN-GITYEADP-LKNV---GIA--------------------------------------
A0C5E5_PARTE/21-187VLMAIDCGGQES..--.FNSKE-GFLYQDDQ-YFSG---DSR--------------------------------------
A0D555_PARTE/21-188VIYAINCGAPSN..--.YKSPS-GIQYEKDI-QTDP---ETV--------------------------------------
Q232Z6_TETTS/33-200VVHAINAGSHMA..--.KRSVE-GFVYTRDQ-GYDE---DTN--------------------------------------
Q22CM9_TETTS/26-197IVVALDCGSTAPY.--.KSSSD-GITYTADN-LYTQ---NTK--------------------------------------
A6H797_BOVIN/39-199VIWAVNAGGEAH..--..VDVH-GIHFRKDP-LEGR---VGR--------------------------------------
A7RLY6_NEMVE/27-185VVYAVNSGGPAH..--..TDLN-GVHYQADK-LT..---VGV--------------------------------------
Q17BA6_AEDAE/29-192VIYAINAGGEAH..--..VDSN-GIKYARDP-LMGK---TGT--------------------------------------
A8X3B8_CAEBR/29-187VVAAINCGGPEA..--..LGSY-GITYAADY-HD..---EGQ--------------------------------------
Q95QG1_CAEEL/43-202VVAAVNCGGPDA..--..LGAY-GIEYSADT-SE..---DGV--------------------------------------
Q231X5_TETTS/32-203KILAINCGENKFY.--.KDTSS-KILYKPDT-FRDG---GQV--------------------------------------
A0CEJ8_PARTE/2-159KYRSFN........--......-GINYKNDQ-FFQG---SSE--------------------------------------
A0DJ13_PARTE/493-661VIHAIDCGSYLE..--.TRTSA-GIKYKSDH-HHIG---TSE--------------------------------------
A0DRE8_PARTE/13-175HLLALSIRGQFN..--......-.TQHLKDH-HYIG---QSE--------------------------------------
Q7XTR9_ORYSJ/429-616ASFAVDCGGSRT..--.ISGSD-NAMYQADN-AN.L---GAA--------------------------------------
Q6F2P3_ORYSJ/440-627YSFAVDCGSNSS..--.TRGSD-NTIYEADP-MN.L---GAG--------------------------------------
Q6ZKW6_ORYSJ/422-609YSFAVDCGSNKS..--.TRGSD-NTLYETDA-QN.I---GAA--------------------------------------
A4AT33_MARSH/904-1052SLLGINAGGVLI..--...DQN-GTTFVADE-HFVG---GTP--------------------------------------
A4AUK4_MARSH/903-1051TAIRINSGGPQV..--...VHD-GNIFNADQ-HYVG---GQS--------------------------------------
A4CK29_ROBBH/1247-1419ALYRVNAGGPLTA.--.SNDAD-PKTWDEDQ-AVAN---ANA--------------------------------------
A4CK28_ROBBH/332-497FQLCIAAGNDAL..--...TAF-GRDFVGDP-NTTP---PTT--------------------------------------
Q21PD3_SACD2/360-498LVIAINAGGGAT..--...SLD-GVNFVADV-HSLG---GST--------------------------------------
B9M0U3_GEODF/207-345KSFAANSGGAAF..--..TDAT-GLIYGADS-AFSG---GSA--------------------------------------
B9M0U3_GEODF/432-570VQFAVNSGGTGF..--..TDST-GAVYQADG-RFSG---GSS--------------------------------------
Q01NB6_SOLUE/205-356DDLRIIVGAVNP..--.FMDRS-GRTWGPDR-FFSG---GSV--------------------------------------
Q021C7_SOLUE/211-363NPLEVRILAGRQNG--DYTDRL-GRIWQSDR-YFQG---GSV--------------------------------------
Q026G9_SOLUE/209-373GEVRIAAGHTGPP.--.YVDVF-GRRWEADR-YFEG---GIP--------------------------------------
Q01RD0_SOLUE/183-344VPHPIRILAGSSTD--KSVDRF-GVEWAGDR-YFAG---GEQ--------------------------------------
Q7UIV5_RHOBA/6-153LCLCIILIATPAIR--GQDIPL-NVAEQPDT-....---...--------------------------------------
A5FCJ0_FLAJ1/725-892YIYRVNCGGSEL..--..TDSA-GNTWLTDT-HKNG---QNT--------------------------------------
A6L3S6_BACV8/1081-1251YLYRLNCGGDTY..--..TDTY-GQVWAQDN-SRYS---HSW--------------------------------------
A4CKE5_ROBBH/1275-1442TTWRINAGGEEV..--.TATDD-GTNWRYNG-ASGA---YTG--------------------------------------

PF12819

Y5573_ARATH/35-359V..R.NCYTLNVT...LGT.NYLIRASFVYGNYD....GL..N.KE...LE.FDLYLGPNLWANVNTAV.YLM.......
Y4291_ARATH/31-359N..R.NCYTLTPSDG.KGN.LYLIRASFMYGNYD....GK..N.AL...PE.FDLYVNVNFWTSVKLRNASEN.......
MEE39_ARATH/34-356I..R.NCYDLRVE...EGR.NYLIRATFFYGNFD....GL..N....VSPE.FDMHIGPNKWTTIDLQIVPDG.......
Q0DGL3_ORYSJ/34-370A..R.NCYTVPSV.V.PGS.KYLVRAKFLYGNYD....GL.NK......PPVFDLHLGVNFWQTVTVPSADWL.......
Y5169_ARATH/27-358L..R.NCYTLDVL...QNR.RYMIKAVFVYGNYD....GY..N.DY...PS.FDLYLGPNKWVRVDLEGKVNG.......
Y5189_ARATH/28-350Q..R.NCYNFSLT...AKR.KYLIRGTFIYGNYD....GL..N.QL...PS.FDLYIGPNKWTSVSIPGVRNG.......
Y1756_ARATH/33-356V..R.NCYTLIVI...QGT.NYLIVAMFTYGNYD....NL..N.TH...PK.FDLYLGPNIWTTVDLQRNVNG.......
Y4245_ARATH/33-374A..R.NCYNLTVM...QGT.HYLIRAVFVYGNYD.........LKQ...RPKFDLYLGPNFWTTINLQDPSGGFYYRIWL
Y1518_ARATH/32-355Q..R.NCYNVNLT...ANN.KYLIRGTFVYGNYD....GL..N.QF...PS.FDLHIGPNKWSSVKILGVTNT.......
Q0JIC9_ORYSJ/48-385Q..R.NCYTLPTNRS.K...KYLIRATFTYGNYD....GR..NSSESGSPFLFGLHIGINFWTMVNLTKLPSS.......
Q0J2D5_ORYSJ/28-372V..R.NCYTLPTA...AGS.KYLVRLVFVYGNYDGKNISS.SSSSAAAAALRFDLYLGLSRWTTVQGGTGSGG.......
Y1677_ARATH/29-363N..KKYCYRLSTK...ERR.RYIVRTTFLYGG...........LGSEEAYPKFQLYLDATKWATVTIQEVSRV.......
Y1755_ARATH/32-354I..R.NCYSLNVK...QDT.NYLIRVMFRYGNYD....GL.NN......SPRFDLYLGPNIWTTIDMGKSGDG.......
PAM74_ARATH/32-354R..R.NCYSLSVD...KNR.KYLIRARFIYGNYD....GR..N.SN...PI.FELHLGPNLWATIDLQKFVNG.......
Q9C8I6_ARATH/32-353I..R.NCYTLNLT...IGD.EYLIRANFLHGGYD....DK..P.ST....Q.FELYLGPNLWSTVTTTNETEA.......
Q6ERN3_ORYSJ/27-359Q..R.NCYSLPND...VRS.KYLVRLKFLYGNYD..........GLDSSSLKFNLTLGVKHWDTVSIDTTDGN.......
B9RQ86_RICCO/32-352D..R.NCYKVELV...KNT.RYLIRATFLYANYD....GL..N.KL...PA.FDLHIGPNKWVNVQITNPLIY.......
Q65X94_ORYSJ/35-368A..R.NCYTLRS.LV.AGL.KYLIRATFMYGNYD....GL..S.KL...PI.FDVYIGVNFWMMVNIS..DPS.......
RLK6_ARATH/36-358F..R.NCYTLNVT...QDT.NYLIKAVFVYGNYD....GL..N.NP...PS.FDLYLGPNLWVTVD..MNGRT.......
Q5VQN2_ORYSJ/40-388Q..R.NCYTLPT....NSSKKYLIRATFTYGNYD....GL.NS.SEKGSLFLFGLHIGVNFWATVNLTNWGSS.......
B9RQ88_RICCO/35-358D..R.NCYQVELT...RGT.KYLIRAIFLYRNYD....GL..S.KL...PH.FDLHLGPNKWITVKILNATIP.......
Q5QL24_ORYSJ/29-348E..R.NCYALPTV...YGD.KYIVRVMISRNSQM....IS.LL.WPTLP..QFALHLGANYWDTVQD.............
B9RQ82_RICCO/34-356D..R.NCFNVELA...KNT.KYLIRAIFAHGDYD....GS..N.EL...PE.FDLHLGPNKWVTVKILNASIP.......
Y2451_ARATH/32-355I..R.NCYSLSVK...QGT.KYLIRTLFYYGNYD....GL..N.TS...PR.FDLFLGPNIWTSVDVLIADVG.......
Y5188_ARATH/32-354E..R.NCYNFNLT...AKS.RYLIRATFTYGNYD....GL..R.QV...PK.FDIHIGPSKWTSVKLDGVGNG.......
B9RQ90_RICCO/31-355D..R.NCYNLTLA...KDT.EYLIRATFMYGNYD....GL..N.QL...PE.FDLHIGPNKWVSVKILNASTS.......
RLK7_ARATH/31-354V..R.NCYNLSVF...KER.KYLIAASFLYGNYD....GH..N.IA...PV.FDLYLGPNLWAKIDL.QDVNG.......
B9RQ85_RICCO/33-355S..R.NCYNVTLT...KDT.EYLIRATFMYGNYD....GI..N.QR...PS.FDLYLGPNKWVSVQILNGSIP.......
Q6EQQ3_ORYSJ/24-352E..R.SCYSLPTK...KGD.KYNVRLEFLYGNYD..........GLDSASLTFNLTLGVNHWDTVILDTTI.H.......
Q67UW6_ORYSJ/28-358T..R.NCYTLRS.LQ.EGN.KYFVRAVFYYANYD....SL..N.KL...PV.FDLYLGANYWHEVKFSNADAV.......
B9RQB2_RICCO/34-359I..R.NCYTLRPPEG.KAS.IYLIRASFMYGNYD....NL..N.QL...PQ.FSLYLGVNLWDTVKFD..NAS.......
Y2923_ARATH/33-360K..K.NCYDVQPPQG.KGF.KYLIRTRFMYGNYD....NL..G.KA...PD.FDLYLGVNLWDSVTLENSTTI.......
Y5181_ARATH/29-348V..R.NCFSLNVT...RGT.KYLIKPTFLYGNYD....GR..N.VI...PD.FDLYIGPNMWITVN......T.......
Y3463_ARATH/35-357K..R.NCYNLIVK...QGK.TYMIRATALYGNYD....GL..N.IS...PK.FDLYIGANFWTTLDAGEYLSG.......
Q6EQK1_ORYSJ/34-368G..R.NCYTLYPA...IKGQKYLIRGMFMHGNYD....NK.GQ.DLVSSPVTFDIRIGLNFWNRLNIINATMT.......
B9RQ87_RICCO/35-359K..K.SCYTLNATQG.KNN.KHLIRAGFLYGNYD..........EQGNIPR.FDLYLGPNWWETVILEGASSF.......
Q9SN97_ARATH/32-354I..R.NCYNLTVT...QGT.NYLIRARAIYGNYD....GL..N.IY...PK.FDLYIGPNFWVTIDLGKYVNG.......
Y5596_ARATH/32-354K..R.NCYNLNVE...KGR.NHLIRARFVYGNYD....GR..D.TG...PK.FDLYLGPNPWATIDLAKQVNG.......
B9RQ89_RICCO/61-383V..R.NCYKIGLK...KGA.KYLIRAEFLYGNYD....GQ..N.KA...PI.FDLYLGSSKWETVDTINSTMI.......
Y2921_ARATH/34-359N..R.NCYDVKPPQG.KGF.KYLIRTRFMYGNYD....NL..G.KA...PD.FDLYLGFNIWDSVTIDNATTI.......
Y2899_ARATH/28-349K..R.NCYSLDVK...RGT.TYLIVVSFVYGNYD....GL..N.RD...PN.FDIHLGPNKWKRID..LDGEK.......
B9H626_POPTR/24-339K..K.NCYSITAD...KGS.LVLVRASFFYGNYD....KR.......SSPPSFDLLFDGNNWATVKTSL.DQL.......
B9H6K7_POPTR/19-375E..R.SSYEF.VISSAG...TYLVRLHFFSFSYSA.NLST.ALFNV....LASEISLVGNFS..VPLRS...N.......
B9HLB9_POPTR/28-361N..K.YCYTLGTK...ERR.RYLVRATFQYGS...........SENEDAYPKFDLYLDTTKWSTMVVLDASRV.......
B9HS06_POPTR/28-348S.AKKYCYVLPVI...KGG.KYLVRTTYYYGGYD....GG..K.....EPPVFDQIIQGTKWSTVNTTEDYAN.......
D7U071_VITVI/66-391K..R.NCYTLRPPEG.HGT.MYLIRASFMYGNYD....EL..N.QV...PQ.FDLYIGVNMWDSVKLDNASHL.......
F4HWL3_ARATH/31-365P..N.NCYNIVRVPK.G...HYSVRIFFGLVD.......Q.PSFDK...EPLFDISIEGTQISSLKSGWSSQD.......
F4I065_ARATH/33-357E..R.NCYNLNVT...QGT.NYLIRAAFLYGNYD....GL..N.TV...PN.FDLFIGPNKVTTVNFNATGG........
F4IB60_ARATH/32-356I..R.NCYTIAVN...SST.KYLIRADFMYGNYD....SR..N.EI...PG.FDLHLGPNKWDTVELVS..PL.......
F4IB63_ARATH/29-347A..R.NCYNLNVS...RDT.NYMIKATFVYGNYD....GH..K.DE...PN.FDLYLGPNLWATVSRS............
F4IB71_ARATH/32-354E..R.NCYNFNLT...VNS.TYLIRGTFLYGNYD....GL..N.Q....SPSFDLHIGASKWTSVNIVGVT.........
F4IB76_ARATH/32-354Q..R.NCYNFNLK...ANL.KYLIRGTFVYGNYD....GL..N.QM...PK.FDLHIGPNKWTSVILEGVANA.......
F4ICJ5_ARATH/32-364K..K.NCYVVPL.PP.G...RYYLRTFTVYDNYD....GKSHSPSFDVSVEGTLVFSWRSPW..........PES...LL
F4J801_ARATH/31-354Q..T.NCYTNIPA.T.KGR.TTLVRTKFYYKNYD....EN.......YSPPSFDVVYDGKHRNSIAMTV.DSLFS...DE
F4JB46_ARATH/25-347S.SRKHCYNFPVA...KTS.KYLIRTTYYYGNFD....GK..N.....NPPVFDQIIGGTKWSVVNTSEDYAK.......
F6H477_VITVI/48-422R.FQ.FAYIFPVT...TGQ.K.FIRLHFYPSSVAGFDRSK.AFFSV.KIGGYT.LLNNFSAALAADA...HGD.......
F6HY53_VITVI/28-350V..K.NCYTLPADQG.KDN.KYLIRAVFMCGNVQ....EY..NNQL...PE.FKLYLGVEEWDSVTFNSSYNI.......
I1MCW6_SOYBN/32-358K..R.NCYKINIT...RGS.KYLIRASFLYGNYD....GL..N.M....LPQFDLLLGANRWRTVNINNAS.V.......
I1PTQ3_ORYGL/76-415T..R.NCYTLKQLT..RGG.KYLVRATFGYGNYD....AF..N.....SPPAFDLYLGANYWVKVNITNSSRA.......
I1PXF6_ORYGL/34-366A..R.NCYTLRSL.V.AGL.KYLIRATFMYGNYD....GL..N.KL...PVSFDLHIGVNFWTVVNITD..PI.......
I1QAW3_ORYGL/40-375P..E.NCYYINNVPN.G...HYQVRLFFALVA.D....PN.LD.....SEPIFDVSVEGTLFSSLLLGWSSED.......
K4B910_SOLLC/3-338P..E.NCYNIKRVPH.G...HYSVRIFFGMIE.......E.PSFDN...EPLFDVSVEGTLVYTLPSGW.SNHD......
M0S6H3_MUSAM/43-370T..R.NCYTINSITP..SS.KYLIRASFFYGNYD....GL..G.SQ...SRLFDLYLGVNLWKTINITDPGSG.......
SIRK_ARATH/33-359K..R.SCYDVPTPRG.KGF.KYLIRTRFMYGNYD....DL..G.RV...PE.FDLYLGVNFWDSVKLDDATTI.......
Q0DGL2_ORYSJ/34-367E..R.NCYTLRSL.T.AGL.KYLIRAAFVYGNYD....GL..K..K...PPVFDLYIGVNFLTMVNITGLDGA.......
Q0J2E4_ORYSJ/17-347K..R.NCYSLPTN...VGD.KYLVRLEFLYGNYD....SM......DSSLLKFNLSLGVNHWNTVNLDTTDDQ.......
Q0J2E5_ORYSJ/9-345E..R.NCYALPTV...PGA.IYLVRLRFAYGNYD....NM..N.SE...SVQFDLFLGVNKWDEVYIANKDKE.......
Q2QNF5_ORYSJ/41-399E..RGGCYTLRQLSP..GG.RYLVRATFYYGNYD....GA.IA....MLPVVFDLHLGANRWTAVNVTAADAI.......
Q5JNB7_ORYSJ/47-383R..K.YCYRVSVK...ART.RYLVRASFLYGNFD....GS..R....VFPE.FDLYVGASRWSTIVIYDESKV.......
Q5VQN4_ORYSJ/8-346Q..R.NCYTLPTNSS.K...KYLIRATFTYGNYD....GL..NSSEKGSLFIFGLHIGVNFWTTVNLTKWDPS.......
Q5ZCA6_ORYSJ/34-370A..R.NCYTARSLA..PGI.KYLIRASFLYGNYD....GL..N.KL...PV.FHLYIGVNFWTMVNITSLGLG.......
Q5ZDH7_ORYSJ/38-375...KSSCYSLPL.PP.G...RYYLRLFSVYDNYDS.KLR...TPSFDVSAAATLVLSFRSPW.....PEPASR.......
Q65X96_ORYSJ/43-376K..R.NCYTLRSL.V.AGL.KYLFRTTFFYGNYD....GL..N.KL...PV.FDLYVGVNYWTMVNITGPG.........
Q67TV6_ORYSJ/37-371AAPR.SCYTLRSL.V.PGL.KYLVRASFMYGNYD....GL.RR......PPVFDLYAGVNFWRTVNITDAA.........
Q6EQM5_ORYSJ/33-373P..R.NCYALPTV...AGT.KYLVRLGFLYGNYD....GE.NSSSSSASSLRFDLHLGAQRWATVDDVVVQTG.......
Q6ERZ1_ORYSJ/29-346V..R.NCYALPTV...AGA.KYLVRVRSAYGNYD....GK..N.S..SSTIQFDLYLGVNYWATVKD....PW.......
Q94HA8_ORYSJ/46-404S..DISTYSFFIS.QPG...HHWIRLHFLPIPDDHYNLTT.ATFSV.STDDMV.LLHDFSFIAT.......PP.......
Q9M0D8_ARATH/30-359N..R.NCYTLKLSQG.KDH.LYLIRASFMYGNYD....GK..K.AL...PE.FDLYVNVNFWSTVKFKNASDQ.......
Q9SZV2_ARATH/30-354K..R.NCYDIRPQQG.KGF.KYLIRTRFMYGNYD....GF....SK..TPE.FDLYIGANLWESVVLINETAI.......

PF11721

Y1972_ARATH/435-593---.-.............................----------------------------------------------
Y3148_ARATH/403-590---.-..YYDSKNGWVSSNTGNFLDDDRTNNGKS----------------------------------------------
RKF1_ARATH/416-604---.-.KYFLKPDANWG......FSSTGDFMDDN----------------------------------------------
Y1534_ARATH/364-548---.-...YESRNGWFS......NNVGVFVDDKH----------------------------------------------
Y5343_ARATH/408-592---F-SSVSERWGYSS.........SGVWLGKED----------------------------------------------
Y5614_ARATH/424-612---.-.SFVVSAGQRWAA....SSVGLFAGSSNN----------------------------------------------
Q29NS0_DROPS/68-230---.-SDYGKH.......................----------------------------------------------
A0C5E5_PARTE/21-187---V-SDYTYN...................D...----------------------------------------------
A0D555_PARTE/21-188---V-ADYSLN...................SE..----------------------------------------------
Q232Z6_TETTS/33-200---A-VDYSDD...................EN..----------------------------------------------
Q22CM9_TETTS/26-197---I-ADYTYN...................QS..----------------------------------------------
A6H797_BOVIN/39-199---A-SDYGMK.......................----------------------------------------------
A7RLY6_NEMVE/27-185---S-SDYGKM.......................----------------------------------------------
Q17BA6_AEDAE/29-192---E-SDYGKQ.......................----------------------------------------------
A8X3B8_CAEBR/29-187---A-SDVGVQ.......................----------------------------------------------
Q95QG1_CAEEL/43-202---S-SDHGMQ.......................----------------------------------------------
Q231X5_TETTS/32-203---A-RREDVR...................FQ..----------------------------------------------
A0CEJ8_PARTE/2-159---F-VDYYDE...................QQ..----------------------------------------------
A0DJ13_PARTE/493-661---F-VDYYES...................VE..----------------------------------------------
A0DRE8_PARTE/13-175---I-VDYYER...................AQ..----------------------------------------------
Q7XTR9_ORYSJ/429-616---.-.SYYVAGTPTWGV....STTGRFMDPPNG----------------------------------------------
Q6F2P3_ORYSJ/440-627---.-.SYFVTGEKRWGI....SNVGKFDQATNG----------------------------------------------
Q6ZKW6_ORYSJ/422-609---.-.SYYVSDNARWGV....SSVGKFNEASNG----------------------------------------------
A4AT33_MARSH/904-1052---.-.............................----------------------------------------------
A4AUK4_MARSH/903-1051---.-.............................----------------------------------------------
A4CK29_ROBBH/1247-1419---G-ATTGTPSP..............YVNSGAE----------------------------------------------
A4CK28_ROBBH/332-497---.-......T................LFSRTN----------------------------------------------
Q21PD3_SACD2/360-498---.-.............................----------------------------------------------
B9M0U3_GEODF/207-345---.-.............................----------------------------------------------
B9M0U3_GEODF/432-570---.-.............................----------------------------------------------
Q01NB6_SOLUE/205-356---.-.............................----------------------------------------------
Q021C7_SOLUE/211-363---.-.............................----------------------------------------------
Q026G9_SOLUE/209-373---.-...........................QP----------------------------------------------
Q01RD0_SOLUE/183-344---.-............................N----------------------------------------------
Q7UIV5_RHOBA/6-153---.-...........................QD----------------------------------------------
A5FCJ0_FLAJ1/725-892---W-GSLSWT..................DNFEK----------------------------------------------
A6L3S6_BACV8/1081-1251---A-ESFIHPS.................DSVQL----------------------------------------------
A4CKE5_ROBBH/1275-1442---.-......GI..............YSVNTGV----------------------------------------------

PF12819

Y5573_ARATH/35-359.NGVTTEEIIHSTKS.KVLQVCLIKTGE..SI.PIINSLELRPLINDTY..................NTQ.SGS..LKYL
Y4291_ARATH/31-359...VIKE.ILSFAES.DTIYVCLVNKGK..GT.PFISALELRPMNSSIY..G..............T.EF.GRNVSLVLY
MEE39_ARATH/34-356...TVKE.IIHIPRS.NSLQICLVKTGA..TI.PMISALELRPLANDTY.................I.AK.SGS..LKYY
Q0DGL3_ORYSJ/34-370...GNAEVIAVVP.D.DFLQVCLVNTGA..GT.PFISGLDLRPLPSSLY.................A.PA.NATQGLVLL
Y5169_ARATH/27-358...SVEE.IIHIPSS.NSLQICLVKTGN..SL.PFISALELRLLRNDTY.................V.VQ.DVS..LKHL
Y5189_ARATH/28-350...SVSE.MIHVLRQ.DHLQICLVKTGE..TT.PFISSLELRPLNNNTY.................V.TK.SGS..LIVV
Y1756_ARATH/33-356...TRAE.IIHIPRS.TSLQICLVKTGT..TT.PLISALELRPLRNNTY.................I.PQ.SGS..LKTL
Y4245_ARATH/33-374QDGTVEE.VIHMPKS.NNLDICLVKTGT..TT.PFISSLELRPLRDDTY.................T.TT.TGS..LKLI
Y1518_ARATH/32-355...SMHE.IIHVVPQ.DSLEVCLVKTGP..TT.PFISSLEVRPLNNESY.................L.TQ.SGS..LMLF
Q0JIC9_ORYSJ/48-385.NTIWKE.LIMVAPG.NSVSVCLINNEL..GT.PFISTLDLRPLQDTMY.P.................FV.NVSVAVSYF
Q0J2D5_ORYSJ/28-372...EVHE.AVFVAWA.SWAPVCLVNTGS..GT.PFVSTVELRPLVDSLY.PA..............V.MA.NQS..LAML
Y1677_ARATH/29-363...YVEELIVRAT.S.SYVDVCVCCAIT..GS.PFMSTLELRPLNLSMY..A..............T.DY.EDNFFLKVA
Y1755_ARATH/32-354...VLEE.IIHITRS.NILDICLVKTGT..ST.PMISSIELRPLLYDTY.................I.AQ.TGS..LRNY
PAM74_ARATH/32-354...TMEE.ILHTPTS.NSLNVCLVKTGT..TT.PLISALELRPLGNNSY..L..............T.DG...S..LNLF
Q9C8I6_ARATH/32-353...SIFE.MIHILTT.DRLQICLVKTGN..AT.PFISALELRKLMNTTY..L..............T.RQ.G.S..LQTF
Q6ERN3_ORYSJ/27-359.DGYNVHEAVFVAWA.SWAPVCLINIGQ..GT.PFMSMVELRPLGILPY.PA..............V.MG.NVS..LSLY
B9RQ86_RICCO/32-352...PIKE.IIHAPTF.NNIYVCLVRTGP..WT.PFISALEIRPLHNSTY..V..............A.QS.G.S..LSLF
Q65X94_ORYSJ/35-368.GATLLE.AIVVVPD.DFVQVCLVNTGT..GT.PFISGLDLRPLEKKLY.PQ..............A.ND.KRGLSLF..
RLK6_ARATH/36-358.NGTIQE.IIHKTIS.KSLQVCLVKTGT..SS.PMINTLELRPLKNNTY..N..............T.QS.G.S..LKYF
Q5VQN2_ORYSJ/40-388.DTMYKE.VITVAPD.KFISVCLINLGS..GT.PFVSTLDLRELDGAMF.PF..............L.NL.SVSISHLAR
B9RQ88_RICCO/35-358...VITE.IIYTPIL.NYIHVCLVNTGL..GT.PFISALELRPLKNTTY.EI..............R.SE.G.A..LAKF
Q5QL24_ORYSJ/29-348.DSTEVYEALFMAWA.SWAPVCLVNTDQ..GT.PYASAIELRPLGNELY.PA..............V.MA.NQS..MRMS
B9RQ82_RICCO/34-356...VIKE.IIHTPTL.NYIHICLVNTDS..GM.PFISALELRPLKNTTY..V..............A.QS.G.A..LVKS
Y2451_ARATH/32-355.DGVVEE.IVHVTRS.NILDICLVKTGT..ST.PMISAIELRPLRYDTY..T..............A.RT.G.S..LKSM
Y5188_ARATH/32-354...AVLE.MIHVLTQ.DRLQICLVKTGK..GI.PFISSLELRPLNNNTY..L..............T.QS.G.S..LIGF
B9RQ90_RICCO/31-355...VTEEIIIGSPKS.KYIHVCLVTKDT..GT.PFISALETRPLKNGTY..V..............T.ES.G.SLGLALF
RLK7_ARATH/31-354...TGEE.ILHIPTS.NSLQICLVQTGE..TT.PLISSLELRPMRTGSY..T..............T.VS.G.S..LKTY
B9RQ85_RICCO/33-355...VRKE.IIHHPKR.KYIHVCLVNTNS..GT.PFISALELRPLKNGTY..V..............S.ES.G.S..LALF
Q6EQQ3_ORYSJ/24-352.YGYKAYAAVFVAWA.MSAPVCLVNTGG..GT.PFVSTVELRPFESLAY.PT.................D.NQS..LSLY
Q67UW6_ORYSJ/28-358.NW..MD.IIVVAPA.DYLQVCLVNKGT..GT.PFISGLDLRPLKSTLY.PE..............A.NT.TQSLVLINS
B9RQB2_RICCO/34-359.HVVIKE.IIHVPAL.NDIYVCLLNTGS..GT.PFISALELRHFHNSTY.R...............T.ES.G...SLVLF
Y2923_ARATH/33-360...VTKE.IIYTLRS.DKVHVCLVDKER..GT.PFLSVLELRLLKNNIY..E..............T.AS.D.S..LMLY
Y5181_ARATH/29-348.DNTIKE.ILHVSKS.NTLQVCLVKTGT..SI.PYINTLELRPLADDIY..T..............N.ES.G.S..LNYL
Y3463_ARATH/35-357...VVEE.VNYIPRS.NSLDVCLVKTDT..ST.PFLSLLELRPLDNDSY..L..............T.GS.G.S..LKTF
Q6EQK1_ORYSJ/34-368...YTSE.AIVVAIV.NSVSVCLVDNGE..GT.PFISSLEMRPMKSSNY.PA..............A.TP.NHP..LLLQ
B9RQ87_RICCO/35-359...FTVE.IIHVPSS.NHIDICLVNTGF..GT.PFISVLELRPLYNDIY..V..............M.SA.SGS..LQNF
Q9SN97_ARATH/32-354...TWEE.IIYIPKS.NMLDVCLVKTGP..ST.PLISSLVLRPLANATY..I..............T.QS.G.W..LKTY
Y5596_ARATH/32-354...TRPE.IMHIPTS.NKLQVCLVKTGE..TT.PLISVLEVRPMGSGTY..L..............T.KS.G.S..LKLY
B9RQ89_RICCO/61-383...ITKE.IIHLINT.SYIDVCLVNTGS..GT.PFMSKLELRPIRISAY..S..............T.SL.G.S..LARF
Y2921_ARATH/34-359...VTKE.IIHTLRS.DHVHVCLVDKNR..GT.PFLSALEIRLLKSNTY..E..............T.PY.D.S..LILF
Y2899_ARATH/28-349.EGTREE.IIHKARS.NSLDICLVKTGE..TL.PIISAIEIRPLRNNTY..V..............T.QS.G.S..LMMS
B9H626_POPTR/24-339...VYYE.VMYVVKS.DTTSICLAQTQP..NQFPFISALEVRNLDSKMY.G.................DV.DPNYALFLR
B9H6K7_POPTR/19-375.SPLIKEFFINITV..GKFPIYFIPQG...SSFAFVNAIELFLAPENFI.PSSALLVS.PAGSEGKN.ED.ILSMVLLTI
B9HLB9_POPTR/28-361...YVKEMIIRAP.S.SSIDVCICCATT..GS.PFISTLELRPLNLSMY..A..............T.DF.EDNFFLEVA
B9HS06_POPTR/28-348GMSSYYE.IIVASLA.KTLSVCLARNVH.TTSSPFISALEIEYLGNSVY.NS................TD.FSKYALVTV
D7U071_VITVI/66-391...VMKE.ILHAPSD.DDIYVCLVNIGY..GE.PFISSLEVRHFHDSSY.................K.TE.SGS..LALY
F4HWL3_ARATH/31-365.DQVFAEALIFLLG..GTATICFHSTGH..GD.PAILSIEILQVDDKAY.SF..............G.EGWGQGVILRTA
F4I065_ARATH/33-357..GVFVE.IIHMSRS.TPLDICLVKTGT..TT.PMISTLELRPLRSDTY.................I.SAIGSS..LLLY
F4IB60_ARATH/32-356.QTVSKEIIYYVL.T.DTIQVCLVNTGN..GT.PFISVLELRQLPNSSY.................A.A...QSESLQLF
F4IB63_ARATH/29-347..ETVEE.IIHVTKS.DSLQVCLAKTGD..FI.PFINILELRPLKKNVY.................V.TE.SGS..LKLL
F4IB71_ARATH/32-354.DTVMPE.IIHVLTQ.KRLQVCLVKTGK..TT.PFISSLELRPLINNIY.................I.AE.SGS..MVLQ
F4IB76_ARATH/32-354...TIFE.IIHVLTQ.DRLQVCLVKTGQ..TT.PFISSLELRPLNNDTY.................V.TQ.GGS..LMSF
F4ICJ5_ARATH/32-364RDGSYSDLFAFIG.D.GELDLCFYSIAT..DP.PIVGSLEVLQVDPSSY.DA..............D.GT.GQNVLLVNY
F4J801_ARATH/31-354ETFHYSE.VIFAPAN.ENISVCLVRTSP..SDNPFISSIEVYRFDAGMY.D.................DL.GPEEGFILY
F4JB46_ARATH/25-347GQSSYYEIIVGVPG..NRLSVCLAKNAHTLSSSPFISSLDVQSLEDTMY.NS..............T..D.LGSYKLSLI
F6H477_VITVI/48-422.ETVSKEFCVNVKQGDQMLNITFTPTASDPDAYAFINGIEIVSMPDYLYYTSPQNGGIQFIGQKNVF.WI.EIEYALEMV
F6HY53_VITVI/28-350...VRRE.IIYVPKT.DEIYVCLVNTDS..GT.PFISALELRPIDDSIY...................NK.TQSGSLVLF
I1MCW6_SOYBN/32-358..SRDFE.IIYVPSL.DYVHICMVDTGL..GT.PFISAIELRSLRNDIY.................E.TE.FGS..LEKY
I1PTQ3_ORYGL/76-415...YVHE.TIAVSPS.EFLQVCLVNTGS..GT.PFISGLDLRSLPANFY.PE..............A.NV.AQSLVLLSF
I1PXF6_ORYGL/34-366.QPVNREAIVVVP.D.DSVQVCLVNTGA..GT.PFISGLDLRPLMNKLY.PQ..............V.NA.TQG..LLQL
I1QAW3_ORYGL/40-375.EKTFAEALVFVQ.D.SSLSICFHSTGH..GD.PSILSIEVLQIDDNAY.KF..............G.PSWGKGTILRTA
K4B910_SOLLC/3-338DEQVFVETLIFLD.D.GTASLCFHSTGH..GD.PAILAIEILQVDDRAYYFG..............A.DF.GLGTIIRTV
M0S6H3_MUSAM/43-370...YRTD.VITVAAS.GSFSVCLVNTGH..GT.PFISGLDVRPLKEILY.PA..............V.NA.SRS..LVLT
SIRK_ARATH/33-359...LNKE.IITIPLL.DNVQVCVVDKNA..GT.PFLSVLEIRLLLNTTY...................ET..PYDALTLL
Q0DGL2_ORYSJ/34-367...ALEEAIVVVP.D.DFVQVCLVNTGT..GT.PFISGLDLRPLKSTLY.PQ..............V.TE.TQG..LSLF
Q0J2E4_ORYSJ/17-347.DGYNFYEAVFVAWA.SWAPVCLINIGQ..GI.PFVSTVELRLLGTLPY.PA..............I.IG.NQS..LSLY
Q0J2E5_ORYSJ/9-345...YSSE.AMFVAWA.SWASVCLVNTYQ..GT.PFVNTVELRQLDSMLHFRK..............I.MG.NSS..IYLY
Q2QNF5_ORYSJ/41-399...YIFEAVVSPP.A.DFLQVCLVNIGK..GT.PFISGLDLRPLKPELY.PE..............A.TA.NQSLLLLNH
Q5JNB7_ORYSJ/47-383...VTREMVALAQSG.PSLSVCLANATT..GH.PFISTLELRPLNASLY.H...............T.AF.EAAFFLSLA
Q5VQN4_ORYSJ/8-346.STVWKE.VITVAPD.KSVSVCLINMGS..GT.PFISTLDLRPLQDTMY.PF..............V.NA.STS..VSYF
Q5ZCA6_ORYSJ/34-370.GSRYEEAIVVVP.D.DFVQVCLINTGT..GT.PFISSLELRPLDKRLY.PQ..............V.NA.T..LGLLQL
Q5ZDH7_ORYSJ/38-375.YGAYSDLIFPSATS.PTSDICFYSLST..DA.PVVASIEVAPVHPLAY.DG..............A.TT.GADLILVNY
Q65X96_ORYSJ/43-376.DAVIVEAIVVVP.D.DFVQVCLVNTGA..GT.PFISGLDLRPLKNTLY.PQ..............S.NA.T..QGLVLL
Q67TV6_ORYSJ/37-371.ASITAEAIIVVP.E.DSMQVCLLNTGA..GT.PFISSLDLRPLKNSLY.PQ..............A.NA.TQ..GLVMV
Q6EQM5_ORYSJ/33-373GISRMYE.VVFMGWA.RWAPACLVNVGG..GT.PFVSSVELRPIDDELY.PS..............V.KT.SES..LSLF
Q6ERZ1_ORYSJ/29-346..NEFHE.ALFVAWA.SWVPVCLLNTGR..GT.PFASSVVLRRLSSELY.PV..............I.NA.KQS..MRMI
Q94HA8_ORYSJ/46-404.NPVLREYIVATQG..DTLKIIFTPKKD..SI.AFINAIEVVSAPPSLI.PNTTTG.....MAPQGQ.LD.ISNNALQVV
Q9M0D8_ARATH/30-359...VTKE.ILSFAES.DTIYVCLVNKGK..GT.PFISGLELRPVNSSIY..G..............T.EF.GRNVSLVLY
Q9SZV2_ARATH/30-354...MTKE.IIYTPPS.DHIHVCLVDKNR..GT.PFLSVLEIRFLKNDTY.D....................TPYEALMLG

PF11721

Y1972_ARATH/435-593----------------.........TS.--TN-LTLSGDYP.....DLY-------------------------------
Y3148_ARATH/403-590----------------KWS.....NSS.--EL-KITNSSID....FRLY-------------------------------
RKF1_ARATH/416-604----------------NFQ.....NTR.--FT-MFVPASNQ....SDLY-------------------------------
Y1534_ARATH/364-548----------------VPER..VTIES.--NS-SELNVVDF.....GLY-------------------------------
Y5343_ARATH/408-592----------------AGY....LATD.--RF-NLINGSTP.....EYY-------------------------------
Y5614_ARATH/424-612----------------IYI.....STS.--QS-QFVNTLDS.....ELF-------------------------------
Q29NS0_DROPS/68-230----------------.........LL.--MI-GRTHEHDE.....MLY-------------------------------
A0C5E5_PARTE/21-187----------------.........VV.--YA-GIAYTFTP.....RVY-------------------------------
A0D555_PARTE/21-188----------------.........VA.--SQ-QIKYTREP.....EIY-------------------------------
Q232Z6_TETTS/33-200----------------.........LK.--GL-VIKYAKEP.....TIY-------------------------------
Q22CM9_TETTS/26-197----------------.........IM.--KK-TIKYTDDQ.....QLY-------------------------------
A6H797_BOVIN/39-199----------------..........L.--PI-LRSNPEDQ.....ILY-------------------------------
A7RLY6_NEMVE/27-185----------------..........L.--TI-GRVAPPDQ.....ILY-------------------------------
Q17BA6_AEDAE/29-192----------------.........LL.--MI-NRVKPNDE.....LLY-------------------------------
A8X3B8_CAEBR/29-187----------------..........Y.--SF-NNAENDDV.....EIY-------------------------------
Q95QG1_CAEEL/43-202----------------..........Y.--SF-NNAEVDDM.....EIY-------------------------------
Q231X5_TETTS/32-203----------------.........QR.--KT-IFDEIYDW.....NIH-------------------------------
A0CEJ8_PARTE/2-159----------------............--SV-KVRKTVDQ.....ELY-------------------------------
A0DJ13_PARTE/493-661----------------............--NR-KIRFTDDQ.....SLY-------------------------------
A0DRE8_PARTE/13-175----------------............--RR-KIKFTDDQ.....SLY-------------------------------
Q7XTR9_ORYSJ/429-616----------------SY......IIY.--SS-RQFDKTLD....SGLF-------------------------------
Q6F2P3_ORYSJ/440-627----------------ID......IIY.--SS-DHFQNTVD....SKLF-------------------------------
Q6ZKW6_ORYSJ/422-609----------------SY......AIY.--SP-QQFQSALN....SELF-------------------------------
A4AT33_MARSH/904-1052----------------............--..-....YTNPSALVPDMY-------------------------------
A4AUK4_MARSH/903-1051----------------............--..-....YVNGNAQVPELF-------------------------------
A4CK29_ROBBH/1247-1419----------------DVTYGVVPLPA.--GF-TNTTGYPD.....AIF-------------------------------
A4CK28_ROBBH/332-497----------------GKAYKGYSSAI.--AG-TTPGSPEE.....LLF-------------------------------
Q21PD3_SACD2/360-498----------------........GST.--TD-SIAGATSS.....TLY-------------------------------
B9M0U3_GEODF/207-345----------------........AKT.--TA-AIGGTTDD.....TLY-------------------------------
B9M0U3_GEODF/432-570----------------........AKT.--TA-TIAGTTND.....VLY-------------------------------
Q01NB6_SOLUE/205-356----------------..L.....LHP.--SE-RIVRTLDP.....DLY-------------------------------
Q021C7_SOLUE/211-363----------------..F.....ETH.--DH-AIFGTREP.....RIY-------------------------------
Q026G9_SOLUE/209-373----------------GPKHFFPPVPD.--DG-LFKNMREAISADMTVP-------------------------------
Q01RD0_SOLUE/183-344----------------RWEFGGKEMGVP--VR-TIRYAPDQ.....LYF-------------------------------
Q7UIV5_RHOBA/6-153----------------KSQLTGLDTDK.--EL-DSTATLDE.....FLV-------------------------------
A5FCJ0_FLAJ1/725-892----------------LPDFFASQRTT.--FD-PINGTKDP.....ELF-------------------------------
A6L3S6_BACV8/1081-1251----------------LSPYQASQRTT.--ND-PIHGTRDW.....ELF-------------------------------
A4CKE5_ROBBH/1275-1442----------------ALESGLEFSQR.--DA-SIPAYIDETV.YESLF-------------------------------

PF12819

Y5573_ARATH/35-359FRNYF.STSRRI...............IRYPNDV......NDRHWY.......PF...FD.......EDAWTELTTNLN.
Y4291_ARATH/31-359QRWDT.GYLNGT...............GRYQKDT......YDRIWS.......PY...S........PVSWNTTMTTGY.
MEE39_ARATH/34-356FRMYL.SNATVL...............LRYPKDV......YDRSWV.......PY...I........QPEWNQISTTSN.
Q0DGL3_ORYSJ/34-370DRRNF.GASGST..............VIRYPDDT......YDRVWW.......PW..SNP.......PAEWSDISTADK.
Y5169_ARATH/27-358FRRYY.RQSDRL...............IRYPDDV......YDRVWS.......PF...F........LPEWTQITTSLD.
Y5189_ARATH/28-350ARLYF.SPTPPF...............LRYDEDV......HDRIWI.......PF...L........DNKNSLLSTELS.
Y1756_ARATH/33-356FRVHL.TDSKET...............VRYPEDV......HDRLWS.......PF...F........MPEWRLLRTSLT.
Y4245_ARATH/33-374SRWYF.RKPFPTLE...........SIIRHPDDV......HDRLWD.......VY...HA.......DEEWTDINTTTP.
Y1518_ARATH/32-355ARVYFPSSSSSF...............IRYDEDI......HDRVWN.......SF...T........DDETVWISTDLP.
Q0JIC9_ORYSJ/48-385SRQRY.GQVNDV..............ITRYPEDV......YDRFWE......GAF..HTR.......SYPWINLNTTQE.
Q0J2D5_ORYSJ/28-372RRRNMAANNFIRRHLVWSSCKNHAYRKNMYPDDP......YDRYWW.......PM...NA.......DPAWANLSTTST.
Y1677_ARATH/29-363ARVNF.GAPNMD..............ALRYPDDP......YDRIWESDINKRPNYL.VGV.......APGTTRINTSKT.
Y1755_ARATH/32-354NRFYF.TDSNNY...............IRYPQDV......HDRIWV.......PL...I........LPEWTHINTSHH.
PAM74_ARATH/32-354VRIYL.NKT..DG.............FLRYPDDI......YDRRWH.......NY...FM.......VDDWTQIFTTLE.
Q9C8I6_ARATH/32-353IRADV..GA..TVN...........QGYRYGIDV......FDRVWT.......P....YN.......FGNWSQISTNQS.
Q6ERN3_ORYSJ/27-359VRSNV.GSSPDDD............KLVRYPDDQ......YDRFWS.......TD............EAHPLSTNISTQ.
B9RQ86_RICCO/32-352NRVDV..GS..LTN...........QTIRYPDDV......YDRMWL.......P....FH.......FDKGTDISTKEN.
Q65X94_ORYSJ/35-368GRWNF.GPISTTE.............FIRYPDDP......HDRIWM.......PW...VS.......PSYWVEVSTTRP.
RLK6_ARATH/36-358FRYYF.SGS..GQ.............NIRYPDDV......NDRKWY.......PF...FD.......AKEWTELTTNLN.
Q5VQN2_ORYSJ/40-388QR.........YGSV........DDYITRYPTDP......FDRFWE...........AAL.......RYKFPFLNMTTN.
B9RQ88_RICCO/35-358ARLDF..GS..VTN...........KTVRYPDDV......YDRIWT.......P....DH.......YYKWTDLSTPET.
Q5QL24_ORYSJ/29-348IRCRM.GQTDSS...............ITRFPDD......QHDRYW.......WTT.PT........NPMWAN.LSTTS.
B9RQ82_RICCO/34-356TRLDL..GS..LTN...........KTVRYPDDV......FDRIWT.......P....DH.......FHKWTDLSTPDT.
Y2451_ARATH/32-355AHFYF.TNS..DE.............AIRYPEDV......YDRVWM.......PY...S........QPEWTQINTTRN.
Y5188_ARATH/32-354ARVFF...S..ATP...........TFIRYDEDI......HDRVWV.......R....QF.......GNGLKSISTDLL.
B9RQ90_RICCO/31-355TREDV..GS..LNN...........RIVRYPNDV......YDRRWF.......P....YH.......FKRGTDISTTLT.
RLK7_ARATH/31-354RRLYF.KKS..GS.............RLRYSKDV......YDRSWF.......PR...F........MDEWTQISTALG.
B9RQ85_RICCO/33-355DRADI..SS..ITN...........QTVRYPDDV......YDRRWS.......P....FH.......FVEWTDISTTET.
Q6EQQ3_ORYSJ/24-352ERKSM.RSG..FH.............KYRFPDDQ......YDRYWY.......AWE.LT........GNDPYS.NISTQ.
Q67UW6_ORYSJ/28-358NRFNM.GPTDNS..............ITRYPLDP......HDRLWS.......TY...DT.......IPDWTEISATSV.
B9RQB2_RICCO/34-359QRLDF.GSTTNE..............IVRYHDDA......YDRIWF.......PY...NC........PQYAALSTSFA.
Y2923_ARATH/33-360RRWDL..GA..TGD...........LPARYKDDI......FDRFWM.......P....LM.......FPNFLILNTSLM.
Y5181_ARATH/29-348FRVYY.SNL..KG.............YIEYPDDV......HDRIWK.......QI...LP.......YQDWQILTTNLQ.
Y3463_ARATH/35-357RRYYL.SNS..ES.............VIAYPEDV......KDRIWE.......PT...F........DSEWKQIWTTLK.
Q6EQK1_ORYSJ/34-368DRRSM.GAS..R..............IIRYPDDP......YDRVWW.......LP...QI.......TSGLIKISTRSL.
B9RQ87_RICCO/35-359GRYDC.GSTSDR..............AIRFPRDI......YDRIWS.......P....NN.......SPYWEVLSTTST.
Q9SN97_ARATH/32-354VRVYL.SDS..ND.............VIRYPDDV......YDRIWG.......SY...F........EPEWKKISTTLG.
Y5596_ARATH/32-354YREYF.SKS..DS.............SLRYPDDI......YDRQWT.......SF...F........DTEWTQINTTSD.
B9RQ89_RICCO/61-383SRSDV..GS..TTN...........RTLRYADDV......YDRIWT.......P....NH.......FFKWAEISTSET.
Y2921_ARATH/34-359KRWDL..GG..LGA...........LPVRYKDDV......FDRIWI.......P....LR.......FPKYTIFNASLT.
Y2899_ARATH/28-349FRVYL.SNS..DA.............SIRYADDV......HDRIWS.......PF...N........GSSHTHITTDLN.
B9H626_POPTR/24-339SRIAY.GANT.T...............VRFPDDG......YDRIWV.......PE............RVGSGLVSVASD.
B9H6K7_POPTR/19-375HRINV.GGPT.................LSPENDT......LWRYWVP....DDSF..LYS.......PDTAKNISSLSS.
B9HLB9_POPTR/28-361ARVNFGALSKDA...............IRYPDDP......YDRIWGSD...LEK.....RQNYLVGVAPGTVRINTSRY.
B9HS06_POPTR/28-348ARDNF.GADEEI...............IGFPDDQ......FNRLWQ.......PY..IDQ.......NP.....VVECQ.
D7U071_VITVI/66-391RRLDA.GSTTNE..............IVRFKDDA......YDRIWF.......PY...NL.......PDCE.SLNTTVP.
F4HWL3_ARATH/31-365TRLTCGTGKSRF..............DEDYRGDHW....GGDRFWNR....MRSF...G........KSADSPRSTEET.
F4I065_ARATH/33-357FRGYL.NDSGVV...............LRYPDDV......NDRRWF.......PF...S........YKEWKIVTTTLN.
F4IB60_ARATH/32-356QRLDF.GSTTNL..............TVRYPNDV......FDRIWF.......PA...T........PNGTKPLSDPST.
F4IB63_ARATH/29-347FRKYF.SDSGQT...............IRYPDDI......YDRVWH.......AS...FL.......ENNWAQVSTTLG.
F4IB71_ARATH/32-354NRVYFPSDSTSI...............VRYDEDI......HDRVWN.......PV...S........DDDSSSISTDLQ.
F4IB76_ARATH/32-354ARIYF.PKTAYF...............LRYSDDL......YDRVWV.......PF...S........QNETVSLSTNLP.
F4ICJ5_ARATH/32-364GRLSC.GSDQWGP.............GFTNHTDN......FGRSWQS....DEDF...RSE....DSRSVARSLSTLEK.
F4J801_ARATH/31-354KRNAY.GATK.L...............ISYPLDP......YGRLWS.......PK..GSQ.......DYPGLIDLT.TS.
F4JB46_ARATH/25-347ARNSF.GGDGEI...............ISYPDDK......YNRLWQ.......PF...SD.......QKHLTV....TS.
F6H477_VITVI/48-422YRLNV.GGRF.................VSPMEDT.....GMFRTWDE....DDDYC.VKL.......AFVPANSSIDLK.
F6HY53_VITVI/28-350NRYNFGSETSET...............VRYGDDV......LDRIWG.......PY...SW.......SSGESI.KAPYS.
I1MCW6_SOYBN/32-358IRRDL.GSNK.G...............YRYDDDV......YDRYWSYD..DADTW..YDN.......VDKWRKLNFPID.
I1PTQ3_ORYGL/76-415FRETV.SFGFNRFHFG......TDEHHIRYPVDR......YDRFWQ.......RY...ED.......IPGWEDVPDKIN.
I1PXF6_ORYGL/34-366ARLNF.GPSDET..............SIRYPDDP......HDRVWF.......PW...FD.......AAKWNEISTTNR.
I1QAW3_ORYGL/40-375KRLTC.GSGK.................PAFDEDLNGIHWGGDRFWLG.....VKT..LS........SSSDDQPISTEN.
K4B910_SOLLC/3-338KRLSC.GAQESMF.............DVDYSGDHW....GGDRFWS.......SIK.TFG.......QNSDRRISTKNS.
M0S6H3_MUSAM/43-370RRLNM.GPTDTF...............IRYPDDS......HDRIWD.......PF...NN.......IPFWAETSTNST.
SIRK_ARATH/33-359RRLDY.SKTGKL..............PSRYKDDI......YDRIWT.......PR...IV.......SSEYKILNTSLT.
Q0DGL2_ORYSJ/34-367GRWNF.GPTSNTE.............IIRYPDDP......HDREWV.......PW...IN.......PFDWTVISTTTM.
Q0J2E4_ORYSJ/17-347VRRSI.GSSADD..............DMRYPDDQ......YDRYWIM.....GET...TG.......AADMSNISTP...
Q0J2E5_ORYSJ/9-345ERRNM.GPSSRDN............PIIRYPNDT......YDRFWY.......PWG.SED.......DPTYSNLSAPST.
Q2QNF5_ORYSJ/41-399DRPPA.RFAFNRYQFWRP...ASYYKLFRYPFDP......YDRLWQ.......PY...GD.......DPSWTNITVAAA.
Q5JNB7_ORYSJ/47-383ARINFGAPTADP...............VRYPDDP......YDRVWESDM.ARRP.....NF....LVDAAPGTIRVATD.
Q5VQN4_ORYSJ/8-346SRIRF.GSVDEY..............ITRFPTDQ......YDRFWE.......GWVFTMH.......TFPWVNKSSNGK.
Q5ZCA6_ORYSJ/34-370NRLNF.GPTDNS..............LVRYPDDP......HDRFWG.......NWD.SYT.......SSLWKEISTASR.
Q5ZDH7_ORYSJ/38-375GRLTC.GNNL.F..............GPGFTNDSD....AFSRVWQS....DIDF...RN.......NDLNYDAITAGGR
Q65X96_ORYSJ/43-376GRLNF.GPTDYTD.............VIRYPDDP......HDRIWF.......PW...VD.......STKWSQISSTKK.
Q67TV6_ORYSJ/37-371SRVNF.GPTDTF...............IRYPDDP......RDRGWR.......PW...ID.......TMRYVEVSTTKT.
Q6EQM5_ORYSJ/33-373KRSDM.GADTTT..............LTRYPADE......HDRIWK.......GT...G........NPGSTDISTQEK.
Q6ERZ1_ORYSJ/29-346SRKNV.GSDIST...............LSYPYDR......YDRHWW......GQI...AP.......DPTCKNLSTAST.
Q94HA8_ORYSJ/46-404YRLNM.GGPL.................VTAFNDT......LGRIWLP....DAPF..LKLQA...AANAAWVPPRT.IK.
Q9M0D8_ARATH/30-359RRWDI.GYLNGT...............GRYQDDR......FDRIWS.......PY...SS.......NISWNSIITSGY.
Q9SZV2_ARATH/30-354RRWDF.GTATNL..............QIRYKDDF......YDRIWM.......PY...K........SPYQKTLNTSLT.

PF11721

Y1972_ARATH/435-593----------------------------------------KTARR.----------------------------------
Y3148_ARATH/403-590----------------------------------------TQARL.----------------------------------
RKF1_ARATH/416-604----------------------------------------KSARI.----------------------------------
Y1534_ARATH/364-548----------------------------------------TQARI.----------------------------------
Y5343_ARATH/408-592----------------------------------------KTARL.----------------------------------
Y5614_ARATH/424-612----------------------------------------QSARL.----------------------------------
Q29NS0_DROPS/68-230----------------------------------------RTERY.----------------------------------
A0C5E5_PARTE/21-187----------------------------------------FTERH.----------------------------------
A0D555_PARTE/21-188----------------------------------------LTERH.----------------------------------
Q232Z6_TETTS/33-200----------------------------------------MTERH.----------------------------------
Q22CM9_TETTS/26-197----------------------------------------KTERH.----------------------------------
A6H797_BOVIN/39-199----------------------------------------QTERY.----------------------------------
A7RLY6_NEMVE/27-185----------------------------------------QTERY.----------------------------------
Q17BA6_AEDAE/29-192----------------------------------------QTERY.----------------------------------
A8X3B8_CAEBR/29-187----------------------------------------QTERW.----------------------------------
Q95QG1_CAEEL/43-202----------------------------------------QTERW.----------------------------------
Q231X5_TETTS/32-203----------------------------------------RTYVY.----------------------------------
A0CEJ8_PARTE/2-159----------------------------------------MTQRL.----------------------------------
A0DJ13_PARTE/493-661----------------------------------------ITQRQ.----------------------------------
A0DRE8_PARTE/13-175----------------------------------------LTQRQ.----------------------------------
Q7XTR9_ORYSJ/429-616----------------------------------------QTARM.----------------------------------
Q6F2P3_ORYSJ/440-627----------------------------------------ETARM.----------------------------------
Q6ZKW6_ORYSJ/422-609----------------------------------------QTARM.----------------------------------
A4AT33_MARSH/904-1052----------------------------------------KTERS.----------------------------------
A4AUK4_MARSH/903-1051----------------------------------------QSEHT.----------------------------------
A4CK29_ROBBH/1247-1419----------------------------------------QTERYN----------------------------------
A4CK28_ROBBH/332-497----------------------------------------QKEIYG----------------------------------
Q21PD3_SACD2/360-498----------------------------------------QTERY.----------------------------------
B9M0U3_GEODF/207-345----------------------------------------QSERW.----------------------------------
B9M0U3_GEODF/432-570----------------------------------------QSERW.----------------------------------
Q01NB6_SOLUE/205-356----------------------------------------RHLRT.----------------------------------
Q021C7_SOLUE/211-363----------------------------------------QGRRE.----------------------------------
Q026G9_SOLUE/209-373----------------------------------------QSQRQ.----------------------------------
Q01RD0_SOLUE/183-344----------------------------------------RSFRF.----------------------------------
Q7UIV5_RHOBA/6-153----------------------------------------NSEHW.----------------------------------
A5FCJ0_FLAJ1/725-892----------------------------------------QSFRY.----------------------------------
A6L3S6_BACV8/1081-1251----------------------------------------QTFRF.----------------------------------
A4CKE5_ROBBH/1275-1442----------------------------------------ATERYD----------------------------------

PF12819

Y5573_ARATH/35-359.VN..SSN..GYDPPKFVMASASTPISKN.AP...FNFTW......SL.IPSTAK............FYSYMHFADIQTL
Y4291_ARATH/31-359.ID..IFQ.SGYRPPDEVIKTAASPKSDD.EP...LELSW......TS.SDPDTR............FYAYLYFAELENL
MEE39_ARATH/34-356.VS..NKN..HYDPPQVALKMAATPTNLD.AA...LTMVW......RL.ENPDDQ............IYLYMHFSEIQ..
Q0DGL3_ORYSJ/34-370.VQ..NTIAPVFDVPSVVMQTAITTRNSS.IP...IQFSWDT..KPNH.VYPDPG............SIFTLYVTELELL
Y5169_ARATH/27-358.VN..NSN..NYEPPKAALTSAATPGDNG.TR...LTIIW......TL.DNPDEQ............IHLYVHFAELEPV
Y5189_ARATH/28-350.VD..TSN..FYNVPQTVAKTAAVPLNAT.QP...LKINW......SL.DDITSQ............SYIYMHFAEIENL
Y1756_ARATH/33-356.VN..TSDDNGYDIPEDVVVTAATPANVS.SP...LTISW......NL.ETPDDL............VYAYLHVAEIQSL
Y4245_ARATH/33-374.VN.TTVN..AFDLPQAIISKASIPQVAS.DT...WSTTW......SI.QNPDDD............VHVYLHFAEIQAL
Y1518_ARATH/32-355.ID..TSN..SYDMPQSVMKTAAVPKNAS.EP...WLLWW......TL.DENTAQ............SYVYMHFAEVQNL
Q0JIC9_ORYSJ/48-385.VK.RLPGDEKFMVPNTILQKASTINITF.SW...LNITVRG..ANNLLGLGDLE............LLPVFHFAEIASN
Q0J2D5_ORYSJ/28-372.IK..TGS..TFAVPSSVLQTAVTPSGNS.TV...LNVIS......WQ.DTTAKE............YVVYLHFADFQSS
Y1677_ARATH/29-363.IN..TLT..REYPPMKVMQTAVVGTQGL......ISYRL......NL.EDFPAN............ARAYAYFAEIEEL
Y1755_ARATH/32-354.VI.DSID..GYDPPQDVLRTGAMPANAS.DP...MTITW......NL.KTATDQ............VYGYIYIAEIME.
PAM74_ARATH/32-354.VT..NDN..NYEPPKKALAAAATPSNAS.AP...LTISW......PP.DNPGDQ............YYLYSHFSEIQD.
Q9C8I6_ARATH/32-353.....VNINNDYQPPEIAMVTASVPTDPD.AA...MNISL......VG.VERTVQ............FYVFMHFAEIQE.
Q6ERN3_ORYSJ/27-359.TT..IQASTEFAVPSPVLQKAIVPSGNSMKL...VFFSD......QV.DVLLHN............HFVILHFADFQNN
B9RQ86_RICCO/32-352.IT..SGI.DYFQLPSTVMNSATVPLNAS.EQ...IILNI......DT.QDNTFQ............AYVYIHFAEIVR.
Q65X94_ORYSJ/35-368.VQ..HTDEDVFDAPTKVMQTAIAPLNAS.SN...IEFAWVP..YTQP.KDPAPG............YITVMHFSELQLR
RLK6_ARATH/36-358.IN..SSN..GYAPPEVVMASASTPISTF.GT...WNFSW......LL.PSSTTQ............FYVYMHFAEIQT.
Q5VQN2_ORYSJ/40-388QDVTKLPGNDDFQVPMPILQKASTIS.........SNFSEFNVSVIFP.DNMKNIDNINNIDYRSLELLPIFHFADIGGN
B9RQ88_RICCO/35-358.ID..AQFHNDFQPPSIVMSTANVPTNAS.ED...MQFFI......DN.EDTSLQ............FYFYMHFAEIVK.
Q5QL24_ORYSJ/29-348.DI..QEESSLFGVPSAILQKAVTVVGNGTM....LNVTW......ED.RLFI.E............FMVFLHFADFQDS
B9RQ82_RICCO/34-356.VD..AQNHIDFQPPSVVMRTANMPTNAS.EN...MEFYI......DI.DDTTSL............FYVYMHFAEIVE.
Y2451_ARATH/32-355.VS..GFSD.GYNPPQGVIQTASIPTNGS.EP...LTFTW......NL.ESSDDE............TYAYLFFAEIQQ.
Y5188_ARATH/32-354.VD..T.S.NPYDVPQAVAKTACVPSNAS.QP...LIFDW......TL.DNITSQ............SYVYMHFAEIQT.
B9RQ90_RICCO/31-355.VD..LDDHNDFQPPSIVMRSAVISINTS.SP...LEFYI.......N.NDTTYK............LYAYMHFAEIVK.
RLK7_ARATH/31-354.VI..NTN..IYQPPEDALKNAATPTDAS.AP...LTFKW......NS.EKLDVQ............YYFYAHYAEIQD.
B9RQ85_RICCO/33-355.ID..LGKSNSYQLPSTVMRSAGTPRNSS.SP...MEVTI......AA.EDPTLK............FYAYFHFAEIVK.
Q6EQQ3_ORYSJ/24-352.SA..IELNTTFMVPLRVLQTAFVPVGNSNEL...VLRSK......RR.DRLPGD............HLVILHFADFQDN
Q67UW6_ORYSJ/28-358.VQ..NYLTDVYDVPSAVMQSAATV..NS.SR...INFTWDP..SDPS.VNISSK............YFFVLYFSELQSV
B9RQB2_RICCO/34-359.VD..SLKTTDFNLPSKVMQTAVEPMNAN.ES...LNFEF......DI.GTPNMN............FYIYMHFAEVESI
Y2923_ARATH/33-360.ID..PTSSNGFLPPSVVMSTAVAPMNSSIEQ...IMVYW......EP.RDPNWK............FYIYIHFAEVEK.
Y5181_ARATH/29-348.IN..VSN..DYDLPQRVMKTAVTPIKASTTT...MEFPW......NL.EPPTSQ............FYLFLHFAELQS.
Y3463_ARATH/35-357.PN..NSN..GYLVPKNVLMTAAIPANDS.AP...FRFTE......EL.DSPTDE............LYVYLHFSEVQS.
Q6EQK1_ORYSJ/34-368.IS..RYTDDVYEVPVAVLKTAATTSSTS.TA...LNFLWAAPTGW....DATPG............YLIGLHFTDFQQG
B9RQ87_RICCO/35-359.VQ...HSRNKFQMPSIVMETAVTVNDSYVG....LILSW......VR.DNPNSQ............FHIYFHLAEIQEL
Q9SN97_ARATH/32-354.VN..SSS..GFLPPLKALMTAASPANAS.AP...LAIPG......VL.DFPSDK............LYLFLHFSEIQV.
Y5596_ARATH/32-354.VG..NSN..DYKPPKVALTTAAIPTNAS.AP...LTNEW......SS.VNPDEQ............YYVYAHFSEIQE.
B9RQ89_RICCO/61-383.ID..ALAQNDYRPPSIVMRTAGIPANDN.EP...MTVSI......DF.EDTTFR............FLVYMHFAEILK.
Y2921_ARATH/34-359.ID..SNNNEGFQPARFVMNTATSPEDLS.QD...IIFSW......EP.KDPTWK............YFVYMHFAEVVE.
Y2899_ARATH/28-349.IN..NSN..AYEIPKNILQTAAIPRNAS.AP...LIITW......DP.LPINAE............VYLYMHFAEIQT.
B9H626_POPTR/24-339.AILIDVANAPDNPPPEVLQNAITTSNTS.AS...ITLNP......GF.PDQDVS............VYMNLYFSEVTEL
B9H6K7_POPTR/19-375.KPNSQGGVSKYIAPDLVYQTAKEMNINNSRSSNNFNITW......SFNVSKNAM............HFVRVHFCDFLSA
B9HLB9_POPTR/28-361.VD....TRTREYPPVKVMQTAVVGTEGI......LSYRL......NL.EDFPAN............ARAYAYFAEIEDL
B9HS06_POPTR/28-348.NN.ISSSEFWNFPPQRAFASAITTSRGK..T...IKIQW......PPVSLPSTK............YYIALYFQDNRTP
D7U071_VITVI/66-391.ID..SHAETEYKLPSKVMTTAIRPMNSS.AS...LDFDF......DI.GDSTLE............FYVYMHFAELEGL
F4HWL3_ARATH/31-365.IK..KASVSPNFYPEGLYQSALVSTDDQ......PDLTY......SLDVEPNRN............YSVWLHFAEIDNT
F4I065_ARATH/33-357.VN..T..SNGFDLPQGAMASAATRVNDN.GT...WEFPW......SL.EDSTTR............FHIYLHFAELQTL
F4IB60_ARATH/32-356SLT..SNSTGNFRLPQVVMRTGIVPDNPR.GF...VDFGW......IP.DDPSLE............FFFYLYFTELQQP
F4IB63_ARATH/29-347.VN...V.TDNYDLSQDVMATGATPLNDS.ET...LNITW......NV.EPPTTK............VYSYMHFAELETL
F4IB71_ARATH/32-354.VQ....TNNLYDVPQFVMKTAAIPKDAS.AP...WSLVW......TI.DNTTAL............SYVYMHFAEIQDL
F4IB76_ARATH/32-354.VD...TSSNSYNVPQNVANSAIIPAEAT.HP...LNIWW......DL.QNINAP............SYVYMHFAEIQNL
F4ICJ5_ARATH/32-364.IK..GVDQAPNYFPMKLYQTAVTVSGGG.......SLVY......ELEVDAKLD............YLLWFHFSEIDST
F4J801_ARATH/31-354.APSIDITGALNKPPEIVMTKAMSGD..G......FIMSG.....LNL.PSTLLP............VYLALYFSEPQSL
F4JB46_ARATH/25-347.RSRINPSNFWNIPPAEAFVEGFTASKG..KP...LELQW......PPFPLPATK............YYVALYFQDNRSP
F6H477_VITVI/48-422.FT..QQ..PEYTAPPDVYRTARTMGNNKTENM.GYNLTW......VLSVDSGFN............YLLRLHFCEFQPE
F6HY53_VITVI/28-350.SS..GLSENQFKLPAKVMETAVKPVNGT..S...LDFYL......DG.IDSSQE............FYVYLHVAEIETL
I1MCW6_SOYBN/32-358.AD..SLVQNKYQPPAVVMSTAVTPANVS.AP...LVISW......EP.DDPKES............FYVYMHFTEIQVL
I1PTQ3_ORYGL/76-415.GTVKSPQNDTYGAPSDLMRSASTAVNAS..R...MDLPWSS..DASMDVGIGPE............YIVVLYFAEVQAI
I1PXF6_ORYGL/34-366.VQ..NIDNDLFEAPTAVMQTAVTPINAS.NN...IDFFWNS..QPQP.NDPAPG............YIAIFHFSELENL
I1QAW3_ORYGL/40-375.VI.AETLLAPNFYPQSIYQSAIVGTDRQ......PSLSF......EMDVTPNRN............YSVWLHFAEIENG
K4B910_SOLLC/3-338.TK..STSKAPNFYPGSIYQTALLSTDNE......PELTY......TMDIDPNKK............YSVWLHFAEIDPS
M0S6H3_MUSAM/43-370.VE..NFVDDKFEAPSAVMQTAVIPVNST..K...LMISWE....PEL.GDVN.E............YYAVMYFSEFLTL
SIRK_ARATH/33-359.VD..QFLNNGYQPASTVMSTAETARNES.LY...LTLSF......RP.PDPNAK............FYVYMHFAEIEVL
Q0DGL2_ORYSJ/34-367.VQ..NIENDIFEAPSRVMQTAITPRNAS.GN...IEFAWDA..YTQP.KDPTPG............YIANFYFTEVQLL
Q0J2E4_ORYSJ/17-347.T..IIPPSVPFAVPSPILQKAVVPADNS.MK...LVFHS.....DQL.DAQLRD............HLVILHFADFQNN
Q0J2E5_ORYSJ/9-345.LI..IPPSPSYAVPSPVLETAVVPADNNKSV...LSIIQ......TN.DKEIHE............YLVLVHYADFQST
Q2QNF5_ORYSJ/41-399.VDVTNIS..RSDDPSPILRSAATPANATVRR...LDFPW......SSDDAATTT............YLLLLYFAELQRL
Q5JNB7_ORYSJ/47-383.NP..VFVASGERPPQKVMQTAVVGTLGA......LTYRL......DLNGFPGS.............GWACSYLAEIEDD
Q5VQN4_ORYSJ/8-346.VA.ELPNIDTFGLPPAILGSASTINGNF.SW...LNISVS...ASNS.LATDLE............LLPVFHFVELGN.
Q5ZCA6_ORYSJ/34-370.VD..NLDGDIFDAPTAVMQTAVTPRNAS.GN...IYFFWEP..WPQP.NDPTPP............YTVIFHFSELEIL
Q5ZDH7_ORYSJ/38-375KI..FGSNQPPNYFPTKLYTSAITTGGDA..S...NEIEY......LMPVDTRMS............YMVWLHFAEIDAG
Q65X96_ORYSJ/43-376.VQ..DLDNDMYETPTAVMQTAITPRNAS.RN...IEFSWD...PVPLPNDPTPG............YIAIFHFSELQLL
Q67TV6_ORYSJ/37-371.VQ..NVEKDLFEAPSAVMQTAITPRNAS.DS...IELYWTADPSAAA.GDPPPG............YIAIMHFSELQL.
Q6EQM5_ORYSJ/33-373.IQ....SENSFEVPLPVLQTAITTPGGNDTT...LTVAW......QD.TRSSSE............YMVFLHFADFQKI
Q6ERZ1_ORYSJ/29-346.IK..N..NSMFSVPSPVMQTAVEAANKS..S...LRIKW......EN.SAPIE.............YKVFMHFADFQNS
Q94HA8_ORYSJ/46-404.YP.DDKTNTPLIAPANIYSTAQQMASTNTSDA.RFNITW......EMVTEPGFS............YFVRLHFCDIVS.
Q9M0D8_ARATH/30-359.ID...VFQNGYCPPDEVIKTAAAPENVD.DP...LELFW......TS.DDPNVR............FYAYLYFAELETL
Q9SZV2_ARATH/30-354.ID..ETNHNGFRPASIVMRSAIAPGNES.NP...LKFNW......AP.DDPRSK............FYIYMHFAEVREL

PF11721

Y1972_ARATH/435-593-...SAL.SLVYYAF.------------------------------...CLENGN------------YNVKLHFMEIQFS
Y3148_ARATH/403-590-...SAI.SLTYQAL.------------------------------...CLGKGN------------YTVNLHFAEIMFN
RKF1_ARATH/416-604-...APV.SLTYFHA.------------------------------...CLENGN------------YTINLDFAEIRFT
Y1534_ARATH/364-548-...SAI.SLTYYAL.------------------------------...CLENGN------------YNVNLHFAEIMFN
Y5343_ARATH/408-592-...SPQ.SLKYYGL.------------------------------...CLRRGS------------YKLQLHFAEIMFS
Y5614_ARATH/424-612-...SAS.SLRYYGL.------------------------------...GLENGG------------YTVTLQFAEIQIL
Q29NS0_DROPS/68-230-...HTT.TFGYDFP.------------------------------...TDGDGD------------YALIMKFCEVYFD
A0C5E5_PARTE/21-187-...GNS..FDYNLP.------------------------------...INKNGQ------------YTIILQFVELYFE
A0D555_PARTE/21-188-...AYK.SFSYQIP.------------------------------...LQKEGT------------YTLILKFAEMYFD
Q232Z6_TETTS/33-200-...GYN.SFGYQLA.------------------------------...LDIEQT------------YTLILKFCEMYFD
Q22CM9_TETTS/26-197-...SDE.NFAYSLP.------------------------------...VKEFGT------------YTLILKFCELYFT
A6H797_BOVIN/39-199-...NEE.TFGYEVP.------------------------------...IKEEGD------------YVLVLKFAEVYFA
A7RLY6_NEMVE/27-185-...HLS.NFGYTVP.------------------------------...IKENGE------------YVLVLKFCEVYFQ
Q17BA6_AEDAE/29-192-...HHD.SFGYELP.------------------------------...IAGDGE------------YVLILKFCEVYFN
A8X3B8_CAEBR/29-187-...SKE.SFDYEVP.------------------------------....VGDGE------------YVIILKFSEVYFQ
Q95QG1_CAEEL/43-202-...SKE.SFSYDVP.------------------------------...ISEDGE------------YVIILKFSEVYFQ
Q231X5_TETTS/32-203-...DQK.AFSYLLP.------------------------------...LKRSGE------------YSLIMIFAEINDI
A0CEJ8_PARTE/2-159-...GLN..FFYKLPL------------------------------NKDSPETQN------------YILTLYFAELQYQ
A0DJ13_PARTE/493-661-...GQS..FAYTIPI------------------------------GNEVPENQT------------YVLVLKFAELHYE
A0DRE8_PARTE/13-175-...GQS..FAYTIPI------------------------------GNDIPENQT------------YVLVLKFAELFYE
Q7XTR9_ORYSJ/429-616-...SPS.SLRYYGI.------------------------------...GLENGN------------YTVTLQFAEVDFP
Q6F2P3_ORYSJ/440-627-...SAS.SLRYYGL.------------------------------...GLENGN------------YTVLLQFAEFAFP
Q6ZKW6_ORYSJ/422-609-...SPS.SLRYYGI.------------------------------...GLENGN------------YTVSLEFAEFVYP
A4AT33_MARSH/904-1052-...SPSKTFQYSIP.------------------------------....ITDGD------------YTVVLHFAEIYWG
A4AUK4_MARSH/903-1051-...SSSLTFDYQIP.------------------------------....VQNGD------------YTVILHFAEIYWG
A4CK29_ROBBH/1247-1419-.TLAVPDNMQWDFP.------------------------------....VPNGD------------YTVNLLFAEIWTG
A4CK28_ROBBH/332-497-GAGGTNPSYIYDIP.------------------------------....VENGN------------YQVELYFAEVFHP
Q21PD3_SACD2/360-498-...G...SYSYAVP.------------------------------....VTNAT------------YSLKLHFAEIYHT
B9M0U3_GEODF/207-345-...G...NFSYSIP.------------------------------....VANGN------------YSLTLKFAEIYFS
B9M0U3_GEODF/432-570-...G...NFSYTIP.------------------------------....AANGN------------YLVTLKFAEIYFS
Q01NB6_SOLUE/205-356-...G...DFRYAIP.------------------------------....LKPGT------------YELHLHFAETGLA
Q021C7_SOLUE/211-363-...G...SFAYDIP.------------------------------....LPAGV------------YELRLHFAETLYG
Q026G9_SOLUE/209-373-........IRYDIP.------------------------------....VRSGV------------YELRLYFADPLRQ
Q01RD0_SOLUE/183-344-...G...NFSYRIP.------------------------------....LPEGK------------YDLRLYFSEVIFL
Q7UIV5_RHOBA/6-153-...GMR.SFAQDVA.------------------------------......DGD------------YLVNLYFAETFPR
A5FCJ0_FLAJ1/725-892-...GVD.KLRYEFP.------------------------------....APDGE------------YLVELYFTEPWYG
A6L3S6_BACV8/1081-1251-...GRH.KLNFRFP.------------------------------....VPDGE------------YRVELYFTEPWHG
A4CKE5_ROBBH/1275-1442-..APTAPEMEYQVP.------------------------------....LENGD------------YILKVYVGNFFNG

PF12819

Y5573_ARATH/35-359Q------ANET........REFDMMLNGNLAL..E..RYR--P.KTFATGTIYFIKPQICE..GGQ.....CII------
Y4291_ARATH/31-359K------RNES........REIKIFWNGSPVS..G..AFN--P.SPEYSMTVSNSRAFTGK..........DHW------
MEE39_ARATH/34-356V------LKAN......DTREFDIILNGETIN..T.RGVT--P.KYLEIMTW..LTTNPRQCNGGI.....CRM------
Q0DGL3_ORYSJ/34-370A------GNAV........RQFNVTINGVIWT..K.APYK--P.VYLSTDAMYNGDRPYRGI..TR.....YNF------
Y5169_ARATH/27-358G------ENTDEALRTLFTRTFYFVVNGKISY.DE..SIT--P.LDLAVSTV...ETVVNKCDGGN.....CSL------
Y5189_ARATH/28-350E------ANET........REFNITYNGGENW.FS..YFR--P.PKFRITTV..YNPAAVSSLDGN.....FNF------
Y1756_ARATH/33-356.------REND.......TREFNISAGQDVNY..G..PVS--P.DEFLVGTL..FNTSPVKCEGGT.....CHL------
Y4245_ARATH/33-374K------PSDT........REFSILWNKNTII..R.DYYS--P.LEFMADTVPI..RTSSKCGDDG.....FCS------
Y1518_ARATH/32-355.------TANE.......TREFNITYNGGLRW.FS..YLR--P.PNLSISTI..FNPRAVSSSNGI.....FNF------
Q0JIC9_ORYSJ/48-385T------...........TRLFDIYSDSEELF..A..NFS--P.SPFQVDSMYQNGRFLPGVSSTF........------
Q0J2D5_ORYSJ/28-372K------...........LREFDAYPDANQVV..Y..NYT--P.HYLLSSSV..YTPLFRAI.AGE.....YNI------
Y1677_ARATH/29-363G------ANET........RKFKLVQPYFPDY..SNAVVN--I.AENANGSYTLYEPSYMNVTLDF.....VLT------
Y1755_ARATH/32-354V------QANE.......TREFEVVVNNKVHF..D..PFR--P.TRFEAQVM..FNNVPLTCEGGF.....CRL------
PAM74_ARATH/32-354.------LQTN......DTREFDILWDGA..VVEE..GFI--P.PKLGVTTI..HNLSPVTCKGEN.....CIY------
Q9C8I6_ARATH/32-353.------LKSN......DTREFNIMYN..NKHIYG..PFR--P.LNFTTSSV..FTPTEVVADANG.....QYI------
Q6ERN3_ORYSJ/27-359K------...........SREFTVSIDN......G.VQSS--P.YSTPYLKGLSVTGGWSSNSEGK.....YNF------
B9RQ86_RICCO/32-352.------LEPN......QSRRFNISLN..GKILYG..PVT--P.KHLEATTV..YSQSAIPG..GK.....FLF------
Q65X94_ORYSJ/35-368.------SSNA.......TRQFYINLNGNMVFSQ...GYT--P.AYLYADAIFNSN.PFLRYP..Q.....YNI------
RLK6_ARATH/36-358.------LRSL......DTREFKVTLNGK..LAYE..RYS--P.KTLATETI..FYSTPQQCEDGT.....CLL------
Q5VQN2_ORYSJ/40-388N------QNR........TFDIYN..DGNLMF.P...NYI--P.PLFRAESTYQSGKFLRKRGLNF........------
B9RQ88_RICCO/35-358.------LEAN......QSRQFNISLN..GTIFFG..PVI--P.DYLYTSSV..YNGLPINA..GS.....NVF------
Q5QL24_ORYSJ/29-348K------...........IRQFNVYFNN......D.SPLL--Y.TPLYLAADYVYSVVWYSSTNGK.....FNI------
B9RQ82_RICCO/34-356.------LQAN......QSRLFNISLN..GTIWYG..PVI--P.NHLSSGTV..YSQFPIIG..GN.....NMF------
Y2451_ARATH/32-355.------LKVN......ETREFKILANGV..DYID...YT--P.WKFEARTL..SNPAPLKCEGGV.....CRV------
Y5188_ARATH/32-354.------LKDN......DIREFNITYN.GGQNVYS..YLR--P.EKFEISTL..FDSKPLSSPDGS.....FSL------
B9RQ90_RICCO/31-355.------LEAN......QSRQFNISLN..GKIWYG..PVT--P.TYLYTTTV..YSTSAITD..GM.....YEF------
RLK7_ARATH/31-354.------LQAN......DTREFNILLNGQNLSVTG..PEV--P.DKLSIKTF..QSSSPISCNGWA.....CNF------
B9RQ85_RICCO/33-355.------LDAN......QSREFNITLN..GDIWYG..PIT--L.HYLYSTTV..SSGYAISG..GT.....YDF------
Q6EQQ3_ORYSJ/24-352K------...........TREFTVSIDS......G.MQSG--P.ISPPYLKGWSII.NWSSDSE.D.....LSI------
Q67UW6_ORYSJ/28-358.------PSNG.......LRQFDIIVNNNTWNTQ...PYT--P.PFLFADSLSGTV...QGLA..S.....YSV------
B9RQB2_RICCO/34-359.------QRNQ.......YRGFNIALNGKLFNEG....VV--L.KYLQSMTISTMQ.PMRGA...K.....ISI------
Y2923_ARATH/33-360.------LPSN......ETREFSVFLNKEQIDTTS..VFR--P.SYLYTDTL..YVQNPVSG..PF.....LEF------
Y5181_ARATH/29-348.------LQAN......ETREFNVVLNGN..VTFK..SYS--P.KFLEMQTV..YSTAPKQCDGGK.....CLL------
Y3463_ARATH/35-357.------LQAN......ESREFDILWSGE..VAYE..AFI--P.EYLNITTI..QTNTPVTCPGGK.....CNL------
Q6EQK1_ORYSJ/34-368Q------...........LREFDIYYNNDLWNYDN.KKTK--P.PYLLANYI..NGTTPYTSDNYL.....YNI------
B9RQ87_RICCO/35-359K------TTQ........YRGLDIYVNDELWY.G...PFS--P.TYLQTTTIYNTE....AMNATG.....YDV------
Q9SN97_ARATH/32-354.------LKAN......ETREFEIFWNKK..LVYN..AYS--P.VYLQTKTI..RNPSPVTCERGE.....CIL------
Y5596_ARATH/32-354.------LQAN......ETREFNMLLNGK..LFFG..PVV--P.PKLAISTI..LSVSPNTCEGGE.....CNL------
B9RQ89_RICCO/61-383.------LEAN......ESRQFNISLN..GEHWFG..PLR--P.DYLYTTTV..FSPTVLSG..GQ.....YEF------
Y2921_ARATH/34-359.------LPSN......ETREFKVLLNEKEINMSS...FS--P.RYLYTDTL..FVQNPVSG..PK.....LEF------
Y2899_ARATH/28-349.------LEAN......ETRQFDVILRGN..FNHS..GFS--P.TKLKVFTL..YTEEPMKCGSEG.....CYL------
B9H626_POPTR/24-339D------ATQ........KRSFNAYIDNIKSS..E..PII--P.PYEAAKEVSA......NFTASA.....NTS------
B9H6K7_POPTR/19-375S------PGA........LLRFNLYIYSNFSL.....PIS--PYETTGQLAAPFHVDYVVDSDDSG.....IMR------
B9HLB9_POPTR/28-361G------ANE........TRKFKLQQPFLSDY..SNAVVN--I.AENANGSYTLYEPSYMNVSLDF.....VLS------
B9HS06_POPTR/28-348S------PYSW........RVFSVSINGQ........NFY--K.DLNVTANG..VTVYGSEWPLSG.....QTE------
D7U071_VITVI/66-391Q------.ENQ.......TRNFSITLNGNPWG..E.ANIV--P.KYLHSRTVNN..KQPVR...GS.....KLK------
F4HWL3_ARATH/31-365I------TAEG.......KRVFDVVINGDTFF..EDVDII--K..MSGGRYAALVLNATVTVS.GR.....TLT------
F4I065_ARATH/33-357L------ANE........TREFNVLLNGKVYY..G..PYS--P.KMLSIDTMSPQPDSTLTCKGGS.....CLL------
F4IB60_ARATH/32-356N------SG.TV.....ETREFVILLNGKSFG..E..PLS--L.NYFRTLAL..FTSNPLKAE..S......FQ------
F4IB63_ARATH/29-347R------.AND.......TREFNVMLNGNDLF..G..PYS--P.IPLKTETE..TNLKPEECEDGA.....CIL------
F4IB71_ARATH/32-354K------AND........LREFDITYNGGKLW.FS..QFR--P.NKLSILTM..FSQVPLTSSNGE.....YNF------
F4IB76_ARATH/32-354K------.AND.......IREFNITYNGGQVW..E.SSIR--P.HNLSITTI..SSPTALNSSDGF.....FNF------
F4ICJ5_ARATH/32-364V------KKAG.......QRVFDLVVNDNNV...S..RVD--V.FHEVGGFAAYSLNYTVKNLSST.....IVT------
F4J801_ARATH/31-354G------RTQK........RSFTVFLDGM........QVG--S.HPIVPVFGKATQVVLRDIMASS.....ESQ------
F4JB46_ARATH/25-347G------PMSW........RAFDVSVNGL........SFL--R.KLNVSTNGVM..VYSGQWPLSG.....QTQ------
F6H477_VITVI/48-422I------TERQ.......DREFTIFIANQTAE..NHADVI--T..WSGGNGVPIYRDYAVMMPSQGSNKKQNLY------
F6HY53_VITVI/28-350V------QGQ........IREFTVSVNKKAIS..S..AIQ--P.RYMIADTYFT.QS....SLSGS.....ELN------
I1MCW6_SOYBN/32-358A------KNQ........TREFNITLNGKLWY..E..NES--P.RYHSVNTI..YSTS..GI.SGK.....LIN------
I1PTQ3_ORYGL/76-415S------DNL........LRQFLVSVDNTPLA..A..AFS--P.RHMLADVF..SG.TVL...GSD.....QHS------
I1PXF6_ORYGL/34-366P------.NNA.......SRQFYININGILFD..D..GFT--P.SFLYAEAPYSSKPFVRH...PQ......YN------
I1QAW3_ORYGL/40-375I------TAEE.......ERVFDVLINGDTAF..KDIDII--R..MAGERFTALVLNKTIVVT.GT.....TLT------
K4B910_SOLLC/3-338V------TSVG.......QRVMDISINGDTVF..PAVDIV--K..MAGGVNSALVLNTTILVS.GR.....TLT------
M0S6H3_MUSAM/43-370.------TGNM.......SRQFYVYLNGQLWY..A.KPFT--P.DYLFSDAIFGTN..P..AEGYQ.....QYN------
SIRK_ARATH/33-359K------.SNQ.......TREFSIWLNEDVIS..P..SFK--L.RYLLTDTF.VTPDPVSG....I.....TIN------
Q0DGL2_ORYSJ/34-367.------PSNA.......LRQFYINLNGRLVY..N.ESYT--P.LYLYADLIYEKKPFLR.YP........EYN------
Q0J2E4_ORYSJ/17-347K------...........SREFTVSIDSGVQS..G..PFS--P.PYLKVLSI..TTDW.SSDTEGK.....YNF------
Q0J2E5_ORYSJ/9-345L------...........QRQFQAYSNGDPIQGTG.GPYV--A.DYTGQTVG..TIDWISAETSGK......YN------
Q2QNF5_ORYSJ/41-399P------AGA........ARRFDVLVDGDASAGGGRRGYT--P.RYLAAEVV...RSTVRAARPGQ.....RHV------
Q5JNB7_ORYSJ/47-383A------AAT........ARRFKLYIPGLAEV..SKPTVD--I.GENAPGKYRVYQPGYDNISLPF.....VLP------
Q5VQN4_ORYSJ/8-346.------.NGS.......KRIFDIYNVDEPQALFS..NFS--P.PSFLS..SMFHNWFLRK...GR.....RAY------
Q5ZCA6_ORYSJ/34-370T------.NNA.......SRQFYINLNGEPLI..D.TAYE--P.TYLTARYL..YGLEPLERT..S.....RYN------
Q5ZDH7_ORYSJ/38-375I------GSAG.......QRVFDVMLAGKNVT.....RID--I.FKQVGGFTAFKWTYIVENLTSS.....TMS------
Q65X96_ORYSJ/43-376.------PGNA.......VREFYINLNGKPWS..L.TAFK--P.EYLYNDATFNRNPFL.RYP........QYN------
Q67TV6_ORYSJ/37-371V------QGNA.......VRAFNISLNDQ.WL..D.IGMT--P.DYLYADAS..FNTVPFR..GSS.....RYN------
Q6EQM5_ORYSJ/33-373Q------...........PRQFNVTLNDIPIG.SNGRSLM--F.SPSPLDSSSVYSSDGYRADDGN.....YNL------
Q6ERZ1_ORYSJ/29-346Q------...........LRQFNVSFNELGSY.....QVS--P.PYL..DNGVLSNSQWYKAPGGV.....YTI------
Q94HA8_ORYSJ/46-404.------KALN.......SLYFNVYINGMMGV.LN.LDLS--S..LTVGLAVPYYRDFIIDSSSIIN...STLI------
Q9M0D8_ARATH/30-359E------KNE........TRKIKILWNGSPVS..E.TSFE--P.SSKYSTTF..SN..PRAFT.GK.....DHW------
Q9SZV2_ARATH/30-354Q------RNE........TREFDIYINDVILA..E..NFR--P.FYLFTDTRSTVDPVGR.....K.....MNE------

PF11721

Y1972_ARATH/435-593D..KEVYSRLG-------RRIFDVYVQG.KLFLRDFNINK..E-ANGNM.KPVIKEI.NA.TVTNH-----MLE......
Y3148_ARATH/403-590E..KNMYSNLG-------RRYFDIYVQG.KREVKDFNIVD..E-AKGVG.KAVVKKF.PV.MVTNG-----KLE......
RKF1_ARATH/416-604N..DENYNRLG-------RRLFDIYIQE.KLVAKDFNIMD..E-AKGAQ.TPIIKPL.TA.YVTNH-----FLT......
Y1534_ARATH/364-548G..NNNYQSLG-------RRFFDIYIQR.KLEVKDFNIAK..E-AKDVG.NVVIKTF.PV.EIKDG-----KLE......
Y5343_ARATH/408-592N..DQTFNSLG-------RRIFDIYVQG.NLLERDFNIAE..R-AGGVG.KPFIRQIDGV.QVNGS-----TLE......
Y5614_ARATH/424-612GSTSNTWRGLG-------RRRFDIYVQG.RLVEKDFDVRR..T-AGDSTVRAVQREY.KA.NVSQN-----HLE......
Q29NS0_DROPS/68-230A........PG-------RKVFDVLLNRKHTVIRQLDIYE..Q-VGRGS...AHDEIVYF.KINNG-----RLHY.....
A0C5E5_PARTE/21-187N........EG-------ERQFDIYIGT.KRVIQNLSIID..N-KHQKG..SAKEVFIYI.DIKED-----KVFHQ...G
A0D555_PARTE/21-188T........KG-------KRVFHIKFGQ.QRVVEKLDVVA..K-V.GKF..ASNDEYIEF.EYVAG-----QVFHN...N
Q232Z6_TETTS/33-200K........PG-------RRVFHVKLGD.TRVITNLDIFA..K-A.GRF..VAHDEYVEF.KYQNG-----KIYYK...N
Q22CM9_TETTS/26-197E........PN-------KRVFSILFGD.SLVVPEVDIVK..E-V.GPF..AAYDLYIEF.EYKSD-----QLFYHNGKA
A6H797_BOVIN/39-199Q........SQ-------QKVFDVRLNG.HVVVKDLDIFD..R-V.GHS..TAHDEIIPM.SIRKG-----KLS......
A7RLY6_NEMVE/27-185A........PR-------LKVFDVSINS.HPVIQGLDIYE..K-V.GRG..IAHDEYVPF.TIRDN-----QLI......
Q17BA6_AEDAE/29-192A........PN-------MKVFDVLLNSRHMVITDLDIFS..L-V.GKG..TAHDEYVYF.TVSRG-----RLYF.....
A8X3B8_CAEBR/29-187R........VQ-------EKVFNVRINS.YTAVKNLDIYE..A-AGGRG..YAHDIYIPL.VIKDK-----KIS......
Q95QG1_CAEEL/43-202K........AG-------EKIFNIRINS.HLAVKNLDIFD..A-AGGRG..FAHDVYIPV.VIKGS-----SIS......
Q231X5_TETTS/32-203G........AK-------KRVFNIIVED.EVVIPNFDIYT..L-AGGKQ..LPHFEIIEF.SFQNR-----VLKNKSKDN
A0CEJ8_PARTE/2-159E........SN-------ARIFEVFFGN.KLVIENLDIYE..T-VGMQT...AYSIDLSFQKIGQQ-----ILYK....G
A0DJ13_PARTE/493-661E........SN-------SRVFNILLGK.KMILQNIDISQ..L-VGPFT...AHTEYIEI.IIDGG-----AVYYQ...G
A0DRE8_PARTE/13-175E........SN-------SRIFNVMLGK.MMILQNIDIFQ..L-VGTFT...AHTEYIEF.IIDEG-----TVYYQ...G
Q7XTR9_ORYSJ/429-616D..VQSWRSRG-------RRIFDIYIQG.ERKEQNFDIRK..A-AGGKSFTVVKKQY.VV.PVTKN-----FLE......
Q6F2P3_ORYSJ/440-627D..SQGWQSLG-------KRIFDIYVQG.ALKEKDFNIKK..T-AGGKSFTVVNRNY.TA.TVSKN-----FLE......
Q6ZKW6_ORYSJ/422-609N..SLTSNSIG-------RRVFDIYVQG.ELKEKNFNIRK..M-AGGKSLIAVNKRY.TA.TVSKN-----FLE......
A4AT33_MARSH/904-1052A.TGGGPGGSG-------QRVFDVTVEG.NLVLDNYDIFS..E-VGA...EVAQQKSFDV.TVNDG-----SLN......
A4AUK4_MARSH/903-1051A.TGGGSGATG-------IRVFDVSLEG.SLVLDDYDIYD..D-VGA...ETEVSKSFDI.TVLDG-----SVD......
A4CK29_ROBBH/1247-1419A......QDPG-------IRVFDVQIEG.NPVLTNFD.....Q-TAAYGWATAGVESFPV.TVSDG-----NLD......
A4CK28_ROBBH/332-497G........PN-------GRVFDVFLDG.NLILDEYDLVNPIK-DGLSSNQTAITRTYNV.NVTDG-----NIS......
Q21PD3_SACD2/360-498E........AG-------ARSFNLAVEG.QQEMASVDLYS..L-SGHDGAYTYEVNDFPV...DDG-----EVT......
B9M0U3_GEODF/207-345A........AG-------QRVFSVTVNG.QTVISNLDIFA..K-VGK...NVAYDVVIPI.NVTTG-----AVT......
B9M0U3_GEODF/432-570A........AG-------RRVFNVAING.QTVISNLDIYA..K-VGK...NVAYDVVIPV.TATNG-----AIT......
Q01NB6_SOLUE/205-356DFISAESSGEG-------QRVFHVSANG.KRLLDFFDVVA..D-ANGVN.TSDERVFRNIAPAEDG-----FLH......
Q021C7_SOLUE/211-363E.NNVAGGGES-------SRVFNVSING.KEALHEFDVTS..E-VGPST..ADVRAFKDISPEADG-----KLH......
Q026G9_SOLUE/209-373PEVDQKEDAQN-------RRHFQINLNG.HLLLRDFDAVA..D-GGSAA..VTVRVFKDVYPAPDG-----KLH......
Q01RD0_SOLUE/183-344P.TEFGDGVEN-------RRIFDVLMNG.QPLLSSFDIAA..D-AGGAN.TAIIRAFSNVSPV.NG-----YLT......
Q7UIV5_RHOBA/6-153I......TGPG-------QRVFSFRVNG..IEFDEFDIWQ..K-AGGSN.RVYVESV.PV.KINSG-----ILW......
A5FCJ0_FLAJ1/725-892T..GGGLDCKG-------WRLFDVAIND.NVVLKDFDIWA..E-AGHDN...ALKKTFKV.KSTNG-----KIV......
A6L3S6_BACV8/1081-1251TGGGVQTDCEG-------LRIFDVAVND.KVLLNDLDVWA..E-AGHDG...ACKKVVNA.VVKGG-----VLK......
A4CKE5_ROBBH/1275-1442T......DEVG-------ERVFDINVEG.VLVEDDFDPVA..A-FGHLSGGALSYPV....TVTDG-----VMN......

PF12819

Y5573_ARATH/35-359-.ELLKTSKS..TL.PPLCSALE----VFTV
Y4291_ARATH/31-359-ISVQKTAES..TR.PPILNAIE----IFSA
MEE39_ARATH/34-356-.QLTKTQKS..TL.PPLLNAFE----VYSV
Q0DGL3_ORYSJ/34-370-.SLNAAGSS..TL.PPILNAAE----AFSV
Y5169_ARATH/27-358-.QLVRSEASPGVR.VPLVNAME----AFTA
Y5189_ARATH/28-350-.TFSMTGNS..TH.PPLINGLE----IYQV
Y1756_ARATH/33-356-.QLIKTPKS..TL.PPLLNAIE----AFIT
Y4245_ARATH/33-374-LDLTRTKSS..TL.PPYCNAME----VFGL
Y1518_ARATH/32-355-.TFAMTGNS..TL.PPLLNALE----IYTV
Q0JIC9_ORYSJ/48-385-.TLRKQPTS...Q.PPLINAFE----VYSL
Q0J2D5_ORYSJ/28-372-.TLAATANS..AL.PPMLNAFE----IYFL
Y1677_ARATH/29-363-FSFGKTKDS..TQ.GPLLNAIE----ISKY
Y1755_ARATH/32-354-.QLIKTPKS..TL.PPLMNAFE----IFTG
PAM74_ARATH/32-354-.QLIKTSRS..TL.PSLLNALE----IYTV
Q9C8I6_ARATH/32-353-FSLQRTGNS..TL.PPLLNAME----IYSV
Q6ERN3_ORYSJ/27-359-.TIAATATS..AL.PPILNAYE----VYGR
B9RQ86_RICCO/32-352-.SFYGVGGS..TL.PPLLNALE----LYSV
Q65X94_ORYSJ/35-368-.SINATANS..TL.PPIINAIE----VFSV
RLK6_ARATH/36-358-.ELTKTPKS..TL.PPLMNALE----VFTV
Q5VQN2_ORYSJ/40-388-.TLRKTPSS..EL.QPLINAFE----VYSL
B9RQ88_RICCO/35-358-.SLFKIGGS..TL.PPLLNAIE----IYFF
Q5QL24_ORYSJ/29-348-.TLVATAKS..LL.PPMLNAYE----IYTL
B9RQ82_RICCO/34-356-.SLFKIEGS..TL.PPLLNAIE----IYFV
Y2451_ARATH/32-355-.QLSKTPKS..TL.PPLMNAIE----IFSV
Y5188_ARATH/32-354-.SFTKTGNS..TL.PPLINGLE----IYKV
B9RQ90_RICCO/31-355-.SLSKVEGS..AL.PPLLNAIE----LYYV
RLK7_ARATH/31-354-.QLIRTKRS..TL.PPLLNALE----VYTV
B9RQ85_RICCO/33-355-.QIFKVGGS..TL.PPLLNAVE----VYYI
Q6EQQ3_ORYSJ/24-352-.KLVATATS..SL.PPILNAYE----VYSR
Q67UW6_ORYSJ/28-358-.SLVATKNA..TL.PPILNAME----MYLV
B9RQB2_RICCO/34-359-.SLNKLPNS..TL.PPILNAME----IYLM
Y2923_ARATH/33-360-.VLRQGVKS..TR.PPIMNAIE----TYRT
Y5181_ARATH/29-348-.QLVKTSRS..TL.PPLINAME----AYTV
Y3463_ARATH/35-357-.ELKRTKNS..TH.PPLINAIE----FYTV
Q6EQK1_ORYSJ/34-368-.SLVATNAS..VL.PPMLNAIE----IYYQ
B9RQ87_RICCO/35-359-.LINKTENS..TL.PPLLNAFE----IYFV
Q9SN97_ARATH/32-354-.EMIKTERS..TL.PPLLNAVE----VFTV
Y5596_ARATH/32-354-.QLIRTNRS..TL.PPLLNAYE----VYKV
B9RQ89_RICCO/61-383-.SIYKTENS..TL.PPLLNAIE----IYYI
Y2921_ARATH/34-359-.RLQQTPRS..TL.PPIINAIE----TYRV
Y2899_ARATH/28-349-.QLVKTPNS..TL.PPLINAIE----AYSV
B9H626_POPTR/24-339-ISLVSTTDS..TL.PPLINAME----VFF.
B9H6K7_POPTR/19-375-ISIGPRQDS..GNHTAFLNGLE----IMEI
B9HLB9_POPTR/28-361-FSFAKTRDS..TL.GPLLNAIE----ISK.
B9HS06_POPTR/28-348-ITLTPGNNI..PV.GPVINAGE----IYHI
D7U071_VITVI/66-391-FSIYKTLNS..SL.PPILNAME----IYMV
F4HWL3_ARATH/31-365-VVLQPKAGG.....HAIINAIE----VFEI
F4I065_ARATH/33-357-.QLVKTTKS..TL.PPLINAIE----LFTV
F4IB60_ARATH/32-356-FSLRQTQSS..SL.PPLINAME----TYF.
F4IB63_ARATH/29-347-.QLVKTSKS..TL.PPLLNAIE----AFTV
F4IB71_ARATH/32-354-.TFEMTSNS..TL.PPLINALE----IYT.
F4IB76_ARATH/32-354-.TFTMTTTS..TL.PPLINALE----VYT.
F4ICJ5_ARATH/32-364-VKLSSVSGA......PIISGLE----NYA.
F4J801_ARATH/31-354-LVFKSTDDS..GL.PTIISGLE----VYSI
F4JB46_ARATH/25-347-ITLTPAKDA..PV.GPFINAGE----VFQI
F6H477_VITVI/48-422-IQLHPNPDWRTRYNDAILNGIE----LFKV
F6HY53_VITVI/28-350-FSLSQTNQS..TL.PPIMNALE----IYM.
I1MCW6_SOYBN/32-358-FSFVMTETS..TL.PPIINAIE----IYRV
I1PTQ3_ORYGL/76-415-ISLITTIIS..DL.PPLISAME----IF..
I1PXF6_ORYGL/34-366-ITINATANS..TM.PPLINAVE----VYSV
I1QAW3_ORYGL/40-375-IVLQPLKGT.....RATISAIE----VFEI
K4B910_SOLLC/3-338-ITLQPKNGT.....YAIISAIE----IFEV
M0S6H3_MUSAM/43-370-VTIQALDNS..TL.PPILNAME----VYS.
SIRK_ARATH/33-359-FSLLQPPGE.FVL.PPIINALE----VYQV
Q0DGL2_ORYSJ/34-367-ISINATSNS..TL.PPIINAIE----VFSV
Q0J2E4_ORYSJ/17-347-.TLTATSTS..SL.PPILNAYE----VY..
Q0J2E5_ORYSJ/9-345-ITLAATDSS..QL.PPIVNAFE----VY..
Q2QNF5_ORYSJ/41-399-VSLVAAPDS..AL.PPIVNGLE----IYSV
Q5JNB7_ORYSJ/47-383-FAFRKTDDS..AR.GPILNAME----IYS.
Q5VQN4_ORYSJ/8-346-FQLRKTPDS..QL.PPLINAYE----VYS.
Q5ZCA6_ORYSJ/34-370-ITINATANS..TL.PPLINAAE----IFSI
Q5ZDH7_ORYSJ/38-375-VKLVPVVGR......PILCGLE----NYAM
Q65X96_ORYSJ/43-376-ISINATANS..TL.PPLINAVE----VFSV
Q67TV6_ORYSJ/37-371-LTFRATANS..TL.PPIINALE----IFSV
Q6EQM5_ORYSJ/33-373-.VLRRTAAS..AL.PPMLNAME----IYTV
Q6ERZ1_ORYSJ/29-346-.TLEPTAES..KL.PPMLNAYE----IYA.
Q94HA8_ORYSJ/46-404-VQIGPGTTD.TSNPNAILNGLE----IMKI
Q9M0D8_ARATH/30-359-ISIQKTVDS..TL.PPILNAIE----IFT.
Q9SZV2_ARATH/30-354-IVLQRTGVS..TL.PPIINAIE----IYQI

PF11721

Y1972_ARATH/435-593.IRLYWAGKGTTLI-PKR.GNYG.PL.ISAI
Y3148_ARATH/403-590.IRLQWAGKGTQAI-PVR.GVYG.PL.ISAV
RKF1_ARATH/416-604.IRLSWAGKGTTRI-PTR.GVYG.PI.ISAI
Y1534_ARATH/364-548.IRLYWAGRGTTVI-PKE.RVYG.PL.ISAI
Y5343_ARATH/408-592.IHLQWTGKGTNVI-PTR.GVYG.PL.ISAI
Y5614_ARATH/424-612.IHLFWAGKGTCCI-PIQ.GAYG.PL.ISAV
Q29NS0_DROPS/68-230LGEVSDVRNGQLRL-DFIKGALDNPK.INAF
A0C5E5_PARTE/21-187QECNKGFINGKLKI-GFRKGAADLPK.VDGI
A0D555_PARTE/21-188VLCVDAVQEGKLQV-NLEKTKFDNPY.IHGI
Q232Z6_TETTS/33-200QVCNNGIVDGKLNI-SFEKTQNDNPF.IHGI
Q22CM9_TETTS/26-197CENALDTAHQGLIV-EFRKIGKDLPK.VDAI
A6H797_BOVIN/39-199VQGEVSTFTGKLYI-EFVKGYYDNPK.VCAL
A7RLY6_NEMVE/27-185HNGNTMPFTGTVYV-EFIKGVYDNPK.INAM
Q17BA6_AEDAE/29-192KEEDSEIRGGKVKL-EFLKGYKDNPK.INAI
A8X3B8_CAEBR/29-187VNGHKKDYKGKIVI-EFAKGPHDNPK.VNGF
Q95QG1_CAEEL/43-202VSGHSREYKGKVII-ELSKGPHDNPK.LNGY
Q231X5_TETTS/32-203VIKTYNATYQSLNV-TF.ESIRGSAK.LDAI
A0CEJ8_PARTE/2-159EQINGALSKNQELI-IRFKAIKSQAA.IAGI
A0DJ13_PARTE/493-661KPCIGALNNRNELV-VGFSASQDQAT.VAAL
A0DRE8_PARTE/13-175EICIGALNSRNELI-VGFSASQDQAT.IAAL
Q7XTR9_ORYSJ/429-616.IHLFWAGKGTCCI-PHQ.GYYG.PA.ISAL
Q6F2P3_ORYSJ/440-627.IHLFWAGKGTCCV-PTQ.GYYG.PM.ISAL
Q6ZKW6_ORYSJ/422-609.IHLFWAGKGTCCI-PTQ.GHYG.PT.ISAL
A4AT33_MARSH/904-1052.IDFSALAAV....-....GGIDQPK.VSAI
A4AUK4_MARSH/903-1051.IYFSALTST....-....GGANQPK.ISAI
A4CK29_ROBBH/1247-1419.IDFI.........-....MGVQNPS.IKGI
A4CK28_ROBBH/332-497.VQIGD........-....ATIDNGK.LAGI
Q21PD3_SACD2/360-498.ISLE.........-....SLTDNGT.LSGF
B9M0U3_GEODF/207-345.IGFT.........-....STRDYGK.ISAI
B9M0U3_GEODF/432-570.VKFT.........-....STKDYGK.VSAI
Q01NB6_SOLUE/205-356.LAFS.........-....PVRGTAM.LSAI
Q021C7_SOLUE/211-363.LKFE.........-....PSSNPPL.LCAI
Q026G9_SOLUE/209-373.LEFL.........-....SSWGKPAFVSAL
Q01RD0_SOLUE/183-344.LDFR.........-....PILSGAW.LNAI
Q7UIV5_RHOBA/6-153.VTFS.........-....SEMDYPT.IKAI
A5FCJ0_FLAJ1/725-892.ISFPN........-....VKASQAI.ISAI
A6L3S6_BACV8/1081-1251.IDFPE........-....VKAGQAL.ICGI
A4CKE5_ROBBH/1275-1442.IQFI.........-....HQVENPV.LNAI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window