Sequence alignment for CL0476

PF12928

A1CTU3_ASPCL/75-180MHNAL.SYPRLHHPKHKIVGVYA..PDGPAPPST.ATLPPV.......D.....TPTPDT.....KTGRPAATKLGVHPD
A2QVA9_ASPNC/75-154MHNAL.SYPRLHHPKTQVIGIYS..PDG............................................TEMGVHPD
A3LPV9_PICST/65-141MYDAL.EGVRGHHLKSKLIAVWI..A....................................................SE
A5BBM2_VITVI/1051-1121YYTSS.SISKLQFRKDVSKAIWN..D....................................................AM
A5DEP8_PICGU/52-126MYRAL.ETPRGHYLKHKLEAIWM..P....................................................DR
A6RV11_BOTFB/70-166MHDAL.DHTRFHLPKAHVRAFYY..GEGVGKELERDELVGEEWRKGLE..............................PD
A6ZWG8_YEAS7/73-145MFDTISDSIRGTTVKSEVRGYYV..P....................................................HK
A7RL81_NEMVE/51-121HAAVL.NEERVVKRGNLSVGIWV..P....................................................EK
A7TGL4_VANPO/82-154MYDTLFNSIRGSMLKNQVKAFYI..P....................................................DR
A7UUG1_ANOGA/55-124LRCLL.SQERVNKTESLSEGVWE..S....................................................EH
A8NQA7_COPC7/37-122MFETL.RATRTTSSKAISYAIWH..P....................................................SL
A8PX46_MALGO/78-157LFTTI.SLPRAHSSKTLSAATWD..P....................................................QF
A8XBD8_CAEBR/1-72MSNSNGDWSRAKRKRKTIEIQYS..P....................................................GN
B0CYZ5_LACBS/80-163MLEAL.RATRTTSSKAISYGVWQ..P....................................................SL
B0WD03_CULQU/60-129FRLLL.AQNRVGKADLYSEGEWQ..R....................................................DR
SEN54_MOUSE/62-132LWQLL.AEERVERLGSLVAAEWK..P....................................................EE
B2VSF4_PYRTR/71-141MHGVL.SWQRTHTQKGHILAMYD..P....................................................ER
B3M7U5_DROAN/58-127LRAQL.SVPRIERLAGRALATWN..K....................................................DQ
B4GR76_DROPE/63-132LRAQL.SVPRIERLGGRALASWD..E....................................................EQ
B4N3S4_DROWI/61-130LRTQL.SVPRIERLAGRSLATYH..K....................................................DQ
B6HKN4_PENCW/73-184MHNAL.SYPRLHGAKTRVIAFYA..PDGYVPP....AQPDRAKPKAGED.....GKSSES...TPKPARPLPSSARISPD
B6JWH8_SCHJY/68-139MFDAL.AVERLIPAKTVIQAVWR..P....................................................QQ
B6Q7Q0_PENMQ/75-183MYTAI.SHPRLHPEKSRCVGIYA..PEGPTPPPT.EANNQEDAPASVED.....KPAKRT.........IKDPMAGISPD
B7Q6C9_IXOSC/101-169RAQAV.ACVGAYKLADVAEATW........................................................HE
B8N854_ASPFN/75-192MHNAL.AHPRLHNPKNQIIGIYA..PDGPAPPRS.VATPKTLDTIAEND.....TPAQTAEAEESQSKKPAGTGTNVHPD
B9MWZ6_POPTR/25-96FYSTSACLSKLQFRNDVSKAKWN..V....................................................EM
B9SMU1_RICCO/27-98LYCTLESLPKLQFRSDISKARWN..A....................................................EM
C1E2N9_MICSR/97-172LCSAL.ERPAGAHPNNLSVARWT..ATGDAA...............................................LP
C1N906_MICPC/146-216LCAAY.ACKLGAAPGGVSVAMWR..P....................................................RE
C4JQ88_UNCRE/77-200MHNAL.MYPRLHNPKNRIVGIFC..PDGILEPESSRTVQASQATCAQPPTTENASKVDSTVEGIAQLQVQRQVYRPRGDD
C4R2E0_PICPG/54-130MFQALEAKKRGFACNIGQELRYT..................................................IRFNKRN
C4XX71_CLAL4/65-142MYDAL.SCIRGHLVRQILVAVWI..P....................................................QR
C5DIJ3_LACTC/72-144MFDSLSDASRGSVVKNLIKAYYV..P....................................................DL
C5DP14_ZYGRC/68-140MFDTLSNSARGSVVKNLVKAYYD..P....................................................HE
C5FK56_ARTOC/78-153MHNAL.SYPRLHNTKNRIIGIYY..PNGHQ................................................GD
SEN54_SCHPO/68-139MFDAL.SVERLISAKHAIIATWN..A....................................................QN
Q0CVB9_ASPTN/73-177MHNAL.SFPRLHNPRNLVVGIYA..PDGPAPPRSHTAAPSTGD.....D.....AQLKKS.........PALGAAAIHPA
Q16F18_AEDAE/59-128FRTVL.AQQRVGKAEMYSEGEWD..N....................................................KR
Q4P5A0_USTMA/136-220MFTAV.SGERRVAYRSLVRATWD..A....................................................RT
Q54ND7_DICDI/106-177YKTILELHGKSTSKNSMSYGHWD..S....................................................NL
Q55JP1_CRYNB/129-211LFNAL.IGVRGGHNNSISHALLT..P....................................................KK
Q5BAI1_EMENI/73-178MHNAL.AYPRLHHPKNSIIGVYA..PNGPAPP....AAPKALDTIAE.D.....IPAEKA........APNSVGAHVSPD
Q6BWF5_DEBHA/67-142MYQAL.SYPRGHNSKQKLISVWM..P....................................................NE
Q6CGL6_YARLI/63-134MYGAL.GGERRHNAKNHVRAVWF..D....................................................EL
Q6DBN3_ARATH/25-96EFHSGGSVPKLQFRVGSSKARWI..T....................................................EL
Q6DE24_XENLA/46-116QWELL.KEERVERLGSLVKSVWR..P....................................................KE
Q6FRV7_CANGA/72-144MFDTLRNSIRGSVIKSQVKAYYN..I....................................................DK
SEN54_ASHGO/69-141MFGTLLNSVRGSTVKTLIKAYWE..E....................................................EQ
Q9TXV5_CAEEL/1-70MA....EWNRAKRKRKTIEIQYTGLA....................................................SN

PF02778

ENDA_HALVD/1-63MQGRL-EDGVVHLP.....G.----D----------------------------------------------------AR
ENDA_HALVD/171-233LDAEL-LSDRALVW.......----D----------------------------------------------------GV
SEN2_CHICK/253-325VQEEE-ESSLCPEEGSAREQE----N----------------------------------------------------FV
Q6GPB4_XENLA/264-324PEGTE-E............NK----G----------------------------------------------------AR
SEN21_ARATH/35-108ALGFL-SSCNVLLS.....VE----S----------------------------------------------------EE
SEN22_ARATH/35-108SSGTL-SSCNVLLA.....VE----P----------------------------------------------------EQ
A2Q3E8_MEDTR/41-117TCGFL-SDNCVHLT.....VQ----A----------------------------------------------------EQ
ENDA_HALSA/1-63MDGDL-RGDTVHIG.....G.----D----------------------------------------------------AR
ENDA_HALMA/1-62MELTL-EGDVVRAG.....Y.----E----------------------------------------------------AR
ENDA_NATPD/1-62MEGHL-SDGLVEVG.....P.----N----------------------------------------------------GR
Q2LGU7_9EURY/1-62MEGTL-VDGTVQVG.....A.----D----------------------------------------------------AK
A2ST79_METLZ/1-61MKAEF-DGTQVIAS.......----S----------------------------------------------------EA
Q2FKW0_METHJ/1-60MKARI-EEDKVLLG.......----S----------------------------------------------------EG
A7I612_METB6/17-76VKAIF-DGTSVLTG.......----K----------------------------------------------------DG
A3CT74_METMJ/1-60MLAIF-DGTWVRLG.......----G----------------------------------------------------EG
ENDA_METBU/1-65MRAEI-VKDRVLVE.....K.----K----------------------------------------------------AI
Q0W0Y3_UNCMA/4-68MKGVL-KGDKVIFG.....G.----E----------------------------------------------------AV
ENDA_METAC/1-65MKTQL-EGDRVLAG.....K.----E----------------------------------------------------AV
ENDA_METBF/1-65MKTQL-KGDRVLAE.....K.----E----------------------------------------------------AV
A0B716_METTP/6-70LLGRL-ESGKVHLG.....K.----D----------------------------------------------------AV
ENDA_METJA/10-75ITGLL-DGDRVIVF.....DK----N----------------------------------------------------GI
A6UVS0_META3/6-71IIAKL-SEDRALIF.....NK----D----------------------------------------------------GI
A4FX38_METM5/8-73IPAKL-SDERIVIY.....DK----D----------------------------------------------------GI
ENDA_METVS/9-74IPAKL-SDERIVIY.....DK----D----------------------------------------------------GI
ENDA_NANEQ/1-46MIGYL-FGNRVLVD.....DK----E----------------------------------------------------..
Q2NGK3_METST/1-65MYSIL-LNDRVIVK.....DE----N----------------------------------------------------.A
ENDA_PYRKO/2-67IIFYL-SGDRVFST.....DQ----N----------------------------------------------------AI
ENDA_PYRFU/5-70IEFYL-SGDRVYSE.....RE----K----------------------------------------------------AI
ENDA_PYRAB/5-70IEFYL-SGDRVYST.....RE----K----------------------------------------------------AI
A1RWZ0_THEPD/12-77GEGVF-DGRIVRVL.....DK----E----------------------------------------------------FA
ENDA_SULSO/2-79VKALL-VGSKVLVP.....SI----D----------------------------------------------------ES
ENDA_SULTO/1-77MIGEL-VKDKILIK.....NI----E----------------------------------------------------DA
A4YIV3_METS5/3-79ISGEL-LGDKIVIF.....NL----D----------------------------------------------------EA
ENDA_SULAC/2-78IQGEI-LGDKVLIN.....DV----E----------------------------------------------------KA
A9A3K3_NITMS/1-76MKGEL-IENRVIVW.....NI----E----------------------------------------------------DS
A0RWF1_CENSY/1-76MKAEL-VENRIIVW.....GI----P----------------------------------------------------DA
ENDA_AERPE/10-86ASGVL-IGDSVLVT.....DV----E----------------------------------------------------QA
ENDA_HYPBU/2-78IRAVL-LGLRAVVF.....DR----E----------------------------------------------------AA
A3MWN0_PYRCJ/2-81IKGVL-RGLAVVVE.....DV----E----------------------------------------------------SG
ENDA_PYRAR/1-80MRGVL-RGLAVVVE.....DV----E----------------------------------------------------FG
ENDA_PYRAE/1-80MIGYL-RGLAVIVE.....DV----E----------------------------------------------------FA
ENDA_PYRIL/1-80MKGVL-KGLAVVVE.....DV----E----------------------------------------------------FA
A8MBA4_CALMQ/13-91YRGVL-KGDKVIIP.....SI----D----------------------------------------------------ES
ENDAL_METKA/3-67AKGEL-VGSKVLVR.....ND----R----------------------------------------------------DA
A8A8Q2_IGNH4/2-80YTAYL-VGDRVVVL.....DD----A----------------------------------------------------AA
ENDA_METAC/179-246TDATF-LEDRVIAW.....DA----E----------------------------------------------------AS
ENDA_METBF/179-246TDATF-LEDRVIAW.....DA----Q----------------------------------------------------AS
ENDA_METBU/180-247ADATF-LEDRVVVW.....DE----E----------------------------------------------------AS
A0B716_METTP/182-248GQATL-LDDRVVLW.....DP----K----------------------------------------------------AS
Q0W0Y3_UNCMA/183-250GSATF-LQDRVVIW.....DT----E----------------------------------------------------VS
ENDA_HALSA/171-236VPGVL-LDDRVLVW.......----E----------------------------------------------------PP
ENDA_HALMA/168-228TAGEL-LGERVVCW.......----E----------------------------------------------------PP
ENDA_NATPD/169-230ADGVL-LEDRVLCW.......----D----------------------------------------------------AP
Q18DJ0_HALWD/238-300LSADV-IHDRVVCY.......----D----------------------------------------------------AT
Q2FKW0_METHJ/172-236APGLL-SSISVIIN.......----A----------------------------------------------------GA
ENDA_METTH/3-68VEGQL-GDEVVTIK.....AT----S----------------------------------------------------IA
A5UJP4_METS3/1-69MRGNL-SNDIVSIK.....IE----E----------------------------------------------------GS
A1RXU3_THEPD/7-69LQGNQ-L..............----.----------------------------------------------------..
ENDA_ARCFU/149-206IAGIL-SDEYVITK.....QT----E----------------------------------------------------..
A3DN76_STAMF/7-72VWFDQ-SKCIGIVK.....DK----K----------------------------------------------------SI
A0RWP7_CENSY/9-73VEGEL-SRDLAIIS.....DD----S----------------------------------------------------MR
A9A5E7_NITMS/19-83VRGTL-VSDQACIS.....DK----K----------------------------------------------------MI
A3CT74_METMJ/173-237VEATL-FGTYALAH.......----L----------------------------------------------------PP
A7I612_METB6/189-253AESVL-VGRSAMIR.......----V----------------------------------------------------PL
ENDA_METKA/13-75RAKVF-EGGSLVSK.....DY----E----------------------------------------------------DL

PF12928

A1CTU3_ASPCL/75-180ACVYVSNPKGQYFKTMG.............QAD...RWNRVW..LLPEEALYLLER-GSLEIR----WPF---------
A2QVA9_ASPNC/75-154SCVYVPTPKGQYFKSIG.............QAD...RWNRIW..LLPEEALYLLER-GTLDIR----WPC---------
A3LPV9_PICST/65-141SKCIMPHARGNYFRDMG........IPIHIGSK...VKDGVE..LNSLEAVYLVER-GSVVIY----LGN---------
A5BBM2_VITVI/1051-1121RMAEVVEMKGKMWTTTG..............ML...HSGKIY..CSIEETLFLAEL-GALHLL----DDX---------
A5DEP8_PICGU/52-126QMAIITAAKGGYFKDLG.............RQTSFGHRQVIW..LTGVEVTYLVER-GSMMIY----LND---------
A6RV11_BOTFB/70-166HVVVVEGPRGPHFRTIG.............RANEGKHKSSLW..LLPEEALYLVER-GNLDLW----WPN---------
A6ZWG8_YEAS7/73-145HQAVLLKPKGSFMQTMG.............RAD...STGELW..LDFHEFVYLAER-GTILPY----YRL---------
A7RL81_NEMVE/51-121AMIKIEAAKGTHWNHFG..............VT...INSVLW..AAPEEALFLLEQ-GSLELY----YGG---------
A7TGL4_VANPO/82-154HVAIIPHPKGNFLQTIG.............RVD...KTGICY..LNFLEFLYLAER-GTVTPF----LCN---------
A7UUG1_ANOGA/55-124RRIRLTRVEGK.WQSFG..............YE...DSTGKY..VECYEGLFLMEM-NRLMVK----WNG---------
A8NQA7_COPC7/37-122SRAEVTLNRGIHFSSMGHSAPRTIPTTSTGGTP...KVHKRL.ELLPEEAIYLIER-GSLFCW----KWV---------
A8PX46_MALGO/78-157QRAFVHVQRGQSCVHVG..........LSERRKLENGQSMTFLELFPEEAVYLIER-GALDCR----WTQ---------
A8XBD8_CAEBR/1-72STLKVTKVTGKHLESMG...................NPVKNGYELFPEEAVYLVET-GSGTIL----TPS---------
B0CYZ5_LACBS/80-163ARTHVTVARGIHFSSMGHSAPR..SLLGENGVE...KIQKRL.ELLPEEAIYLIER-GSMFCW----KET---------
B0WD03_CULQU/60-129KRVRLRRTAGK.WNLYG..............YM...EDKVHY..LDGYEALHLMEM-NRLLVY----WNS---------
SEN54_MOUSE/62-132GFVELTSPAGKFWQTMG..............YS...EEGRQR..LHPEEALYLLEC-GSIQLF----YQD---------
B2VSF4_PYRTR/71-141NMACVDKVRSQHFQTIG..............TN...KGGREW..LLPEEALFLLER-GTLDCR----WPV---------
B3M7U5_DROAN/58-127QVAEVLRKDGK.FENFG..............HS...KQGKLF..LEYYEALFLLEV-GRLQLE----YCG---------
B4GR76_DROPE/63-132QAAEILRKDGK.FGSFG..............YS...VQSKLY..LEYYEALFLLEL-GRLQLE----YHD---------
B4N3S4_DROWI/61-130QVVEVLKKDGK.FEHFG..............YS...HKGKFY..LEYYEALFLVEL-NRLQLE----HEG---------
B6HKN4_PENCW/73-184ACVYVPSPKGQFFKTMG.............QAD...SSSRVW..LLPEEALYLIER-GSLDIR----WPS---------
B6JWH8_SCHJY/68-139QKAEVLHAHGPMFKTMG.............HAT...SNNSVW..LLPEETVYLVER-GSMECW----CEE---------
B6Q7Q0_PENMQ/75-183ACVCVPQPKGPFFKTMG.............RAD...RWNRVW..LLPEEAIYLVER-GSLYLK----WPS---------
B7Q6C9_IXOSC/101-169EKIVLTRHKGPFLSFMG..............RA...VGRQTL..LHPLETLFLVLS-GQLTLK----RDG---------
B8N854_ASPFN/75-192SCVYVTNPKGQFFKNMG.............RAD...RWGRIW..LLPEEALYMLER-GSLDVR----WPR---------
B9MWZ6_POPTR/25-96GMAEVIEKKGKMWITTG..............IV...RNGKTF..CLIEETLFLAEI-GALLVM----DDN---------
B9SMU1_RICCO/27-98GMAELVEKKGKLWTNTG..............IA...RSGKTY..CSIEETLFLAEL-GALVLM----DDE---------
C1E2N9_MICSR/97-172FVAELLRTRGKHFTKFG..............HV...CGARTY..LLPEEVLFLVET-ERLAVV----PPG---------
C1N906_MICPC/146-216RVAELVRMRGKHFVKFG..............YA...AGSRTF..LHAEEALFLVET-ERLALL----APG---------
C4JQ88_UNCRE/77-200LCVCVPNPRGQHFRTMG.............RAD...QFNRVW..LLPEEALYLLER-GSLDIR----WPV---------
C4R2E0_PICPG/54-130QSFHILNAQGKFLDSMG.............KTD...GNHKTW..FTKFEALYLIER-GTCRIT----YDE---------
C4XX71_CLAL4/65-142KMALVPHAKGAFFKDMG.......TAHVFKRKT...KLSGMW..LTPIETVYLTER-GSLITY----LSN---------
C5DIJ3_LACTC/72-144HKACVPHPKGSFMHTMG.............KVD...RDGACW..LSFFEFVYLAER-GTIAPY----YKR---------
C5DP14_ZYGRC/68-140HKALVLRPKGNFLHTLG.............KMH...RDGTVW..LEFHEFVYLAER-GSITPF----YKM---------
C5FK56_ARTOC/78-153ACVCVPNPRGQYFRTMA.............QAD...NINRMW..LLPEEALYLLER-GSLDIR----WPA---------
SEN54_SCHPO/68-139GMSCVEKAHGPLFKTMG.............TAD...SQNRMW..LLPEETLYLVER-GSMECW----SEE---------
Q0CVB9_ASPTN/73-177SCVYVPVPKGQYFKSIG.............QAD...RWNRMW..LLPEEALYLLER-GSLDIR----WPR---------
Q16F18_AEDAE/59-128KRIRIRKAVGK.WHIYG..............YL...ENKVQY..VDGYEALHLLEM-NRLIVF----WDT---------
Q4P5A0_USTMA/136-220RRARLLDIQGKIFETVG.....VIQREQVVDKATGKLVTKAWNELLPEEALFLTER-GSLQIY----HPA---------
Q54ND7_DICDI/106-177KKFEITLRKGKQFDSVG..............QQ...IGSKLY..LHIEEAIYFQDL-GIVELY----INQ---------
Q55JP1_CRYNB/129-211PFPRVLVVHGHLLDTMG....ITVRTPPPAGSK...GKGKTSLELLPEEALYLLER-GSLQIW----IGR---------
Q5BAI1_EMENI/73-178SCVYVTNPKGQHFKSLG.............QAD...RWGRVW..LLPEEALYLLER-GSLDIR----WPR---------
Q6BWF5_DEBHA/67-142KRALVPHAKGGFFKDMG............KTANFGKKIQGLW..LEPLEVVYLVER-GSMAIF----LGN---------
Q6CGL6_YARLI/63-134QKAQVDVARGPHFKTIG.............TSD...SQGKVW..LYPEETIYLLER-GSMELF----WPN---------
Q6DBN3_ARATH/25-96GMAEVEVKRGKLWTTTG..............II...RSGKTY..CFIEEALYLSEI-GELQIL----GNE---------
Q6DE24_XENLA/46-116DLVELTSPAGKFWQTMG..............FT...YQGKQC..LLPEEAVYLLEC-GAVQIF----YRD---------
Q6FRV7_CANGA/72-144HKAYVPHPKGSFLQTMG.............WAD...SNGVFW..LDFHELVYLSER-GTVTPY----WGS---------
SEN54_ASHGO/69-141RMARIPNARGSFTNTMG.............KVD...KHGQCW..LQLHEFVYLVER-GTVSPY----LAL---------
Q9TXV5_CAEEL/1-70STLKVTKVTGKHLESMG...................IPGKFGYEVYPEEAVYLMET-GSATIS----TSS---------

PF02778

ENDA_HALVD/1-63QR...FHDSRGYGRP..--------..........TGGDDLE--VAPVEAAHLLSR.DDIDGV.......DGMGLRELL
ENDA_HALVD/171-233DR...LYQRGFFGQRLY--------.......GRNADSGPLQ--LSLLEAAYLARA.DALAID...........EADVV
SEN2_CHICK/253-325KKEKLVCRRNPF.....--------..........RIFEYLQ--LSLEEAFFLVYALGCLTVY....YGEEPLTILKLW
Q6GPB4_XENLA/264-324GRGRLVCRRNPF.....--------..........RIFEYLQ--LSREEAFFLVYALGCLTIS....YKKEPLTIQKLW
SEN21_ARATH/35-108AE...LLDRCCFGRLVV--------.......GAEKDKRWIQ--LSFEEAFFLFYKLKCIKIC...LHGRSLENEVDLW
SEN22_ARATH/35-108AE...LLDRCCFGRLVL--------.......SAEKIKKWIQ--LSFEEAFFLHYNLKCIKIS...LQGRCLENEVDTW
A2Q3E8_MEDTR/41-117LD...LLDKACFGRPVR--------.......IVEKDMYWFQ--LTVEEAFYLCYSLKCLKIKINVGADTGPLNDEELW
ENDA_HALSA/1-63QR...FHDARGYGYP..--------..........LGGNDIA--VSLVEAAHLLFR.GDLDSV.......DGMGFRAFL
ENDA_HALMA/1-62ER...FYDSRGYGK...--------..........VRNGDID--LAPVEAAHLLYR.GDIESI.......DGMDFRGFL
ENDA_NATPD/1-62ER...YYDSSGYGRP..--------...........DGAGVR--LAPVEAAYLLAR.GDLDAV.......DGMGLEAFL
Q2LGU7_9EURY/1-62QR...FHDARGYGRM..--------..........RDSTIVE--LAPVEAAHLLAR.GDLETV........IIDASSSA
A2ST79_METLZ/1-61LS...LYEQSGYGRP..--------..........DKSGVLR--LDPKEALYLMAR.GKIEIP........GLSFDQLL
Q2FKW0_METHJ/1-60YA...LYEQSGFGR...--------..........PQKDGLR--LSPVEALYLVYR.GRIEIP........GYDFDTLL
A7I612_METB6/17-76RT...LYDQSGYGR...--------..........PEGEGIR--LAPQEALYLLHR.QKLDVP........GYTFDSLL
A3CT74_METMJ/1-60RA...LYEQGGYGR...--------..........PEGRGLR--LSPEEALYLMER.NKIDVK........DFGFDALL
ENDA_METBU/1-65NE...FYNNGYYGR...--------..........PKSSGLE--LTLIEAVYLAFR.GKIEVE....HEGKVLEFSDLF
Q0W0Y3_UNCMA/4-68AE...LYNAQYYGR...--------..........LKGETLE--LALVEAAYLLDR.ERISVD....QEGRSLSFRDFF
ENDA_METAC/1-65AE...LYKTGYFGR...--------..........PREDGLE--LSLVEAAYLQFR.GKIEIE....LEGRKLDFRALF
ENDA_METBF/1-65AE...FYKTGYFGR...--------..........PKGEGLE--LSLVEAAFLLSR.GKLEIE....LEGTMLDFRYFF
A0B716_METTP/6-70KV...LYEQGYFGR...--------..........PLDDGLE--LTLVEAAYLLDR.SRLRIE....YDGHILSFRSFF
ENDA_METJA/10-75SK...LSAR.HYGN...--------..........VEGNFLS--LSLVEALYLINL.GWLEVK...YKDNKPLSFEELY
A6UVS0_META3/6-71SR...LNAKG.YGE...--------..........LNDNFLS--ISIVETMYLLSK.NWIKVK...STTGQLLSFEELY
A4FX38_METM5/8-73SR...LNEKR.YGE...--------..........LHENFLS--LSFVEGLYLVSK.NWISLK...DKKNKLLSFEEVY
ENDA_METVS/9-74SR...LNEKR.YGE...--------..........LHENFLS--LSYVEALYLVAK.DWVLIR...DKKNKILSFEELH
ENDA_NANEQ/1-46.................--------.................--LPLIEAYYLLDK.GELEVY....EDDKKLSKEEFL
Q2NGK3_METST/1-65HN...LYNKRYYGN...--------..........LTDSGLE--LSFIEALFLLTK.NKIEIY....DDDKLITKEDLT
ENDA_PYRKO/2-67NG...LYNKRYFGK...--------..........VVEGKLF--LSLLEAAYLVER.GKIEVR....DGKRKLSLEEIM
ENDA_PYRFU/5-70NQ...LHINRGYGE...--------..........LKGKRLF--LSLIEAAYLLEK.GWIKVL....DGERELSFYDVV
ENDA_PYRAB/5-70NQ...LYNNRGYGE...--------..........LKGNKLF--LSLIEAAYLVER.GWIKVL....DEDRELTFEEIF
A1RWZ0_THEPD/12-77EQ...LYQRG.YGM...--------..........LSGEILE--LTLVEAAYLVYR.EMLKVK...DDQGRTLSFPEIV
ENDA_SULSO/2-79RY...LYSNGFYGKPIG--------ISK..PKGPKDIVRPLE--LSLIESVYLTKK.GLINVV...DKNGDLLEYKKLY
ENDA_SULTO/1-77RL...IYKMGYYGKPIG--------ISK..PKSAEEINSELI--LSLIEGVYLVKK.GKLEIV....SNGERLDFERLY
A4YIV3_METS5/3-79RT...LYQMGFYGKPLT--------ISK..PKSAKDINKPLE--LSLIEGLYLSEQ.GILEVR....HLGEVLDIARLE
ENDA_SULAC/2-78KE...IYKLGYYGKPLD--------ITK..PKSPEDIKKPLI--LSLIEALYLSKK.KIIEVI....RDGKVIDDALLY
A9A3K3_NITMS/1-76RK...LFGGGYYGKPIG--------IP...KPKIEEIDAPLV--LDLIESLYLLEN.KKISIS....KSKHKVTVEQMI
A0RWF1_CENSY/1-76RQ...LFGSGYYGKPVG--------IP...KPKVDEIDAPLV--LDMMEGLYLSRA.GKITVY....RSKKRVPDEELA
ENDA_AERPE/10-86RS...LYSCGYYGQPLD--------VE...KPRGADFEGPLR--LSLIESLYLAEK.GVLEVA...KPDGSSVGVEDLR
ENDA_HYPBU/2-78RR...LYASGYYGKPLG--------IP...KPRGSNFDAPLE--LGLLETLHLLER.GMLEVY...DEEGHRVSVEEVR
A3MWN0_PYRCJ/2-81RE...LYRRGFYGRFLG--------YDKVKREEVDKVDAPLI--LALYEALYLAEK.GVLTVV...DENGVEIPPQQLV
ENDA_PYRAR/1-80RR...LYKEGFYGRFLG--------YDKVKREEVDRINAPLV--LALYEALYLVER.GVLEVV...TDSGEKITQTRLV
ENDA_PYRAE/1-80RR...LYKEGFYGRFLG--------YDKVKRDEVEKINAPLI--LGLYEALYLAEK.GRLKVM...GEDGREVAPEELA
ENDA_PYRIL/1-80RK...LYKEGFYGRFLG--------YDKVRREEVDKISAPLI--LALYEALYLAER.GKLKVV...SKNGTEVLPEKLI
A8MBA4_CALMQ/13-91RA...LYKLGFFGKFLG--------KDKIKIEEVDSVDSPLH--LSPLEALYLVEL.GLLEVV....DNGSVVGRGTLK
ENDAL_METKA/3-67NR...LYS.SMYGK...--------..........PSRRGLQ--LWPEEALFLCEI.GRLEVR....SGNVRISPEELM
A8A8Q2_IGNH4/2-80KD...IYSKGFFGHPLG--------TEK..PKGPEDVKAPLA--LSPLEALYLLET.GVIEIRD..ITTDKSYSPEELK
ENDA_METAC/179-246GA...LYAGGFYGKM..--------..........LDPERLQ--LSLVESLYLFSR.GIIVVR...DRKDRIFSFDEFV
ENDA_METBF/179-246ET...LYKRGFYGKM..--------..........LDSERLQ--LSLVESLYLFSR.GIITVR...DRKGKVFSFDEFI
ENDA_METBU/180-247KT...LFENGFYGKP..--------..........LDSQRLQ--LSLVESRYLLEK.GVLNIN...NRQDESMDVDAFS
A0B716_METTP/182-248ER...LHKHGFYGK...--------..........MIGERLQ--LSLVETAYLLER.GMIQLV...DRSGVPVPLDELM
Q0W0Y3_UNCMA/183-250TR...LHQDGFYGNP..--------..........MDDRRLQ--LSLVEAAYLIMR.GKLEVT...DYEGRIMTPDDFT
ENDA_HALSA/171-236QR...LHNAGFYGQPLG--------.......GRAADHDALQ--LSLVEAAYLIDA.GVLRLT........DATIDDVR
ENDA_HALMA/168-228AE...LYEQAFYGQQ..--------.........LGDDGAVQ--LSLVEAAYLTQE.GMLTVE.........GGADAVV
ENDA_NATPD/169-230PA...LYEQGFYGQRM.--------.........DREDGPLQ--LSLLEAAHLAAT.GVLSVA.........GGAAAVE
Q18DJ0_HALWD/238-300DS...LYDENFYGQRLF--------.......GRNADTGPIQ--FSLIEAAYLAQQ.GVIAVD...........TATIV
Q2FKW0_METHJ/172-236DL...GYDQAFYGKR..--------..........LDDSRIV--LSTVEAAYLIEQ.GLVTIQ....LGEATLTAEEYC
ENDA_METTH/3-68RR...LHGKSHYGK...--------..........MYEDRLQ--LSLIEAAYLMER.GKLKLM....KDDDEVSPEEFI
A5UJP4_METS3/1-69KRPIALHEKSLFGK...--------..........IEADTLN--LSLIEACYLHEK.GRLDVY....EDEIKCSLDYLI
A1RXU3_THEPD/7-69.....YFKGGFYGRFFT--------VP...KPKLPDVRKELE--LSLFDAMYLLEQ.GCLDLK...REDGSPVSPSELF
ENDA_ARCFU/149-206.....IFSRYFYGS...--------..........EKGDLVT--LSLIESLYLLDL.GKLNLL........NADREELV
A3DN76_STAMF/7-72NN....LEKKWFGR...--------..........LEGENLV--LDIVELAYLLLH.GRIRLV...LEGLEITTYNEFL
A0RWP7_CENSY/9-73HE....LETRGYGE...--------..........VDKKRFY--LRPFESLYLLFY.GRLKLA....KSGKAIGFESML
A9A5E7_NITMS/19-83HE....LELKGYGE...--------..........IEKEKFF--LKQFETLYLLYT.NKLILK....KGKKEIDFDFFM
A3CT74_METMJ/173-237GT...PLEEDWYGKR..--------..........LDTERLL--LRPVESIYLMRR.GCLSIT....QDEEPMAAEQFL
A7I612_METB6/189-253QS...DLERAGFGKR..--------..........LDDERLM--LAPVELLYLMDC.GVLKAK....RDGAFISTADYF
ENDA_METKA/13-75KR.......RYFGT...--------..........EHGNVLF--LDPFETVYLTEK.GEIDPE...TPEGEPMSVEELL

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window