Sequence alignment for CL0481

PF04986

A0NYF6_9RHOB/143-334GITAVLHTWGSA.MT---HHPHVHMIV-PGGGISLNG....TRWIS....SRPA.FLLPV-RVLGKLFRRLFLSRLIALH
Q9RDU8_PSEPV/69-254GAVAFIHRFGSS.LN---EHVHFHCCV-IDGVFEPAEMDGATEAN.....ATPGVVFHAA-TELDPEAIAAVQAQARRRI
Q83XH8_VIBAN/105-287GIFGALHTYGRA.LN---WHPHIHLSV-TRGGLDKHN.....TWKP.........IYFKK-KHVEYHWRRTLIRLLRQKY
Q01P74_SOLUE/145-335GFLCVLHTWGQT.LI---HHPHIHCVL-PGGGFAPGR....TRWVR....PRRAGFFLPK-YVLSEVFRGKFIDGLRDLF
A9L1Z0_SHEB9/140-307GFTGVLHTHSRR.RD---YHPHLHFII-PAGSYHSGK....RQWRK....CQTH.YLFNA-FNLAKVWRARLLAYLSDT.
A5YVZ3_SALTM/172-397GSVTLIQRFGPA.LN---LNVHYHMLF-LDGVYAED..............DYGKQRFHRV-KAPTYDELNTLAHTLSHRI
A1WDQ9_ACISJ/182-382GAVAFIHRFGSS.LN---EHVHFHVCV-VDGMFEAVAGE...ASEQGTRTTAISVMFHPA-IGIDPEAVTQAQASLRRRI
Q79BR9_PSESD/174-368GAIAFIHRFGSS.LN---EHVHFHVCV-VDGVFEEVEGE..GDADATPRISSPGVIFHAA-TGIDAATVAPVQTTLQKRI
Q12Q53_SHEDO/139-306GFTGVLHTHNRR.RD---LHPHIHFII-PAGSFDKDR....KQWHK....SKGK.YLFNN-VNLASVWRAKLLEQLTKK.
Q47906_9FUSO/38-214GLITVIHTFGRD.LK---WNPHVHALI-SLGGFNKRF.....VWKKL........DYFHV-DVIANQWKFIVLQLIQSGN
A5GBJ9_GEOUR/131-297GILAVLHTWTRA.LE---HHPHVHMLV-PAGGLDKDG.....QWRE....SRKK.YLVPV-KALSKGFRYRFMKMARKA.
A4BNA6_9GAMM/69-274GAVTLIQRFGSA.LN---LNVHFHMLF-LDGVYVER..............PDGSLRFRWV-KAPTSAELARLTQNLPRRI
Q981L3_RHILO/137-326GFFAVLHTWGQN.LS---HHPHLHCVV-PGGGLSPDG....SRWIE....CRPR.FFLPV-AVLSRLFRRLFLEDLQKAF
A3JF95_9ALTE/140-304GLVGVLHTHSRR.LA---FHPHVHIVV-PGGGLTGHH......WHA....RAGR.YLFNG-RALATVFRAKFLTRMREQ.
Q5P667_AROAE/144-333GFIAILHTWGQN.ML---HHPHLHCVV-PGGGVSADG....ERWIA....CRRG.FFLPV-RVLSRLFRHLFLKRLQQAF
Q01TH4_SOLUE/47-236GFFSVLHTWNQQ.LL---HHPHVHCVV-PAGGLSADH....QRWIS....AQPS.FFLPV-KVLSRVFRGKFVEGLRKLH
Q7UCL9_SHIFL/142-324GIFTVIHTWGRD.QQ---WHPHIHLST-TAGGVTSGH.....TWKN.........LHFYA-RKVMSMWRYRITRLLSRKY
Q328X8_SHIDS/147-330GIFCAIHTYGRR.LN---CHPHVHVSV-TCGGLNKHG.....QWKK.........LSFLK-DAMRSRWMWNMRQRLLKAW
Q2W8U4_MAGSA/134-323GFITVLHTWGQA.LQ---HHPHLHCVV-PAGGLSPDG....QRWVA....CRPG.FFLPV-KVLSRLFRRLFLEQLTAAF
Q1ZUG8_PHOAS/139-306GFTSVLHTHNRR.RD---LHPHIHMVI-TCGGFDDKK....RQWKN....CKNH.YLFNA-FALAKVWRARLLAYLTTE.
Q7TTN7_RHOBA/141-311GFFGVLHTWGRDPAV---YHPHVHYVV-PGGGVKLDELGHALSWQS....TPKN.FLFHH-GTLIRTYKAKLAEELRAA.
B6EMI2_ALISL/105-289GIFCALHTYGRK.LN---WNTHLHLSV-TRGGICERT....GLWKP.........IYFQM-KTTEPCWRAAIVSLLGKAY
A1WDQ5_ACISJ/174-373GAVAFIHRFGSS.LN---EHVHFHVCA-VDGVFEEVAGEEGDAADAASQSSPSRIIFHPA-TGVTADAVGQVQASLRKRI
A3XUQ2_9VIBR/116-283GFTAVLHTHSRQ.RN---LHPHLHIIV-AAGQYDPSR....QTWHK....GNKR.YLFNA-FALAKVWRARMLEAINQH.
A9AVJ8_HERA2/140-307GMLGILQTWTRD.LR---YHPHIHYLI-PAVVRTPDG.........TICQPAPG.FLLPV-RPLALLFRGKLRAAIGQL.
Q2FD24_ACIBA/179-405GAVTLIQRFGSA.LN---LNIHFHMLW-LDGVYVEAT...........ELPRRELRLHRA-RAPTTAQLTQLAATIAHRV
A8H5W4_SHEPA/54-221GFTGVLHTHNRR.RD---YHPHLHFII-PAGSFNKDK....KQWQK....SRGK.YLFNA-FNLATVWRARLLEYLTNK.
A0P0Y4_9RHOB/143-332GLIAVLHSWGQT.LT---YHPHLHCIV-PGGGPSPDG....SRWIS....CRPG.FFLAV-RVLSRLFRRLFLEALRVAF
Q12YW6_METBU/152-326GAIVVLHPFSKD.MG---FNPHLHILL-TEGRFDMYG....KFIHQ.........KFIHF-KTMRKTWQYQVLTRFKDA.
Q1VPE4_9FLAO/140-316GMIAVLHTWGQN.LQ---LHPHLHCIV-PGGGVCEAG.....FWKKGT..AKDD.FLFSV-EAMSDKFRGRFVSKLRKA.
Q9F8W1_ECOLX/171-394GAVTLIQRFGSA.LN---LNVHFHMLF-LDGVYVEQ..............SHGSARFRWV-KAPTTPELTQLTHTIAHRV
A9B8K8_HERA2/140-308GMLGVLQTWTRD.LR---YHPHIHYLI-PGVGRTATG........QLVFPPAEN.FLLPM-RPLAVLFRAKLRAALRQI.
Q48B93_PSE14/155-338GIFGALHTYGRR.LN---WHPHVHLSV-TAGGLDEQG.....VWKN.........LSFHK-EALRRRWMWLVRDYLLGQP
Q56753_9FLAO/152-326GMIAVLHTWGQN.LS---LHPHLHCIV-PGGGVDESG.....RWKNLR..SDGK.FLFPV-KALSKVFRAKFCEKLKDK.
A6TTH3_ALKMQ/138-326GMIATLQTWGQT.LY---LHPHIHCLI-TGGGLTDTE.....EWKN....SNKD.YLVPC-KTLMEIFRGKYIDELHKLA
A5G657_GEOUR/141-307GFFGVLHTWGRQ.LQ---YHPHIHYVV-PGGAISTAD....GSWRR....SGEH.FFLPV-KALSSIFRAKFRESIEKA.
Q93R66_9PSED/154-336GVFCAIHTYGRR.LN---WHPHIHVSV-TLGGIDDAG.....VWKD.........LSVHP-SALRRRWMWNVRQYLLSQW
A8LSZ6_DINSH/144-335GMTSVLHTWGSA.MT---HHPHVHVIV-PGGGLSPDG....SRWVA....CRPG.FFLPV-KVLSQLFRRLFLEGLIRLH
Q121V9_POLSJ/144-335GATLVLHTWGSA.LT---HHPHVHGIV-PGGGLAADG....KTWVA....CRPG.FFLPV-RVLSRLFRRRFLEELHLAH
A3UHI1_9RHOB/361-552GITAVLHTWGSA.MT---HHPHVHMIV-PGGGITPDG....QRWIS....SRPA.FLLPV-RVLGALFRRVFLTRLMALH
A0LBL2_MAGSM/140-314GVLALLHTWTQQ.LI---YHPHAHCLV-TGGGLSEDG....ATWYA....AKNG.FLIPT-KALARMIRGKVMSTFKMI.
Q7WXN2_CUPNH/120-251GATLVLHTWGSA.LT---HHPHVHGIV-PGGGLSLDG....ERWVA....CRPG.FFLPV-RVLSRLFRRRFLEALQAAH
A6VW84_MARMS/139-317GMTAVLHTWGQT.LV---RHVHLHALV-PSGVYRDQG......WHS....LKKN.YFLPV-KLLSNRFRGAMVSQLRAAF
Q8EE63_SHEON/141-311GCTMVLHTWGQT.LS---QHIHLHCLI-PGGVVTSAG.....DWHG....VKTD.YLFPV-KALSTVYRAKLLRALRQH.
Q039J1_LACC3/145-318GVVAALHTFGSK.LE---FNPHVHMVV-TMGGITPDG.....QWKTY........DYLPY-KRLRVYWQNAVLKLIRRTL
A9B8X8_HERA2/140-308GMLGIFQTWTRD.LR---YHPHIHYLI-PGVGRTTDE........RIVFPPAPD.FLLPV-RPLAMIFRAKLRAALRQT.
A1TZA6_MARAV/137-319GMTAVLHTWGQN.LS---RHVHVHCLI-PGGVLTEAG.....EWHE....AKHQ.YLFPV-RALSRRFRGRMVSSLRRSV
Q1M5F3_RHIL3/143-332GFIAVLHSWGQT.LH---YHPHIHCIV-PGGGLSADQ....SRWVA....CRAN.FFLPV-RVLSRLFRRLFLEELKQAY
Q1M648_RHIL3/143-332GFFAVLHTWGQN.LL---HHPHLHCVV-PGGGFSPDG....TRWIT....CKRG.FFLPV-RVLSRLFRRLFLEHLQKAF
A1VWX4_POLNA/23-168GACWRV.......VR---PKTCWPTST-AASR..................STPVCALRRT-PAQHWSGCSASQPRARQAF
A3J7Z8_9ALTE/139-305GMTGVLHTHSRR.LD---YHPHIHFIV-PAGGLLKSR....KEWRK....KRGK.YLFKE-KNLATVFRARLLQALKQS.
A6DN83_9BACT/134-299GMIGVLHTHGRD.LC---YHPHIHYIV-PGLVLNSQE....KLLRV....IKKN.YLVNN-KALGALYRGKFLAALTEH.
A7B3V2_RUMGN/140-328GYICILHTWGSE.MN---FHPHIHMIL-LGGGLTPKN.....EWKD....NGTE.FFLPI-WAISKVFRGKYMDELKNLW
Q6LHG6_PHOPR/138-305GFTAVLHTHSRQ.RN---LHPHLHIII-AGGRYDSSK....QVWHK....SNKQ.YLFNA-FALAKVWRARLLAAINQH.
A3XDT2_9RHOB/144-335GMTSVLHTWGSA.LT---HHPHIHMIV-PGGGLSPDG....TKWVA....SKPG.FFLHV-RVLSRLFRRLFLDGLVALH
A0PB90_PASPI/105-289GLFCVVHTFGRQ.LN---WNVHFHLSV-TRGGVNLKT....KRWGN.........IYFNA-AMVEQHWKQQVVSFLRDHY
Q0A7P5_ALHEH/141-322GIVMALHTWGRT.LN---AHPHVHCLI-SGGGLTTGG.....QWRA....VKGD.FLLPA-AVVKRVFRGKLLSRLRHDL
A3JIR7_9ALTE/137-319GMTAVLHTWGQN.LS---RHVHVHCLI-PGGVLTGTG.....DWRK....AKSH.YLFPV-RALSRRFRGRMVSLLRAAV
A0YEL0_9GAMM/162-387GAVTLIQRFGSA.LN---LNLHFHVLF-IDGVYQQK..............NNGKLRFHRV-NAPTANELNTLVATISQGV
Q7TTG3_RHOBA/141-314GFTSVLHTWGRD.LG---YHPHVHVVV-PAGGIDAGG.....VWQS....SRAS.VFVPE-QILERLFRGKLKDKLRSE.
A5G455_GEOUR/137-325GVIMARHTWGQM.LG---LHPHVHCLV-SGGGLTQSG.....EWRS....VANG.YLLPV-RVVRSLFCGKFLDAIRRGV
Q1Q731_9BACT/12-184GYIVVLQTHGRS.GQ---YNPHLHIIA-SSGGLDEEG....QRWEHL........SYLPY-KMLHKKWQWYLLEMMRKEL
B2JTR0_BURP8/144-333GFITILHTWGQN.LL---HHPHVHCVV-PGGGIAPDG....ERWIA....CRPG.FFLPV-RVLSRLFRRLFLEQLRRAF
Q01XA5_SOLUE/73-262GFLSVLHTWGQT.LQ---HHPHIHCVI-PSGGLSPDH....QHWVH....PRYP.FFLPV-PVLRRVFRGKFVAGLKSAF
A6FA86_9GAMM/141-311GGTVVLHTWGQT.LT---QHIHLHCLI-PGGVLTSQG.....EWHG....VKSD.YLFPV-KALANVYRAKMMQALRHR.

PF01797

B8GCQ7_CHLAD/12-128VLRINSH------LV...WCPKRRRKI.VVDR.LKTR------------------LEELI.RETASELGCEILA...LEI
B1KEE0_SHEWM/11-130YWRCQYH------IV...WTPKYRFRI.LKNK.LGKD------------------VYRCI.HVYSEQLGCVVVE...LNV
B4SJM3_STRM5/13-127RIDGCYV------LT...TVVRRRCRV.FDDPRCATC------------------LVDAL.RFVESMGLSHSFA...WVV
B9LSV3_HALLT/9-121KYELYYH------IV...FVPKYRRSH.LTGK.TKER------------------LESIF.AEICEDKGLELAE...SEV
B9LMY5_HALLT/12-130VYALQYH------FV...TVTKYRADL.LTDE.IAER------------------VGEIA.SDISEDFGVNIQN...VNG
B4SER8_PELPB/11-131VTVLMYH------IV...LPAKYRRVI.FDDE.VDEV------------------LKDVC.LEIENRYQIKFLE...IGT
A8KYK3_FRASN/14-134VSSLHAH------LV...FVTRYRRGG.LDDA.MLTR------------------CEQIM.RSVCCDFGAALTE...FNG
A8L9Q9_FRASN/6-123VYDLGYR------IV...WCPKYRRPV.FAGS.VRDR------------------CEELV.RRKCTEHEWMVVA...WEV
B1YEE0_EXIS2/12-129VSLIHYH------FV...FCPRYRRKI.FLRNDVEGY------------------FKELV.QEICESLEIHTIA...LAC
B1YKP1_EXIS2/10-129VFLLNYH------LV...LVVKYRRKV.IDDA.ISDF------------------ARQTF.ERIGASYHITLNE...WNH
A0A7E6_9CAUD/12-134TFNLTVH------IV...LVTKYRRKV.FQKE.HLEF------------------LKVAF.NSIAAKWDAEVVE...ING
A0JQH2_LACS1/15-136VYNLHFH------LI...WCTKYRNKT.FTDDKLSNE------------------MKEIL.QRVADDNEIAIEK...MEV
A0L321_SHESA/19-138VSKLVVH------LV...FTTKYRRKL.FTGV.MIEQ------------------LREAF.ESACVKLECELIE...MDG
A0M0J7_GRAFK/11-130VSRLTVH------VV...WCTKYRYRV.LKDD.IQIR------------------CRSLL.IQICEAEDVSILK...GVV
A0QCS6_MYCA1/1-112MSLLHAH------LV...FVTKFRRKL.FTDP.MLTF------------------AETTM.RTVCAELDVELVE...FNG
A0YIB8_LYNSP/13-134VYRLTVH------IV...FVTKYRRKT.ITDE.ILTR------------------LNQIC.ADTCIKWECSLIE...FNG
A0YJH2_LYNSP/10-131VSDVRVH------LV...LVTKFRRKV.FVGN.MLLL------------------IEATI.SKVLENNDCELIE...FNG
A0YNL9_LYNSP/12-131ISDLKAH------LV...LTTKYRRKV.FTGA.IIER------------------LQTII.WELCRKWDCQMIE...VNG
A0YQF8_LYNSP/12-130IGNATVH------LV...WIPCRRKRLFYQNETLKLR------------------CIEVF.QSVANDKKWIIKA...IEV
A0YS48_LYNSP/10-130QHCLGYH------II...VVPNTVLPV.LEGA.VEVE------------------LKRII.GEICKTYRWKLHA...RSI
A0YTU0_LYNSP/12-132VYSLAAH------MV...LVTKYRKKA.ISQQ.MLDR------------------LNIIF.NETFQKWGCRLIE...FNG
A0YV57_LYNSP/12-133VSDLKAH------LV...LTTKYRRKV.FTGK.IIER------------------LHDVF.ESLLEQQECKLVS...FDG
A0YWZ8_LYNSP/7-123VTLLNYH------FV...FCPKRRKKV.LVGE.VAMR------------------LQDII.FELCVENNWRLIA...LEV
A0ZDZ5_NODSP/12-129TYSCKYH------VV...WCPKYRRKV.LVQG.VDVR------------------LKAIL.QEVATEFKSELIE...MEV
A1ASY5_PELPD/11-130KWDCKYH------IV...WVPKCRRKV.LYGR.IRKH------------------LADLL.HCLARQKECKIQE...GHL
A1B6L6_PARDP/10-129VFYHRYH------IV...WSTKYRYKV.RIGP.LRLR------------------VRDIC.RQVCRENGVDILR...GVL
A1T0T7_PSYIN/11-131VYRLIYH------FV...WIPKYRHKV.FNEP.HRST------------------IKAII.QKIGYDYDIDIVE...LEI
A1T5G3_MYCVP/16-133AFQCAYH------VV...WCPKYRRKV.IGGR.METR------------------LKEII.CEVVDEKGSWLIE...LET
A1U7S0_MARAV/12-131AYLLHAH------IV...FVTKYRRKI.FAPA.HHDA------------------FREAA.RQVCAEFGVEIEE...CNG
A1VLR6_POLNA/14-134VFLMHVH------LV...FITKYRHGV.FTKE.VIDD------------------LRAIF.ASVCKDFESELVE...FDG
A1ZGJ3_9BACT/12-129VYSLGYH------II...WCPKYRRKV.LTEE.IQKR------------------LKELL.LLKAKSLGIEIQT...MET
A3DH13_CLOTH/11-129QWNCKYH------IV...FVPKYRRQV.IYGK.IKKD------------------IGQIL.RKLCEMKGVEIIE...ASL
A3ESB6_9BACT/11-130TTDLKVH------LV...WIPKYRKAV.LTGD.VAVR------------------VRDLI.RQIAMEHELEVIS...GKV
A3HSL3_9BACT/3-118FVKVYIH------FV...WTTKNRYPY.FNSKELRLK------------------VWEHI.RENSKSKGIFVDF...VSG
A3HTZ3_9BACT/7-121FSQIYIQ------II...FAVKNRNTL.ISKI.WEEE------------------LYKYI.SGIITNKDQKLIA...ING
A3HZW2_9BACT/5-119YSQMYAQ------CV...FAVKYRNSQ.IHKN.WEKD------------------LFSVI.GNLIKENNCDLMI...VNG
A3ITV5_9CHRO/14-130VGLATVH------LV...WIPKRRRKV.LIGD.VKKR------------------LLEIF.AEVAKDNSFVIRS...QEV
A3JHU9_9ALTE/14-134VYKNTIH------LV...FVTKYRRAV.FTDE.ILTA------------------LEAIF.RETCEQMGSELIE...CNG
A3N3W0_ACTP2/3-118YTKLFYH------IV...FRTLQSVPA.INEE.NEKE------------------LYQYI.WAFCQQQKCTLHH...ING
A3W7S5_9RHOB/10-129RFYHRYH------VV...WATKYRYKV.LHGA.MRER------------------IRIII.IQTCDELGVHIVK...GVL
A3ZXL2_9PLAN/11-130RFDIKYH------FV...WVTKYRKPI.LAGE.VGVR------------------LRELV.REVCRTNEIEILE...GAV
A4E7V4_9ACTN/12-130KWMCKYR------IV...FTPKYRRKV.IYNQ.IRSD------------------IGEIL.RKLCEYKGIEIIE...GHL
A4J2W0_DESRM/10-130RYNINYH------LV...WCPKYRHQV.LTDQ.IETY------------------LKKLI.YNICDHYKYEVLT...MEV
A4N2N4_HAEIF/3-118YCRLFYH------IV...FRTKDSVYA.INEE.NEKI------------------LYDYI.WGFVKSHHSILHR...ING
A4TFZ9_MYCGI/18-138VYNLHAH------LV...FTSKYRRGP.FTDE.ILRR------------------CEQIM.SDVCADFGAELRE...FNG
A4XMT5_CALS8/11-128KFLINYH------FI...WIPKYRKDF.LKDPEVKKT------------------VEDTI.KELSKAYKFDILA...LEI
A5CZ87_PELTS/12-131VYSIQFH------LV...FCVKYRRKV.LKGP.VVER------------------LKEIV.HHIAERFGVEIIE...QET
A5EW57_DICNV/13-134VYKLTYH------LV...LVTKYRKKC.FTDV.MLTR------------------LHLIV.KELCQKWGIQLLS...FHG
A5F7S7_VIBC3/11-129YWRCKYH------IV...WTPKFRFKI.LKGN.VAKE------------------LNRSI.YILCNMKDCEVLE...LNV
A5FCA3_FLAJ1/8-121YTQLHVQ------FV...FAVKYRKAL.ITKD.WKER------------------LHQYI.TGIIQSNQHKMLC...INS
A5FHV9_FLAJ1/5-119YTQIHIH------FV...FAVKYRKAI.IHKN.WRDE------------------LFKYI.SGIIKNNNHKLLA...ING
A5FLD5_FLAJ1/5-119YSQLYIQ------IV...FAVKGRQNL.ISKK.WKDE------------------IYKYI.TGIITNQKQKLIA...ING
A5FLH9_FLAJ1/5-119FTKLWIH------AI...WATKNRQEL.IDFS.IEKT------------------VYDYI.HNELIDLDCPARI...ING
A5FNU2_FLAJ1/3-118FTKVYIH------CV...WSTKNRFPF.LNSTDLRQK------------------VWHHI.KENALKKEIYLEY...ISC
A5FTI1_ACICJ/14-134VYALNYH------LV...LVTKYRRKC.ITGP.MLGR------------------FREIA.AARCEGWGGKLIE...VNG
A5G3E6_GEOUR/11-130LWHCQYH------IV...WVPKYRYRV.LRGP.VAEE------------------VYKCI.QVFSGRLGCEVVE...LNV
A5G9R6_GEOUR/9-128QNGQYIH------RIALPYRIQYEKPR.TVAYPAEGS------------------SYLGIPCGIARTNAMKALQ...VGG
A5KLF3_9FIRM/15-133KWNCKYH------VV...FAPKYRRKV.FYNE.KKEA------------------IREII.RTLCQWKGVEIIE...GEV
A5MCH0_STRPN/12-130TWNCKYH------IV...FAPKYRRQI.IYGR.YKAS------------------IGRII.RDLCERKGVIIHE...ANA
A5TXA2_FUSNP/11-130VYSIQYH------IV...WCVKYRRKV.LIDD.IEKT------------------LKELL.IEISNENNIKIIE...MET
A5UR96_ROSS1/3-117YWRLHYH------LI...WSTQDRLPT.LTGE.REKM------------------FYGVL.YRKAAELGVKIHA...AGN
A5UWB3_ROSS1/9-123KLALFLH------LV...WATWDRLPL.ITPD.IERR------------------LYRNI.ESEARKQGCTVLA...LNG
A5VHM5_LACRD/16-137VYNFHYH------LI...WVTKYRHQA.FSTKELVDE------------------MKDIL.RMVAKDNEIVIEK...MEV
A5W7D3_PSEP1/16-130HPGRLYM------LT...TVTHQRRPL.FHNFNLARL------------------VVNHL.RQADRENSCATLA...WVV
A5ZT63_9FIRM/10-128KWNCKYH------IV...FAPKYRRKV.AYGK.IKQD------------------IANIL.SMLCKRKGVKIVE...AEI
A5ZT97_9FIRM/33-152VYSLQYH------LV...WCTKYRKKV.LKDG.IDAE------------------CKRML.YNLAEEYKFQILA...MEV
A5ZYT4_9FIRM/11-130VYLMYYH------LI...MVVKYRRKV.INDP.ISER------------------AKEIW.EYIAPRYGIVLEE...WNH
A6DFZ7_9BACT/5-123LCQNYVH------II...FHINFVNPVKIPSE.IERD------------------LYAYL.AEICKRHGSNSSM...ING
A6DIE5_9BACT/3-117YVQSYYH------IV...FSVKERLPL.LKQD.IRED------------------IYKYI.WGICKNKGCYLYR...IGG
A6DJE0_9BACT/5-115FNQVYVH------II...FHVGSG.AF.IRSD.NEAE------------------LYSYI.SGISKNLFCHIMA...ING
A6DTI6_9BACT/5-124LSQIYIH------TI...FHISFSDPVKIPNS.LQDD------------------LHKYI.AGHCKSESCIPIL...ING
A6NSH3_9FIRM/13-131KWNCKYH------IV...FAPKYRRKV.FYQE.KRAE------------------VGKIL.RQLCEWKGVRLLE...GEV
A6QB17_SULNB/11-130IWHCQYH------IV...WVPKYRYRI.LNGE.IARE------------------VENLI.RAFSHQMKCEIIE...LNV
A6TLW4_ALKMQ/10-129VFLMYYH------LV...LVVKYRRRV.IDHP.ISEE------------------LKAIF.VKIASNYNITLQE...WNH
A6VTE3_MARMS/13-129EPNREYF------IT...FNTLDRIPH.FNDFSLAHL------------------FCQQI.ETNQKYHKCTWLT...WVL
A8F1E5_RICM5/13-132VYYHRYH------IV...WITKYRYKV.LTQV.IKER------------------IREII.AQVSEEMNIRIVN...GVI
A8F729_THELT/10-129VFLLHYH------LV...LVIKYRRDV.ITDQ.ISKR------------------LKEIF.EYIQPSYNITLLE...WNH
O06525_HELPX/14-134VFLMHTH------LV...FVTKYRRKA.FNKE.VIDF------------------LGSVF.AKVCKDFESELVE...FDG
O83028_DEIRD/17-136VYQLEYH------LI...WCVKYRHQV.LVGE.VADG------------------LKDIL.RDIAAQNGLEVIT...MEV
P94655_CLOPF/10-128KWNCKYH------IV...FAPKHRRKE.IYGE.KKQE------------------ISEIL.RQLCELKGVRIVE...AHA
P97210_HELPX/24-147KHNLKAH------LI...LVCKYRKKL.LQGD.LNNF------------------IKSVI.DEIATQSHFIIIA...MES
Q0GL54_LACRE/14-133VYLLNYH------LV...MVVKYRRKV.INDE.ISEY------------------LKHRF.VVVGQAYGINLQE...WNH
Q0I2W7_HAES1/22-142VFNLHVH------LV...FVTKYRREV.FTKL.ILDD------------------LKVIF.ESVCSDFEAKLVE...FDG
Q11SK3_CYTH3/5-119LSKIWIH------AI...WSTKNRTEL.IEKH.HEQH------------------IYTFI.KNQFNECGCYIKN...ING
Q11V54_CYTH3/5-117LSQMYIH------LI...FGTKNRYPF.IIGS.VETE------------------LHKYI.AEILKSYESPAIK...INS
Q11Y47_CYTH3/3-117FARIWVH------LV...FATKNRTPF.LTRE.IRYQ------------------VKKRI.MQNCKEHGIFLQS...VNG
Q11YI8_CYTH3/5-119FSQMYIQ------IV...FAVKGRNSL.IHPS.WENE------------------LHKYM.TGFIQNNGQKLLA...ING
Q18CV0_CLOD6/9-126VYDCKYH------IV...FCPKYRKPV.LVGE.VEKM------------------LKEIL.PYKADELGAEIIE...MET
Q18KK1_HALWD/19-139ISLCKYH------FV...WCRKYRHGM.LEL..VQDE------------------LAELF.EGIAERFGHEIVSV.EVEI
Q1I4D7_PSEE4/16-130EPGRLYL------LT...TTTRDRKPL.FADFNLARV------------------VVKQM.RLCDQKHACRTLA...WVL
Q1I8P3_PSEE4/16-130EPGRLYV------LT...TVTHHRQPL.FLDLHHART------------------AIRFL.RQADQEGQCRSLA...WVV
Q1IW17_DEIGD/12-128VYLLNYH------FV...FIPKRRRKV.LVGP.VETR------------------LKEVL.AEKCAEMKWDILA...LEV
Q1Q1X9_9BACT/11-130IWHCQYH------IL...WTPKYRLRI.LTGQ.VAEE------------------VGKCI.RAFSEQKGCEVVE...LNV
Q1QF32_NITHX/11-129VWDCKYH------IV...WVTKYRFAV.LGGD.VGFR------------------ARELL.REIALSHEMVIHA...GTI
Q1VS81_9FLAO/5-119YTQLYFH------IV...FAVKGRNNL.IAVR.WKDE------------------LYKYI.TGIISNKNQKLMI...ING
Q1VUJ0_9FLAO/5-119YTQLYVQ------FV...FSVKRRQNL.IKES.FRDE------------------LEKVM.CGIITNQKCKTYA...IYC
Q1VXK0_9FLAO/13-133VSVLLYH------FV...FPAKYRRLV.FDKK.VDHT------------------LIEVC.LEIEKRYEIHSLE...IGI
Q20XV6_RHOPB/11-129KWECKYH------VV...FIPKCRRKT.LYGE.LRRH------------------LGELF.RKLAQQKESRIQE...GHL
Q24Z31_DESHY/8-127VFLLTYH------LV...MVVKYRRKV.IDDT.IALR------------------IREIG.ESIGKNYHITFLE...YNH
Q2JNY0_SYNJB/12-132VSDLKAH------LV...LTTKYRRKV.FTSE.MLQR------------------LHEVM.YDLCQKWGCKLIE...FNG
Q2JT06_SYNJA/33-153VYSLQIH------LV...LVTKYRRRV.ITAP.MLQR------------------LEDIF.RATCQKWRSSLVE...FNG
Q2JX40_SYNJA/15-131VGLAVVR------LV...FCPKRRKKV.LVGE.VRNR------------------LFELW.QELSSEKGWHVRA...IEI
Q2S639_SALRD/15-131VHAVKYH------FV...FCPKRRASV.LKDE.VANR------------------LGKVL.HEVAEEHDWEINS...LAI
Q331U4_CBCP/17-137VYRCCYH------VV...FCPKYRRSI.LLGN.VTNR------------------LKEIC.YEIAKTHDFLIEE...IET
Q332K6_CBCP/12-129ISLINYH------FI...FCPRYRRKIFDISN.VENR------------------FKELV.KDICEELDIKIIA...MEC
Q38463_BPPHH/12-130VYALQYH------FV...TVTKYRADI.LTYE.RLER------------------VAEIA.HDIADDFEADIKN...VDG
Q3AEI0_CARHZ/18-135MYSCKYH------VV...WCPKYRRPV.LKDG.VDVR------------------LKEIL.FEVAREKRAEIIE...LEV
Q3ASF0_CHLCH/5-119YSQIYIQ------YV...FAVKGRENL.LQKP.WRDD------------------VFKYI.AGIIKGKNQKPII...VNG
Q3BWF5_XANC5/19-133SPNSAYL------LT...TATWQRRAV.FADFLIAAT------------------ACRAF.TKATPCDA.RLLA...WVL
Q3EVJ8_BACTI/10-129VFLLYYH------LV...LVVKYRRNV.FDDD.MSDY------------------AKDMF.VRLSENYHITLVE...WNH
Q3ILG5_PSEHT/10-130KYLIALH------LI...LVVKYRKQL.LKGD.VGDF------------------VKQKI.TEIAERSEFNIEE...IEV
Q3IPA5_NATPD/11-130VSSCKYH------FV...WCRKYRHQI.LNA..VEDD------------------VRELF.DETADHFGHEILA...LEI
Q3JB10_NITOC/14-133VTRLVVH------LV...FTTKYRGKV.FDGY.ILGQ------------------LREAF.ESACEKLDCRILE...FDG
Q3JE33_NITOC/16-133VFSLKLH------LV...WCPKYRRGV.LVGE.IAER------------------LCALL.HKKADELEMTIHA...LEV
Q3M4G8_ANAVT/13-135VFDIHLH------MV...FITKFRRLV.FTEA.MLAD------------------MEPIF.VRVLTAHQCILEE...FNG
Q3MDI5_ANAVT/3-118LWRLYYH------IV...WATKQRLPL.IMPS.KESE------------------LHNYI.IGKSDALNCIVHG...IGG
Q3R3H9_XYLFA/22-141VFKMHVH------LV...FVAKYRRNV.FDGN.AIQR------------------LRAIF.TRVCTDFEAKLIE...MDG
Q464U6_METBF/10-131VYKIRYH------MV...FCMKYRKKL.LLDAEIIRF------------------LKTIC.FGIGERYCFEFDA...IGT
Q46ET2_METBF/11-131YGQITYH------IV...LVPKYRYSI.FYNKRIKKD------------------CELIL.SSICMEKGYKIHA...MEV
Q484I4_COLP3/11-129GWDCKYH------IV...FIPTKRRKM.IFGS.IRKH------------------LGEVF.HELARQKCVIIEE...GHL
Q485N4_COLP3/13-128LKHHIYH------VI...TCTKNRQPF.FNDFECARF------------------LINEM.TNLVEQKEINSIT...WVI
Q48DG1_PSE14/17-131GTGQIYL------VT...AKTLQRKPA.FSDWRMGRL------------------FVDEL.RQVQEQQLADSLA...WVV
Q4BZD6_CROWT/12-132VSDLKAH------LV...LTTKYRKDV.FTGE.MIER------------------VHEIM.FDLCKKWDCKLIE...FNG
Q4C7A6_CROWT/12-133VYLLTVH------IV...LVTKYRRKV.ITND.LLSR------------------LQRIF.TDTCSKWDCRLVE...FNG
Q4C9I1_CROWT/12-132VSDLKAH------LV...LTTKYRKKV.FTSE.MLTR------------------LHEIT.ENLLEKWECRLIE...ING
Q5GN45_LYSSH/10-128TWNCKYH------IV...FVPKYRRQV.IYRQ.IKAE------------------IGRIL.RQLCERKGVEIVE...ATA
Q5J4C5_SALCH/18-137VSKLVVH------LI...FTTKYRCKL.FDGQ.IIAQ------------------LRDAF.GSAAAKLECEIIE...MDG
Q5JI87_PYRKO/12-132VYSLYYH------LI...LVVKHRRKV.FTNDRIIDF------------------LKQKI.HEISETHEVEVLT...IET
Q5NX16_AROAE/12-130VFNLKLH------II...FVTKYRRKT.LTPE.LLDY------------------LKEAF.ADCLSAWRCKLVE...FGG
Q5NY63_AROAE/12-103RQGSTYR------TG...FPVQ...............------------------...............TIGA...TSL
Q5V3V2_HALMA/10-129VYNINYH------FV...WCPKYRHTI.LEP..IEDS------------------LEASF.RAMCDEYGYEILS...LHI
Q5V7Q1_HALMA/12-132TYSLHYH------LI...LTTKYRRGV.LTEE.RTQF------------------IHEVI.SGFTDNYGVELTN...LDG
Q5W394_9BACT/11-130FYRCQYH------IV...WTPKYRYKI.LKGN.IAQE------------------LARSI.YVFCNMKNCRVVE...LNV
Q5WKC7_BACSK/10-128RWNCKYH------IV...FIPKYRRKI.VYGK.LRKD------------------IGAIL.RRLCEMKDVEIIE...AHA
Q649F0_9ARCH/18-138AWQIHYH------IV...FPVKYRKAL.LEEE.VVEI------------------IKETA.IGIQERYAIEFEA...LGM
Q6LR15_PHOPR/12-131VFKIQYH------FV...FVTKYRYQV.LTGD.VGLK------------------ARELI.RQTCHAFEIDILK...GVI
Q6T8F3_9CHLA/11-131IFKNNVH------LV...FVTKYRRGV.FTKE.MLER------------------TEAIM.KETCEQMDCELLE...FGG
Q74KQ8_LACJO/18-139VYNTHYH------LI...WCTKYRNQI.FTNTNLAEE------------------MRKLL.LQIAEDNQIKIEK...MEI
Q7M7F4_PHOLL/10-129VFQIEYH------FV...WVTKYRYKV.LTGE.VASR------------------VRELI.RQTCGSFEIRILK...GVV
Q7US03_RHOBA/3-117YTNLRVH------LI...WSTKDRKQW.FFDE.FQEE------------------LSAYI.GGVLRKRKHSLLA...AGG
Q7UVV9_RHOBA/38-155ASGHLYH------VL...NRANRRATI.FRKQQDYEA------------------FESVL.AEALSKDEVELFS...YCL
Q7WCD1_BORPA/9-125LQGHPHH------VV...QRAHRRQQI.FTDEADCLP------------------YLNDL.QRERRRLQVAVYA...WCL
Q7X379_9BACT/16-133PGGVVYH------AF...NRGSRKGPL.FRSPEEYIA------------------FERVL.AEGREVRPMRIVA...YCL
Q815G4_BACCR/12-129VSLINYH------FV...FCPRYRRKIFLNTK.VEER------------------FKELV.QEICGEMDVAIVA...MEC
Q82PQ1_STRAW/18-138VFNLHAH------LV...FVTKYRREI.FNGE.MLTR------------------CEAIM.SDVCESFGAELRE...FNG
Q82QX0_STRAW/13-131SHTLSPR------VA...MLWEASRSVWATTP.HPRQ------------------MKSPW....STRFRLSLRE...FNG
Q82SR9_NITEU/15-133RWDCKYH------VV...FIPKRRKKR.IFGM.LRWH------------------LGELF.HELASHKESKIVE...GHL
Q83T86_SALTI/25-144AFLLHVH------LV...FITKYRRKI.LGES.HYAA------------------FHQYA.AEVCRDFGGELKE...SNG
Q893W3_CLOTE/12-126SENAIYH------IM...IRSITEVPL.FKKHEDKIR------------------YLNKM.REYQKIYKFKVYA...YCL
Q897V3_CLOTE/10-129AFLLNYH------LV...LVIKYRRNV.IDDQ.VSNR------------------LKEIF.EYICPKYNIVLEE...WNH
Q898F8_CLOTE/24-138TDNSIFH------IM...VRSISEVNL.FQTDFDKIQ------------------YLNFV.KFYKEIFNFKVYA...YCL
Q899Z5_CLOTE/12-129VYSCKYH------IV...WCPKYRRKV.LIGN.VETR------------------LKELL.IETCADIEVDIIK...MEL
Q8CM83_THEEB/12-128VTDLKIH------LV...CVTKYRRPV.LSAE.GLEL------------------IEKSF.REVAKKMDFQILE...FNG
Q8CXX7_ECOL6/29-148AYLLHVH------VV...FMTKYRRPV.FGEL.HHAN------------------MRQYV.AEVCADFGAELKE...CDG
Q8GF06_ENTFC/10-129VFLLYYH------LV...LVTKYRRQV.IDDE.ISDY------------------AKTTF.ERISESYHITLVE...WNH
Q8PRR7_METMA/14-133VYNTNYH------FV...WSTKYRRKI.LIGK.IAED------------------LKELH.EQIAKEKGVTLVT...QEV
Q8R791_THETN/9-123SKSGYYH------VM...LRGNEKKNI.FNNDDDKKR------------------FIEIL.AEKKLDGKFYLTA...FCL
Q8RLV2_XENNE/11-131VTVLMYP------IV...LPAKYRRAV.FDAR.VDEI------------------LKTVC.LEIELRYQVKFLE...IGT
Q8TU17_METAC/10-130KFLLMYH------II...FVCKYRKAI.LEP..ISEE------------------LKQIV.IDISKGSNFEILE...MET
Q8X2J7_ECO57/19-139VFLMHVH------LF...FVTRYRRQI.FDYD.ATEK------------------LRTYF.SNVCADFEAELVE...MDG
Q8XV65_RALSO/11-124DSPV..H------VL...QRGNNRQAV.FRADEDYAF------------------YLDTL.RMAAREHDFAIHA...FAL
Q8YK47_NOSS1/12-135VFSIHLH------VV...LIAKYRKEV.ITQE.ILVK------------------LQEVF.NRVCEKRKCLLTE...FSG
Q8YKY9_NOSS1/9-130VYRLNAH------IV...LVVKYRRKA.INAE.ILNR------------------LKEII.TDTLKKWDCELLE...FNG
Q8YLC6_NOSS1/12-132VSDLKVH------LV...LVTKYRRKA.FTSE.MLSR------------------LNVVM.QELLEKWDCKLVT...FNG
Q8YMI3_NOSS1/9-129QPGYSYH------IT...IRCNNREFR.LTRWECRQV------------------LLYAI.KKAIDKYQFKLYGLCIMCI
Q8YRS2_NOSS1/12-130IGLATVH------LV...WIPCRRRRVFANNEKLKLR------------------CIEIF.QSVANDKRWIIKA...LEI
Q8YWC8_NOSS1/12-129VYSCKYH------IV...WTPKYRRKV.LKDG.VDTR------------------LKELL.QQIAAEIQVEILE...MEV
Q93C78_HELPX/14-131VYSCKYH------IV...WCPKYRRKV.LVGA.VELR------------------LKEII.QEVAKELRVEIIE...MQT
Q93PB3_9BACT/11-128LFDLKYH------LV...WITKYRKQV.LVGS.VAER------------------SRELI.REICKANDVEIVK...GHV
Q972N6_SULTO/10-128KYLCNYH------FV...WIPKYRRKV.LTGE.VAEY------------------TKEVL.RTIAEELGCEVLA...LEV
Q987Z8_RHILO/19-133VPGLPHH------VT...QRGNGRAKV.FFTTEDYAL------------------YKILL.VEHCRAANVGIWA...WCL
Q9HHX7_HALSA/8-124TYNLNYH------IV...WLPKYRQSV.LVNE.VASR------------------VRSIL.HEIAADKGVEILD...LTV
Q9HKW9_THEAC/17-134VYSCQYH------VI...FCPKYRRKV.LVDG.IDKR------------------LKELI.LEKQNEYQYKILE...MEV
Q9HSD5_HALSA/12-126VHKLQYH------FI...WCPKYRKSV.LTGE.VRDR------------------LEELI.KEKADELGVEILE...LAI
Q9RMA7_BACCI/9-123TPERFYH------IV...SRGNRRDPL.FRNASDFQA------------------FLHIL.TQLYEKYPFEIAS...YCL
Q9RT39_DEIRA/11-130VSRLTLH------VV...WATKYRYHV.LVGE.IKPR------------------CRELL.IQICKAEDVRILK...GVV
Q9X2F2_THEMA/10-126HYNLNYH------FA...WIPKYRRKI.LVGS.IAEE------------------LERIL.RNTAKQHGIEILA...LSI
Q9ZN95_9RICK/11-130VYECTYH------IV...WITKYRYPV.LVGD.IGQK------------------AKEVV.QEVCANNQVEIIR...GRV

PF04986

A0NYF6_9RHOB/143-334DTGQLAFFGSMTQLANRRVFLRHLKPVRSK................................................RW
Q9RDU8_PSEPV/69-254LRTFVR....RGLIEKCDAEEMAGWEHGG.................................................GF
Q83XH8_VIBAN/105-287DDLNLS.TSTTHHIQYYRQWNFFLERHYQR................................................YW
Q01P74_SOLUE/145-335RRKKLAFHGSLLWLQEPRSFARFLEDLHQY................................................DW
A9L1Z0_SHEB9/140-307...................FQLTLPHQSHS................................................KW
A5YVZ3_SALTM/172-397ARCMEK....RGILERDAENTWLTLEEGEDDTLTQLHGASVTYRIAVGPQQGRKVFTLQTLPGREDKADSSSRVANHAGF
A1WDQ9_ACISJ/182-382LRAFVG....RGLLEGFEAQEMLGYKHS..................................................GF
Q79BR9_PSESD/174-368LRAFVA....RGLLENCDAKDMLGYKHS..................................................GF
Q12Q53_SHEDO/139-306...................FNIKLPSATPK................................................KW
Q47906_9FUSO/38-214YQDPIW.......KEKAKQVANKLYKENAR................................................LF
A5GBJ9_GEOUR/131-297.................LPEVIFPGQVWDK................................................EW
A4BNA6_9GAMM/69-274GRFLER....QGLLERDAENSYLAGDAFEAGPMEQLLGSSITYRIAVGPQQGRKVFTLQTLPACEEPFDVG..VGKVAGF
Q981L3_RHILO/137-326TAGKLRFFSSLAGLSDAAAFRRHLDRVRHI................................................NW
A3JF95_9ALTE/140-304....................GFTLPESIPG................................................HW
Q5P667_AROAE/144-333DAGELHFFNALAALHAPAVFARHLARARRS................................................EW
Q01TH4_SOLUE/47-236AEGKLGFYGQLAHLQTPQAFAAWLRPLFRS................................................DW
Q7UCL9_SHIFL/142-324PELVIP.DELAVEGNSKRDWNRFLDTHYRR................................................GW
Q328X8_SHIDS/147-330SEGLAM.PESLSHITTESQRRSLVLKAGGK................................................YW
Q2W8U4_MAGSA/134-323QAGALAFFSDLAALAEPAGFTRYLAPLRKA................................................NW
Q1ZUG8_PHOAS/139-306...................LKWALPDHITK................................................KW
Q7TTN7_RHOBA/141-311.................GLYAQIDREAWSK................................................DF
B6EMI2_ALISL/105-289YELDLS.SEECPYIRNKTDWSRFLSSQYNR................................................RW
A1WDQ5_ACISJ/174-373LRAFVG....RGLLESFEAQEMLGYKHS..................................................GF
A3XUQ2_9VIBR/116-283...................PTLWLPSGIPK................................................QW
A9AVJ8_HERA2/140-307.................PGGTTRDSAIWQR................................................PW
Q2FD24_ACIBA/179-405CRHLTR....KGWLEGEGESAFLADSAAGDDSMDGLRMSSITYRIATGRDAGCKVVTLQTLPGDAGSLEGE..AGKVGGF
A8H5W4_SHEPA/54-221...................LDITLPAATPK................................................KW
A0P0Y4_9RHOB/143-332EAGGLQFFGSIADLAGPAAFARLLAAARRR................................................DW
Q12YW6_METBU/152-326..........LSKVQAFSHLVNQLFKEYPD................................................GF
Q1VPE4_9FLAO/140-316...............LPQLPQSLYDKLFKK................................................EW
Q9F8W1_ECOLX/171-394GRYLER....QGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQAGRKVFTLQTLPTSGDPFGDG..IGKVAGS
A9B8K8_HERA2/140-308.................PHGTVIPAAVWEH................................................DW
Q48B93_PSE14/155-338LSQLTM.PPPLAHILCESDWRRLILTAGGQ................................................HW
Q56753_9FLAO/152-326...............NLKEYTKIRQNLWEK................................................PW
A6TTH3_ALKMQ/138-326HKNKIK....RPEGMKYLEIHDLLKKLRTK................................................NW
A5G657_GEOUR/141-307.................GLLAEVPKEAWLK................................................PW
Q93R66_9PSED/154-336EHTTV..PPENAHLQSENDWRHLVLNAGGQ................................................HW
A8LSZ6_DINSH/144-335QTGKLAFFGELAGLADPDAFASHLAPLRKA................................................SW
Q121V9_POLSJ/144-335RAGQLNFFGEHAALADAKAFADWLAPLRKC................................................EW
A3UHI1_9RHOB/361-552DAGKLTFFGKLAGLTDRRTFLKHLSPVRKK................................................RW
A0LBL2_MAGSM/140-314.................RPDIAWPQQAWQQ................................................DW
Q7WXN2_CUPNH/120-251GRGQLRFFGDYATLADPAAFAQWIAPLR..................................................EW
A6VW84_MARMS/139-317REGLLP.......ALSQMEVSRLLNVLMQK................................................PW
Q8EE63_SHEON/141-311.................ELAIPAAETLMAK................................................PW
Q039J1_LACC3/145-318SPWDKK.........RVQPRLQRAYKANAE................................................GF
A9B8X8_HERA2/140-308.................AIAATIPSTAWEH................................................DW
A1TZA6_MARAV/137-319RTGELH......RLTEPQAIDDVLKKVMQQ................................................DW
Q1M5F3_RHIL3/143-332DLGQLRFFGDIAGLADPAAFNRIVKEARRV................................................DW
Q1M648_RHIL3/143-332DAGKLQFFSDLRALSDRNAFRRTVAPLRKA................................................DW
A1VWX4_POLNA/23-168MKKLLLSVMKRGLY..................................................................
A3J7Z8_9ALTE/139-305....................GLWLPRDIPK................................................AW
A6DN83_9BACT/134-299...................KIGFQSSLYAK................................................KW
A7B3V2_RUMGN/140-328NTDQLEFHGTAEKYRNHYEFKELIDSCYDT................................................EW
Q6LHG6_PHOPR/138-305...................PLLWLPQNIPK................................................QW
A3XDT2_9RHOB/144-335QAGDLAFYGDLERLALTDAFTTWLTPFRKS................................................EW
A0PB90_PASPI/105-289NALNTK.HDNYQHIRDFRGWSQFLSSQYSR................................................KW
Q0A7P5_ALHEH/141-322DTGRLK.....APRGDHPTVDYWLKATAKK................................................EW
A3JIR7_9ALTE/137-319NAGELH......RVTRNGEIDGVLDGLMQH................................................EW
A0YEL0_9GAMM/162-387ALHLER....QGLLTRDDESSYLTLDLQDDDAMNQLQGHSITYRIAVGPQQGRKVFTLQTIPSWEDDDYGSSPVGKVAGF
Q7TTG3_RHOBA/141-314.................SYFDSIPDDVWKG................................................RF
A5G455_GEOUR/137-325ERAELT....VPDGERPQQVLNLLNKLGRK................................................KW
Q1Q731_9BACT/12-184DTEEIE............KIVDACYRCYPE................................................GF
B2JTR0_BURP8/144-333DTGSLRFHGQLEPLRDPRAFAAWLAPAAQA................................................EW
Q01XA5_SOLUE/73-262HQGKLVFPGSLQPMAAEKSFAKFLRPLFRK................................................EW
A6FA86_9GAMM/141-311.................ELVIEQADELMKK................................................SW

PF01797

B8GCQ7_CHLAD/12-128MPDHL-------------------------------------------------------------------------PP
B1KEE0_SHEWM/11-130QIDHV-------------------------------------------------------------------------HL
B4SJM3_STRM5/13-127MPDHL-------------------------------------------------------------------------HW
B9LSV3_HALLT/9-121MPDHV-------------------------------------------------------------------------HL
B9LMY5_HALLT/12-130GSDHV-------------------------------------------------------------------------HI
B4SER8_PELPB/11-131DKDHV-------------------------------------------------------------------------HF
A8KYK3_FRASN/14-134EDDHV-------------------------------------------------------------------------HL
A8L9Q9_FRASN/6-123TPDHV-------------------------------------------------------------------------RL
B1YEE0_EXIS2/12-129DQDHT-------------------------------------------------------------------------HL
B1YKP1_EXIS2/10-129DGDHI-------------------------------------------------------------------------HV
A0A7E6_9CAUD/12-134ESDHV-------------------------------------------------------------------------HI
A0JQH2_LACS1/15-136MPDHV-------------------------------------------------------------------------HM
A0L321_SHESA/19-138EQDHI-------------------------------------------------------------------------HL
A0M0J7_GRAFK/11-130SKDHV-------------------------------------------------------------------------HM
A0QCS6_MYCA1/1-112EADHV-------------------------------------------------------------------------HL
A0YIB8_LYNSP/13-134EHDHI-------------------------------------------------------------------------HL
A0YJH2_LYNSP/10-131EVDHI-------------------------------------------------------------------------HV
A0YNL9_LYNSP/12-131ETDHI-------------------------------------------------------------------------HL
A0YQF8_LYNSP/12-130ASDHV-------------------------------------------------------------------------HL
A0YS48_LYNSP/10-130MPDHV-------------------------------------------------------------------------HV
A0YTU0_LYNSP/12-132ESDHV-------------------------------------------------------------------------HL
A0YV57_LYNSP/12-133EKDHV-------------------------------------------------------------------------HL
A0YWZ8_LYNSP/7-123MPDHV-------------------------------------------------------------------------HL
A0ZDZ5_NODSP/12-129MPDHV-------------------------------------------------------------------------HI
A1ASY5_PELPD/11-130QPDHI-------------------------------------------------------------------------HI
A1B6L6_PARDP/10-129SSDHV-------------------------------------------------------------------------HM
A1T0T7_PSYIN/11-131PEDHI-------------------------------------------------------------------------HM
A1T5G3_MYCVP/16-133MPDHV-------------------------------------------------------------------------HL
A1U7S0_MARAV/12-131ESDHV-------------------------------------------------------------------------HL
A1VLR6_POLNA/14-134EDDHV-------------------------------------------------------------------------HL
A1ZGJ3_9BACT/12-129MTDHV-------------------------------------------------------------------------HL
A3DH13_CLOTH/11-129CPDHI-------------------------------------------------------------------------HM
A3ESB6_9BACT/11-130ASDHV-------------------------------------------------------------------------HV
A3HSL3_9BACT/3-118HDDHC-------------------------------------------------------------------------HC
A3HTZ3_9BACT/7-121MEDHI-------------------------------------------------------------------------HI
A3HZW2_9BACT/5-119MPDHV-------------------------------------------------------------------------HT
A3ITV5_9CHRO/14-130APDHV-------------------------------------------------------------------------HL
A3JHU9_9ALTE/14-134EGDHV-------------------------------------------------------------------------HL
A3N3W0_ACTP2/3-118MPDHL-------------------------------------------------------------------------HL
A3W7S5_9RHOB/10-129ARDHV-------------------------------------------------------------------------HM
A3ZXL2_9PLAN/11-130SRDHV-------------------------------------------------------------------------HV
A4E7V4_9ACTN/12-130MPDHV-------------------------------------------------------------------------HV
A4J2W0_DESRM/10-130MPDYI-------------------------------------------------------------------------HL
A4N2N4_HAEIF/3-118MPDHL-------------------------------------------------------------------------HL
A4TFZ9_MYCGI/18-138ETDHV-------------------------------------------------------------------------HL
A4XMT5_CALS8/11-128MPDHI-------------------------------------------------------------------------HL
A5CZ87_PELTS/12-131VLDHI-------------------------------------------------------------------------HI
A5EW57_DICNV/13-134EPDYV-------------------------------------------------------------------------HL
A5F7S7_VIBC3/11-129QPGHV-------------------------------------------------------------------------HL
A5FCA3_FLAJ1/8-121MPDHI-------------------------------------------------------------------------HI
A5FHV9_FLAJ1/5-119VSDHV-------------------------------------------------------------------------HI
A5FLD5_FLAJ1/5-119MPDHI-------------------------------------------------------------------------HI
A5FLH9_FLAJ1/5-119MPDHI-------------------------------------------------------------------------HV
A5FNU2_FLAJ1/3-118YSDHC-------------------------------------------------------------------------HC
A5FTI1_ACICJ/14-134EPDHV-------------------------------------------------------------------------HL
A5G3E6_GEOUR/11-130QPDHV-------------------------------------------------------------------------HL
A5G9R6_GEOUR/9-128YDDHI-------------------------------------------------------------------------HI
A5KLF3_9FIRM/15-133CPDHI-------------------------------------------------------------------------HL
A5MCH0_STRPN/12-130CSDHI-------------------------------------------------------------------------HM
A5TXA2_FUSNP/11-130DLDHI-------------------------------------------------------------------------HI
A5UR96_ROSS1/3-117VEDHV-------------------------------------------------------------------------HV
A5UWB3_ROSS1/9-123TEDHV-------------------------------------------------------------------------HL
A5VHM5_LACRD/16-137MPDHV-------------------------------------------------------------------------HV
A5W7D3_PSEP1/16-130MPDHV-------------------------------------------------------------------------HW
A5ZT63_9FIRM/10-128CPDHV-------------------------------------------------------------------------HM
A5ZT97_9FIRM/33-152MPDHI-------------------------------------------------------------------------HL
A5ZYT4_9FIRM/11-130DIDHV-------------------------------------------------------------------------HV
A6DFZ7_9BACT/5-123VNDHV-------------------------------------------------------------------------HI
A6DIE5_9BACT/3-117IEDHI-------------------------------------------------------------------------HM
A6DJE0_9BACT/5-115TGNHI-------------------------------------------------------------------------HL
A6DTI6_9BACT/5-124TEDHI-------------------------------------------------------------------------HL
A6NSH3_9FIRM/13-131CPDHV-------------------------------------------------------------------------HI
A6QB17_SULNB/11-130QIDHV-------------------------------------------------------------------------HL
A6TLW4_ALKMQ/10-129DIDHI-------------------------------------------------------------------------HI
A6VTE3_MARMS/13-129MPDHF-------------------------------------------------------------------------HG
A8F1E5_RICM5/13-132SSDHL-------------------------------------------------------------------------HI
A8F729_THELT/10-129DRDHV-------------------------------------------------------------------------HV
O06525_HELPX/14-134ESDHV-------------------------------------------------------------------------HL
O83028_DEIRD/17-136MPDHV-------------------------------------------------------------------------HL
P94655_CLOPF/10-128CVDHI-------------------------------------------------------------------------HM
P97210_HELPX/24-147DIDHL-------------------------------------------------------------------------HL
Q0GL54_LACRE/14-133DQDHV-------------------------------------------------------------------------HV
Q0I2W7_HAES1/22-142EDDHV-------------------------------------------------------------------------HL
Q11SK3_CYTH3/5-119MPDHI-------------------------------------------------------------------------HC
Q11V54_CYTH3/5-117VPDHM-------------------------------------------------------------------------HI
Q11Y47_CYTH3/3-117YRDHL-------------------------------------------------------------------------HC
Q11YI8_CYTH3/5-119MPDHI-------------------------------------------------------------------------HI
Q18CV0_CLOD6/9-126DKEHV-------------------------------------------------------------------------HL
Q18KK1_HALWD/19-139APDHV-------------------------------------------------------------------------QL
Q1I4D7_PSEE4/16-130MPDHV-------------------------------------------------------------------------HW
Q1I8P3_PSEE4/16-130MPDHV-------------------------------------------------------------------------HW
Q1IW17_DEIGD/12-128MPDHV-------------------------------------------------------------------------HL
Q1Q1X9_9BACT/11-130QIDHV-------------------------------------------------------------------------HL
Q1QF32_NITHX/11-129NRDHV-------------------------------------------------------------------------HL
Q1VS81_9FLAO/5-119MPNHV-------------------------------------------------------------------------HL
Q1VUJ0_9FLAO/5-119NPDHT-------------------------------------------------------------------------HI
Q1VXK0_9FLAO/13-133DKDHA-------------------------------------------------------------------------HF
Q20XV6_RHOPB/11-129MPDHV-------------------------------------------------------------------------HM
Q24Z31_DESHY/8-127DRDHI-------------------------------------------------------------------------HI
Q2JNY0_SYNJB/12-132EADHV-------------------------------------------------------------------------HL
Q2JT06_SYNJA/33-153EADHV-------------------------------------------------------------------------HL
Q2JX40_SYNJA/15-131APDHV-------------------------------------------------------------------------HL
Q2S639_SALRD/15-131RPDHV-------------------------------------------------------------------------HL
Q331U4_CBCP/17-137DKDHV-------------------------------------------------------------------------HM
Q332K6_CBCP/12-129DRDHT-------------------------------------------------------------------------HM
Q38463_BPPHH/12-130GTDHV-------------------------------------------------------------------------HI
Q3AEI0_CARHZ/18-135MPDHV-------------------------------------------------------------------------HL
Q3ASF0_CHLCH/5-119IEDHI-------------------------------------------------------------------------HV
Q3BWF5_XANC5/19-133MPDHV-------------------------------------------------------------------------HW
Q3EVJ8_BACTI/10-129DVDHV-------------------------------------------------------------------------HI
Q3ILG5_PSEHT/10-130DKDHI-------------------------------------------------------------------------HI
Q3IPA5_NATPD/11-130ADDHV-------------------------------------------------------------------------HL
Q3JB10_NITOC/14-133EEDHV-------------------------------------------------------------------------HL
Q3JE33_NITOC/16-133MPDHV-------------------------------------------------------------------------HL
Q3M4G8_ANAVT/13-135EPDHV-------------------------------------------------------------------------HL
Q3MDI5_ANAVT/3-118MEDHI-------------------------------------------------------------------------HL
Q3R3H9_XYLFA/22-141EDDHV-------------------------------------------------------------------------HL
Q464U6_METBF/10-131DGDHV-------------------------------------------------------------------------HL
Q46ET2_METBF/11-131VDDHV-------------------------------------------------------------------------HL
Q484I4_COLP3/11-129MPDHV-------------------------------------------------------------------------HM
Q485N4_COLP3/13-128MPDHL-------------------------------------------------------------------------HW
Q48DG1_PSE14/17-131MPDHI-------------------------------------------------------------------------HW
Q4BZD6_CROWT/12-132ESNHV-------------------------------------------------------------------------HL
Q4C7A6_CROWT/12-133ETDHV-------------------------------------------------------------------------HL
Q4C9I1_CROWT/12-132EEDHV-------------------------------------------------------------------------HI
Q5GN45_LYSSH/10-128CSDHI-------------------------------------------------------------------------YM
Q5J4C5_SALCH/18-137EQDHV-------------------------------------------------------------------------HL
Q5JI87_PYRKO/12-132DQDHV-------------------------------------------------------------------------HI
Q5NX16_AROAE/12-130..DHV-------------------------------------------------------------------------HL
Q5NY63_AROAE/12-103MGDHV-------------------------------------------------------------------------HM
Q5V3V2_HALMA/10-129SPDHV-------------------------------------------------------------------------HL
Q5V7Q1_HALMA/12-132EDDHV-------------------------------------------------------------------------HI
Q5W394_9BACT/11-130QPDHV-------------------------------------------------------------------------HL
Q5WKC7_BACSK/10-128MIDHI-------------------------------------------------------------------------HM
Q649F0_9ARCH/18-138DRDHI-------------------------------------------------------------------------HI
Q6LR15_PHOPR/12-131SKDHV-------------------------------------------------------------------------HL
Q6T8F3_9CHLA/11-131EDDHI-------------------------------------------------------------------------HM
Q74KQ8_LACJO/18-139MPEHV-------------------------------------------------------------------------HL
Q7M7F4_PHOLL/10-129SQDHV-------------------------------------------------------------------------HI
Q7US03_RHOBA/3-117VEDHI-------------------------------------------------------------------------HL
Q7UVV9_RHOBA/38-155MPNHW-------------------------------------------------------------------------HL
Q7WCD1_BORPA/9-125MPNHV-------------------------------------------------------------------------HL
Q7X379_9BACT/16-133MPNHW-------------------------------------------------------------------------HL
Q815G4_BACCR/12-129DKDHV-------------------------------------------------------------------------HL
Q82PQ1_STRAW/18-138EGDHV-------------------------------------------------------------------------HL
Q82QX0_STRAW/13-131ERDHV-------------------------------------------------------------------------HL
Q82SR9_NITEU/15-133MDDHV-------------------------------------------------------------------------HM
Q83T86_SALTI/25-144DVDHV-------------------------------------------------------------------------HM
Q893W3_CLOTE/12-126MSNHG-------------------------------------------------------------------------HF
Q897V3_CLOTE/10-129DLDHV-------------------------------------------------------------------------HL
Q898F8_CLOTE/24-138MSNHG-------------------------------------------------------------------------HF
Q899Z5_CLOTE/12-129MPDHV-------------------------------------------------------------------------HM
Q8CM83_THEEB/12-128EEDHV-------------------------------------------------------------------------HA
Q8CXX7_ECOL6/29-148EADHV-------------------------------------------------------------------------HM
Q8GF06_ENTFC/10-129DKDHV-------------------------------------------------------------------------HI
Q8PRR7_METMA/14-133MPDHV-------------------------------------------------------------------------HL
Q8R791_THETN/9-123MSNHV-------------------------------------------------------------------------HL
Q8RLV2_XENNE/11-131DKDHV-------------------------------------------------------------------------HF
Q8TU17_METAC/10-130DKDHI-------------------------------------------------------------------------HF
Q8X2J7_ECO57/19-139EPDHV-------------------------------------------------------------------------HL
Q8XV65_RALSO/11-124MPNHV-------------------------------------------------------------------------HL
Q8YK47_NOSS1/12-135EDNHV-------------------------------------------------------------------------HL
Q8YKY9_NOSS1/9-130EPDHV-------------------------------------------------------------------------HI
Q8YLC6_NOSS1/12-132EEDHV-------------------------------------------------------------------------HL
Q8YMI3_NOSS1/9-129MSNHI-------------------------------------------------------------------------HY
Q8YRS2_NOSS1/12-130APDHI-------------------------------------------------------------------------HL
Q8YWC8_NOSS1/12-129VEDHV-------------------------------------------------------------------------HL
Q93C78_HELPX/14-131DKDHI-------------------------------------------------------------------------HI
Q93PB3_9BACT/11-128SKDHI-------------------------------------------------------------------------HL
Q972N6_SULTO/10-128MPDHI-------------------------------------------------------------------------HL
Q987Z8_RHILO/19-133MPNHV-------------------------------------------------------------------------HP
Q9HHX7_HALSA/8-124QHDHV-------------------------------------------------------------------------HL
Q9HKW9_THEAC/17-134MPDHV-------------------------------------------------------------------------HL
Q9HSD5_HALSA/12-126RPDHV-------------------------------------------------------------------------HL
Q9RMA7_BACCI/9-123MNNHF-------------------------------------------------------------------------HL
Q9RT39_DEIRA/11-130SKDHV-------------------------------------------------------------------------HM
Q9X2F2_THEMA/10-126QPDHV-------------------------------------------------------------------------HL
Q9ZN95_9RICK/11-130ASSHV-------------------------------------------------------------------------HV

PF04986

A0NYF6_9RHOB/143-334IVYAKPPF-A..GPEAVLAYLARYTHRVAISNRRLIRFD......ENGVTFRYKDYRR...NG.........TDRQQVMT
Q9RDU8_PSEPV/69-254SVDAAVRI-E.GNDRAGLERLLRYCARPPFALEHLHQSD......AEHLVYHCPKPR...............PDGPRDLV
Q83XH8_VIBAN/105-287NIHFAKKT-K..VLKQTVNYLGRYLKRPPISASRLRHYS......GGTVVFKYLDHR...............DGTHKTKT
Q01P74_SOLUE/145-335VVYIKKPF-G..GPEHVLHYLARYTHRVAISNHRLLAME......NGKVTFRWKDYA.....H.........GGKQRKMT
A9L1Z0_SHEB9/140-307VVDCQ.FV-G..KGEPALQYLSRYLYRGVLPDSSICRHV......DNQVSFTYQDSQ...............TRCQQVRS
A5YVZ3_SALTM/172-397SLHAGVMA-E.AHQRDKLERLCRYISRPAVSEKRLALTA......NGQVRYELKTPY...............RNGTTHVI
A1WDQ9_ACISJ/182-382SVDTSVCI-A.AQDRAGLERLLRYCARPPFALDRLRKAG......SE.LIYRCAKQHSEPGSDRRDQRKAKRGVRADELH
Q79BR9_PSESD/174-368SVDAGVCI-E.AHDRAALERLLRYCARPPFSMERLRKEG......SK.LVYRCAKQRSEPTSD.......KRGAKADELH
Q12Q53_SHEDO/139-306VVDCQ.HV-G..KGLPALKYLSRYLYRGVLPDKSIIGTT......DEQVCFEYQNSQ...............TKTTEIRT
Q47906_9FUSO/38-214FSVGRQEV-N..SAEGLLKYLGRYLARAPIADYKIVNVT......EKEVTFFFHDLA.....N.........HKKKTYIT
A5GBJ9_GEOUR/131-297VVFCKPTF-N..RAKKVFHYLGRYVHRIAITNNRILALD......NGQVVFRYQNSD...............TREWKNMR
A4BNA6_9GAMM/69-274SLHAGVAA-R.ADQRQKLERLCRYISRPAISEKRLSLTP......NGNVRYQLKTPY...............RDGTTHVM
Q981L3_RHILO/137-326VVFAKAPF-A..GAEQVLSYVGRYTHRVAIANSRIVDIE......DGKVRFRWKDYR.....D.........GDRQKVMT
A3JF95_9ALTE/140-304VAQCE.QV-G..RGDQALTYLARYLYRGVLREQNIVDYD......GEQVTFRYQDSQ...............TRRWQTLT
Q5P667_AROAE/144-333VVFAKPPF-G..GPQQVLEYLGRYTHRVAISNNRLVACT......DDEVSFRWKDYR.....H.........HGRNKVMR
Q01TH4_SOLUE/47-236VVYSKRPF-G..GAEHALRYLGCYTHRVAISNQRLVSLA......EGRVTFRWRDSA.....H.........KNKKRLMS
Q7UCL9_SHIFL/142-324NVNVSRVM-D..NATHVAVYFGSYLKKPPVPMSRLEHYAG.....QDEIGLRYNSHR...............TKREEYLL
Q328X8_SHIDS/147-330HVYMSKKT-A..GGRNTARYLGRYLKKPPIAASRLAHYNG.....GASLSFRYLDHK...............TGETATET
Q2W8U4_MAGSA/134-323VVYAKRPF-G..GPEQVLAYLGRYTHRVAIANSRLSGIE......DGGVSFRWKDYR.....H.........HDKQKVMT
Q1ZUG8_PHOAS/139-306VVDCR.HV-G..QGKPALLYLSTYLYRGVIADKDILYIN......HEQVTFRYKDSQ...............TKTMKTRT
Q7TTN7_RHOBA/141-311VVDIQ.PV-G..HGVPTLKYLAPYVHRVAINDSRIMDVN......SETVTYQIRRK................GNVMQSKT
B6EMI2_ALISL/105-289KLHFAKKT-N..NVKPTMNYLGRYLKRPPISASRLSHYAK.....GGMITFNYLDHR...............TGTTDSLT
A1WDQ5_ACISJ/174-373SADTSVCI-A.AHDRAGLERLLRYCARPPFAMERLRKAG......SE.LVYRCAKQHSEPGSLPHN....KRGVKADEIT
A3XUQ2_9VIBR/116-283VVDCR.QV-G..YGQAALSYLARYLYRGVLPDEDIIHIT......DDTVTFRYKESQ...............TNTWRTRT
A9AVJ8_HERA2/140-307VVDCR.PV-G..TGETALKYLAPYIFRVALSNNRLLSMD......HDNVTFRYTNGQ...............THQTCTKT
Q2FD24_ACIBA/179-405SLHAGVAA-E.AHESHKLEKLCRYITRPAISEKRLSIAL......QGRVRYQLKTPW...............RNGTTHVE
A8H5W4_SHEPA/54-221VVDCQ.HV-G..KGLPALKYLSRYLYRGVLPDKNIISNI......DGHVSFEYLDSQ...............TQTNKVRT
A0P0Y4_9RHOB/143-332VVYAKPPF-G..GPEQVLAYLGRYTHRVAIANSRLVSLA......DGKVTFRWRDYR.....H.........GRKTKLMT
Q12YW6_METBU/152-326YVHMPKNS-RITNKQRMAQYVGRYIRHPAIANSRLYSYD......GKSVTFWYNDHE................GVRHFVT
Q1VPE4_9FLAO/140-316VVYAKSPF-G..KPEHVIEYLGRYTHKIAISNHRILSIDKE....KRRITFSLKDYR.....K.........GGQKTTLT
Q9F8W1_ECOLX/171-394SLHAGVAA-R.ADERKKLERLCRYISRPAVSEKRLSLTR......GGNVRYQLKTPY...............RDGTTHVI
A9B8K8_HERA2/140-308VIDCR.PV-G..TGETALKYLAPYIFRVALSNNRLLSAD......DDQVTFRYRHSD...............SGENRTST
Q48B93_PSE14/155-338HIHLSKKT-K..NDRKTVNYLGRYLKKPPISGSRLAHYTN.....GATLSFTYLDHR...............TQTYQQET
Q56753_9FLAO/152-326VVYAKKPF-G..SPKSVVEYLGRYTHKIAISNQRIRKID......AKTVTFSYKDYR.....Q.........KGIKKQMV
A6TTH3_ALKMQ/138-326NVRIMERY-T..HGEGVITYLGRYIRGGCISNKRIISIK......NGEVIFKHQDNKETDEKN.........KAKKKTMK
A5G657_GEOUR/141-307NVNSQ.AV-G..ASEASIKYLAPYVFRVAISDHRIVKVE......DGRVLFRYRKQK...............SNRERTMA
Q93R66_9PSED/154-336HIHLSKKT-K..NGKKTVNYLGRYLKKPPISGSRLAHYTN.....SATLSFTYLDHR...............TKTYQQET
A8LSZ6_DINSH/144-335VVYAKPPF-G..GPEAVLAYLSRYTHRVAISNHRLVSAD......AETVAFRWKDYRI...KR.........GDRMKVMR
Q121V9_POLSJ/144-335VVYAKRPF-A..GPQAVLAYLSRYTHRVAISNSRLLCLD......ERGVTFRWKDYRV...KG.........RTRHKTMT
A3UHI1_9RHOB/361-552VVYAKPPF-A..GPEAVLACLSRYTHRVAISNSRLIRFN......GQNVTFRYKDYRR...SG.........ADRQQVMT
A0LBL2_MAGSM/140-314VVHCTPWG-T..GEQAIVDYLARYAFRIAINRERIVAFN......EQTVTIRYKDRK...............QRRWRYCD
Q7WXN2_CUPNH/120-251VVYATRPS-P..GPR.......RY............................WPTCR.......................
A6VW84_MARMS/139-317VVYCKSAL-E..YRSTLVTYLARYSHRIALSNNRFQVWN......NDKISLQYRDYR...............SGKQSLLT
Q8EE63_SHEON/141-311CVYSKACL-S..RAETVVEYLGRYTRKGMLHESRIAEVT......ADHVRFNYKDYR.....D.........GQQHKQMW
Q039J1_LACC3/145-318YVNAPKRS-R.THLKGLLKYISRYMKRGPIAMDRIVMYD......GESVLFSYKDKR...............TNRKETHL
A9B8X8_HERA2/140-308VIDCR.PV-G..TGETALKYLAPYIFRVAMSNNRIVSAD......ETQVTFRYRHSA...............SGENRTST
A1TZA6_MARAV/137-319VVYARPCL-N..QAETVVDYLARYTHRIAISNGRLLSQD......GGRIMIRYVDYR.....E.........GGRQKSLQ
Q1M5F3_RHIL3/143-332VVYAKPPF-A..GPEQVLAYLGRYTHRIAISNSRLVSID......GDRVTFRWKDYR.....T.........GGRQKVMT
Q1M648_RHIL3/143-332VVYAKPPF-A..GPEQVLDYVGRYTHRVAISNNRLVDIE......DGAVRFRWKDYR.....H.........GDRQKVMT
A1VWX4_POLNA/23-168........-........ILFLVRYCARPPLAMDHLRKEG......AA.LVYRCAKQHSEPTGD.......KRGAKVDELT
A3J7Z8_9ALTE/139-305IVDCE.PV-G..SGLPALKYLSRYLYRGVISNSNIMADD......GDTIRFRYVNST...............TGKTNIRQ
A6DN83_9BACT/134-299NVDCR.SV-G..QGLHALEYLSRYLMRGVVSEQSLSEK.......EDKVRLRYKDSQ...............TKRMDSKD
A7B3V2_RUMGN/140-328VPYCKKTF-N..GAQSVIDYLGKYTHRIAISNHRIIHMD......DENVTFSVKDYR.....K.........EGQWKELT
Q6LHG6_PHOPR/138-305VVDCR.CV-G..YGEPALEYLSRYLYRGVLPDNDIINIE......ENSVTFRYLDSS...............TNTKKTRT
A3XDT2_9RHOB/144-335VVYSKPPF-G..GPEAVLAYLSRYTHRVAISNHRLVSAD......ADTVAFRWKDYRL...KN.........GDRQKIMR
A0PB90_PASPI/105-289RIHLAKKT-E..DVGPTVRYLGRYFKRPPIAASRLRHYQ......GGDVHFVYKDHR...............DNCYKTLV
Q0A7P5_ALHEH/141-322NVRLQGRY-T..HGRGVAAYLSRYVRGGPITNTRIKSLG......EGQVQFRYHDHR...............DGRRKLRR
A3JIR7_9ALTE/137-319VVYTRHCL-N..QAESVVDYLARYTHRIAISNGRLLTME......DDRIAFRYKDYR.....D.........HSRLKTQW
A0YEL0_9GAMM/162-387SLHAGVAT-K.TRERKKLERLCRYISRPAVSEKRLALTS......RGMVRYELKTPY...............WDGTTHVI
Q7TTG3_RHOBA/141-314VVDSE.AV-G..SGEFAVAYLAPYVMRGAVANRRVTQCDESTSLEEASLTLQVKRSG...............TRQYKPMQ
A5G455_GEOUR/137-325NVCIRERY-A..HGNGVLTYLGRYLRGGAISNRRIISSD......EEQVRFRYKDYREESESG.........GKKCKTME
Q1Q731_9BACT/12-184VANVQKGE-VPERYESLARYVAKYVVSPPISLRRIDEYD......GRRVTYHYRSHE...............MQRVKKER
B2JTR0_BURP8/144-333VVYAKPPF-G..GAEHVLDYLGRYTHRVAISNNRLLACD......GHTMQFRWKDYR.....H.........ASRQRTMT
Q01XA5_SOLUE/73-262VVYAKRPF-G..GPEHVLHYLARYTHRVAISNHRLLSVA......DGKVTFRWKDYA.....Q.........GSKQRKMT
A6FA86_9GAMM/141-311NVYSKACL-S..RTETVVSYLGRYTRKGMLHESRIKDVS......SSSVSFKYTDYG.....D.........GNKRKVML

PF01797

B8GCQ7_CHLAD/12-128VVSATPHW.V----------PNHIVGRFKGKTSRILR..------QEFPFLQRM...---------------....PSL.
B1KEE0_SHEWM/11-130VIKVPPKL.S----------ISKLMGALKGKIALKMF..------SKYPYLRKNKLW---------------G...NHF.
B4SJM3_STRM5/13-127LVQLRDGS..----------LARLMGTLKSRSSRLLG..------.......QQFGI---------------E...TPL.
B9LSV3_HALLT/9-121FIGSPPKN.A----------PSLIVNWVKGISARKYN..------QRYDD....RVK---------------........
B9LMY5_HALLT/12-130LFTAKPTT.D----------LTKFINSLKGVTSRKIR..------DENPEVRQALDK---------------.....AF.
B4SER8_PELPB/11-131FLQSVPTY.I----------VTKVVTMIKSISAREVF..------RRCPKVK.KLLW---------------G...GEM.
A8KYK3_FRASN/14-134LVEYPPKV.A----------VSALVNSLKGVSARRLR..------TEFTDRVNQHLI---------------R...GHF.
A8L9Q9_FRASN/6-123FVKAHPKH.F----------PSCVANPLKGLTSRVLR..------VEFGHLRSRL..---------------....PAL.
B1YEE0_EXIS2/12-129FLNAPPTL.S----------PADIMAKIKGVTSKKLR..------AEFPHLQHL...---------------....PSL.
B1YKP1_EXIS2/10-129LFKAHPNT.E----------MSKFLNAYKSASSRLIK..------RDFPHIKKQLWK---------------....EMF.
A0A7E6_9CAUD/12-134LLTYPPHK.L----------LSGLIANLKSISCKLLW..------DNYPDHLKKIYG---------------QD.KRVL.
A0JQH2_LACS1/15-136LISFPPRK.S----------AVDVIKALKGRSAFLFL..------QTHPEIRQKQYW---------------G...GHL.
A0L321_SHESA/19-138LISYPPKL.S----------ISVMVNNLKAVSSRMLR..------RQNTHLTRQSKS---------------....SAL.
A0M0J7_GRAFK/11-130HLEYRPSS.N----------VSGLVKKLKGRSSRKLQ..------QEFPELKKRYWG---------------....RHF.
A0QCS6_MYCA1/1-112LVAYPPTL.A----------ISALAQRLKGRTAYAVR..------REFTGAKTGT..---------------....AVP.
A0YIB8_LYNSP/13-134LIDLNPKV.A----------PVKLIANLKTVTSRLIR..------QEFAGHLEKFYG---------------D..KKVF.
A0YJH2_LYNSP/10-131LFQYLPQQ.Q----------LSKLVNTIKTATSRTIS..------SKFESELKKVYS---------------G..KKVL.
A0YNL9_LYNSP/12-131LFQYYPQL.E----------LPKFVGNLKSITSRRLR..------TEFPE.LADVYR---------------K...SVL.
A0YQF8_LYNSP/12-130LVEYDPHH.S----------IAQVVKAFKSRTSRLLR..------EEFPELLKL...---------------....PSL.
A0YS48_LYNSP/10-130FVQADHTT.A----------PVEIAKTIKSISAVHIF..------STFKELKKRRFW---------------G...SGM.
A0YTU0_LYNSP/12-132LFTYAPQV.H----------LSKLIANLKTVSSRLIR..------KEYPEHLAKFYK---------------K...PVF.
A0YV57_LYNSP/12-133LFQYHPDI.H----------LSKLINSLKSVSSRKIR..------VEFGEHLAKTYY---------------K..KPVL.
A0YWZ8_LYNSP/7-123FLEVDPTF.S----------PSTIIKRIKGRASHHLR..------KEYPHLLKL...---------------....PTL.
A0ZDZ5_NODSP/12-129LVEVDPQF.G----------IAKLIQSMKGRSSRFLR..------QEFPWLISRL..---------------....PTL.
A1ASY5_PELPD/11-130LISIPPKY.S----------VAQVIGFIKGKSAIHIA..------RMYLGQKKNYTG---------------....MHF.
A1B6L6_PARDP/10-129FVSVPPRL.A----------ISDLVRKMKGRSSYRVQ..------REFPQIRKRYWG---------------....CRF.
A1T0T7_PSYIN/11-131VIRGIPEQ.S----------PSDVMQIIKSITAREFF..------RTYPEIKKKYFW---------------G...GKL.
A1T5G3_MYCVP/16-133LVEVDPQF.G----------VHRLVKAIKGRSSRVLC..------EEFPWLKSRL..---------------....PSL.
A1U7S0_MARAV/12-131LVNYPPSI.Q----------LTRLINSLKAVSSRRMR..------RQFAD.LVAAYS---------------K...PVL.
A1VLR6_POLNA/14-134LVNYPPKV.S----------VSALVNSLKGVSSRMIR..------QRNYPSVREKLW---------------G...AAL.
A1ZGJ3_9BACT/12-129FIKAKPVD.A----------PHFIVGQLKGYTSRYLR..------KEFPKLRSRL..---------------....PTL.
A3DH13_CLOTH/11-129LVSIPPKI.S----------VSSFMGYLKGKSSLMIF..------DRHANLKYKYGN---------------....RHF.
A3ESB6_9BACT/11-130FLSYRAHQ.D----------ISQIVQWLKGISSRVLL..------QEYPHLRKKFWG---------------....RHF.
A3HSL3_9BACT/3-118LVSLGINQ.T----------IQKIMQLIKGESSYWIN..------..KSQLTAEKFE---------------........
A3HTZ3_9BACT/7-121LIGMRASC.R----------LSDLVREIKKSSTNWIN..------..ERGFAQKSFR---------------........
A3HZW2_9BACT/5-119LFRFKPSV.S----------ISKVMQGVKAKSSKWIN..------..ESDYCNERFE---------------........
A3ITV5_9CHRO/14-130LIEYSSRD.S----------IAQVVQAFKGRSSRLLR..------KEFPELLKL...---------------....PSL.
A3JHU9_9ALTE/14-134IASVHPRH.S----------ISNFVGKLKGKSAYVLR..------RDYREEISPWLW---------------G...NHF.
A3N3W0_ACTP2/3-118LVEIHPSM.A----------VADFVKQLKNASHKWLE..------.HHSDLFPDFYA---------------........
A3W7S5_9RHOB/10-129FLSTPPKL.S----------LSDVMQRIKGRSSRRIQ..------MEFPDLRKRYWG---------------....RRF.
A3ZXL2_9PLAN/11-130LLSCPPNL.A----------PSKIMQYIKGKSSRKLL..------MEFRHLQKQYWG---------------....RHL.
A4E7V4_9ACTN/12-130LLAIPPKY.S----------VASVMGYLKGKSSLMIF..------DRHANLKYKFGN---------------....RKF.
A4J2W0_DESRM/10-130FVSVKPYV.S----------PTEVVKTIKSITAVWIF..------KKFPNLKKRKFW---------------G...SGL.
A4N2N4_HAEIF/3-118FVELHQTI.S----------VAEFVRKLKKSTHRFLD..------.ENKSLFPEFTA---------------........
A4TFZ9_MYCGI/18-138LVHYPPKV.A----------ISRLVNSLKGVSARHLR..------QEFPAHIRKYLW---------------G...EHF.
A4XMT5_CALS8/11-128FISALPRY.S----------PSQLINVIKGATGRKIG..------QKFPQYKQK...---------------....GSV.
A5CZ87_PELTS/12-131LFAGKPQL.Q----------VSKFVNSLKGVSSRLLR..------KEFPE.LREHLW---------------G...NHF.
A5EW57_DICNV/13-134LLDLHPNI.V----------PSRLVNQLKNVTNRLIR..------KEFANHLAQYYW---------------Q...PVL.
A5F7S7_VIBC3/11-129VAIIPPKV.S----------ISTLMGVLKGRSAIRLF..------NKFPHIR.KKLW---------------G...NHF.
A5FCA3_FLAJ1/8-121FIGMRPTQ.S----------ISSLIQNIKTETSKWIK..------..EQKLA.SYFA---------------........
A5FHV9_FLAJ1/5-119LIGIRPVQ.S----------ISELMKTVKQNSSKWIN..------..ENKFINSHFE---------------........
A5FLD5_FLAJ1/5-119LVGIKPNI.S----------LSDLVRDIKSSSSKFIN..------..EQKWINGKFE---------------........
A5FLH9_FLAJ1/5-119LFLLNPKK.S----------LSDVIRQAKGGSSHCIN..------..GVNLIPEKFA---------------........
A5FNU2_FLAJ1/3-118LISLGNNQ.T----------IQKTIQLLKGESSYWIN..------..KNQLTKEKFE---------------........
A5FTI1_ACICJ/14-134LISLPPNL.D----------LSRFVNNLKTTTSRLIR..------KEFAAEVDTVYR---------------K...PVF.
A5G3E6_GEOUR/11-130LVKILPKV.S----------VSEFMGAIKGRTAIRVF..------KQYPYLKERPYW---------------G...NHF.
A5G9R6_GEOUR/9-128LLAMPPSM.P----------ISKAVQLLKGASSRWIH..------..ETDNDMAAFA---------------........
A5KLF3_9FIRM/15-133LLSIPPKM.S----------VSGFMGYLKGKSSLMIF..------QRFGNMKFAYRN---------------....REF.
A5MCH0_STRPN/12-130LISIPPKL.S----------VLSFMGYLKGKSSLMIF..------DKHANLKYKYGN---------------....RKF.
A5TXA2_FUSNP/11-130LIECSPQH.F----------IPNILKIFKGISARKLF..------LKHPEIKNKLWN---------------....GHL.
A5UR96_ROSS1/3-117VASIPPKL.A----------VAECVRHLKGASAYAIN..------..RMPDSDGQFK---------------........
A5UWB3_ROSS1/9-123LVIFPTTI.T----------IADLLKHVKGVSSRFVN..------..ETLRPSAQFK---------------........
A5VHM5_LACRD/16-137LISFPPSK.A----------PTSAIKALKGRSAFIFL..------KRHPEIRQSQYW---------------G...GHL.
A5W7D3_PSEP1/16-130LIELKQVT..----------LATLMRRFKSRSSHALH..------........KAGV---------------TATP..I.
A5ZT63_9FIRM/10-128LVEIPPSI.S----------VSYFVGYLKGKSTLMIF..------ERHANLKYKYGN---------------....RHF.
A5ZT97_9FIRM/33-152LVDCRPQF.Y----------ISDMIKIMKGNIARQMF..------LAHPELKKELWG---------------....GHL.
A5ZYT4_9FIRM/11-130MFRAQPKT.E----------LSKFINAYKSASSRLLK..------KEYPE.IREKLW---------------K...EAF.
A6DFZ7_9BACT/5-123LCRLAKDL.S----------IAELIQKLKSNSSRWMK.T------QNHIDPYLEKFS---------------........
A6DIE5_9BACT/3-117LINLHTSL.C----------LADFIRDLKTSTTTWIK..------...SENIISKFP---------------G.......
A6DJE0_9BACT/5-115LVSLSQKI.S----------VANFVSKVKSNSSKWMK..------.....KYDDKFS---------------........
A6DTI6_9BACT/5-124LTSLSKSI.S----------ASSFVNKIKSTSSKWIKSN------SHEHGLILKKFS---------------........
A6NSH3_9FIRM/13-131LVEIPPKM.S----------VSGFMGYLKGKSSTMLY..------EKFGELKYKYRS---------------....REF.
A6QB17_SULNB/11-130LVMIPPKI.S----------ISDYMGAIKGRTAIRIL..------NRFKKLRQKPYW---------------G...NNF.
A6TLW4_ALKMQ/10-129LFKAHPNS.Q----------LSKFINAYKSASSRLVK..------KEYPA.IREKLW---------------K...EYF.
A6VTE3_MARMS/13-129LVKLKNHSST----------LPTIVGNLKGASAFQVN..------........KHLK---------------KNGT..L.
A8F1E5_RICM5/13-132LVSIPPNI.A----------VSEFVQRAKGRTARRIQ..------QEFPELKKRYWG---------------....KHF.
A8F729_THELT/10-129LFKATPTT.Q----------LSKFINAYKSASSRLIK..------KEFPE.IRKKLW---------------K...GNF.
O06525_HELPX/14-134LINYPPKV.S----------VSKLVNSLKGVSSRLTR..------QHHFKSVEASLW---------------G...KHL.
O83028_DEIRD/17-136LLSATPQQ.A----------IPDFVKALKGASARRMF..------VAYPQLKEKLWG---------------....GNL.
P94655_CLOPF/10-128LVEIPPKM.S----------VSSFVWVLKCKSSLMIF..------EKFANLKYKYGN---------------....RHF.
P97210_HELPX/24-147MVQYIPRM.S----------ISSIISKIKQITTYRVWHD------KRFIPLLQKHFW---------------K..EKTF.
Q0GL54_LACRE/14-133LFRATPHT.E----------MAKFLNAYKSSSSRMVK..------KQFPE.IKQYLW---------------K...SAF.
Q0I2W7_HAES1/22-142LVEYPPKV.A----------ISNLVNSLKGVSSRMIR..------KKNYPSIRKKLW---------------G...NQL.
Q11SK3_CYTH3/5-119LFLLNTQK.S----------ISEVIKQIKGSSAHYIN..------..QNNLCYTTFS---------------........
Q11V54_CYTH3/5-117LFRLSKNY.T----------LVKIIEEIKKHSSKWMK..------....SKGIDGFT---------------........
Q11Y47_CYTH3/3-117LISLGKEQ.S----------ISLVAQHIKGESSHWLN..------..QNYFINKEFM---------------........
Q11YI8_CYTH3/5-119LIGMKPSC.C----------LSDLIRELKKSSSSFIK..------..DKKLSPYAFQ---------------........
Q18CV0_CLOD6/9-126LISCDPQY.G----------IHKVVKGLKGFSSRVLR..------ENFPHLKSSM..---------------....PSM.
Q18KK1_HALWD/19-139FVEADSKW.S----------PAEIAKQFTGYSGRTIL..------KGHPEIKQRYFC---------------G...SGL.
Q1I4D7_PSEE4/16-130LVELGHAR..----------LSTLMCAFKSRSSNALY..------........REGV---------------ERRH..I.
Q1I8P3_PSEE4/16-130LVELKEES..----------LSTLMRYFKARSSHALR..------........KAGV---------------SLIP..V.
Q1IW17_DEIGD/12-128FLAADPAT.A----------PNQVMHLLKGYTSRILR..------QEFPHLNTL...---------------....PAL.
Q1Q1X9_9BACT/11-130LVMVVPKI.S----------ISDFVGIIKGRTAIRVF..------NKFRHLKQKPYW---------------G...NHF.
Q1QF32_NITHX/11-129LLSIPPHL.S----------VSRAVQYLKGKSSHKLL..------TEYQSLRKRYWG---------------.....SI.
Q1VS81_9FLAO/5-119LIGTKPNC.N----------LSDLVRDIKANSSKWIN..------..EKQFVNGKFE---------------........
Q1VUJ0_9FLAO/5-119FVGMHPAI.S----------PSKLMEQVKSGSSKWLN..------..EKKFISGKFY---------------........
Q1VXK0_9FLAO/13-133LLQSVPLK.S----------PKSIVKMLKSSTVREIF..------QRHPEVK.KIVW---------------G...GAF.
Q20XV6_RHOPB/11-129MISIPPKY.A----------VSQVVGFIKGKSAIHLA..------RVYGEKKRNFVG---------------....QHF.
Q24Z31_DESHY/8-127VFKAHPNS.E----------LSKYINAYKSASSRLIK..------KEFSH.LRHQLW---------------K...EYF.
Q2JNY0_SYNJB/12-132LFQYYPQV.D----------LSKLVNNIKSVSSRRMR..------SEFADYISKIYR---------------K...NVL.
Q2JT06_SYNJA/33-153LVSFPPDV.Q----------VSKLVNNLKTVSSRLIR..------KEFATEVARFYS---------------K...PVF.
Q2JX40_SYNJA/15-131FLEIKPTD.P----------IHLVVKAFKGRASKYLR..------QKFPNLRKL...---------------....PSL.
Q2S639_SALRD/15-131FVQADTRH.A----------PYQVIHRFKGTSAHVLR..------DEFDHLHRL...---------------....PSL.
Q331U4_CBCP/17-137IINCNPRY.G----------VIKCVQLIKGISGYKLF..------EEFPFIKKRYLW---------------G...GKF.
Q332K6_CBCP/12-129FLNCLPTL.S----------PRDIMQKIKGVTSRELR..------KEFVELSKM...---------------....PSL.
Q38463_BPPHH/12-130LFQTKPTT.D----------LTKFINSLKGVTSRRIR..------SEFPEVTQTLE.---------------....DAF.
Q3AEI0_CARHZ/18-135LVEVDPQF.G----------IHRLVKLMKGRSSRILR..------QEFPWLRSRL..---------------....PTL.
Q3ASF0_CHLCH/5-119FVGLKPSM.S----------IADLVRDIKNNSSNFIN..------..EQKFLPRKFA---------------........
Q3BWF5_XANC5/19-133LLQLGSDT.A----------LSDAVSRMKACSARAVN..------........AQRQ---------------SRAP..V.
Q3EVJ8_BACTI/10-129LLKAHPNT.E----------MTKFINAYKSASSRLIK..------RDFPQ.VKKKLW---------------K...EMF.
Q3ILG5_PSEHT/10-130LLTISPNI.S----------VASYVRRIKQSTTQSLW..------SRFKWFKKQFWV---------------K...KTF.
Q3IPA5_NATPD/11-130FVQTDSKY.S----------PANIARQFKSYSGKHLL..------ERYPEIRESYFW---------------G...GGF.
Q3JB10_NITOC/14-133LVEYPPKL.S----------ISVLVNNLKSTSSRRVR..------LLNTHLPNLSKS---------------....AAL.
Q3JE33_NITOC/16-133FVEFDPRW.G----------VAEMVNRFKGSTSKELR..------KEFPILRSRL..---------------....PTL.
Q3M4G8_ANAVT/13-135LINLHPDN.N----------ISDLMASLKSASSRILR..------QQYKSEIGKFYW---------------S...EKVK
Q3MDI5_ANAVT/3-118VVSIPPTL.A----------IADFIKKIKGSSSYYFN..------.HNIAASSDKFS---------------........
Q3R3H9_XYLFA/22-141LVEYPPKI.A----------ISNLVNSLKGVSSRLLR..------QERPD.IQKRYW---------------K...NVL.
Q464U6_METBF/10-131FVGAEPKY.S----------PSRVMQIIKSITARQIF..------KQYPEIK.KQLW---------------G...SEL.
Q46ET2_METBF/11-131FLEFHPST.S----------LSEVIQYLKGGSSYRLF..------KLHPEMR.HQYW---------------S...GSL.
Q484I4_COLP3/11-129CLSIPPKL.A----------VSNVVGFIKGKSAISIA..------RTFKGKQRNFTG---------------....EAF.
Q485N4_COLP3/13-128LFELTSDN.H----------LSKVIQTLKGRSARLIN..------........QHDE---------------GQRF..A.
Q48DG1_PSE14/17-131LLQLNSHS..----------LSRVVQRVKSKSAITIN..------........RASG---------------CRGP..F.
Q4BZD6_CROWT/12-132LFQYYPQM.E----------LPKFINSIKSVSSRKIR..------QEYSEHLNKIYW---------------K...KVL.
Q4C7A6_CROWT/12-133LVEFNPKV.Q----------LSKFIANLKTVSSRLIR..------KDYSEHLTKFYG---------------Q..KSVF.
Q4C9I1_CROWT/12-132LFQYHPAM.E----------LSKFVNNFKSVSSRKLR..------QEFPEQINKFYW---------------K...EVF.
Q5GN45_LYSSH/10-128LVKIPPKL.S----------VSAFMGYLKGKSSVMIF..------NRHDSLKYQLGN---------------....RQF.
Q5J4C5_SALCH/18-137LIAYPLKL.G----------VSVMVNNLKSVSSRLLR..------QQNTHLRMQSKT---------------....GLL.
Q5JI87_PYRKO/12-132LFKAKPTL.N----------IPKYINALKTITSREIR..------RNFPE.VKEKLW---------------R...NTF.
Q5NX16_AROAE/12-130LADIHPAL.D----------ISILINNLKTASARRAR..------NRFADHLAAFYK---------------K...PLF.
Q5NY63_AROAE/12-103CLSIPPKY.A----------VSNVVGYLKGKSAIQIA..------RRFGGRQ.KNFT---------------G...ENF.
Q5V3V2_HALMA/10-129FLSAHPKH.A----------PSEIVRTVKSITAREMW..------EQYESYLEEYLW---------------G...GGF.
Q5V7Q1_HALMA/12-132LFRAKPTT.D----------LVKFINTVKGATARRIR..------NEYADELKTELW---------------G...DSF.
Q5W394_9BACT/11-130VVRTPPSQ.S----------VSDLMGVLKGRTAIRLF..------AKFPYLRKKKLW---------------G...NHF.
Q5WKC7_BACSK/10-128LVKIPPKM.S----------VSYFMGYLKGKSSLMIH..------DRHANLKYNHGN---------------....RTF.
Q649F0_9ARCH/18-138LCSAHPKV.S----------PGGIVWIFKSITAREVL..------RRKPTIK.KELW---------------G...GEF.
Q6LR15_PHOPR/12-131LVSAPPNM.A----------PSEIMRRIKGRTSAKLF..------ESYPDLKKKYWG---------------....RHF.
Q6T8F3_9CHLA/11-131MVSVHPKL.A----------ISNLVSKLKGKSSYMIR..------REYWDRVKTMLW---------------G...NHF.
Q74KQ8_LACJO/18-139LVSFKPSK.S----------GSSVIKALKGRSGRLFL..------QAHPEIRQNKMW---------------G...GHL.
Q7M7F4_PHOLL/10-129LVSSPPTL.A----------PSEIMRRLKGRTASKLF..------EEFSHLKKRYWG---------------....QHF.
Q7US03_RHOBA/3-117LVSIHPAQ.S----------ISDCVRDIKSNSSVWVH..------..EHLTNLKSFQ---------------........
Q7UVV9_RHOBA/38-155VLRPKCDG.G----------MSRFVQWLTLTHTQRYN..------........AHYE---------------IVGEGHL.
Q7WCD1_BORPA/9-125LLAPLHDCRA----------LSQIMGKLAGGAGRRFN..------........HRHG---------------LSGT..L.
Q7X379_9BACT/16-133ILWPEHDG.D----------VSRFLHWVTGTHGRRWR..------........RSTG---------------TEGEGAV.
Q815G4_BACCR/12-129FLNTLPTL.S----------PADTMAKIKGVTSKRLR..------EEVPHLQHL...---------------....PSL.
Q82PQ1_STRAW/18-138LVHYPPKI.A----------LSRLVNSLKGVSSRYLR..------AEYTGRINRIGT---------------G...SVF.
Q82QX0_STRAW/13-131LVHYPPKV.A----------ISRLVGSLKGVSARRLR..------QEFPNHIRKYPW---------------G...EHF.
Q82SR9_NITEU/15-133CISIPPKY.A----------VSNVVGYLKGKSAIQIA..------RKFGGRQKNFTG---------------....EHF.
Q83T86_SALTI/25-144LIEYPPTV.Q----------LSVLVNSLKAVTSRRLR..------NEFID.LRGAYG---------------K...AVL.
Q893W3_CLOTE/12-126IIDSNGAD..----------ISKIMHGLNFSYAISFN..------........RIYK---------------RNGH..L.
Q897V3_CLOTE/10-129LFKGSPNT.D----------ISKFINAYKSASSRLIK..------KEFPK.IKNQLW---------------K...EYF.
Q898F8_CLOTE/24-138IIDANGAD..----------ISKIMHGLNLKYSLNFN..------........KRYK---------------RRGH..L.
Q899Z5_CLOTE/12-129LIEVDPQF.G----------VHKAIKRMKGRTSKMLR..------QEFPHLKTKL..---------------....PTL.
Q8CM83_THEEB/12-128LIEYPPKL.S----------VSQIVNALKGVSSRRYG..------.......KAALP---------------KPHEESL.
Q8CXX7_ECOL6/29-148LIEYPPLV.Q----------LTKLVNSLKSVTSRRLR..------NDFID.LRAAYS---------------K...PVL.
Q8GF06_ENTFC/10-129MFKAQPKT.E----------LTKFINAYKSASSRLIK..------RDFPR.VKQFLW---------------K...EMF.
Q8PRR7_METMA/14-133FIIMHPKF.A----------PADIVKIFKGITAKKLF..------EMHPEIKSRLWN---------------....GHL.
Q8R791_THETN/9-123MIKEGNED..----------LSSSIKRIAGTYVSYFN..------........KKYD---------------RTGH..L.
Q8RLV2_XENNE/11-131IEQSVPTY.S----------VTKIIRLIKSLAAREIF..------KRWPQVK.KILW---------------G...GEF.
Q8TU17_METAC/10-130LIKSETKV.S----------VLSIVRKQKHESTNRIW..------KTQKEYLEKYYR---------------G..ENTL.
Q8X2J7_ECO57/19-139LTNYPPKL.A----------ISSLVNSLKGVSGRLLR..------RDRPDIAVRYYY---------------K...GVL.
Q8XV65_RALSO/11-124VGTPKVAD.S----------LSRTLQAVGRRYTRYFN..------........AAAG---------------RSGT..L.
Q8YK47_NOSS1/12-135LIDVHPDN.N----------ISQLIGSLKSASSRIIR..------KEFQDYLKQYYW---------------KEKDPSF.
Q8YKY9_NOSS1/9-130LIDYKPDK.P----------LSTLIGNIKTVSSRLIR..------KEFPSLAKKYFY---------------N..KPYF.
Q8YLC6_NOSS1/12-132LFQYHPDV.E----------LSKLVNNLKSVSSRKLR..------QEFAEHLESFYW---------------K...DVF.
Q8YMI3_NOSS1/9-129LIEPREPQ.D----------VPKIMHWLNWYTAMCFN..------........QMLN---------------RTGH..F.
Q8YRS2_NOSS1/12-130LVEYDPHH.S----------ISQIVKAFKGRSSRYLR..------QEFPELMRL...---------------....PSL.
Q8YWC8_NOSS1/12-129LIEVDPQF.G----------VHKAIKRFKGATSRYLR..------LEFPHLKQRL..---------------....PTL.
Q93C78_HELPX/14-131LADVDPSF.G----------VMKFIKTAKGRSSKVLR..------QEFNHLKTKL..---------------....PTL.
Q93PB3_9BACT/11-128FVSVPPKL.S----------VSKLMQYLKGKTSHKML..------FEFKHLQRQFWG---------------....KHI.
Q972N6_SULTO/10-128FVNCPPRY.A----------PSYLANYFKGKSARLIL..------KKFPELKKATN.---------------....GKL.
Q987Z8_RHILO/19-133ILTPADAD.G----------LRRALAKVHRAYAGIIH..------........ARQK---------------KTGH..F.
Q9HHX7_HALSA/8-124FVSSPPKN.E----------PALLANWFKGISSRKYN..------HRYADHDGEKIG---------------........
Q9HKW9_THEAC/17-134LIDVDPRM.G----------VYHVVNRIKGYTSRVLR..------AEFPELRKRL..---------------....PTL.
Q9HSD5_HALSA/12-126FITGDPTL.A----------PNKIMQQIKGYSSRHLR..------DEFDFGL.....---------------....PSL.
Q9RMA7_BACCI/9-123QLRSSEVP..----------ISKLMALINKRYANYYN..------........TKYR---------------LTGH..V.
Q9RT39_DEIRA/11-130HVEYPPRL.A----------VSDLVKRLKGRTSRRLQ..------QEFPHLEKRYWG---------------....KHF.
Q9X2F2_THEMA/10-126FVSAPPRF.S----------PAEIANLFKGVSARKLL..------EKFPELRTK...---------------....EGL.
Q9ZN95_9RICK/11-130YVSVPPYL.S----------ISKLVQLIKGKSSRKIQ..------QNFPELKKRYWG---------------....KHL.

PF04986

A0NYF6_9RHOB/143-334LTPDEFIRRFLLHVL.PRGFHRIRHYGLLA....GTSRKAS
Q9RDU8_PSEPV/69-254LTPLELIDRIAALVP.RPRTHRHRYYGVLA.......PNAP
Q83XH8_VIBAN/105-287LTQEEMILRYVSHIP.QHHFKMVRYYGFLS....NRKRGRL
Q01P74_SOLUE/145-335LAAEEFIRPFLLHVL.PKGFVRIRHYGWMA....NRCRRQC
A9L1Z0_SHEB9/140-307LPAVEFLWLILQHVL.PKGLRRVRDYGLLR....GNAKKLR
A5YVZ3_SALTM/172-397FEPLDFIAKLAALVP.KPRVNLTRFHGVFA.......PNSK
A1WDQ9_ACISJ/182-382LTPLELIDRLAALVP.PPRAHRHRYYGVLA.......PNSP
Q79BR9_PSESD/174-368LTPLELIDRIAALVP.PPRTHRHRYFGVLA.......PNSP
Q12Q53_SHEDO/139-306LPTVKFLWLVLQHVL.PKGLRRVRDYGLLS....GNCSKLR
Q47906_9FUSO/38-214MSREKFIQQVLIHLP.PKHFKMISRFGFYG......VENQI
A5GBJ9_GEOUR/131-297LPVKEFLRRYLQHVL.PQGFHKVRYYGLLS.......PGNR
A4BNA6_9GAMM/69-274FEP...................HRRKAGCS.......PSRG
Q981L3_RHILO/137-326LEAGEFIRRFLVHVL.PDGFKRIRYYGLLG....NRHRKEK
A3JF95_9ALTE/140-304EPASRFLWRVLQHVL.PKGLRRVREYGFLH....GGARKTL
Q5P667_AROAE/144-333LEAHEFIRRFLLHVL.PAGFHRIRHYGFLA....NRLRASA
Q01TH4_SOLUE/47-236LPVEEFVRRFLLHVL.PPGFVRIRHFGFFA....HRRRAAL
Q7UCL9_SHIFL/142-324MSGDEFMERFSWHVA.DKGFRMVRYYGFLS.....PAKRRL
Q328X8_SHIDS/147-330LTQRELVARLKQHIP.EKFFKMVRYFGFLA....NRVCGEK
Q2W8U4_MAGSA/134-323LKPGEFIRRFLLHVL.PDGFHRIRHYGFLA....NGRRAAK
Q1ZUG8_PHOAS/139-306LPVLQFLWLILQHVL.PKGFRRIRDYGLLR....GHEKKLL
Q7TTN7_RHOBA/141-311VAGDDFVGNFLQHVL.PTNFMKIRHYGWMS.......GNSK
B6EMI2_ALISL/105-289LSPEEMIRRIVEHYP.DKHFKMIRYYGFLS....MRRRGEA
A1WDQ5_ACISJ/174-373LTPLELIERIAKLVP.PPRTHRHRYFGVLA.......PNSP
A3XUQ2_9VIBR/116-283LPILKFLLLILQHVL.PKGLQRVRDYGFLR....GQAHALR
A9AVJ8_HERA2/140-307LSALTFLEQFLQHVL.PKGFVKVRYFGLFC.....PAKRAF
Q2FD24_ACIBA/179-405WDPVDFIAKLAALVP.PPRAHLTRFHGVFA.......PNAN
A8H5W4_SHEPA/54-221LPEIEFLWLVLQHVL.PKGLRPVRDYGLLG....GNFCKLR
A0P0Y4_9RHOB/143-332LKADEFIRRFLLHTL.PDGFHRIRHYGFLA....NGRRVAR
Q12YW6_METBU/152-326MELQEFIRALIQHIP.DRNFKMIRYYGAYS....RKVKKRY
Q1VPE4_9FLAO/140-316LSTKEFIRRFQLHIL.SKGFTRIRHYGFLS....SSWKKEK
Q9F8W1_ECOLX/171-394FEPLDFIARLAALVP.KPRVNLTRFHGVFA.......PNSR
A9B8K8_HERA2/140-308LPVNTFLDRFMAHIL.PKGFVKVRYYGFFR.....PAVRAD
Q48B93_PSE14/155-338LSQADMLFRVVQHIP.EKHFRMIRYFGFLA....NRVCGQY
Q56753_9FLAO/152-326LSHEEFIRRFAMHIL.PKRFVKIRHYGFLS....STWKRIK
A6TTH3_ALKMQ/138-326LKAEEFIQRFLLHIP.KPGTKVVRYYGIYA.....SSKEKS
A5G657_GEOUR/141-307LDAMEFLRRFLQHVL.PTGFMKVRYYGFLS.......PNAA
Q93R66_9PSED/154-336LSQTDMLRRVVQHIP.EKHFRMIRYFGFLA....NRVCGRQ
A8LSZ6_DINSH/144-335LPTGEFIRRFLIHVL.PSGFHRIRHTGFLA....NGIRRDR
Q121V9_POLSJ/144-335LDAQEFMRRFLLHVL.PAGLHRIRHYGLLA....NGNRKEC
A3UHI1_9RHOB/361-552LPADEFIRRFLLHVL.PTGFHRIRHYGLLA....GATHKAN
A0LBL2_MAGSM/140-314IPGQEFLRRFLQHVL.PRGFHKIRYFGLWHPSKRSAAKRVR
Q7WXN2_CUPNH/120-251.............AI.PTAWR.....SPTS....ACSPWTS
A6VW84_MARMS/139-317LTPQELVRRFLLHVL.PRGLMRIRHYGCLS.....NAIRAK
Q8EE63_SHEON/141-311LSCDEFIRRYLLHVL.PKGLMRVRHFGFLA....NACRRKK
Q039J1_LACC3/145-318MSVEAFIGALIRYIP.DRHFKTIRRYGIYS.......RRIK
A9B8X8_HERA2/140-308LPVETFLDRFVAHIL.PKGFVKVRYYGFFR.....TGVRAS
A1TZA6_MARAV/137-319LEGAEFVRRFLMHIL.PKGFMRIRHFGYLS....NRTRRRK
Q1M5F3_RHIL3/143-332LDAHEFIRRFLLHIV.PDGFHRIRHFGLLA....NGHRQLK
Q1M648_RHIL3/143-332VSADEFIRRFLLHVL.PEGFHRIRYYGFLG....NRYREQK
A1VWX4_POLNA/23-168LTPLELIARIAALVP.PPRTHRHRYFGVLA.......PNSP
A3J7Z8_9ALTE/139-305LPGEDFIALLLQHTL.PKGFRRTRDFGFLH....GNAKKTL
A6DN83_9BACT/134-299FGPVEFLQRLAQHVL.PRGFHRVREYGFLA.....PAAKKK
A7B3V2_RUMGN/140-328ISGIEFIRRFLMHVP.PRRFVRIRHYGLLC....SRSKHKK
Q6LHG6_PHOPR/138-305LPTLEFLMLILQHVL.PTGLQRVRDYGFLR....GQAKALR
A3XDT2_9RHOB/144-335LATPEFIRRFLIHVL.PDGFHRIRHYGLLA....SSARKAN
A0PB90_PASPI/105-289LSQIEMIDRLVSHIPAEKNFRAIRYYGFLS....NRKRGEA
Q0A7P5_ALHEH/141-322VAVERFMEQILWHVP.EPGQHTVRHVGLYA.....HTCRAK
A3JIR7_9ALTE/137-319LDGQEFVRRFLMHIL.PKGFMRIRHFGYLS....NCTRRRK
A0YEL0_9GAMM/162-387FEPLDFMAKLAALVP.KSRVNLTRYHGVLA.......PNSK
Q7TTG3_RHOBA/141-314MRVEEFIRRWLQHVL.PAGFHRVRHYGFAN.....ARSKRS
A5G455_GEOUR/137-325LSVNDFVRRVLLHVP.EPGHKVVRSYGLYA.....GSRRQA
Q1Q731_9BACT/12-184VSVYRFIGRMIQHVL.PKGFKRIRYYGVQA.......AKIY
B2JTR0_BURP8/144-333LTADEFIRRFLLHVL.PDGFKRIRSYGWLA....NCHRAQR
Q01XA5_SOLUE/73-262VTAEEFLRRFMLHVL.PLGFIRIRFSGFLA....NRHRKQL
A6FA86_9GAMM/141-311LTADEFIRRYLLHVL.PKGVMRVRHFGFLA....NACKRKR

PF01797

B8GCQ7_CHLAD/12-128.GTRSYVWSTTG..H-V.SADTIRRYSEAQ-----------
B1KEE0_SHEWM/11-130.WQRGYFVDTVG..I-..NEEVIRRYVRHQ-----------
B4SJM3_STRM5/13-127.WQPSYFDHAVR..H-EDALRRHALYILGN-----------
B9LSV3_HALLT/9-121.WTRSYYVGTAG..S-A.SKGAVEQYIAEQ-----------
B9LMY5_HALLT/12-130.WQPGYFLTTTG..Q-V.SIDVLMEYVEEQ-----------
B4SER8_PELPB/11-131.WTDGYYAGTVG..K-HGNEDMIGKYVKGQ-----------
A8KYK3_FRASN/14-134.WSPSYLAVSAE..D-A.PLALVREYIEEQ-----------
A8L9Q9_FRASN/6-123.WSRSYFAGAVG..A-V.SPETVRRYVDTR-----------
B1YEE0_EXIS2/12-129.WTRSYFVSTAG..N-V.SSETIKRYVEQQ-----------
B1YKP1_EXIS2/10-129.WSRSYCLVTTG..G-A.TSDVIRHYIEKQ-----------
A0A7E6_9CAUD/12-134.WTGAYFVASCG..G-V.TIDQLKKYVENQ-----------
A0JQH2_LACS1/15-136.WSSSYYLGSLG..N-M.SKDVVERYINDQ-----------
A0L321_SHESA/19-138.WSRSYFACTAG..G-A.TIETLKAYVESQ-----------
A0M0J7_GRAFK/11-130.WAVGYGCWSTG..N-I.TDEMVDEYLEHH-----------
A0QCS6_MYCA1/1-112.MPRSSMPSTSD..G-.......RRFTKSE-----------
A0YIB8_LYNSP/13-134.WTGSYFIASCG..G-V.TIEQLKSYVQDH-----------
A0YJH2_LYNSP/10-131.WSSSYYVSSCG..G-V.AVDRLKEYIKEQ-----------
A0YNL9_LYNSP/12-131.WNESYFIASCG..G-V.TVSQLKEYVENQ-----------
A0YQF8_LYNSP/12-130.WTHSYMFDTTG..K-I.SSKRILDYINDP-----------
A0YS48_LYNSP/10-130.GRDGTFYSSVG..G-V.SEKAIKQYIETQ-----------
A0YTU0_LYNSP/12-132.WTGSYFLASCG..G-V.TVEQLKKYVEDQ-----------
A0YV57_LYNSP/12-133.WNSSYFIASCG..G-V.TISTLKKYIDQQ-----------
A0YWZ8_LYNSP/7-123.WTPSYFCATTG..N-A.STETIKKYIENQ-----------
A0ZDZ5_NODSP/12-129.RTNSYFVSTVG..G-A.PISVIKQYIENQ-----------
A1ASY5_PELPD/11-130.WARGYFVSTVG..A-DEEMRLIRK.IDGN-----------
A1B6L6_PARDP/10-129.WGRGYFSTTNG..A-I.TEDIVLQYLENH-----------
A1T0T7_PSYIN/11-131.WTQSVFVETIG..N-A.TEEVIRKYVQNQ-----------
A1T5G3_MYCVP/16-133.WTNSYFVATVG..G-A.PLSVIKRYVETQ-----------
A1U7S0_MARAV/12-131.WSRAYFVSSCG..G-A.PLSVIKEYIENQ-----------
A1VLR6_POLNA/14-134.WSPSYFAGSCG..G-A.PIAVIRQYIEQQ-----------
A1ZGJ3_9BACT/12-129.WTRSYYIESVG..R-I.SEKNIKKYIENQ-----------
A3DH13_CLOTH/11-129.WCRGYYVDTVG..R-..NRKAIEQYIRRQ-----------
A3ESB6_9BACT/11-130.WARGYLAVSSG..T-I.TDEMIKEYIDDQ-----------
A3HSL3_9BACT/3-118.WQDEYYAVSVS..E-S.VLDRVRKYIKNQ-----------
A3HTZ3_9BACT/7-121.WQAGFGAFSYT..Q-S.SLPNIISYIENQ-----------
A3HZW2_9BACT/5-119.WQSGFGCFTYS..Q-K.EINSVFKYIEYQ-----------
A3ITV5_9CHRO/14-130.WSRSYFYETTG..K-V.SSEKIRAYIEDP-----------
A3JHU9_9ALTE/14-134.WSPSYCAVSTG..G-A.SLDVVKNYVQKQ-----------
A3N3W0_ACTP2/3-118.WSKGYCALSYS..E-H.EIGKIINYIKGQ-----------
A3W7S5_9RHOB/10-129.WARGYFSTTSG..N-V.TDDVIKQYLELH-----------
A3ZXL2_9PLAN/11-130.WARGYFVATSG..N-V.TDEVIQEYIRHQ-----------
A4E7V4_9ACTN/12-130.WAEGYYVSTVG..L-..NEATIAKYIREQ-----------
A4J2W0_DESRM/10-130.WSKGYYVGTAG..P-V.SAETIQKYIENQ-----------
A4N2N4_HAEIF/3-118.WSVGYCALTYS..D-S.DKYQLINYIKNQ-----------
A4TFZ9_MYCGI/18-138.WSPSYFAGSCG..G-A.PLSVVRDYIENQ-----------
A4XMT5_CALS8/11-128.WTRAYFVATAG..N-V.SSETIKKYIEAQ-----------
A5CZ87_PELTS/12-131.WSPSYFIASTG..R-V.TLDVLRRYVEEQ-----------
A5EW57_DICNV/13-134.WARSYCLLTHG..D-VQTVDIIRHYLERQ-----------
A5F7S7_VIBC3/11-129.WARGYFVDTVG..V-..NEEIIRRYVRHQ-----------
A5FCA3_FLAJ1/8-121.WQEGYGAFSYS..R-S.HVPSVIRYIQNQ-----------
A5FHV9_FLAJ1/5-119.WQEGYGAFSYS..K-S.QLNAVIEYIQKQ-----------
A5FLD5_FLAJ1/5-119.WQNGFGAFSYG..H-S.QLTNVIKYIENQ-----------
A5FLH9_FLAJ1/5-119.WQTGYAAFAVS..E-S.QLDAVYNYIKNQ-----------
A5FNU2_FLAJ1/3-118.WQDEYFAVSVS..E-S.IVDKVRNYIKNQ-----------
A5FTI1_ACICJ/14-134.WSRSYCVISCG..G-A.PLSVIKQYIEQQ-----------
A5G3E6_GEOUR/11-130.WAEGYCVDTVG..L-..DAEMIRKYVVYQ-----------
A5G9R6_GEOUR/9-128.WQDGYGAFTVG..V-S.QIADTVRYIEGQ-----------
A5KLF3_9FIRM/15-133.WCKGYYVDTVG..K-..NTAAIKSYIANQ-----------
A5MCH0_STRPN/12-130.WCRGYYVDTVG..R-..NQKVIAEYIQNQ-----------
A5TXA2_FUSNP/11-130.WNPSYFVATVS..E-N.TEEQIKRYIQTQ-----------
A5UR96_ROSS1/3-117.WQSGYGALSIG..E-Q.SLETVMAYAARQ-----------
A5UWB3_ROSS1/9-123.WQGSYGAFTVS..R-W.DVARIKEYIKRQ-----------
A5VHM5_LACRD/16-137.WSPSYYMSTLG..N-M.SKDVVENYINNQ-----------
A5W7D3_PSEP1/16-130.WQAGYRDRAMR..K-DDDLLNTARYIIAN-----------
A5ZT63_9FIRM/10-128.WCRGYYVDTVG..K-..NAKKIQEYIANQ-----------
A5ZT97_9FIRM/33-152.WNPSYCAVTVS..D-R.SREQVCSYIERQ-----------
A5ZYT4_9FIRM/11-130.WSQSFCLLTAG..G-A.PVEVIRQYIETQ-----------
A6DFZ7_9BACT/5-123.WQKGYGSFSVS..P-S.NLSKVEQYIAQQ-----------
A6DIE5_9BACT/3-117.WQSEYAAISKS..F-N.ELPVTIEYIKNQ-----------
A6DJE0_9BACT/5-115.WQRGYGAFSVS..A-S.VCQKVKRYIEKQ-----------
A6DTI6_9BACT/5-124.WQKGYGVFSVS..P-S.ILDKVKAYVENQ-----------
A6NSH3_9FIRM/13-131.WCRGYYVDTVG..K-..NAGRIAEYIKHQ-----------
A6QB17_SULNB/11-130.WAKGYCVDTVG..L-..DGDMIWKYVKYQ-----------
A6TLW4_ALKMQ/10-129.WARSFCLLTTG..D-V.SVEVIKGYIESQ-----------
A6VTE3_MARMS/13-129.WQPSFYDRALR..A-EDDRLSIARYIITN-----------
A8F1E5_RICM5/13-132.WGRGYFSTTSG..H-I.TDEVINEYINNL-----------
A8F729_THELT/10-129.WSRSYCLISTA..G-V.PIEIIRKYIESQ-----------
O06525_HELPX/14-134.WSPSYFAGSCG..G-A.PLEMIKQYIQEQ-----------
O83028_DEIRD/17-136.WNPSYCILTVS..E-N.TRAQIQKYIESQ-----------
P94655_CLOPF/10-128.WCMGFYVDTVG..K-..NKKAIEDYIRNQ-----------
P97210_HELPX/24-147.WTDGFFVCSIG..Q-A.NPETIKAYIENQ-----------
Q0GL54_LACRE/14-133.WTQSYCLISTG..G-A.PLEVLKRYIESQ-----------
Q0I2W7_HAES1/22-142.WSPSYFAGSCG..G-A.PISIIRQYIEQQ-----------
Q11SK3_CYTH3/5-119.WQTGYAAYSVS..E-S.IVGKVDAYIQNQ-----------
Q11V54_CYTH3/5-117.WQIGYGAFSVS..S-S.KIDTVSNYIMNQ-----------
Q11Y47_CYTH3/3-117.WQDDYFAISVS..E-S.QVKNVIRYIKNQ-----------
Q11YI8_CYTH3/5-119.WQEGYGAFSYS..H-S.NLNQVIAYIMNQ-----------
Q18CV0_CLOD6/9-126.WTNSYFVGTVG..S-V.SLEVVKQYIENQ-----------
Q18KK1_HALWD/19-139.WKDGYDVGTTG..G-V.SEDVVR.YIEEK-----------
Q1I4D7_PSEE4/16-130.WQAGFHDRALH..R-EEDVKAVARYIVAN-----------
Q1I8P3_PSEE4/16-130.WQAGFHDRALR..R-EDDVVKVARYIVAN-----------
Q1IW17_DEIGD/12-128.WTRSYFVSTAG..A-V.SGATIQKYIAAQ-----------
Q1Q1X9_9BACT/11-130.WSRGYCVDTVG..L-..DTEKIRKYVKYQ-----------
Q1QF32_NITHX/11-129.YGQGYWVASSG..N-V.TDEVWKKYIEDQ-----------
Q1VS81_9FLAO/5-119.WQTGFGAFTVS..Q-S.AVNNVLDYIKNQ-----------
Q1VUJ0_9FLAO/5-119.WQNGYGAFTYS..K-S.HIDRVVKYILNQ-----------
Q1VXK0_9FLAO/13-133.WSSGYFVNTVS..K-FGMESAISKYVRDQ-----------
Q20XV6_RHOPB/11-129.WARGYFVSTIG..R-..DEAVIREYIRQE-----------
Q24Z31_DESHY/8-127.WSQSYCMVTTG..G-A.PLDILKKYIESQ-----------
Q2JNY0_SYNJB/12-132.WNESYFIASCG..G-V.TVSALSQYIESQ-----------
Q2JT06_SYNJA/33-153.WTGTYFVASCG..G-V.TVEELKKYVEQQ-----------
Q2JX40_SYNJA/15-131.WSRSYFFCTAG..N-A.SAEVIQNYINDP-----------
Q2S639_SALRD/15-131.WTRSYFVSTTG..K-A.GEQVVQQYIEDQ-----------
Q331U4_CBCP/17-137.WSRSTFVATVG..S-V.SLDIVKRYIENQ-----------
Q332K6_CBCP/12-129.WTRSYFVSTAG..N-I.SSETVKQYVENQ-----------
Q38463_BPPHH/12-130.WQPGYFLATTG..Q-V.SIDTLMDYVDDQ-----------
Q3AEI0_CARHZ/18-135.WTNSYFVATVG..G-A.PRATLREYIEKQ-----------
Q3ASF0_CHLCH/5-119.WQEGYGVFSYA..H-S.QIEYVYQYISKQ-----------
Q3BWF5_XANC5/19-133.WSRSYHDHALR..T-DDDLPAAARYIIAN-----------
Q3EVJ8_BACTI/10-129.WSRSFCLLTTG..G-S.PIDVVKTYIENQ-----------
Q3ILG5_PSEHT/10-130.WSDGYFVCSVG..N-A.AADTIRKYIQEQ-----------
Q3IPA5_NATPD/11-130.WKVGYYVGTTG..A-V.SEEVVERYIEET-----------
Q3JB10_NITOC/14-133.WSRSYFACSAG..G-A.TIETLKAYVQSQ-----------
Q3JE33_NITOC/16-133.WNRSYYAGTVG..H-V.SESTVRAYIENQ-----------
Q3M4G8_ANAVT/13-135LWHDSKCVVSCG..G-A.PLEIVKDYIKGQ-----------
Q3MDI5_ANAVT/3-118.WQEGYGVFSLG..S-K.QLEQAVNYVKNQ-----------
Q3R3H9_XYLFA/22-141.WSPSYFASSCG..G-A.PISIVRQYIEQQ-----------
Q464U6_METBF/10-131.WSDGGYIGTVG..D-GTTSDVIKSYIENQ-----------
Q46ET2_METBF/11-131.WSSGKFYRSVG..N-V.TADTIKHYIKES-----------
Q484I4_COLP3/11-129.WARGYFVSTVG..L-..DENMVREYIRNQ-----------
Q485N4_COLP3/13-128.WQRGFYDHAIR..T-EESLLSVSRYIVAN-----------
Q48DG1_PSE14/17-131.WQSGFHDVSIR..T-EESLLNFARYIVAN-----------
Q4BZD6_CROWT/12-132.WNESYFIASCG..G-V.TISVLKKYIEGQ-----------
Q4C7A6_CROWT/12-133.WTGSYFVATCG..G-V.TIEQLKQYVEKQ-----------
Q4C9I1_CROWT/12-132.WNSSYFIASCG..G-V.TISTLKKYVENQ-----------
Q5GN45_LYSSH/10-128.WCRGYLVDTVS..R-..NRKVIHKYIKKQ-----------
Q5J4C5_SALCH/18-137.WSRSYFACSAG..G-A.TIETLKAYVLRQ-----------
Q5JI87_PYRKO/12-132.WSPSYFLATSG..Q-V.TLDVLKAYVESQ-----------
Q5NX16_AROAE/12-130.WHRAYFVGSVG..G-A.TLETVRAYVDAQ-----------
Q5NY63_AROAE/12-103.WARGYFVSTVG..L-..DEAIVRAYIRAQ-----------
Q5V3V2_HALMA/10-129.WEESYYVGTAG..D-V.STDTIEQYIERT-----------
Q5V7Q1_HALMA/12-132.WNDSYCLISTG..Q-V.SLDVLKQYVEDQ-----------
Q5W394_9BACT/11-130.WQRGYFVDSVG..A-..NEEIIRRYVKHQ-----------
Q5WKC7_BACSK/10-128.WAKGYYVSTVG..L-..NQKTIEKYIREQ-----------
Q649F0_9ARCH/18-138.WTDGYYVATVG..E-RANWRTVERYIERQ-----------
Q6LR15_PHOPR/12-131.WARGYFCVTSG..E-L.TEEMIKEYLDHH-----------
Q6T8F3_9CHLA/11-131.WSPSYCVVSCG..G-V.ALDVVREYINNQ-----------
Q74KQ8_LACJO/18-139.WSPSYYFGSVG..N-M.SKEVVEKYINDQ-----------
Q7M7F4_PHOLL/10-129.WGRGYFCATVG..Q-L.TEEMIKSYLEHH-----------
Q7US03_RHOBA/3-117.WQTKYGAFSVS..E-S.SVDSVKAYVANQ-----------
Q7UVV9_RHOBA/38-155.YQGRYKSFPIQ..D-DEHFLTVCRYVERN-----------
Q7WCD1_BORPA/9-125.WESRYYSSVIG..T-EEYFRECCRYIELN-----------
Q7X379_9BACT/16-133.YQSRFSAVGVS..D-LQHLLTVWCYVERN-----------
Q815G4_BACCR/12-129.WTRSYFVSTAG..N-V.STETIKQYVENQ-----------
Q82PQ1_STRAW/18-138.WSPSYFAGSCG..G-A.PLDIVKDYIENQ-----------
Q82QX0_STRAW/13-131.WSPSYFAASCG..G-A.PLSLIKEYINNQ-----------
Q82SR9_NITEU/15-133.WARGYFVSTVG..L-..DDNIVRTYIRNQ-----------
Q83T86_SALTI/25-144.WSRSYFAGSCG..G-A.PLEVVKQYIQHQ-----------
Q893W3_CLOTE/12-126.FQDRFKSKIVD..T-RRYLIMLSAYIHNN-----------
Q897V3_CLOTE/10-129.WSRSYCLITTG..G-V.PIDIVKKYIENQ-----------
Q898F8_CLOTE/24-138.FQDRFKSKIID..S-QKYLITASAYIHNN-----------
Q899Z5_CLOTE/12-129.WTNSYFVSTVG..G-A.PLSAIKQYIENQ-----------
Q8CM83_THEEB/12-128.WSPSYFAASVG..G-A.PLEVLKEYIRNQ-----------
Q8CXX7_ECOL6/29-148.WSRSYFIGSCG..G-A.PLEVVKKYIQNQ-----------
Q8GF06_ENTFC/10-129.WSKSFCLLTTG..G-A.PIDVIKKYIQNQ-----------
Q8PRR7_METMA/14-133.WNPSYYVGTCG..D-T.TKETVKMYIETQ-----------
Q8R791_THETN/9-123.FQDRFRSEPVE..D-ESYVIALVRYIHQN-----------
Q8RLV2_XENNE/11-131.WTDGYFASTVG..K-HGDEQMIGRYVQNQ-----------
Q8TU17_METAC/10-130.WSDGYFASTIG..N-V.SKEATEYYIRNQ-----------
Q8X2J7_ECO57/19-139.WSPGYFASSCG..G-A.PISVIRQYIEQQ-----------
Q8XV65_RALSO/11-124.WEGRFRSTVLD..P-AEWVLPMILYVEGN-----------
Q8YK47_NOSS1/12-135.WTDAYSVNSVG..G-A.PLEIVKEYIRSQ-----------
Q8YKY9_NOSS1/9-130.WTGAYFVASCG..G-V.TVEQLKNYLENQ-----------
Q8YLC6_NOSS1/12-132.WSGSYFVASCG..G-V.TVSTLRKYIEAQ-----------
Q8YMI3_NOSS1/9-129.WEKRYHSTEFENTD-KKRALNTLRYIHAN-----------
Q8YRS2_NOSS1/12-130.WTHSYMFDTTG..K-V.STQKVLEYINDP-----------
Q8YWC8_NOSS1/12-129.WTNSYFVSTVG..G-A.PLEAVKEYIQNQ-----------
Q93C78_HELPX/14-131.WTNSCFISTVG..G-A.PLNVVKQYIENQ-----------
Q93PB3_9BACT/11-128.WTRGYFAVS....N-V.TDEVIMQYIENQ-----------
Q972N6_SULTO/10-128.WTRSYFVSTAG..N-V.SSETIKKYIEEQ-----------
Q987Z8_RHILO/19-133.WQGRFGAVAM...D-EDHLLSAVRYVGLN-----------
Q9HHX7_HALSA/8-124.WARGYYAGTAG..H-V.SSETVENYIQQH-----------
Q9HKW9_THEAC/17-134.WTHSKFISSVG..A-V.TLEVVQKYIEDQ-----------
Q9HSD5_HALSA/12-126.WTRSYFVSSAG..D-V.SSEVIEEYIDAQ-----------
Q9RMA7_BACCI/9-123.FEKRFYDKIIE..G-KEGMLEVSRYIHLN-----------
Q9RT39_DEIRA/11-130.WGVGYGAWSTG..T-I.TEAMVQEYLEHH-----------
Q9X2F2_THEMA/10-126.WARSYYVGTAG..N-V.SEETIRRYIEEC-----------
Q9ZN95_9RICK/11-130.WAVGYFVRTSG..N-V.TDEMIKNYIENH-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window