Sequence alignment for CL0481

PF01797

B9LSV3_HALLT/9-121KYELYYH------IV...FVPKYRRSH.LTGK.TKER------------------LESIF.AEICEDKGLELAE...SEV
B9LMY5_HALLT/12-130VYALQYH------FV...TVTKYRADL.LTDE.IAER------------------VGEIA.SDISEDFGVNIQN...VNG
B4SER8_PELPB/11-131VTVLMYH------IV...LPAKYRRVI.FDDE.VDEV------------------LKDVC.LEIENRYQIKFLE...IGT
A8KYK3_FRASN/14-134VSSLHAH------LV...FVTRYRRGG.LDDA.MLTR------------------CEQIM.RSVCCDFGAALTE...FNG
A8L9Q9_FRASN/6-123VYDLGYR------IV...WCPKYRRPV.FAGS.VRDR------------------CEELV.RRKCTEHEWMVVA...WEV
B1YEE0_EXIS2/12-129VSLIHYH------FV...FCPRYRRKI.FLRNDVEGY------------------FKELV.QEICESLEIHTIA...LAC
B1YKP1_EXIS2/10-129VFLLNYH------LV...LVVKYRRKV.IDDA.ISDF------------------ARQTF.ERIGASYHITLNE...WNH
A0JQH2_LACS1/15-136VYNLHFH------LI...WCTKYRNKT.FTDDKLSNE------------------MKEIL.QRVADDNEIAIEK...MEV
A0M0J7_GRAFK/11-130VSRLTVH------VV...WCTKYRYRV.LKDD.IQIR------------------CRSLL.IQICEAEDVSILK...GVV
A1ASY5_PELPD/11-130KWDCKYH------IV...WVPKCRRKV.LYGR.IRKH------------------LADLL.HCLARQKECKIQE...GHL
A1B6L6_PARDP/10-129VFYHRYH------IV...WSTKYRYKV.RIGP.LRLR------------------VRDIC.RQVCRENGVDILR...GVL
A1T0T7_PSYIN/11-131VYRLIYH------FV...WIPKYRHKV.FNEP.HRST------------------IKAII.QKIGYDYDIDIVE...LEI
A1T5G3_MYCVP/16-133AFQCAYH------VV...WCPKYRRKV.IGGR.METR------------------LKEII.CEVVDEKGSWLIE...LET
A1U7S0_MARAV/12-131AYLLHAH------IV...FVTKYRRKI.FAPA.HHDA------------------FREAA.RQVCAEFGVEIEE...CNG
A1VLR6_POLNA/14-134VFLMHVH------LV...FITKYRHGV.FTKE.VIDD------------------LRAIF.ASVCKDFESELVE...FDG
A3DH13_CLOTH/11-129QWNCKYH------IV...FVPKYRRQV.IYGK.IKKD------------------IGQIL.RKLCEMKGVEIIE...ASL
A3HSL3_9BACT/3-118FVKVYIH------FV...WTTKNRYPY.FNSKELRLK------------------VWEHI.RENSKSKGIFVDF...VSG
A3HTZ3_9BACT/7-121FSQIYIQ------II...FAVKNRNTL.ISKI.WEEE------------------LYKYI.SGIITNKDQKLIA...ING
A3HZW2_9BACT/5-119YSQMYAQ------CV...FAVKYRNSQ.IHKN.WEKD------------------LFSVI.GNLIKENNCDLMI...VNG
A3N3W0_ACTP2/3-118YTKLFYH------IV...FRTLQSVPA.INEE.NEKE------------------LYQYI.WAFCQQQKCTLHH...ING
A4J2W0_DESRM/10-130RYNINYH------LV...WCPKYRHQV.LTDQ.IETY------------------LKKLI.YNICDHYKYEVLT...MEV
A4XMT5_CALS8/11-128KFLINYH------FI...WIPKYRKDF.LKDPEVKKT------------------VEDTI.KELSKAYKFDILA...LEI
A5CZ87_PELTS/12-131VYSIQFH------LV...FCVKYRRKV.LKGP.VVER------------------LKEIV.HHIAERFGVEIIE...QET
A5EW57_DICNV/13-134VYKLTYH------LV...LVTKYRKKC.FTDV.MLTR------------------LHLIV.KELCQKWGIQLLS...FHG
A5FCA3_FLAJ1/8-121YTQLHVQ------FV...FAVKYRKAL.ITKD.WKER------------------LHQYI.TGIIQSNQHKMLC...INS
A5FHV9_FLAJ1/5-119YTQIHIH------FV...FAVKYRKAI.IHKN.WRDE------------------LFKYI.SGIIKNNNHKLLA...ING
A5FLD5_FLAJ1/5-119YSQLYIQ------IV...FAVKGRQNL.ISKK.WKDE------------------IYKYI.TGIITNQKQKLIA...ING
A5FLH9_FLAJ1/5-119FTKLWIH------AI...WATKNRQEL.IDFS.IEKT------------------VYDYI.HNELIDLDCPARI...ING
A5FNU2_FLAJ1/3-118FTKVYIH------CV...WSTKNRFPF.LNSTDLRQK------------------VWHHI.KENALKKEIYLEY...ISC
A5FTI1_ACICJ/14-134VYALNYH------LV...LVTKYRRKC.ITGP.MLGR------------------FREIA.AARCEGWGGKLIE...VNG
A5G3E6_GEOUR/11-130LWHCQYH------IV...WVPKYRYRV.LRGP.VAEE------------------VYKCI.QVFSGRLGCEVVE...LNV
A5G9R6_GEOUR/9-128QNGQYIH------RIALPYRIQYEKPR.TVAYPAEGS------------------SYLGIPCGIARTNAMKALQ...VGG
A5UR96_ROSS1/3-117YWRLHYH------LI...WSTQDRLPT.LTGE.REKM------------------FYGVL.YRKAAELGVKIHA...AGN
A5UWB3_ROSS1/9-123KLALFLH------LV...WATWDRLPL.ITPD.IERR------------------LYRNI.ESEARKQGCTVLA...LNG
A5VHM5_LACRD/16-137VYNFHYH------LI...WVTKYRHQA.FSTKELVDE------------------MKDIL.RMVAKDNEIVIEK...MEV
A6QB17_SULNB/11-130IWHCQYH------IV...WVPKYRYRI.LNGE.IARE------------------VENLI.RAFSHQMKCEIIE...LNV
A6TLW4_ALKMQ/10-129VFLMYYH------LV...LVVKYRRRV.IDHP.ISEE------------------LKAIF.VKIASNYNITLQE...WNH
A6VTE3_MARMS/13-129EPNREYF------IT...FNTLDRIPH.FNDFSLAHL------------------FCQQI.ETNQKYHKCTWLT...WVL
A8F729_THELT/10-129VFLLHYH------LV...LVIKYRRDV.ITDQ.ISKR------------------LKEIF.EYIQPSYNITLLE...WNH
Q11SK3_CYTH3/5-119LSKIWIH------AI...WSTKNRTEL.IEKH.HEQH------------------IYTFI.KNQFNECGCYIKN...ING
Q11V54_CYTH3/5-117LSQMYIH------LI...FGTKNRYPF.IIGS.VETE------------------LHKYI.AEILKSYESPAIK...INS
Q18CV0_PEPD6/9-126VYDCKYH------IV...FCPKYRKPV.LVGE.VEKM------------------LKEIL.PYKADELGAEIIE...MET
Q18KK1_HALWD/19-139ISLCKYH------FV...WCRKYRHGM.LEL..VQDE------------------LAELF.EGIAERFGHEIVSV.EVEI
Q1IW17_DEIGD/12-128VYLLNYH------FV...FIPKRRRKV.LVGP.VETR------------------LKEVL.AEKCAEMKWDILA...LEV
Q1QF32_NITHX/11-129VWDCKYH------IV...WVTKYRFAV.LGGD.VGFR------------------ARELL.REIALSHEMVIHA...GTI
Q20XV6_RHOPB/11-129KWECKYH------VV...FIPKCRRKT.LYGE.LRRH------------------LGELF.RKLAQQKESRIQE...GHL
Q24Z31_DESHY/8-127VFLLTYH------LV...MVVKYRRKV.IDDT.IALR------------------IREIG.ESIGKNYHITFLE...YNH
Q2JNY0_SYNJB/12-132VSDLKAH------LV...LTTKYRRKV.FTSE.MLQR------------------LHEVM.YDLCQKWGCKLIE...FNG
Q2S639_SALRD/15-131VHAVKYH------FV...FCPKRRASV.LKDE.VANR------------------LGKVL.HEVAEEHDWEINS...LAI
Q3AEI0_CARHZ/18-135MYSCKYH------VV...WCPKYRRPV.LKDG.VDVR------------------LKEIL.FEVAREKRAEIIE...LEV
Q3ASF0_CHLCH/5-119YSQIYIQ------YV...FAVKGRENL.LQKP.WRDD------------------VFKYI.AGIIKGKNQKPII...VNG
Q3ILG5_PSEHT/10-130KYLIALH------LI...LVVKYRKQL.LKGD.VGDF------------------VKQKI.TEIAERSEFNIEE...IEV
Q3IPA5_NATPD/11-130VSSCKYH------FV...WCRKYRHQI.LNA..VEDD------------------VRELF.DETADHFGHEILA...LEI
Q3JB10_NITOC/14-133VTRLVVH------LV...FTTKYRGKV.FDGY.ILGQ------------------LREAF.ESACEKLDCRILE...FDG
Q3JE33_NITOC/16-133VFSLKLH------LV...WCPKYRRGV.LVGE.IAER------------------LCALL.HKKADELEMTIHA...LEV
Q484I4_COLP3/11-129GWDCKYH------IV...FIPTKRRKM.IFGS.IRKH------------------LGEVF.HELARQKCVIIEE...GHL
Q485N4_COLP3/13-128LKHHIYH------VI...TCTKNRQPF.FNDFECARF------------------LINEM.TNLVEQKEINSIT...WVI
Q5JI87_THEKO/12-132VYSLYYH------LI...LVVKHRRKV.FTNDRIIDF------------------LKQKI.HEISETHEVEVLT...IET
Q5WKC7_BACSK/10-128RWNCKYH------IV...FIPKYRRKI.VYGK.LRKD------------------IGAIL.RRLCEMKDVEIIE...AHA
Q74KQ8_LACJO/18-139VYNTHYH------LI...WCTKYRNQI.FTNTNLAEE------------------MRKLL.LQIAEDNQIKIEK...MEI
Q7M7F4_PHOLL/10-129VFQIEYH------FV...WVTKYRYKV.LTGE.VASR------------------VRELI.RQTCGSFEIRILK...GVV
Q7US03_RHOBA/3-117YTNLRVH------LI...WSTKDRKQW.FFDE.FQEE------------------LSAYI.GGVLRKRKHSLLA...AGG
Q7UVV9_RHOBA/38-155ASGHLYH------VL...NRANRRATI.FRKQQDYEA------------------FESVL.AEALSKDEVELFS...YCL
Q815G4_BACCR/12-129VSLINYH------FV...FCPRYRRKIFLNTK.VEER------------------FKELV.QEICGEMDVAIVA...MEC
Q82PQ1_STRAW/18-138VFNLHAH------LV...FVTKYRREI.FNGE.MLTR------------------CEAIM.SDVCESFGAELRE...FNG
Q82QX0_STRAW/13-131SHTLSPR------VA...MLWEASRSVWATTP.HPRQ------------------MKSPW....STRFRLSLRE...FNG
Q82SR9_NITEU/15-133RWDCKYH------VV...FIPKRRKKR.IFGM.LRWH------------------LGELF.HELASHKESKIVE...GHL
Q893W3_CLOTE/12-126SENAIYH------IM...IRSITEVPL.FKKHEDKIR------------------YLNKM.REYQKIYKFKVYA...YCL
Q897V3_CLOTE/10-129AFLLNYH------LV...LVIKYRRNV.IDDQ.VSNR------------------LKEIF.EYICPKYNIVLEE...WNH
Q898F8_CLOTE/24-138TDNSIFH------IM...VRSISEVNL.FQTDFDKIQ------------------YLNFV.KFYKEIFNFKVYA...YCL
Q899Z5_CLOTE/12-129VYSCKYH------IV...WCPKYRRKV.LIGN.VETR------------------LKELL.IETCADIEVDIIK...MEL
Q8CM83_THEEB/12-128VTDLKIH------LV...CVTKYRRPV.LSAE.GLEL------------------IEKSF.REVAKKMDFQILE...FNG
Q8R791_THETN/9-123SKSGYYH------VM...LRGNEKKNI.FNNDDDKKR------------------FIEIL.AEKKLDGKFYLTA...FCL
Q8TU17_METAC/10-130KFLLMYH------II...FVCKYRKAI.LEP..ISEE------------------LKQIV.IDISKGSNFEILE...MET
Q8XV65_RALSO/11-124DSPV..H------VL...QRGNNRQAV.FRADEDYAF------------------YLDTL.RMAAREHDFAIHA...FAL
Q8YK47_NOSS1/12-135VFSIHLH------VV...LIAKYRKEV.ITQE.ILVK------------------LQEVF.NRVCEKRKCLLTE...FSG
Q8YKY9_NOSS1/9-130VYRLNAH------IV...LVVKYRRKA.INAE.ILNR------------------LKEII.TDTLKKWDCELLE...FNG
Q8YLC6_NOSS1/12-132VSDLKVH------LV...LVTKYRRKA.FTSE.MLSR------------------LNVVM.QELLEKWDCKLVT...FNG
Q8YMI3_NOSS1/9-129QPGYSYH------IT...IRCNNREFR.LTRWECRQV------------------LLYAI.KKAIDKYQFKLYGLCIMCI
Q8YRS2_NOSS1/12-130IGLATVH------LV...WIPCRRRRVFANNEKLKLR------------------CIEIF.QSVANDKRWIIKA...LEI
Q8YWC8_NOSS1/12-129VYSCKYH------IV...WTPKYRRKV.LKDG.VDTR------------------LKELL.QQIAAEIQVEILE...MEV
Q972N6_SULTO/10-128KYLCNYH------FV...WIPKYRRKV.LTGE.VAEY------------------TKEVL.RTIAEELGCEVLA...LEV
Q987Z8_RHILO/19-133VPGLPHH------VT...QRGNGRAKV.FFTTEDYAL------------------YKILL.VEHCRAANVGIWA...WCL
Q9HHX7_HALSA/8-124TYNLNYH------IV...WLPKYRQSV.LVNE.VASR------------------VRSIL.HEIAADKGVEILD...LTV
Q9HKW9_THEAC/17-134VYSCQYH------VI...FCPKYRRKV.LVDG.IDKR------------------LKELI.LEKQNEYQYKILE...MEV
Q9HSD5_HALSA/12-126VHKLQYH------FI...WCPKYRKSV.LTGE.VRDR------------------LEELI.KEKADELGVEILE...LAI
Q9RT39_DEIRA/11-130VSRLTLH------VV...WATKYRYHV.LVGE.IKPR------------------CRELL.IQICKAEDVRILK...GVV
Q9X2F2_THEMA/10-126HYNLNYH------FA...WIPKYRRKI.LVGS.IAEE------------------LERIL.RNTAKQHGIEILA...LSI
B0UVA1_HISS2/14-134VFNLHVH------LV...FVTKYRREV.FTKF.ILDD------------------LKAIF.ESVCSDFEAKLVE...FDG
B1WQK8_CYAA5/24-142.SDLKAH------LV...LTTKYRRKV.FTGS.MIER------------------LQTII.WELCCKWDCKMIE...VNG
C7P0F4_HALMD/13-132.FSLHYH------LI...LTTKYRRGV.LTEE.RTQF------------------IHEVI.SGFTDNYGVELTN...LDG
D3VJ26_XENNA/13-131..VLMYP------IV...LPAKYRRAV.FDAR.VDEI------------------LKTVC.LEIELRYQVKFLE...IGT
D4LI30_9FIRM/33-152VYSLQYH------LV...WCTKYRKKV.LKDG.IDAE------------------CKEML.CDLAEEYKFQILA...MEV
G2KUJ1_LACSM/10-129VYLLNYH------LV...MVVKYRRKV.INDE.ISEY------------------LKHRF.VVVGQSYGINLQE...WNH
O34550_HELPY/15-134.FLMHVH------FV...FVTKYRRSA.FNKE.VIDF------------------LGSVF.AKVCKDFESELVE...FDG
O34754_HELPY/19-141.HNLKAH------LI...LVCKYRKKL.LQGD.LNNF------------------IKSVI.DEIATQSNFIIIA...MES
Q32DE7_SHIDS/20-139.FLMHVH------LV...FVTRYRRQI.FDYD.ATEK------------------LRTYF.SNVCADFEAELVE...MDG
Q3Y111_ENTFC/10-129VFLLYYH------LV...LVTKYRRQV.IDDE.ISDY------------------AKTTF.ERISESYHITLVE...WNH
Q6LQP5_PHOPR/12-130VFKIQYH------FV...FVTKYRYQV.LTGD.VGLK------------------ARELI.RQTCHAFEIDILK...GVI
Q7DF83_DEIRA/17-136VYQLEYH------LI...WCVKYRHQV.LVGE.VADG------------------LKDIL.RDIAAQNGLEVIT...MEV
Q9HSW8_HALSA/12-130VYALQYH------FV...TVTKYRADI.LTYE.RLER------------------VAEIA.HDIADDFEADIKN...VDG
Q9KM89_VIBCH/11-129YWRCKYH------IV...WTPKFRFKI.LKGN.VAKE------------------LNRSI.YILCNMKDCEVLE...LNV
R5QF53_9FIRM/16-133.WNCKYH------VV...FAPKYRRKV.FYNE.KKEA------------------IREII.RTLCQWKGVEIIE...GEV
R6RAE1_9FIRM/11-128.WNCKYH------IV...FAPKYRRKV.AYGK.IKQD------------------IANIL.SMLCKRKGVKIVE...AEI

PF04986

Q01P74_SOLUE/145-335GFLCVLHTWGQT.LI---HHPHIHCVL-PGGGFAPGR....TRWVR....PRRAGFFLPK-YVLSEVFRGKFIDGLRDLF
A1WDQ9_ACISJ/182-382GAVAFIHRFGSS.LN---EHVHFHVCV-VDGMFEAVAG...EASEQGTRTTAISVMFHPA-IGIDPEAVTQAQASLRRRI
Q12Q53_SHEDO/139-306GFTGVLHTHNRR.RD---LHPHIHFII-PAGSFDKDR....KQWHK....SKGK.YLFNN-VNLASVWRAKLLEQLTKK.
A5GBJ9_GEOUR/131-297GILAVLHTWTRA.LE---HHPHVHMLV-PAGGLDKDG.....QWRE....SRKK.YLVPV-KALSKGFRYRFMKMARKA.
Q981L3_RHILO/137-326GFFAVLHTWGQN.LS---HHPHLHCVV-PGGGLSPDG....SRWIE....CRPR.FFLPV-AVLSRLFRRLFLEDLQKAF
Q5P667_AROAE/144-333GFIAILHTWGQN.ML---HHPHLHCVV-PGGGVSADG....ERWIA....CRRG.FFLPV-RVLSRLFRHLFLKRLQQAF
Q01TH4_SOLUE/47-236GFFSVLHTWNQQ.LL---HHPHVHCVV-PAGGLSADH....QRWIS....AQPS.FFLPV-KVLSRVFRGKFVEGLRKLH
Q328X8_SHIDS/147-330GIFCAIHTYGRR.LN---CHPHVHVSV-TCGGLNKHG.....QWKK.........LSFLK-DAMRSRWMWNMRQRLLKAW
Q2W8U4_MAGSA/134-323GFITVLHTWGQA.LQ---HHPHLHCVV-PAGGLSPDG....QRWVA....CRPG.FFLPV-KVLSRLFRRLFLEQLTAAF
Q7TTN7_RHOBA/141-311GFFGVLHTWGRDPAV---YHPHVHYVV-PGGGVKLDELGHALSWQS....TPKN.FLFHH-GTLIRTYKAKLAEELRAA.
A1WDQ5_ACISJ/174-373GAVAFIHRFGSS.LN---EHVHFHVCA-VDGVFEEVAGEEGDAADAASQSSPSRIIFHPA-TGVTADAVGQVQASLRKRI
Q12YW6_METBU/152-326GAIVVLHPFSKD.MG---FNPHLHILL-TEGRFDMYG....KFIHQ.........KFIHF-KTMRKTWQYQVLTRFKDA.
Q1VPE4_PSYTT/140-316GMIAVLHTWGQN.LQ---LHPHLHCIV-PGGGVCEAG.....FWKKG..TAKDD.FLFSV-EAMSDKFRGRFVSKLRKA.
A9B8K8_HERA2/140-308GMLGVLQTWTRD.LR---YHPHIHYLI-PGVGRTATG........QLVFPPAEN.FLLPM-RPLAVLFRAKLRAALRQI.
A6TTH3_ALKMQ/138-326GMIATLQTWGQT.LY---LHPHIHCLI-TGGGLTDTE.....EWKN....SNKD.YLVPC-KTLMEIFRGKYIDELHKLA
A5G657_GEOUR/141-307GFFGVLHTWGRQ.LQ---YHPHIHYVV-PGGAISTAD....GSWRR....SGEH.FFLPV-KALSSIFRAKFRESIEKA.
A8LSZ6_DINSH/144-335GMTSVLHTWGSA.MT---HHPHVHVIV-PGGGLSPDG....SRWVA....CRPG.FFLPV-KVLSQLFRRLFLEGLIRLH
Q121V9_POLSJ/144-335GATLVLHTWGSA.LT---HHPHVHGIV-PGGGLAADG....KTWVA....CRPG.FFLPV-RVLSRLFRRRFLEELHLAH
A0LBL2_MAGSM/140-314GVLALLHTWTQQ.LI---YHPHAHCLV-TGGGLSEDG....ATWYA....AKNG.FLIPT-KALARMIRGKVMSTFKMI.
A6VW84_MARMS/139-317GMTAVLHTWGQT.LV---RHVHLHALV-PSGVYRDQG......WHS....LKKN.YFLPV-KLLSNRFRGAMVSQLRAAF
Q039J1_LACC3/145-318GVVAALHTFGSK.LE---FNPHVHMVV-TMGGITPDG.....QWKT...Y.....DYLPY-KRLRVYWQNAVLKLIRRTL
A1TZA6_MARAV/137-319GMTAVLHTWGQN.LS---RHVHVHCLI-PGGVLTEAG.....EWHE....AKHQ.YLFPV-RALSRRFRGRMVSSLRRSV
Q0A7P5_ALKEH/141-322GIVMALHTWGRT.LN---AHPHVHCLI-SGGGLTTGG.....QWRA....VKGD.FLLPA-AVVKRVFRGKLLSRLRHDL
Q7TTG3_RHOBA/141-314GFTSVLHTWGRD.LG---YHPHVHVVV-PAGGIDAGG.....VWQS....SRAS.VFVPE-QILERLFRGKLKDKLRSE.
A5G455_GEOUR/137-325GVIMARHTWGQM.LG---LHPHVHCLV-SGGGLTQSG.....EWRS....VANG.YLLPV-RVVRSLFCGKFLDAIRRGV
B2JTR0_BURP8/144-333GFITILHTWGQN.LL---HHPHVHCVV-PGGGIAPDG....ERWIA....CRPG.FFLPV-RVLSRLFRRLFLEQLRRAF
Q01XA5_SOLUE/73-262GFLSVLHTWGQT.LQ---HHPHIHCVI-PSGGLSPDH....QHWVH....PRYP.FFLPV-PVLRRVFRGKFVAGLKSAF
A1W7Q5_ACISJ/174-367GAIAFIHRFGSS.LN---EHVHFHVCV-VDGVFEEVEG..EGDADATPRISSPGVIFHAA-TGIDAATVAPVQTTLQKRI
A6TIZ2_KLEP7/69-291GAVTLIQRFGSA.LN---LNVHFHMLF-LDGVYVEQ..............SHGSARFRWV-KAPTSPELTQLTHTIAHRV
F7V1Z4_CLOSS/62-247GYICILHTWGSE.MN---FHPHIHTIL-LGGGLTSKN.....EWKD....NGTE.FFLPI-WAISKVFRGKYMDELKNLW
H6URW0_PROSM/172-396GSVTLIQRFGSA.LN---LNVHYHMLF-LDGVYAEDD.............YGKQ.RFHRV-KAPTYDELNTLAHTLSHRI
K0C660_CYCSP/182-407GAVTLIQRFGSA.LN---LNVHFHMLF-IDGVYQEKH..............NGQLRFHRV-NAATTSELNTLVATISQRV
Y4QJ_RHISN/143-329GFFAVLHTWGQN.LL---HHPHLHCVV-PGGGFSPDG....TQWIA....CKPG.FFLPV-RVLSRLFRRLFLEHLEKAF
Q6W4R9_VIBA7/105-283GIFGALHTYGRA.LN---WHPHIHLSV-TRGGLDKHN.....TWKP.........IYFKK-KHVEYHWRRTLIRLLRQKY
Q877Q5_PSESM/155-333GVFCAIHTYGRR.LN---WHPHIHVSV-TLGGIDDAG.....VWKD.........LSFHP-SALRRRWMWNVRQYLLSQW

PF01797

B9LSV3_HALLT/9-121MPDHV-------------------------------------------------------------------------HL
B9LMY5_HALLT/12-130GSDHV-------------------------------------------------------------------------HI
B4SER8_PELPB/11-131DKDHV-------------------------------------------------------------------------HF
A8KYK3_FRASN/14-134EDDHV-------------------------------------------------------------------------HL
A8L9Q9_FRASN/6-123TPDHV-------------------------------------------------------------------------RL
B1YEE0_EXIS2/12-129DQDHT-------------------------------------------------------------------------HL
B1YKP1_EXIS2/10-129DGDHI-------------------------------------------------------------------------HV
A0JQH2_LACS1/15-136MPDHV-------------------------------------------------------------------------HM
A0M0J7_GRAFK/11-130SKDHV-------------------------------------------------------------------------HM
A1ASY5_PELPD/11-130QPDHI-------------------------------------------------------------------------HI
A1B6L6_PARDP/10-129SSDHV-------------------------------------------------------------------------HM
A1T0T7_PSYIN/11-131PEDHI-------------------------------------------------------------------------HM
A1T5G3_MYCVP/16-133MPDHV-------------------------------------------------------------------------HL
A1U7S0_MARAV/12-131ESDHV-------------------------------------------------------------------------HL
A1VLR6_POLNA/14-134EDDHV-------------------------------------------------------------------------HL
A3DH13_CLOTH/11-129CPDHI-------------------------------------------------------------------------HM
A3HSL3_9BACT/3-118HDDHC-------------------------------------------------------------------------HC
A3HTZ3_9BACT/7-121MEDHI-------------------------------------------------------------------------HI
A3HZW2_9BACT/5-119MPDHV-------------------------------------------------------------------------HT
A3N3W0_ACTP2/3-118MPDHL-------------------------------------------------------------------------HL
A4J2W0_DESRM/10-130MPDYI-------------------------------------------------------------------------HL
A4XMT5_CALS8/11-128MPDHI-------------------------------------------------------------------------HL
A5CZ87_PELTS/12-131VLDHI-------------------------------------------------------------------------HI
A5EW57_DICNV/13-134EPDYV-------------------------------------------------------------------------HL
A5FCA3_FLAJ1/8-121MPDHI-------------------------------------------------------------------------HI
A5FHV9_FLAJ1/5-119VSDHV-------------------------------------------------------------------------HI
A5FLD5_FLAJ1/5-119MPDHI-------------------------------------------------------------------------HI
A5FLH9_FLAJ1/5-119MPDHI-------------------------------------------------------------------------HV
A5FNU2_FLAJ1/3-118YSDHC-------------------------------------------------------------------------HC
A5FTI1_ACICJ/14-134EPDHV-------------------------------------------------------------------------HL
A5G3E6_GEOUR/11-130QPDHV-------------------------------------------------------------------------HL
A5G9R6_GEOUR/9-128YDDHI-------------------------------------------------------------------------HI
A5UR96_ROSS1/3-117VEDHV-------------------------------------------------------------------------HV
A5UWB3_ROSS1/9-123TEDHV-------------------------------------------------------------------------HL
A5VHM5_LACRD/16-137MPDHV-------------------------------------------------------------------------HV
A6QB17_SULNB/11-130QIDHV-------------------------------------------------------------------------HL
A6TLW4_ALKMQ/10-129DIDHI-------------------------------------------------------------------------HI
A6VTE3_MARMS/13-129MPDHF-------------------------------------------------------------------------HG
A8F729_THELT/10-129DRDHV-------------------------------------------------------------------------HV
Q11SK3_CYTH3/5-119MPDHI-------------------------------------------------------------------------HC
Q11V54_CYTH3/5-117VPDHM-------------------------------------------------------------------------HI
Q18CV0_PEPD6/9-126DKEHV-------------------------------------------------------------------------HL
Q18KK1_HALWD/19-139APDHV-------------------------------------------------------------------------QL
Q1IW17_DEIGD/12-128MPDHV-------------------------------------------------------------------------HL
Q1QF32_NITHX/11-129NRDHV-------------------------------------------------------------------------HL
Q20XV6_RHOPB/11-129MPDHV-------------------------------------------------------------------------HM
Q24Z31_DESHY/8-127DRDHI-------------------------------------------------------------------------HI
Q2JNY0_SYNJB/12-132EADHV-------------------------------------------------------------------------HL
Q2S639_SALRD/15-131RPDHV-------------------------------------------------------------------------HL
Q3AEI0_CARHZ/18-135MPDHV-------------------------------------------------------------------------HL
Q3ASF0_CHLCH/5-119IEDHI-------------------------------------------------------------------------HV
Q3ILG5_PSEHT/10-130DKDHI-------------------------------------------------------------------------HI
Q3IPA5_NATPD/11-130ADDHV-------------------------------------------------------------------------HL
Q3JB10_NITOC/14-133EEDHV-------------------------------------------------------------------------HL
Q3JE33_NITOC/16-133MPDHV-------------------------------------------------------------------------HL
Q484I4_COLP3/11-129MPDHV-------------------------------------------------------------------------HM
Q485N4_COLP3/13-128MPDHL-------------------------------------------------------------------------HW
Q5JI87_THEKO/12-132DQDHV-------------------------------------------------------------------------HI
Q5WKC7_BACSK/10-128MIDHI-------------------------------------------------------------------------HM
Q74KQ8_LACJO/18-139MPEHV-------------------------------------------------------------------------HL
Q7M7F4_PHOLL/10-129SQDHV-------------------------------------------------------------------------HI
Q7US03_RHOBA/3-117VEDHI-------------------------------------------------------------------------HL
Q7UVV9_RHOBA/38-155MPNHW-------------------------------------------------------------------------HL
Q815G4_BACCR/12-129DKDHV-------------------------------------------------------------------------HL
Q82PQ1_STRAW/18-138EGDHV-------------------------------------------------------------------------HL
Q82QX0_STRAW/13-131ERDHV-------------------------------------------------------------------------HL
Q82SR9_NITEU/15-133MDDHV-------------------------------------------------------------------------HM
Q893W3_CLOTE/12-126MSNHG-------------------------------------------------------------------------HF
Q897V3_CLOTE/10-129DLDHV-------------------------------------------------------------------------HL
Q898F8_CLOTE/24-138MSNHG-------------------------------------------------------------------------HF
Q899Z5_CLOTE/12-129MPDHV-------------------------------------------------------------------------HM
Q8CM83_THEEB/12-128EEDHV-------------------------------------------------------------------------HA
Q8R791_THETN/9-123MSNHV-------------------------------------------------------------------------HL
Q8TU17_METAC/10-130DKDHI-------------------------------------------------------------------------HF
Q8XV65_RALSO/11-124MPNHV-------------------------------------------------------------------------HL
Q8YK47_NOSS1/12-135EDNHV-------------------------------------------------------------------------HL
Q8YKY9_NOSS1/9-130EPDHV-------------------------------------------------------------------------HI
Q8YLC6_NOSS1/12-132EEDHV-------------------------------------------------------------------------HL
Q8YMI3_NOSS1/9-129MSNHI-------------------------------------------------------------------------HY
Q8YRS2_NOSS1/12-130APDHI-------------------------------------------------------------------------HL
Q8YWC8_NOSS1/12-129VEDHV-------------------------------------------------------------------------HL
Q972N6_SULTO/10-128MPDHI-------------------------------------------------------------------------HL
Q987Z8_RHILO/19-133MPNHV-------------------------------------------------------------------------HP
Q9HHX7_HALSA/8-124QHDHV-------------------------------------------------------------------------HL
Q9HKW9_THEAC/17-134MPDHV-------------------------------------------------------------------------HL
Q9HSD5_HALSA/12-126RPDHV-------------------------------------------------------------------------HL
Q9RT39_DEIRA/11-130SKDHV-------------------------------------------------------------------------HM
Q9X2F2_THEMA/10-126QPDHV-------------------------------------------------------------------------HL
B0UVA1_HISS2/14-134EDDHV-------------------------------------------------------------------------HL
B1WQK8_CYAA5/24-142EADHI-------------------------------------------------------------------------HL
C7P0F4_HALMD/13-132EDDHV-------------------------------------------------------------------------HI
D3VJ26_XENNA/13-131DKDHV-------------------------------------------------------------------------HF
D4LI30_9FIRM/33-152MPDHI-------------------------------------------------------------------------HL
G2KUJ1_LACSM/10-129DIDHV-------------------------------------------------------------------------HV
O34550_HELPY/15-134ESDHV-------------------------------------------------------------------------HL
O34754_HELPY/19-141DIDHL-------------------------------------------------------------------------HL
Q32DE7_SHIDS/20-139EPDHV-------------------------------------------------------------------------HL
Q3Y111_ENTFC/10-129DKDHV-------------------------------------------------------------------------HI
Q6LQP5_PHOPR/12-130SKDHV-------------------------------------------------------------------------HL
Q7DF83_DEIRA/17-136MPDHV-------------------------------------------------------------------------HL
Q9HSW8_HALSA/12-130GTDHV-------------------------------------------------------------------------HI
Q9KM89_VIBCH/11-129QPGHV-------------------------------------------------------------------------HL
R5QF53_9FIRM/16-133CPDHI-------------------------------------------------------------------------HL
R6RAE1_9FIRM/11-128CPDHV-------------------------------------------------------------------------HM

PF04986

Q01P74_SOLUE/145-335RRKKLAFHGSLLWLQEPRSFARFLEDLHQY................................................DW
A1WDQ9_ACISJ/182-382LRAFVG....RGLLEGFEAQEMLGYKHS..................................................GF
Q12Q53_SHEDO/139-306...................FNIKLPSATPK................................................KW
A5GBJ9_GEOUR/131-297.................LPEVIFPGQVWDK................................................EW
Q981L3_RHILO/137-326TAGKLRFFSSLAGLSDAAAFRRHLDRVRHI................................................NW
Q5P667_AROAE/144-333DAGELHFFNALAALHAPAVFARHLARARRS................................................EW
Q01TH4_SOLUE/47-236AEGKLGFYGQLAHLQTPQAFAAWLRPLFRS................................................DW
Q328X8_SHIDS/147-330SEGLAMP.ESLSHITTESQRRSLVLKAGGK................................................YW
Q2W8U4_MAGSA/134-323QAGALAFFSDLAALAEPAGFTRYLAPLRKA................................................NW
Q7TTN7_RHOBA/141-311.................GLYAQIDREAWSK................................................DF
A1WDQ5_ACISJ/174-373LRAFVG....RGLLESFEAQEMLGYKHS..................................................GF
Q12YW6_METBU/152-326..........LSKVQAFSHLVNQLFKEYPD................................................GF
Q1VPE4_PSYTT/140-316...............LPQLPQSLYDKLFKK................................................EW
A9B8K8_HERA2/140-308.................PHGTVIPAAVWEH................................................DW
A6TTH3_ALKMQ/138-326HKNKIK....RPEGMKYLEIHDLLKKLRTK................................................NW
A5G657_GEOUR/141-307.................GLLAEVPKEAWLK................................................PW
A8LSZ6_DINSH/144-335QTGKLAFFGELAGLADPDAFASHLAPLRKA................................................SW
Q121V9_POLSJ/144-335RAGQLNFFGEHAALADAKAFADWLAPLRKC................................................EW
A0LBL2_MAGSM/140-314.................RPDIAWPQQAWQQ................................................DW
A6VW84_MARMS/139-317REGLLP.......ALSQMEVSRLLNVLMQK................................................PW
Q039J1_LACC3/145-318SPWDKK.........RVQPRLQRAYKANAE................................................GF
A1TZA6_MARAV/137-319RTGELH......RLTEPQAIDDVLKKVMQQ................................................DW
Q0A7P5_ALKEH/141-322DTGRLK.....APRGDHPTVDYWLKATAKK................................................EW
Q7TTG3_RHOBA/141-314.................SYFDSIPDDVWKG................................................RF
A5G455_GEOUR/137-325ERAELT....VPDGERPQQVLNLLNKLGRK................................................KW
B2JTR0_BURP8/144-333DTGSLRFHGQLEPLRDPRAFAAWLAPAAQA................................................EW
Q01XA5_SOLUE/73-262HQGKLVFPGSLQPMAAEKSFAKFLRPLFRK................................................EW
A1W7Q5_ACISJ/174-367LRAFVA....RGLLENCDAKDMLGYKHS..................................................GF
A6TIZ2_KLEP7/69-291GRYLER....QGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQAGR..KVFTLQTLPTSGDPFGDGIGKVAGS
F7V1Z4_CLOSS/62-247NTNQLKFHGTAEKYSNHYVFKELIDFCYDA................................................EW
H6URW0_PROSM/172-396ARCMEK....RGILERDAENTWLTLEEGEDDTLTQLHGASVTYRIAVGPQQGRKVFTLQTLPGREDKADSSSRVANHAGF
K0C660_CYCSP/182-407AGHLER....QGLLVRDDESSYLTLDLQDDDAMNQLQGHSITYRIAVGPQQGRKVFTLQTIPSWEDDDFGTNQVGKIAGF
Y4QJ_RHISN/143-329DGGKLQFFSDLRALNERNAFRRYLAPLRKA................................................EW
Q6W4R9_VIBA7/105-283DDLNLST.STTHHIQYYRQWNFFLERHYQR................................................YW
Q877Q5_PSESM/155-333EHTTVPP..ENAHLQSENDWRHLVLNAGGQ................................................HW

PF01797

B9LSV3_HALLT/9-121FIGSPPKN.--APSLIVNWVKGISARKYN..QRYDD....RVK.......WTRSYY---------------VGTAG..SA
B9LMY5_HALLT/12-130LFTAKPTT.--DLTKFINSLKGVTSRKIR..DENPEVRQALDK.....AFWQPGYF---------------LTTTG..QV
B4SER8_PELPB/11-131FLQSVPTY.--IVTKVVTMIKSISAREVF..RRCPKVK.KLLWG...GEMWTDGYY---------------AGTVG..KH
A8KYK3_FRASN/14-134LVEYPPKV.--AVSALVNSLKGVSARRLR..TEFTDRVNQHLIR...GHFWSPSYL---------------AVSAE..DA
A8L9Q9_FRASN/6-123FVKAHPKH.--FPSCVANPLKGLTSRVLR..VEFGHLRSRL......PALWSRSYF---------------AGAVG..AV
B1YEE0_EXIS2/12-129FLNAPPTL.--SPADIMAKIKGVTSKKLR..AEFPHLQHL.......PSLWTRSYF---------------VSTAG..NV
B1YKP1_EXIS2/10-129LFKAHPNT.--EMSKFLNAYKSASSRLIK..RDFPHIKKQLWK....EMFWSRSYC---------------LVTTG..GA
A0JQH2_LACS1/15-136LISFPPRK.--SAVDVIKALKGRSAFLFL..QTHPEIRQKQYWG...GHLWSSSYY---------------LGSLG..NM
A0M0J7_GRAFK/11-130HLEYRPSS.--NVSGLVKKLKGRSSRKLQ..QEFPELKKRYWG....RHFWAVGYG---------------CWSTG..NI
A1ASY5_PELPD/11-130LISIPPKY.--SVAQVIGFIKGKSAIHIA..RMYLGQKKNYTG....MHFWARGYF---------------VSTVG..AD
A1B6L6_PARDP/10-129FVSVPPRL.--AISDLVRKMKGRSSYRVQ..REFPQIRKRYWG....CRFWGRGYF---------------STTNG..AI
A1T0T7_PSYIN/11-131VIRGIPEQ.--SPSDVMQIIKSITAREFF..RTYPEIKKKYFWG...GKLWTQSVF---------------VETIG..NA
A1T5G3_MYCVP/16-133LVEVDPQF.--GVHRLVKAIKGRSSRVLC..EEFPWLKSRL......PSLWTNSYF---------------VATVG..GA
A1U7S0_MARAV/12-131LVNYPPSI.--QLTRLINSLKAVSSRRMR..RQFAD.LVAAYSK...PVLWSRAYF---------------VSSCG..GA
A1VLR6_POLNA/14-134LVNYPPKV.--SVSALVNSLKGVSSRMIR..QRNYPSVREKLWG...AALWSPSYF---------------AGSCG..GA
A3DH13_CLOTH/11-129LVSIPPKI.--SVSSFMGYLKGKSSLMIF..DRHANLKYKYGN....RHFWCRGYY---------------VDTVG..R.
A3HSL3_9BACT/3-118LVSLGINQ.--TIQKIMQLIKGESSYWIN....KSQLTAEKFE.......WQDEYY---------------AVSVS..ES
A3HTZ3_9BACT/7-121LIGMRASC.--RLSDLVREIKKSSTNWIN....ERGFAQKSFR.......WQAGFG---------------AFSYT..QS
A3HZW2_9BACT/5-119LFRFKPSV.--SISKVMQGVKAKSSKWIN....ESDYCNERFE.......WQSGFG---------------CFTYS..QK
A3N3W0_ACTP2/3-118LVEIHPSM.--AVADFVKQLKNASHKWLE...HHSDLFPDFYA.......WSKGYC---------------ALSYS..EH
A4J2W0_DESRM/10-130FVSVKPYV.--SPTEVVKTIKSITAVWIF..KKFPNLKKRKFWG...SGLWSKGYY---------------VGTAG..PV
A4XMT5_CALS8/11-128FISALPRY.--SPSQLINVIKGATGRKIG..QKFPQYKQK.......GSVWTRAYF---------------VATAG..NV
A5CZ87_PELTS/12-131LFAGKPQL.--QVSKFVNSLKGVSSRLLR..KEFPE.LREHLWG...NHFWSPSYF---------------IASTG..RV
A5EW57_DICNV/13-134LLDLHPNI.--VPSRLVNQLKNVTNRLIR..KEFANHLAQYYWQ...PVLWARSYC---------------LLTHG..DV
A5FCA3_FLAJ1/8-121FIGMRPTQ.--SISSLIQNIKTETSKWIK....EQKLA.SYFA.......WQEGYG---------------AFSYS..RS
A5FHV9_FLAJ1/5-119LIGIRPVQ.--SISELMKTVKQNSSKWIN....ENKFINSHFE.......WQEGYG---------------AFSYS..KS
A5FLD5_FLAJ1/5-119LVGIKPNI.--SLSDLVRDIKSSSSKFIN....EQKWINGKFE.......WQNGFG---------------AFSYG..HS
A5FLH9_FLAJ1/5-119LFLLNPKK.--SLSDVIRQAKGGSSHCIN....GVNLIPEKFA.......WQTGYA---------------AFAVS..ES
A5FNU2_FLAJ1/3-118LISLGNNQ.--TIQKTIQLLKGESSYWIN....KNQLTKEKFE.......WQDEYF---------------AVSVS..ES
A5FTI1_ACICJ/14-134LISLPPNL.--DLSRFVNNLKTTTSRLIR..KEFAAEVDTVYRK...PVFWSRSYC---------------VISCG..GA
A5G3E6_GEOUR/11-130LVKILPKV.--SVSEFMGAIKGRTAIRVF..KQYPYLKERPYWG...NHFWAEGYC---------------VDTVG..L.
A5G9R6_GEOUR/9-128LLAMPPSM.--PISKAVQLLKGASSRWIH....ETDNDMAAFA.......WQDGYG---------------AFTVG..VS
A5UR96_ROSS1/3-117VASIPPKL.--AVAECVRHLKGASAYAIN....RMPDSDGQFK.......WQSGYG---------------ALSIG..EQ
A5UWB3_ROSS1/9-123LVIFPTTI.--TIADLLKHVKGVSSRFVN....ETLRPSAQFK.......WQGSYG---------------AFTVS..RW
A5VHM5_LACRD/16-137LISFPPSK.--APTSAIKALKGRSAFIFL..KRHPEIRQSQYWG...GHLWSPSYY---------------MSTLG..NM
A6QB17_SULNB/11-130LVMIPPKI.--SISDYMGAIKGRTAIRIL..NRFKKLRQKPYWG...NNFWAKGYC---------------VDTVG..L.
A6TLW4_ALKMQ/10-129LFKAHPNS.--QLSKFINAYKSASSRLVK..KEYPA.IREKLWK...EYFWARSFC---------------LLTTG..DV
A6VTE3_MARMS/13-129LVKLKNHSS--TLPTIVGNLKGASAFQVN..........KHLKKNGT..LWQPSFY---------------DRALR..AE
A8F729_THELT/10-129LFKATPTT.--QLSKFINAYKSASSRLIK..KEFPE.IRKKLWK...GNFWSRSYC---------------LISTA..GV
Q11SK3_CYTH3/5-119LFLLNTQK.--SISEVIKQIKGSSAHYIN....QNNLCYTTFS.......WQTGYA---------------AYSVS..ES
Q11V54_CYTH3/5-117LFRLSKNY.--TLVKIIEEIKKHSSKWMK......SKGIDGFT.......WQIGYG---------------AFSVS..SS
Q18CV0_PEPD6/9-126LISCDPQY.--GIHKVVKGLKGFSSRVLR..ENFPHLKSSM......PSMWTNSYF---------------VGTVG..SV
Q18KK1_HALWD/19-139FVEADSKW.--SPAEIAKQFTGYSGRTIL..KGHPEIKQRYFCG...SGLWKDGYD---------------VGTTG..GV
Q1IW17_DEIGD/12-128FLAADPAT.--APNQVMHLLKGYTSRILR..QEFPHLNTL.......PALWTRSYF---------------VSTAG..AV
Q1QF32_NITHX/11-129LLSIPPHL.--SVSRAVQYLKGKSSHKLL..TEYQSLRKRYWG.....SIYGQGYW---------------VASSG..NV
Q20XV6_RHOPB/11-129MISIPPKY.--AVSQVVGFIKGKSAIHLA..RVYGEKKRNFVG....QHFWARGYF---------------VSTIG..R.
Q24Z31_DESHY/8-127VFKAHPNS.--ELSKYINAYKSASSRLIK..KEFSH.LRHQLWK...EYFWSQSYC---------------MVTTG..GA
Q2JNY0_SYNJB/12-132LFQYYPQV.--DLSKLVNNIKSVSSRRMR..SEFADYISKIYRK...NVLWNESYF---------------IASCG..GV
Q2S639_SALRD/15-131FVQADTRH.--APYQVIHRFKGTSAHVLR..DEFDHLHRL.......PSLWTRSYF---------------VSTTG..KA
Q3AEI0_CARHZ/18-135LVEVDPQF.--GIHRLVKLMKGRSSRILR..QEFPWLRSRL......PTLWTNSYF---------------VATVG..GA
Q3ASF0_CHLCH/5-119FVGLKPSM.--SIADLVRDIKNNSSNFIN....EQKFLPRKFA.......WQEGYG---------------VFSYA..HS
Q3ILG5_PSEHT/10-130LLTISPNI.--SVASYVRRIKQSTTQSLW..SRFKWFKKQFWVK...KTFWSDGYF---------------VCSVG..NA
Q3IPA5_NATPD/11-130FVQTDSKY.--SPANIARQFKSYSGKHLL..ERYPEIRESYFWG...GGFWKVGYY---------------VGTTG..AV
Q3JB10_NITOC/14-133LVEYPPKL.--SISVLVNNLKSTSSRRVR..LLNTHLPNLSKS....AALWSRSYF---------------ACSAG..GA
Q3JE33_NITOC/16-133FVEFDPRW.--GVAEMVNRFKGSTSKELR..KEFPILRSRL......PTLWNRSYY---------------AGTVG..HV
Q484I4_COLP3/11-129CLSIPPKL.--AVSNVVGFIKGKSAISIA..RTFKGKQRNFTG....EAFWARGYF---------------VSTVG..L.
Q485N4_COLP3/13-128LFELTSDN.--HLSKVIQTLKGRSARLIN..........QHDEGQRF..AWQRGFY---------------DHAIR..TE
Q5JI87_THEKO/12-132LFKAKPTL.--NIPKYINALKTITSREIR..RNFPE.VKEKLWR...NTFWSPSYF---------------LATSG..QV
Q5WKC7_BACSK/10-128LVKIPPKM.--SVSYFMGYLKGKSSLMIH..DRHANLKYNHGN....RTFWAKGYY---------------VSTVG..L.
Q74KQ8_LACJO/18-139LVSFKPSK.--SGSSVIKALKGRSGRLFL..QAHPEIRQNKMWG...GHLWSPSYY---------------FGSVG..NM
Q7M7F4_PHOLL/10-129LVSSPPTL.--APSEIMRRLKGRTASKLF..EEFSHLKKRYWG....QHFWGRGYF---------------CATVG..QL
Q7US03_RHOBA/3-117LVSIHPAQ.--SISDCVRDIKSNSSVWVH....EHLTNLKSFQ.......WQTKYG---------------AFSVS..ES
Q7UVV9_RHOBA/38-155VLRPKCDG.--GMSRFVQWLTLTHTQRYN..........AHYEIVGEGHLYQGRYK---------------SFPIQ..DD
Q815G4_BACCR/12-129FLNTLPTL.--SPADTMAKIKGVTSKRLR..EEVPHLQHL.......PSLWTRSYF---------------VSTAG..NV
Q82PQ1_STRAW/18-138LVHYPPKI.--ALSRLVNSLKGVSSRYLR..AEYTGRINRIGTG...SVFWSPSYF---------------AGSCG..GA
Q82QX0_STRAW/13-131LVHYPPKV.--AISRLVGSLKGVSARRLR..QEFPNHIRKYPWG...EHFWSPSYF---------------AASCG..GA
Q82SR9_NITEU/15-133CISIPPKY.--AVSNVVGYLKGKSAIQIA..RKFGGRQKNFTG....EHFWARGYF---------------VSTVG..L.
Q893W3_CLOTE/12-126IIDSNGAD.--.ISKIMHGLNFSYAISFN..........RIYKRNGH..LFQDRFK---------------SKIVD..TR
Q897V3_CLOTE/10-129LFKGSPNT.--DISKFINAYKSASSRLIK..KEFPK.IKNQLWK...EYFWSRSYC---------------LITTG..GV
Q898F8_CLOTE/24-138IIDANGAD.--.ISKIMHGLNLKYSLNFN..........KRYKRRGH..LFQDRFK---------------SKIID..SQ
Q899Z5_CLOTE/12-129LIEVDPQF.--GVHKAIKRMKGRTSKMLR..QEFPHLKTKL......PTLWTNSYF---------------VSTVG..GA
Q8CM83_THEEB/12-128LIEYPPKL.--SVSQIVNALKGVSSRRYG.........KAALPKPHEESLWSPSYF---------------AASVG..GA
Q8R791_THETN/9-123MIKEGNED.--.LSSSIKRIAGTYVSYFN..........KKYDRTGH..LFQDRFR---------------SEPVE..DE
Q8TU17_METAC/10-130LIKSETKV.--SVLSIVRKQKHESTNRIW..KTQKEYLEKYYRG..ENTLWSDGYF---------------ASTIG..NV
Q8XV65_RALSO/11-124VGTPKVAD.--SLSRTLQAVGRRYTRYFN..........AAAGRSGT..LWEGRFR---------------STVLD..PA
Q8YK47_NOSS1/12-135LIDVHPDN.--NISQLIGSLKSASSRIIR..KEFQDYLKQYYWKEKDPSFWTDAYS---------------VNSVG..GA
Q8YKY9_NOSS1/9-130LIDYKPDK.--PLSTLIGNIKTVSSRLIR..KEFPSLAKKYFYN..KPYFWTGAYF---------------VASCG..GV
Q8YLC6_NOSS1/12-132LFQYHPDV.--ELSKLVNNLKSVSSRKLR..QEFAEHLESFYWK...DVFWSGSYF---------------VASCG..GV
Q8YMI3_NOSS1/9-129LIEPREPQ.--DVPKIMHWLNWYTAMCFN..........QMLNRTGH..FWEKRYH---------------STEFENTDK
Q8YRS2_NOSS1/12-130LVEYDPHH.--SISQIVKAFKGRSSRYLR..QEFPELMRL.......PSLWTHSYM---------------FDTTG..KV
Q8YWC8_NOSS1/12-129LIEVDPQF.--GVHKAIKRFKGATSRYLR..LEFPHLKQRL......PTLWTNSYF---------------VSTVG..GA
Q972N6_SULTO/10-128FVNCPPRY.--APSYLANYFKGKSARLIL..KKFPELKKATN.....GKLWTRSYF---------------VSTAG..NV
Q987Z8_RHILO/19-133ILTPADAD.--GLRRALAKVHRAYAGIIH..........ARQKKTGH..FWQGRFG---------------AVAM...DE
Q9HHX7_HALSA/8-124FVSSPPKN.--EPALLANWFKGISSRKYN..HRYADHDGEKIG.......WARGYY---------------AGTAG..HV
Q9HKW9_THEAC/17-134LIDVDPRM.--GVYHVVNRIKGYTSRVLR..AEFPELRKRL......PTLWTHSKF---------------ISSVG..AV
Q9HSD5_HALSA/12-126FITGDPTL.--APNKIMQQIKGYSSRHLR..DEFDFGL.........PSLWTRSYF---------------VSSAG..DV
Q9RT39_DEIRA/11-130HVEYPPRL.--AVSDLVKRLKGRTSRRLQ..QEFPHLEKRYWG....KHFWGVGYG---------------AWSTG..TI
Q9X2F2_THEMA/10-126FVSAPPRF.--SPAEIANLFKGVSARKLL..EKFPELRTK.......EGLWARSYY---------------VGTAG..NV
B0UVA1_HISS2/14-134LVEYPPKV.--AISNLVNSLKGVSSRMIR..KKNYPSIRKKLWG...NQLWSPSYF---------------ASSCG..GA
B1WQK8_CYAA5/24-142LFQYYPQL.--ELPKFVGNLKSITSRRLR..NEFPELANV.YKK...SVLWNESYF---------------IASCG..GV
C7P0F4_HALMD/13-132LFRAKPTT.--DLVKFINTVKGATARRIR..NEYADELKTELWG...DSFWNDSYC---------------LISTG..QV
D3VJ26_XENNA/13-131IEQSVPTY.--SVTKIVRLIKSLTAREIF..KRWPQVK.KILWG...GEFWTDGYF---------------ASTVG..KH
D4LI30_9FIRM/33-152LVDCRPQF.--YISDMIKIMKGNIARQMF..LVHPELKKEL.WG...GHLWNPSYC---------------AVTVS..DR
G2KUJ1_LACSM/10-129LFRATPHT.--EMAKFLNAYKSSSSRMVK..KLFPEIKRQ.LWK...SAFWTQSYC---------------LISTG..GA
O34550_HELPY/15-134LINYPPKV.--SVSKLVNSLKGVSSRLTR..QHHFKSVEASLWG...KHLWSPSYF---------------AGSCG..DA
O34754_HELPY/19-141MVQYIPRM.--SISSIISRIKQITTYRVWRDKRFIPLLQKHFWK..EKTFWTDGFF---------------VCSIG..EA
Q32DE7_SHIDS/20-139LITYPPKL.--AISSLVNSLKGVSGRLLR..RARPDIAVRYYYK...GVLWSPGYF---------------ASSCG..GA
Q3Y111_ENTFC/10-129MFKAQPKT.--ELTKFINAYKSASSRLIK..RDFPRVK.QFLWK...EMFWSKSFC---------------LLTTG..GA
Q6LQP5_PHOPR/12-130LVSAPPNM.--APSEIMRRIKGRTSAKLF..ESYPDLKKKYWG....RHFWARGYF---------------CVTSG..DL
Q7DF83_DEIRA/17-136LLSATPQQ.--AIPDFVKALKGASARRMF..VAYPQLKEKLWG....GNLWNPSYC---------------ILTVS..EN
Q9HSW8_HALSA/12-130LFQTKPTT.--DLTKFINSLKGVTSRRIR..SEFPEVTQT.LE....DAFWQPGYF---------------LATTG..QV
Q9KM89_VIBCH/11-129VAIIPPKV.--SISTLMGVLKGRSAIRLF..NKFPHIRKK.LWG...NHFWARGYF---------------VDTVG..V.
R5QF53_9FIRM/16-133LLSIPPKM.--SVSGFMGYLKGKSSLMIF..QRFGNMKFAYRN....REFWCKGYY---------------VDTVG..K.
R6RAE1_9FIRM/11-128LVEIPPSI.--SVSYFVGYLKGKSTLMIF..ERHANLKYKYGN....RHFWCRGYY---------------VDTVG..K.

PF04986

Q01P74_SOLUE/145-335VVYIKKPFG..GPEHVLHYLARYTHRVAISNHRLLAME......NGKVTFRWKDYA..............HGGKQRKMTL
A1WDQ9_ACISJ/182-382SVDTSVCIA.AQDRAGLERLLRYCARPPFALDRLRKAG......SE.LIYRCAKQHSEPGSDRRDQRKAKRGVRADELHL
Q12Q53_SHEDO/139-306VVDCQ.HVG..KGLPALKYLSRYLYRGVLPDKSIIGTT......DEQVCFEYQNSQ...............TKTTEIRTL
A5GBJ9_GEOUR/131-297VVFCKPTFN..RAKKVFHYLGRYVHRIAITNNRILALD......NGQVVFRYQNSD...............TREWKNMRL
Q981L3_RHILO/137-326VVFAKAPFA..GAEQVLSYVGRYTHRVAIANSRIVDIE......DGKVRFRWKDYR..............DGDRQKVMTL
Q5P667_AROAE/144-333VVFAKPPFG..GPQQVLEYLGRYTHRVAISNNRLVACT......DDEVSFRWKDYR..............HHGRNKVMRL
Q01TH4_SOLUE/47-236VVYSKRPFG..GAEHALRYLGCYTHRVAISNQRLVSLA......EGRVTFRWRDSA..............HKNKKRLMSL
Q328X8_SHIDS/147-330HVYMSKKTA..GGRNTARYLGRYLKKPPIAASRLAHYN.....GGASLSFRYLDHK...............TGETATETL
Q2W8U4_MAGSA/134-323VVYAKRPFG..GPEQVLAYLGRYTHRVAIANSRLSGIE......DGGVSFRWKDYR..............HHDKQKVMTL
Q7TTN7_RHOBA/141-311VVDIQ.PVG..HGVPTLKYLAPYVHRVAINDSRIMDVN......SETVTYQIRRK................GNVMQSKTV
A1WDQ5_ACISJ/174-373SADTSVCIA.AHDRAGLERLLRYCARPPFAMERLRKAG......SE.LVYRCAKQHSEPGS....LPHNKRGVKADEITL
Q12YW6_METBU/152-326YVHMPKNSRITNKQRMAQYVGRYIRHPAIANSRLYSYD......GKSVTFWYNDHE................GVRHFVTM
Q1VPE4_PSYTT/140-316VVYAKSPFG..KPEHVIEYLGRYTHKIAISNHRILSIDK....EKRRITFSLKDYR..............KGGQKTTLTL
A9B8K8_HERA2/140-308VIDCR.PVG..TGETALKYLAPYIFRVALSNNRLLSAD......DDQVTFRYRHSD...............SGENRTSTL
A6TTH3_ALKMQ/138-326NVRIMERYT..HGEGVITYLGRYIRGGCISNKRIISIK......NGEVIFKHQDNKETD.........EKNKAKKKTMKL
A5G657_GEOUR/141-307NVNSQ.AVG..ASEASIKYLAPYVFRVAISDHRIVKVE......DGRVLFRYRKQK...............SNRERTMAL
A8LSZ6_DINSH/144-335VVYAKPPFG..GPEAVLAYLSRYTHRVAISNHRLVSAD......AETVAFRWKDYRI............KRGDRMKVMRL
Q121V9_POLSJ/144-335VVYAKRPFA..GPQAVLAYLSRYTHRVAISNSRLLCLD......ERGVTFRWKDYRV............KGRTRHKTMTL
A0LBL2_MAGSM/140-314VVHCTPWGT..GEQAIVDYLARYAFRIAINRERIVAFN......EQTVTIRYKDRK...............QRRWRYCDI
A6VW84_MARMS/139-317VVYCKSALE..YRSTLVTYLARYSHRIALSNNRFQVWN......NDKISLQYRDYR...............SGKQSLLTL
Q039J1_LACC3/145-318YVNAPKRSR.THLKGLLKYISRYMKRGPIAMDRIVMYD......GESVLFSYKDKR...............TNRKETHLM
A1TZA6_MARAV/137-319VVYARPCLN..QAETVVDYLARYTHRIAISNGRLLSQD......GGRIMIRYVDYR..............EGGRQKSLQL
Q0A7P5_ALKEH/141-322NVRLQGRYT..HGRGVAAYLSRYVRGGPITNTRIKSLG......EGQVQFRYHDHR...............DGRRKLRRV
Q7TTG3_RHOBA/141-314VVDSE.AVG..SGEFAVAYLAPYVMRGAVANRRVTQCDESTSLEEASLTLQVKRSG...............TRQYKPMQM
A5G455_GEOUR/137-325NVCIRERYA..HGNGVLTYLGRYLRGGAISNRRIISSD......EEQVRFRYKDYREES.........ESGGKKCKTMEL
B2JTR0_BURP8/144-333VVYAKPPFG..GAEHVLDYLGRYTHRVAISNNRLLACD......GHTMQFRWKDYR..............HASRQRTMTL
Q01XA5_SOLUE/73-262VVYAKRPFG..GPEHVLHYLARYTHRVAISNHRLLSVA......DGKVTFRWKDYA..............QGSKQRKMTV
A1W7Q5_ACISJ/174-367SVDAGVCIE.AHDRAALERLLRYCARPPFSMERLRKEG......SK.LVYRCAKQRSEPT.......SDKRGAKADELHL
A6TIZ2_KLEP7/69-291SLHAGVAAR.ADERKKLERLCRYISRPAVSEKRLSLTR......GGNVRYQLKTPY...............RDGTTHVIF
F7V1Z4_CLOSS/62-247IPYCKKTFN..GAQSVIDYLGKYTHRIAISNHRIICMD......DENVTFSVKDYR..............NKGQWKELTL
H6URW0_PROSM/172-396SLHAGVMAE.AHQRDKLERLCRYISRPAVSEKRLALTA......NGQVRYELKTPY...............RNGTTHVIF
K0C660_CYCSP/182-407SLHAGVATK.TRERKKLERLCRYISRPAVSEKRLALTS......QGKVRYQLKTPY...............RDGTTHVIF
Y4QJ_RHISN/143-329VVFAKPPFA..GPEQVLDYVGRYTHRVAISNNRLVDIE......DGAVRFRWKDYR..............HGDRQKVMTV
Q6W4R9_VIBA7/105-283NIHFAKKTK..VLKQTVNYLGRYLKRPPISASRLRHYS......GGTVVFKYLDHR...............DGTHKTKTL
Q877Q5_PSESM/155-333HIHLSKKTK..NGKKTVNYLGRYLKKPPISGSRLAHYT.....SGATLSFTYLDHR...............TKTYQQETL

PF01797

B9LSV3_HALLT/9-121.SKGAVEQYIAEQ--------------------------
B9LMY5_HALLT/12-130.SIDVLMEYVEEQ--------------------------
B4SER8_PELPB/11-131GNEDMIGKYVKGQ--------------------------
A8KYK3_FRASN/14-134.PLALVREYIEEQ--------------------------
A8L9Q9_FRASN/6-123.SPETVRRYVDTR--------------------------
B1YEE0_EXIS2/12-129.SSETIKRYVEQQ--------------------------
B1YKP1_EXIS2/10-129.TSDVIRHYIEKQ--------------------------
A0JQH2_LACS1/15-136.SKDVVERYINDQ--------------------------
A0M0J7_GRAFK/11-130.TDEMVDEYLEHH--------------------------
A1ASY5_PELPD/11-130EEMRLIRK.IDGN--------------------------
A1B6L6_PARDP/10-129.TEDIVLQYLENH--------------------------
A1T0T7_PSYIN/11-131.TEEVIRKYVQNQ--------------------------
A1T5G3_MYCVP/16-133.PLSVIKRYVETQ--------------------------
A1U7S0_MARAV/12-131.PLSVIKEYIENQ--------------------------
A1VLR6_POLNA/14-134.PIAVIRQYIEQQ--------------------------
A3DH13_CLOTH/11-129.NRKAIEQYIRRQ--------------------------
A3HSL3_9BACT/3-118.VLDRVRKYIKNQ--------------------------
A3HTZ3_9BACT/7-121.SLPNIISYIENQ--------------------------
A3HZW2_9BACT/5-119.EINSVFKYIEYQ--------------------------
A3N3W0_ACTP2/3-118.EIGKIINYIKGQ--------------------------
A4J2W0_DESRM/10-130.SAETIQKYIENQ--------------------------
A4XMT5_CALS8/11-128.SSETIKKYIEAQ--------------------------
A5CZ87_PELTS/12-131.TLDVLRRYVEEQ--------------------------
A5EW57_DICNV/13-134QTVDIIRHYLERQ--------------------------
A5FCA3_FLAJ1/8-121.HVPSVIRYIQNQ--------------------------
A5FHV9_FLAJ1/5-119.QLNAVIEYIQKQ--------------------------
A5FLD5_FLAJ1/5-119.QLTNVIKYIENQ--------------------------
A5FLH9_FLAJ1/5-119.QLDAVYNYIKNQ--------------------------
A5FNU2_FLAJ1/3-118.IVDKVRNYIKNQ--------------------------
A5FTI1_ACICJ/14-134.PLSVIKQYIEQQ--------------------------
A5G3E6_GEOUR/11-130.DAEMIRKYVVYQ--------------------------
A5G9R6_GEOUR/9-128.QIADTVRYIEGQ--------------------------
A5UR96_ROSS1/3-117.SLETVMAYAARQ--------------------------
A5UWB3_ROSS1/9-123.DVARIKEYIKRQ--------------------------
A5VHM5_LACRD/16-137.SKDVVENYINNQ--------------------------
A6QB17_SULNB/11-130.DGDMIWKYVKYQ--------------------------
A6TLW4_ALKMQ/10-129.SVEVIKGYIESQ--------------------------
A6VTE3_MARMS/13-129DDRLSIARYIITN--------------------------
A8F729_THELT/10-129.PIEIIRKYIESQ--------------------------
Q11SK3_CYTH3/5-119.IVGKVDAYIQNQ--------------------------
Q11V54_CYTH3/5-117.KIDTVSNYIMNQ--------------------------
Q18CV0_PEPD6/9-126.SLEVVKQYIENQ--------------------------
Q18KK1_HALWD/19-139.SEDVVR.YIEEK--------------------------
Q1IW17_DEIGD/12-128.SGATIQKYIAAQ--------------------------
Q1QF32_NITHX/11-129.TDEVWKKYIEDQ--------------------------
Q20XV6_RHOPB/11-129.DEAVIREYIRQE--------------------------
Q24Z31_DESHY/8-127.PLDILKKYIESQ--------------------------
Q2JNY0_SYNJB/12-132.TVSALSQYIESQ--------------------------
Q2S639_SALRD/15-131.GEQVVQQYIEDQ--------------------------
Q3AEI0_CARHZ/18-135.PRATLREYIEKQ--------------------------
Q3ASF0_CHLCH/5-119.QIEYVYQYISKQ--------------------------
Q3ILG5_PSEHT/10-130.AADTIRKYIQEQ--------------------------
Q3IPA5_NATPD/11-130.SEEVVERYIEET--------------------------
Q3JB10_NITOC/14-133.TIETLKAYVQSQ--------------------------
Q3JE33_NITOC/16-133.SESTVRAYIENQ--------------------------
Q484I4_COLP3/11-129.DENMVREYIRNQ--------------------------
Q485N4_COLP3/13-128ESLLSVSRYIVAN--------------------------
Q5JI87_THEKO/12-132.TLDVLKAYVESQ--------------------------
Q5WKC7_BACSK/10-128.NQKTIEKYIREQ--------------------------
Q74KQ8_LACJO/18-139.SKEVVEKYINDQ--------------------------
Q7M7F4_PHOLL/10-129.TEEMIKSYLEHH--------------------------
Q7US03_RHOBA/3-117.SVDSVKAYVANQ--------------------------
Q7UVV9_RHOBA/38-155EHFLTVCRYVERN--------------------------
Q815G4_BACCR/12-129.STETIKQYVENQ--------------------------
Q82PQ1_STRAW/18-138.PLDIVKDYIENQ--------------------------
Q82QX0_STRAW/13-131.PLSLIKEYINNQ--------------------------
Q82SR9_NITEU/15-133.DDNIVRTYIRNQ--------------------------
Q893W3_CLOTE/12-126RYLIMLSAYIHNN--------------------------
Q897V3_CLOTE/10-129.PIDIVKKYIENQ--------------------------
Q898F8_CLOTE/24-138KYLITASAYIHNN--------------------------
Q899Z5_CLOTE/12-129.PLSAIKQYIENQ--------------------------
Q8CM83_THEEB/12-128.PLEVLKEYIRNQ--------------------------
Q8R791_THETN/9-123SYVIALVRYIHQN--------------------------
Q8TU17_METAC/10-130.SKEATEYYIRNQ--------------------------
Q8XV65_RALSO/11-124EWVLPMILYVEGN--------------------------
Q8YK47_NOSS1/12-135.PLEIVKEYIRSQ--------------------------
Q8YKY9_NOSS1/9-130.TVEQLKNYLENQ--------------------------
Q8YLC6_NOSS1/12-132.TVSTLRKYIEAQ--------------------------
Q8YMI3_NOSS1/9-129KRALNTLRYIHAN--------------------------
Q8YRS2_NOSS1/12-130.STQKVLEYINDP--------------------------
Q8YWC8_NOSS1/12-129.PLEAVKEYIQNQ--------------------------
Q972N6_SULTO/10-128.SSETIKKYIEEQ--------------------------
Q987Z8_RHILO/19-133DHLLSAVRYVGLN--------------------------
Q9HHX7_HALSA/8-124.SSETVENYIQQH--------------------------
Q9HKW9_THEAC/17-134.TLEVVQKYIEDQ--------------------------
Q9HSD5_HALSA/12-126.SSEVIEEYIDAQ--------------------------
Q9RT39_DEIRA/11-130.TEAMVQEYLEHH--------------------------
Q9X2F2_THEMA/10-126.SEETIRRYIEEC--------------------------
B0UVA1_HISS2/14-134.PISIIRQYIEQQ--------------------------
B1WQK8_CYAA5/24-142.TVSQLKEYVENQ--------------------------
C7P0F4_HALMD/13-132.SLDVLKQYVEDQ--------------------------
D3VJ26_XENNA/13-131GDEQMIGRYVQNQ--------------------------
D4LI30_9FIRM/33-152.SREQVCSYIEGQ--------------------------
G2KUJ1_LACSM/10-129.PLEVVKKYIESQ--------------------------
O34550_HELPY/15-134.PLEMIKQYIQDQ--------------------------
O34754_HELPY/19-141.NPETIKAYIENQ--------------------------
Q32DE7_SHIDS/20-139.PISVIRQYIEQQ--------------------------
Q3Y111_ENTFC/10-129.PIDVIKKYIQNQ--------------------------
Q6LQP5_PHOPR/12-130.TEEMIKEYLDH.--------------------------
Q7DF83_DEIRA/17-136.TRAQIQKYIESQ--------------------------
Q9HSW8_HALSA/12-130.SIDTLMDYVDDQ--------------------------
Q9KM89_VIBCH/11-129.NEEIIRRYVRHQ--------------------------
R5QF53_9FIRM/16-133.NTAAIKSYIANQ--------------------------
R6RAE1_9FIRM/11-128.NAKKIQEYIANQ--------------------------

PF04986

Q01P74_SOLUE/145-335AAEEFIRPFLLHVLPKGFVRIRHYGWMA....NRCRRQC
A1WDQ9_ACISJ/182-382TPLELIDRLAALVPPPRAHRHRYYGVLA.......PNSP
Q12Q53_SHEDO/139-306PTVKFLWLVLQHVLPKGLRRVRDYGLLS....GNCSKLR
A5GBJ9_GEOUR/131-297PVKEFLRRYLQHVLPQGFHKVRYYGLLS.......PGNR
Q981L3_RHILO/137-326EAGEFIRRFLVHVLPDGFKRIRYYGLLG....NRHRKEK
Q5P667_AROAE/144-333EAHEFIRRFLLHVLPAGFHRIRHYGFLA....NRLRASA
Q01TH4_SOLUE/47-236PVEEFVRRFLLHVLPPGFVRIRHFGFFA....HRRRAAL
Q328X8_SHIDS/147-330TQRELVARLKQHIPEKFFKMVRYFGFLA....NRVCGEK
Q2W8U4_MAGSA/134-323KPGEFIRRFLLHVLPDGFHRIRHYGFLA....NGRRAAK
Q7TTN7_RHOBA/141-311AGDDFVGNFLQHVLPTNFMKIRHYGWMS.......GNSK
A1WDQ5_ACISJ/174-373TPLELIERIAKLVPPPRTHRHRYFGVLA.......PNSP
Q12YW6_METBU/152-326ELQEFIRALIQHIPDRNFKMIRYYGAYS....RKVKKRY
Q1VPE4_PSYTT/140-316STKEFIRRFQLHILSKGFTRIRHYGFLS....SSWKKEK
A9B8K8_HERA2/140-308PVNTFLDRFMAHILPKGFVKVRYYGFFR.....PAVRAD
A6TTH3_ALKMQ/138-326KAEEFIQRFLLHIPKPGTKVVRYYGIYA.....SSKEKS
A5G657_GEOUR/141-307DAMEFLRRFLQHVLPTGFMKVRYYGFLS.......PNAA
A8LSZ6_DINSH/144-335PTGEFIRRFLIHVLPSGFHRIRHTGFLA....NGIRRDR
Q121V9_POLSJ/144-335DAQEFMRRFLLHVLPAGLHRIRHYGLLA....NGNRKEC
A0LBL2_MAGSM/140-314PGQEFLRRFLQHVLPRGFHKIRYFGLWHPSKRSAAKRVR
A6VW84_MARMS/139-317TPQELVRRFLLHVLPRGLMRIRHYGCLS.....NAIRAK
Q039J1_LACC3/145-318SVEAFIGALIRYIPDRHFKTIRRYGIYS.......RRIK
A1TZA6_MARAV/137-319EGAEFVRRFLMHILPKGFMRIRHFGYLS....NRTRRRK
Q0A7P5_ALKEH/141-322AVERFMEQILWHVPEPGQHTVRHVGLYA.....HTCRAK
Q7TTG3_RHOBA/141-314RVEEFIRRWLQHVLPAGFHRVRHYGFAN.....ARSKRS
A5G455_GEOUR/137-325SVNDFVRRVLLHVPEPGHKVVRSYGLYA.....GSRRQA
B2JTR0_BURP8/144-333TADEFIRRFLLHVLPDGFKRIRSYGWLA....NCHRAQR
Q01XA5_SOLUE/73-262TAEEFLRRFMLHVLPLGFIRIRFSGFLA....NRHRKQL
A1W7Q5_ACISJ/174-367TPLELIDRIAALVPPPRTHRHRYFGVLA.......PNS.
A6TIZ2_KLEP7/69-291EPLDFIARLAALVPKPRVNLTRFHGVFA.......PNS.
F7V1Z4_CLOSS/62-247SGVEFIRRFLMHVPPKRFVRIRHYGLLC....SRSK...
H6URW0_PROSM/172-396EPLDFIAKLAALVPKPRVNLTRFHGVFA.......PNS.
K0C660_CYCSP/182-407EPLDFMAKLAALVPKPRANLTRYHGVLA.......PNSK
Y4QJ_RHISN/143-329STDEFIRRFLLHVLPEGFHRIRYYGFLG....NRYR...
Q6W4R9_VIBA7/105-283TQEEMILRYVSHIPQHHFKMVRYYGFLS.....NRK...
Q877Q5_PSESM/155-333SQTDMLRRVVQHIPEKHFRMIRYFGFLA....NRV....

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window