Sequence alignment for CL0482

PF14368

Q1G3I0_ARATH/16-107AIAPLLAEPQS..T..MFP...............EMTPEC........ATV...MPDL-.LE..KC...F.........A
Q3ECK0_ARATH/8-101FAAAMTVMALL..L.VPTI...............EAQTEC........VSK..LVPC.-.....FN...D.........L
B9RBQ4_RICCO/7-100MVALLFLTTTI..A.PSQA...............QDTASC........AQN..LISC.-.....AE...Y.........L
Q9LE56_ARATH/14-113FCYVTSSNAQM..T.SPPSGGA.........GGDAHSLPC........IQK..LMPC.-.....QP...Y.........L
Q0D9K5_ORYSJ/20-116GAASSSAAAQAAVD.TGAA...............AGVPSC........ASK..LVPC.-.....GG...Y.........L
Q9SUV6_ARATH/10-114FLAVVIAPQWT..E.TKKPPRPSDTSDTSGTSGRDRRTMC........PLS...IPGI-.VQ..NC...Y.........A
C5Z9F1_SORBI/22-116V....LAPSAHAQG.TSGS...............GAMPSC........AAK..LVPCA-.GY..LN...S.........T
C5XVS1_SORBI/14-118LLLAVAVDTVS..S.RRHHHAPAGAP.HGVVAPSQHLLPC........LEE..LLPC.-.....TA...Y.........L
C3SA92_BRADI/13-112VLALAAAASAA..T..PAP...............APAVDC........QEAFLALSDC-.LD..YV...Q.........P
Q9LJ85_ARATH/13-108AVLALPIRGQQ..Q..PLS...............QCTPSM........MTT..VSPCM-.GF.ITN...S.........S
Q7XIG9_ORYSJ/15-115ALACGAASQSP..APAPAA...............GPASDC........GSS..ITALA-.GC..LT...Y.........I
C5X2J9_SORBI/14-111ALASGAASQAP..G.PSSP...............PVDCSS........AVT.GLIGC.-.....LP...Y.........V
A9S0T9_PHYPA/9-107MCLVLIVASAM..V.VTTA...............AAGCDI........DL...LLPCL-.....NA...S.........R
C5Y597_SORBI/23-118FLATVVIPAAA..A.QEGY...............SCRDSL........AG...LKEC.-.....ES...F.........M
B9RIH6_RICCO/12-107ILAIWIAVGMS..I.SGQI...............AAAQSC........NTD...LTDL-.VS..KCQRFV.........I
B9RIH3_RICCO/10-107IMAMLVMVGTQ..V.LSDK...............KVSAQC........EGK.VPLPQL-.IS..KC...YK.......FV
A9TY60_PHYPA/11-108LFASVLVAGVG..VGGQSL...............YCREAT........YSS..LAPC.-.SK..YM...A.........V
B9HP13_POPTR/12-110ALAMLLIVGIH..I.LGNQ...............KVAASC........NET...VTSL-.VS..KCS.QF.........V
C5XAF7_SORBI/6-114LLATAAVPLAS..G.QQQP...............AGAASC........TAS..LLTS.-.FT..PC...FSFLTSSGGGS
A9T6D1_PHYPA/9-104LLLVVLVG.LS..A.VVNV...............ESQAQCGG....RNLSI..LAPC.-.....LP...A.........A
B9HP10_POPTR/10-105VLAWLVVVGAR..F.LGDH...............KVSAQC........GGS..FVD.I-.EA..QCS.QF.........V
B9RTN3_RICCO/10-113FLLMATASQTP..C.PPPP...............VASCTG........ELV..AISPC-.LG..YI...S.........S
B9RIH4_RICCO/10-105ALAVLLIAGML..I.SGEL...............VSAINC........DND..LIGL.-.AS..KCQ.KY.........V
B9RZC4_RICCO/7-99ALVLVLVLAIV..V...NG...............ENPCRL........TNE..GIEAC-.RP..SV...T.........G
A9SQH6_PHYPA/103-196VLALVLNAPGT..A.QAQI...............CADSQA........AVL..YVSC.-.....YG...Y.........L
B9SEE9_RICCO/14-106VLVAVMVDEAR.MV.QGAG...............LSPSQC........KQE..QTLG.-.VN..AC..RD.........I
C5WP26_SORBI/30-121AAAATPTPPQA..A..QAA...............AAGAAC........HND...IVAL-.RT..TCY.DY.........V
B9SEE8_RICCO/14-105LVAVLSIVEVK..T.ANAA...............PSAAQC........KEE..RRLG.-.LN..ACK.PV.........V
C5WP25_SORBI/18-110LLLAAATAAAA..T.PEAP...............TAGAAC........YND...IVAL-.RS..TCY.RY.........V
A9SQH9_PHYPA/117-210ILTLVLAATGG..V..QAQ...............PCSPTQ........PL...LLYG.-.YC..AS...Y.........L
B9GVR5_POPTR/18-112VMAVVFSSCTT..TLTKAQ...............ESSTSC........ATK..LTAC.-.....QA...F.........L
B9H8A8_POPTR/14-108..STLLVISVN..G.QIST...............PCTTSM........ISS..FTPCI-.NF.ITG...S.........T
B9HUT8_POPTR/13-107....MLLLLSA..A.EPSP...............ASPPGC........SDE..LVAFS-.PC..LG...Y.........V
D7T8D6_VITVI/12-114VMALMLVSQAF..V.Q.EA...............NGAGECGKTPIQSAAAS..LSSCL-.....SA...A.........G
I1PAV8_ORYGL/35-130....VASSPWA..A.PA.P..............WPGELDC........TGA..LLNLS-.SC..LT...Y.........V
I1QT58_ORYGL/18-119...AATAAAAG..L.PPLPSTMP......ADVPQPEIPPC........LND..LMPC.-......A...S.........V
I1R180_ORYGL/22-119..AWLPSRASA..A.SDAA...............AGGEYC........RDS..LSGLL-.AC..RD...F.........M
Q1G2Y5_ARATH/16-109....LLSSNSP..T.SILA...............QINTPC........SPS..MLSS.-.VTGCTS...F.........L
Q2R222_ORYSJ/12-114VLLVLLVAAAG..G..GAE...............AAATTC........VAS..LLELS-.PC..LP...F.........F
Q75GY5_ORYSJ/27-127.AAIMASSAQP..Q.QQQQQPPQ......PPGQPANAPSCP.....PVQAS..LSPCV-.....SY...F.........I
Q8S077_ORYSJ/23-111.....AVAPAA..A.AGAP...............FMVCGV........DAD.RMAADC-.GS..YC..RA.........G
Q9SUV7_ARATH/19-112FLAVTIVDAQS..M.PPMP...............KFNPVC........ALA..DLPNI-.VQ..LC...Y.........F
U5G1T3_POPTR/18-113.LAVMILPVYG..Q..INT...............ACTASV........LAT..FTPCM-.NF..LTN.ST.........A
U5GQ18_POPTR/24-115..VVVVLGMWEVNK.ADAA...............LSAAQC........KEE..RRLGL-NAC..KP...V.........I

PF14547

F2DU32_HORVD/35-120PCPTNALADLK--V-------------------------C--------ADV--L.VLL-KLK-----------------I
D7ME35_ARALL/36-114VCPR....DIQ--A-------------------------C--------VNV--L..RT-SVI-----------------L
A8MRQ5_ARATH/577-656TCPRNAN.QIR--T-------------------------C--------SNV--L.RFF-GNF-----------------L
D7ME37_ARALL/85-164RCPRNGL.PLQ--I-------------------------C--------STI--L.SIF-DGF-----------------L
D7ME34_ARALL/31-113VCPRDSI.NFI--S-------------------------C--------SNV--F.RLS-LIL-----------------I
D7ME36_ARALL/7-89TTIMS...DLG--I-------------------------C--------VNV--L.GLI-NLT-----------------T
D7MAX1_ARALL/157-241TCPIDAL.KLG--A-------------------------C--------VDV--LGGLI-HIG-----------------L
Q7XTE3_ORYSJ/6-89FCPWDAV.KFG--A-------------------------C--------AGV--L.GVV-GVQ-----------------A
B9S3J8_RICCO/215-298TCPIDTL.KLG--A-------------------------C--------VDV--LGGLI-HIG-----------------I
D7ME38_ARALL/36-117TCPRNPL.QLG--V-------------------------C--------ANV--L.GLA-NVT-----------------A
C5Z4Z5_SORBI/237-320TCPIDTL.KLN--A-------------------------C--------VDV--LSGLI-HLV-----------------I
C5Y909_SORBI/46-127.CPWDAV.KFG--A-------------------------C--------VGV--L.GAA-GLQ-----------------A
F4JLV4_ARATH/297-375.CSKNDT.ELK--I-------------------------C--------AGI--L.AIS-DGL-----------------L
I1QBL2_ORYGL/229-307KCPLLLT.NLG--G-------------------------C--------ISL--G....-...-----------------I
M4F7Y5_BRARP/170-253TCPIDTL.KLG--A-------------------------C--------VDL--LGGLV-KIG-----------------L
Q9SU32_ARATH/33-116TCPRDVL.KLS--T-------------------------C--------SNV--L.NLI-NLK-----------------L
W4ZSZ5_WHEAT/138-222KCPTDAL.KLH--V-------------------------C--------ANV--L.DLI-KAK-----------------V
W5AJU0_WHEAT/30-113SCPKDGL.KLK--A-------------------------C--------VDV--L.GLL-KLK-----------------V
W5AP16_WHEAT/30-114FCPWEAV.KFG--A-------------------------C--------AAV--L.GLA-DAQ-----------------A

PF13016

Q5Z9M9_ORYSJ/30-100QQQPF......--M----------------------------------QPI--MNPC-----------------------
Q0D7V8_ORYSJ/32-104QLQSH...LLL--Q----------------------------------QQV--LSPC-----------------------
AVLBB_WHEAT/153-224Q....QQQQQL--.----------------------------------QEQ--LTPC-----------------------
D2KFG9_WHEAT/47-117EHPVP......--.----------------------------------HQK--LNPC-----------------------
I1I1L7_BRADI/190-267.SQPQGQQYPT--S----------------------------------QHQ--LGQC-----------------------
M8A4Q2_TRIUA/135-215QQQPSVEE...--.----------------------------------NQQ--LNLC-----------------------
GDBB_WHEAT/132-208QQQPSLIQQSL--.----------------------------------QQQ--LNPC-----------------------
GLTA_WHEAT/180-256QQQIPVIHPSV--.----------------------------------LQQ--LNPC-----------------------
W5D734_WHEAT/36-109QPQQKTVQSFF--.----------------------------------EQQ--LISC-----------------------

PF00234

IAA2_WHEAT/37-143-CNPATG..YK--VSALTG...............CRAMVK-------------LQCVG-SQVPE..-------------.
PRO28_ORYSJ/47-143-CGEFVRQQCS--TVA......................TP-------------FFQSP-VFQLRNC-------------Q
RAG1_ORYSJ/39-150-CRPGIS..YP--TYSLPQ................CRTLV-------------RRQCV-GRGAASA-------------A
NLTP1_ORYSI/28-112-CGQVNSA...--...........................-------------VGPCL-TYARGGA-------------G
NLTP4_ORYSJ/30-115-CGQVVSM...--...........................-------------LAPCI-MYATGRV-------------S
B7E7J9_ORYSJ/30-95-CN..AGQ...--...........................-------------LTVCT-GAIAGGA-------------R
NLTP3_ORYSI/32-117-CGDVTSS...--...........................-------------IAPCL-SYVMGRE-------------S
A9_ARATH/27-87-CRDELSN...--...........................-------------VQVCA-PLLLPGA-------------V
108_SOLLC/35-99-CQ..PQQSCT--ASL......................TG-------------LNVCA-PFLVPGS-------------P
14KD_DAUCA/54-136-CPRDALK...--...........................-------------LGVCA-DVLNLVH-------------N
2SS1_ARATH/59-153-CQQLMLQQAR--QGRSDE................FDFED-------------DMENP-QGQQ.QE-------------Q
2SS1_BRANA/16-122-CQQWLHKQAM--QSGGGPSWT.........LDGEFDFED-------------DMEKQ-GPQQR..-------------.
2SS2_ARATH/58-158-CQKLMRMQMR--QGRGGGPSL..........DDEFDLED-------------DIENP-QGPQQGH-------------Q
2SS5_HELAN/53-148-CRMFLQQGQN--IPR......................EF-------------DNPQM-GRQQE..-------------.
2SS5_HELAN/190-290-CQRFVEQQMQ--QSP......................RS-------------TRPYQ-QRPGQQQ-------------Q
2SS8_HELAN/49-139-CYQQMEEAEM--LNH.....................CGM-------------YLMKN-LGERSQV-------------S
2SSE_BRANA/60-174-CQQWLHKQAM--QPGGGSGPSW.......TLDGEFDFED-------------DVENQ-QQGPQQR-------------P
2SSL_PICGL/52-156-CDPQ......--.RD.....................PQR-------------LSSCR-DYLERRR-------------E
2SS1_BEREX/40-137-CREQMQRQQM--LSHCRMYM...........RQQMEESP-------------YQTMP-RRGME..-------------.
B9SA35_RICCO/61-155-CERYLRQSSS--RRSP...................GEEV-------------LRMPG-DENQQQE-------------S
B9SA35_RICCO/162-256-CRGQIQEQQN--LRQCQ..................EYIK-------------QQVSG-QGPRRSD-------------N
2SS_SOYBN/43-152-CEKHIMEKIQ--GRGDDDDDDDDDNHILRTMRGRINYIR-------------RNEGK-DEDEEEE-------------G
M4CYI5_BRARP/32-92-CLDNLSN...--...........................-------------MQVCA-PLVLPGA-------------V
A6N9I7_ALLCE/31-116-CPRVNRI...--...........................-------------VTPCV-AYGLGR.-------------.
AVE3_AVESA/69-210-CRQFLVQQCS--PVA.....................VVP-------------FLRSQ-ILQQSSC-------------Q
CCDP_MAIZE/48-127-CPIDALK...--...........................-------------LKVCA-KVLGL..-------------.
FIL1_ANTMA/31-90-CSASLAN...--...........................-------------LNACA-PFVVLGA-------------A
GDA0_WHEAT/146-275-CMDVVLQQHN--I.........................A-------------HGRSQ-VLQQSTY-------------Q
GDA2_WHEAT/143-280-CRDVVLQQHN--I.........................A-------------HGSSQ-VLQESTY-------------Q
GDA5_WHEAT/152-306-CRDVVLQQHN--I.........................A-------------HASSQ-VLQQSTY-------------Q
GDA6_WHEAT/155-283-CRDVVLQQHN--I..........................-------------AHARS-QVLQQST-------------Y
GDA8_WHEAT/46-175-CMDVVLQQHN--I.........................A-------------HGRSQ-VLQQSTY-------------Q
GDB1_WHEAT/134-288-CKVFLQQQCS--PVAM....................PQR-------------LARSQ-MWQQSSC-------------H
GDB2_WHEAT/184-310-CKNILLQQSK--PAS.....................LVS-------------SLWSI-IWPQSDC-------------Q
GDB3_WHEAT/87-228-CKVFLQQQCS--PVAM....................PQR-------------LARSQ-MLQQSSC-------------H
B6UKL2_TRITU/171-285-CKNFLLQQCN--HVS.....................LVS-------------SLVSI-ILPRSDC-------------Q
A2Y665_ORYSI/48-178-CRQVLDRQLT--GRE......................RF-------------...QP-MFRRPGA-------------L
D2DII3_WHEAT/197-341-CKVFLQQQCI--PVAM....................QRC-------------LARSQ-MLQQSIC-------------H
GLU2_MAIZE/128-213-CVEFLRHQCS--PTA......................TP-------------.....-.YCSPQC-------------Q
HOG1_HORVU/166-288-CKEFLLQQCR--PVS.....................LLS-------------YIWSK-IVQQSSC-------------R
HOG3_HORVU/142-276-CKEFLLQQCT--LDEKVPL..............LQSVIS-------------FLRPH-ISQQNSC-------------Q
HOR1_HORVU/143-282-CKVFLQQQCS--PVPV....................PQR-------------IARSQ-MLQQSSC-------------H
HPSE_SOYBN/8-77-CP.D......--...........................-------------LSICL-NILGGSL-------------G
IAAC1_WHEAT/30-140-CYAGMG..LP--INPLEG...............CREYVA-------------QQTCG-ISISGSA-------------V
IAAC3_WHEAT/43-159-CRDYVLQQTC--GTFTPG...............SKLPEW-------------MTSAS-IYSPGKP-------------Y
IAC16_WHEAT/30-134-CTPWMS..TL--ITPLPS...............CRDYVE-------------QQACR-IETPGSP-------------Y
IAA1_HORVU/20-131-CWPGMG..YP--VYPFPR................CRALV-------------KSQCA-GGQVV..-------------.
IAA1_WHEAT/6-115-CY..PGQAFQ--VPALPA...............CRPLLR-------------LQCNG-SQVPE..-------------.
IAA2_HORVU/37-144-CDPEMG..HK--VSPLTR...............CRALVK-------------LECVG-NRVPE..-------------.
IAA4_SORBI/7-111-CAPGLA..IP--APPLPT...............CRTFAR-------------PRTCG-LGGPYGP-------------V
IAA5_SORBI/4-106-CEPGLV..IP--LNPLPS...............CRTYMV-------------RRACG-VSIGPVV-------------P
IAAA_HORVU/30-140-CYAGMG..LP--SNPLEG...............CREYVA-------------QQTCG-VTIAGSP-------------V
IAAE_HORVU/29-137-CAPGDA..LP--HNPLRA...............CRTYVV-------------SQICH-QGPRLLT-------------S
IAAT_ELECO/6-114-CIPGMA..IP--HNPLDS...............CRWYVS-------------TRTCG-VGPRLAT-------------Q
B6UHB4_MAIZE/34-143-CVPGWA..IP--HNPLPS...............CRWYVT-------------SRTCG-I....GP-------------R
LIM1_LILLO/29-88-CSAAIGE...--...........................-------------LMTCG-PYVLPGN-------------N
MC1_PINRA/28-88-CSNAMDK...--...........................-------------LAPCT-SAVGLSS-------------N
MEN8_SILLA/38-98-CASQLGN...--...........................-------------LNVCA-PYVVPGA-------------V
NLT11_PARJU/4-91-CGTMVRA...--...........................-------------LMPCL-PFVQGKE-------------K
NLT21_PARJU/35-121-CGKVVQD...--...........................-------------IMPCL-HFVKGEE-------------K
F2DCX3_HORVD/29-111-CGQVSSA...--...........................-------------LSPCI-SYARG..-------------.
NLTP1_ARATH/29-114-CGSVNSN...--...........................-------------LAACI-GYVLQ..-------------.
NLTP1_BRANA/29-113-CGTVSGN...--...........................-------------LAACI-GYLT.QN-------------G
A8YPK3_HORVU/29-113-CGQVDSK...--...........................-------------MKPCL-TYVQGGP-------------G
NLTP2_SOLLC/27-110-CGEVTSG...--...........................-------------LAPCL-PYLEGR.-------------.
NLTP1_PRUAR/3-87-CGQVSSS...--...........................-------------LAPCI-GYVRG..-------------.
NLTP1_TOBAC/27-110-CGQVTSN...--...........................-------------LAPCL-AYLRN..-------------.
NLTP2_HORVU/37-102-CE..PAQ...--...........................-------------LAVCA-SAILG..-------------.
NLTP3_HORVU/29-114-CGQVSSA...--...........................-------------LSPCI-SYARG..-------------.
B6CQU4_9ROSA/33-119-CGQVVNN...--...........................-------------LTPCI-NYVAN..-------------.
NLTPA_BRAOT/29-114-CGTVNSN...--...........................-------------VAPCI-GYITQ..-------------.
NLTPA_RICCO/3-88-CGQVNSS...--...........................-------------LASCI-PFLTGGV-------------A
NLTP1_WHEAT/26-110-CGHVDSL...--...........................-------------VRPCL-SYVQGGP-------------G
NLTPB_RICCO/3-88-CGQVNKA...--...........................-------------LSSCV-PFLTG..-------------.
NLTPC_RICCO/28-112-CSTVDMK...--...........................-------------AAACV-GFATG..-------------.
NLTP_AMACA/4-90-CTVVTKA...--...........................-------------LGPCM-TYLKG..-------------.
NLTP_BETVU/29-113-CGLVASK...--...........................-------------LAPCI-GYLQG..-------------.
NLTP_CICAR/27-111-CGRVDTA...--...........................-------------LAPCL-GYLQGGP-------------G
NLTP_DAUCA/30-116-CGQVTGA...--...........................-------------LAPCL-GYLRSQV-------------N
NLTP_ELECO/4-90-CGQVSSA...--...........................-------------IGPCL-AYARG..-------------.
NLTP_GERHY/28-112-CGQVTSG...--...........................-------------LVPCF-GYLAA..-------------.
NLTP_HELAN/28-112-CGQVSSS...--...........................-------------LAPCI-SYLTK..-------------.
NLTP_PINTA/34-119-CNQVVSA...--...........................-------------MTPCA-TYLIGNA-------------A
NLTP_SPIOL/30-113-CGMVSSK...--...........................-------------LAPCI-GYLKG..-------------.
NLTP_STRHE/10-89-CGTVDMK...--...........................-------------AASCI-SFATG..-------------.
NLTP_VIGUN/34-99-CN..PTE...--...........................-------------LSSCV-PAITGGS-------------K
NLTP6_AMBAR/30-113-CDTVQNI...--...........................-------------LAPCA-GFLTGQ.-------------.
O22110_PICAB/25-104-CEDSDNT...--.AC.....................LSS-------------LSSCA-PYLNA..-------------.
O22272_ARATH/48-125-CSTVIYS...--...........................-------------MMDCL-GYLGVGS-------------N
NLTP2_SOLPN/27-110-CGQVTST...--...........................-------------LAPCL-PYLMNR.-------------.
O24101_MEDTR/31-102-CNIDPND...--..........................L-------------KQSCS-KFVTGRN-------------P
O24355_SILLA/25-110-CSDVIPK...--...........................-------------VTFCL-LYITGGS-------------P
O24440_PHAVU/29-112-CGQVTSS...--...........................-------------LASCI-PFLTK..-------------.
O24485_PINRA/36-122-CNTIIQQ...--...........................-------------ITSCA-TYLTTGT-------------P
O24486_PINRA/39-97-CAATAES...--...........................-------------LSPCA-SAVGNNP-------------Q
O49116_ARATH/29-125-CRDVFVS...--...........................-------------FMPCM-GFVEGIF-------------Q
O49178_ORYSA/42-149-CQPGMG..YP--MYPLR.................VAGVG-------------EAPLL-GRARPRR-------------R
O49644_ARATH/39-110-CVMMIPD...--..........................I-------------LEECF-THDRL..-------------.
O64431_BRACM/21-86-CD..PKQ...--...........................-------------LQPCL-AAITG..-------------.
YLS3_ARATH/36-113-CTAQLVG...--...........................-------------MATCL-PYVQGKA-------------K
O65368_ARATH/32-112-CSRDAIK...--...........................-------------LGVCA-KILDVAV-------------G
O65369_ARATH/55-137-CPKDTLK...--...........................-------------LGVCA-NVLNGLL-------------D
O65561_ARATH/29-103-CQGDIEG...--..........................L-------------MKECA-VYVQR..-------------.
O81135_HORVU/27-92-CE..VGQ...--...........................-------------LTVCM-PAIT...-------------.
O81410_PICGL/53-146-CE..QQR...--...........................-------------LSSCR-EYLERRR-------------N
O81872_ARATH/32-107-CGANLSG...--..........................L-------------MNECQ-RYVSNAG-------------P
O82439_ARATH/25-107-CPKNSIE...--...........................-------------IGTCV-TVLN.LV-------------D
NLTP2_PRUAR/3-68-CSPV..Q...--...........................-------------LSPCL-GPINSGA-------------P
F2D8V2_HORVD/31-96-CN..ALQ...--...........................-------------LTPCA-GAIMGNA-------------A
P93198_9ROSI/39-132-CREQIQRQQN--LNHCQYYL...........RQQSRSGG-------------YDEDN-QR.....-------------.
P93274_MALDO/2-73-CVDVLGG...--...........................-------------.....-.....LI-------------H
P93513_9POAL/63-154-CSDYVMD.RC--VMKD...................MPLS-------------WFFPR-TWGKRSC-------------E
P93611_WHEAT/84-166-CPVDTLK...--...........................-------------LLGCV-DALNGLV-------------H
P93705_DAUCA/264-345-CPLDALK...--...........................-------------LGACV-DVLGGLV-------------H
P93794_WHEAT/195-344-CKVFLQQQCI--PVAM....................QRC-------------LARSQ-MLQQSIC-------------H
PRF1_SOLLC/261-343-CPIDALK...--...........................-------------LGACV-DVLGGLI-------------H
PROA_ORYSI/43-134-CRQYMMQ...--.TL......................GM-------------GSSTA-MFMSQPM-------------A
PRO25_ORYSJ/47-143-CSEFVRQQYS--IVA......................TP-------------FWQPA-TFQLINN-------------Q
J7FK20_9POAL/48-138-CRNYLLDRCS--TMKD...................FPVT-------------WRWWK-WWKG.GC-------------Q
B6Z278_WHEAT/50-140-CKDYVMERCF--TMKD...................FPVT-------------.WPTK-WWKGGCE-------------H
Q00318_COILA/103-188-CIEFLRHQCS--PAA......................TP-------------.....-.YCSPQC-------------Q
Q06763_SOYBN/68-149-CPIDTLK...--...........................-------------LGACV-DLLGGLV-------------H
Q09071_AVESA/48-166-CQMFLMQQCS--PVE.....................MVP-------------FLRSQ-ILRQSTC-------------H
Q09072_AVESA/74-212-CKQFLVQQCS--PVA.....................AVP-------------FLRSQ-ILRQAIC-------------Q
Q39100_ARATH/48-126-CK.DALK...--...........................-------------LKVCA-NVLD.LV-------------K
ERLI1_ARATH/85-167-CPIDALR...--...........................-------------LGVCA-NVLSSLL-------------N
Q39332_BRANA/28-112-CGTVTST...--...........................-------------MTQCI-SYLTN..-------------.
Q39574_CATRO/55-137-CPRDALK...--...........................-------------LGVCA-DLLGGLI-------------S
2SS_CUCMA/55-139-CEQYLRQ...--.QSR....................DVL-------------QMRGI-ENPWRRE-------------G
Q39787_GOSHI/36-131-CEQQIRKQAH--LKHCQKYM............EEEWGGE-------------GSDNI-AG.....-------------.
Q39928_HELAN/52-143-CRMFLQQ...--.GQ......................RG-------------QQHQQ-QQHQQQE-------------Q
Q40335_MEDSA/84-165-CPTDTLK...--...........................-------------LGVCA-DVLG.LV-------------N
Q40453_TOBAC/25-114-CQTVTTQ...--...........................-------------LAPCL-SYIQNRV-------------K
Q40654_ORYSJ/41-149-CQPGIG..YP--TYPLPR...............CRAFVK-------------RQCVA-PGTL...-------------.
A2X812_ORYSI/52-133-CPRDALK...--...........................-------------LGVCA-NVLG.LI-------------K
Q40997_PINST/58-160-CD..PQR...--...........................-------------LSDCH-DYLQRRR-------------E
Q41125_PHAVU/45-126-CPENTLK...--...........................-------------FGVCA-DVLG.LI-------------G
Q41168_RAPSA/29-141-CQQWLHRQAR--QSGSGPSWT.........LDDEFDFED-------------DMENP-QGPQQRP-------------P
Q41320_SECCE/55-178-CKNVLLQQCS--PVA.....................LVS-------------SLRSK-IFPQSEC-------------Q
Q41378_9ASTR/24-89-CS..VTE...--...........................-------------LMPCS-SAFTSSA-------------A
Q41543_WHEAT/137-262-CKNFLLQQCK--PVS.....................LVS-------------SLWSM-ILPRSDC-------------Q
Q41848_MAIZE/215-296-CPIDTLK...--...........................-------------LNACV-DVLSGLI-------------H
Q42044_ARATH/52-133-CPTDTLK...--...........................-------------LGVCA-DLLG.LV-------------N
Q42158_ARATH/29-94-CS..PMQ...--...........................-------------LASCL-AAMTSSS-------------P
Q42392_ZINVI/30-95-CQ..VTQ...--...........................-------------LAPCA-SAISSSS-------------P
Q42474_ORYSA/65-146-CPIDALK...--...........................-------------LRVCA-NVLNGAL-------------G
Q42487_POPNI/58-140-CPKDALK...--...........................-------------LGVCA-DLLGSLL-------------N
M0VYA0_HORVD/33-118-CGQVDSK...--...........................-------------LAPCV-AYVTGRA-------------S
Q43496_SOLLC/28-101-CSSTFFS...--...........................-------------ALIQL-IPCRASV-------------V
Q43522_SOLLC/127-207-CPRDALK...--...........................-------------LGVCA-NVLN.LV-------------N
F2E1T8_HORVD/29-111-CGQVSSA...--...........................-------------LGPCA-AYAKG..-------------.
Q96232_ASPOF/101-182-CPLDALK...--...........................-------------LGACV-DLLGGLV-------------H
Q9S7U3_ARATH/46-128-CPKDTLK...--...........................-------------LGVCA-NVLKDLL-------------K
Q9SA59_ARATH/25-103-CRDTLTS...--...........................-------------LSPCL-YYLNGGS-------------S
Q9SBW9_MAIZE/43-101-CLPQLNR...--...........................-------------LLACR-AYLVPGA-------------P
Q9SC06_TRIMO/34-125-CSDYVMDRCV--TKD......................MP-------------LSWVF-PRTWGKR-------------S
Q9SDS2_CAPAN/27-110-CGQVQSR...--...........................-------------MTPCL-PYLTG..-------------.
Q9SDS4_CAPAN/19-102-CGQIQVG...--...........................-------------VVNCL-PYLQNR.-------------.
F2CY84_HORVD/32-117-CSAVYST...--...........................-------------LMPCL-QYVQQ..-------------.
Q9SET1_ARATH/222-304-CPIDTLK...--...........................-------------LGACV-DVLGGLI-------------H
Q9SHA0_ARATH/27-109-CGRMPINQAA--A.........................S-------------LSPCL-PATKNPR-------------G
Q9SI70_ARATH/29-101-C...VSK...--...........................-------------LVPCF-NDLNT..-------------.
Q9SKI0_ARATH/208-289-CPIDTLK...--...........................-------------LGACV-DLLGGLV-------------K
Q9SRS1_ARATH/32-105-CGRTFLSALI--Q..........................-------------LVPCR-PSVAP..-------------.
Q9ST25_MAIZE/51-132-CPLNALK...--...........................-------------FGVCA-DVLG.LV-------------K
Q9STH5_ARATH/42-113-CAAG......--...........................-------------LAVCL-PAIT.QR-------------G
Q9SU32_ARATH/34-115-CPRDVLK...--...........................-------------LSTCS-NVLN.LI-------------N
Q9SUV8_ARATH/28-104-CPRDIE....--.ACS...................NVFG-------------LGRIL-NY.....-------------.
Q9SUW7_ARATH/37-117-CPRDSTQ...--...........................-------------FLSCT-NVLNL..-------------S
Q9SUX0_ARATH/37-116-CPRNPLQ...--...........................-------------LGVCA-NVLG.LA-------------N
Q9SUX3_ARATH/50-132-CPKDALK...--...........................-------------VGVCV-NALNLLN-------------G
Q9SUZ2_ARATH/48-121-CSRTFFS...--.AL......................VQ-------------LIPCR-AAVAP..-------------.
SCA_LILLO/25-109-CGQVDSD...--...........................-------------LTSCL-GYARK..-------------.
Q9SXE7_ARATH/212-293-CPINALK...--...........................-------------LGACV-DVLGGLI-------------H
Q9XF30_ORYSI/41-111-CNPTL.....--...........................-------------LTPCA-GPTL...-------------.
NLTP5_ARATH/29-114-CGAVTGS...--...........................-------------LGQCY-NYLTR..-------------.
2SS1_SESIN/54-141-CMQWMRSMRG--QYE......................ES-------------FLRSA-EANQGQF-------------E
NLTP8_ARATH/28-112-CSVVLQD...--...........................-------------LQPCV-SYLTSGS-------------G
NLTL2_ARATH/27-105-CSSLILN...--...........................-------------MADCL-SFVTSGS-------------T
Q9ZSL7_BRANA/27-108-CGTVTSN...--...........................-------------LAPCA-VYLM...-------------.
Q9ZTW2_FRAAN/73-155-CPRDALK...--...........................-------------LGICA-NVLNNLL-------------N
NLTP7_ARATH/29-118-CGEVNSN...--...........................-------------LKPCT-GYLTN..-------------.
XYP11_ARATH/40-120-CLVSMLN...--...........................-------------VSDCF-SYVQVGS-------------N
YY1_ORYSJ/31-94-CAAQLTQ...--...........................-------------LAPCA-RVGV.AP-------------A
ZEB2_MAIZE/86-172-CVEFLRHQCS--PAA......................TP-------------YGSP.-.....QC-------------Q
ZM33_MAIZE/45-108-CAGQLRG...--...........................-------------LAPCL-RYSVPPL-------------P

PF05617

M4FC94_BRARP/72-146TCMDKMK.PIG------------------------------------------..KCGFEDVIKEILT-----------.
B9S177_RICCO/41-104NCWDSLI...Q------------------------------------------LEACT.TEIILFFL.-----------.
U5FMS5_POPTR/61-132NCANTIS....------------------------------------------.KSAG.DKVFNYIFG-----------D
M1BC58_SOLTU/78-151ECLQNIS....------------------------------------------.DDCG.IIIFNRILD-----------S
M4FCA2_BRARP/71-146TCADKMG.PSG------------------------------------------ISECN.EDVLREILT-----------.
M4F146_BRARP/69-143VCAQKLN....------------------------------------------SSHCG.DALFTNMVG-----------E
M4FC93_BRARP/72-147TCGKNMG.PSG------------------------------------------TVKCN.VDVLKEILT-----------.
EC12_ARATH/45-109ECWNALY...E------------------------------------------LKSCT.NEIVLFFL.-----------.
M4FC76_BRARP/105-178ICLQKLN....------------------------------------------.SDCG.DNIVKNMLD-----------K
D7LVH8_ARALL/44-116KCMAKLS....------------------------------------------.SRCA.MYVTAEVLY-----------S
M4F8U3_BRARP/34-96DCLSSLE...T------------------------------------------IPDCI.PEIFRSIIS-----------.
K4CB92_SOLLC/64-137NCTKYLP....------------------------------------------.NKCG.IKVLNATLH-----------D
B9SN88_RICCO/61-124KCFQDFN...I------------------------------------------DQECG.QQIMNSFTS-----------.
B9SVP5_RICCO/53-119DCWNALM...E------------------------------------------IKSCS.NEIILFFL.-----------.
B9GGT7_POPTR/48-111.CWGSLL...H------------------------------------------LQSCI.SNVLLFFL.-----------.
I1I7L3_BRADI/74-140ECLKMVL...R------------------------------------------AEGCA.VDILRWFAS-----------P
K7KX58_SOYBN/72-144KCVVKIG....------------------------------------------.TECG.EEVFDNLKH-----------N
K7KX56_SOYBN/72-143KCTENLG....------------------------------------------.NECG.EQVYNKLIH-----------D
K7MQC1_SOYBN/160-232DCAAKLH....------------------------------------------.PHCG.DQFYAGIFY-----------G
M0TQL0_MUSAM/66-131.CWDSLM...E------------------------------------------LRSCT.GEVILFFL.-----------.
EC11_ARATH/57-120.CWDSLM...Q------------------------------------------LQHCS.GELILFFL.-----------.
B9T247_RICCO/77-140KCLQDFH...V------------------------------------------EQGCV.NQILHSYAS-----------.
M4FC95_BRARP/79-152TCMDKME.PIG------------------------------------------..KCG.LYVIKEILT-----------.
D7KC93_ARALL/38-103TCLVKIT....------------------------------------------.PKCA.LNIIAVVFG-----------N
M4EKA3_BRARP/43-105KCWSSIF...N------------------------------------------VNGCV.LELYRSVFS-----------.
D7MTL8_ARALL/141-203KCLSSLV...S------------------------------------------VQGCV.TEIYKSVFT-----------.
C5YSL3_SORBI/84-148ECWAAVM...G------------------------------------------LSSCY.SEILLFFV.-----------.
A8MS74_ARATH/69-143DCAVKMG..AG------------------------------------------GNECN.IE.IRDVFS-----------R
U5GVU7_POPTR/48-112NCWDSLV...Q------------------------------------------LQACS.GEIILFFL.-----------.
Q6ZKQ3_ORYSJ/79-152.CWNAVL...R------------------------------------------AEVCA.GDVLRSVA.-----------.
K7LY71_SOYBN/49-122NCGSHLS....------------------------------------------.PNCG.DEVFSAIFF-----------G
B9SXP3_RICCO/41-109QCLAPFL...G------------------------------------------ISGCQ.SAIKEI...-----------.
K7KW29_SOYBN/52-115.CWDSLW...Q------------------------------------------LQACT.GEIVTFFL.-----------.
B9HRY2_POPTR/41-112QCVAVTG....------------------------------------------.ARCG.EEILYGSFM-----------G
M4DW18_BRARP/37-99DCMSSLY...A------------------------------------------IPNCL.QEIVHSFVN-----------.
M4DVD8_BRARP/72-146NCAKTRDV...------------------------------------------..KCD.DEVLLDLFK-----------.
B9RBY2_RICCO/99-162KCWSPIT...R------------------------------------------IEGCY.VKVMKSAFN-----------H
B9P5Y5_POPTR/32-100.CFLPLT...T------------------------------------------IPGCS.KEIFVAISA-----------G
B9GU63_POPTR/46-117GCAAKLT....------------------------------------------.GKCG.AEIFLSFSG-----------N
M4FC77_BRARP/64-140DCLKKVE....------------------------------------------TDYCA.AKIFKDMLD-----------E
Q8S8C9_ARATH/73-145.CSKKMAV...------------------------------------------PDKCI.EEVMAEIIQ-----------.
B9SN89_RICCO/73-136KCLQDFH...V------------------------------------------DQGCV.QQIMTSFTS-----------.
Q3EBD9_ARATH/70-142TCAGLMG....------------------------------------------GEKCS.DQVMSEILQ-----------.
D7MVA2_ARALL/48-118ACAEKPS....------------------------------------------.SICG.GEIFQNVLD-----------E
B9SVP8_RICCO/47-111DCWNALI...E------------------------------------------IKSCS.NEIILFFL.-----------.
W5I1G9_WHEAT/44-110QCWEALL...D------------------------------------------IKSCT.GEIILFFL.-----------.
U5DGU8_AMBTC/38-101QCLMSVA...L------------------------------------------VAGCA.QEVYSFFQ.-----------.
D7MSB1_ARALL/48-110KCWSSLF...N------------------------------------------VEGCV.LEIAKSIFS-----------.
D7LBY0_ARALL/72-145NCSKKMDV...------------------------------------------PYQCT.VEVLADIIQ-----------.
Q9LXX9_ARATH/44-121KCMAKLS....------------------------------------------.SRCA.MYVTDAICT-----------I
A7REG6_ARATH/64-136ACPKKPS....------------------------------------------.SKCD.DEIFNNMLD-----------G
B9HQH8_POPTR/62-126ECLATIK..AH------------------------------------------ADICL.HEVASLVLT-----------F
M4F9M9_BRARP/52-124DCWNAAL...E------------------------------------------LKSCT.DEIVKFFMS-----------R
K7N3Y2_SOYBN/45-109NCWDSLF...E------------------------------------------LQACT.GEVITFFL.-----------.
M4FC77_BRARP/213-288.CLDKVE....------------------------------------------TGYCG.AKILTDMLD-----------E
M4CIW6_BRARP/37-108QCVVKIS....------------------------------------------.PNCA.LKIISQVFG-----------D
B9SE79_RICCO/48-112SCWDSLV...Q------------------------------------------LQACT.GEIILFFL.-----------.
K7KX55_SOYBN/121-191KCAEQLG....------------------------------------------..YCG.EQVYQKLIH-----------D
K4D4G7_SOLLC/44-108DCFNALA...E------------------------------------------IKSCT.NEIVAYFT.-----------.
B9GGU6_POPTR/50-114ECWNALV...E------------------------------------------IKSCT.NEIVLFFM.-----------.
U7DW65_POPTR/42-112QCHAKVT....------------------------------------------.KRCA.IEISNSIY.-----------N
D7LQP6_ARALL/70-141ACPKKPS....------------------------------------------.PKCE.DEIFNNMLD-----------E
A8MQ83_ARATH/72-148NCGKKMDMPYG------------------------------------------PYQCA.DEVIAYIVQ-----------.
M4F142_BRARP/86-160ACFQNLN....------------------------------------------SLDCG.DNIFKNMLD-----------E
D7MQQ8_ARALL/38-109TCLVKIT....------------------------------------------.PKCA.LDIIAVVFE-----------N
U5GKZ5_POPTR/42-112ECHTKVT....------------------------------------------.KRCA.IEISNSIY.-----------T
I1IN82_BRADI/69-133ECWGAVA...E------------------------------------------LRACT.DEMVLFFL.-----------.
K4C587_SOLLC/77-151KCLQNIS....------------------------------------------.DDCG.VIIFNKIFD-----------N
Q3ECV9_ARATH/81-154ACAMKQS....------------------------------------------.WICL.NVVFENMKD-----------E
W1PLV8_AMBTC/49-113ECWNALA...E------------------------------------------LSSCS.GEIILFFM.-----------.
K4D4G3_SOLLC/55-119ECWDSLF...E------------------------------------------LQACT.GEIVLFFV.-----------.
B9IKH4_POPTR/49-122RCEKPLA..TK------------------------------------------FPSCS.NATLAAIFK-----------N
A5AZZ7_VITVI/45-108ECWNALM...E------------------------------------------IRQCT.NEIILFFL.-----------.
M0ZZI9_SOLTU/49-111KCVASVL...N------------------------------------------VPGCV.EEIITSFLR-----------.
K7KX59_SOYBN/86-158GCMVKMG....------------------------------------------.SECG.KEVFDKLMH-----------G
I1K1Y8_SOYBN/51-124DCASKLK....------------------------------------------.PHCG.EQIFFSVFV-----------G
D7MTL8_ARALL/48-110KCWSSIF...N------------------------------------------VQGCN.IEILKSALT-----------.
I1QJT2_ORYGL/79-143.CWESVV..GT------------------------------------------SPPCA.RDVLLSLAL-----------H
U5DBS7_AMBTC/38-100.CFGAVT...Y------------------------------------------LGGCI.QSLIKFITK-----------K
EC14_ARATH/47-111ECWNALY...E------------------------------------------LKSCT.NEIVLFFL.-----------.
K7KX55_SOYBN/32-108ECAKHIG....------------------------------------------.PQCG.KEILGKVLL-----------P
Q9LUB3_ARATH/33-97DCWSSLE...V------------------------------------------IPDCV.PEIFRSITN-----------.
I1QY08_ORYGL/55-119ECWSAVT...K------------------------------------------LGSCT.NEIVLFFV.-----------.
K7L6R0_SOYBN/36-100ECWSNLI...V------------------------------------------LKSCS.NEIMHFFI.-----------.
M0TA67_MUSAM/60-124DCWNALL...E------------------------------------------LRSCT.NEIVLFFI.-----------.
M1ASC9_SOLTU/60-130NCTNNIS....------------------------------------------.QPCG.PEIVTTLFK-----------Y
W5I3U0_WHEAT/51-117QCWEILM...D------------------------------------------IRSCT.GEIILFFL.-----------.
M4DW17_BRARP/37-100ECMSSMF...V------------------------------------------IPNCI.PEIIQSLVN-----------.
Q9C924_ARATH/63-134DCSDKMS....------------------------------------------.SKCN.VEMTEGLID-----------D
M4EJU1_BRARP/45-107KCWSSLT...S------------------------------------------IQGCV.TEIYKSVVT-----------.
D7LL48_ARALL/69-143NCGVKMG..PG------------------------------------------GTECN.IE.YRDGIS-----------R
Q3ECV8_ARATH/86-158ACSEKPS....------------------------------------------.SKCG.NEVFKNMLD-----------E
Q9FYN3_ARATH/84-147KCLADCK...D------------------------------------------VKTCL.ADIAKAFFT-----------.
U5GF05_POPTR/42-112DCHKKVT....------------------------------------------.KRCA.IEISNSIY.-----------T

PF14368

Q1G3I0_ARATH/16-107T.....G...S...VTPTED-CCT-------DLKSA-----------.....TS.TQ..VTCLCD--NYIANP..-----
Q3ECK0_ARATH/8-101N.....T...T...TTPVKE-CCD-------SIKEA-----------.....VE.KE..LTCLCT--IYTSPG..-----
B9RBQ4_RICCO/7-100N.....T...T...TTPPDS-CCS-------SIKDA-----------.....VT.ND..LTCLCN--LYNTPG..-----
Q9LE56_ARATH/14-113H.....L...A...TPPPAT-CCM-------PLNEI-----------.....VA.KD..ATCLCA--VFNNVD..-----
Q0D9K5_ORYSJ/20-116N.....A...T..AAPPPAS-CCG-------PLREA-----------.....AA.NE..TACLCA--ILTNKA..-----
Q9SUV6_ARATH/10-114T.....L...N...AFPSKE-CCK-------DLKTA-----------.....SK.RE..VTCLCN--NVIAHP..-----
C5Z9F1_SORBI/22-116S.....T...A...AAPAPA-CCG-------PLREA-----------.....AA.NE..TACLCA--MLLNRA..-----
C5XVS1_SORBI/14-118K.....T...T...KHPSST-CCT-------AMHTA-----------.....AA.AE..MPCLCR--LFADPE..-----
C3SA92_BRADI/13-112G....SS...T...ARPGKT-CCG-------EVKTA-----------.....VS.NPGIVDCLCA--AIASKQ..-----
Q9LJ85_ARATH/13-108S.....N...G...TSPSSD-CCN-------SLRSL-----------.....TT.GG..MGCLCL--IVTGTV..-----
Q7XIG9_ORYSJ/15-115TP..GSP...E...ARPAKD-CCA-------GVKSA-----------.....LG.SPAAVACLCG--ALGQ.D..-----
C5X2J9_SORBI/14-111QQ..GST...Q...GKPTSG-CCT-------GVKAA-----------.....LK.SPATVACLCA--AFGQ.N..-----
A9S0T9_PHYPA/9-107D.....P...R...VKPDKR-CCD-------AIRQF-----------LPPRKQK.SA..IDCLCR--LATSKE..-----
C5Y597_SORBI/23-118Y....GG...A...AAPSAA-CCA-------AYEAA-----------.....FD.AD..PFCLCY--VADG.TY.-----
B9RIH6_RICCO/12-107K.....TG.PK...FSPSPS-CCA-------VVKNV-----------.........D..VACVCD--LITKEI..-----
B9RIH3_RICCO/10-107E.....KPGPK...VPPSQG-CCQ-------VVKK.-----------........AD..IPCACK--LVTSEI..-----
A9TY60_PHYPA/11-108N....SN...S...STPTPT-CCS-------SILAL-----------.....NT.KQ..PDCLCQ--IMTQLL..-----
B9HP13_POPTR/12-110RI..PGP...R...VLPSDA-CCQ-------AAKQV-----------.....TV.GD..LPCVCK--LVTPAT..-----
C5XAF7_SORBI/6-114N.....G...S...APPTRE-CCR-------SLAAL-----------.....VN.AS..TGCACL--VLTGAVPL-----
A9T6D1_PHYPA/9-104K.....A...N...VQPSAA-CCR-------ALSSF-----------.....AT.NT.GEDCLCA--AASS.Q..-----
B9HP10_POPTR/10-105H.....K...TGPKTPPSLG-CCQ-------VVKTL-----------.........N..VNCVCR--FVTPQV..-----
B9RTN3_RICCO/10-113EP..NNM...T...ETPTSQ-CCD-------ALEKA-----------.....FSSSE..GNCFCY--LIKQ.P..-----
B9RIH4_RICCO/10-105VK..QGS...S...AKPSPE-CCK-------VVKNV-----------.........N..VPCVCS--HVTKQI..-----
B9RZC4_RICCO/7-99Q.....N...P...AAPSDA-CCA-------ALSK.-----------........AD..LQCLCF--YKNNYPW.-----
A9SQH6_PHYPA/103-196E.....D...T..LTYPDTS-CCD-------EVGYL-----------.....YK.LE.GADCFCD--EVRSLT..-----
B9SEE9_RICCO/14-106L.....L...G...KAPSPA-CCG-------RVR..-----------......V.SH..VECICP--AITPKL..-----
C5WP26_SORBI/30-121QE..GGR...T...LPPSSN-CCA-------TLIGL-----------........TN..VPCVCD--YLGS....-----
B9SEE8_RICCO/14-105......Y...G...RPPSPQ-CCQ-------RIR..-----------......V.TH..IECVCP--VVTPKL..-----
C5WP25_SORBI/18-110Q.....D...EGPMVQPSPH-CCA-------TVSGI-----------........AN..ATCVCD--YLSS....-----
A9SQH9_PHYPA/117-210T....DA...T...SYPDNT-CCD-------VILNM-----------.....YNLRG..ANCFCD--AVRSLV..-----
B9GVR5_POPTR/18-112A.....T...T...TTPPDN-CCN-------PIKEA-----------.....VA.KE..LPCLCK--LYNDPN..-----
B9H8A8_POPTR/14-108N.....N...G...SSPTGS-CCS-------SFKSL-----------.....MS.TG..MDCACL--LITANV..-----
B9HUT8_POPTR/13-107SAPPNRV...T...DTATSR-CCD-------AFSKA-----------.....FNSSD..GNCFCY--LIKQPL..-----
D7T8D6_VITVI/12-114N.....A...K...AKVPPT-CCT-------KVTAL-----------.....IN.TA..PKCLCA--VVLSPL..-----
I1PAV8_ORYGL/35-130EY..RST...L...TRPDKG-CCG-------ALAGV-----------.....VD.GE..AACLCG--LVGGYG..-----
I1QT58_ORYGL/18-119Y.....D...D...SSMLGP-CCD-------ALGKV-----------.....FK.SD..RACLCQ--IWEMARN.-----
I1R180_ORYGL/22-119F....GG...A...AVASPA-CCA-------AYSAA-----------.....FD.AD..PFCLCY--IADGVYG.-----
Q1G2Y5_ARATH/16-109T....GG...G...SFPTSD-CCG-------ALKSL-----------.....TG.TG..MDCLCL--IVTAGV..-----
Q2R222_ORYSJ/12-114KD...KA...A...TAAPEG-CCA-------GLSSI-----------.....VK.GE..AVCLCH--IVNHTLE.-----
Q75GY5_ORYSJ/27-127G.....N...S...STPSDA-CCE-------QMRAM-----------.....FQ.SQ..APCLCA--AVASAP..-----
Q8S077_ORYSJ/23-111S.....R...E...RAPRRE-CCD-------AVRG.-----------........AD..FKCLCK--YRDELR..-----
Q9SUV7_ARATH/19-112N.....L...D...LTPSEE-CCN-------DLKSS-----------.....ST.IQ..VNCLCD--NFIAHP..-----
U5G1T3_POPTR/18-113A.....N...G...TSPTAG-CCG-------ALKNL-----------.....TS.NG..MDCFCL--IVTGSV..-----
U5GQ18_POPTR/24-115......Y...G...KLPSPA-CCE-------RVRV.-----------........SH..VECVCP--VITPKL..-----

PF14547

F2DU32_HORVD/35-120N---------V---P.ANQQ-CCP-------LIGQL----------------VKLDV--AACLCA--ALKLNV-------
D7ME35_ARALL/36-114N---------A---Q.TVSR-CCT-------LVAGL----------------DASVA--SVCICN--AVRISL-------
A8MRQ5_ARATH/577-656D---------F---R.LAQP-CCT-------LIRNL----------------SDAEA--AACLCD--LVRARR-------
D7ME37_ARALL/85-164G---------F---G.RAQP-CCS-------LIRNL----------------SDADA--LACLCE--SVRAPS-------
D7ME34_ARALL/31-113N---------K---Q.TVLP-CCT-------LVAGL----------------DAAAA--SACICN--AVRITI-------
D7ME36_ARALL/7-89S---------.---..NVAQ-CCS-------ILSGL----------------NAPLV--SVCACE--ALRLNI-------
D7MAX1_ARALL/157-241G---------K---SYAKAK-CCP-------LLEGL----------------ASVDA--AVCLCT--TIRAKL-------
Q7XTE3_ORYSJ/6-89G---------A---H.LGSK-CCA-------LVDGL----------------AAAEA--AACFCT--TIKESV-------
B9S3J8_RICCO/215-298G---------S---S.AKDA-CCP-------VLQGL----------------VDLDA--ALCLCT--TIKAKL-------
D7ME38_ARALL/36-117G---------D---P.RARQ-CCT-------AINGL----------------ADVQV--ADCLCF--IFRP..-------
C5Z4Z5_SORBI/237-320G---------Q---E.ARSK-CCP-------LVQGI----------------ADLDA--ALCLCT--TIRLRL-------
C5Y909_SORBI/46-127G---------A---Q.LGSK-CCD-------VVQGL----------------AAAEA--AACFCT--TVKETV-------
F4JLV4_ARATH/297-375T---------T---G.RAEP-CCS-------IVRNV----------------SDLDA--VTCFCK--SVGARR-------
I1QBL2_ORYGL/229-307G---------N---SLMKYP-CCS-------QLYNL----------------QYDTA--AACLCD--AMKIDL-------
M4F7Y5_BRARP/170-253G---------D---P.AANK-CCP-------LLKGL----------------VEVEA--AACLCT--TLKLKA-------
Q9SU32_ARATH/33-116G---------A---P.AMRP-CCS-------ILFGL----------------IDLDV--AVCLCT--ALKLSL-------
W4ZSZ5_WHEAT/138-222G---------V---PPLNDR-CCP-------LLNGL----------------VDLDA--AICLCT--AIKADV-------
W5AJU0_WHEAT/30-113N---------V---P.RHEP-CCS-------LLDGL----------------VGLDA--ALCLCA--NIDANV-------
W5AP16_WHEAT/30-114G---------A---Q.LGSE-CCQ-------LVGGL----------------AATEA--AACLCV--AAKEGV-------

PF13016

Q5Z9M9_ORYSJ/30-100----------N---EFVRQQ-CSP........MSLP----------------WEQSRRLQLSSCQ--VMRQQC-------
Q0D7V8_ORYSJ/32-104----------S---EFVRQQ-YSI........VATP----------------FWQPATFQLINNQ--VMQQQC-------
AVLBB_WHEAT/153-224----------A---TFLQHQ-CSP........VTVP----------------FPQIRVDQPTSCQ--NVQHQC-------
D2KFG9_WHEAT/47-117----------R---DALLQQ-CSP.......VADMS----------------FLRSQVVQHSSCL--VMWEQC-------
I1I1L7_BRADI/190-267----------R---EFFLQQ-CSQ......GAMAPF----------------VQPSHMMQQSSCQ--VMQRQC-------
M8A4Q2_TRIUA/135-215----------K---EFLLQQ-CNPEEKLSLLQSVIP----------------FLRPKTSQQNNCQ--LKRQQC-------
GDBB_WHEAT/132-208----------K---NFLLQQ-CKP.......VSLVS----------------SLWSIILPPSDCQ--VMRQQC-------
GLTA_WHEAT/180-256----------K---VFLQQQ-CIP......VAMQRC----------------LARSQMLQQSICH--VMQQQC-------
W5D734_WHEAT/36-109----------R---DVLLMQ-CN.........ILVP----------------SFKSQILQENVCA--VMRKEC-------

PF00234

IAA2_WHEAT/37-143.---------.....AVLRD-CCQ-------QLADI...................NN--EWCRCG--DLSSMLRSVYQEL
PRO28_ORYSJ/47-143.---------.....VMQQQ-CCQ-------QLRMI....................A--QQSHCQ--AIS.SVQAIVQQL
RAG1_ORYSJ/39-150D---------....EQVWQD-CCR-------QLAAV...................DD--GWCRCG--ALDHMLSGIYREL
NLTP1_ORYSI/28-112.---------......PSAA-CCS-------GVRSLKAAAS..........TTADRR--TACNCL--KNAARGIK.....
NLTP4_ORYSJ/30-115.---------.....APTGG-CCD-------GVRTLNSAAA..........TTADRQ--TTCACL--KQQTSAMG.....
B7E7J9_ORYSJ/30-95.---------......PTAA-CCS-------SLR.....................AQ--QGCFCQ--FAKDPRYG.....
NLTP3_ORYSI/32-117.---------.....SPSSS-CCS-------GVRTLNGKAS..........SSADRR--TACSCL--KNMASSFR.....
A9_ARATH/27-87N---------....PAANSN-CCA-------ALQAT....................N--KDCLCN--ALR..........
108_SOLLC/35-99.---------.....TASTE-CCN-------AVQSI...................N.--HDCMCN--TMR..........
14KD_DAUCA/54-136V---------VIGSP.PTLP-CCS-------LLEGLVN................LEA--AVCLCT--AIKANILGK....
2SS1_ARATH/59-153.---------.....QLFQQ-CCN-------ELRQE....................E--PDCVCP--TLKQAAKAVRLQG
2SS1_BRANA/16-122.---------....PPLHQQ-YCN-------ELQQE....................E--PLCVCP--TLRGASKAVKQQI
2SS2_ARATH/58-158.---------......ILQQ-CCS-------ELRQE....................E--PVCVCP--TLRQAARAVSLQG
2SS5_HELAN/53-148.---------.....QQLQQ-CCQ-------ELQNI....................E--GQCQCE--AVKQVFREAQQQV
2SS5_HELAN/190-290Q---------Q..RG.LQQQ-CCN-------ELQNV....................K--RECHCE--AIQEVARRVMRQP
2SS8_HELAN/49-139P---------RMREEDHKQL-CCM-------QLKNL....................D--EKCMCP--AIMMMLNEPMW..
2SSE_BRANA/60-174.---------....P.PPQQ-CCN-------ELHQE....................E--PLCVCP--TLKGASKAVRQQV
2SSL_PICGL/52-156.---------.....QPSER-CCE-------ELQRM....................S--PQCRCQ--AIQQMLDQSLSYD
2SS1_BEREX/40-137.---------....P.HMSE-CCE-------QLEGM....................D--ESCRCE--GLRMMMMRMQQEE
B9SA35_RICCO/61-155.---------.....QQLQQ-CCN-------QVKQV....................R--DECQCE--AIKYIAEDQIQQG
B9SA35_RICCO/162-256Q---------....ERSLRG-CCD-------HLKQM....................Q--SQCRCE--GLRQAIEQQQSQG
2SS_SOYBN/43-152.---------......HMQK-CCT-------EMSEL...................RS--PKCQCK--ALQKIMENQSEEL
M4CYI5_BRARP/32-92N---------....PAPNSN-CCI-------ALQAT...................N.--KDCICN--ALR..........
A6N9I7_ALLCE/31-116.---------.....APIAP-CCR-------ALNDLRFVN...........TRNLRR--AACRCL--VGVVNRNP.....
AVE3_AVESA/69-210.---------.....VMRQQ-CCR-------QLEQI....................P--EQLRCP--AIHSVVQAIIMQQ
CCDP_MAIZE/48-127V---------KVGLP.QYEQ-CCP-------LLEGLVD................LDA--ALCLCT--AIKANVLGI....
FIL1_ANTMA/31-90.---------....TTPSSD-CCT-------ALQSV....................D--HECLCN--TLR..........
GDA0_WHEAT/146-275.---------.....LLQEL-CCQ-------HLWQI....................P--EQSQCQ--AIHNVVHAIILHQ
GDA2_WHEAT/143-280.---------.....LVQQL-CCQ-------QLWQI....................P--EQSRCQ--AIHNVVHAIILHQ
GDA5_WHEAT/152-306.---------.....LLQQL-CCQ-------QLLQI....................P--EQSQCQ--AIHNVAHAIIMHQ
GDA6_WHEAT/155-283Q---------....P.LQQL-CCQ-------QLWQI....................P--EQSRCQ--AIHNVVHAIILHQ
GDA8_WHEAT/46-175.---------.....LLQEL-CCQ-------HLWQI....................P--EQSQCQ--AIHNVVHAIILHQ
GDB1_WHEAT/134-288.---------.....VMQQQ-CCQ-------QLQQI....................P--EQSRYE--AIRAIIYSIILQE
GDB2_WHEAT/184-310.---------.....VMRQQ-CCQ-------QLAQI....................P--QQLQCA--AIHSVVHSIIMQQ
GDB3_WHEAT/87-228.---------.....VMQQQ-CCQ-------QLPQI....................P--QQSRYQ--AIRAIIYSIILQE
B6UKL2_TRITU/171-285.---------.....VMQQQ-CCQ-------QLAQI....................P--QQLQCA--AIHSVAHSIIMQQ
A2Y665_ORYSI/48-178.---------.....GLRMQ-CCQ-------QLQDV....................S--RECRCA--AIRRMVRSYEESM
D2DII3_WHEAT/197-341.---------.....VMQQQ-CCQ-------QLRQI....................P--EQSRHE--SIRAIIYSIILQQ
GLU2_MAIZE/128-213.---------.....SLRQQ-CCQ-------QLRQV....................E--PQHRYQ--AIFGLVLQSILQQ
HOG1_HORVU/166-288.---------.....VMQQQ-CCL-------QLAQI....................P--EQYKCT--AIDSIVHAIFMQQ
HOG3_HORVU/142-276.---------.....LKRQQ-CCQ-------QLANI...................N.--EQSRCP--AIQTIVHAIVMQQ
HOR1_HORVU/143-282.---------.....VLQQQ-CCQ-------QLPQI....................P--EQFRHE--AIRAIVYSIFLQE
HPSE_SOYBN/8-77.---------......TVDD-CCA-------LIGGLGD................IEA--IVCLCI--QLRALGI......
IAAC1_WHEAT/30-140S---------TEPGNTPRDR-CCK-------ELYDA....................S--QHCRCE--AVRYFIGRRSDPN
IAAC3_WHEAT/43-159.---------.....LAKLY-CCQ-------ELAEI....................S--QQCRCE--ALRYFIALPVPSQ
IAC16_WHEAT/30-134.---------.....LAKQQ-CCG-------ELANI....................P--QQCRCQ--ALRYFMGPKSRPD
IAA1_HORVU/20-131.---------....ESIQKD-CCR-------QIAAI...................GD--EWCICG--ALGSMRGSMYKEL
IAA1_WHEAT/6-115.---------.....AVLRD-CCQ-------QLAHI....................S--EWCRCG--ALYSMLDSMYKEH
IAA2_HORVU/37-144.---------.....DVLRD-CCQ-------EVANI...................SN--EWCRCG--DLGSMLRSVYAAL
IAA4_SORBI/7-111D---------P..SPVLKQR-CCR-------ELAAV....................P--SRCRCA--ALGFMMDGVDAPL
IAA5_SORBI/4-106L---------....PVLKER-CCS-------ELEKL....................V--PYCRCG--ALRTALDSMMTGY
IAAA_HORVU/30-140S---------SEPGDTPKDR-CCQ-------ELDEA....................P--QHCRCE--AVRYFIGRRSHPD
IAAE_HORVU/29-137.---------.....DMKRR-CCD-------ELSAI....................P--AYCRCE--ALRIIMQGVVTWQ
IAAT_ELECO/6-114.---------.....EMKAR-CCR-------QLEAI....................P--AYCRCE--AVRILMDGVVTPS
B6UHB4_MAIZE/34-143L---------P..WPELKRR-CCR-------ELADI....................P--AYCRCT--ALSILMDGAIPPG
LIM1_LILLO/29-88.---------....GAPSEQ-CCS-------ALRAV...................N.--HGCLCE--TIN..........
MC1_PINRA/28-88G---------...VK.PSSE-CCD-------ALKGT....................S--TSCVCK--SVR..........
MEN8_SILLA/38-98N---------....TNPSQE-CCA-------ALSGV...................N.--HDCMCN--TLR..........
NLT11_PARJU/4-91.---------.....EPSKG-CCS-------GAKRLDGETK..........TGPQRV--HACECI--QTAMKTYS.....
NLT21_PARJU/35-121.---------.....EPSKE-CCS-------GTKKLSEEVK..........TTEQKR--EACKCI--VRATKGIS.....
F2DCX3_HORVD/29-111N---------G..AK.PPAA-CCS-------GVKRLAGAAQ..........STADKQ--AACKCI--KSAAGG.......
NLTP1_ARATH/29-114G---------....GVIPPA-CCS-------GVKNLNSIAK..........TTPDRQ--QACNCI--QGAARALG.....
NLTP1_BRANA/29-113.---------....P.LPRG-CCT-------GVTNLNNMAR..........TTPDRQ--QACRCL--VGAANAFP.....
A8YPK3_HORVU/29-113.---------......PSGE-CCN-------GVRDLHNQAQ..........SSGDRQ--TVCNCL--KGIARGIH.....
NLTP2_SOLLC/27-110.---------.....GPLGG-CCG-------GVKGLLGAAK..........TPEDRK--TACTCL--KSAANSIK.....
NLTP1_PRUAR/3-87G---------....GAVPPA-CCN-------GIRNVNNLAR..........TTPDRR--TACNCL--KQLSGSIS.....
NLTP1_TOBAC/27-110.---------....TGPLGR-CCG-------GVKALVNSAR..........TTEDRQ--IACTCL--KSAAGAIS.....
NLTP2_HORVU/37-102G---------...TK.PSGE-CCG-------NLR.....................AQ--QGCLCQ--YVKDPNYG.....
NLTP3_HORVU/29-114N---------G..AK.PPVA-CCS-------GVKRLAGAAQ..........STADKQ--AACRCL--KSLATSIK.....
B6CQU4_9ROSA/33-119G---------....GALNPS-CCT-------GVRSLYSLAQ..........TTADRQ--SICNCL--KQAVNGIPY....
NLTPA_BRAOT/29-114G---------....GTLPGA-CCT-------GVSKLNSMAR..........TTPDRQ--QACRCL--ETAARALG.....
NLTPA_RICCO/3-88.---------.....SPSAS-CCA-------GVQNLKTLAP..........TSADRR--AACECI--KAAAARFP.....
NLTP1_WHEAT/26-110.---------......PSGQ-CCD-------GVKNLHNQAR..........SQSDRQ--SACNCL--KGIARGIH.....
NLTPB_RICCO/3-88F---------...DTTPSLT-CCA-------GVMELKRLAP..........TVKDKR--IACECV--KTAAARYP.....
NLTPC_RICCO/28-112K---------...DSKPSQA-CCT-------GLQQLAQTVK..........TVDDKK--AICRCL--KASSKSL......
NLTP_AMACA/4-90T---------G..ATPPPAN-CCA-------GVRSLKAAAQ..........TVADRR--MACNCM--KSAAQKTK.....
NLTP_BETVU/29-113A---------....PGPSAA-CCG-------GIKSLNSAAA..........SPADRK--TACTCL--KSAATSIK.....
NLTP_CICAR/27-111.---------......PSAQ-CCG-------GVRNLNSAAV..........TTPDRQ--AACNCL--KSAAGSIS.....
NLTP_DAUCA/30-116V---------....P.VPLT-CCN-------VVRGLNNAAR..........TTLDKR--TACGCL--KQTANAVT.....
NLTP_ELECO/4-90A---------G..AA.PSAS-CQS-------GVRSLNAAAR..........TTADRR--AACNCS--LKSAASRV.....
NLTP_GERHY/28-112G---------...GP.VPPA-CCN-------GVRGLNNAAK..........TTPDRQ--TACGCL--KGILAANT.....
NLTP_HELAN/28-112G---------....GAVPPA-CCS-------GVKSLNSAAK..........TTPDRQ--AACGCL--KSAYNSIS.....
NLTP_PINTA/34-119.---------.....TPAAT-CCP-------SIRGLDSQVK..........ATPDRQ--AVCNCL--KTQAKSY......
NLTP_SPIOL/30-113G---------....P.LGGG-CCG-------GIKALNAAAA..........TTPDRK--TACNCL--KSAANAIK.....
NLTP_STRHE/10-89K---------...DKKPSAA-CCS-------GLHPLAQTVK..........TVEDNK--AICRCL--KTAIKNFS.....
NLTP_VIGUN/34-99.---------......PSST-CCS-------KLK.V....................Q--EPCLCN--YIKNPSLK.....
NLTP6_AMBAR/30-113.---------.....EPSKA-CCT-------GVNNLNNSRK..........TKADRV--AVCNCI--KELTKSI......
O22110_PICAB/25-104T---------....TKPDSS-CCS-------ALISVI.................DKD--SQCLCN--LLNSDTVKQ....
O22272_ARATH/48-125E---------....TKPEKS-CCT-------GIETVL.................QYN--PQCICA--GLVSAGEMG....
NLTP2_SOLPN/27-110.---------.....GPLGG-CCG-------GVKGLLGQAQ..........TTVDRQ--TACTCL--KSAASSFT.....
O24101_MEDTR/31-102.---------....PRADEA-CCG-------VLRRA...................N.--LPCLCG--YKSALTYY.....
O24355_SILLA/25-110.---------.....SPSDA-CCN-------GIKTVASTVK..........DKNDAV--LVCNCL--KDKLVDL......
O24440_PHAVU/29-112G---------....GAVPAS-CCS-------GVRSLNAAAK..........TTPDRQ--.VCNCL--KSAAGAIP.....
O24485_PINRA/36-122V---------....PQEESS-CCQ-------GVQSLYGDAT..........TTEEIQ--QICTCL--KNEAINY......
O24486_PINRA/39-97.---------.....DPTPE-CCA-------VLQTA...................N.--VDCICA--LVQ..........
O49116_ARATH/29-125.---------.....QPSPD-CCR-------GVTHLNNVVKFTSPGSRNRQDSGETE--RVCLCI--EIMGNANH.....
O49178_ORYSA/42-149.---------.....AVPGD-CCR-------QFPPV...................DY--SWCRCE--AISHMLGGIYREL
O49644_ARATH/39-110.---------.....KPTED-CCN-------DLKNAT.................MTQ--VDCLCD--NFLESLSF.....
O64431_BRACM/21-86G---------....GQPSGD-CCA-------KLK.....................EQ--QPCLCG--FSKNPAFA.....
YLS3_ARATH/36-113.---------.....SPTPD-CCS-------GLKQVI.................NSD--MKCLCM--IIQERNDPDL...
O65368_ARATH/32-112T---------VIGNP.SDTL-CCS-------VLQGLVD................LDA--AVCLCT--TIKANILGI....
O65369_ARATH/55-137L---------TLGKP.PVEP-CCS-------LIQGLAD................VEA--AVCLCT--ALKANILGI....
O65561_ARATH/29-103P---------G.PKVNPSEA-CCR-------VVKRS....................D--IPCACG--RITASVQQ.....
O81135_HORVU/27-92T---------G..AK.PSGA-CCA-------NLG.....................AQ--QGCFCQ--YAKDPALGR....
O81410_PICGL/53-146.---------.....QPSER-CCE-------ELQRM....................S--PQCRCQ--AIQQTLEDVFMDS
O81872_ARATH/32-107N---------S..QP.PSRS-CCA-------LIRPI....................D--VPCACR--YVSRDVTN.....
O82439_ARATH/25-107L---------TLGNP.PVKP-CCS-------LIQGLAD................LEA--AACLCT--ALKASILGI....
NLTP2_PRUAR/3-68.---------......SPTT-CCQ-------KLR.....................EQ--RPCLCG--YLKNPSLR.....
F2D8V2_HORVD/31-96.---------......PTAS-CCS-------KMR.....................EQ--QPCMCQ--YARDPNLK.....
P93198_9ROSI/39-132.---------.....QHFRQ-CCQ-------QLSQM....................D--EQCQCE--GLRQVVRRQQQQQ
P93274_MALDO/2-73I---------GIGSS.AKDA-CCP-------VLQGLVD................LDA--AICLCT--TIKAKLLN.....
P93513_9POAL/63-154.---------.....EVRNQ-CCK-------QLRQT....................T--SRCRCK--AIWTSIQGDLSGF
P93611_WHEAT/84-166A---------VIGSS.ASDK-CCP-------LLSGVTG................LDA--ALCLCT--TIELKALNI....
P93705_DAUCA/264-345V---------GLGDP.NVNK-CCP-------VLAGLVE................LEA--AVCLCT--TIKLSLLN.....
P93794_WHEAT/195-344.---------.....VMQQQ-CCQ-------QLRQI....................P--EQSRHE--SIRAIIYSIILQQ
PRF1_SOLLC/261-343I---------GIGGS.AKQT-CCP-------LLGGLVD................LDA--AICLCT--TIRLKLLNI....
PROA_ORYSI/43-134.---------.....LLQQQ-CCM-------QLQGM....................M--PQCHCG--TSCQMMQSMQQVI
PRO25_ORYSJ/47-143.---------.....VMQQQ-CCQ-------QLRLV....................A--QQSHYQ--AISIVQAIVQQLQ
J7FK20_9POAL/48-138.---------.....ELLGE-CCS-------RLGQM....................P--PQCRCN--IIQGSIQGDLGGI
B6Z278_WHEAT/50-140.---------.....EVREK-CCK-------QLSQI....................A--PQCRCD--SIRRVIQGRLGGF
Q00318_COILA/103-188.---------.....ALRQQ-CCH-------QLRQV....................E--PLHRQQ--AIFGVVLQSIQQQ
Q06763_SOYBN/68-149I---------GLGDP.VANQ-CCP-------VLQGLVE................VEA--AVCLCT--TLKLKLLN.....
Q09071_AVESA/48-166.---------.....VMRRQ-CCR-------QLAQI....................P--RQLRCP--AIHSMVHAIIMQQ
Q09072_AVESA/74-212.---------.....VTRQQ-CCR-------QLAQI....................P--EQLRCP--AIHSVVQSIILQQ
Q39100_ARATH/48-126V---------S..LP.PTSN-CCA-------LIKGLVD................LEA--AVCLCT--ALKANVLGI....
ERLI1_ARATH/85-167I---------QLGQP.SAQP-CCS-------LIQGLVD................LDA--AICLCT--ALRANVLGI....
Q39332_BRANA/28-112G---------...GP.LPSS-CCV-------AVKSLNQMAQ..........TTPDRR--QVCECL--KSAGKEIK.....
Q39574_CATRO/55-137A---------VIGAP.PKTP-CCS-------LIEGLAD................LEA--AVCLCT--AIKANVLGI....
2SS_CUCMA/55-139.---------.....GSFDE-CCR-------ELKNV....................D--EECRCD--MLEEIAREEQRQA
Q39787_GOSHI/36-131.---------.....GYIDS-CCQ-------QLEKM....................D--TQCRCQ--GLRHATMQQMQQM
Q39928_HELAN/52-143.---------.....QLLQQ-CCQ-------ELQNI....................E--GQCQCE--AVKQVVRDAQRHE
Q40335_MEDSA/84-165V---------IVGSP.ASSK-CCT-------LIQGLAD................LDA--AVCLCT--AIKANILGI....
Q40453_TOBAC/25-114G---------G..GN.PSVP-CCT-------GINNIYELAK..........TKEDRV--AICNCL--KNAFIHAG.....
Q40654_ORYSJ/41-149D---------....EQVRRG-CCR-------QLAGI...................DS--SWCRCD--ALNHMLRIIYREE
A2X812_ORYSI/52-133A---------KVGVP.PAEP-CCP-------LLEGLVD................LEA--AVCLCT--AIRGNILGI....
Q40997_PINST/58-160.---------.....QPSER-CCE-------ELQRM....................S--PHCRCR--AIEQTLDQSLSFD
Q41125_PHAVU/45-126V---------ELGKP.PKTP-CCN-------LIQGLAD................LEA--AVCLCT--ALRANVLGI....
Q41168_RAPSA/29-141.---------......LLQQ-CCN-------ELHQE....................E--PPCVCT--TLKAASKAVKQQV
Q41320_SECCE/55-178.---------.....VMQQQ-CCQ-------QLAQI....................P--HHLQCA--AIHSVVHAIIMQQ
Q41378_9ASTR/24-89.---------......PTAQ-CCT-------KLK.....................EQ--SPCLCG--YLKNPTLK.....
Q41543_WHEAT/137-262.---------.....VMRQQ-CCQ-------QLAQI....................P--QQLQCA--AIHSIVHSIIMQQ
Q41848_MAIZE/215-296L---------VIGQE.ARSK-CCP-------LVQGVAD................LDA--ALCLCT--TIRARLLN.....
Q42044_ARATH/52-133V---------VVGSP.PKTP-CCT-------LLQGLAN................LEA--AVCLCT--ALKANVLGI....
Q42158_ARATH/29-94.---------......QSEA-CCT-------KLR.....................EQ--QPCLCG--YMRNPTLR.....
Q42392_ZINVI/30-95.---------......PSSQ-CCA-------KIK.....................EQ--KPCLCQ--YMKNPSLK.....
Q42474_ORYSA/65-146V---------NVGHG.PYD.-CCP-------LLAGLAD................ADA--AVCLCT--AVKANVLGV....
Q42487_POPNI/58-140V---------TVGTP.PVKP-CCS-------VIQGLLD................LEA--AVCLCT--AIKANILGI....
M0VYA0_HORVD/33-118.---------.....AISKE-CCS-------GVQGLNGLAR..........SSPDRQ--TACRCL--KSLATSIK.....
Q43496_SOLLC/28-101P---------FSSVP.PSEA-CCA-------SIKAL....................G--QPCLCV--LINGPPIS.....
Q43522_SOLLC/127-207V---------VVGSP.PTLP-CCS-------LIQGLAN................LEV--AACLCT--AIRANILGL....
F2E1T8_HORVD/29-111S---------G..TS.PSAG-CCS-------GVKRLAGLAR..........STADKQ--ATCRCL--KSVAGA.......
Q96232_ASPOF/101-182I---------GLGDP.VVNQ-CCP-------LIEGLVE................IEA--AVCLCT--TIRLKLLNI....
Q9S7U3_ARATH/46-128I---------QLGTP.PVKP-CCS-------LLNGLVD................LEA--AACLCT--ALKAKVLGI....
Q9SA59_ARATH/25-103.---------.....SPSWS-CCR-------QFSTVV.................QSS--PECLCS--VVNSNESSFY...
Q9SBW9_MAIZE/43-101.---------.....DPSAD-CCS-------ALSAV....................S--HECACS--TMG..........
Q9SC06_TRIMO/34-125C---------....EEVQNQ-CCQ-------QLRQT....................T--PRCRCK--AIWTSIQGDLSGF
Q9SDS2_CAPAN/27-110.---------....SGPLGR-CCG-------GVKGLLGAAK..........TPADRK--TVCSCL--KSAAGSIG.....
Q9SDS4_CAPAN/19-102.---------.....GPLGR-CCG-------VIKDLLKLCK..........TPHERR--KSCKCV--KTAANTIK.....
F2CY84_HORVD/32-117G---------....GTPARG-CCA-------GIQNLLAEAN..........NSPDRR--TICGCL--KNVANAAP.....
Q9SET1_ARATH/222-304I---------GLGKSHAKAE-CCP-------VLGGLLD................LDA--AVCLCT--TIKLKLLNI....
Q9SHA0_ARATH/27-109.---------.....KVPPV-CCA-------KVGALI.................RTN--PRCLCA--VMLSPLAKK....
Q9SI70_ARATH/29-101T---------....TTPVKE-CCD-------SIKEAV.................EKE--LTCLCT--IYTSPGLLA....
Q9SKI0_ARATH/208-289I---------GLGDP.AVNK-CCP-------LLKGLVE................VEA--AACLCT--TLKLKALDL....
Q9SRS1_ARATH/32-105F---------S.TLP.PNGL-CCA-------AIKTL....................G--QPCLCV--LAKGPPIV.....
Q9ST25_MAIZE/51-132G---------EAGKV.PAEP-CCT-------LIKGLAD................FEA--AVCLCT--AIKANVLGV....
Q9STH5_ARATH/42-113.---------....P.PSQE-CCT-------AVETAL.................TTQ--LSCLCG--FIKSPMLLI....
Q9SU32_ARATH/34-115L---------KLGAP.AMRP-CCS-------ILFGLID................LDV--AVCLCT--ALKLSLLGI....
Q9SUV8_ARATH/28-104.---------.....QTVRP-CCT-------LVDGLDA................YVA--SVCICD--SIKIYGIS.....
Q9SUW7_ARATH/37-117L---------ILINNQSVLP-CCT-------LVTGLDA................ATA--SACICN--AVRITIFN.....
Q9SUX0_ARATH/37-116V---------TAGDP.RARQ-CCT-------ALNGLTN................VQV--TDCLCF--IFRPIPLV.....
Q9SUX3_ARATH/50-132L---------TPGTP.PVTP-CCS-------LIEGLVD................LEA--AICLCT--ALKASVLGI....
Q9SUZ2_ARATH/48-121F---------S.PIP.PTEI-CCS-------AVVTL....................G--RPCLCL--LANGPPLS.....
SCA_LILLO/25-109G---------....GVIPPG-CCA-------GVRTLNNLAK..........TTPDRQ--TACNCL--KSLVNPSL.....
Q9SXE7_ARATH/212-293I---------GLGNP.VENV-CCP-------VLQGLLE................LEA--AVCLCT--TIRLKLLNL....
Q9XF30_ORYSI/41-111F---------G..GP.VPPA-CCA-------QLR.....................AQ--AACLCA--YARSPNYG.....
NLTP5_ARATH/29-114G---------...GF.IPRG-CCS-------GVQRLNSLAR..........TTRDRQ--QACRCI--QGAARALG.....
2SS1_SESIN/54-141.---------......HFRE-CCN-------ELRDV....................K--SHCRCE--ALRCMMRQMQQEY
NLTP8_ARATH/28-112.---------.....NPPET-CCD-------GVKSLAAATT..........TSADKK--AACQCI--KSVANSV......
NLTL2_ARATH/27-105V---------....VKPEGT-CCS-------GLKTVV.................RTG--PECLCE--AFKNSGSLG....
Q9ZSL7_BRANA/27-108K---------G..GP.VPAP-CCA-------GVSKLNSMAK..........TTPDRQ--QACKCL--KTAAKN.......
Q9ZTW2_FRAAN/73-155V---------TIGTP.PVQP-CCT-------LIQGLAD................LEA--AVCLCT--AIRASILGI....
NLTP7_ARATH/29-118G---------G..ITSPGPQ-CCN-------GVRKLNGMVL..........TTLDRR--QACRCI--KNAARNVG.....
XYP11_ARATH/40-120E---------....IKPEAA-CCP-------ELAGMV.................QSS--PECVCN--LYGGGASPRF...
YY1_ORYSJ/31-94P---------GQPLPAPPAE-CCS-------ALGAV....................S--HDCACG--TLD..........
ZEB2_MAIZE/86-172.---------.....ALQQQ-CCH-------QIRQV....................E--PLHRYQ--ATYGVVLQSFLQQ
ZM33_MAIZE/45-108G---------QVPPA.PGPE-CCS-------ALGAV....................S--RDCACG--TFS..........

PF05617

M4FC94_BRARP/72-146N.E.P...........VSRE.CCM-------KVVSA-------------------.G--KECYLE..ISKL.M-------
B9S177_RICCO/41-104N.GETH..........LGHG.CCQ-------AIRTI-------------------.S--EQCWPN..LIDTLG-------
U5FMS5_POPTR/61-132E.K.S...........LDYD.TCS-------E.VTG-------------------SG--KECNDA..LVKY.V-------
M1BC58_SOLTU/78-151G.KYSD..........VE.E.CCA-------QLLAL-------------------.G--IKCHNA..IMES.T-------
M4FCA2_BRARP/71-146N.K.P...........VSRD.CCL-------MVVRA-------------------.G--KECYMK..IRKF.M-------
M4F146_BRARP/69-143G.KPV...........LLAE.CCG-------ELLRI-------------------.G--KDCYLG..TVQV.I-------
M4FC93_BRARP/72-147N.K.P...........ISRE.CCQ-------KVVKA-------------------.G--KECYME..IRKL.M-------
EC12_ARATH/45-109N.GETK..........LGVD.CCQ-------AVEVI-------------------.T--TDCWPA..MLTSLG-------
M4FC76_BRARP/105-178T.TTQ...........LTNE.CCL-------ILLKI-------------------.G--KDCQLG..VAHI.I-------
D7LVH8_ARALL/44-116H.GP............LKQHGCCL-------EVYHM-------------------.G--RVCLNI..VTKH.V-------
M4F8U3_BRARP/34-96G.QIGS..........IGHS.CCH-------AFLGI-------------------.S--TECASH..VFVFAP-------
K4CB92_SOLLC/64-137N.E..D..........IDKK.CCH-------DLVGM-------------------.G--LKCYKT..LIKV.Y-------
B9SN88_RICCO/61-124L.KF.N..........VDAK.CCQ-------SIQQV-------------------.I--DDCVSA..IFGNFD-------
B9SVP5_RICCO/53-119N.GQTDIT........IGAD.CCS-------AISII-------------------.A--HNCWPS..MLTSLG-------
B9GGT7_POPTR/48-111N.GETY..........LRPS.CCH-------AIRII-------------------.G--HHCWPS..MLASLG-------
I1I7L3_BRADI/74-140D.LAVR..........VSRV.CCG-------ILHKV-------------------.G--DRCIRG..LFPASP-------
K7KX58_SOYBN/72-144K.N.N...........VTDC.CCG-------RLVET-------------------.G--LPCHIN..MAKA.L-------
K7KX56_SOYBN/72-143G.R.............ITKP.CCQ-------ELVKN-------------------.G--LQCHTA..MVKS.L-------
K7MQC1_SOYBN/160-232R.G.T...........ISKD.CCK-------NVVTD-------------------VG--KTCYDN..MTKY.V-------
M0TQL0_MUSAM/66-131N.GETY..........LGPS.CCR-------AIRVI-------------------.V--HHCWAAEVMLAALG-------
EC11_ARATH/57-120N.GETY..........IGPG.CCS-------AIRTI-------------------.G--RKCWPT..MIGVLG-------
B9T247_RICCO/77-140H.NI.N..........LDAS.CCS-------VVDAI-------------------.K--QDCVSP..IFAHFS-------
M4FC95_BRARP/79-152N.E.H...........VSRE.CCL-------KVVRA-------------------.G--KQCFIE..TNKL.M-------
D7KC93_ARALL/38-103G.T.............LIES.CCH-------DLVQE-------------------.G--KVCHDN..LIKY.I-------
M4EKA3_BRARP/43-105G.KFGN..........VGVA.CCK-------AFSTI-------------------.D--ANCWPH..MFPLNP-------
D7MTL8_ARALL/141-203R.KFDN..........VGPM.CCK-------ALSAM-------------------.D--AKCWPQ..MFPLNP-------
C5YSL3_SORBI/84-148N.GESY..........IGPE.CCV-------AIRGA-------------------.T--RYCWPA..MLASVG-------
A8MS74_ARATH/69-143N.K.S...........FSKD.CCR-------VLVKG-------------------.G--RKCYTE..WMKM.F-------
U5GVU7_POPTR/48-112N.GETQ..........LGRS.CCQ-------ALRTI-------------------.G--EHCWPN..MIDTLG-------
Q6ZKQ3_ORYSJ/79-152S.LLLHDGERHPWGVHVGAP.CCG-------VLQTV-------------------.G--DRCFRD..LLTDSP-------
K7LY71_SOYBN/49-122N.K.T...........VSNG.CCD-------KLVND-------------------VG--KVCHDD..MTKY.I-------
B9SXP3_RICCO/41-109..EHSSTTVSSPEMAKLISP.CCQ-------VVNKI-------------------.N--MDCWPY..LLPSK.-------
K7KW29_SOYBN/52-115N.GKTY..........LGHG.CCQ-------AIRVI-------------------.G--HDCWPN..IVASLG-------
B9HRY2_POPTR/41-112K...P...........VTLE.CCQ-------KLLLM-------------------.G--KACDDA..LMRV.V-------
M4DW18_BRARP/37-99G.EFGT..........IGHS.CCH-------AFLGL-------------------.S--ADCITE..RFAFAP-------
M4DVD8_BRARP/72-146N.E.P...........MSRE.CCL-------MVLHN-------------------.G--EGCNML..FAKF.S-------
B9RBY2_RICCO/99-162G.QVSE..........IGNA.CCH-------AILAI-------------------.Q--DNCWPQ..MFPLPP-------
B9P5Y5_POPTR/32-100T.GRIA..........IGPA.CCK-------VINEL-------------------.T--DVCWAR..LFPSIP-------
B9GU63_POPTR/46-117N.N.N...........PSDS.CCQ-------KLVAT-------------------.G--IDCHNA..FTEFLE-------
M4FC77_BRARP/64-140T.TTP...........LTIG.CCR-------NLLKI-------------------.G--RDCHLV..VAKFES-------
Q8S8C9_ARATH/73-145N.K.S...........ASRD.CCL-------GIVKA-------------------.G--KECHME..YMKL.F-------
B9SN89_RICCO/73-136N.KV.N..........LDAK.CCQ-------SVQQI-------------------.V--DDCISA..IFGHFD-------
Q3EBD9_ARATH/70-142N.I.P...........TSRY.CCL-------KMIIY-------------------.G--QECHMV..LRNL.L-------
D7MVA2_ARALL/48-118KNL.............VTDE.CCR-------DILKI-------------------.G--KDCHLG..LIKI.I-------
B9SVP8_RICCO/47-111N.GHTD..........IGAD.CCR-------SIAIF-------------------.T--HNCWPA..MLTSIG-------
W5I1G9_WHEAT/44-110N.GEAY..........LGPG.CCR-------AIRVI-------------------.E--QRCWAADLMLSVIG-------
U5DGU8_AMBTC/38-101T.GKNY..........PGVD.CCE-------AVLSV-------------------.G--EQCWAS..FSVPGR-------
D7MSB1_ARALL/48-110G.KFEN..........VEAA.CCK-------AFLTL-------------------.D--TNCWPQ..MFPLNP-------
D7LBY0_ARALL/72-145N.K.S...........VSRD.CCR-------GIVRA-------------------.G--KECHTE..WMRL.F-------
Q9LXX9_ARATH/44-121H.GPMR..........LKHHGCCL-------EVFHM-------------------.G--RACLKI..VTNH.V-------
A7REG6_ARATH/64-136T.T.P...........VTNE.CCH-------DILKT-------------------.G--KDCHLA..LVKI.I-------
B9HQH8_POPTR/62-126Q.KNL...........VGPK.CCS-------ALAVI-------------------.D--DKCKPK..GFSFDP-------
M4F9M9_BRARP/52-124N.GTAEPGVTGG....IDKD.CCG-------AIGLI-------------------.G--KECWSV..MFTSLG-------
K7N3Y2_SOYBN/45-109N.GETY..........LGPS.CCQ-------AIRIV-------------------.G--HDCWPD..MIASLG-------
M4FC77_BRARP/213-288T.TTP...........LPIE.CCR-------YLLKI-------------------.G--RDCHLV..VAKYET-------
M4CIW6_BRARP/37-108G.V.............VSIP.CCK-------ELVQE-------------------.G--KECHDT..LVKY.I-------
B9SE79_RICCO/48-112N.GETY..........LGHS.CCE-------AIRII-------------------.T--KQCWPT..MIDTLG-------
K7KX55_SOYBN/121-191K.N.............ITRH.CCK-------ELVKM-------------------.G--KPCHDD..MVKA.L-------
K4D4G7_SOLLC/44-108I.GTID..........IDLP.CCQ-------AIFVI-------------------.T--HHCWPS..MLTTLG-------
B9GGU6_POPTR/50-114T.GQAD..........IGPD.CCR-------AIHTI-------------------.T--HNCWPA..MFTSLG-------
U7DW65_POPTR/42-112N.N.T...........PSEY.CCQ-------KHITT-------------------.G--KACNND..FIKLFM-------
D7LQP6_ARALL/70-141T.M.P...........MTDE.CCR-------DVLNT-------------------.G--KDCHLA..MVKI.I-------
A8MQ83_ARATH/72-148N.K.S...........VSRV.CCW-------GIVKA-------------------.G--KECHKK..WTGL.F-------
M4F142_BRARP/86-160A.AQV...........LSNE.CCH-------DLLKI-------------------.S--KDCYLG..MTQS.I-------
D7MQQ8_ARALL/38-109G.T.............ISDP.CCN-------DLVKE-------------------.G--KMCHDT..LIKY.I-------
U5GKZ5_POPTR/42-112N.K.T...........PSEY.CCQ-------KHITT-------------------.G--KACNDD..FIKLFI-------
I1IN82_BRADI/69-133N.GQSY..........LGRP.CCL-------AIRTV-------------------.T--AHCWPA..MLDAVG-------
K4C587_SOLLC/77-151G.KPTD..........VD.E.CCG-------QLLTL-------------------.G--KKCHHT..IIES.T-------
Q3ECV9_ARATH/81-154M.M.P...........IINE.CCR-------EILKM-------------------.G--KDCHFR..LVEG.W-------
W1PLV8_AMBTC/49-113N.GETY..........LGKD.CCR-------GVRVI-------------------.T--RHCWPS..MLTSVG-------
K4D4G3_SOLLC/55-119N.GETY..........LGQD.CCS-------AIRII-------------------.E--RQCWPS..MLDSLG-------
B9IKH4_POPTR/49-122K.R.............IPNK.CCP-------EVTKF-------------------.S--KICYHA..LGLF.V-------
A5AZZ7_VITVI/45-108N.GQTV..........LGPE.CCQ-------AISII-------------------.T--RNCWPA..MLTSLG-------
M0ZZI9_SOLTU/49-111T.QLRL..........IGPQ.CCK-------AVLDI-------------------.H--DSCWPK..IFPF..-------
K7KX59_SOYBN/86-158K.I.N...........VTKH.CCE-------KLVKM-------------------.G--ESCHIN..MAKA.L-------
I1K1Y8_SOYBN/51-124N.Q.T...........VTNR.CCL-------SLLND-------------------MG--KACHTD..VTKY.A-------
D7MTL8_ARALL/48-110G.KFEN..........VGPT.CCK-------AFTEL-------------------.D--AKCWPK..IFPLNP-------
I1QJT2_ORYGL/79-143APR.............LSGE.CCT-------VLARA-------------------.G--DKCVAG..VFSGLP-------
U5DBS7_AMBTC/38-100GSN.............PEHE.CCD-------AVLKI-------------------.G--VECIAN..LLIVGG-------
EC14_ARATH/47-111N.GETK..........LGVS.CCE-------SVDII-------------------.T--TNCWPA..MLTSLG-------
K7KX55_SOYBN/32-108FEEPI...........VSTN.CCY-------KLIQT-------------------.G--YQCHTR..LTQYFL-------
Q9LUB3_ARATH/33-97G.QFGN..........VGPS.CCH-------AFIGL-------------------.D--TECIPQ..MFIFAP-------
I1QY08_ORYGL/55-119N.GESY..........LGPD.CCV-------AIRTV-------------------.T--RRCWPA..MLASIG-------
K7L6R0_SOYBN/36-100N.GQAD..........IGPN.CCC-------AIRVI-------------------.T--HDCWPE..MLTSLG-------
M0TA67_MUSAM/60-124N.GESY..........LGLD.CCR-------AIRVI-------------------.T--RHCWTS..MLTTLG-------
M1ASC9_SOLTU/60-130K.N.............ITSN.CCN-------ELVQS-------------------.G--LECHAT..LVKL.L-------
W5I3U0_WHEAT/51-117N.GEAY..........LGPG.CCR-------AIRAI-------------------.E--QRCWAADAMLSVIG-------
M4DW17_BRARP/37-100G.EIGT..........VSHS.CCH-------AFLGL-------------------.S--ADCITE..RFDFTP-------
Q9C924_ARATH/63-134K...P...........VSED.CCV-------NFLKI-------------------.G--RECHEG..LMTF.V-------
M4EJU1_BRARP/45-107G.KFEN..........VGPA.CCK-------AFTDV-------------------.D--AKCWPT..MFPLNP-------
D7LL48_ARALL/69-143N.K.S...........TSRD.CCL-------MIVKA-------------------.G--KQCHTE..LMKL.F-------
Q3ECV8_ARATH/86-158T.V.P...........ITDE.CCR-------DILKI-------------------.G--KDCHLG..LVKL.I-------
Q9FYN3_ARATH/84-147R.KPA...........IGLD.CCA-------SIQKM-------------------.D--EDCDKT..VFGAYH-------
U5GF05_POPTR/42-112D.K.T...........ASEY.CCQ-------KHVTT-------------------.G--KACHDD..FIKLFI-------

PF14368

Q1G3I0_ARATH/16-107-------------------------------------------------------------------....AVS.NIT.G
Q3ECK0_ARATH/8-101-------------------------------------------------------------------..LLAQF.NVT.T
B9RBQ4_RICCO/7-100-------------------------------------------------------------------..LLESF.KVN.V
Q9LE56_ARATH/14-113-------------------------------------------------------------------..MLKSL.NLT.K
Q0D9K5_ORYSJ/20-116-------------------------------------------------------------------..ALQAF.GVA.P
Q9SUV6_ARATH/10-114-------------------------------------------------------------------....DPL.....Y
C5Z9F1_SORBI/22-116-------------------------------------------------------------------..ALQAF.GVA.P
C5XVS1_SORBI/14-118-------------------------------------------------------------------..LLATF.NVT.K
C3SA92_BRADI/13-112-------------------------------------------------------------------....VQL.PVN.M
Q9LJ85_ARATH/13-108-------------------------------------------------------------------...PFNI.PIN.R
Q7XIG9_ORYSJ/15-115-------------------------------------------------------------------....FGI.KIN.Y
C5X2J9_SORBI/14-111-------------------------------------------------------------------....YGI.QVN.L
A9S0T9_PHYPA/9-107-------------------------------------------------------------------...AVAL.KIN.L
C5Y597_SORBI/23-118-------------------------------------------------------------------.GRATGY.DVD.V
B9RIH6_RICCO/12-107-------------------------------------------------------------------....EDM..ID.M
B9RIH3_RICCO/10-107-------------------------------------------------------------------....EKI..VS.M
A9TY60_PHYPA/11-108-------------------------------------------------------------------..NSTLT.GVN.S
B9HP13_POPTR/12-110-------------------------------------------------------------------....QKV..FS.M
C5XAF7_SORBI/6-114-------------------------------------------------------------------PALGGGV.PVN.R
A9T6D1_PHYPA/9-104-------------------------------------------------------------------....QQS.GAK.V
B9HP10_POPTR/10-105-------------------------------------------------------------------....E.A.MIS.M
B9RTN3_RICCO/10-113-------------------------------------------------------------------..LIFGF.PLN.Q
B9RIH4_RICCO/10-105-------------------------------------------------------------------....EDL..IS.M
B9RZC4_RICCO/7-99-------------------------------------------------------------------..LLSSY.KID.P
A9SQH6_PHYPA/103-196-------------------------------------------------------------------....ALYPTSN.A
B9SEE9_RICCO/14-106-------------------------------------------------------------------....ASL..IN.V
C5WP26_SORBI/30-121-------------------------------------------------------------------.....DL.DID.L
B9SEE8_RICCO/14-105-------------------------------------------------------------------....AAL..ID.V
C5WP25_SORBI/18-110-------------------------------------------------------------------.....LD.DIN.L
A9SQH9_PHYPA/117-210-------------------------------------------------------------------...ASNP.TLN.A
B9GVR5_POPTR/18-112-------------------------------------------------------------------..LFPSL.GIN.V
B9H8A8_POPTR/14-108-------------------------------------------------------------------...PLQL.PIN.R
B9HUT8_POPTR/13-107-------------------------------------------------------------------...IFGF.PLD.E
D7T8D6_VITVI/12-114-------------------------------------------------------------------...AKKA.GIK.P
I1PAV8_ORYGL/35-130-------------------------------------------------------------------...AYGV.RVD.A
I1QT58_ORYGL/18-119-------------------------------------------------------------------..DTRQV.GSNAL
I1R180_ORYGL/22-119-------------------------------------------------------------------..RSTGY.DVN.V
Q1G2Y5_ARATH/16-109-------------------------------------------------------------------...PISI.PIN.R
Q2R222_ORYSJ/12-114-------------------------------------------------------------------..RAIGV.DIP.V
Q75GY5_ORYSJ/27-127-------------------------------------------------------------------...SPLA.PVL.G
Q8S077_ORYSJ/23-111-------------------------------------------------------------------....VMG.NID.A
Q9SUV7_ARATH/19-112-------------------------------------------------------------------....SNG.NIS.Q
U5G1T3_POPTR/18-113-------------------------------------------------------------------...PFSI.PIN.R
U5GQ18_POPTR/24-115-------------------------------------------------------------------....AAL..ID.L

PF14547

F2DU32_HORVD/35-120-----------------------------------------------------------------------IG.IPIN-L
D7ME35_ARALL/36-114-----------------------------------------------------------------------LNILTIT-L
A8MRQ5_ARATH/577-656-----------------------------------------------------------------------STLSP..-.
D7ME37_ARALL/85-164-----------------------------------------------------------------------GSLPP..-.
D7ME34_ARALL/31-113-----------------------------------------------------------------------FNFLTIN-L
D7ME36_ARALL/7-89-----------------------------------------------------------------------LNLLGIT-I
D7MAX1_ARALL/157-241-----------------------------------------------------------------------LN.IDLI-I
Q7XTE3_ORYSJ/6-89-----------------------------------------------------------------------LG.IPTE-W
B9S3J8_RICCO/215-298-----------------------------------------------------------------------LN.LNII-I
D7ME38_ARALL/36-117-----------------------------------------------------------------------...LPLV-F
C5Z4Z5_SORBI/237-320-----------------------------------------------------------------------LN.INIY-L
C5Y909_SORBI/46-127-----------------------------------------------------------------------LG.IPTE-W
F4JLV4_ARATH/297-375-----------------------------------------------------------------------FSLSP..-.
I1QBL2_ORYGL/229-307-----------------------------------------------------------------------RVNVDVD-I
M4F7Y5_BRARP/170-253-----------------------------------------------------------------------LN.LKLY-V
Q9SU32_ARATH/33-116-----------------------------------------------------------------------LG.ITID-T
W4ZSZ5_WHEAT/138-222-----------------------------------------------------------------------LG.IHIN-L
W5AJU0_WHEAT/30-113-----------------------------------------------------------------------LG.LNLH-L
W5AP16_WHEAT/30-114-----------------------------------------------------------------------LGLVSAE-W

PF13016

Q5Z9M9_ORYSJ/30-100-------------------------------------------------------------------------------C
Q0D7V8_ORYSJ/32-104-------------------------------------------------------------------------------C
AVLBB_WHEAT/153-224-------------------------------------------------------------------------------C
D2KFG9_WHEAT/47-117-------------------------------------------------------------------------------C
I1I1L7_BRADI/190-267-------------------------------------------------------------------------------C
M8A4Q2_TRIUA/135-215-------------------------------------------------------------------------------C
GDBB_WHEAT/132-208-------------------------------------------------------------------------------C
GLTA_WHEAT/180-256-------------------------------------------------------------------------------C
W5D734_WHEAT/36-109-------------------------------------------------------------------------------C

PF00234

IAA2_WHEAT/37-143GVR...............................................EGK.E.............VLPGCRKEVM-K
PRO28_ORYSJ/47-143RLQQFA..........................................SVYFD.QS............QAQAQAM...-.
RAG1_ORYSJ/39-150GATEA............................................GHPM.AE............VFPGCRRGDL-E
NLTP1_ORYSI/28-112...........................................................................GLN-A
NLTP4_ORYSJ/30-115...........................................................................GLR-P
B7E7J9_ORYSJ/30-95..........................................................................RYVN-S
NLTP3_ORYSI/32-117...........................................................................NLN-M
A9_ARATH/27-87..............................................................................-.
108_SOLLC/35-99..............................................................................-.
14KD_DAUCA/54-136..........................................................................NLNL-P
2SS1_ARATH/59-153Q....................................................................HQPMQVRKI-Y
2SS1_BRANA/16-122QQQ...............................................EQQ.Q..............GKQQMVNRI-Y
2SS2_ARATH/58-158Q....................................................................HGPFQSRKI-Y
2SS5_HELAN/53-148QQQQG............................................RQLV.P.............FRGSQQTQQL-K
2SS5_HELAN/190-290QQQQ.............................................QQRR.G.............QFGGQEMETA-R
2SS8_HELAN/49-139.......................................................................IRMRDQV-M
2SSE_BRANA/60-174RQQQG............................................QQMQ.G.............QQMQQVISRV-Y
2SSL_PICGL/52-156SFMDSDSQ.....................................EDAPLNQR.RRR..........REGRGREEEEA-M
2SS1_BEREX/40-137M...................................................Q................PRGEQMRRM-M
B9SA35_RICCO/61-155Q....................................................................LHGEESERV-A
B9SA35_RICCO/162-256Q....................................................................LQGQDVFEA-F
2SS_SOYBN/43-152......................................................................EEKQKKKM-E
M4CYI5_BRARP/32-92..............................................................................-.
A6N9I7_ALLCE/31-116..........................................................................GLRR-N
AVE3_AVESA/69-210QQFFQPQMQQQFFQPQMQQV..............TQGIFQPQMQQVTQGIFQP.QLQQVTQ..GIFQPQMQGQIEGMR-A
CCDP_MAIZE/48-127..........................................................................HLNV-P
FIL1_ANTMA/31-90..............................................................................-.
GDA0_WHEAT/146-275QQKQQQQPSSQVSFQQP....................LQQYPLGQGSFRPSQQ.NPQAQG....SVQPQQLPQFEEIR-N
GDA2_WHEAT/143-280QHHHHQQQQQQQQQQPLSQV..............SFQQPQQQYPSGQGFFQPS.QQNPQAQ..GSFQPQQLPQFEEIR-N
GDA5_WHEAT/152-306QQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIR-N
GDA6_WHEAT/155-283QQRQQQPSSQVSLQQPQ....................QQYPSGQGFFQPSQQN.PQAQG.....SVQPQQLPQFEEIR-N
GDA8_WHEAT/46-175QQQKQQQQPSSQFSFQQ....................PLQQYPLGQGSFRPSQ.QNPQAQ....GSVQPQQLPQFEIR-N
GDB1_WHEAT/134-288QQQGFVQPQQQQPQQSGQGVSQSQ.....QQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVT-S
GDB2_WHEAT/184-310QQQQQQQQGIDIFL.........................PLSQHEQVGQGSLV.QGQGI......IQPQQPAQLEAIR-S
GDB3_WHEAT/87-228QQQVQGSIQSQQQQPQQLGQ..............CVSQPQQQSQQQLGQQPQQ.QQLAQG...TFLQPHQIAQLEVMT-S
B6UKL2_TRITU/171-285EQQQGVPILR..................................PLFQLAQGL.GII.........QPQQPAQLEGIR-S
A2Y665_ORYSI/48-178PMPLEQGWSSSSSEYYGG..................EGSSSEQGYYGEGSSEE.GYYGEQ....QQQPGMTRVRLTRA-R
D2DII3_WHEAT/197-341QQQQQQQQQQQQGQSIIQYQ.............QQQPQQLGQCVSQPLQQLQQ.QLGQQPQ..QQQLAHQIAQLEVMT-S
GLU2_MAIZE/128-213QP..................................................Q................SGQVAGLLA-A
HOG1_HORVU/166-288GQRQGVQIVQQQP............................QPQQVGQCVLVQ.GQGV.......VQPQQLAQMEAIR-T
HOG3_HORVU/142-276QVQQQVGHGFVQSQL........................QQLGQGMPIQLQQQ.PGQAF......VLPQQQAQFKVVG-S
HOR1_HORVU/143-282QPQQLVEGVSQPQQQLWPQ................QVGQCSFQQPQPQQVGQQ.QQVPQS...AFLQPHQIAQLEATT-S
HPSE_SOYBN/8-77...........................................................................LNL-N
IAAC1_WHEAT/30-140SSV...............................................LKD.L.............PGCPREPQRD-F
IAAC3_WHEAT/43-159PVDPRSG.......................................NVGESGL.ID...........LPGCPREMQWD-F
IAC16_WHEAT/30-134QSG...............................................LME.L.............PGCPREVQMD-F
IAA1_HORVU/20-131GVALAD..........................................DKATV.AE............VFPGCRTEVM-D
IAA1_WHEAT/6-115GAQEG............................................QAGT.G.............AFPRCRREVV-K
IAA2_HORVU/37-144GVGG..............................................GPE.E.............VFPGCQKDVM-K
IAA4_SORBI/7-111QD.................................................FR.G..............CTREMQRIY-A
IAA5_SORBI/4-106EM..................................................R.P..............TCSWGGLLT-F
IAAA_HORVU/30-140WSV...............................................LKD.L.............PGCPKEPQRD-F
IAAE_HORVU/29-137GAFEG............................................AYFK.DS............PNCPRERQTS-Y
IAAT_ELECO/6-114GQHEG............................................RLLQ.DL............PGCPRQVQRA-F
B6UHB4_MAIZE/34-143PDAQL...........................................EGRLE.DL............PGCPREVQRG-F
LIM1_LILLO/29-88..............................................................................-.
MC1_PINRA/28-88..............................................................................-.
MEN8_SILLA/38-98..............................................................................-.
NLT11_PARJU/4-91...........................................................................DID-G
NLT21_PARJU/35-121...........................................................................GIK-N
F2DCX3_HORVD/29-111............................................................................LN-A
NLTP1_ARATH/29-114..........................................................................SGLN-A
NLTP1_BRANA/29-113...........................................................................TLN-A
A8YPK3_HORVU/29-113...........................................................................NLN-L
NLTP2_SOLLC/27-110...........................................................................GID-T
NLTP1_PRUAR/3-87...........................................................................GVN-P
NLTP1_TOBAC/27-110...........................................................................GIN-L
NLTP2_HORVU/37-102..........................................................................HYVS-S
NLTP3_HORVU/29-114...........................................................................GIN-M
B6CQU4_9ROSA/33-119..........................................................................TNAN-A
NLTPA_BRAOT/29-114..........................................................................PNLN-A
NLTPA_RICCO/3-88...........................................................................TIK-Q
NLTP1_WHEAT/26-110...........................................................................NLN-E
NLTPB_RICCO/3-88...........................................................................NIR-E
NLTPC_RICCO/28-112...........................................................................GIK-D
NLTP_AMACA/4-90...........................................................................SLN-Y
NLTP_BETVU/29-113...........................................................................GIN-Y
NLTP_CICAR/27-111...........................................................................RLN-A
NLTP_DAUCA/30-116...........................................................................GLN-L
NLTP_ELECO/4-90..........................................................................SGLN-A
NLTP_GERHY/28-112...........................................................................RIN-L
NLTP_HELAN/28-112...........................................................................GVN-A
NLTP_PINTA/34-119...........................................................................GVK-L
NLTP_SPIOL/30-113...........................................................................GIN-Y
NLTP_STRHE/10-89...........................................................................RVQ-D
NLTP_VIGUN/34-99..........................................................................QYVN-S
NLTP6_AMBAR/30-113...........................................................................AYD-P
O22110_PICAB/25-104..........................................................................LGVN-V
O22272_ARATH/48-125..........................................................................IELN-S
NLTP2_SOLPN/27-110...........................................................................GLD-L
O24101_MEDTR/31-102...........................................................................GIN-A
O24355_SILLA/25-110...........................................................................QYQ-P
O24440_PHAVU/29-112...........................................................................GFN-A
O24485_PINRA/36-122...........................................................................NLN-D
O24486_PINRA/39-97..............................................................................-.
O49116_ARATH/29-125..........................................................................LPFL-P
O49178_ORYSA/42-149GAPDV............................................GHPM.S.............EVFRGCRRGT-W
O49644_ARATH/39-110..........................................................................SDLS-R
O64431_BRACM/21-86..........................................................................QYIS-S
YLS3_ARATH/36-113.........................................................................GLQVN-V
O65368_ARATH/32-112..........................................................................NIDL-P
O65369_ARATH/55-137..........................................................................NLNL-P
O65561_ARATH/29-103...........................................................................MID-M
O81135_HORVU/27-92..........................................................................YITS-P
O81410_PICGL/53-146DSQDGA..........................................PLNQR.RG............QGRGMEEEEV-L
O81872_ARATH/32-107...........................................................................YID-M
O82439_ARATH/25-107.........................................................................VNINL-P
NLTP2_PRUAR/3-68..........................................................................QYVN-S
F2D8V2_HORVD/31-96..........................................................................QYVD-S
P93198_9ROSI/39-132G....................................................................LRGEEMEEM-V
P93274_MALDO/2-73..........................................................................INLI-I
P93513_9POAL/63-154K...................................................G................LQQGLKART-V
P93611_WHEAT/84-166..........................................................................NLVL-P
P93705_DAUCA/264-345..........................................................................INIA-L
P93794_WHEAT/195-344QQQQQQQQQQGQSIIQYQQQQP.........QQLGQCVSQPQQQLQQQLGQQP.QQQQLAH.GTFLQPHQIAQLEVMT-S
PRF1_SOLLC/261-343..........................................................................NIIL-P
PROA_ORYSI/43-134.....................................................................CAGLGQQQM-M
PRO25_ORYSJ/47-143LQQ...............................................FSG.V.............YFDQTQAQAQ-T
J7FK20_9POAL/48-138F...................................................G................FQRDRASKV-I
B6Z278_WHEAT/50-140L...................................................G................IWRGEVFKQ-L
Q00318_COILA/103-188P....................................................................IGQPLALMA-A
Q06763_SOYBN/68-149..........................................................................LNIY-V
Q09071_AVESA/48-166QQQQLVQAQQM...............................GLVQPQTQMAG.QVFI........QPQQLSQYQTMK-V
Q09072_AVESA/74-212QQQQQQFIQPQLQQQVFQP................QLQLQQQVFQPQLQQQVF.QPQLQQ...VFNQPQMQGQIEGMR-A
Q39100_ARATH/48-126..........................................................................NLNV-P
ERLI1_ARATH/85-167..........................................................................NLNV-P
Q39332_BRANA/28-112...........................................................................GLN-I
Q39574_CATRO/55-137..........................................................................NLNV-P
2SS_CUCMA/55-139......................................................................RGQEGRQM-L
Q39787_GOSHI/36-131QE..................................................Q.M..............GSKQMREIM-Q
Q39928_HELAN/52-143QQR...............................................PRV.P.............FQGSQQSQQL-K
Q40335_MEDSA/84-165..........................................................................NLNV-P
Q40453_TOBAC/25-114...........................................................................NVN-P
Q40654_ORYSJ/41-149RAADA............................................GHPM.AE............VFRGCRRGDI-E
A2X812_ORYSI/52-133..........................................................................NLNL-P
Q40997_PINST/58-160SSTDSDSQD...................................GAPLNQRRR.RPE..........GRGREEEEEEA-V
Q41125_PHAVU/45-126..........................................................................NLNV-P
Q41168_RAPSA/29-141RQQQG............................................QQGQ.QG............QQMQQAVSRI-Y
Q41320_SECCE/55-178EQREGVQILLPQS...........................HQQLVGQGALAQV.QGII.......QPQQLSQFNVGIV-L
Q41378_9ASTR/24-89..........................................................................QYIT-N
Q41543_WHEAT/137-262EQQEQRQGVQILVP..........................LSQQQQVGQGTLV.QGQGI......IQPQQPAQLEVIR-S
Q41848_MAIZE/215-296..........................................................................INIY-L
Q42044_ARATH/52-133..........................................................................NLNV-P
Q42158_ARATH/29-94..........................................................................QYVS-S
Q42392_ZINVI/30-95..........................................................................AYVS-S
Q42474_ORYSA/65-146..........................................................................NLNV-P
Q42487_POPNI/58-140..........................................................................NLNI-P
M0VYA0_HORVD/33-118...........................................................................AIN-M
Q43496_SOLLC/28-101...........................................................................GVD-R
Q43522_SOLLC/127-207..........................................................................NLNV-P
F2E1T8_HORVD/29-111............................................................................YN-A
Q96232_ASPOF/101-182..........................................................................NLYL-P
Q9S7U3_ARATH/46-128..........................................................................NLNV-P
Q9SA59_ARATH/25-103.........................................................................GFKFN-R
Q9SBW9_MAIZE/43-101..............................................................................-.
Q9SC06_TRIMO/34-125K...................................................G................LQQGLKAKT-V
Q9SDS2_CAPAN/27-110...........................................................................GIN-V
Q9SDS4_CAPAN/19-102...........................................................................GID-F
F2CY84_HORVD/32-117..........................................................................GGSE-I
Q9SET1_ARATH/222-304..........................................................................DLVL-P
Q9SHA0_ARATH/27-109..........................................................................AGIN-P
Q9SI70_ARATH/29-101.........................................................................QFNVT-T
Q9SKI0_ARATH/208-289..........................................................................NLYV-P
Q9SRS1_ARATH/32-105...........................................................................GVD-R
Q9ST25_MAIZE/51-132..........................................................................VIDV-P
Q9STH5_ARATH/42-113..........................................................................PFNV-T
Q9SU32_ARATH/34-115..........................................................................TIDT-P
Q9SUV8_ARATH/28-104...........................................................................YPF-T
Q9SUW7_ARATH/37-117..........................................................................FLTI-N
Q9SUX0_ARATH/37-116...........................................................................FGI-D
Q9SUX3_ARATH/50-132..........................................................................NLTL-P
Q9SUZ2_ARATH/48-121...........................................................................GID-R
SCA_LILLO/25-109...........................................................................GLN-A
Q9SXE7_ARATH/212-293..........................................................................NIFI-P
Q9XF30_ORYSI/41-111..........................................................................SYIR-S
NLTP5_ARATH/29-114..........................................................................SRLN-A
2SS1_SESIN/54-141.....................................................................GMEQEMQQM-Q
NLTP8_ARATH/28-112...........................................................................TVK-P
NLTL2_ARATH/27-105..........................................................................LTLD-L
Q9ZSL7_BRANA/27-108............................................................................VN-P
Q9ZTW2_FRAAN/73-155..........................................................................NLNI-P
NLTP7_ARATH/29-118..........................................................................PGLN-A
XYP11_ARATH/40-120.........................................................................GVKLD-K
YY1_ORYSJ/31-94..............................................................................-.
ZEB2_MAIZE/86-172Q...................................................P................QGELAALMA-A
ZM33_MAIZE/45-108..............................................................................-.

PF05617

M4FC94_BRARP/72-146-------------------------------------------------------------------------------F
B9S177_RICCO/41-104-------------------------------------------------------------------------------F
U5FMS5_POPTR/61-132-------------------------------------------------------------------------------A
M1BC58_SOLTU/78-151-------------------------------------------------------------------------------L
M4FCA2_BRARP/71-146-------------------------------------------------------------------------------F
M4F146_BRARP/69-143-------------------------------------------------------------------------------L
M4FC93_BRARP/72-147-------------------------------------------------------------------------------F
EC12_ARATH/45-109-------------------------------------------------------------------------------F
M4FC76_BRARP/105-178-------------------------------------------------------------------------------S
D7LVH8_ARALL/44-116-------------------------------------------------------------------------------I
M4F8U3_BRARP/34-96-------------------------------------------------------------------------------.
K4CB92_SOLLC/64-137-------------------------------------------------------------------------------I
B9SN88_RICCO/61-124-------------------------------------------------------------------------------N
B9SVP5_RICCO/53-119-------------------------------------------------------------------------------F
B9GGT7_POPTR/48-111-------------------------------------------------------------------------------F
I1I7L3_BRADI/74-140-------------------------------------------------------------------------------F
K7KX58_SOYBN/72-144-------------------------------------------------------------------------------I
K7KX56_SOYBN/72-143-------------------------------------------------------------------------------I
K7MQC1_SOYBN/160-232-------------------------------------------------------------------------------L
M0TQL0_MUSAM/66-131-------------------------------------------------------------------------------F
EC11_ARATH/57-120-------------------------------------------------------------------------------F
B9T247_RICCO/77-140-------------------------------------------------------------------------------N
M4FC95_BRARP/79-152-------------------------------------------------------------------------------F
D7KC93_ARALL/38-103-------------------------------------------------------------------------------A
M4EKA3_BRARP/43-105-------------------------------------------------------------------------------.
D7MTL8_ARALL/141-203-------------------------------------------------------------------------------.
C5YSL3_SORBI/84-148-------------------------------------------------------------------------------F
A8MS74_ARATH/69-143-------------------------------------------------------------------------------F
U5GVU7_POPTR/48-112-------------------------------------------------------------------------------F
Q6ZKQ3_ORYSJ/79-152-------------------------------------------------------------------------------F
K7LY71_SOYBN/49-122-------------------------------------------------------------------------------L
B9SXP3_RICCO/41-109-------------------------------------------------------------------------------.
K7KW29_SOYBN/52-115-------------------------------------------------------------------------------F
B9HRY2_POPTR/41-112-------------------------------------------------------------------------------L
M4DW18_BRARP/37-99-------------------------------------------------------------------------------.
M4DVD8_BRARP/72-146-------------------------------------------------------------------------------S
B9RBY2_RICCO/99-162-------------------------------------------------------------------------------.
B9P5Y5_POPTR/32-100-------------------------------------------------------------------------------A
B9GU63_POPTR/46-117-------------------------------------------------------------------------------S
M4FC77_BRARP/64-140-------------------------------------------------------------------------------V
Q8S8C9_ARATH/73-145-------------------------------------------------------------------------------F
B9SN89_RICCO/73-136-------------------------------------------------------------------------------N
Q3EBD9_ARATH/70-142-------------------------------------------------------------------------------F
D7MVA2_ARALL/48-118-------------------------------------------------------------------------------F
B9SVP8_RICCO/47-111-------------------------------------------------------------------------------F
W5I1G9_WHEAT/44-110-------------------------------------------------------------------------------F
U5DGU8_AMBTC/38-101-------------------------------------------------------------------------------L
D7MSB1_ARALL/48-110-------------------------------------------------------------------------------.
D7LBY0_ARALL/72-145-------------------------------------------------------------------------------F
Q9LXX9_ARATH/44-121-------------------------------------------------------------------------------I
A7REG6_ARATH/64-136-------------------------------------------------------------------------------F
B9HQH8_POPTR/62-126-------------------------------------------------------------------------------F
M4F9M9_BRARP/52-124-------------------------------------------------------------------------------L
K7N3Y2_SOYBN/45-109-------------------------------------------------------------------------------F
M4FC77_BRARP/213-288-------------------------------------------------------------------------------I
M4CIW6_BRARP/37-108-------------------------------------------------------------------------------A
B9SE79_RICCO/48-112-------------------------------------------------------------------------------F
K7KX55_SOYBN/121-191-------------------------------------------------------------------------------I
K4D4G7_SOLLC/44-108-------------------------------------------------------------------------------F
B9GGU6_POPTR/50-114-------------------------------------------------------------------------------F
U7DW65_POPTR/42-112-------------------------------------------------------------------------------S
D7LQP6_ARALL/70-141-------------------------------------------------------------------------------F
A8MQ83_ARATH/72-148-------------------------------------------------------------------------------F
M4F142_BRARP/86-160-------------------------------------------------------------------------------L
D7MQQ8_ARALL/38-109-------------------------------------------------------------------------------A
U5GKZ5_POPTR/42-112-------------------------------------------------------------------------------S
I1IN82_BRADI/69-133-------------------------------------------------------------------------------F
K4C587_SOLLC/77-151-------------------------------------------------------------------------------I
Q3ECV9_ARATH/81-154-------------------------------------------------------------------------------S
W1PLV8_AMBTC/49-113-------------------------------------------------------------------------------F
K4D4G3_SOLLC/55-119-------------------------------------------------------------------------------F
B9IKH4_POPTR/49-122-------------------------------------------------------------------------------A
A5AZZ7_VITVI/45-108-------------------------------------------------------------------------------F
M0ZZI9_SOLTU/49-111-------------------------------------------------------------------------------S
K7KX59_SOYBN/86-158-------------------------------------------------------------------------------I
I1K1Y8_SOYBN/51-124-------------------------------------------------------------------------------V
D7MTL8_ARALL/48-110-------------------------------------------------------------------------------.
I1QJT2_ORYGL/79-143-------------------------------------------------------------------------------S
U5DBS7_AMBTC/38-100-------------------------------------------------------------------------------I
EC14_ARATH/47-111-------------------------------------------------------------------------------F
K7KX55_SOYBN/32-108-------------------------------------------------------------------------------K
Q9LUB3_ARATH/33-97-------------------------------------------------------------------------------.
I1QY08_ORYGL/55-119-------------------------------------------------------------------------------F
K7L6R0_SOYBN/36-100-------------------------------------------------------------------------------Y
M0TA67_MUSAM/60-124-------------------------------------------------------------------------------F
M1ASC9_SOLTU/60-130-------------------------------------------------------------------------------I
W5I3U0_WHEAT/51-117-------------------------------------------------------------------------------F
M4DW17_BRARP/37-100-------------------------------------------------------------------------------.
Q9C924_ARATH/63-134-------------------------------------------------------------------------------F
M4EJU1_BRARP/45-107-------------------------------------------------------------------------------.
D7LL48_ARALL/69-143-------------------------------------------------------------------------------L
Q3ECV8_ARATH/86-158-------------------------------------------------------------------------------F
Q9FYN3_ARATH/84-147-------------------------------------------------------------------------------N
U5GF05_POPTR/42-112-------------------------------------------------------------------------------S

PF14368

Q1G3I0_ARATH/16-107PY--SKAIT.TKCGV------F.DKY.....SC-
Q3ECK0_ARATH/8-101EK--ALGLS.RRCNV------T.TDL....SAC-
B9RBQ4_RICCO/7-100TQ--ALALT.GRCGV------N.SDL....SAC-
Q9LE56_ARATH/14-113EN--ALDLP.KACGA------K.ADV....SLC-
Q0D9K5_ORYSJ/20-116EQ--GLLLA.KRCGV------T.TDA....SAC-
Q9SUV6_ARATH/10-114TN--TNQVN.KACGV------L.DKY.....AC-
C5Z9F1_SORBI/22-116EQ--GLVLA.RRCNV------T.TDA....SAC-
C5XVS1_SORBI/14-118EQ--MFKLP.ARCNL------P...V.....GC-
C3SA92_BRADI/13-112TR--VLALP.AACGG------S.NAV...FSKC-
Q9LJ85_ARATH/13-108TT--AVSLP.RACNM------P.RVP....LQC-
Q7XIG9_ORYSJ/15-115TR--AAALP.AACGG------D.SSA...LSKC-
C5X2J9_SORBI/14-111TR--AAGLP.AACGE------DPAAL....SKC-
A9S0T9_PHYPA/9-107SA--AIAIP.QKCGI------KFEQR....FYC-
C5Y597_SORBI/23-118AH--GLQIP.ARCGQ------G.QPP...VELC-
B9RIH6_RICCO/12-107DK--MVYVA.RSCGK------K.ISA...GTKC-
B9RIH3_RICCO/10-107EK--VVYVA.RTCGV------E.VKP...GLKC-
A9TY60_PHYPA/11-108TK--AHQIP.VMCCI------A.VDT....VKC-
B9HP13_POPTR/12-110DK--AVFVA.RTCGL------T.IPP...GTVC-
C5XAF7_SORBI/6-114TL--AVSLP.KACDS------M.SVP....LQC-
A9T6D1_PHYPA/9-104EF--AKYIP.QKCQL------T.YKA...GIVC-
B9HP10_POPTR/10-105EK--VVYVA.RTCGV------T.VRA...GTQC-
B9RTN3_RICCO/10-113SR--VVSLP.SVCSE------T.TNFTSLESIC-
B9RIH4_RICCO/10-105KK--VFDVA.KSCGK------K.VTP...GTKC-
B9RZC4_RICCO/7-99NL--AMQLP.VKCKL------V.GES....FHC-
A9SQH6_PHYPA/103-196NK--ASSLL.RDCKL------S.AGA.....SC-
B9SEE9_RICCO/14-106KQ--AIKLL.QDCGR------K.VPR...HFKC-
C5WP26_SORBI/30-121DK--VFYVC.RSCGV------A.IPR.....GC-
B9SEE8_RICCO/14-105NR--AIRVI.EGCGR------R.VPR...HFKC-
C5WP25_SORBI/18-110DK--VFYVA.GQCAV------S.IPW.....FC-
A9SQH9_PHYPA/117-210NK--ARALL.NDCEI------S.AGS.....TC-
B9GVR5_POPTR/18-112TQ--AVNLS.QRCGV------T.TNL....TSC-
B9H8A8_POPTR/14-108TL--AITLP.RACKM------S.GVP....MLC-
B9HUT8_POPTR/13-107SR--VIALP.SACSL------S.SPV.......-
D7T8D6_VITVI/12-114AI--AITIP.KRCNI------K.NRPV..GKKC-
I1PAV8_ORYGL/35-130VR--ALALP.TICRV------D.APP...PRLC-
I1QT58_ORYGL/18-119DG--DQQMF.ARCKI------P.GAS...STIC-
I1R180_ORYGL/22-119TH--ALEIP.VSCGL------A.TPP...IELC-
Q1G2Y5_ARATH/16-109TL--AISLP.RACGI------P.GVP....VQC-
Q2R222_ORYSJ/12-114DR--AFALLRDVCRL------S.PPAD.IISTC-
Q75GY5_ORYSJ/27-127GV--QSLLP.TACNL------P.PN........-
Q8S077_ORYSJ/23-111AR--AMQIP.SKCRI------K.GAP....KSC-
Q9SUV7_ARATH/19-112AR--YDLVN.SACGV------A.DKF.....AC-
U5G1T3_POPTR/18-113TL--AISLP.RACNM------P.GVP....VQC-
U5GQ18_POPTR/24-115DR--AIRLI.EGCGR------R.VPR...HFKC-

PF14547

F2DU32_HORVD/35-120PL..DVPLVLNYCGR------NATAA---GSNCS
D7ME35_ARALL/36-114....RLNQVLGIC.R------ITPPA---GFTCA
A8MRQ5_ARATH/577-656....NIIILCRACGR------RI.PR---GFTCP
D7ME37_ARALL/85-164....NIINLYRTCGR------SI.PP---GFTCP
D7ME34_ARALL/31-113....RVNQVLRLC.R------ILPPA---GFRCA
D7ME36_ARALL/7-89NLNLRLNGLLGLC.R------LPIQP---GYNCL
D7MAX1_ARALL/157-241PI..ALELLVD.CGK------TP.PR---GFKCP
Q7XTE3_ORYSJ/6-89TV..GVSVLVSTC.K------TELPD---GFKCV
B9S3J8_RICCO/215-298PI..ALEVLVD.CGK------NP.PP---GFQCP
D7ME38_ARALL/36-117AIDEAVREIFFAC.N------RVFPI---GFQCP
C5Z4Z5_SORBI/237-320PI..ALNLLIT.CGK------HP.PS---GFQCP
C5Y909_SORBI/46-127DV..GVGVLASACKT------EL.PN---GFKC.
F4JLV4_ARATH/297-375....NFGIFFKVCGR------RI.PQ---GFSCP
I1QBL2_ORYGL/229-307NV..MIDKILKLCSK------AG.DS---TVVC.
M4F7Y5_BRARP/170-253PV..ALQLLLT.CGK------NP.PP---GYTCS
Q9SU32_ARATH/33-116PI..HLNLALNACGG------TL.PD---GFRCP
W4ZSZ5_WHEAT/138-222PI..HLSLILNFCGK------GV.PT---GFMCP
W5AJU0_WHEAT/30-113PV..DLRLILNNCGK------VC.PT---DFRCP
W5AP16_WHEAT/30-114SV..GVELLASACKT------EI.PD---GFKCV

PF13016

Q5Z9M9_ORYSJ/30-100QQMRLMAQQ-YHCQA------ICTMV---QSIMQ
Q0D7V8_ORYSJ/32-104QQLRLVAQQ-SHYQA------I.SIV---QAIVQ
AVLBB_WHEAT/153-224RQLSQIPEQ-YRCQA------IHNVA---EAIRH
D2KFG9_WHEAT/47-117QQLKAIPKQ-SRCEA------IHNVV---HAIIL
I1I1L7_BRADI/190-267QQLSQIDVQ-SRCQA------IRDVV---DAIIK
M8A4Q2_TRIUA/135-215RQLAHISEP-SRCPA------IHNTV---HAIIM
GDBB_WHEAT/132-208QQLAQIPQQ-LQCAA------IHSVV---HSIIM
GLTA_WHEAT/180-256QQLRQIPEQ-SRHES------IRAII---YSII.
W5D734_WHEAT/36-109EQFRQVPEQ-SRCLA------INSVA---HAII.

PF00234

IAA2_WHEAT/37-143LT--AASVP-EVCKV....PIP.NPSGDRAGVC-
PRO28_ORYSJ/47-143.L--ALNMP-SICGI....YPSY........NT-
RAG1_ORYSJ/39-150RA--AASLP-AFCNV....DIPNG....PGGVC-
NLTP1_ORYSI/28-112GN--AASIP-SKCGV....SVPYTI..SASIDC-
NLTP4_ORYSJ/30-115DL--VAGIP-SKCGV....NIPYAI..SPSTDC-
B7E7J9_ORYSJ/30-95PN--ARKAV-SSCGI....ALPT.........C-
NLTP3_ORYSI/32-117GN--AASIP-SKCGV....SVAFPI..STSVDC-
A9_ARATH/27-87.A--ATTLT-SLCNL.....PSF........DC-
108_SOLLC/35-99.I--AAQIP-AQCNL....PPLS.........C-
14KD_DAUCA/54-136IA--LSLVL-NNCGK....QVPN......GFEC-
2SS1_ARATH/59-153QT--AKHLP-NVCDI....PQVD........VC-
2SS1_BRANA/16-122QT--ATHLP-KVCNI....PQVS........VC-
2SS2_ARATH/58-158KT--AKYLP-NICKI....QQVG........EC-
2SS5_HELAN/53-148QK--AQILP-NVCNL.....QSR........RC-
2SS5_HELAN/190-290RV--IQNLP-NQCDL....EVQQ.........C-
2SS8_HELAN/49-139SM--AHNLP-IECNL....MSQP.........C-
2SSE_BRANA/60-174QT--ATHLP-RVCNI....RQVS........IC-
2SSL_PICGL/52-156ER--AAYLP-NTCNV....REPP.......RRC-
2SS1_BEREX/40-137RL--AENIP-SRCNL....SPMR.........C-
B9SA35_RICCO/61-155QR--AGEIV-SSCGV....RCMR......QTRT-
B9SA35_RICCO/162-256RT--AANLP-SMCGV.....SPT........EC-
2SS_SOYBN/43-152KE--LINLA-TMCRF....GPMI........QC-
M4CYI5_BRARP/32-92.A--ATTFT-TTCNL....PSL.........DC-
A6N9I7_ALLCE/31-116PR--FQNIP-RDCRN....TFVRPFWWRPRIQC-
AVE3_AVESA/69-210FA--LQALP-AMCDV....YVPP........HC-
CCDP_MAIZE/48-127LS--LNFIL-NNCGR....ICPE......DFTC-
FIL1_ANTMA/31-90.I--ASRVP-AQCNL....PPLS.........C-
GDA0_WHEAT/146-275LA--LQTLP-AMCNV....YIPP........YC-
GDA2_WHEAT/143-280LA--LQTLP-AMCNV....YIPP........YC-
GDA5_WHEAT/152-306LA--LQTLP-AMCNV....YIPP........HC-
GDA6_WHEAT/155-283LA--LQTLP-RMCNV....YIPP........YC-
GDA8_WHEAT/46-175LA--LQTLP-AMCNV....YIPP........YC-
GDB1_WHEAT/134-288IA--LRTLP-TMCSV....NVPL........YS-
GDB2_WHEAT/184-310LV--LQTLP-SMCNV....YVPP........EC-
GDB3_WHEAT/87-228IA--LRILP-TMCSV....NVPL........YR-
B6UKL2_TRITU/171-285LV--LKTLP-TMCNV....YVPP........DC-
A2Y665_ORYSI/48-178QY--AAQLP-SMCRV.....EPQ........QC-
D2DII3_WHEAT/197-341IA--LRTLP-TMCNV....NVPL.......YET-
GLU2_MAIZE/128-213QI--AQQLT-AMCGL....QQPT........PC-
HOG1_HORVU/166-288LV--LQSVP-SMCNF....NVPP........NC-
HOG3_HORVU/142-276LV--IQTLP-MLCNV....HVPP........YC-
HOR1_HORVU/143-282IA--LRTLP-MMCSV....NVPL........YR-
HPSE_SOYBN/8-77RN--LQLIL-NSCGR....SYPS......NATC-
IAAC1_WHEAT/30-140AK--VLVTS-GHCNV....MTVHN....APY.C-
IAAC3_WHEAT/43-159VR--LLVAP-GQCNL....ATIHN....VRY.C-
IAC16_WHEAT/30-134VR--ILVTP-GYCNL....TTVHN....TPY.C-
IAA1_HORVU/20-131RA--VASLP-AVCNQ....YIPNTN..GTDGVC-
IAA1_WHEAT/6-115LT--AASIT-AVCRL....PIVVDASGDGAYVC-
IAA2_HORVU/37-144LL--VAGVP-ALCNV....PIPNEAA.GTRGVC-
IAA4_SORBI/7-111VS--RLTRA-AECNL....PTIP......GGGC-
IAA5_SORBI/4-106AP--TIVCY-RECNL....RTLHG....RPF.C-
IAAA_HORVU/30-140AK--VLVTP-GQCNVLTVHNAPY.........C-
IAAE_HORVU/29-137AA--NLVTP-QECNL....GTIHG.....SAYC-
IAAT_ELECO/6-114AP--KLVTE-VECNL....ATIHG....GPF.C-
B6UHB4_MAIZE/34-143AA--TLVTE-AECNL....ATISG.....VAEC-
LIM1_LILLO/29-88.I--ISSLP-DHCSL....PAVN.........C-
MC1_PINRA/28-88.A--VISLP-AKCNL....PALT.........C-
MEN8_SILLA/38-98.V--ASQLP-SSCNL....AALN.........C-
NLT11_PARJU/4-91KL--VSEVP-KHCGI....VDSKLPPIDVNMDC-
NLT21_PARJU/35-121EL--VAEVP-KKCDI....KTT.LPPITADFDC-
F2DCX3_HORVD/29-111GK--AAGIP-SMCGV....SVPYAI..SASVDC-
NLTP1_ARATH/29-114GR--AAGIP-KACGV....NIPYKI..STSTNC-
NLTP1_BRANA/29-113AR--AAGLP-KACGV....NIPYKI..SKSTNC-
A8YPK3_HORVU/29-113NN--AASIP-SKCNV....NVPYTI..SPDIDC-
NLTP2_SOLLC/27-110GK--AAGLP-GVCGV....NIPYKI..SPSTDC-
NLTP1_PRUAR/3-87NN--AAALP-GKCGV....NIPYKI..SASTNC-
NLTP1_TOBAC/27-110GK--AAGLP-STCGV....NIPYKI..SPSTDC-
NLTP2_HORVU/37-102PH--ARDTL-NLCGI....PVPH.........C-
NLTP3_HORVU/29-114GK--VSGVP-GKCGV....SVPFPI..SMSTDC-
B6CQU4_9ROSA/33-119GL--AAGLP-GKCGV....NIPYKI..SPSTDC-
NLTPA_BRAOT/29-114GR--AAGIP-KACGV....SVPFPI..STNTNC-
NLTPA_RICCO/3-88DA--ASSLP-KKCGV....DINIPI..SKTTNC-
NLTP1_WHEAT/26-110DN--ARSIP-PKCGV....NLPYTI..SLNIDC-
NLTPB_RICCO/3-88DA--ASSLP-YKCGV....VINVPI..SKTTNC-
NLTPC_RICCO/28-112QF--LSKIP-AACNI....KVGFPV..STNTNC-
NLTP_AMACA/4-90KV--AARLA-SQCGV....RMSYSV..SPNVNC-
NLTP_BETVU/29-113GK--AASLP-RQCGV....SVPYAI..SPNTNC-
NLTP_CICAR/27-111NN--AAALP-GKCVV....NIPYKI..STSTNC-
NLTP_DAUCA/30-116NA--AAGLP-ARCGV....NIPYKI..SPTTDC-
NLTP_ELECO/4-90GK--ASSIP-GRCGV....RLPYAI..SASIDC-
NLTP_GERHY/28-112NN--ANSLP-GKCGI....SIGYKI..TPNIDC-
NLTP_HELAN/28-112GN--AASFP-GKCGV....SIPYKI..SPSTDC-
NLTP_PINTA/34-119GK--AANLP-GLCKV....TDLNVPI.SPNVDC-
NLTP_SPIOL/30-113GK--AAGLP-GMCGV....HIPYAI..SPSTNC-
NLTP_STRHE/10-89RF--LGQIP-TPCKIK..GRLP..........C-
NLTP_VIGUN/34-99PG--AKKVL-SNCGV....TYPN.........C-
NLTP6_AMBAR/30-113KR--MPLLS-TKCGV....KPDFPAV.DKNLDC-
O22110_PICAB/25-104TQ--AMKMP-AECGK....NVSA.......TQC-
O22272_ARATH/48-125TR--ALATP-KACKL....SIAP.......PHC-
NLTP2_SOLPN/27-110GK--AASLP-STCSV....NIPYKI..SPSTDC-
O24101_MEDTR/31-102KK--ALALP-GQCGL....QTPS........NC-
O24355_SILLA/25-110SL--IASLS-DKCSV....SFK.LPAISKATDC-
O24440_PHAVU/29-112NN--AGILP-GKCGV....SIHYNI..STSTNC-
O24485_PINRA/36-122RA--LQSLP-SNCGL....QLSFTI..TRDIDC-
O24486_PINRA/39-97.S--TMQLP-SECGL....ETPQ.........C-
O49116_ARATH/29-125AA--INNLP-LRCSL....TLSFPI..SVDMDC-
O49178_ORYSA/42-149SA--RRRAP-GVLQV....DIPNG....GGGVC-
O49644_ARATH/39-110TF--SAGVL-KKCDV....SHKY.......M.C-
O64431_BRACM/21-86PN--SRKVL-TACGI....PYPS.........C-
YLS3_ARATH/36-113SL--ALALP-SVCHA....TADI.......TKC-
O65368_ARATH/32-112IS--LSLLI-NTCGK....KLPS........DC-
O65369_ARATH/55-137IS--LSLLL-NVCSK....QLPP......GFQC-
O65561_ARATH/29-103DK--VVHVT-AFCGK....PLAH......GTKC-
O81135_HORVU/27-92HA--RDTLL-S.CGL....AVPR.........C-
O81410_PICGL/53-146RR--AEELP-NTCNV....PQSP.......RRC-
O81872_ARATH/32-107DK--VVYVA-RSCGK....KIPS......GYKC-
O82439_ARATH/25-107IN--LSVLL-NVCSR....NAPK......SFQC-
NLTP2_PRUAR/3-68PN--ARKLA-SNCGV....PVPQ.........C-
F2D8V2_HORVD/31-96PN--GKKVM-AACKV....PVPS.........C-
P93198_9ROSI/39-132QS--ARDLP-NECGI....SSQR.........C-
P93274_MALDO/2-73PI--VLQVL-IDCGK....TPPS......GFQC-
P93513_9POAL/63-154QT--AKSLP-TQCNI....DPKF.........C-
P93611_WHEAT/84-166IA--IQVLV-NQCGK....TVPS......DFQC-
P93705_DAUCA/264-345PV--ALQLL-ITCGK....TPPP......GFTC-
P93794_WHEAT/195-344IA--PRTLP-TMCSV....NVPL.......YET-
PRF1_SOLLC/261-343IA--LQVLI-DDCGK....YPPK......DFKC-
PROA_ORYSI/43-134KM--AMQMP-YMCNM.....APVNFQLSSCGCC-
PRO25_ORYSJ/47-143LL--TFNLP-SICGI....YPNY........YS-
J7FK20_9POAL/48-138QE--AKNLP-PRCNQ....GPP..........C-
B6Z278_WHEAT/50-140QR--AQSLP-SKCNM....GAD..........C-
Q00318_COILA/103-188QI--AQQLT-VMCGV....RQPM......TSPC-
Q06763_SOYBN/68-149PL--ALQLL-VTCGK....SPPP......GYTC-
Q09071_AVESA/48-166VA--MQTLP-AMCNV....QVPP........YC-
Q09072_AVESA/74-212FA--LQALP-AMCDV....YVPP........QC-
Q39100_ARATH/48-126IS--LNVVL-NHCGK....KVPS......GFKC-
ERLI1_ARATH/85-167IS--LSVLL-NVCNR....KVPS......GFQC-
Q39332_BRANA/28-112DL--VAALP-TTCGV....SLSYPI..GFNTNC-
Q39574_CATRO/55-137VS--LTLLL-NVCSK....KVPE......GFIC-
2SS_CUCMA/55-139QK--ARNLP-SMCGI.....RPQ........RC-
Q39787_GOSHI/36-131KV--TKNIM-SECEM.....EPG........RC-
Q39928_HELAN/52-143QR--AQILP-NVCNL.....QSR........RC-
Q40335_MEDSA/84-165IT--LSLLL-SACEK....SIPN......GFQC-
Q40453_TOBAC/25-114TL--VAELP-KKCGI....SFN.MPPIDKNYDC-
Q40654_ORYSJ/41-149RA--AASLP-AFCNV....DIPNG....VGGVC-
A2X812_ORYSI/52-133ID--LSLIL-NYCGK....TVPT......GFKC-
Q40997_PINST/58-160ER--AGELP-DRCNV....RESP.......RRC-
Q41125_PHAVU/45-126IK--LNLLL-NYCGK....KTPK......DFVC-
Q41168_RAPSA/29-141QT--ATHLP-RVCRI....PQVS........IC-
Q41320_SECCE/55-178QM--LQNLP-TMCNV....YVPR........QC-
Q41378_9ASTR/24-89PN--AKKVT-STCGV....PIPN.........C-
Q41543_WHEAT/137-262SV--LQTLA-TMCNV....YVPP........YC-
Q41848_MAIZE/215-296PI--ALNLL-ITCGK....HAPS......GFQC-
Q42044_ARATH/52-133ID--LTLLL-NYCGK....KVPH......GFQC-
Q42158_ARATH/29-94PN--ARKVS-NSCKI....PSPS.........C-
Q42392_ZINVI/30-95PN--AKKVA-NACGV....PIPK.........C-
Q42474_ORYSA/65-146VE--LKLIL-NKCGK....TCPS......DFTC-
Q42487_POPNI/58-140LS--LSLLL-NVCGK....KVPK......DFQC-
M0VYA0_HORVD/33-118GK--VSGVP-GKCGV....SVPFPI..SMSTDC-
Q43496_SOLLC/28-101NM--AVQLP-EKCTA....NFEQ.........C-
Q43522_SOLLC/127-207LT--LSLIL-NNCGM....NNS.......GFTC-
F2E1T8_HORVD/29-111GR--AAGIP-SRCGV....SVPYTI..SASVDC-
Q96232_ASPOF/101-182LA--LQLLL-T.CGK....TPPP......GYTC-
Q9S7U3_ARATH/46-128VS--LSLLL-NVCGK....KVPS......GFVC-
Q9SA59_ARATH/25-103TL--ALNLP-TACNV....QTPS......PSLC-
Q9SBW9_MAIZE/43-101.I--INSLP-GRCHL....AQAN.........C-
Q9SC06_TRIMO/34-125QT--AKSLP-SKCNI....DPKY.........C-
Q9SDS2_CAPAN/27-110RK--AAGLP-NMCGV....NIPYQI..SPSTDC-
Q9SDS4_CAPAN/19-102GK--AAGLS-GVCGV....KIPFEI..SPSVDC-
F2CY84_HORVD/32-117TR--AAALP-SKCNV....NLPYKI..SPSVDC-
Q9SET1_ARATH/222-304IA--LELLL-D.CGK....TPPS......DFKC-
Q9SHA0_ARATH/27-109GI--AIGVP-KRCNI...RNRPA......GKRC-
Q9SI70_ARATH/29-101EK--ALGLS-RRCNV....TTDL......SA.C-
Q9SKI0_ARATH/208-289VA--LQLLL-T.CGK....NPPP......GYTC-
Q9SRS1_ARATH/32-105TL--ALHLP-GKCSA....NFLP.........C-
Q9ST25_MAIZE/51-132IK--LSALV-NYCGK....CVPK......GYLC-
Q9STH5_ARATH/42-113DF--NALFS-KTCGL....TTDP.......NLC-
Q9SU32_ARATH/34-115IH--LNLAL-NACGG....TLPD......GFRC-
Q9SUV8_ARATH/28-104VG--LVQVL-SLCGA....DYPPP.....GFRC-
Q9SUW7_ARATH/37-117VR--VNQVL-RLCRI....IPPL......GFRC-
Q9SUX0_ARATH/37-116VA--VREIF-FACNR....VFPI......GFQC-
Q9SUX3_ARATH/50-132IN--LSLLL-NICNR....EASR......DFQF-
Q9SUZ2_ARATH/48-121SM--ALQLP-QRCSA....NFPP.........C-
SCA_LILLO/25-109AI--VAGIP-GKCGV....NIPYPI..RMQTDC-
Q9SXE7_ARATH/212-293LA--LQALI-T.CGI....NPPS......GFVC-
Q9XF30_ORYSI/41-111PN--AKRLF-TVCGL....PIPRS....KTNPC-
NLTP5_ARATH/29-114GR--AARLP-GACRV....RISYPI..SARTNC-
2SS1_SESIN/54-141QM--MQYLP-RMCGM....SYPT........EC-
NLTP8_ARATH/28-112EL--AQALA-SNCGA....SLPVDA..SPTVDC-
NLTL2_ARATH/27-105SK--AASLP-SVCKV....AAPP......SARC-
Q9ZSL7_BRANA/27-108SL--ASSLP-GKCGV....SIPYPI..SMSTNC-
Q9ZTW2_FRAAN/73-155IA--LSLLL-NACGN....QVPR......GFQC-
NLTP7_ARATH/29-118DR--AAGIP-RRCGI....KIPYSTQIRFNTKC-
XYP11_ARATH/40-120QR--AEQLS-TICGV....KAPS......PSLC-
YY1_ORYSJ/31-94.I--INSLP-AKCGL....PRVT.........C-
ZEB2_MAIZE/86-172QV--AQQLT-AMCGL....QLQQ......PGPC-
ZM33_MAIZE/45-108.I--INSLP-AKCAL....PPVS.........C-

PF05617

M4FC94_BRARP/72-146RL..YQLK.-R.FASQV...SLEINE..VWNRCS
B9S177_RICCO/41-104T........-..........TEEGDI..LEGYC.
U5FMS5_POPTR/61-132EG..PMFK.-A.NYDFY...LKRGDD..LYNIC.
M1BC58_SOLTU/78-151LS..PEMK.-GVNTTEI...WKNSDK..LWEEC.
M4FCA2_BRARP/71-146QL..YQLK.-R.FASQV...SFKTNE..VWNRCS
M4F146_BRARP/69-143SR..YEYR.-N.IASKA...IPKSKQ..TWNDCV
M4FC93_BRARP/72-147RL..YQLK.-H.FASKV...SFKINK..VWNRCS
EC12_ARATH/45-109T........-..........SDETNV..LRGFCQ
M4FC76_BRARP/105-178SN..TEYN.-N.IASKA...IPKSKH..TWKDCV
D7LVH8_ARALL/44-116QTFLPKLR.-...KQDS...LEKSTQ..IWYLC.
M4F8U3_BRARP/34-96.........-...........FFPPT..LRDHCS
K4CB92_SOLLC/64-137GL..PKVKD-KIDSKVV...KSNVSK..VFKRC.
B9SN88_RICCO/61-124P........-...........FFGPL..LKLFCS
B9SVP5_RICCO/53-119T........-..........VEEVNI..LNGYCA
B9GGT7_POPTR/48-111T........-..........VQEGDI..LLGYCD
I1I7L3_BRADI/74-140G........-..........QFYDPL..VRNACD
K7KX58_SOYBN/72-144RT..PEMR.-NVDAIEF...LNKGKK..LFDEC.
K7KX56_SOYBN/72-143RI..PEMR.-NANATEL...MKKNSL..IFNHC.
K7MQC1_SOYBN/160-232GS..PQFK.-E.NEAQI...MNRSNQ..IWNYC.
M0TQL0_MUSAM/66-131T........-..........PQEGDV..LRGYCD
EC11_ARATH/57-120T........-..........AQEGDM..LQGYCD
B9T247_RICCO/77-140P........-...........FFGGL..LKQHCS
M4FC95_BRARP/79-152QF..YQLK.-R.FASQV...FFKINE..VWNRCS
D7KC93_ARALL/38-103DR..PSLV.-G.RETQY...........VWSHCV
M4EKA3_BRARP/43-105.........-...........FFPPL..IKDNCA
D7MTL8_ARALL/141-203.........-...........FFPPL..LKNECS
C5YSL3_SORBI/84-148T........-..........AEEADV..LRGFCD
A8MS74_ARATH/69-143QF..YQLN.-R.FSSNA...MIKTNE..TWNKCS
U5GVU7_POPTR/48-112T........-..........AEEGQI..LEGYCD
Q6ZKQ3_ORYSJ/79-152R........-..........PLYAPL..VNHVCS
K7LY71_SOYBN/49-122TL..PKFR.-A.HKIQI...LKRSEK..VWFDCD
B9SXP3_RICCO/41-109.........-..........PEIGKQ..LKNICA
K7KW29_SOYBN/52-115T........-..........NEETDV..LEGYCD
B9HRY2_POPTR/41-112EF..PEYK.-G.HEEEA...LAGSNK..LWEKCA
M4DW18_BRARP/37-99.........-...........DFPPT..LRDHCS
M4DVD8_BRARP/72-146RL..YQLR.-R.FTSVAKILLLRTGK..ILSRCS
B9RBY2_RICCO/99-162.........-...........SFPSR..LKSFCA
B9P5Y5_POPTR/32-100TVESA....-..........LLRRRR..LIKSC.
B9GU63_POPTR/46-117KE..PQEN.-P...SKI...SLRSLD..IWNHCV
M4FC77_BRARP/64-140PQ..NAFI.-DPSAANA...VAKSKY..TWKDCV
Q8S8C9_ARATH/73-145QM..YELR.-R.FTSKR...FSKTNE..IWNRCS
B9SN89_RICCO/73-136P........-...........FFGPL..LKKVCS
Q3EBD9_ARATH/70-142QT..YYYK.-P.FASKG...RPRILK..VWNRCS
D7MVA2_ARALL/48-118SS..YEYK.-N.IAS.....IPRSKQ..TWNDCV
B9SVP8_RICCO/47-111T........-..........AEEGNI..LRGYCD
W5I1G9_WHEAT/44-110T........-..........PEEGDM..LKGYCD
U5DGU8_AMBTC/38-101SP.......-G.........LVHQ....LNSYC.
D7MSB1_ARALL/48-110.........-...........FFPPL..LKDICA
D7LBY0_ARALL/72-145QI..YQLK.-R.FSSKR...FSKTNE..IWNRCS
Q9LXX9_ARATH/44-121QMFLPKFE.-GVRKQYS...LEKSTY..IMQLC.
A7REG6_ARATH/64-136ST..NDYK.-K.IASKA...IPKSKQ..TWNDCV
B9HQH8_POPTR/62-126LPPLW....-..................IRKRCA
M4F9M9_BRARP/52-124T........-..........TMEGNM..LREYCD
K7N3Y2_SOYBN/45-109T........-..........TEEGDV..LQGYCD
M4FC77_BRARP/213-288PQ..FAYF.-DPSASNA...VPKSKY..TWKDCV
M4CIW6_BRARP/37-108DR..PSLI.-G.NESKY...LQKRDE..IWAYCV
B9SE79_RICCO/48-112T........-..........TEEGDI..LEGYCD
K7KX55_SOYBN/121-191RA..PDLR.-NVDPIQL...LEKSKE..TFDNC.
K4D4G7_SOLLC/44-108T........-..........LEETNM..LRGYCD
B9GGU6_POPTR/50-114T........-..........DEEGNI..LRGYCD
U7DW65_POPTR/42-112RL..PKEK.-V...TFV...VATGDQ..IWNHCV
D7LQP6_ARALL/70-141ST..KDYK.-N.IASKA...IPKSKK..AWNDC.
A8MQ83_ARATH/72-148EM..YQLK.-R.FSSKK...FSKTNE..IWNMCS
M4F142_BRARP/86-160SS..YEYR.-F.IASKA...IPKSKQ..TWNDCV
D7MQQ8_ARALL/38-109DK..PMLI.-A.HETEY...LKKSDD..LWNHCV
U5GKZ5_POPTR/42-112KV..LKEK.-V...TFV...VAKGDQ..IWNYCA
I1IN82_BRADI/69-133T........-..........AREADV..LRGFCD
K4C587_SOLLC/77-151HS..PEMK.-GVNKTAV...WINSEN..LWKRCV
Q3ECV9_ARATH/81-154AM..YVYG.-NSIASKD...IPYSKQ..SWNECV
W1PLV8_AMBTC/49-113T........-..........AEEGDI..LRGYCD
K4D4G3_SOLLC/55-119T........-..........SQEGDI..LHGYCD
B9IKH4_POPTR/49-122TT..PNFV.-.LTVPEF...FERTEK..VYDHC.
A5AZZ7_VITVI/45-108T........-..........AEEGNI..LQGYC.
M0ZZI9_SOLTU/49-111S........-...........LFPLT..LKSFCS
K7KX59_SOYBN/86-158RT..PEMR.-DVDAMQL...LNKGKK..MFDQC.
I1K1Y8_SOYBN/51-124TL..PLFK.-Q.NLTQI...LKRSEK..VWNDCS
D7MTL8_ARALL/48-110.........-...........LFPPL..LKDGCS
I1QJT2_ORYGL/79-143G........-..........EKYLPL..VKRICS
U5DBS7_AMBTC/38-100D........-..........GGFANQ..LYEFC.
EC14_ARATH/47-111T........-..........PEEANV..LRGFCQ
K7KX55_SOYBN/32-108SS..QQLK.-NVNQTEI...MSKNDK..IFNKCD
Q9LUB3_ARATH/33-97.........-...........LIPPSRRLRDHCS
I1QY08_ORYGL/55-119T........-..........AQEADI..LRGFCD
K7L6R0_SOYBN/36-100S........-..........YHEALS..IRGYCD
M0TA67_MUSAM/60-124T........-..........TQESDI..LRGYCD
M1ASC9_SOLTU/60-130RL..PQYE.-K.ESKSI...LANSIK..VFDSC.
W5I3U0_WHEAT/51-117T........-..........AEEGDM..LKGYCD
M4DW17_BRARP/37-100.........-..........EDFPLA..LRDYCS
Q9C924_ARATH/63-134AT..YELK.-D.VASAI...LPRSKR..MWNKCV
M4EJU1_BRARP/45-107.........-...........LFPPL..IKDGCS
D7LL48_ARALL/69-143QF..YQLK.-R.FSSKA...MIKTNE..IWNKCS
Q3ECV8_ARATH/86-158AT..YEYK.-N.KASKG...IPKSKQ..TWNECV
Q9FYN3_ARATH/84-147P........-...........FFDCV..VKLHCS
U5GF05_POPTR/42-112KV..PKEK.-V...TFV...AAKGDQ..IWNHCA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window