Sequence alignment for CL0482

PF13016

Q5Z9M9_ORYSJ/30-100-QQQPF.-.....MQPI----------------------MNPC--------N-EF--VRQQCSP........M--SLPWE
PRO25_ORYSJ/32-104-QLQSH.-..LLLQQQV----------------------LSPC--------S-EF--VRQQYSI........V--ATPFW
AVLBB_WHEAT/153-224-Q....Q-QQQQL.QEQ----------------------LTPC--------A-TF--LQHQCSP........V--TVPFP
D2KFG9_WHEAT/47-117-EHPVP.-......HQK----------------------LNPC--------R-DA--LLQQCSP.......VA--DMSFL
I1I1L7_BRADI/190-267-.SQPQG-QQYPTSQHQ----------------------LGQC--------R-EF--FLQQCSQ......GAM--APFVQ
M8A4Q2_TRIUA/135-215-QQQPSV-EE....NQQ----------------------LNLC--------K-EF--LLQQCNPEEKLSLLQS--VIPFL
GDBB_WHEAT/132-208-QQQPSL-IQQSL.QQQ----------------------LNPC--------K-NF--LLQQCKP.......VS--LVSSL
GLTA_WHEAT/180-256-QQQIPV-IHPSV.LQQ----------------------LNPC--------K-VF--LQQQCIP......VAM--QRCLA

PF00234

RA16_ORYSJ/41-149-CQPGIG-YPTYP..........................LPRC--------R-AF--VKRQCVA----------------
IAA2_WHEAT/37-143-CNPATG-..YKVSALTG...............CRAMVKLQCV--------G-SQ--VPE....----------------
PRO28_ORYSJ/47-143-CGEFVR-QQCSTVA......................TPFFQS--------P-VF--QLRNCQ.----------------
RAG1_ORYSJ/39-150-CRPGIS-..YPTYSLPQ................CRTLVRRQC--------V-GR--GAASAAD----------------
NLTP1_ORYSI/28-112-CGQVNS-A..............................VGPC--------L-TY--ARGGAG.----------------
NLTP4_ORYSJ/30-115-CGQVVS-M..............................LAPC--------I-MY--ATGRVS.----------------
A0A0E0NNN2_ORYRU/30-95-CN..AG-Q..............................LTVC--------T-GA--IAGGAR.----------------
NLTP3_ORYSI/32-117-CGDVTS-S..............................IAPC--------L-SY--VMGRES.----------------
A9_ARATH/27-87-CRDELS-N..............................VQVC--------A-PL--LLPGAVN----------------
108_SOLLC/35-99-CQ..PQ-QSCTASL......................TGLNVC--------A-PF--LVPGSP.----------------
14KD_DAUCA/54-136-CPRDAL-K..............................LGVC--------A-DV--LNLVHNV----------------
2SS1_ARATH/59-153-CQQLML-QQARQGRSDE................FDFEDDMEN--------P-QG--QQ.QEQ.----------------
2SS1_BRANA/16-122-CQQWLH-KQAMQSGGGPSWT.........LDGEFDFEDDMEK--------Q-GP--QQR....----------------
2SS2_ARATH/58-158-CQKLMR-MQMRQGRGGGPSL..........DDEFDLEDDIEN--------P-QG--PQQGHQ.----------------
2SS5_HELAN/53-148-CRMFLQ-QGQNIPR......................EFDNPQ--------M-GR--QQE....----------------
2SS5_HELAN/190-290-CQRFVE-QQMQQSP......................RSTRPY--------Q-QR--PGQQQQQ----------------
2SS8_HELAN/49-139-CYQQME-EAEMLNH.....................CGMYLMK--------N-LG--ERSQVSP----------------
2SSE_BRANA/60-174-CQQWLH-KQAMQPGGGSGPSW.......TLDGEFDFEDDVEN--------Q-QQ--GPQQRP.----------------
2SSL_PICGL/52-156-CDPQ..-.....RD.....................PQRLSSC--------R-DY--LERRRE.----------------
2SS1_BEREX/40-137-CREQMQ-RQQMLSHCRMYM...........RQQMEESPYQTM--------P-RR--GME....----------------
B9SA35_RICCO/61-155-CERYLR-QSSSRRSP...................GEEVLRMP--------G-DE--NQQQES.----------------
B9SA35_RICCO/162-256-CRGQIQ-EQQNLRQCQ..................EYIKQQVS--------G-QG--PRRSDNQ----------------
2SS_SOYBN/43-152-CEKHIM-EKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEG--------K-DE--DEEEEG.----------------
M4CYI5_BRARP/32-92-CLDNLS-N..............................MQVC--------A-PL--VLPGAVN----------------
A6N9I7_ALLCE/31-116-CPRVNR-I..............................VTPC--------V-AY--GLGR...----------------
AVE3_AVESA/69-210-CRQFLV-QQCSPVA.....................VVPFLRS--------Q-IL--QQSSCQ.----------------
CCDP_MAIZE/48-127-CPIDAL-K..............................LKVC--------A-KV--LGL...V----------------
FIL1_ANTMA/31-90-CSASLA-N..............................LNAC--------A-PF--VVLGAA.----------------
GDA0_WHEAT/146-275-CMDVVL-QQHNI.........................AHGRS--------Q-VL--QQSTYQ.----------------
GDA2_WHEAT/143-280-CRDVVL-QQHNI.........................AHGSS--------Q-VL--QESTYQ.----------------
GDA5_WHEAT/152-306-CRDVVL-QQHNI.........................AHASS--------Q-VL--QQSTYQ.----------------
GDA6_WHEAT/155-283-CRDVVL-QQHNI..........................AHAR--------S-QV--LQQSTYQ----------------
GDA8_WHEAT/46-175-CMDVVL-QQHNI.........................AHGRS--------Q-VL--QQSTYQ.----------------
GDB1_WHEAT/134-288-CKVFLQ-QQCSPVAM....................PQRLARS--------Q-MW--QQSSCH.----------------
GDB2_WHEAT/184-310-CKNILL-QQSKPAS.....................LVSSLWS--------I-IW--PQSDCQ.----------------
GDB3_WHEAT/87-228-CKVFLQ-QQCSPVAM....................PQRLARS--------Q-ML--QQSSCH.----------------
GDBX_WHEAT/171-285-CKNFLL-QQCNHVS.....................LVSSLVS--------I-IL--PRSDCQ.----------------
A2Y665_ORYSI/48-178-CRQVLD-RQLTGRE......................RF...Q--------P-MF--RRPGAL.----------------
HOG1_HORVU/166-288-CKEFLL-QQCRPVS.....................LLSYIWS--------K-IV--QQSSCR.----------------
HOG3_HORVU/142-276-CKEFLL-QQCTLDEKVPL..............LQSVISFLRP--------H-IS--QQNSCQ.----------------
HOR1_HORVU/143-282-CKVFLQ-QQCSPVPV....................PQRIARS--------Q-ML--QQSSCH.----------------
HPSE_SOYBN/8-77-CP.D..-...............................LSIC--------L-NI--LGGSLG.----------------
IAAC1_WHEAT/30-140-CYAGMG-..LPINPLEG...............CREYVAQQTC--------G-IS--ISGSAVS----------------
IAAC3_WHEAT/43-159-CRDYVL-QQTCGTFTPG...............SKLPEWMTSA--------S-IY--SPGKPY.----------------
IAC16_WHEAT/30-134-CTPWMS-..TLITPLPS...............CRDYVEQQAC--------R-IE--TPGSPY.----------------
IAA1_HORVU/20-131-CWPGMG-..YPVYPFPR................CRALVKSQC--------A-GG--QVV....----------------
IAA1_WHEAT/6-115-CY..PG-QAFQVPALPA...............CRPLLRLQCN--------G-SQ--VPE....----------------
IAA2_HORVU/37-144-CDPEMG-..HKVSPLTR...............CRALVKLECV--------G-NR--VPE....----------------
IAA4_SORBI/7-111-CAPGLA-..IPAPPLPT...............CRTFARPRTC--------G-LG--GPYGPVD----------------
IAA5_SORBI/4-106-CEPGLV-..IPLNPLPS...............CRTYMVRRAC--------G-VS--IGPVVPL----------------
IAAA_HORVU/30-140-CYAGMG-..LPSNPLEG...............CREYVAQQTC--------G-VT--IAGSPVS----------------
IAAE_HORVU/29-137-CAPGDA-..LPHNPLRA...............CRTYVVSQIC--------H-QG--PRLLTS.----------------
IAAT_ELECO/6-114-CIPGMA-..IPHNPLDS...............CRWYVSTRTC--------G-VG--PRLATQ.----------------
ITRF_MAIZE/34-143-CVPGWA-..IPHNPLPS...............CRWYVTSRTC--------G-I.--...GPRL----------------
LIM1_LILLO/29-88-CSAAIG-E..............................LMTC--------G-PY--VLPGNN.----------------
MC1_PINRA/28-88-CSNAMD-K..............................LAPC--------T-SA--VGLSSNG----------------
MEN8_SILLA/38-98-CASQLG-N..............................LNVC--------A-PY--VVPGAVN----------------
NLT11_PARJU/4-91-CGTMVR-A..............................LMPC--------L-PF--VQGKEK.----------------
NLT21_PARJU/35-121-CGKVVQ-D..............................IMPC--------L-HF--VKGEEK.----------------
F2DCX3_HORVD/29-111-CGQVSS-A..............................LSPC--------I-SY--ARG...N----------------
NLTP1_ARATH/29-114-CGSVNS-N..............................LAAC--------I-GY--VLQ...G----------------
NLTP1_BRANA/29-113-CGTVSG-N..............................LAAC--------I-GY--LT.QNG.----------------
A8YPK3_HORVU/29-113-CGQVDS-K..............................MKPC--------L-TY--VQGGPG.----------------
NLTP2_SOLLC/27-110-CGEVTS-G..............................LAPC--------L-PY--LEGR...----------------
NLTP1_PRUAR/3-87-CGQVSS-S..............................LAPC--------I-GY--VRG...G----------------
NLTP1_TOBAC/27-110-CGQVTS-N..............................LAPC--------L-AY--LRN....----------------
NLTP2_HORVU/37-102-CE..PA-Q..............................LAVC--------A-SA--ILG...G----------------
NLTP3_HORVU/29-114-CGQVSS-A..............................LSPC--------I-SY--ARG...N----------------
M5W0S9_PRUPE/33-119-CGQVVN-N..............................LTPC--------I-NY--VAN...G----------------
NLTPA_BRAOT/29-114-CGTVNS-N..............................VAPC--------I-GY--ITQ...G----------------
NLTPA_RICCO/3-88-CGQVNS-S..............................LASC--------I-PF--LTGGVA.----------------
NLTP1_WHEAT/26-110-CGHVDS-L..............................VRPC--------L-SY--VQGGPG.----------------
NLTPB_RICCO/3-88-CGQVNK-A..............................LSSC--------V-PF--LTG...F----------------
NLTPC_RICCO/28-112-CSTVDM-K..............................AAAC--------V-GF--ATG...K----------------
NLTP_AMACA/4-90-CTVVTK-A..............................LGPC--------M-TY--LKG...T----------------
NLTP_BETVU/29-113-CGLVAS-K..............................LAPC--------I-GY--LQG...A----------------
NLTP_CICAR/27-111-CGRVDT-A..............................LAPC--------L-GY--LQGGPG.----------------
NLTP_DAUCA/30-116-CGQVTG-A..............................LAPC--------L-GY--LRSQVNV----------------
NLTP_ELECO/4-90-CGQVSS-A..............................IGPC--------L-AY--ARG...A----------------
NLTP_GERHY/28-112-CGQVTS-G..............................LVPC--------F-GY--LAA...G----------------
NLTP_HELAN/28-112-CGQVSS-S..............................LAPC--------I-SY--LTK...G----------------
NLTP_PINTA/34-119-CNQVVS-A..............................MTPC--------A-TY--LIGNAA.----------------
A0A0K9Q9K1_SPIOL/30-113-CGMVSS-K..............................LAPC--------I-GY--LKG...G----------------
NLTP_STRHE/10-89-CGTVDM-K..............................AASC--------I-SF--ATG...K----------------
NLTP_VIGUN/34-99-CN..PT-E..............................LSSC--------V-PA--ITGGSK.----------------
NLTP6_AMBAR/30-113-CDTVQN-I..............................LAPC--------A-GF--LTGQ...----------------
O22110_PICAB/25-104-CEDSDN-T....AC.....................LSSLSSC--------A-PY--LNA...T----------------
O22272_ARATH/48-125-CSTVIY-S..............................MMDC--------L-GY--LGVGSNE----------------
NLTP2_SOLPN/27-110-CGQVTS-T..............................LAPC--------L-PY--LMNR...----------------
O24101_MEDTR/31-102-CNIDPN-D.............................LKQSC--------S-KF--VTGRNP.----------------
O24355_SILLA/25-110-CSDVIP-K..............................VTFC--------L-LY--ITGGSP.----------------
O24440_PHAVU/29-112-CGQVTS-S..............................LASC--------I-PF--LTK...G----------------
O24485_PINRA/36-122-CNTIIQ-Q..............................ITSC--------A-TY--LTTGTPV----------------
O24486_PINRA/39-97-CAATAE-S..............................LSPC--------A-SA--VGNNPQ.----------------
ATA7_ARATH/29-125-CRDVFV-S..............................FMPC--------M-GF--VEGIFQ.----------------
O49178_ORYSA/42-149-CQPGMG-..YPMYPLR.................VAGVGEAPL--------L-GR--ARPRRR.----------------
O49644_ARATH/39-110-CVMMIP-D.............................ILEEC--------F-TH--DRL....----------------
O64431_BRACM/21-86-CD..PK-Q..............................LQPC--------L-AA--ITG...G----------------
YLS3_ARATH/36-113-CTAQLV-G..............................MATC--------L-PY--VQGKAK.----------------
O65368_ARATH/32-112-CSRDAI-K..............................LGVC--------A-KI--LDVAVGT----------------
O65369_ARATH/55-137-CPKDTL-K..............................LGVC--------A-NV--LNGLLDL----------------
O65561_ARATH/29-103-CQGDIE-G.............................LMKEC--------A-VY--VQR...P----------------
O81135_HORVU/27-92-CE..VG-Q..............................LTVC--------M-PA--IT....T----------------
O81410_PICGL/53-146-CE..QQ-R..............................LSSC--------R-EY--LERRRN.----------------
O81872_ARATH/32-107-CGANLS-G.............................LMNEC--------Q-RY--VSNAGPN----------------
O82439_ARATH/25-107-CPKNSI-E..............................IGTC--------V-TV--LN.LVDL----------------
NLTP2_PRUAR/3-68-CSPV..-Q..............................LSPC--------L-GP--INSGAP.----------------
F2D8V2_HORVD/31-96-CN..AL-Q..............................LTPC--------A-GA--IMGNAA.----------------
P93198_9ROSI/39-132-CREQIQ-RQQNLNHCQYYL...........RQQSRSGGYDED--------N-QR--.......----------------
P93274_MALDO/2-73-CVDVLG-G..................................--------.-..--...LIHI----------------
P93513_9POAL/63-154-CSDYVM-D.RCVMKD...................MPLSWFFP--------R-TW--GKRSCE.----------------
P93611_WHEAT/84-166-CPVDTL-K..............................LLGC--------V-DA--LNGLVHA----------------
P93705_DAUCA/264-345-CPLDAL-K..............................LGAC--------V-DV--LGGLVHV----------------
P93794_WHEAT/195-344-CKVFLQ-QQCIPVAM....................QRCLARS--------Q-ML--QQSICH.----------------
PRF1_SOLLC/261-343-CPIDAL-K..............................LGAC--------V-DV--LGGLIHI----------------
PROA_ORYSI/43-134-CRQYMM-Q....TL......................GMGSST--------A-MF--MSQPMA.----------------
PUIA_WHEAT/48-138-CRNYLL-DRCSTMKD...................FPVTWRWW--------K-WW--KG.GCQ.----------------
PUIB_WHEAT/50-140-CKDYVM-ERCFTMKD...................FPVT.WPT--------K-WW--KGGCEH.----------------
Q00318_COILA/103-188-CIEFLR-HQCSPAA......................TP....--------.-.Y--CSPQCQ.----------------
Q06763_SOYBN/68-149-CPIDTL-K..............................LGAC--------V-DL--LGGLVHI----------------
Q09071_AVESA/48-166-CQMFLM-QQCSPVE.....................MVPFLRS--------Q-IL--RQSTCH.----------------
Q09072_AVESA/74-212-CKQFLV-QQCSPVA.....................AVPFLRS--------Q-IL--RQAICQ.----------------
Q39100_ARATH/48-126-CK.DAL-K..............................LKVC--------A-NV--LD.LVKV----------------
ERLI1_ARATH/85-167-CPIDAL-R..............................LGVC--------A-NV--LSSLLNI----------------
A0A0D3A8B1_BRAOL/28-112-CGTVTS-T..............................MTQC--------I-SY--LTN...G----------------
Q39574_CATRO/55-137-CPRDAL-K..............................LGVC--------A-DL--LGGLISA----------------
2SS_CUCMA/55-139-CEQYLR-Q....QSR....................DVLQMRG--------I-EN--PWRREG.----------------
Q39787_GOSHI/36-131-CEQQIR-KQAHLKHCQKYM............EEEWGGEGSDN--------I-AG--.......----------------
Q39928_HELAN/52-143-CRMFLQ-Q....GQ......................RGQQHQ--------Q-QQ--HQQQEQ.----------------
Q40335_MEDSA/84-165-CPTDTL-K..............................LGVC--------A-DV--LG.LVNV----------------
Q40453_TOBAC/25-114-CQTVTT-Q..............................LAPC--------L-SY--IQNRVKG----------------
A2X812_ORYSI/52-133-CPRDAL-K..............................LGVC--------A-NV--LG.LIKA----------------
Q40997_PINST/58-160-CD..PQ-R..............................LSDC--------H-DY--LQRRRE.----------------
Q41125_PHAVU/45-126-CPENTL-K..............................FGVC--------A-DV--LG.LIGV----------------
Q41168_RAPSA/29-141-CQQWLH-RQARQSGSGPSWT.........LDDEFDFEDDMEN--------P-QG--PQQRPP.----------------
Q41320_SECCE/55-178-CKNVLL-QQCSPVA.....................LVSSLRS--------K-IF--PQSECQ.----------------
Q41378_9ASTR/24-89-CS..VT-E..............................LMPC--------S-SA--FTSSAA.----------------
Q41543_WHEAT/137-262-CKNFLL-QQCKPVS.....................LVSSLWS--------M-IL--PRSDCQ.----------------
Q41848_MAIZE/215-296-CPIDTL-K..............................LNAC--------V-DV--LSGLIHL----------------
Q42044_ARATH/52-133-CPTDTL-K..............................LGVC--------A-DL--LG.LVNV----------------
Q42158_ARATH/29-94-CS..PM-Q..............................LASC--------L-AA--MTSSSP.----------------
Q42392_ZINVI/30-95-CQ..VT-Q..............................LAPC--------A-SA--ISSSSP.----------------
A0A0E0R296_ORYRU/65-146-CPIDAL-K..............................LRVC--------A-NV--LNGALGV----------------
Q42487_POPNI/58-140-CPKDAL-K..............................LGVC--------A-DL--LGSLLNV----------------
M0VYA0_HORVD/33-118-CGQVDS-K..............................LAPC--------V-AY--VTGRAS.----------------
Q43496_SOLLC/28-101-CSSTFF-S..............................ALIQ--------L-IP--CRASVVP----------------
Q43522_SOLLC/127-207-CPRDAL-K..............................LGVC--------A-NV--LN.LVNV----------------
F2E1T8_HORVD/29-111-CGQVSS-A..............................LGPC--------A-AY--AKG...S----------------
Q96232_ASPOF/101-182-CPLDAL-K..............................LGAC--------V-DL--LGGLVHI----------------
Q9S7U3_ARATH/46-128-CPKDTL-K..............................LGVC--------A-NV--LKDLLKI----------------
Q9SA59_ARATH/25-103-CRDTLT-S..............................LSPC--------L-YY--LNGGSS.----------------
Q9SBW9_MAIZE/43-101-CLPQLN-R..............................LLAC--------R-AY--LVPGAP.----------------
Q9SC06_TRIMO/34-125-CSDYVM-DRCVTKD......................MPLSWV--------F-PR--TWGKRSC----------------
Q9SDS2_CAPAN/27-110-CGQVQS-R..............................MTPC--------L-PY--LTG....----------------
Q9SDS4_CAPAN/19-102-CGQIQV-G..............................VVNC--------L-PY--LQNR...----------------
F2CY84_HORVD/32-117-CSAVYS-T..............................LMPC--------L-QY--VQQ...G----------------
Q9SET1_ARATH/222-304-CPIDTL-K..............................LGAC--------V-DV--LGGLIHI----------------
Q9SHA0_ARATH/27-109-CGRMPI-NQAAA.........................SLSPC--------L-PA--TKNPRG.----------------
Q9SI70_ARATH/29-101-C...VS-K..............................LVPC--------F-ND--LNT...T----------------
Q9SKI0_ARATH/208-289-CPIDTL-K..............................LGAC--------V-DL--LGGLVKI----------------
Q9SRS1_ARATH/32-105-CGRTFL-SALIQ..........................LVPC--------R-PS--VAP...F----------------
Q9ST25_MAIZE/51-132-CPLNAL-K..............................FGVC--------A-DV--LG.LVKG----------------
Q9STH5_ARATH/42-113-CAAG..-...............................LAVC--------L-PA--IT.QRG.----------------
Q9SU32_ARATH/34-115-CPRDVL-K..............................LSTC--------S-NV--LN.LINL----------------
Q9SUV8_ARATH/28-104-CPRDIE-.....ACS...................NVFGLGRI--------L-NY--.......----------------
Q9SUW7_ARATH/37-117-CPRDST-Q..............................FLSC--------T-NV--LNL..SL----------------
Q9SUX0_ARATH/37-116-CPRNPL-Q..............................LGVC--------A-NV--LG.LANV----------------
Q9SUX3_ARATH/50-132-CPKDAL-K..............................VGVC--------V-NA--LNLLNGL----------------
Q9SUZ2_ARATH/48-121-CSRTFF-S....AL......................VQLIPC--------R-AA--VAP...F----------------
SCA_LILLO/25-109-CGQVDS-D..............................LTSC--------L-GY--ARK...G----------------
Q9SXE7_ARATH/212-293-CPINAL-K..............................LGAC--------V-DV--LGGLIHI----------------
Q9XF30_ORYSI/41-111-CNPTL.-...............................LTPC--------A-GP--TL....F----------------
NLTP5_ARATH/29-114-CGAVTG-S..............................LGQC--------Y-NY--LTR...G----------------
2SS1_SESIN/54-141-CMQWMR-SMRGQYE......................ESFLRS--------A-EA--NQGQFE.----------------
NLTP8_ARATH/28-112-CSVVLQ-D..............................LQPC--------V-SY--LTSGSG.----------------
NLTL2_ARATH/27-105-CSSLIL-N..............................MADC--------L-SF--VTSGSTV----------------
Q9ZSL7_BRANA/27-108-CGTVTS-N..............................LAPC--------A-VY--LM....K----------------
Q9ZTW2_FRAAN/73-155-CPRDAL-K..............................LGIC--------A-NV--LNNLLNV----------------
NLTP7_ARATH/29-118-CGEVNS-N..............................LKPC--------T-GY--LTN...G----------------
XYP11_ARATH/40-120-CLVSML-N..............................VSDC--------F-SY--VQVGSNE----------------
YY1_ORYSJ/31-94-CAAQLT-Q..............................LAPC--------A-RV--GV.APAP----------------
ZEB2_MAIZE/86-172-CVEFLR-HQCSPAA......................TPYGSP--------.-..--...QCQ.----------------
ZM33_MAIZE/45-108-CAGQLR-G..............................LAPC--------L-RY--SVPPLPG----------------

PF14368

Q1G3I0_ARATH/16-107-AIAPLL-A-EPQS..T..MFP...............EMTPEC........A-TV...MPDL.LE..KC...F..AT...
Q3ECK0_ARATH/8-101-FAAAMT-V-MALL..L.VPTI...............EAQTEC........V-SK..LVPC......FN...D..LN...
B9RBQ4_RICCO/7-100-MVALLF-L-TTTI..A.PSQA...............QDTASC........A-QN..LISC......AE...Y..LN...
Q9LE56_ARATH/14-113-FCYVTS-S-NAQM..T.SPPSGGA.........GGDAHSLPC........I-QK..LMPC......QP...Y..LH...
Q0D9K5_ORYSJ/20-116-GAASSS-A-AAQAAVD.TGAA...............AGVPSC........A-SK..LVPC......GG...Y..LN...
Q9SUV6_ARATH/10-114-FLAVVI-A-PQWT..E.TKKPPRPSDTSDTSGTSGRDRRTMC........P-LS...IPGI.VQ..NC...Y..AT...
C5Z9F1_SORBI/22-116-V....L-A-PSAHAQG.TSGS...............GAMPSC........A-AK..LVPCA.GY..LN...S..TS...
C3SA92_BRADI/13-112-VLALAA-A-ASAA..T..PAP...............APAVDC........Q-EAFLALSDC.LD..YV...Q..PG...
Q9LJ85_ARATH/13-108-AVLALP-I-RGQQ..Q..PLS...............QCTPSM........M-TT..VSPCM.GF.ITN...S..SS...
Q7XIG9_ORYSJ/15-115-ALACGA-A-SQSP..APAPAA...............GPASDC........G-SS..ITALA.GC..LT...Y..ITP..
C5X2J9_SORBI/14-111-ALASGA-A-SQAP..G.PSSP...............PVDCSS........A-VT.GLIGC......LP...Y..VQQ..
A9S0T9_PHYPA/9-107-MCLVLI-V-ASAM..V.VTTA...............AAGCDI........D-L...LLPCL.....NA...S..RD...
B9RIH6_RICCO/12-107-ILAIWI-A-VGMS..I.SGQI...............AAAQSC........N-TD...LTDL.VS..KCQRFV..IK...
B9RIH3_RICCO/10-107-IMAMLV-M-VGTQ..V.LSDK...............KVSAQC........E-GK.VPLPQL.IS..KC...YKFVE...
A9TY60_PHYPA/11-108-LFASVL-V-AGVG..VGGQSL...............YCREAT........Y-SS..LAPC..SK..YM...A..VN...
B9HP13_POPTR/12-110-ALAMLL-I-VGIH..I.LGNQ...............KVAASC........N-ET...VTSL.VS..KCS.QF..VRI..
A9T6D1_PHYPA/9-104-LLLVVL-V-G.LS..A.VVNV...............ESQAQCGG....RNL-SI..LAPC......LP...A..AK...
B9HP10_POPTR/10-105-VLAWLV-V-VGAR..F.LGDH...............KVSAQC........G-GS..FVD.I.EA..QCS.QF..VH...
B9RTN3_RICCO/10-113-FLLMAT-A-SQTP..C.PPPP...............VASCTG........E-LV..AISPC.LG..YI...S..SEP..
B9RIH4_RICCO/10-105-ALAVLL-I-AGML..I.SGEL...............VSAINC........D-ND..LIGL..AS..KCQ.KY..VVK..
B9RZC4_RICCO/7-99-ALVLVL-V-LAIV..V...NG...............ENPCRL........T-NE..GIEAC.RP..SV...T..GQ...
A9SQH6_PHYPA/103-196-VLALVL-N-APGT..A.QAQI...............CADSQA........A-VL..YVSC......YG...Y..LE...
B9SEE9_RICCO/14-106-VLVAVM-V-DEAR.MV.QGAG...............LSPSQC........K-QE..QTLG..VN..AC..RD..IL...
B9SEE8_RICCO/14-105-LVAVLS-I-VEVK..T.ANAA...............PSAAQC........K-EE..RRLG..LN..ACK.PV..V....
A9SQH9_PHYPA/117-210-ILTLVL-A-ATGG..V..QAQ...............PCSPTQ........P-L...LLYG..YC..AS...Y..LT...
B9GVR5_POPTR/18-112-VMAVVF-S-SCTT..TLTKAQ...............ESSTSC........A-TK..LTAC......QA...F..LA...
B9H8A8_POPTR/14-108-..STLL-V-ISVN..G.QIST...............PCTTSM........I-SS..FTPCI.NF.ITG...S..TN...
B9HUT8_POPTR/13-107-....ML-L-LLSA..A.EPSP...............ASPPGC........S-DE..LVAFS.PC..LG...Y..VSAPP
D7T8D6_VITVI/12-114-VMALML-V-SQAF..V.Q.EA...............NGAGECGKTPIQSAA-AS..LSSCL.....SA...A..GN...
I1PAV8_ORYGL/35-130-....VA-S-SPWA..A.PA.P..............WPGELDC........T-GA..LLNLS.SC..LT...Y..VEY..
I1QT58_ORYGL/18-119-...AAT-A-AAAG..L.PPLPSTMP......ADVPQPEIPPC........L-ND..LMPC.......A...S..VY...
I1R180_ORYGL/22-119-..AWLP-S-RASA..A.SDAA...............AGGEYC........R-DS..LSGLL.AC..RD...F..MF...
Q1G2Y5_ARATH/16-109-....LL-S-SNSP..T.SILA...............QINTPC........S-PS..MLSS..VTGCTS...F..LT...
C6_ORYSJ/12-114-VLLVLL-V-AAAG..G..GAE...............AAATTC........V-AS..LLELS.PC..LP...F..FKD..
Q75GY5_ORYSJ/27-127-.AAIMA-S-SAQP..Q.QQQQQPPQ......PPGQPANAPSCP.....PVQ-AS..LSPCV.....SY...F..IG...
Q8S077_ORYSJ/23-111-.....A-V-APAA..A.AGAP...............FMVCGV........D-AD.RMAADC.GS..YC..RA..GS...
Q9SUV7_ARATH/19-112-FLAVTI-V-DAQS..M.PPMP...............KFNPVC........A-LA..DLPNI.VQ..LC...Y..FN...
U5G1T3_POPTR/18-113-.LAVMI-L-PVYG..Q..INT...............ACTASV........L-AT..FTPCM.NF..LTN.ST..AA...
U5GQ18_POPTR/24-115-..VVVV-L-GMWEVNK.ADAA...............LSAAQC........K-EE..RRLGLNAC..KP...V..I....

PF14547

F2DU32_HORVD/35-120PCPTNALAD------------------------------LKVC--------A-DV--L.VLLKL----------------
D7ME35_ARALL/36-114VCPR....D------------------------------IQAC--------V-NV--L..RTSV----------------
A8MRQ5_ARATH/577-656TCPRNAN.Q------------------------------IRTC--------S-NV--L.RFFGN----------------
D7ME37_ARALL/85-164RCPRNGL.P------------------------------LQIC--------S-TI--L.SIFDG----------------
D7ME34_ARALL/31-113VCPRDSI.N------------------------------FISC--------S-NV--F.RLSLI----------------
D7ME36_ARALL/7-89TTIMS...D------------------------------LGIC--------V-NV--L.GLINL----------------
D7MAX1_ARALL/157-241TCPIDAL.K------------------------------LGAC--------V-DV--LGGLIHI----------------
I1PQ77_ORYGL/6-89FCPWDAV.K------------------------------FGAC--------A-GV--L.GVVGV----------------
B9S3J8_RICCO/215-298TCPIDTL.K------------------------------LGAC--------V-DV--LGGLIHI----------------
D7ME38_ARALL/36-117TCPRNPL.Q------------------------------LGVC--------A-NV--L.GLANV----------------
C5Z4Z5_SORBI/237-320TCPIDTL.K------------------------------LNAC--------V-DV--LSGLIHL----------------
C5Y909_SORBI/46-127.CPWDAV.K------------------------------FGAC--------V-GV--L.GAAGL----------------
F4JLV4_ARATH/297-375.CSKNDT.E------------------------------LKIC--------A-GI--L.AISDG----------------
I1QBL2_ORYGL/229-307KCPLLLT.N------------------------------LGGC--------I-SL--G......----------------
M4F7Y5_BRARP/170-253TCPIDTL.K------------------------------LGAC--------V-DL--LGGLVKI----------------
W4ZSZ5_WHEAT/138-222KCPTDAL.K------------------------------LHVC--------A-NV--L.DLIKA----------------
W5AJU0_WHEAT/30-113SCPKDGL.K------------------------------LKAC--------V-DV--L.GLLKL----------------

PF05617

M4FC94_BRARP/72-146TCMDKMK----------------------------.PIG..KC--------GFED--VIKEILT----------------
B9S177_RICCO/41-104NCWDSLI----------------------------...QLEAC--------T.TE--IILFFL.----------------
U5FMS5_POPTR/61-132NCANTIS----------------------------.....KSA--------G.DK--VFNYIFG----------------
M1BC58_SOLTU/78-151ECLQNIS----------------------------.....DDC--------G.II--IFNRILD----------------
M4FCA2_BRARP/71-146TCADKMG----------------------------.PSGISEC--------N.ED--VLREILT----------------
M4F146_BRARP/69-143VCAQKLN----------------------------....SSHC--------G.DA--LFTNMVG----------------
M4FC93_BRARP/72-147TCGKNMG----------------------------.PSGTVKC--------N.VD--VLKEILT----------------
EC12_ARATH/45-109ECWNALY----------------------------...ELKSC--------T.NE--IVLFFL.----------------
M4FC76_BRARP/105-178ICLQKLN----------------------------.....SDC--------G.DN--IVKNMLD----------------
D7LVH8_ARALL/44-116KCMAKLS----------------------------.....SRC--------A.MY--VTAEVLY----------------
M4F8U3_BRARP/34-96DCLSSLE----------------------------...TIPDC--------I.PE--IFRSIIS----------------
K4CB92_SOLLC/64-137NCTKYLP----------------------------.....NKC--------G.IK--VLNATLH----------------
B9SN88_RICCO/61-124KCFQDFN----------------------------...IDQEC--------G.QQ--IMNSFTS----------------
B9SVP5_RICCO/53-119DCWNALM----------------------------...EIKSC--------S.NE--IILFFL.----------------
B9GGT7_POPTR/48-111.CWGSLL----------------------------...HLQSC--------I.SN--VLLFFL.----------------
I1I7L3_BRADI/74-140ECLKMVL----------------------------...RAEGC--------A.VD--ILRWFAS----------------
K7KX58_SOYBN/72-144KCVVKIG----------------------------.....TEC--------G.EE--VFDNLKH----------------
K7KX56_SOYBN/72-143KCTENLG----------------------------.....NEC--------G.EQ--VYNKLIH----------------
K7MQC1_SOYBN/160-232DCAAKLH----------------------------.....PHC--------G.DQ--FYAGIFY----------------
M0TQL0_MUSAM/66-131.CWDSLM----------------------------...ELRSC--------T.GE--VILFFL.----------------
EC11_ARATH/57-120.CWDSLM----------------------------...QLQHC--------S.GE--LILFFL.----------------
B9T247_RICCO/77-140KCLQDFH----------------------------...VEQGC--------V.NQ--ILHSYAS----------------
M4FC95_BRARP/79-152TCMDKME----------------------------.PIG..KC--------G.LY--VIKEILT----------------
D7KC93_ARALL/38-103TCLVKIT----------------------------.....PKC--------A.LN--IIAVVFG----------------
M4EKA3_BRARP/43-105KCWSSIF----------------------------...NVNGC--------V.LE--LYRSVFS----------------
D7MTL8_ARALL/141-203KCLSSLV----------------------------...SVQGC--------V.TE--IYKSVFT----------------
C5YSL3_SORBI/84-148ECWAAVM----------------------------...GLSSC--------Y.SE--ILLFFV.----------------
A8MS74_ARATH/69-143DCAVKMG----------------------------..AGGNEC--------N.IE--.IRDVFS----------------
U5GVU7_POPTR/48-112NCWDSLV----------------------------...QLQAC--------S.GE--IILFFL.----------------
Q6ZKQ3_ORYSJ/79-152.CWNAVL----------------------------...RAEVC--------A.GD--VLRSVA.----------------
K7LY71_SOYBN/49-122NCGSHLS----------------------------.....PNC--------G.DE--VFSAIFF----------------
B9SXP3_RICCO/41-109QCLAPFL----------------------------...GISGC--------Q.SA--IKEI...----------------
K7KW29_SOYBN/52-115.CWDSLW----------------------------...QLQAC--------T.GE--IVTFFL.----------------
B9HRY2_POPTR/41-112QCVAVTG----------------------------.....ARC--------G.EE--ILYGSFM----------------
M4DW18_BRARP/37-99DCMSSLY----------------------------...AIPNC--------L.QE--IVHSFVN----------------
M4DVD8_BRARP/72-146NCAKTRD----------------------------V.....KC--------D.DE--VLLDLFK----------------
B9RBY2_RICCO/99-162KCWSPIT----------------------------...RIEGC--------Y.VK--VMKSAFN----------------
B9P5Y5_POPTR/32-100.CFLPLT----------------------------...TIPGC--------S.KE--IFVAISA----------------
B9GU63_POPTR/46-117GCAAKLT----------------------------.....GKC--------G.AE--IFLSFSG----------------
M4FC77_BRARP/64-140DCLKKVE----------------------------....TDYC--------A.AK--IFKDMLD----------------
Q8S8C9_ARATH/73-145.CSKKMA----------------------------V...PDKC--------I.EE--VMAEIIQ----------------
B9SN89_RICCO/73-136KCLQDFH----------------------------...VDQGC--------V.QQ--IMTSFTS----------------
Q3EBD9_ARATH/70-142TCAGLMG----------------------------....GEKC--------S.DQ--VMSEILQ----------------
D7MVA2_ARALL/48-118ACAEKPS----------------------------.....SIC--------G.GE--IFQNVLD----------------
B9SVP8_RICCO/47-111DCWNALI----------------------------...EIKSC--------S.NE--IILFFL.----------------
W5I1G9_WHEAT/44-110QCWEALL----------------------------...DIKSC--------T.GE--IILFFL.----------------
U5DGU8_AMBTC/38-101QCLMSVA----------------------------...LVAGC--------A.QE--VYSFFQ.----------------
D7MSB1_ARALL/48-110KCWSSLF----------------------------...NVEGC--------V.LE--IAKSIFS----------------
D7LBY0_ARALL/72-145NCSKKMD----------------------------V...PYQC--------T.VE--VLADIIQ----------------
Q9LXX9_ARATH/44-121KCMAKLS----------------------------.....SRC--------A.MY--VTDAICT----------------
A7REG6_ARATH/64-136ACPKKPS----------------------------.....SKC--------D.DE--IFNNMLD----------------
B9HQH8_POPTR/62-126ECLATIK----------------------------..AHADIC--------L.HE--VASLVLT----------------
M4F9M9_BRARP/52-124DCWNAAL----------------------------...ELKSC--------T.DE--IVKFFMS----------------
K7N3Y2_SOYBN/45-109NCWDSLF----------------------------...ELQAC--------T.GE--VITFFL.----------------
M4FC77_BRARP/213-288.CLDKVE----------------------------....TGYC--------G.AK--ILTDMLD----------------
M4CIW6_BRARP/37-108QCVVKIS----------------------------.....PNC--------A.LK--IISQVFG----------------
B9SE79_RICCO/48-112SCWDSLV----------------------------...QLQAC--------T.GE--IILFFL.----------------
K7KX55_SOYBN/121-191KCAEQLG----------------------------......YC--------G.EQ--VYQKLIH----------------
K4D4G7_SOLLC/44-108DCFNALA----------------------------...EIKSC--------T.NE--IVAYFT.----------------
B9GGU6_POPTR/50-114ECWNALV----------------------------...EIKSC--------T.NE--IVLFFM.----------------
U7DW65_POPTR/42-112QCHAKVT----------------------------.....KRC--------A.IE--ISNSIY.----------------
D7LQP6_ARALL/70-141ACPKKPS----------------------------.....PKC--------E.DE--IFNNMLD----------------
A8MQ83_ARATH/72-148NCGKKMD----------------------------MPYGPYQC--------A.DE--VIAYIVQ----------------
M4F142_BRARP/86-160ACFQNLN----------------------------....SLDC--------G.DN--IFKNMLD----------------
D7MQQ8_ARALL/38-109TCLVKIT----------------------------.....PKC--------A.LD--IIAVVFE----------------
U5GKZ5_POPTR/42-112ECHTKVT----------------------------.....KRC--------A.IE--ISNSIY.----------------
I1IN82_BRADI/69-133ECWGAVA----------------------------...ELRAC--------T.DE--MVLFFL.----------------
K4C587_SOLLC/77-151KCLQNIS----------------------------.....DDC--------G.VI--IFNKIFD----------------
Q3ECV9_ARATH/81-154ACAMKQS----------------------------.....WIC--------L.NV--VFENMKD----------------
W1PLV8_AMBTC/49-113ECWNALA----------------------------...ELSSC--------S.GE--IILFFM.----------------
K4D4G3_SOLLC/55-119ECWDSLF----------------------------...ELQAC--------T.GE--IVLFFV.----------------
B9IKH4_POPTR/49-122RCEKPLA----------------------------..TKFPSC--------S.NA--TLAAIFK----------------
A5AZZ7_VITVI/45-108ECWNALM----------------------------...EIRQC--------T.NE--IILFFL.----------------
M0ZZI9_SOLTU/49-111KCVASVL----------------------------...NVPGC--------V.EE--IITSFLR----------------
K7KX59_SOYBN/86-158GCMVKMG----------------------------.....SEC--------G.KE--VFDKLMH----------------
I1K1Y8_SOYBN/51-124DCASKLK----------------------------.....PHC--------G.EQ--IFFSVFV----------------
D7MTL8_ARALL/48-110KCWSSIF----------------------------...NVQGC--------N.IE--ILKSALT----------------
I1QJT2_ORYGL/79-143.CWESVV----------------------------..GTSPPC--------A.RD--VLLSLAL----------------
U5DBS7_AMBTC/38-100.CFGAVT----------------------------...YLGGC--------I.QS--LIKFITK----------------
EC14_ARATH/47-111ECWNALY----------------------------...ELKSC--------T.NE--IVLFFL.----------------
K7KX55_SOYBN/32-108ECAKHIG----------------------------.....PQC--------G.KE--ILGKVLL----------------
Q9LUB3_ARATH/33-97DCWSSLE----------------------------...VIPDC--------V.PE--IFRSITN----------------
I1QY08_ORYGL/55-119ECWSAVT----------------------------...KLGSC--------T.NE--IVLFFV.----------------
K7L6R0_SOYBN/36-100ECWSNLI----------------------------...VLKSC--------S.NE--IMHFFI.----------------
M0TA67_MUSAM/60-124DCWNALL----------------------------...ELRSC--------T.NE--IVLFFI.----------------
M1ASC9_SOLTU/60-130NCTNNIS----------------------------.....QPC--------G.PE--IVTTLFK----------------
W5I3U0_WHEAT/51-117QCWEILM----------------------------...DIRSC--------T.GE--IILFFL.----------------
M4DW17_BRARP/37-100ECMSSMF----------------------------...VIPNC--------I.PE--IIQSLVN----------------
Q9C924_ARATH/63-134DCSDKMS----------------------------.....SKC--------N.VE--MTEGLID----------------
M4EJU1_BRARP/45-107KCWSSLT----------------------------...SIQGC--------V.TE--IYKSVVT----------------
D7LL48_ARALL/69-143NCGVKMG----------------------------..PGGTEC--------N.IE--.YRDGIS----------------
Q3ECV8_ARATH/86-158ACSEKPS----------------------------.....SKC--------G.NE--VFKNMLD----------------
Q9FYN3_ARATH/84-147KCLADCK----------------------------...DVKTC--------L.AD--IAKAFFT----------------
U5GF05_POPTR/42-112DCHKKVT----------------------------.....KRC--------A.IE--ISNSIY.----------------

PF13016

Q5Z9M9_ORYSJ/30-100QSRRLQLSSCQV---------------MRQQ-CCQQMRLM--------------------A--QQYHCQ--AICTMVQSI
PRO25_ORYSJ/32-104QPATFQLINNQV---------------MQQQ-CCQQLRLV--------------------A--QQSHYQ--AI.SIVQAI
AVLBB_WHEAT/153-224QIRVDQPTSCQN---------------VQHQ-CCRQLSQI--------------------P--EQYRCQ--AIHNVAEAI
D2KFG9_WHEAT/47-117RSQVVQHSSCLV---------------MWEQ-CCQQLKAI--------------------P--KQSRCE--AIHNVVHAI
I1I1L7_BRADI/190-267PSHMMQQSSCQV---------------MQRQ-CCQQLSQI--------------------D--VQSRCQ--AIRDVVDAI
M8A4Q2_TRIUA/135-215RPKTSQQNNCQL---------------KRQQ-CCRQLAHI--------------------S--EPSRCP--AIHNTVHAI
GDBB_WHEAT/132-208WSIILPPSDCQV---------------MRQQ-CCQQLAQI--------------------P--QQLQCA--AIHSVVHSI
GLTA_WHEAT/180-256RSQMLQQSICHV---------------MQQQ-CCQQLRQI--------------------P--EQSRHE--SIRAIIYSI

PF00234

RA16_ORYSJ/41-149-----PGTVDEQ---------------VRRG-CCRQLAAI...................DS--SWCRCD--ALNHMLRII
IAA2_WHEAT/37-143-----......A---------------VLRD-CCQQLADI...................NN--EWCRCG--DLSSMLRSV
PRO28_ORYSJ/47-143-----......V---------------MQQQ-CCQQLRMI....................A--QQSHCQ--AIS.SVQAI
RAG1_ORYSJ/39-150-----.....EQ---------------VWQD-CCRQLAAV...................DD--GWCRCG--ALDHMLSGI
NLTP1_ORYSI/28-112-----.......---------------PSAA-CCSGVRSLKAAAS..........TTADRR--TACNCL--KNAARGIK.
NLTP4_ORYSJ/30-115-----......A---------------PTGG-CCDGVRTLNSAAA..........TTADRQ--TTCACL--KQQTSAMG.
A0A0E0NNN2_ORYRU/30-95-----.......---------------PTAA-CCSSLR.....................AQ--QGCFCQ--FAKDPRYG.
NLTP3_ORYSI/32-117-----......S---------------PSSS-CCSGVRTLNGKAS..........SSADRR--TACSCL--KNMASSFR.
A9_ARATH/27-87-----.....PA---------------ANSN-CCAALQAT....................N--KDCLCN--ALR......
108_SOLLC/35-99-----......T---------------ASTE-CCNAVQSI...................N.--HDCMCN--TMR......
14KD_DAUCA/54-136-----VI.GSP.---------------PTLP-CCSLLEGLVN................LEA--AVCLCT--AIKANILGK
2SS1_ARATH/59-153-----......Q---------------LFQQ-CCNELRQE....................E--PDCVCP--TLKQAAKAV
2SS1_BRANA/16-122-----.....PP---------------LHQQ-YCNELQQE....................E--PLCVCP--TLRGASKAV
2SS2_ARATH/58-158-----.......---------------ILQQ-CCSELRQE....................E--PVCVCP--TLRQAARAV
2SS5_HELAN/53-148-----......Q---------------QLQQ-CCQELQNI....................E--GQCQCE--AVKQVFREA
2SS5_HELAN/190-290-----Q...RG.---------------LQQQ-CCNELQNV....................K--RECHCE--AIQEVARRV
2SS8_HELAN/49-139-----RM.REED---------------HKQL-CCMQLKNL....................D--EKCMCP--AIMMMLNEP
2SSE_BRANA/60-174-----.....P.---------------PPQQ-CCNELHQE....................E--PLCVCP--TLKGASKAV
2SSL_PICGL/52-156-----......Q---------------PSER-CCEELQRM....................S--PQCRCQ--AIQQMLDQS
2SS1_BEREX/40-137-----.....P.---------------HMSE-CCEQLEGM....................D--ESCRCE--GLRMMMMRM
B9SA35_RICCO/61-155-----......Q---------------QLQQ-CCNQVKQV....................R--DECQCE--AIKYIAEDQ
B9SA35_RICCO/162-256-----.....ER---------------SLRG-CCDHLKQM....................Q--SQCRCE--GLRQAIEQQ
2SS_SOYBN/43-152-----.......---------------HMQK-CCTEMSEL...................RS--PKCQCK--ALQKIMENQ
M4CYI5_BRARP/32-92-----.....PA---------------PNSN-CCIALQAT...................N.--KDCICN--ALR......
A6N9I7_ALLCE/31-116-----......A---------------PIAP-CCRALNDLRFVN...........TRNLRR--AACRCL--VGVVNRNP.
AVE3_AVESA/69-210-----......V---------------MRQQ-CCRQLEQI....................P--EQLRCP--AIHSVVQAI
CCDP_MAIZE/48-127-----KV.GLP.---------------QYEQ-CCPLLEGLVD................LDA--ALCLCT--AIKANVLGI
FIL1_ANTMA/31-90-----.....TT---------------PSSD-CCTALQSV....................D--HECLCN--TLR......
GDA0_WHEAT/146-275-----......L---------------LQEL-CCQHLWQI....................P--EQSQCQ--AIHNVVHAI
GDA2_WHEAT/143-280-----......L---------------VQQL-CCQQLWQI....................P--EQSRCQ--AIHNVVHAI
GDA5_WHEAT/152-306-----......L---------------LQQL-CCQQLLQI....................P--EQSQCQ--AIHNVAHAI
GDA6_WHEAT/155-283-----.....P.---------------LQQL-CCQQLWQI....................P--EQSRCQ--AIHNVVHAI
GDA8_WHEAT/46-175-----......L---------------LQEL-CCQHLWQI....................P--EQSQCQ--AIHNVVHAI
GDB1_WHEAT/134-288-----......V---------------MQQQ-CCQQLQQI....................P--EQSRYE--AIRAIIYSI
GDB2_WHEAT/184-310-----......V---------------MRQQ-CCQQLAQI....................P--QQLQCA--AIHSVVHSI
GDB3_WHEAT/87-228-----......V---------------MQQQ-CCQQLPQI....................P--QQSRYQ--AIRAIIYSI
GDBX_WHEAT/171-285-----......V---------------MQQQ-CCQQLAQI....................P--QQLQCA--AIHSVAHSI
A2Y665_ORYSI/48-178-----......G---------------LRMQ-CCQQLQDV....................S--RECRCA--AIRRMVRSY
HOG1_HORVU/166-288-----......V---------------MQQQ-CCLQLAQI....................P--EQYKCT--AIDSIVHAI
HOG3_HORVU/142-276-----......L---------------KRQQ-CCQQLANI...................N.--EQSRCP--AIQTIVHAI
HOR1_HORVU/143-282-----......V---------------LQQQ-CCQQLPQI....................P--EQFRHE--AIRAIVYSI
HPSE_SOYBN/8-77-----.......---------------TVDD-CCALIGGLGD................IEA--IVCLCI--QLRALGI..
IAAC1_WHEAT/30-140-----TE.PGNT---------------PRDR-CCKELYDA....................S--QHCRCE--AVRYFIGRR
IAAC3_WHEAT/43-159-----......L---------------AKLY-CCQELAEI....................S--QQCRCE--ALRYFIALP
IAC16_WHEAT/30-134-----......L---------------AKQQ-CCGELANI....................P--QQCRCQ--ALRYFMGPK
IAA1_HORVU/20-131-----.....ES---------------IQKD-CCRQIAAI...................GD--EWCICG--ALGSMRGSM
IAA1_WHEAT/6-115-----......A---------------VLRD-CCQQLAHI....................S--EWCRCG--ALYSMLDSM
IAA2_HORVU/37-144-----......D---------------VLRD-CCQEVANI...................SN--EWCRCG--DLGSMLRSV
IAA4_SORBI/7-111-----P...SPV---------------LKQR-CCRELAAV....................P--SRCRCA--ALGFMMDGV
IAA5_SORBI/4-106-----.....PV---------------LKER-CCSELEKL....................V--PYCRCG--ALRTALDSM
IAAA_HORVU/30-140-----SE.PGDT---------------PKDR-CCQELDEA....................P--QHCRCE--AVRYFIGRR
IAAE_HORVU/29-137-----......D---------------MKRR-CCDELSAI....................P--AYCRCE--ALRIIMQGV
IAAT_ELECO/6-114-----......E---------------MKAR-CCRQLEAI....................P--AYCRCE--AVRILMDGV
ITRF_MAIZE/34-143-----P...WPE---------------LKRR-CCRELADI....................P--AYCRCT--ALSILMDGA
LIM1_LILLO/29-88-----.....GA---------------PSEQ-CCSALRAV...................N.--HGCLCE--TIN......
MC1_PINRA/28-88-----....VK.---------------PSSE-CCDALKGT....................S--TSCVCK--SVR......
MEN8_SILLA/38-98-----.....TN---------------PSQE-CCAALSGV...................N.--HDCMCN--TLR......
NLT11_PARJU/4-91-----......E---------------PSKG-CCSGAKRLDGETK..........TGPQRV--HACECI--QTAMKTYS.
NLT21_PARJU/35-121-----......E---------------PSKE-CCSGTKKLSEEVK..........TTEQKR--EACKCI--VRATKGIS.
F2DCX3_HORVD/29-111-----G...AK.---------------PPAA-CCSGVKRLAGAAQ..........STADKQ--AACKCI--KSAAGG...
NLTP1_ARATH/29-114-----.....GV---------------IPPA-CCSGVKNLNSIAK..........TTPDRQ--QACNCI--QGAARALG.
NLTP1_BRANA/29-113-----.....P.---------------LPRG-CCTGVTNLNNMAR..........TTPDRQ--QACRCL--VGAANAFP.
A8YPK3_HORVU/29-113-----.......---------------PSGE-CCNGVRDLHNQAQ..........SSGDRQ--TVCNCL--KGIARGIH.
NLTP2_SOLLC/27-110-----......G---------------PLGG-CCGGVKGLLGAAK..........TPEDRK--TACTCL--KSAANSIK.
NLTP1_PRUAR/3-87-----.....GA---------------VPPA-CCNGIRNVNNLAR..........TTPDRR--TACNCL--KQLSGSIS.
NLTP1_TOBAC/27-110-----.....TG---------------PLGR-CCGGVKALVNSAR..........TTEDRQ--IACTCL--KSAAGAIS.
NLTP2_HORVU/37-102-----....TK.---------------PSGE-CCGNLR.....................AQ--QGCLCQ--YVKDPNYG.
NLTP3_HORVU/29-114-----G...AK.---------------PPVA-CCSGVKRLAGAAQ..........STADKQ--AACRCL--KSLATSIK.
M5W0S9_PRUPE/33-119-----.....GA---------------LNPS-CCTGVRSLYSLAQ..........TTADRQ--SICNCL--KQAVNGIPY
NLTPA_BRAOT/29-114-----.....GT---------------LPGA-CCTGVSKLNSMAR..........TTPDRQ--QACRCL--ETAARALG.
NLTPA_RICCO/3-88-----......S---------------PSAS-CCAGVQNLKTLAP..........TSADRR--AACECI--KAAAARFP.
NLTP1_WHEAT/26-110-----.......---------------PSGQ-CCDGVKNLHNQAR..........SQSDRQ--SACNCL--KGIARGIH.
NLTPB_RICCO/3-88-----....DTT---------------PSLT-CCAGVMELKRLAP..........TVKDKR--IACECV--KTAAARYP.
NLTPC_RICCO/28-112-----....DSK---------------PSQA-CCTGLQQLAQTVK..........TVDDKK--AICRCL--KASSKSL..
NLTP_AMACA/4-90-----G...ATP---------------PPAN-CCAGVRSLKAAAQ..........TVADRR--MACNCM--KSAAQKTK.
NLTP_BETVU/29-113-----.....PG---------------PSAA-CCGGIKSLNSAAA..........SPADRK--TACTCL--KSAATSIK.
NLTP_CICAR/27-111-----.......---------------PSAQ-CCGGVRNLNSAAV..........TTPDRQ--AACNCL--KSAAGSIS.
NLTP_DAUCA/30-116-----.....P.---------------VPLT-CCNVVRGLNNAAR..........TTLDKR--TACGCL--KQTANAVT.
NLTP_ELECO/4-90-----G...AA.---------------PSAS-CQSGVRSLNAAAR..........TTADRR--AACNCS--LKSAASRV.
NLTP_GERHY/28-112-----....GP.---------------VPPA-CCNGVRGLNNAAK..........TTPDRQ--TACGCL--KGILAANT.
NLTP_HELAN/28-112-----.....GA---------------VPPA-CCSGVKSLNSAAK..........TTPDRQ--AACGCL--KSAYNSIS.
NLTP_PINTA/34-119-----......T---------------PAAT-CCPSIRGLDSQVK..........ATPDRQ--AVCNCL--KTQAKSY..
A0A0K9Q9K1_SPIOL/30-113-----.....P.---------------LGGG-CCGGIKALNAAAA..........TTPDRK--TACNCL--KSAANAIK.
NLTP_STRHE/10-89-----....DKK---------------PSAA-CCSGLHPLAQTVK..........TVEDNK--AICRCL--KTAIKNFS.
NLTP_VIGUN/34-99-----.......---------------PSST-CCSKLK.V....................Q--EPCLCN--YIKNPSLK.
NLTP6_AMBAR/30-113-----......E---------------PSKA-CCTGVNNLNNSRK..........TKADRV--AVCNCI--KELTKSI..
O22110_PICAB/25-104-----.....TK---------------PDSS-CCSALISVI.................DKD--SQCLCN--LLNSDTVKQ
O22272_ARATH/48-125-----.....TK---------------PEKS-CCTGIETVL.................QYN--PQCICA--GLVSAGEMG
NLTP2_SOLPN/27-110-----......G---------------PLGG-CCGGVKGLLGQAQ..........TTVDRQ--TACTCL--KSAASSFT.
O24101_MEDTR/31-102-----.....PR---------------ADEA-CCGVLRRA...................N.--LPCLCG--YKSALTYY.
O24355_SILLA/25-110-----......S---------------PSDA-CCNGIKTVASTVK..........DKNDAV--LVCNCL--KDKLVDL..
O24440_PHAVU/29-112-----.....GA---------------VPAS-CCSGVRSLNAAAK..........TTPDRQ--.VCNCL--KSAAGAIP.
O24485_PINRA/36-122-----.....PQ---------------EESS-CCQGVQSLYGDAT..........TTEEIQ--QICTCL--KNEAINY..
O24486_PINRA/39-97-----......D---------------PTPE-CCAVLQTA...................N.--VDCICA--LVQ......
ATA7_ARATH/29-125-----......Q---------------PSPD-CCRGVTHLNNVVKFTSPGSRNRQDSGETE--RVCLCI--EIMGNANH.
O49178_ORYSA/42-149-----......A---------------VPGD-CCRQFPPV...................DY--SWCRCE--AISHMLGGI
O49644_ARATH/39-110-----......K---------------PTED-CCNDLKNAT.................MTQ--VDCLCD--NFLESLSF.
O64431_BRACM/21-86-----.....GQ---------------PSGD-CCAKLK.....................EQ--QPCLCG--FSKNPAFA.
YLS3_ARATH/36-113-----......S---------------PTPD-CCSGLKQVI.................NSD--MKCLCM--IIQERNDPD
O65368_ARATH/32-112-----VI.GNP.---------------SDTL-CCSVLQGLVD................LDA--AVCLCT--TIKANILGI
O65369_ARATH/55-137-----TL.GKP.---------------PVEP-CCSLIQGLAD................VEA--AVCLCT--ALKANILGI
O65561_ARATH/29-103-----G..PKVN---------------PSEA-CCRVVKRS....................D--IPCACG--RITASVQQ.
O81135_HORVU/27-92-----G...AK.---------------PSGA-CCANLG.....................AQ--QGCFCQ--YAKDPALGR
O81410_PICGL/53-146-----......Q---------------PSER-CCEELQRM....................S--PQCRCQ--AIQQTLEDV
O81872_ARATH/32-107-----S...QP.---------------PSRS-CCALIRPI....................D--VPCACR--YVSRDVTN.
O82439_ARATH/25-107-----TL.GNP.---------------PVKP-CCSLIQGLAD................LEA--AACLCT--ALKASILGI
NLTP2_PRUAR/3-68-----.......---------------SPTT-CCQKLR.....................EQ--RPCLCG--YLKNPSLR.
F2D8V2_HORVD/31-96-----.......---------------PTAS-CCSKMR.....................EQ--QPCMCQ--YARDPNLK.
P93198_9ROSI/39-132-----......Q---------------HFRQ-CCQQLSQM....................D--EQCQCE--GLRQVVRRQ
P93274_MALDO/2-73-----GI.GSS.---------------AKDA-CCPVLQGLVD................LDA--AICLCT--TIKAKLLN.
P93513_9POAL/63-154-----......E---------------VRNQ-CCKQLRQT....................T--SRCRCK--AIWTSIQGD
P93611_WHEAT/84-166-----VI.GSS.---------------ASDK-CCPLLSGVTG................LDA--ALCLCT--TIELKALNI
P93705_DAUCA/264-345-----GL.GDP.---------------NVNK-CCPVLAGLVE................LEA--AVCLCT--TIKLSLLN.
P93794_WHEAT/195-344-----......V---------------MQQQ-CCQQLRQI....................P--EQSRHE--SIRAIIYSI
PRF1_SOLLC/261-343-----GI.GGS.---------------AKQT-CCPLLGGLVD................LDA--AICLCT--TIRLKLLNI
PROA_ORYSI/43-134-----......L---------------LQQQ-CCMQLQGM....................M--PQCHCG--TSCQMMQSM
PUIA_WHEAT/48-138-----......E---------------LLGE-CCSRLGQM....................P--PQCRCN--IIQGSIQGD
PUIB_WHEAT/50-140-----......E---------------VREK-CCKQLSQI....................A--PQCRCD--SIRRVIQGR
Q00318_COILA/103-188-----......A---------------LRQQ-CCHQLRQV....................E--PLHRQQ--AIFGVVLQS
Q06763_SOYBN/68-149-----GL.GDP.---------------VANQ-CCPVLQGLVE................VEA--AVCLCT--TLKLKLLN.
Q09071_AVESA/48-166-----......V---------------MRRQ-CCRQLAQI....................P--RQLRCP--AIHSMVHAI
Q09072_AVESA/74-212-----......V---------------TRQQ-CCRQLAQI....................P--EQLRCP--AIHSVVQSI
Q39100_ARATH/48-126-----S...LP.---------------PTSN-CCALIKGLVD................LEA--AVCLCT--ALKANVLGI
ERLI1_ARATH/85-167-----QL.GQP.---------------SAQP-CCSLIQGLVD................LDA--AICLCT--ALRANVLGI
A0A0D3A8B1_BRAOL/28-112-----....GP.---------------LPSS-CCVAVKSLNQMAQ..........TTPDRR--QVCECL--KSAGKEIK.
Q39574_CATRO/55-137-----VI.GAP.---------------PKTP-CCSLIEGLAD................LEA--AVCLCT--AIKANVLGI
2SS_CUCMA/55-139-----......G---------------SFDE-CCRELKNV....................D--EECRCD--MLEEIAREE
Q39787_GOSHI/36-131-----......G---------------YIDS-CCQQLEKM....................D--TQCRCQ--GLRHATMQQ
Q39928_HELAN/52-143-----......Q---------------LLQQ-CCQELQNI....................E--GQCQCE--AVKQVVRDA
Q40335_MEDSA/84-165-----IV.GSP.---------------ASSK-CCTLIQGLAD................LDA--AVCLCT--AIKANILGI
Q40453_TOBAC/25-114-----G...GN.---------------PSVP-CCTGINNIYELAK..........TKEDRV--AICNCL--KNAFIHAG.
A2X812_ORYSI/52-133-----KV.GVP.---------------PAEP-CCPLLEGLVD................LEA--AVCLCT--AIRGNILGI
Q40997_PINST/58-160-----......Q---------------PSER-CCEELQRM....................S--PHCRCR--AIEQTLDQS
Q41125_PHAVU/45-126-----EL.GKP.---------------PKTP-CCNLIQGLAD................LEA--AVCLCT--ALRANVLGI
Q41168_RAPSA/29-141-----.......---------------LLQQ-CCNELHQE....................E--PPCVCT--TLKAASKAV
Q41320_SECCE/55-178-----......V---------------MQQQ-CCQQLAQI....................P--HHLQCA--AIHSVVHAI
Q41378_9ASTR/24-89-----.......---------------PTAQ-CCTKLK.....................EQ--SPCLCG--YLKNPTLK.
Q41543_WHEAT/137-262-----......V---------------MRQQ-CCQQLAQI....................P--QQLQCA--AIHSIVHSI
Q41848_MAIZE/215-296-----VI.GQE.---------------ARSK-CCPLVQGVAD................LDA--ALCLCT--TIRARLLN.
Q42044_ARATH/52-133-----VV.GSP.---------------PKTP-CCTLLQGLAN................LEA--AVCLCT--ALKANVLGI
Q42158_ARATH/29-94-----.......---------------QSEA-CCTKLR.....................EQ--QPCLCG--YMRNPTLR.
Q42392_ZINVI/30-95-----.......---------------PSSQ-CCAKIK.....................EQ--KPCLCQ--YMKNPSLK.
A0A0E0R296_ORYRU/65-146-----NV.GHG.---------------PYD.-CCPLLAGLAD................ADA--AVCLCT--AVKANVLGV
Q42487_POPNI/58-140-----TV.GTP.---------------PVKP-CCSVIQGLLD................LEA--AVCLCT--AIKANILGI
M0VYA0_HORVD/33-118-----......A---------------ISKE-CCSGVQGLNGLAR..........SSPDRQ--TACRCL--KSLATSIK.
Q43496_SOLLC/28-101-----FS.SVP.---------------PSEA-CCASIKAL....................G--QPCLCV--LINGPPIS.
Q43522_SOLLC/127-207-----VV.GSP.---------------PTLP-CCSLIQGLAN................LEV--AACLCT--AIRANILGL
F2E1T8_HORVD/29-111-----G...TS.---------------PSAG-CCSGVKRLAGLAR..........STADKQ--ATCRCL--KSVAGA...
Q96232_ASPOF/101-182-----GL.GDP.---------------VVNQ-CCPLIEGLVE................IEA--AVCLCT--TIRLKLLNI
Q9S7U3_ARATH/46-128-----QL.GTP.---------------PVKP-CCSLLNGLVD................LEA--AACLCT--ALKAKVLGI
Q9SA59_ARATH/25-103-----......S---------------PSWS-CCRQFSTVV.................QSS--PECLCS--VVNSNESSF
Q9SBW9_MAIZE/43-101-----......D---------------PSAD-CCSALSAV....................S--HECACS--TMG......
Q9SC06_TRIMO/34-125-----.....EE---------------VQNQ-CCQQLRQT....................T--PRCRCK--AIWTSIQGD
Q9SDS2_CAPAN/27-110-----.....SG---------------PLGR-CCGGVKGLLGAAK..........TPADRK--TVCSCL--KSAAGSIG.
Q9SDS4_CAPAN/19-102-----......G---------------PLGR-CCGVIKDLLKLCK..........TPHERR--KSCKCV--KTAANTIK.
F2CY84_HORVD/32-117-----.....GT---------------PARG-CCAGIQNLLAEAN..........NSPDRR--TICGCL--KNVANAAP.
Q9SET1_ARATH/222-304-----GL.GKSH---------------AKAE-CCPVLGGLLD................LDA--AVCLCT--TIKLKLLNI
Q9SHA0_ARATH/27-109-----......K---------------VPPV-CCAKVGALI.................RTN--PRCLCA--VMLSPLAKK
Q9SI70_ARATH/29-101-----.....TT---------------PVKE-CCDSIKEAV.................EKE--LTCLCT--IYTSPGLLA
Q9SKI0_ARATH/208-289-----GL.GDP.---------------AVNK-CCPLLKGLVE................VEA--AACLCT--TLKLKALDL
Q9SRS1_ARATH/32-105-----S..TLP.---------------PNGL-CCAAIKTL....................G--QPCLCV--LAKGPPIV.
Q9ST25_MAIZE/51-132-----EA.GKV.---------------PAEP-CCTLIKGLAD................FEA--AVCLCT--AIKANVLGV
Q9STH5_ARATH/42-113-----.....P.---------------PSQE-CCTAVETAL.................TTQ--LSCLCG--FIKSPMLLI
Q9SU32_ARATH/34-115-----KL.GAP.---------------AMRP-CCSILFGLID................LDV--AVCLCT--ALKLSLLGI
Q9SUV8_ARATH/28-104-----......Q---------------TVRP-CCTLVDGLDA................YVA--SVCICD--SIKIYGIS.
Q9SUW7_ARATH/37-117-----IL.INNQ---------------SVLP-CCTLVTGLDA................ATA--SACICN--AVRITIFN.
Q9SUX0_ARATH/37-116-----TA.GDP.---------------RARQ-CCTALNGLTN................VQV--TDCLCF--IFRPIPLV.
Q9SUX3_ARATH/50-132-----TP.GTP.---------------PVTP-CCSLIEGLVD................LEA--AICLCT--ALKASVLGI
Q9SUZ2_ARATH/48-121-----S..PIP.---------------PTEI-CCSAVVTL....................G--RPCLCL--LANGPPLS.
SCA_LILLO/25-109-----.....GV---------------IPPG-CCAGVRTLNNLAK..........TTPDRQ--TACNCL--KSLVNPSL.
Q9SXE7_ARATH/212-293-----GL.GNP.---------------VENV-CCPVLQGLLE................LEA--AVCLCT--TIRLKLLNL
Q9XF30_ORYSI/41-111-----G...GP.---------------VPPA-CCAQLR.....................AQ--AACLCA--YARSPNYG.
NLTP5_ARATH/29-114-----....GF.---------------IPRG-CCSGVQRLNSLAR..........TTRDRQ--QACRCI--QGAARALG.
2SS1_SESIN/54-141-----.......---------------HFRE-CCNELRDV....................K--SHCRCE--ALRCMMRQM
NLTP8_ARATH/28-112-----......N---------------PPET-CCDGVKSLAAATT..........TSADKK--AACQCI--KSVANSV..
NLTL2_ARATH/27-105-----.....VK---------------PEGT-CCSGLKTVV.................RTG--PECLCE--AFKNSGSLG
Q9ZSL7_BRANA/27-108-----G...GP.---------------VPAP-CCAGVSKLNSMAK..........TTPDRQ--QACKCL--KTAAKN...
Q9ZTW2_FRAAN/73-155-----TI.GTP.---------------PVQP-CCTLIQGLAD................LEA--AVCLCT--AIRASILGI
NLTP7_ARATH/29-118-----G...ITS---------------PGPQ-CCNGVRKLNGMVL..........TTLDRR--QACRCI--KNAARNVG.
XYP11_ARATH/40-120-----.....IK---------------PEAA-CCPELAGMV.................QSS--PECVCN--LYGGGASPR
YY1_ORYSJ/31-94-----GQ.PLPA---------------PPAE-CCSALGAV....................S--HDCACG--TLD......
ZEB2_MAIZE/86-172-----......A---------------LQQQ-CCHQIRQV....................E--PLHRYQ--ATYGVVLQS
ZM33_MAIZE/45-108-----QV.PPA.---------------PGPE-CCSALGAV....................S--RDCACG--TFS......

PF14368

Q1G3I0_ARATH/16-107..G...S...VT---------------PTED-CCTDLKSA-----------.....TS.TQ..VTCLCD--NYIANP..-
Q3ECK0_ARATH/8-101..T...T...TT---------------PVKE-CCDSIKEA-----------.....VE.KE..LTCLCT--IYTSPG.L-
B9RBQ4_RICCO/7-100..T...T...TT---------------PPDS-CCSSIKDA-----------.....VT.ND..LTCLCN--LYNTPG.L-
Q9LE56_ARATH/14-113..L...A...TP---------------PPAT-CCMPLNEI-----------.....VA.KD..ATCLCA--VFNNVD.M-
Q0D9K5_ORYSJ/20-116..A...T..AAP---------------PPAS-CCGPLREA-----------.....AA.NE..TACLCA--ILTNKA.A-
Q9SUV6_ARATH/10-114..L...N...AF---------------PSKE-CCKDLKTA-----------.....SK.RE..VTCLCN--NVIAHP..-
C5Z9F1_SORBI/22-116..T...A...AA---------------PAPA-CCGPLREA-----------.....AA.NE..TACLCA--MLLNRA.A-
C3SA92_BRADI/13-112.SS...T...AR---------------PGKT-CCGEVKTA-----------.....VS.NPGIVDCLCA--AIASKQ..-
Q9LJ85_ARATH/13-108..N...G...TS---------------PSSD-CCNSLRSL-----------.....TT.GG..MGCLCL--IVTGTV..-
Q7XIG9_ORYSJ/15-115GSP...E...AR---------------PAKD-CCAGVKSA-----------.....LG.SPAAVACLCG--ALGQ.D..-
C5X2J9_SORBI/14-111GST...Q...GK---------------PTSG-CCTGVKAA-----------.....LK.SPATVACLCA--AFGQ.N..-
A9S0T9_PHYPA/9-107..P...R...VK---------------PDKR-CCDAIRQF-----------LPPRKQK.SA..IDCLCR--LATSKE..-
B9RIH6_RICCO/12-107..TG.PK...FS---------------PSPS-CCAVVKNV-----------.........D..VACVCD--LITKEI..-
B9RIH3_RICCO/10-107..KPGPK...VP---------------PSQG-CCQVVKK.-----------........AD..IPCACK--LVTSEI..-
A9TY60_PHYPA/11-108.SN...S...ST---------------PTPT-CCSSILAL-----------.....NT.KQ..PDCLCQ--IMTQLL.N-
B9HP13_POPTR/12-110PGP...R...VL---------------PSDA-CCQAAKQV-----------.....TV.GD..LPCVCK--LVTPAT..-
A9T6D1_PHYPA/9-104..A...N...VQ---------------PSAA-CCRALSSF-----------.....AT.NT.GEDCLCA--AASS.Q..-
B9HP10_POPTR/10-105..K...TGPKTP---------------PSLG-CCQVVKTL-----------.........N..VNCVCR--FVTPQV..-
B9RTN3_RICCO/10-113NNM...T...ET---------------PTSQ-CCDALEKA-----------.....FSSSE..GNCFCY--LIKQ.P.L-
B9RIH4_RICCO/10-105QGS...S...AK---------------PSPE-CCKVVKNV-----------.........N..VPCVCS--HVTKQI..-
B9RZC4_RICCO/7-99..N...P...AA---------------PSDA-CCAALSK.-----------........AD..LQCLCF--YKNNYPWL-
A9SQH6_PHYPA/103-196..D...T..LTY---------------PDTS-CCDEVGYL-----------.....YK.LE.GADCFCD--EVRSLT..-
B9SEE9_RICCO/14-106..L...G...KA---------------PSPA-CCGRVR..-----------......V.SH..VECICP--AITPKL..-
B9SEE8_RICCO/14-105..Y...G...RP---------------PSPQ-CCQRIR..-----------......V.TH..IECVCP--VVTPKL..-
A9SQH9_PHYPA/117-210.DA...T...SY---------------PDNT-CCDVILNM-----------.....YNLRG..ANCFCD--AVRSLV..-
B9GVR5_POPTR/18-112..T...T...TT---------------PPDN-CCNPIKEA-----------.....VA.KE..LPCLCK--LYNDPN.L-
B9H8A8_POPTR/14-108..N...G...SS---------------PTGS-CCSSFKSL-----------.....MS.TG..MDCACL--LITANV..-
B9HUT8_POPTR/13-107NRV...T...DT---------------ATSR-CCDAFSKA-----------.....FNSSD..GNCFCY--LIKQPL..-
D7T8D6_VITVI/12-114..A...K...AK---------------VPPT-CCTKVTAL-----------.....IN.TA..PKCLCA--VVLSPL..-
I1PAV8_ORYGL/35-130RST...L...TR---------------PDKG-CCGALAGV-----------.....VD.GE..AACLCG--LVGGYG..-
I1QT58_ORYGL/18-119..D...D...SS---------------MLGP-CCDALGKV-----------.....FK.SD..RACLCQ--IWEMARND-
I1R180_ORYGL/22-119.GG...A...AV---------------ASPA-CCAAYSAA-----------.....FD.AD..PFCLCY--IADGVYGR-
Q1G2Y5_ARATH/16-109.GG...G...SF---------------PTSD-CCGALKSL-----------.....TG.TG..MDCLCL--IVTAGV..-
C6_ORYSJ/12-114.KA...A...TA---------------APEG-CCAGLSSI-----------.....VK.GE..AVCLCH--IVNHTLER-
Q75GY5_ORYSJ/27-127..N...S...ST---------------PSDA-CCEQMRAM-----------.....FQ.SQ..APCLCA--AVASAP..-
Q8S077_ORYSJ/23-111..R...E...RA---------------PRRE-CCDAVRG.-----------........AD..FKCLCK--YRDELR..-
Q9SUV7_ARATH/19-112..L...D...LT---------------PSEE-CCNDLKSS-----------.....ST.IQ..VNCLCD--NFIAHP..-
U5G1T3_POPTR/18-113..N...G...TS---------------PTAG-CCGALKNL-----------.....TS.NG..MDCFCL--IVTGSV..-
U5GQ18_POPTR/24-115..Y...G...KL---------------PSPA-CCERVRV.-----------........SH..VECVCP--VITPKL..-

PF14547

F2DU32_HORVD/35-120------KINVP.---------------ANQQ-CCPLIGQL----------------VKLDV--AACLCA--ALKLNVIG-
D7ME35_ARALL/36-114------ILNAQ.---------------TVSR-CCTLVAGL----------------DASVA--SVCICN--AVRISLLN-
A8MRQ5_ARATH/577-656------FLDFR.---------------LAQP-CCTLIRNL----------------SDAEA--AACLCD--LVRARRST-
D7ME37_ARALL/85-164------FLGFG.---------------RAQP-CCSLIRNL----------------SDADA--LACLCE--SVRAPSGS-
D7ME34_ARALL/31-113------LINKQ.---------------TVLP-CCTLVAGL----------------DAAAA--SACICN--AVRITIFN-
D7ME36_ARALL/7-89------TTS...---------------NVAQ-CCSILSGL----------------NAPLV--SVCACE--ALRLNILN-
D7MAX1_ARALL/157-241------GLGKSY---------------AKAK-CCPLLEGL----------------ASVDA--AVCLCT--TIRAKLLN-
I1PQ77_ORYGL/6-89------QAGAH.---------------LGSK-CCALVDGL----------------AAAEA--AACFCT--TIKESVLG-
B9S3J8_RICCO/215-298------GIGSS.---------------AKDA-CCPVLQGL----------------VDLDA--ALCLCT--TIKAKLLN-
D7ME38_ARALL/36-117------TAGDP.---------------RARQ-CCTAINGL----------------ADVQV--ADCLCF--IFRP....-
C5Z4Z5_SORBI/237-320------VIGQE.---------------ARSK-CCPLVQGI----------------ADLDA--ALCLCT--TIRLRLLN-
C5Y909_SORBI/46-127------QAGAQ.---------------LGSK-CCDVVQGL----------------AAAEA--AACFCT--TVKETVLG-
F4JLV4_ARATH/297-375------LLTTG.---------------RAEP-CCSIVRNV----------------SDLDA--VTCFCK--SVGARRFS-
I1QBL2_ORYGL/229-307------.IGNSL---------------MKYP-CCSQLYNL----------------QYDTA--AACLCD--AMKIDLRV-
M4F7Y5_BRARP/170-253------GLGDP.---------------AANK-CCPLLKGL----------------VEVEA--AACLCT--TLKLKALN-
W4ZSZ5_WHEAT/138-222------KVGVPP---------------LNDR-CCPLLNGL----------------VDLDA--AICLCT--AIKADVLG-
W5AJU0_WHEAT/30-113------KVNVP.---------------RHEP-CCSLLDGL----------------VGLDA--ALCLCA--NIDANVLG-

PF05617

M4FC94_BRARP/72-146----------.N.E.P...........VSRE.CCMKVVSA-------------------.G--KECYLE..ISKL.MFR-
B9S177_RICCO/41-104----------.N.GETH..........LGHG.CCQAIRTI-------------------.S--EQCWPN..LIDTLGFT-
U5FMS5_POPTR/61-132----------DE.K.S...........LDYD.TCSE.VTG-------------------SG--KECNDA..LVKY.VAE-
M1BC58_SOLTU/78-151----------SG.KYSD..........VE.E.CCAQLLAL-------------------.G--IKCHNA..IMES.TLL-
M4FCA2_BRARP/71-146----------.N.K.P...........VSRD.CCLMVVRA-------------------.G--KECYMK..IRKF.MFQ-
M4F146_BRARP/69-143----------EG.KPV...........LLAE.CCGELLRI-------------------.G--KDCYLG..TVQV.ILS-
M4FC93_BRARP/72-147----------.N.K.P...........ISRE.CCQKVVKA-------------------.G--KECYME..IRKL.MFR-
EC12_ARATH/45-109----------.N.GETK..........LGVD.CCQAVEVI-------------------.T--TDCWPA..MLTSLGFT-
M4FC76_BRARP/105-178----------KT.TTQ...........LTNE.CCLILLKI-------------------.G--KDCQLG..VAHI.ISS-
D7LVH8_ARALL/44-116----------SH.GP............LKQHGCCLEVYHM-------------------.G--RVCLNI..VTKH.VIQ-
M4F8U3_BRARP/34-96----------.G.QIGS..........IGHS.CCHAFLGI-------------------.S--TECASH..VFVFAP..-
K4CB92_SOLLC/64-137----------DN.E..D..........IDKK.CCHDLVGM-------------------.G--LKCYKT..LIKV.YIG-
B9SN88_RICCO/61-124----------.L.KF.N..........VDAK.CCQSIQQV-------------------.I--DDCVSA..IFGNFDNP-
B9SVP5_RICCO/53-119----------.N.GQTDIT........IGAD.CCSAISII-------------------.A--HNCWPS..MLTSLGFT-
B9GGT7_POPTR/48-111----------.N.GETY..........LRPS.CCHAIRII-------------------.G--HHCWPS..MLASLGFT-
I1I7L3_BRADI/74-140----------PD.LAVR..........VSRV.CCGILHKV-------------------.G--DRCIRG..LFPASPFG-
K7KX58_SOYBN/72-144----------NK.N.N...........VTDC.CCGRLVET-------------------.G--LPCHIN..MAKA.LIR-
K7KX56_SOYBN/72-143----------DG.R.............ITKP.CCQELVKN-------------------.G--LQCHTA..MVKS.LIR-
K7MQC1_SOYBN/160-232----------GR.G.T...........ISKD.CCKNVVTD-------------------VG--KTCYDN..MTKY.VLG-
M0TQL0_MUSAM/66-131----------.N.GETY..........LGPS.CCRAIRVI-------------------.V--HHCWAAEVMLAALGFT-
EC11_ARATH/57-120----------.N.GETY..........IGPG.CCSAIRTI-------------------.G--RKCWPT..MIGVLGFT-
B9T247_RICCO/77-140----------.H.NI.N..........LDAS.CCSVVDAI-------------------.K--QDCVSP..IFAHFSNP-
M4FC95_BRARP/79-152----------.N.E.H...........VSRE.CCLKVVRA-------------------.G--KQCFIE..TNKL.MFQ-
D7KC93_ARALL/38-103----------NG.T.............LIES.CCHDLVQE-------------------.G--KVCHDN..LIKY.IAD-
M4EKA3_BRARP/43-105----------.G.KFGN..........VGVA.CCKAFSTI-------------------.D--ANCWPH..MFPLNP..-
D7MTL8_ARALL/141-203----------.R.KFDN..........VGPM.CCKALSAM-------------------.D--AKCWPQ..MFPLNP..-
C5YSL3_SORBI/84-148----------.N.GESY..........IGPE.CCVAIRGA-------------------.T--RYCWPA..MLASVGFT-
A8MS74_ARATH/69-143----------RN.K.S...........FSKD.CCRVLVKG-------------------.G--RKCYTE..WMKM.FFQ-
U5GVU7_POPTR/48-112----------.N.GETQ..........LGRS.CCQALRTI-------------------.G--EHCWPN..MIDTLGFT-
Q6ZKQ3_ORYSJ/79-152----------.S.LLLHDGERHPWGVHVGAP.CCGVLQTV-------------------.G--DRCFRD..LLTDSPFR-
K7LY71_SOYBN/49-122----------GN.K.T...........VSNG.CCDKLVND-------------------VG--KVCHDD..MTKY.ILT-
B9SXP3_RICCO/41-109----------...EHSSTTVSSPEMAKLISP.CCQVVNKI-------------------.N--MDCWPY..LLPSK...-
K7KW29_SOYBN/52-115----------.N.GKTY..........LGHG.CCQAIRVI-------------------.G--HDCWPN..IVASLGFT-
B9HRY2_POPTR/41-112----------GK...P...........VTLE.CCQKLLLM-------------------.G--KACDDA..LMRV.VLE-
M4DW18_BRARP/37-99----------.G.EFGT..........IGHS.CCHAFLGL-------------------.S--ADCITE..RFAFAP..-
M4DVD8_BRARP/72-146----------.N.E.P...........MSRE.CCLMVLHN-------------------.G--EGCNML..FAKF.SSR-
B9RBY2_RICCO/99-162----------HG.QVSE..........IGNA.CCHAILAI-------------------.Q--DNCWPQ..MFPLPP..-
B9P5Y5_POPTR/32-100----------GT.GRIA..........IGPA.CCKVINEL-------------------.T--DVCWAR..LFPSIPAT-
B9GU63_POPTR/46-117----------NN.N.N...........PSDS.CCQKLVAT-------------------.G--IDCHNA..FTEFLESK-
M4FC77_BRARP/64-140----------ET.TTP...........LTIG.CCRNLLKI-------------------.G--RDCHLV..VAKFESVP-
Q8S8C9_ARATH/73-145----------.N.K.S...........ASRD.CCLGIVKA-------------------.G--KECHME..YMKL.FFQ-
B9SN89_RICCO/73-136----------.N.KV.N..........LDAK.CCQSVQQI-------------------.V--DDCISA..IFGHFDNP-
Q3EBD9_ARATH/70-142----------.N.I.P...........TSRY.CCLKMIIY-------------------.G--QECHMV..LRNL.LFQ-
D7MVA2_ARALL/48-118----------EKNL.............VTDE.CCRDILKI-------------------.G--KDCHLG..LIKI.IFS-
B9SVP8_RICCO/47-111----------.N.GHTD..........IGAD.CCRSIAIF-------------------.T--HNCWPA..MLTSIGFT-
W5I1G9_WHEAT/44-110----------.N.GEAY..........LGPG.CCRAIRVI-------------------.E--QRCWAADLMLSVIGFT-
U5DGU8_AMBTC/38-101----------.T.GKNY..........PGVD.CCEAVLSV-------------------.G--EQCWAS..FSVPGRLS-
D7MSB1_ARALL/48-110----------.G.KFEN..........VEAA.CCKAFLTL-------------------.D--TNCWPQ..MFPLNP..-
D7LBY0_ARALL/72-145----------.N.K.S...........VSRD.CCRGIVRA-------------------.G--KECHTE..WMRL.FFQ-
Q9LXX9_ARATH/44-121----------IH.GPMR..........LKHHGCCLEVFHM-------------------.G--RACLKI..VTNH.VIQ-
A7REG6_ARATH/64-136----------GT.T.P...........VTNE.CCHDILKT-------------------.G--KDCHLA..LVKI.IFS-
B9HQH8_POPTR/62-126----------FQ.KNL...........VGPK.CCSALAVI-------------------.D--DKCKPK..GFSFDPFL-
M4F9M9_BRARP/52-124----------RN.GTAEPGVTGG....IDKD.CCGAIGLI-------------------.G--KECWSV..MFTSLGLT-
K7N3Y2_SOYBN/45-109----------.N.GETY..........LGPS.CCQAIRIV-------------------.G--HDCWPD..MIASLGFT-
M4FC77_BRARP/213-288----------ET.TTP...........LPIE.CCRYLLKI-------------------.G--RDCHLV..VAKYETIP-
M4CIW6_BRARP/37-108----------DG.V.............VSIP.CCKELVQE-------------------.G--KECHDT..LVKY.IAD-
B9SE79_RICCO/48-112----------.N.GETY..........LGHS.CCEAIRII-------------------.T--KQCWPT..MIDTLGFT-
K7KX55_SOYBN/121-191----------DK.N.............ITRH.CCKELVKM-------------------.G--KPCHDD..MVKA.LIR-
K4D4G7_SOLLC/44-108----------.I.GTID..........IDLP.CCQAIFVI-------------------.T--HHCWPS..MLTTLGFT-
B9GGU6_POPTR/50-114----------.T.GQAD..........IGPD.CCRAIHTI-------------------.T--HNCWPA..MFTSLGFT-
U7DW65_POPTR/42-112----------NN.N.T...........PSEY.CCQKHITT-------------------.G--KACNND..FIKLFMSR-
D7LQP6_ARALL/70-141----------ET.M.P...........MTDE.CCRDVLNT-------------------.G--KDCHLA..MVKI.IFS-
A8MQ83_ARATH/72-148----------.N.K.S...........VSRV.CCWGIVKA-------------------.G--KECHKK..WTGL.FFE-
M4F142_BRARP/86-160----------EA.AQV...........LSNE.CCHDLLKI-------------------.S--KDCYLG..MTQS.ILS-
D7MQQ8_ARALL/38-109----------NG.T.............ISDP.CCNDLVKE-------------------.G--KMCHDT..LIKY.IAD-
U5GKZ5_POPTR/42-112----------TN.K.T...........PSEY.CCQKHITT-------------------.G--KACNDD..FIKLFISK-
I1IN82_BRADI/69-133----------.N.GQSY..........LGRP.CCLAIRTV-------------------.T--AHCWPA..MLDAVGFT-
K4C587_SOLLC/77-151----------NG.KPTD..........VD.E.CCGQLLTL-------------------.G--KKCHHT..IIES.TIH-
Q3ECV9_ARATH/81-154----------EM.M.P...........IINE.CCREILKM-------------------.G--KDCHFR..LVEG.WSA-
W1PLV8_AMBTC/49-113----------.N.GETY..........LGKD.CCRGVRVI-------------------.T--RHCWPS..MLTSVGFT-
K4D4G3_SOLLC/55-119----------.N.GETY..........LGQD.CCSAIRII-------------------.E--RQCWPS..MLDSLGFT-
B9IKH4_POPTR/49-122----------NK.R.............IPNK.CCPEVTKF-------------------.S--KICYHA..LGLF.VAT-
A5AZZ7_VITVI/45-108----------.N.GQTV..........LGPE.CCQAISII-------------------.T--RNCWPA..MLTSLGFT-
M0ZZI9_SOLTU/49-111----------.T.QLRL..........IGPQ.CCKAVLDI-------------------.H--DSCWPK..IFPF..SS-
K7KX59_SOYBN/86-158----------GK.I.N...........VTKH.CCEKLVKM-------------------.G--ESCHIN..MAKA.LIR-
I1K1Y8_SOYBN/51-124----------GN.Q.T...........VTNR.CCLSLLND-------------------MG--KACHTD..VTKY.AVT-
D7MTL8_ARALL/48-110----------.G.KFEN..........VGPT.CCKAFTEL-------------------.D--AKCWPK..IFPLNP..-
I1QJT2_ORYGL/79-143----------HAPR.............LSGE.CCTVLARA-------------------.G--DKCVAG..VFSGLPSG-
U5DBS7_AMBTC/38-100----------KGSN.............PEHE.CCDAVLKI-------------------.G--VECIAN..LLIVGGID-
EC14_ARATH/47-111----------.N.GETK..........LGVS.CCESVDII-------------------.T--TNCWPA..MLTSLGFT-
K7KX55_SOYBN/32-108----------PFEEPI...........VSTN.CCYKLIQT-------------------.G--YQCHTR..LTQYFLKS-
Q9LUB3_ARATH/33-97----------.G.QFGN..........VGPS.CCHAFIGL-------------------.D--TECIPQ..MFIFAP..-
I1QY08_ORYGL/55-119----------.N.GESY..........LGPD.CCVAIRTV-------------------.T--RRCWPA..MLASIGFT-
K7L6R0_SOYBN/36-100----------.N.GQAD..........IGPN.CCCAIRVI-------------------.T--HDCWPE..MLTSLGYS-
M0TA67_MUSAM/60-124----------.N.GESY..........LGLD.CCRAIRVI-------------------.T--RHCWTS..MLTTLGFT-
M1ASC9_SOLTU/60-130----------YK.N.............ITSN.CCNELVQS-------------------.G--LECHAT..LVKL.LIR-
W5I3U0_WHEAT/51-117----------.N.GEAY..........LGPG.CCRAIRAI-------------------.E--QRCWAADAMLSVIGFT-
M4DW17_BRARP/37-100----------.G.EIGT..........VSHS.CCHAFLGL-------------------.S--ADCITE..RFDFTP..-
Q9C924_ARATH/63-134----------DK...P...........VSED.CCVNFLKI-------------------.G--RECHEG..LMTF.VFA-
M4EJU1_BRARP/45-107----------.G.KFEN..........VGPA.CCKAFTDV-------------------.D--AKCWPT..MFPLNP..-
D7LL48_ARALL/69-143----------RN.K.S...........TSRD.CCLMIVKA-------------------.G--KQCHTE..LMKL.FLQ-
Q3ECV8_ARATH/86-158----------ET.V.P...........ITDE.CCRDILKI-------------------.G--KDCHLG..LVKL.IFA-
Q9FYN3_ARATH/84-147----------.R.KPA...........IGLD.CCASIQKM-------------------.D--EDCDKT..VFGAYHNP-
U5GF05_POPTR/42-112----------TD.K.T...........ASEY.CCQKHVTT-------------------.G--KACHDD..FIKLFISK-

PF13016

Q5Z9M9_ORYSJ/30-100MQ------------------------------------------------------------------------------
PRO25_ORYSJ/32-104VQ------------------------------------------------------------------------------
AVLBB_WHEAT/153-224RH------------------------------------------------------------------------------
D2KFG9_WHEAT/47-117IL------------------------------------------------------------------------------
I1I1L7_BRADI/190-267IK------------------------------------------------------------------------------
M8A4Q2_TRIUA/135-215IM------------------------------------------------------------------------------
GDBB_WHEAT/132-208IM------------------------------------------------------------------------------
GLTA_WHEAT/180-256I.------------------------------------------------------------------------------

PF00234

RA16_ORYSJ/41-149YRESGAADAG.................................................HPMAEVF........RGCRRG
IAA2_WHEAT/37-143YQELGVRE......................................................GKE.V......LPGCRKE
PRO28_ORYSJ/47-143VQQLRLQQFAS................................................VYFDQS.Q......AQAQAM.
RAG1_ORYSJ/39-150YRELGATEAG..................................................HPMAE.V......FPGCRRG
NLTP1_ORYSI/28-112...............................................................................G
NLTP4_ORYSJ/30-115...............................................................................G
A0A0E0NNN2_ORYRU/30-95..............................................................................RY
NLTP3_ORYSI/32-117...............................................................................N
A9_ARATH/27-87................................................................................
108_SOLLC/35-99................................................................................
14KD_DAUCA/54-136..............................................................................NL
2SS1_ARATH/59-153RLQGQ....................................................................HQPMQVR
2SS1_BRANA/16-122KQQIQQQE......................................................QQQ........GKQQMVN
2SS2_ARATH/58-158SLQGQ....................................................................HGPFQSR
2SS5_HELAN/53-148QQQVQQQQG...................................................RQLVP.F......RGSQQTQ
2SS5_HELAN/190-290MRQPQQQQQ....................................................QRRG.Q......FGGQEME
2SS8_HELAN/49-139MW.........................................................................IRMRD
2SSE_BRANA/60-174RQQVRQQQG...................................................QQMQG.Q......QMQQVIS
2SSL_PICGL/52-156LSYDSFMDSDSQED..........................................APLNQRRRR.R.....EGRGREEE
2SS1_BEREX/40-137QQEEM...........................................................Q........PRGEQMR
B9SA35_RICCO/61-155IQQGQ....................................................................LHGEESE
B9SA35_RICCO/162-256QSQGQ....................................................................LQGQDVF
2SS_SOYBN/43-152SEEL......................................................................EEKQKK
M4CYI5_BRARP/32-92................................................................................
A6N9I7_ALLCE/31-116..............................................................................GL
AVE3_AVESA/69-210IMQQQQFFQPQMQQQFFQPQMQQVTQG...............IFQPQMQQVTQGIFQPQLQQVTQ.GIF.QPQMQGQIEG
CCDP_MAIZE/48-127..............................................................................HL
FIL1_ANTMA/31-90................................................................................
GDA0_WHEAT/146-275ILHQQQKQQQQPSSQVSFQQPLQQ......................YPLGQGSFRPSQQNPQAQG.SVQ..PQQLPQFEE
GDA2_WHEAT/143-280ILHQQHHHHQQQQQQQQQQPLSQVSFQ...............QPQQQYPSGQGFFQPSQQNPQAQ.GSF.QPQQLPQFEE
GDA5_WHEAT/152-306IMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAE
GDA6_WHEAT/155-283ILHQQQRQQQPSSQVSLQQPQQQ.......................YPSGQGFFQPSQQNPQAQG.SVQ..PQQLPQFEE
GDA8_WHEAT/46-175ILHQQQQKQQQQPSSQFSFQQPLQ......................QYPLGQGSFRPSQQNPQAQ.GSV..QPQQLPQFE
GDB1_WHEAT/134-288ILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQ.....QQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEA
GDB2_WHEAT/184-310IMQQQQQQQQQQGIDIFLPLS............................QHEQVGQGSLVQGQGI.IQ...PQQPAQLEA
GDB3_WHEAT/87-228ILQEQQQVQGSIQSQQQQPQQLGQCVS................QPQQQSQQQLGQQPQQQQLAQG.TFL.QPHQIAQLEV
GDBX_WHEAT/171-285IMQQEQQQGVPILRP.......................................LFQLAQGLGII.QP....QQPAQLEG
A2Y665_ORYSI/48-178EESMPMPLEQGWSSSSSEYYGGEGS....................SSEQGYYGEGSSEEGYYGEQ.QQQ..PGMTRVRLT
HOG1_HORVU/166-288FMQQGQRQGVQIVQQQPQP................................QQVGQCVLVQGQGV.VQ...PQQLAQMEA
HOG3_HORVU/142-276VMQQQVQQQVGHGFVQSQLQQ...........................LGQGMPIQLQQQPGQAF.VL...PQQQAQFKV
HOR1_HORVU/143-282FLQEQPQQLVEGVSQPQQQLWPQQVG..................QCSFQQPQPQQVGQQQQVPQS.AFL.QPHQIAQLEA
HPSE_SOYBN/8-77...............................................................................L
IAAC1_WHEAT/30-140SDPNSSVL......................................................KDL.P......GCPREPQ
IAAC3_WHEAT/43-159VPSQPVDPRSGN.............................................VGESGLID.L.....PGCPREMQ
IAC16_WHEAT/30-134SRPDQSGL......................................................MEL.P......GCPREVQ
IAA1_HORVU/20-131YKELGVALADD................................................KATVAE.V......FPGCRTE
IAA1_WHEAT/6-115YKEHGAQEG...................................................QAGTG.A......FPRCRRE
IAA2_HORVU/37-144YAALGVGG.....................................................GPEE.V......FPGCQKD
IAA4_SORBI/7-111DAPLQDF........................................................RG........CTREMQR
IAA5_SORBI/4-106MTGYEM.........................................................RP........TCSWGGL
IAAA_HORVU/30-140SHPDWSVL......................................................KDL.P......GCPKEPQ
IAAE_HORVU/29-137VTWQGAFEGA..................................................YFKDS.P......NCPRERQ
IAAT_ELECO/6-114VTPSGQHEGR..................................................LLQDL.P......GCPRQVQ
ITRF_MAIZE/34-143IPPGPDAQLE.................................................GRLEDL.P......GCPREVQ
LIM1_LILLO/29-88................................................................................
MC1_PINRA/28-88................................................................................
MEN8_SILLA/38-98................................................................................
NLT11_PARJU/4-91...............................................................................D
NLT21_PARJU/35-121...............................................................................G
F2DCX3_HORVD/29-111................................................................................
NLTP1_ARATH/29-114..............................................................................SG
NLTP1_BRANA/29-113...............................................................................T
A8YPK3_HORVU/29-113...............................................................................N
NLTP2_SOLLC/27-110...............................................................................G
NLTP1_PRUAR/3-87...............................................................................G
NLTP1_TOBAC/27-110...............................................................................G
NLTP2_HORVU/37-102..............................................................................HY
NLTP3_HORVU/29-114...............................................................................G
M5W0S9_PRUPE/33-119..............................................................................TN
NLTPA_BRAOT/29-114..............................................................................PN
NLTPA_RICCO/3-88...............................................................................T
NLTP1_WHEAT/26-110...............................................................................N
NLTPB_RICCO/3-88...............................................................................N
NLTPC_RICCO/28-112...............................................................................G
NLTP_AMACA/4-90...............................................................................S
NLTP_BETVU/29-113...............................................................................G
NLTP_CICAR/27-111...............................................................................R
NLTP_DAUCA/30-116...............................................................................G
NLTP_ELECO/4-90..............................................................................SG
NLTP_GERHY/28-112...............................................................................R
NLTP_HELAN/28-112...............................................................................G
NLTP_PINTA/34-119...............................................................................G
A0A0K9Q9K1_SPIOL/30-113...............................................................................G
NLTP_STRHE/10-89...............................................................................R
NLTP_VIGUN/34-99..............................................................................QY
NLTP6_AMBAR/30-113...............................................................................A
O22110_PICAB/25-104..............................................................................LG
O22272_ARATH/48-125..............................................................................IE
NLTP2_SOLPN/27-110...............................................................................G
O24101_MEDTR/31-102...............................................................................G
O24355_SILLA/25-110...............................................................................Q
O24440_PHAVU/29-112...............................................................................G
O24485_PINRA/36-122...............................................................................N
O24486_PINRA/39-97................................................................................
ATA7_ARATH/29-125..............................................................................LP
O49178_ORYSA/42-149YRELGAPDV...................................................GHPMS.E......VFRGCRR
O49644_ARATH/39-110..............................................................................SD
O64431_BRACM/21-86..............................................................................QY
YLS3_ARATH/36-113L............................................................................GLQ
O65368_ARATH/32-112..............................................................................NI
O65369_ARATH/55-137..............................................................................NL
O65561_ARATH/29-103...............................................................................M
O81135_HORVU/27-92..............................................................................YI
O81410_PICGL/53-146FMDSDSQDGAP................................................LNQRRG.Q......GRGMEEE
O81872_ARATH/32-107...............................................................................Y
O82439_ARATH/25-107.............................................................................VNI
NLTP2_PRUAR/3-68..............................................................................QY
F2D8V2_HORVD/31-96..............................................................................QY
P93198_9ROSI/39-132QQQQG....................................................................LRGEEME
P93274_MALDO/2-73..............................................................................IN
P93513_9POAL/63-154LSGFK...........................................................G........LQQGLKA
P93611_WHEAT/84-166..............................................................................NL
P93705_DAUCA/264-345..............................................................................IN
P93794_WHEAT/195-344ILQQQQQQQQQQQQGQSIIQYQQQQPQQLG..........QCVSQPQQQLQQQLGQQPQQQQLAH.GTFLQPHQIAQLEV
PRF1_SOLLC/261-343..............................................................................NI
PROA_ORYSI/43-134QQVI.....................................................................CAGLGQQ
PUIA_WHEAT/48-138LGGIF...........................................................G........FQRDRAS
PUIB_WHEAT/50-140LGGFL...........................................................G........IWRGEVF
Q00318_COILA/103-188IQQQP....................................................................IGQPLAL
Q06763_SOYBN/68-149..............................................................................LN
Q09071_AVESA/48-166IMQQQQQQLVQAQQMGL...................................VQPQTQMAGQVFI.QP....QQLSQYQT
Q09072_AVESA/74-212ILQQQQQQQQFIQPQLQQQVFQPQLQ..................LQQQVFQPQLQQQVFQPQLQQ.VFN.QPQMQGQIEG
Q39100_ARATH/48-126..............................................................................NL
ERLI1_ARATH/85-167..............................................................................NL
A0A0D3A8B1_BRAOL/28-112...............................................................................G
Q39574_CATRO/55-137..............................................................................NL
2SS_CUCMA/55-139QRQA......................................................................RGQEGR
Q39787_GOSHI/36-131MQQMQE.........................................................QM........GSKQMRE
Q39928_HELAN/52-143QRHEQQRP......................................................RVP.F......QGSQQSQ
Q40335_MEDSA/84-165..............................................................................NL
Q40453_TOBAC/25-114...............................................................................N
A2X812_ORYSI/52-133..............................................................................NL
Q40997_PINST/58-160LSFDSSTDSDSQDGA........................................PLNQRRRRPE.G.....RGREEEEE
Q41125_PHAVU/45-126..............................................................................NL
Q41168_RAPSA/29-141KQQVRQQQGQ..................................................QGQQG.Q......QMQQAVS
Q41320_SECCE/55-178IMQQEQREGVQILLPQSHQ...............................QLVGQGALAQVQGII.QP...QQLSQFNVG
Q41378_9ASTR/24-89..............................................................................QY
Q41543_WHEAT/137-262IMQQEQQEQRQGVQILVPLS.............................QQQQVGQGTLVQGQGI.IQ...PQQPAQLEV
Q41848_MAIZE/215-296..............................................................................IN
Q42044_ARATH/52-133..............................................................................NL
Q42158_ARATH/29-94..............................................................................QY
Q42392_ZINVI/30-95..............................................................................AY
A0A0E0R296_ORYRU/65-146..............................................................................NL
Q42487_POPNI/58-140..............................................................................NL
M0VYA0_HORVD/33-118...............................................................................A
Q43496_SOLLC/28-101...............................................................................G
Q43522_SOLLC/127-207..............................................................................NL
F2E1T8_HORVD/29-111................................................................................
Q96232_ASPOF/101-182..............................................................................NL
Q9S7U3_ARATH/46-128..............................................................................NL
Q9SA59_ARATH/25-103Y............................................................................GFK
Q9SBW9_MAIZE/43-101................................................................................
Q9SC06_TRIMO/34-125LSGFK...........................................................G........LQQGLKA
Q9SDS2_CAPAN/27-110...............................................................................G
Q9SDS4_CAPAN/19-102...............................................................................G
F2CY84_HORVD/32-117..............................................................................GG
Q9SET1_ARATH/222-304..............................................................................DL
Q9SHA0_ARATH/27-109..............................................................................AG
Q9SI70_ARATH/29-101.............................................................................QFN
Q9SKI0_ARATH/208-289..............................................................................NL
Q9SRS1_ARATH/32-105...............................................................................G
Q9ST25_MAIZE/51-132..............................................................................VI
Q9STH5_ARATH/42-113..............................................................................PF
Q9SU32_ARATH/34-115..............................................................................TI
Q9SUV8_ARATH/28-104...............................................................................Y
Q9SUW7_ARATH/37-117..............................................................................FL
Q9SUX0_ARATH/37-116...............................................................................F
Q9SUX3_ARATH/50-132..............................................................................NL
Q9SUZ2_ARATH/48-121...............................................................................G
SCA_LILLO/25-109...............................................................................G
Q9SXE7_ARATH/212-293..............................................................................NI
Q9XF30_ORYSI/41-111..............................................................................SY
NLTP5_ARATH/29-114..............................................................................SR
2SS1_SESIN/54-141QQEY.....................................................................GMEQEMQ
NLTP8_ARATH/28-112...............................................................................T
NLTL2_ARATH/27-105..............................................................................LT
Q9ZSL7_BRANA/27-108................................................................................
Q9ZTW2_FRAAN/73-155..............................................................................NL
NLTP7_ARATH/29-118..............................................................................PG
XYP11_ARATH/40-120F............................................................................GVK
YY1_ORYSJ/31-94................................................................................
ZEB2_MAIZE/86-172FLQQQ...........................................................P........QGELAAL
ZM33_MAIZE/45-108................................................................................

PF14368

Q1G3I0_ARATH/16-107--------------------------------------------------------------------------.AVS.N
Q3ECK0_ARATH/8-101--------------------------------------------------------------------------LAQF.N
B9RBQ4_RICCO/7-100--------------------------------------------------------------------------LESF.K
Q9LE56_ARATH/14-113--------------------------------------------------------------------------LKSL.N
Q0D9K5_ORYSJ/20-116--------------------------------------------------------------------------LQAF.G
Q9SUV6_ARATH/10-114--------------------------------------------------------------------------.DPL..
C5Z9F1_SORBI/22-116--------------------------------------------------------------------------LQAF.G
C3SA92_BRADI/13-112--------------------------------------------------------------------------.VQL.P
Q9LJ85_ARATH/13-108--------------------------------------------------------------------------PFNI.P
Q7XIG9_ORYSJ/15-115--------------------------------------------------------------------------.FGI.K
C5X2J9_SORBI/14-111--------------------------------------------------------------------------.YGI.Q
A9S0T9_PHYPA/9-107--------------------------------------------------------------------------AVAL.K
B9RIH6_RICCO/12-107--------------------------------------------------------------------------.EDM..
B9RIH3_RICCO/10-107--------------------------------------------------------------------------.EKI..
A9TY60_PHYPA/11-108--------------------------------------------------------------------------STLT.G
B9HP13_POPTR/12-110--------------------------------------------------------------------------.QKV..
A9T6D1_PHYPA/9-104--------------------------------------------------------------------------.QQS.G
B9HP10_POPTR/10-105--------------------------------------------------------------------------.E.A.M
B9RTN3_RICCO/10-113--------------------------------------------------------------------------IFGF.P
B9RIH4_RICCO/10-105--------------------------------------------------------------------------.EDL..
B9RZC4_RICCO/7-99--------------------------------------------------------------------------LSSY.K
A9SQH6_PHYPA/103-196--------------------------------------------------------------------------.ALYPT
B9SEE9_RICCO/14-106--------------------------------------------------------------------------.ASL..
B9SEE8_RICCO/14-105--------------------------------------------------------------------------.AAL..
A9SQH9_PHYPA/117-210--------------------------------------------------------------------------ASNP.T
B9GVR5_POPTR/18-112--------------------------------------------------------------------------FPSL.G
B9H8A8_POPTR/14-108--------------------------------------------------------------------------PLQL.P
B9HUT8_POPTR/13-107--------------------------------------------------------------------------IFGF.P
D7T8D6_VITVI/12-114--------------------------------------------------------------------------AKKA.G
I1PAV8_ORYGL/35-130--------------------------------------------------------------------------AYGV.R
I1QT58_ORYGL/18-119--------------------------------------------------------------------------TRQV.G
I1R180_ORYGL/22-119--------------------------------------------------------------------------STGY.D
Q1G2Y5_ARATH/16-109--------------------------------------------------------------------------PISI.P
C6_ORYSJ/12-114--------------------------------------------------------------------------AIGV.D
Q75GY5_ORYSJ/27-127--------------------------------------------------------------------------SPLA.P
Q8S077_ORYSJ/23-111--------------------------------------------------------------------------.VMG.N
Q9SUV7_ARATH/19-112--------------------------------------------------------------------------.SNG.N
U5G1T3_POPTR/18-113--------------------------------------------------------------------------PFSI.P
U5GQ18_POPTR/24-115--------------------------------------------------------------------------.AAL..

PF14547

F2DU32_HORVD/35-120---------------------------------------------------------------------------.IPIN
D7ME35_ARALL/36-114---------------------------------------------------------------------------ILTIT
A8MRQ5_ARATH/577-656---------------------------------------------------------------------------LSP..
D7ME37_ARALL/85-164---------------------------------------------------------------------------LPP..
D7ME34_ARALL/31-113---------------------------------------------------------------------------FLTIN
D7ME36_ARALL/7-89---------------------------------------------------------------------------LLGIT
D7MAX1_ARALL/157-241---------------------------------------------------------------------------.IDLI
I1PQ77_ORYGL/6-89---------------------------------------------------------------------------.IPTE
B9S3J8_RICCO/215-298---------------------------------------------------------------------------.LNII
D7ME38_ARALL/36-117---------------------------------------------------------------------------.LPLV
C5Z4Z5_SORBI/237-320---------------------------------------------------------------------------.INIY
C5Y909_SORBI/46-127---------------------------------------------------------------------------.IPTE
F4JLV4_ARATH/297-375---------------------------------------------------------------------------LSP..
I1QBL2_ORYGL/229-307---------------------------------------------------------------------------NVDVD
M4F7Y5_BRARP/170-253---------------------------------------------------------------------------.LKLY
W4ZSZ5_WHEAT/138-222---------------------------------------------------------------------------.IHIN
W5AJU0_WHEAT/30-113---------------------------------------------------------------------------.LNLH

PF05617

M4FC94_BRARP/72-146---------------------------------------------------------------------------L..YQ
B9S177_RICCO/41-104---------------------------------------------------------------------------.....
U5FMS5_POPTR/61-132---------------------------------------------------------------------------G..PM
M1BC58_SOLTU/78-151---------------------------------------------------------------------------S..PE
M4FCA2_BRARP/71-146---------------------------------------------------------------------------L..YQ
M4F146_BRARP/69-143---------------------------------------------------------------------------R..YE
M4FC93_BRARP/72-147---------------------------------------------------------------------------L..YQ
EC12_ARATH/45-109---------------------------------------------------------------------------.....
M4FC76_BRARP/105-178---------------------------------------------------------------------------N..TE
D7LVH8_ARALL/44-116---------------------------------------------------------------------------TFLPK
M4F8U3_BRARP/34-96---------------------------------------------------------------------------.....
K4CB92_SOLLC/64-137---------------------------------------------------------------------------L..PK
B9SN88_RICCO/61-124---------------------------------------------------------------------------.....
B9SVP5_RICCO/53-119---------------------------------------------------------------------------.....
B9GGT7_POPTR/48-111---------------------------------------------------------------------------.....
I1I7L3_BRADI/74-140---------------------------------------------------------------------------.....
K7KX58_SOYBN/72-144---------------------------------------------------------------------------T..PE
K7KX56_SOYBN/72-143---------------------------------------------------------------------------I..PE
K7MQC1_SOYBN/160-232---------------------------------------------------------------------------S..PQ
M0TQL0_MUSAM/66-131---------------------------------------------------------------------------.....
EC11_ARATH/57-120---------------------------------------------------------------------------.....
B9T247_RICCO/77-140---------------------------------------------------------------------------.....
M4FC95_BRARP/79-152---------------------------------------------------------------------------F..YQ
D7KC93_ARALL/38-103---------------------------------------------------------------------------R..PS
M4EKA3_BRARP/43-105---------------------------------------------------------------------------.....
D7MTL8_ARALL/141-203---------------------------------------------------------------------------.....
C5YSL3_SORBI/84-148---------------------------------------------------------------------------.....
A8MS74_ARATH/69-143---------------------------------------------------------------------------F..YQ
U5GVU7_POPTR/48-112---------------------------------------------------------------------------.....
Q6ZKQ3_ORYSJ/79-152---------------------------------------------------------------------------.....
K7LY71_SOYBN/49-122---------------------------------------------------------------------------L..PK
B9SXP3_RICCO/41-109---------------------------------------------------------------------------.....
K7KW29_SOYBN/52-115---------------------------------------------------------------------------.....
B9HRY2_POPTR/41-112---------------------------------------------------------------------------F..PE
M4DW18_BRARP/37-99---------------------------------------------------------------------------.....
M4DVD8_BRARP/72-146---------------------------------------------------------------------------L..YQ
B9RBY2_RICCO/99-162---------------------------------------------------------------------------.....
B9P5Y5_POPTR/32-100---------------------------------------------------------------------------VESA.
B9GU63_POPTR/46-117---------------------------------------------------------------------------E..PQ
M4FC77_BRARP/64-140---------------------------------------------------------------------------Q..NA
Q8S8C9_ARATH/73-145---------------------------------------------------------------------------M..YE
B9SN89_RICCO/73-136---------------------------------------------------------------------------.....
Q3EBD9_ARATH/70-142---------------------------------------------------------------------------T..YY
D7MVA2_ARALL/48-118---------------------------------------------------------------------------S..YE
B9SVP8_RICCO/47-111---------------------------------------------------------------------------.....
W5I1G9_WHEAT/44-110---------------------------------------------------------------------------.....
U5DGU8_AMBTC/38-101---------------------------------------------------------------------------P....
D7MSB1_ARALL/48-110---------------------------------------------------------------------------.....
D7LBY0_ARALL/72-145---------------------------------------------------------------------------I..YQ
Q9LXX9_ARATH/44-121---------------------------------------------------------------------------MFLPK
A7REG6_ARATH/64-136---------------------------------------------------------------------------T..ND
B9HQH8_POPTR/62-126---------------------------------------------------------------------------PPLW.
M4F9M9_BRARP/52-124---------------------------------------------------------------------------.....
K7N3Y2_SOYBN/45-109---------------------------------------------------------------------------.....
M4FC77_BRARP/213-288---------------------------------------------------------------------------Q..FA
M4CIW6_BRARP/37-108---------------------------------------------------------------------------R..PS
B9SE79_RICCO/48-112---------------------------------------------------------------------------.....
K7KX55_SOYBN/121-191---------------------------------------------------------------------------A..PD
K4D4G7_SOLLC/44-108---------------------------------------------------------------------------.....
B9GGU6_POPTR/50-114---------------------------------------------------------------------------.....
U7DW65_POPTR/42-112---------------------------------------------------------------------------L..PK
D7LQP6_ARALL/70-141---------------------------------------------------------------------------T..KD
A8MQ83_ARATH/72-148---------------------------------------------------------------------------M..YQ
M4F142_BRARP/86-160---------------------------------------------------------------------------S..YE
D7MQQ8_ARALL/38-109---------------------------------------------------------------------------K..PM
U5GKZ5_POPTR/42-112---------------------------------------------------------------------------V..LK
I1IN82_BRADI/69-133---------------------------------------------------------------------------.....
K4C587_SOLLC/77-151---------------------------------------------------------------------------S..PE
Q3ECV9_ARATH/81-154---------------------------------------------------------------------------M..YV
W1PLV8_AMBTC/49-113---------------------------------------------------------------------------.....
K4D4G3_SOLLC/55-119---------------------------------------------------------------------------.....
B9IKH4_POPTR/49-122---------------------------------------------------------------------------T..PN
A5AZZ7_VITVI/45-108---------------------------------------------------------------------------.....
M0ZZI9_SOLTU/49-111---------------------------------------------------------------------------.....
K7KX59_SOYBN/86-158---------------------------------------------------------------------------T..PE
I1K1Y8_SOYBN/51-124---------------------------------------------------------------------------L..PL
D7MTL8_ARALL/48-110---------------------------------------------------------------------------.....
I1QJT2_ORYGL/79-143---------------------------------------------------------------------------.....
U5DBS7_AMBTC/38-100---------------------------------------------------------------------------.....
EC14_ARATH/47-111---------------------------------------------------------------------------.....
K7KX55_SOYBN/32-108---------------------------------------------------------------------------S..QQ
Q9LUB3_ARATH/33-97---------------------------------------------------------------------------.....
I1QY08_ORYGL/55-119---------------------------------------------------------------------------.....
K7L6R0_SOYBN/36-100---------------------------------------------------------------------------.....
M0TA67_MUSAM/60-124---------------------------------------------------------------------------.....
M1ASC9_SOLTU/60-130---------------------------------------------------------------------------L..PQ
W5I3U0_WHEAT/51-117---------------------------------------------------------------------------.....
M4DW17_BRARP/37-100---------------------------------------------------------------------------.....
Q9C924_ARATH/63-134---------------------------------------------------------------------------T..YE
M4EJU1_BRARP/45-107---------------------------------------------------------------------------.....
D7LL48_ARALL/69-143---------------------------------------------------------------------------F..YQ
Q3ECV8_ARATH/86-158---------------------------------------------------------------------------T..YE
Q9FYN3_ARATH/84-147---------------------------------------------------------------------------.....
U5GF05_POPTR/42-112---------------------------------------------------------------------------V..PK

PF13016

Q5Z9M9_ORYSJ/30-100-------------------------------------
PRO25_ORYSJ/32-104-------------------------------------
AVLBB_WHEAT/153-224-------------------------------------
D2KFG9_WHEAT/47-117-------------------------------------
I1I1L7_BRADI/190-267-------------------------------------
M8A4Q2_TRIUA/135-215-------------------------------------
GDBB_WHEAT/132-208-------------------------------------
GLTA_WHEAT/180-256-------------------------------------

PF00234

RA16_ORYSJ/41-149DI-ERAAASLP-AFCNV....D-IPNG....VGGVC-
IAA2_WHEAT/37-143VM-KLTAASVP-EVCKV....P-IP.NPSGDRAGVC-
PRO28_ORYSJ/47-143..-..LALNMP-SICGI....Y-PSY........NT-
RAG1_ORYSJ/39-150DL-ERAAASLP-AFCNV....D-IPNG....PGGVC-
NLTP1_ORYSI/28-112LN-AGNAASIP-SKCGV....S-VPYTI..SASIDC-
NLTP4_ORYSJ/30-115LR-PDLVAGIP-SKCGV....N-IPYAI..SPSTDC-
A0A0E0NNN2_ORYRU/30-95VN-SPNARKAV-SSCGI....A-LPT.........C-
NLTP3_ORYSI/32-117LN-MGNAASIP-SKCGV....S-VAFPI..STSVDC-
A9_ARATH/27-87..-..AATTLT-SLCNL.....-PSF........DC-
108_SOLLC/35-99..-..IAAQIP-AQCNL....P-PLS.........C-
14KD_DAUCA/54-136NL-PIALSLVL-NNCGK....Q-VPN......GFEC-
2SS1_ARATH/59-153KI-YQTAKHLP-NVCDI....P-QVD........VC-
2SS1_BRANA/16-122RI-YQTATHLP-KVCNI....P-QVS........VC-
2SS2_ARATH/58-158KI-YKTAKYLP-NICKI....Q-QVG........EC-
2SS5_HELAN/53-148QL-KQKAQILP-NVCNL.....-QSR........RC-
2SS5_HELAN/190-290TA-RRVIQNLP-NQCDL....E-VQQ.........C-
2SS8_HELAN/49-139QV-MSMAHNLP-IECNL....M-SQP.........C-
2SSE_BRANA/60-174RV-YQTATHLP-RVCNI....R-QVS........IC-
2SSL_PICGL/52-156EA-MERAAYLP-NTCNV....R-EPP.......RRC-
2SS1_BEREX/40-137RM-MRLAENIP-SRCNL....S-PMR.........C-
B9SA35_RICCO/61-155RV-AQRAGEIV-SSCGV....R-CMR......QTRT-
B9SA35_RICCO/162-256EA-FRTAANLP-SMCGV.....-SPT........EC-
2SS_SOYBN/43-152KM-EKELINLA-TMCRF....G-PMI........QC-
M4CYI5_BRARP/32-92..-..AATTFT-TTCNL....P-SL.........DC-
A6N9I7_ALLCE/31-116RR-NPRFQNIP-RDCRN....T-FVRPFWWRPRIQC-
AVE3_AVESA/69-210MR-AFALQALP-AMCDV....Y-VPP........HC-
CCDP_MAIZE/48-127NV-PLSLNFIL-NNCGR....I-CPE......DFTC-
FIL1_ANTMA/31-90..-..IASRVP-AQCNL....P-PLS.........C-
GDA0_WHEAT/146-275IR-NLALQTLP-AMCNV....Y-IPP........YC-
GDA2_WHEAT/143-280IR-NLALQTLP-AMCNV....Y-IPP........YC-
GDA5_WHEAT/152-306IR-NLALQTLP-AMCNV....Y-IPP........HC-
GDA6_WHEAT/155-283IR-NLALQTLP-RMCNV....Y-IPP........YC-
GDA8_WHEAT/46-175IR-NLALQTLP-AMCNV....Y-IPP........YC-
GDB1_WHEAT/134-288VT-SIALRTLP-TMCSV....N-VPL........YS-
GDB2_WHEAT/184-310IR-SLVLQTLP-SMCNV....Y-VPP........EC-
GDB3_WHEAT/87-228MT-SIALRILP-TMCSV....N-VPL........YR-
GDBX_WHEAT/171-285IR-SLVLKTLP-TMCNV....Y-VPP........DC-
A2Y665_ORYSI/48-178RA-RQYAAQLP-SMCRV.....-EPQ........QC-
HOG1_HORVU/166-288IR-TLVLQSVP-SMCNF....N-VPP........NC-
HOG3_HORVU/142-276VG-SLVIQTLP-MLCNV....H-VPP........YC-
HOR1_HORVU/143-282TT-SIALRTLP-MMCSV....N-VPL........YR-
HPSE_SOYBN/8-77NL-NRNLQLIL-NSCGR....S-YPS......NATC-
IAAC1_WHEAT/30-140RD-FAKVLVTS-GHCNV....M-TVHN....APY.C-
IAAC3_WHEAT/43-159WD-FVRLLVAP-GQCNL....A-TIHN....VRY.C-
IAC16_WHEAT/30-134MD-FVRILVTP-GYCNL....T-TVHN....TPY.C-
IAA1_HORVU/20-131VM-DRAVASLP-AVCNQ....Y-IPNTN..GTDGVC-
IAA1_WHEAT/6-115VV-KLTAASIT-AVCRL....P-IVVDASGDGAYVC-
IAA2_HORVU/37-144VM-KLLVAGVP-ALCNV....P-IPNEAA.GTRGVC-
IAA4_SORBI/7-111IY-AVSRLTRA-AECNL....P-TIP......GGGC-
IAA5_SORBI/4-106LT-FAPTIVCY-RECNL....R-TLHG....RPF.C-
IAAA_HORVU/30-140RD-FAKVLVTP-GQCNVLTVHN-APY.........C-
IAAE_HORVU/29-137TS-YAANLVTP-QECNL....G-TIHG.....SAYC-
IAAT_ELECO/6-114RA-FAPKLVTE-VECNL....A-TIHG....GPF.C-
ITRF_MAIZE/34-143RG-FAATLVTE-AECNL....A-TISG.....VAEC-
LIM1_LILLO/29-88..-..IISSLP-DHCSL....P-AVN.........C-
MC1_PINRA/28-88..-..AVISLP-AKCNL....P-ALT.........C-
MEN8_SILLA/38-98..-..VASQLP-SSCNL....A-ALN.........C-
NLT11_PARJU/4-91ID-GKLVSEVP-KHCGI....V-DSKLPPIDVNMDC-
NLT21_PARJU/35-121IK-NELVAEVP-KKCDI....K-TT.LPPITADFDC-
F2DCX3_HORVD/29-111LN-AGKAAGIP-SMCGV....S-VPYAI..SASVDC-
NLTP1_ARATH/29-114LN-AGRAAGIP-KACGV....N-IPYKI..STSTNC-
NLTP1_BRANA/29-113LN-AARAAGLP-KACGV....N-IPYKI..SKSTNC-
A8YPK3_HORVU/29-113LN-LNNAASIP-SKCNV....N-VPYTI..SPDIDC-
NLTP2_SOLLC/27-110ID-TGKAAGLP-GVCGV....N-IPYKI..SPSTDC-
NLTP1_PRUAR/3-87VN-PNNAAALP-GKCGV....N-IPYKI..SASTNC-
NLTP1_TOBAC/27-110IN-LGKAAGLP-STCGV....N-IPYKI..SPSTDC-
NLTP2_HORVU/37-102VS-SPHARDTL-NLCGI....P-VPH.........C-
NLTP3_HORVU/29-114IN-MGKVSGVP-GKCGV....S-VPFPI..SMSTDC-
M5W0S9_PRUPE/33-119AN-AGLAAGLP-GKCGV....N-IPYKI..SPSTDC-
NLTPA_BRAOT/29-114LN-AGRAAGIP-KACGV....S-VPFPI..STNTNC-
NLTPA_RICCO/3-88IK-QDAASSLP-KKCGV....D-INIPI..SKTTNC-
NLTP1_WHEAT/26-110LN-EDNARSIP-PKCGV....N-LPYTI..SLNIDC-
NLTPB_RICCO/3-88IR-EDAASSLP-YKCGV....V-INVPI..SKTTNC-
NLTPC_RICCO/28-112IK-DQFLSKIP-AACNI....K-VGFPV..STNTNC-
NLTP_AMACA/4-90LN-YKVAARLA-SQCGV....R-MSYSV..SPNVNC-
NLTP_BETVU/29-113IN-YGKAASLP-RQCGV....S-VPYAI..SPNTNC-
NLTP_CICAR/27-111LN-ANNAAALP-GKCVV....N-IPYKI..STSTNC-
NLTP_DAUCA/30-116LN-LNAAAGLP-ARCGV....N-IPYKI..SPTTDC-
NLTP_ELECO/4-90LN-AGKASSIP-GRCGV....R-LPYAI..SASIDC-
NLTP_GERHY/28-112IN-LNNANSLP-GKCGI....S-IGYKI..TPNIDC-
NLTP_HELAN/28-112VN-AGNAASFP-GKCGV....S-IPYKI..SPSTDC-
NLTP_PINTA/34-119VK-LGKAANLP-GLCKV....T-DLNVPI.SPNVDC-
A0A0K9Q9K1_SPIOL/30-113IN-YGKAAGLP-GMCGV....H-IPYAI..SPSTNC-
NLTP_STRHE/10-89VQ-DRFLGQIP-TPCKIK..GR-LP..........C-
NLTP_VIGUN/34-99VN-SPGAKKVL-SNCGV....T-YPN.........C-
NLTP6_AMBAR/30-113YD-PKRMPLLS-TKCGV....K-PDFPAV.DKNLDC-
O22110_PICAB/25-104VN-VTQAMKMP-AECGK....N-VSA.......TQC-
O22272_ARATH/48-125LN-STRALATP-KACKL....S-IAP.......PHC-
NLTP2_SOLPN/27-110LD-LGKAASLP-STCSV....N-IPYKI..SPSTDC-
O24101_MEDTR/31-102IN-AKKALALP-GQCGL....Q-TPS........NC-
O24355_SILLA/25-110YQ-PSLIASLS-DKCSV....S-FK.LPAISKATDC-
O24440_PHAVU/29-112FN-ANNAGILP-GKCGV....S-IHYNI..STSTNC-
O24485_PINRA/36-122LN-DRALQSLP-SNCGL....Q-LSFTI..TRDIDC-
O24486_PINRA/39-97..-..STMQLP-SECGL....E-TPQ.........C-
ATA7_ARATH/29-125FL-PAAINNLP-LRCSL....T-LSFPI..SVDMDC-
O49178_ORYSA/42-149GT-WSARRRAP-GVLQV....D-IPNG....GGGVC-
O49644_ARATH/39-110LS-RTFSAGVL-KKCDV....S-HKY.......M.C-
O64431_BRACM/21-86IS-SPNSRKVL-TACGI....P-YPS.........C-
YLS3_ARATH/36-113VN-VSLALALP-SVCHA....T-ADI.......TKC-
O65368_ARATH/32-112DL-PISLSLLI-NTCGK....K-LPS........DC-
O65369_ARATH/55-137NL-PISLSLLL-NVCSK....Q-LPP......GFQC-
O65561_ARATH/29-103ID-MDKVVHVT-AFCGK....P-LAH......GTKC-
O81135_HORVU/27-92TS-PHARDTLL-S.CGL....A-VPR.........C-
O81410_PICGL/53-146EV-LRRAEELP-NTCNV....P-QSP.......RRC-
O81872_ARATH/32-107ID-MDKVVYVA-RSCGK....K-IPS......GYKC-
O82439_ARATH/25-107NL-PINLSVLL-NVCSR....N-APK......SFQC-
NLTP2_PRUAR/3-68VN-SPNARKLA-SNCGV....P-VPQ.........C-
F2D8V2_HORVD/31-96VD-SPNGKKVM-AACKV....P-VPS.........C-
P93198_9ROSI/39-132EM-VQSARDLP-NECGI....S-SQR.........C-
P93274_MALDO/2-73LI-IPIVLQVL-IDCGK....T-PPS......GFQC-
P93513_9POAL/63-154RT-VQTAKSLP-TQCNI....D-PKF.........C-
P93611_WHEAT/84-166VL-PIAIQVLV-NQCGK....T-VPS......DFQC-
P93705_DAUCA/264-345IA-LPVALQLL-ITCGK....T-PPP......GFTC-
P93794_WHEAT/195-344MT-SIAPRTLP-TMCSV....N-VPL.......YET-
PRF1_SOLLC/261-343IL-PIALQVLI-DDCGK....Y-PPK......DFKC-
PROA_ORYSI/43-134QM-MKMAMQMP-YMCNM.....-APVNFQLSSCGCC-
PUIA_WHEAT/48-138KV-IQEAKNLP-PRCNQ....G-PP..........C-
PUIB_WHEAT/50-140KQ-LQRAQSLP-SKCNM....G-AD..........C-
Q00318_COILA/103-188MA-AQIAQQLT-VMCGV....R-QPM......TSPC-
Q06763_SOYBN/68-149IY-VPLALQLL-VTCGK....S-PPP......GYTC-
Q09071_AVESA/48-166MK-VVAMQTLP-AMCNV....Q-VPP........YC-
Q09072_AVESA/74-212MR-AFALQALP-AMCDV....Y-VPP........QC-
Q39100_ARATH/48-126NV-PISLNVVL-NHCGK....K-VPS......GFKC-
ERLI1_ARATH/85-167NV-PISLSVLL-NVCNR....K-VPS......GFQC-
A0A0D3A8B1_BRAOL/28-112LN-IDLVAALP-TTCGV....S-LSYPI..GFNTNC-
Q39574_CATRO/55-137NV-PVSLTLLL-NVCSK....K-VPE......GFIC-
2SS_CUCMA/55-139QM-LQKARNLP-SMCGI.....-RPQ........RC-
Q39787_GOSHI/36-131IM-QKVTKNIM-SECEM.....-EPG........RC-
Q39928_HELAN/52-143QL-KQRAQILP-NVCNL.....-QSR........RC-
Q40335_MEDSA/84-165NV-PITLSLLL-SACEK....S-IPN......GFQC-
Q40453_TOBAC/25-114VN-PTLVAELP-KKCGI....S-FN.MPPIDKNYDC-
A2X812_ORYSI/52-133NL-PIDLSLIL-NYCGK....T-VPT......GFKC-
Q40997_PINST/58-160EA-VERAGELP-DRCNV....R-ESP.......RRC-
Q41125_PHAVU/45-126NV-PIKLNLLL-NYCGK....K-TPK......DFVC-
Q41168_RAPSA/29-141RI-YQTATHLP-RVCRI....P-QVS........IC-
Q41320_SECCE/55-178IV-LQMLQNLP-TMCNV....Y-VPR........QC-
Q41378_9ASTR/24-89IT-NPNAKKVT-STCGV....P-IPN.........C-
Q41543_WHEAT/137-262IR-SSVLQTLA-TMCNV....Y-VPP........YC-
Q41848_MAIZE/215-296IY-LPIALNLL-ITCGK....H-APS......GFQC-
Q42044_ARATH/52-133NV-PIDLTLLL-NYCGK....K-VPH......GFQC-
Q42158_ARATH/29-94VS-SPNARKVS-NSCKI....P-SPS.........C-
Q42392_ZINVI/30-95VS-SPNAKKVA-NACGV....P-IPK.........C-
A0A0E0R296_ORYRU/65-146NV-PVELKLIL-NKCGK....T-CPS......DFTC-
Q42487_POPNI/58-140NI-PLSLSLLL-NVCGK....K-VPK......DFQC-
M0VYA0_HORVD/33-118IN-MGKVSGVP-GKCGV....S-VPFPI..SMSTDC-
Q43496_SOLLC/28-101VD-RNMAVQLP-EKCTA....N-FEQ.........C-
Q43522_SOLLC/127-207NV-PLTLSLIL-NNCGM....N-NS.......GFTC-
F2E1T8_HORVD/29-111YN-AGRAAGIP-SRCGV....S-VPYTI..SASVDC-
Q96232_ASPOF/101-182YL-PLALQLLL-T.CGK....T-PPP......GYTC-
Q9S7U3_ARATH/46-128NV-PVSLSLLL-NVCGK....K-VPS......GFVC-
Q9SA59_ARATH/25-103FN-RTLALNLP-TACNV....Q-TPS......PSLC-
Q9SBW9_MAIZE/43-101..-..IINSLP-GRCHL....A-QAN.........C-
Q9SC06_TRIMO/34-125KT-VQTAKSLP-SKCNI....D-PKY.........C-
Q9SDS2_CAPAN/27-110IN-VRKAAGLP-NMCGV....N-IPYQI..SPSTDC-
Q9SDS4_CAPAN/19-102ID-FGKAAGLS-GVCGV....K-IPFEI..SPSVDC-
F2CY84_HORVD/32-117SE-ITRAAALP-SKCNV....N-LPYKI..SPSVDC-
Q9SET1_ARATH/222-304VL-PIALELLL-D.CGK....T-PPS......DFKC-
Q9SHA0_ARATH/27-109IN-PGIAIGVP-KRCNI...RN-RPA......GKRC-
Q9SI70_ARATH/29-101VT-TEKALGLS-RRCNV....T-TDL......SA.C-
Q9SKI0_ARATH/208-289YV-PVALQLLL-T.CGK....N-PPP......GYTC-
Q9SRS1_ARATH/32-105VD-RTLALHLP-GKCSA....N-FLP.........C-
Q9ST25_MAIZE/51-132DV-PIKLSALV-NYCGK....C-VPK......GYLC-
Q9STH5_ARATH/42-113NV-TDFNALFS-KTCGL....T-TDP.......NLC-
Q9SU32_ARATH/34-115DT-PIHLNLAL-NACGG....T-LPD......GFRC-
Q9SUV8_ARATH/28-104PF-TVGLVQVL-SLCGA....D-YPPP.....GFRC-
Q9SUW7_ARATH/37-117TI-NVRVNQVL-RLCRI....I-PPL......GFRC-
Q9SUX0_ARATH/37-116GI-DVAVREIF-FACNR....V-FPI......GFQC-
Q9SUX3_ARATH/50-132TL-PINLSLLL-NICNR....E-ASR......DFQF-
Q9SUZ2_ARATH/48-121ID-RSMALQLP-QRCSA....N-FPP.........C-
SCA_LILLO/25-109LN-AAIVAGIP-GKCGV....N-IPYPI..RMQTDC-
Q9SXE7_ARATH/212-293FI-PLALQALI-T.CGI....N-PPS......GFVC-
Q9XF30_ORYSI/41-111IR-SPNAKRLF-TVCGL....P-IPRS....KTNPC-
NLTP5_ARATH/29-114LN-AGRAARLP-GACRV....R-ISYPI..SARTNC-
2SS1_SESIN/54-141QM-QQMMQYLP-RMCGM....S-YPT........EC-
NLTP8_ARATH/28-112VK-PELAQALA-SNCGA....S-LPVDA..SPTVDC-
NLTL2_ARATH/27-105LD-LSKAASLP-SVCKV....A-APP......SARC-
Q9ZSL7_BRANA/27-108VN-PSLASSLP-GKCGV....S-IPYPI..SMSTNC-
Q9ZTW2_FRAAN/73-155NI-PIALSLLL-NACGN....Q-VPR......GFQC-
NLTP7_ARATH/29-118LN-ADRAAGIP-RRCGI....K-IPYSTQIRFNTKC-
XYP11_ARATH/40-120LD-KQRAEQLS-TICGV....K-APS......PSLC-
YY1_ORYSJ/31-94..-..IINSLP-AKCGL....P-RVT.........C-
ZEB2_MAIZE/86-172MA-AQVAQQLT-AMCGL....Q-LQQ......PGPC-
ZM33_MAIZE/45-108..-..IINSLP-AKCAL....P-PVS.........C-

PF14368

Q1G3I0_ARATH/16-107IT.GPYSKAIT.TKCGV----F.DKY---.....SC-
Q3ECK0_ARATH/8-101VT.TEKALGLS.RRCNV----T.TDL---....SAC-
B9RBQ4_RICCO/7-100VN.VTQALALT.GRCGV----N.SDL---....SAC-
Q9LE56_ARATH/14-113LT.KENALDLP.KACGA----K.ADV---....SLC-
Q0D9K5_ORYSJ/20-116VA.PEQGLLLA.KRCGV----T.TDA---....SAC-
Q9SUV6_ARATH/10-114...YTNTNQVN.KACGV----L.DKY---.....AC-
C5Z9F1_SORBI/22-116VA.PEQGLVLA.RRCNV----T.TDA---....SAC-
C3SA92_BRADI/13-112VN.MTRVLALP.AACGG----S.NAV---...FSKC-
Q9LJ85_ARATH/13-108IN.RTTAVSLP.RACNM----P.RVP---....LQC-
Q7XIG9_ORYSJ/15-115IN.YTRAAALP.AACGG----D.SSA---...LSKC-
C5X2J9_SORBI/14-111VN.LTRAAGLP.AACGE----DPAAL---....SKC-
A9S0T9_PHYPA/9-107IN.LSAAIAIP.QKCGI----KFEQR---....FYC-
B9RIH6_RICCO/12-107ID.MDKMVYVA.RSCGK----K.ISA---...GTKC-
B9RIH3_RICCO/10-107VS.MEKVVYVA.RTCGV----E.VKP---...GLKC-
A9TY60_PHYPA/11-108VN.STKAHQIP.VMCCI----A.VDT---....VKC-
B9HP13_POPTR/12-110FS.MDKAVFVA.RTCGL----T.IPP---...GTVC-
A9T6D1_PHYPA/9-104AK.VEFAKYIP.QKCQL----T.YKA---...GIVC-
B9HP10_POPTR/10-105IS.MEKVVYVA.RTCGV----T.VRA---...GTQC-
B9RTN3_RICCO/10-113LN.QSRVVSLP.SVCSE----T.TNF---TSLESIC-
B9RIH4_RICCO/10-105IS.MKKVFDVA.KSCGK----K.VTP---...GTKC-
B9RZC4_RICCO/7-99ID.PNLAMQLP.VKCKL----V.GES---....FHC-
A9SQH6_PHYPA/103-196SN.ANKASSLL.RDCKL----S.AGA---.....SC-
B9SEE9_RICCO/14-106IN.VKQAIKLL.QDCGR----K.VPR---...HFKC-
B9SEE8_RICCO/14-105ID.VNRAIRVI.EGCGR----R.VPR---...HFKC-
A9SQH9_PHYPA/117-210LN.ANKARALL.NDCEI----S.AGS---.....TC-
B9GVR5_POPTR/18-112IN.VTQAVNLS.QRCGV----T.TNL---....TSC-
B9H8A8_POPTR/14-108IN.RTLAITLP.RACKM----S.GVP---....MLC-
B9HUT8_POPTR/13-107LD.ESRVIALP.SACSL----S.SPV---.......-
D7T8D6_VITVI/12-114IK.PAIAITIP.KRCNI----K.NRP---V..GKKC-
I1PAV8_ORYGL/35-130VD.AVRALALP.TICRV----D.APP---...PRLC-
I1QT58_ORYGL/18-119SNALDGDQQMF.ARCKI----P.GAS---...STIC-
I1R180_ORYGL/22-119VN.VTHALEIP.VSCGL----A.TPP---...IELC-
Q1G2Y5_ARATH/16-109IN.RTLAISLP.RACGI----P.GVP---....VQC-
C6_ORYSJ/12-114IP.VDRAFALLRDVCRL----S.PPA---D.IISTC-
Q75GY5_ORYSJ/27-127VL.GGVQSLLP.TACNL----P.PN.---.......-
Q8S077_ORYSJ/23-111ID.AARAMQIP.SKCRI----K.GAP---....KSC-
Q9SUV7_ARATH/19-112IS.QARYDLVN.SACGV----A.DKF---.....AC-
U5G1T3_POPTR/18-113IN.RTLAISLP.RACNM----P.GVP---....VQC-
U5GQ18_POPTR/24-115ID.LDRAIRLI.EGCGR----R.VPR---...HFKC-

PF14547

F2DU32_HORVD/35-120LPL..DVPLVL-NYCGR----NATAA------GSNCS
D7ME35_ARALL/36-114L....RLNQVL-GIC.R----ITPPA------GFTCA
A8MRQ5_ARATH/577-656.....NIIILC-RACGR----RI.PR------GFTCP
D7ME37_ARALL/85-164.....NIINLY-RTCGR----SI.PP------GFTCP
D7ME34_ARALL/31-113L....RVNQVL-RLC.R----ILPPA------GFRCA
D7ME36_ARALL/7-89INLNLRLNGLL-GLC.R----LPIQP------GYNCL
D7MAX1_ARALL/157-241IPI..ALELLV-D.CGK----TP.PR------GFKCP
I1PQ77_ORYGL/6-89WTV..GVSVLV-STC.K----TELPD------GFKCV
B9S3J8_RICCO/215-298IPI..ALEVLV-D.CGK----NP.PP------GFQCP
D7ME38_ARALL/36-117FAIDEAVREIF-FAC.N----RVFPI------GFQCP
C5Z4Z5_SORBI/237-320LPI..ALNLLI-T.CGK----HP.PS------GFQCP
C5Y909_SORBI/46-127WDV..GVGVLA-SACKT----EL.PN------GFKC.
F4JLV4_ARATH/297-375.....NFGIFF-KVCGR----RI.PQ------GFSCP
I1QBL2_ORYGL/229-307INV..MIDKIL-KLCSK----AG.DS------TVVC.
M4F7Y5_BRARP/170-253VPV..ALQLLL-T.CGK----NP.PP------GYTCS
W4ZSZ5_WHEAT/138-222LPI..HLSLIL-NFCGK----GV.PT------GFMCP
W5AJU0_WHEAT/30-113LPV..DLRLIL-NNCGK----VC.PT------DFRCP

PF05617

M4FC94_BRARP/72-146LK.R.FASQV.----------..SLEINE..VWNRCS
B9S177_RICCO/41-104...........----------..TEEGDI..LEGYC.
U5FMS5_POPTR/61-132FK.A.NYDFY.----------..LKRGDD..LYNIC.
M1BC58_SOLTU/78-151MK.GVNTTEI.----------..WKNSDK..LWEEC.
M4FCA2_BRARP/71-146LK.R.FASQV.----------..SFKTNE..VWNRCS
M4F146_BRARP/69-143YR.N.IASKA.----------..IPKSKQ..TWNDCV
M4FC93_BRARP/72-147LK.H.FASKV.----------..SFKINK..VWNRCS
EC12_ARATH/45-109...........----------..SDETNV..LRGFCQ
M4FC76_BRARP/105-178YN.N.IASKA.----------..IPKSKH..TWKDCV
D7LVH8_ARALL/44-116LR....KQDS.----------..LEKSTQ..IWYLC.
M4F8U3_BRARP/34-96...........----------...FFPPT..LRDHCS
K4CB92_SOLLC/64-137VKDKIDSKVV.----------..KSNVSK..VFKRC.
B9SN88_RICCO/61-124...........----------...FFGPL..LKLFCS
B9SVP5_RICCO/53-119...........----------..VEEVNI..LNGYCA
B9GGT7_POPTR/48-111...........----------..VQEGDI..LLGYCD
I1I7L3_BRADI/74-140...........----------..QFYDPL..VRNACD
K7KX58_SOYBN/72-144MR.NVDAIEF.----------..LNKGKK..LFDEC.
K7KX56_SOYBN/72-143MR.NANATEL.----------..MKKNSL..IFNHC.
K7MQC1_SOYBN/160-232FK.E.NEAQI.----------..MNRSNQ..IWNYC.
M0TQL0_MUSAM/66-131...........----------..PQEGDV..LRGYCD
EC11_ARATH/57-120...........----------..AQEGDM..LQGYCD
B9T247_RICCO/77-140...........----------...FFGGL..LKQHCS
M4FC95_BRARP/79-152LK.R.FASQV.----------..FFKINE..VWNRCS
D7KC93_ARALL/38-103LV.G.RETQY.----------..........VWSHCV
M4EKA3_BRARP/43-105...........----------...FFPPL..IKDNCA
D7MTL8_ARALL/141-203...........----------...FFPPL..LKNECS
C5YSL3_SORBI/84-148...........----------..AEEADV..LRGFCD
A8MS74_ARATH/69-143LN.R.FSSNA.----------..MIKTNE..TWNKCS
U5GVU7_POPTR/48-112...........----------..AEEGQI..LEGYCD
Q6ZKQ3_ORYSJ/79-152...........----------..PLYAPL..VNHVCS
K7LY71_SOYBN/49-122FR.A.HKIQI.----------..LKRSEK..VWFDCD
B9SXP3_RICCO/41-109...........----------..PEIGKQ..LKNICA
K7KW29_SOYBN/52-115...........----------..NEETDV..LEGYCD
B9HRY2_POPTR/41-112YK.G.HEEEA.----------..LAGSNK..LWEKCA
M4DW18_BRARP/37-99...........----------...DFPPT..LRDHCS
M4DVD8_BRARP/72-146LR.R.FTSVAK----------ILLLRTGK..ILSRCS
B9RBY2_RICCO/99-162...........----------...SFPSR..LKSFCA
B9P5Y5_POPTR/32-100...........----------..LLRRRR..LIKSC.
B9GU63_POPTR/46-117EN.P...SKI.----------..SLRSLD..IWNHCV
M4FC77_BRARP/64-140FI.DPSAANA.----------..VAKSKY..TWKDCV
Q8S8C9_ARATH/73-145LR.R.FTSKR.----------..FSKTNE..IWNRCS
B9SN89_RICCO/73-136...........----------...FFGPL..LKKVCS
Q3EBD9_ARATH/70-142YK.P.FASKG.----------..RPRILK..VWNRCS
D7MVA2_ARALL/48-118YK.N.IAS...----------..IPRSKQ..TWNDCV
B9SVP8_RICCO/47-111...........----------..AEEGNI..LRGYCD
W5I1G9_WHEAT/44-110...........----------..PEEGDM..LKGYCD
U5DGU8_AMBTC/38-101...G.......----------..LVHQ....LNSYC.
D7MSB1_ARALL/48-110...........----------...FFPPL..LKDICA
D7LBY0_ARALL/72-145LK.R.FSSKR.----------..FSKTNE..IWNRCS
Q9LXX9_ARATH/44-121FE.GVRKQYS.----------..LEKSTY..IMQLC.
A7REG6_ARATH/64-136YK.K.IASKA.----------..IPKSKQ..TWNDCV
B9HQH8_POPTR/62-126...........----------..........IRKRCA
M4F9M9_BRARP/52-124...........----------..TMEGNM..LREYCD
K7N3Y2_SOYBN/45-109...........----------..TEEGDV..LQGYCD
M4FC77_BRARP/213-288YF.DPSASNA.----------..VPKSKY..TWKDCV
M4CIW6_BRARP/37-108LI.G.NESKY.----------..LQKRDE..IWAYCV
B9SE79_RICCO/48-112...........----------..TEEGDI..LEGYCD
K7KX55_SOYBN/121-191LR.NVDPIQL.----------..LEKSKE..TFDNC.
K4D4G7_SOLLC/44-108...........----------..LEETNM..LRGYCD
B9GGU6_POPTR/50-114...........----------..DEEGNI..LRGYCD
U7DW65_POPTR/42-112EK.V...TFV.----------..VATGDQ..IWNHCV
D7LQP6_ARALL/70-141YK.N.IASKA.----------..IPKSKK..AWNDC.
A8MQ83_ARATH/72-148LK.R.FSSKK.----------..FSKTNE..IWNMCS
M4F142_BRARP/86-160YR.F.IASKA.----------..IPKSKQ..TWNDCV
D7MQQ8_ARALL/38-109LI.A.HETEY.----------..LKKSDD..LWNHCV
U5GKZ5_POPTR/42-112EK.V...TFV.----------..VAKGDQ..IWNYCA
I1IN82_BRADI/69-133...........----------..AREADV..LRGFCD
K4C587_SOLLC/77-151MK.GVNKTAV.----------..WINSEN..LWKRCV
Q3ECV9_ARATH/81-154YG.NSIASKD.----------..IPYSKQ..SWNECV
W1PLV8_AMBTC/49-113...........----------..AEEGDI..LRGYCD
K4D4G3_SOLLC/55-119...........----------..SQEGDI..LHGYCD
B9IKH4_POPTR/49-122FV..LTVPEF.----------..FERTEK..VYDHC.
A5AZZ7_VITVI/45-108...........----------..AEEGNI..LQGYC.
M0ZZI9_SOLTU/49-111...........----------...LFPLT..LKSFCS
K7KX59_SOYBN/86-158MR.DVDAMQL.----------..LNKGKK..MFDQC.
I1K1Y8_SOYBN/51-124FK.Q.NLTQI.----------..LKRSEK..VWNDCS
D7MTL8_ARALL/48-110...........----------...LFPPL..LKDGCS
I1QJT2_ORYGL/79-143...........----------..EKYLPL..VKRICS
U5DBS7_AMBTC/38-100...........----------..GGFANQ..LYEFC.
EC14_ARATH/47-111...........----------..PEEANV..LRGFCQ
K7KX55_SOYBN/32-108LK.NVNQTEI.----------..MSKNDK..IFNKCD
Q9LUB3_ARATH/33-97...........----------...LIPPSRRLRDHCS
I1QY08_ORYGL/55-119...........----------..AQEADI..LRGFCD
K7L6R0_SOYBN/36-100...........----------..YHEALS..IRGYCD
M0TA67_MUSAM/60-124...........----------..TQESDI..LRGYCD
M1ASC9_SOLTU/60-130YE.K.ESKSI.----------..LANSIK..VFDSC.
W5I3U0_WHEAT/51-117...........----------..AEEGDM..LKGYCD
M4DW17_BRARP/37-100...........----------..EDFPLA..LRDYCS
Q9C924_ARATH/63-134LK.D.VASAI.----------..LPRSKR..MWNKCV
M4EJU1_BRARP/45-107...........----------...LFPPL..IKDGCS
D7LL48_ARALL/69-143LK.R.FSSKA.----------..MIKTNE..IWNKCS
Q3ECV8_ARATH/86-158YK.N.KASKG.----------..IPKSKQ..TWNECV
Q9FYN3_ARATH/84-147...........----------...FFDCV..VKLHCS
U5GF05_POPTR/42-112EK.V...TFV.----------..AAKGDQ..IWNHCA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window