Sequence alignment for CL0482

PF13016

Q5Z9M9_ORYSJ/30-100QQQPF......MQPIMNPCNEFVR-QQCSP--.-.....---------------------------------..MSL-PW
Q0D7V8_ORYSJ/32-104QLQSH...LLLQQQVLSPCSEFVR-QQYSI--.-.....---------------------------------..VAT-PF
AVLBB_WHEAT/153-224Q....QQQQQL.QEQLTPCATFLQ-HQCSP--.-.....---------------------------------..VTV-PF
D2KFG9_WHEAT/47-117EHPVP.......HQKLNPCRDALL-QQCSP--.-.....---------------------------------.VADM-SF
I1I1L7_BRADI/190-267.SQPQGQQYPTSQHQLGQCREFFL-QQCSQ--.-.....---------------------------------GAMAP-FV
M8A4Q2_TRIUA/135-215QQQPSVEE....NQQLNLCKEFLL-QQCNP--E-EKLSL---------------------------------LQSVI-PF
GDBB_WHEAT/132-208QQQPSLIQQSL.QQQLNPCKNFLL-QQCKP--.-.....---------------------------------.VSLV-SS
GLTA_WHEAT/180-256QQQIPVIHPSV.LQQLNPCKVFLQ-QQCIP--.-.....---------------------------------VAMQR-CL

PF00234

IAA2_WHEAT/37-143------------------CNPATG-..YKV--S-ALTG...............CRAMVK-------------LQCVG-SQ
PRO28_ORYSJ/47-143------------------CGEFVR-QQCST--V-A......................TP-------------FFQSP-VF
RAG1_ORYSJ/39-150------------------CRPGIS-..YPT--Y-SLPQ................CRTLV-------------RRQCV-GR
NLTP1_ORYSI/28-112------------------CGQVNS-A....--.-.........................-------------VGPCL-TY
NLTP4_ORYSJ/30-115------------------CGQVVS-M....--.-.........................-------------LAPCI-MY
B7E7J9_ORYSJ/30-95------------------CN..AG-Q....--.-.........................-------------LTVCT-GA
NLTP3_ORYSI/32-117------------------CGDVTS-S....--.-.........................-------------IAPCL-SY
A9_ARATH/27-87------------------CRDELS-N....--.-.........................-------------VQVCA-PL
108_SOLLC/35-99------------------CQ..PQ-QSCTA--S-L......................TG-------------LNVCA-PF
14KD_DAUCA/54-136------------------CPRDAL-K....--.-.........................-------------LGVCA-DV
2SS1_ARATH/59-153------------------CQQLML-QQARQ--G-RSDE................FDFED-------------DMENP-QG
2SS1_BRANA/16-122------------------CQQWLH-KQAMQ--S-GGGPSWT.........LDGEFDFED-------------DMEKQ-GP
2SS2_ARATH/58-158------------------CQKLMR-MQMRQ--G-RGGGPSL..........DDEFDLED-------------DIENP-QG
2SS5_HELAN/53-148------------------CRMFLQ-QGQNI--P-R......................EF-------------DNPQM-GR
2SS5_HELAN/190-290------------------CQRFVE-QQMQQ--S-P......................RS-------------TRPYQ-QR
2SS8_HELAN/49-139------------------CYQQME-EAEML--N-H.....................CGM-------------YLMKN-LG
2SSE_BRANA/60-174------------------CQQWLH-KQAMQ--P-GGGSGPSW.......TLDGEFDFED-------------DVENQ-QQ
2SSL_PICGL/52-156------------------CDPQ..-.....--R-D.....................PQR-------------LSSCR-DY
2SS1_BEREX/40-137------------------CREQMQ-RQQML--S-HCRMYM...........RQQMEESP-------------YQTMP-RR
B9SA35_RICCO/61-155------------------CERYLR-QSSSR--R-SP...................GEEV-------------LRMPG-DE
B9SA35_RICCO/162-256------------------CRGQIQ-EQQNL--R-QCQ..................EYIK-------------QQVSG-QG
2SS_SOYBN/43-152------------------CEKHIM-EKIQG--R-GDDDDDDDDDNHILRTMRGRINYIR-------------RNEGK-DE
M4CYI5_BRARP/32-92------------------CLDNLS-N....--.-.........................-------------MQVCA-PL
A6N9I7_ALLCE/31-116------------------CPRVNR-I....--.-.........................-------------VTPCV-AY
AVE3_AVESA/69-210------------------CRQFLV-QQCSP--V-A.....................VVP-------------FLRSQ-IL
CCDP_MAIZE/48-127------------------CPIDAL-K....--.-.........................-------------LKVCA-KV
FIL1_ANTMA/31-90------------------CSASLA-N....--.-.........................-------------LNACA-PF
GDA0_WHEAT/146-275------------------CMDVVL-QQHNI--.-........................A-------------HGRSQ-VL
GDA2_WHEAT/143-280------------------CRDVVL-QQHNI--.-........................A-------------HGSSQ-VL
GDA5_WHEAT/152-306------------------CRDVVL-QQHNI--.-........................A-------------HASSQ-VL
GDA6_WHEAT/155-283------------------CRDVVL-QQHNI--.-.........................-------------AHARS-QV
GDA8_WHEAT/46-175------------------CMDVVL-QQHNI--.-........................A-------------HGRSQ-VL
GDB1_WHEAT/134-288------------------CKVFLQ-QQCSP--V-AM....................PQR-------------LARSQ-MW
GDB2_WHEAT/184-310------------------CKNILL-QQSKP--A-S.....................LVS-------------SLWSI-IW
GDB3_WHEAT/87-228------------------CKVFLQ-QQCSP--V-AM....................PQR-------------LARSQ-ML
B6UKL2_TRITU/171-285------------------CKNFLL-QQCNH--V-S.....................LVS-------------SLVSI-IL
A2Y665_ORYSI/48-178------------------CRQVLD-RQLTG--R-E......................RF-------------...QP-MF
D2DII3_WHEAT/197-341------------------CKVFLQ-QQCIP--V-AM....................QRC-------------LARSQ-ML
GLU2_MAIZE/128-213------------------CVEFLR-HQCSP--T-A......................TP-------------.....-.Y
HOG1_HORVU/166-288------------------CKEFLL-QQCRP--V-S.....................LLS-------------YIWSK-IV
HOG3_HORVU/142-276------------------CKEFLL-QQCTL--D-EKVPL..............LQSVIS-------------FLRPH-IS
HOR1_HORVU/143-282------------------CKVFLQ-QQCSP--V-PV....................PQR-------------IARSQ-ML
HPSE_SOYBN/8-77------------------CP.D..-.....--.-.........................-------------LSICL-NI
IAAC1_WHEAT/30-140------------------CYAGMG-..LPI--N-PLEG...............CREYVA-------------QQTCG-IS
IAAC3_WHEAT/43-159------------------CRDYVL-QQTCG--T-FTPG...............SKLPEW-------------MTSAS-IY
IAC16_WHEAT/30-134------------------CTPWMS-..TLI--T-PLPS...............CRDYVE-------------QQACR-IE
IAA1_HORVU/20-131------------------CWPGMG-..YPV--Y-PFPR................CRALV-------------KSQCA-GG
IAA1_WHEAT/6-115------------------CY..PG-QAFQV--P-ALPA...............CRPLLR-------------LQCNG-SQ
IAA2_HORVU/37-144------------------CDPEMG-..HKV--S-PLTR...............CRALVK-------------LECVG-NR
IAA4_SORBI/7-111------------------CAPGLA-..IPA--P-PLPT...............CRTFAR-------------PRTCG-LG
IAA5_SORBI/4-106------------------CEPGLV-..IPL--N-PLPS...............CRTYMV-------------RRACG-VS
IAAA_HORVU/30-140------------------CYAGMG-..LPS--N-PLEG...............CREYVA-------------QQTCG-VT
IAAE_HORVU/29-137------------------CAPGDA-..LPH--N-PLRA...............CRTYVV-------------SQICH-QG
IAAT_ELECO/6-114------------------CIPGMA-..IPH--N-PLDS...............CRWYVS-------------TRTCG-VG
B6UHB4_MAIZE/34-143------------------CVPGWA-..IPH--N-PLPS...............CRWYVT-------------SRTCG-I.
LIM1_LILLO/29-88------------------CSAAIG-E....--.-.........................-------------LMTCG-PY
MC1_PINRA/28-88------------------CSNAMD-K....--.-.........................-------------LAPCT-SA
MEN8_SILLA/38-98------------------CASQLG-N....--.-.........................-------------LNVCA-PY
NLT11_PARJU/4-91------------------CGTMVR-A....--.-.........................-------------LMPCL-PF
NLT21_PARJU/35-121------------------CGKVVQ-D....--.-.........................-------------IMPCL-HF
F2DCX3_HORVD/29-111------------------CGQVSS-A....--.-.........................-------------LSPCI-SY
NLTP1_ARATH/29-114------------------CGSVNS-N....--.-.........................-------------LAACI-GY
NLTP1_BRANA/29-113------------------CGTVSG-N....--.-.........................-------------LAACI-GY
A8YPK3_HORVU/29-113------------------CGQVDS-K....--.-.........................-------------MKPCL-TY
NLTP2_SOLLC/27-110------------------CGEVTS-G....--.-.........................-------------LAPCL-PY
NLTP1_PRUAR/3-87------------------CGQVSS-S....--.-.........................-------------LAPCI-GY
NLTP1_TOBAC/27-110------------------CGQVTS-N....--.-.........................-------------LAPCL-AY
NLTP2_HORVU/37-102------------------CE..PA-Q....--.-.........................-------------LAVCA-SA
NLTP3_HORVU/29-114------------------CGQVSS-A....--.-.........................-------------LSPCI-SY
B6CQU4_9ROSA/33-119------------------CGQVVN-N....--.-.........................-------------LTPCI-NY
NLTPA_BRAOT/29-114------------------CGTVNS-N....--.-.........................-------------VAPCI-GY
NLTPA_RICCO/3-88------------------CGQVNS-S....--.-.........................-------------LASCI-PF
NLTP1_WHEAT/26-110------------------CGHVDS-L....--.-.........................-------------VRPCL-SY
NLTPB_RICCO/3-88------------------CGQVNK-A....--.-.........................-------------LSSCV-PF
NLTPC_RICCO/28-112------------------CSTVDM-K....--.-.........................-------------AAACV-GF
NLTP_AMACA/4-90------------------CTVVTK-A....--.-.........................-------------LGPCM-TY
NLTP_BETVU/29-113------------------CGLVAS-K....--.-.........................-------------LAPCI-GY
NLTP_CICAR/27-111------------------CGRVDT-A....--.-.........................-------------LAPCL-GY
NLTP_DAUCA/30-116------------------CGQVTG-A....--.-.........................-------------LAPCL-GY
NLTP_ELECO/4-90------------------CGQVSS-A....--.-.........................-------------IGPCL-AY
NLTP_GERHY/28-112------------------CGQVTS-G....--.-.........................-------------LVPCF-GY
NLTP_HELAN/28-112------------------CGQVSS-S....--.-.........................-------------LAPCI-SY
NLTP_PINTA/34-119------------------CNQVVS-A....--.-.........................-------------MTPCA-TY
NLTP_SPIOL/30-113------------------CGMVSS-K....--.-.........................-------------LAPCI-GY
NLTP_STRHE/10-89------------------CGTVDM-K....--.-.........................-------------AASCI-SF
NLTP_VIGUN/34-99------------------CN..PT-E....--.-.........................-------------LSSCV-PA
NLTP6_AMBAR/30-113------------------CDTVQN-I....--.-.........................-------------LAPCA-GF
O22110_PICAB/25-104------------------CEDSDN-T....--A-C.....................LSS-------------LSSCA-PY
O22272_ARATH/48-125------------------CSTVIY-S....--.-.........................-------------MMDCL-GY
NLTP2_SOLPN/27-110------------------CGQVTS-T....--.-.........................-------------LAPCL-PY
O24101_MEDTR/31-102------------------CNIDPN-D....--.-........................L-------------KQSCS-KF
O24355_SILLA/25-110------------------CSDVIP-K....--.-.........................-------------VTFCL-LY
O24440_PHAVU/29-112------------------CGQVTS-S....--.-.........................-------------LASCI-PF
O24485_PINRA/36-122------------------CNTIIQ-Q....--.-.........................-------------ITSCA-TY
O24486_PINRA/39-97------------------CAATAE-S....--.-.........................-------------LSPCA-SA
O49116_ARATH/29-125------------------CRDVFV-S....--.-.........................-------------FMPCM-GF
O49178_ORYSA/42-149------------------CQPGMG-..YPM--Y-PLR.................VAGVG-------------EAPLL-GR
O49644_ARATH/39-110------------------CVMMIP-D....--.-........................I-------------LEECF-TH
O64431_BRACM/21-86------------------CD..PK-Q....--.-.........................-------------LQPCL-AA
YLS3_ARATH/36-113------------------CTAQLV-G....--.-.........................-------------MATCL-PY
O65368_ARATH/32-112------------------CSRDAI-K....--.-.........................-------------LGVCA-KI
O65369_ARATH/55-137------------------CPKDTL-K....--.-.........................-------------LGVCA-NV
O65561_ARATH/29-103------------------CQGDIE-G....--.-........................L-------------MKECA-VY
O81135_HORVU/27-92------------------CE..VG-Q....--.-.........................-------------LTVCM-PA
O81410_PICGL/53-146------------------CE..QQ-R....--.-.........................-------------LSSCR-EY
O81872_ARATH/32-107------------------CGANLS-G....--.-........................L-------------MNECQ-RY
O82439_ARATH/25-107------------------CPKNSI-E....--.-.........................-------------IGTCV-TV
NLTP2_PRUAR/3-68------------------CSPV..-Q....--.-.........................-------------LSPCL-GP
F2D8V2_HORVD/31-96------------------CN..AL-Q....--.-.........................-------------LTPCA-GA
P93198_9ROSI/39-132------------------CREQIQ-RQQNL--N-HCQYYL...........RQQSRSGG-------------YDEDN-QR
P93274_MALDO/2-73------------------CVDVLG-G....--.-.........................-------------.....-..
P93513_9POAL/63-154------------------CSDYVM-D.RCV--M-KD...................MPLS-------------WFFPR-TW
P93611_WHEAT/84-166------------------CPVDTL-K....--.-.........................-------------LLGCV-DA
P93705_DAUCA/264-345------------------CPLDAL-K....--.-.........................-------------LGACV-DV
P93794_WHEAT/195-344------------------CKVFLQ-QQCIP--V-AM....................QRC-------------LARSQ-ML
PRF1_SOLLC/261-343------------------CPIDAL-K....--.-.........................-------------LGACV-DV
PROA_ORYSI/43-134------------------CRQYMM-Q....--T-L......................GM-------------GSSTA-MF
PRO25_ORYSJ/47-143------------------CSEFVR-QQYSI--V-A......................TP-------------FWQPA-TF
J7FK20_9POAL/48-138------------------CRNYLL-DRCST--M-KD...................FPVT-------------WRWWK-WW
B6Z278_WHEAT/50-140------------------CKDYVM-ERCFT--M-KD...................FPVT-------------.WPTK-WW
Q00318_COILA/103-188------------------CIEFLR-HQCSP--A-A......................TP-------------.....-.Y
Q06763_SOYBN/68-149------------------CPIDTL-K....--.-.........................-------------LGACV-DL
Q09071_AVESA/48-166------------------CQMFLM-QQCSP--V-E.....................MVP-------------FLRSQ-IL
Q09072_AVESA/74-212------------------CKQFLV-QQCSP--V-A.....................AVP-------------FLRSQ-IL
Q39100_ARATH/48-126------------------CK.DAL-K....--.-.........................-------------LKVCA-NV
ERLI1_ARATH/85-167------------------CPIDAL-R....--.-.........................-------------LGVCA-NV
Q39332_BRANA/28-112------------------CGTVTS-T....--.-.........................-------------MTQCI-SY
Q39574_CATRO/55-137------------------CPRDAL-K....--.-.........................-------------LGVCA-DL
2SS_CUCMA/55-139------------------CEQYLR-Q....--Q-SR....................DVL-------------QMRGI-EN
Q39787_GOSHI/36-131------------------CEQQIR-KQAHL--K-HCQKYM............EEEWGGE-------------GSDNI-AG
Q39928_HELAN/52-143------------------CRMFLQ-Q....--G-Q......................RG-------------QQHQQ-QQ
Q40335_MEDSA/84-165------------------CPTDTL-K....--.-.........................-------------LGVCA-DV
Q40453_TOBAC/25-114------------------CQTVTT-Q....--.-.........................-------------LAPCL-SY
Q40654_ORYSJ/41-149------------------CQPGIG-..YPT--Y-PLPR...............CRAFVK-------------RQCVA-PG
A2X812_ORYSI/52-133------------------CPRDAL-K....--.-.........................-------------LGVCA-NV
Q40997_PINST/58-160------------------CD..PQ-R....--.-.........................-------------LSDCH-DY
Q41125_PHAVU/45-126------------------CPENTL-K....--.-.........................-------------FGVCA-DV
Q41168_RAPSA/29-141------------------CQQWLH-RQARQ--S-GSGPSWT.........LDDEFDFED-------------DMENP-QG
Q41320_SECCE/55-178------------------CKNVLL-QQCSP--V-A.....................LVS-------------SLRSK-IF
Q41378_9ASTR/24-89------------------CS..VT-E....--.-.........................-------------LMPCS-SA
Q41543_WHEAT/137-262------------------CKNFLL-QQCKP--V-S.....................LVS-------------SLWSM-IL
Q41848_MAIZE/215-296------------------CPIDTL-K....--.-.........................-------------LNACV-DV
Q42044_ARATH/52-133------------------CPTDTL-K....--.-.........................-------------LGVCA-DL
Q42158_ARATH/29-94------------------CS..PM-Q....--.-.........................-------------LASCL-AA
Q42392_ZINVI/30-95------------------CQ..VT-Q....--.-.........................-------------LAPCA-SA
Q42474_ORYSA/65-146------------------CPIDAL-K....--.-.........................-------------LRVCA-NV
Q42487_POPNI/58-140------------------CPKDAL-K....--.-.........................-------------LGVCA-DL
M0VYA0_HORVD/33-118------------------CGQVDS-K....--.-.........................-------------LAPCV-AY
Q43496_SOLLC/28-101------------------CSSTFF-S....--.-.........................-------------ALIQL-IP
Q43522_SOLLC/127-207------------------CPRDAL-K....--.-.........................-------------LGVCA-NV
F2E1T8_HORVD/29-111------------------CGQVSS-A....--.-.........................-------------LGPCA-AY
Q96232_ASPOF/101-182------------------CPLDAL-K....--.-.........................-------------LGACV-DL
Q9S7U3_ARATH/46-128------------------CPKDTL-K....--.-.........................-------------LGVCA-NV
Q9SA59_ARATH/25-103------------------CRDTLT-S....--.-.........................-------------LSPCL-YY
Q9SBW9_MAIZE/43-101------------------CLPQLN-R....--.-.........................-------------LLACR-AY
Q9SC06_TRIMO/34-125------------------CSDYVM-DRCVT--K-D......................MP-------------LSWVF-PR
Q9SDS2_CAPAN/27-110------------------CGQVQS-R....--.-.........................-------------MTPCL-PY
Q9SDS4_CAPAN/19-102------------------CGQIQV-G....--.-.........................-------------VVNCL-PY
F2CY84_HORVD/32-117------------------CSAVYS-T....--.-.........................-------------LMPCL-QY
Q9SET1_ARATH/222-304------------------CPIDTL-K....--.-.........................-------------LGACV-DV
Q9SHA0_ARATH/27-109------------------CGRMPI-NQAAA--.-........................S-------------LSPCL-PA
Q9SI70_ARATH/29-101------------------C...VS-K....--.-.........................-------------LVPCF-ND
Q9SKI0_ARATH/208-289------------------CPIDTL-K....--.-.........................-------------LGACV-DL
Q9SRS1_ARATH/32-105------------------CGRTFL-SALIQ--.-.........................-------------LVPCR-PS
Q9ST25_MAIZE/51-132------------------CPLNAL-K....--.-.........................-------------FGVCA-DV
Q9STH5_ARATH/42-113------------------CAAG..-.....--.-.........................-------------LAVCL-PA
Q9SU32_ARATH/34-115------------------CPRDVL-K....--.-.........................-------------LSTCS-NV
Q9SUV8_ARATH/28-104------------------CPRDIE-.....--A-CS...................NVFG-------------LGRIL-NY
Q9SUW7_ARATH/37-117------------------CPRDST-Q....--.-.........................-------------FLSCT-NV
Q9SUX0_ARATH/37-116------------------CPRNPL-Q....--.-.........................-------------LGVCA-NV
Q9SUX3_ARATH/50-132------------------CPKDAL-K....--.-.........................-------------VGVCV-NA
Q9SUZ2_ARATH/48-121------------------CSRTFF-S....--A-L......................VQ-------------LIPCR-AA
SCA_LILLO/25-109------------------CGQVDS-D....--.-.........................-------------LTSCL-GY
Q9SXE7_ARATH/212-293------------------CPINAL-K....--.-.........................-------------LGACV-DV
Q9XF30_ORYSI/41-111------------------CNPTL.-.....--.-.........................-------------LTPCA-GP
NLTP5_ARATH/29-114------------------CGAVTG-S....--.-.........................-------------LGQCY-NY
2SS1_SESIN/54-141------------------CMQWMR-SMRGQ--Y-E......................ES-------------FLRSA-EA
NLTP8_ARATH/28-112------------------CSVVLQ-D....--.-.........................-------------LQPCV-SY
NLTL2_ARATH/27-105------------------CSSLIL-N....--.-.........................-------------MADCL-SF
Q9ZSL7_BRANA/27-108------------------CGTVTS-N....--.-.........................-------------LAPCA-VY
Q9ZTW2_FRAAN/73-155------------------CPRDAL-K....--.-.........................-------------LGICA-NV
NLTP7_ARATH/29-118------------------CGEVNS-N....--.-.........................-------------LKPCT-GY
XYP11_ARATH/40-120------------------CLVSML-N....--.-.........................-------------VSDCF-SY
YY1_ORYSJ/31-94------------------CAAQLT-Q....--.-.........................-------------LAPCA-RV
ZEB2_MAIZE/86-172------------------CVEFLR-HQCSP--A-A......................TP-------------YGSP.-..
ZM33_MAIZE/45-108------------------CAGQLR-G....--.-.........................-------------LAPCL-RY

PF14368

Q1G3I0_ARATH/16-107------------------AIAPLL-AEPQS..T..MFP...............EMTPEC........ATV...MPDL-.L
Q3ECK0_ARATH/8-101------------------FAAAMT-VMALL..L.VPTI...............EAQTEC........VSK..LVPC.-..
B9RBQ4_RICCO/7-100------------------MVALLF-LTTTI..A.PSQA...............QDTASC........AQN..LISC.-..
Q9LE56_ARATH/14-113------------------FCYVTS-SNAQM..T.SPPSGGA.........GGDAHSLPC........IQK..LMPC.-..
Q0D9K5_ORYSJ/20-116------------------GAASSS-AAAQAAVD.TGAA...............AGVPSC........ASK..LVPC.-..
Q9SUV6_ARATH/10-114------------------FLAVVI-APQWT..E.TKKPPRPSDTSDTSGTSGRDRRTMC........PLS...IPGI-.V
C5Z9F1_SORBI/22-116------------------V....L-APSAHAQG.TSGS...............GAMPSC........AAK..LVPCA-.G
C5XVS1_SORBI/14-118------------------LLLAVA-VDTVS..S.RRHHHAPAGAP.HGVVAPSQHLLPC........LEE..LLPC.-..
C3SA92_BRADI/13-112------------------VLALAA-AASAA..T..PAP...............APAVDC........QEAFLALSDC-.L
Q9LJ85_ARATH/13-108------------------AVLALP-IRGQQ..Q..PLS...............QCTPSM........MTT..VSPCM-.G
Q7XIG9_ORYSJ/15-115------------------ALACGA-ASQSP..APAPAA...............GPASDC........GSS..ITALA-.G
C5X2J9_SORBI/14-111------------------ALASGA-ASQAP..G.PSSP...............PVDCSS........AVT.GLIGC.-..
A9S0T9_PHYPA/9-107------------------MCLVLI-VASAM..V.VTTA...............AAGCDI........DL...LLPCL-..
C5Y597_SORBI/23-118------------------FLATVV-IPAAA..A.QEGY...............SCRDSL........AG...LKEC.-..
B9RIH6_RICCO/12-107------------------ILAIWI-AVGMS..I.SGQI...............AAAQSC........NTD...LTDL-.V
B9RIH3_RICCO/10-107------------------IMAMLV-MVGTQ..V.LSDK...............KVSAQC........EGK.VPLPQL-.I
A9TY60_PHYPA/11-108------------------LFASVL-VAGVG..VGGQSL...............YCREAT........YSS..LAPC.-.S
B9HP13_POPTR/12-110------------------ALAMLL-IVGIH..I.LGNQ...............KVAASC........NET...VTSL-.V
C5XAF7_SORBI/6-114------------------LLATAA-VPLAS..G.QQQP...............AGAASC........TAS..LLTS.-.F
A9T6D1_PHYPA/9-104------------------LLLVVL-VG.LS..A.VVNV...............ESQAQCGG....RNLSI..LAPC.-..
B9HP10_POPTR/10-105------------------VLAWLV-VVGAR..F.LGDH...............KVSAQC........GGS..FVD.I-.E
B9RTN3_RICCO/10-113------------------FLLMAT-ASQTP..C.PPPP...............VASCTG........ELV..AISPC-.L
B9RIH4_RICCO/10-105------------------ALAVLL-IAGML..I.SGEL...............VSAINC........DND..LIGL.-.A
B9RZC4_RICCO/7-99------------------ALVLVL-VLAIV..V...NG...............ENPCRL........TNE..GIEAC-.R
A9SQH6_PHYPA/103-196------------------VLALVL-NAPGT..A.QAQI...............CADSQA........AVL..YVSC.-..
B9SEE9_RICCO/14-106------------------VLVAVM-VDEAR.MV.QGAG...............LSPSQC........KQE..QTLG.-.V
C5WP26_SORBI/30-121------------------AAAATP-TPPQA..A..QAA...............AAGAAC........HND...IVAL-.R
B9SEE8_RICCO/14-105------------------LVAVLS-IVEVK..T.ANAA...............PSAAQC........KEE..RRLG.-.L
C5WP25_SORBI/18-110------------------LLLAAA-TAAAA..T.PEAP...............TAGAAC........YND...IVAL-.R
A9SQH9_PHYPA/117-210------------------ILTLVL-AATGG..V..QAQ...............PCSPTQ........PL...LLYG.-.Y
B9GVR5_POPTR/18-112------------------VMAVVF-SSCTT..TLTKAQ...............ESSTSC........ATK..LTAC.-..
B9H8A8_POPTR/14-108------------------..STLL-VISVN..G.QIST...............PCTTSM........ISS..FTPCI-.N
B9HUT8_POPTR/13-107------------------....ML-LLLSA..A.EPSP...............ASPPGC........SDE..LVAFS-.P
D7T8D6_VITVI/12-114------------------VMALML-VSQAF..V.Q.EA...............NGAGECGKTPIQSAAAS..LSSCL-..
I1PAV8_ORYGL/35-130------------------....VA-SSPWA..A.PA.P..............WPGELDC........TGA..LLNLS-.S
I1QT58_ORYGL/18-119------------------...AAT-AAAAG..L.PPLPSTMP......ADVPQPEIPPC........LND..LMPC.-..
I1R180_ORYGL/22-119------------------..AWLP-SRASA..A.SDAA...............AGGEYC........RDS..LSGLL-.A
Q1G2Y5_ARATH/16-109------------------....LL-SSNSP..T.SILA...............QINTPC........SPS..MLSS.-.V
Q2R222_ORYSJ/12-114------------------VLLVLL-VAAAG..G..GAE...............AAATTC........VAS..LLELS-.P
Q75GY5_ORYSJ/27-127------------------.AAIMA-SSAQP..Q.QQQQQPPQ......PPGQPANAPSCP.....PVQAS..LSPCV-..
Q8S077_ORYSJ/23-111------------------.....A-VAPAA..A.AGAP...............FMVCGV........DAD.RMAADC-.G
Q9SUV7_ARATH/19-112------------------FLAVTI-VDAQS..M.PPMP...............KFNPVC........ALA..DLPNI-.V
U5G1T3_POPTR/18-113------------------.LAVMI-LPVYG..Q..INT...............ACTASV........LAT..FTPCM-.N
U5GQ18_POPTR/24-115------------------..VVVV-LGMWEVNK.ADAA...............LSAAQC........KEE..RRLGL-NA

PF14547

F2DU32_HORVD/35-120-----------------PCPTNALAD----------------------------------------------LKVCA-DV
D7ME35_ARALL/36-114-----------------VCPR....D----------------------------------------------IQACV-NV
A8MRQ5_ARATH/577-656-----------------TCPRNAN.Q----------------------------------------------IRTCS-NV
D7ME37_ARALL/85-164-----------------RCPRNGL.P----------------------------------------------LQICS-TI
D7ME34_ARALL/31-113-----------------VCPRDSI.N----------------------------------------------FISCS-NV
D7ME36_ARALL/7-89-----------------TTIMS...D----------------------------------------------LGICV-NV
D7MAX1_ARALL/157-241-----------------TCPIDAL.K----------------------------------------------LGACV-DV
Q7XTE3_ORYSJ/6-89-----------------FCPWDAV.K----------------------------------------------FGACA-GV
B9S3J8_RICCO/215-298-----------------TCPIDTL.K----------------------------------------------LGACV-DV
D7ME38_ARALL/36-117-----------------TCPRNPL.Q----------------------------------------------LGVCA-NV
C5Z4Z5_SORBI/237-320-----------------TCPIDTL.K----------------------------------------------LNACV-DV
C5Y909_SORBI/46-127-----------------.CPWDAV.K----------------------------------------------FGACV-GV
F4JLV4_ARATH/297-375-----------------.CSKNDT.E----------------------------------------------LKICA-GI
I1QBL2_ORYGL/229-307-----------------KCPLLLT.N----------------------------------------------LGGCI-SL
M4F7Y5_BRARP/170-253-----------------TCPIDTL.K----------------------------------------------LGACV-DL
W4ZSZ5_WHEAT/138-222-----------------KCPTDAL.K----------------------------------------------LHVCA-NV
W5AJU0_WHEAT/30-113-----------------SCPKDGL.K----------------------------------------------LKACV-DV

PF05617

M4FC94_BRARP/72-146-----------------TCMDKMK.PIG--------------------------------------------..KCGFED
B9S177_RICCO/41-104-----------------NCWDSLI...Q--------------------------------------------LEACT.TE
U5FMS5_POPTR/61-132-----------------NCANTIS....--------------------------------------------.KSAG.DK
M1BC58_SOLTU/78-151-----------------ECLQNIS....--------------------------------------------.DDCG.II
M4FCA2_BRARP/71-146-----------------TCADKMG.PSG--------------------------------------------ISECN.ED
M4F146_BRARP/69-143-----------------VCAQKLN....--------------------------------------------SSHCG.DA
M4FC93_BRARP/72-147-----------------TCGKNMG.PSG--------------------------------------------TVKCN.VD
EC12_ARATH/45-109-----------------ECWNALY...E--------------------------------------------LKSCT.NE
M4FC76_BRARP/105-178-----------------ICLQKLN....--------------------------------------------.SDCG.DN
D7LVH8_ARALL/44-116-----------------KCMAKLS....--------------------------------------------.SRCA.MY
M4F8U3_BRARP/34-96-----------------DCLSSLE...T--------------------------------------------IPDCI.PE
K4CB92_SOLLC/64-137-----------------NCTKYLP....--------------------------------------------.NKCG.IK
B9SN88_RICCO/61-124-----------------KCFQDFN...I--------------------------------------------DQECG.QQ
B9SVP5_RICCO/53-119-----------------DCWNALM...E--------------------------------------------IKSCS.NE
B9GGT7_POPTR/48-111-----------------.CWGSLL...H--------------------------------------------LQSCI.SN
I1I7L3_BRADI/74-140-----------------ECLKMVL...R--------------------------------------------AEGCA.VD
K7KX58_SOYBN/72-144-----------------KCVVKIG....--------------------------------------------.TECG.EE
K7KX56_SOYBN/72-143-----------------KCTENLG....--------------------------------------------.NECG.EQ
K7MQC1_SOYBN/160-232-----------------DCAAKLH....--------------------------------------------.PHCG.DQ
M0TQL0_MUSAM/66-131-----------------.CWDSLM...E--------------------------------------------LRSCT.GE
EC11_ARATH/57-120-----------------.CWDSLM...Q--------------------------------------------LQHCS.GE
B9T247_RICCO/77-140-----------------KCLQDFH...V--------------------------------------------EQGCV.NQ
M4FC95_BRARP/79-152-----------------TCMDKME.PIG--------------------------------------------..KCG.LY
D7KC93_ARALL/38-103-----------------TCLVKIT....--------------------------------------------.PKCA.LN
M4EKA3_BRARP/43-105-----------------KCWSSIF...N--------------------------------------------VNGCV.LE
D7MTL8_ARALL/141-203-----------------KCLSSLV...S--------------------------------------------VQGCV.TE
C5YSL3_SORBI/84-148-----------------ECWAAVM...G--------------------------------------------LSSCY.SE
A8MS74_ARATH/69-143-----------------DCAVKMG..AG--------------------------------------------GNECN.IE
U5GVU7_POPTR/48-112-----------------NCWDSLV...Q--------------------------------------------LQACS.GE
Q6ZKQ3_ORYSJ/79-152-----------------.CWNAVL...R--------------------------------------------AEVCA.GD
K7LY71_SOYBN/49-122-----------------NCGSHLS....--------------------------------------------.PNCG.DE
B9SXP3_RICCO/41-109-----------------QCLAPFL...G--------------------------------------------ISGCQ.SA
K7KW29_SOYBN/52-115-----------------.CWDSLW...Q--------------------------------------------LQACT.GE
B9HRY2_POPTR/41-112-----------------QCVAVTG....--------------------------------------------.ARCG.EE
M4DW18_BRARP/37-99-----------------DCMSSLY...A--------------------------------------------IPNCL.QE
M4DVD8_BRARP/72-146-----------------NCAKTRDV...--------------------------------------------..KCD.DE
B9RBY2_RICCO/99-162-----------------KCWSPIT...R--------------------------------------------IEGCY.VK
B9P5Y5_POPTR/32-100-----------------.CFLPLT...T--------------------------------------------IPGCS.KE
B9GU63_POPTR/46-117-----------------GCAAKLT....--------------------------------------------.GKCG.AE
M4FC77_BRARP/64-140-----------------DCLKKVE....--------------------------------------------TDYCA.AK
Q8S8C9_ARATH/73-145-----------------.CSKKMAV...--------------------------------------------PDKCI.EE
B9SN89_RICCO/73-136-----------------KCLQDFH...V--------------------------------------------DQGCV.QQ
Q3EBD9_ARATH/70-142-----------------TCAGLMG....--------------------------------------------GEKCS.DQ
D7MVA2_ARALL/48-118-----------------ACAEKPS....--------------------------------------------.SICG.GE
B9SVP8_RICCO/47-111-----------------DCWNALI...E--------------------------------------------IKSCS.NE
W5I1G9_WHEAT/44-110-----------------QCWEALL...D--------------------------------------------IKSCT.GE
U5DGU8_AMBTC/38-101-----------------QCLMSVA...L--------------------------------------------VAGCA.QE
D7MSB1_ARALL/48-110-----------------KCWSSLF...N--------------------------------------------VEGCV.LE
D7LBY0_ARALL/72-145-----------------NCSKKMDV...--------------------------------------------PYQCT.VE
Q9LXX9_ARATH/44-121-----------------KCMAKLS....--------------------------------------------.SRCA.MY
A7REG6_ARATH/64-136-----------------ACPKKPS....--------------------------------------------.SKCD.DE
B9HQH8_POPTR/62-126-----------------ECLATIK..AH--------------------------------------------ADICL.HE
M4F9M9_BRARP/52-124-----------------DCWNAAL...E--------------------------------------------LKSCT.DE
K7N3Y2_SOYBN/45-109-----------------NCWDSLF...E--------------------------------------------LQACT.GE
M4FC77_BRARP/213-288-----------------.CLDKVE....--------------------------------------------TGYCG.AK
M4CIW6_BRARP/37-108-----------------QCVVKIS....--------------------------------------------.PNCA.LK
B9SE79_RICCO/48-112-----------------SCWDSLV...Q--------------------------------------------LQACT.GE
K7KX55_SOYBN/121-191-----------------KCAEQLG....--------------------------------------------..YCG.EQ
K4D4G7_SOLLC/44-108-----------------DCFNALA...E--------------------------------------------IKSCT.NE
B9GGU6_POPTR/50-114-----------------ECWNALV...E--------------------------------------------IKSCT.NE
U7DW65_POPTR/42-112-----------------QCHAKVT....--------------------------------------------.KRCA.IE
D7LQP6_ARALL/70-141-----------------ACPKKPS....--------------------------------------------.PKCE.DE
A8MQ83_ARATH/72-148-----------------NCGKKMDMPYG--------------------------------------------PYQCA.DE
M4F142_BRARP/86-160-----------------ACFQNLN....--------------------------------------------SLDCG.DN
D7MQQ8_ARALL/38-109-----------------TCLVKIT....--------------------------------------------.PKCA.LD
U5GKZ5_POPTR/42-112-----------------ECHTKVT....--------------------------------------------.KRCA.IE
I1IN82_BRADI/69-133-----------------ECWGAVA...E--------------------------------------------LRACT.DE
K4C587_SOLLC/77-151-----------------KCLQNIS....--------------------------------------------.DDCG.VI
Q3ECV9_ARATH/81-154-----------------ACAMKQS....--------------------------------------------.WICL.NV
W1PLV8_AMBTC/49-113-----------------ECWNALA...E--------------------------------------------LSSCS.GE
K4D4G3_SOLLC/55-119-----------------ECWDSLF...E--------------------------------------------LQACT.GE
B9IKH4_POPTR/49-122-----------------RCEKPLA..TK--------------------------------------------FPSCS.NA
A5AZZ7_VITVI/45-108-----------------ECWNALM...E--------------------------------------------IRQCT.NE
M0ZZI9_SOLTU/49-111-----------------KCVASVL...N--------------------------------------------VPGCV.EE
K7KX59_SOYBN/86-158-----------------GCMVKMG....--------------------------------------------.SECG.KE
I1K1Y8_SOYBN/51-124-----------------DCASKLK....--------------------------------------------.PHCG.EQ
D7MTL8_ARALL/48-110-----------------KCWSSIF...N--------------------------------------------VQGCN.IE
I1QJT2_ORYGL/79-143-----------------.CWESVV..GT--------------------------------------------SPPCA.RD
U5DBS7_AMBTC/38-100-----------------.CFGAVT...Y--------------------------------------------LGGCI.QS
EC14_ARATH/47-111-----------------ECWNALY...E--------------------------------------------LKSCT.NE
K7KX55_SOYBN/32-108-----------------ECAKHIG....--------------------------------------------.PQCG.KE
Q9LUB3_ARATH/33-97-----------------DCWSSLE...V--------------------------------------------IPDCV.PE
I1QY08_ORYGL/55-119-----------------ECWSAVT...K--------------------------------------------LGSCT.NE
K7L6R0_SOYBN/36-100-----------------ECWSNLI...V--------------------------------------------LKSCS.NE
M0TA67_MUSAM/60-124-----------------DCWNALL...E--------------------------------------------LRSCT.NE
M1ASC9_SOLTU/60-130-----------------NCTNNIS....--------------------------------------------.QPCG.PE
W5I3U0_WHEAT/51-117-----------------QCWEILM...D--------------------------------------------IRSCT.GE
M4DW17_BRARP/37-100-----------------ECMSSMF...V--------------------------------------------IPNCI.PE
Q9C924_ARATH/63-134-----------------DCSDKMS....--------------------------------------------.SKCN.VE
M4EJU1_BRARP/45-107-----------------KCWSSLT...S--------------------------------------------IQGCV.TE
D7LL48_ARALL/69-143-----------------NCGVKMG..PG--------------------------------------------GTECN.IE
Q3ECV8_ARATH/86-158-----------------ACSEKPS....--------------------------------------------.SKCG.NE
Q9FYN3_ARATH/84-147-----------------KCLADCK...D--------------------------------------------VKTCL.AD
U5GF05_POPTR/42-112-----------------DCHKKVT....--------------------------------------------.KRCA.IE

PF13016

Q5Z9M9_ORYSJ/30-100EQSRR-------------LQ---------LSSCQVMRQQ-CCQQMRLM--------------------A--QQYHCQ--A
Q0D7V8_ORYSJ/32-104WQPAT-------------FQ---------LINNQVMQQQ-CCQQLRLV--------------------A--QQSHYQ--A
AVLBB_WHEAT/153-224PQIRV-------------DQ---------PTSCQNVQHQ-CCRQLSQI--------------------P--EQYRCQ--A
D2KFG9_WHEAT/47-117LRSQV-------------VQ---------HSSCLVMWEQ-CCQQLKAI--------------------P--KQSRCE--A
I1I1L7_BRADI/190-267QPSHM-------------MQ---------QSSCQVMQRQ-CCQQLSQI--------------------D--VQSRCQ--A
M8A4Q2_TRIUA/135-215LRPKT-------------SQ---------QNNCQLKRQQ-CCRQLAHI--------------------S--EPSRCP--A
GDBB_WHEAT/132-208LWSII-------------LP---------PSDCQVMRQQ-CCQQLAQI--------------------P--QQLQCA--A
GLTA_WHEAT/180-256ARSQM-------------LQ---------QSICHVMQQQ-CCQQLRQI--------------------P--EQSRHE--S

PF00234

IAA2_WHEAT/37-143VPE..-------------..---------.....AVLRD-CCQQLADI...................NN--EWCRCG--D
PRO28_ORYSJ/47-143QLRNC-------------Q.---------.....VMQQQ-CCQQLRMI....................A--QQSHCQ--A
RAG1_ORYSJ/39-150GAASA-------------AD---------....EQVWQD-CCRQLAAV...................DD--GWCRCG--A
NLTP1_ORYSI/28-112ARGGA-------------G.---------......PSAA-CCSGVRSLKAAAS..........TTADRR--TACNCL--K
NLTP4_ORYSJ/30-115ATGRV-------------S.---------.....APTGG-CCDGVRTLNSAAA..........TTADRQ--TTCACL--K
B7E7J9_ORYSJ/30-95IAGGA-------------R.---------......PTAA-CCSSLR.....................AQ--QGCFCQ--F
NLTP3_ORYSI/32-117VMGRE-------------S.---------.....SPSSS-CCSGVRTLNGKAS..........SSADRR--TACSCL--K
A9_ARATH/27-87LLPGA-------------VN---------....PAANSN-CCAALQAT....................N--KDCLCN--A
108_SOLLC/35-99LVPGS-------------P.---------.....TASTE-CCNAVQSI...................N.--HDCMCN--T
14KD_DAUCA/54-136LNLVH-------------NV---------VIGSP.PTLP-CCSLLEGLVN................LEA--AVCLCT--A
2SS1_ARATH/59-153QQ.QE-------------Q.---------.....QLFQQ-CCNELRQE....................E--PDCVCP--T
2SS1_BRANA/16-122QQR..-------------..---------....PPLHQQ-YCNELQQE....................E--PLCVCP--T
2SS2_ARATH/58-158PQQGH-------------Q.---------......ILQQ-CCSELRQE....................E--PVCVCP--T
2SS5_HELAN/53-148QQE..-------------..---------.....QQLQQ-CCQELQNI....................E--GQCQCE--A
2SS5_HELAN/190-290PGQQQ-------------QQ---------Q..RG.LQQQ-CCNELQNV....................K--RECHCE--A
2SS8_HELAN/49-139ERSQV-------------SP---------RMREEDHKQL-CCMQLKNL....................D--EKCMCP--A
2SSE_BRANA/60-174GPQQR-------------P.---------....P.PPQQ-CCNELHQE....................E--PLCVCP--T
2SSL_PICGL/52-156LERRR-------------E.---------.....QPSER-CCEELQRM....................S--PQCRCQ--A
2SS1_BEREX/40-137GME..-------------..---------....P.HMSE-CCEQLEGM....................D--ESCRCE--G
B9SA35_RICCO/61-155NQQQE-------------S.---------.....QQLQQ-CCNQVKQV....................R--DECQCE--A
B9SA35_RICCO/162-256PRRSD-------------NQ---------....ERSLRG-CCDHLKQM....................Q--SQCRCE--G
2SS_SOYBN/43-152DEEEE-------------G.---------......HMQK-CCTEMSEL...................RS--PKCQCK--A
M4CYI5_BRARP/32-92VLPGA-------------VN---------....PAPNSN-CCIALQAT...................N.--KDCICN--A
A6N9I7_ALLCE/31-116GLGR.-------------..---------.....APIAP-CCRALNDLRFVN...........TRNLRR--AACRCL--V
AVE3_AVESA/69-210QQSSC-------------Q.---------.....VMRQQ-CCRQLEQI....................P--EQLRCP--A
CCDP_MAIZE/48-127LGL..-------------.V---------KVGLP.QYEQ-CCPLLEGLVD................LDA--ALCLCT--A
FIL1_ANTMA/31-90VVLGA-------------A.---------....TTPSSD-CCTALQSV....................D--HECLCN--T
GDA0_WHEAT/146-275QQSTY-------------Q.---------.....LLQEL-CCQHLWQI....................P--EQSQCQ--A
GDA2_WHEAT/143-280QESTY-------------Q.---------.....LVQQL-CCQQLWQI....................P--EQSRCQ--A
GDA5_WHEAT/152-306QQSTY-------------Q.---------.....LLQQL-CCQQLLQI....................P--EQSQCQ--A
GDA6_WHEAT/155-283LQQST-------------YQ---------....P.LQQL-CCQQLWQI....................P--EQSRCQ--A
GDA8_WHEAT/46-175QQSTY-------------Q.---------.....LLQEL-CCQHLWQI....................P--EQSQCQ--A
GDB1_WHEAT/134-288QQSSC-------------H.---------.....VMQQQ-CCQQLQQI....................P--EQSRYE--A
GDB2_WHEAT/184-310PQSDC-------------Q.---------.....VMRQQ-CCQQLAQI....................P--QQLQCA--A
GDB3_WHEAT/87-228QQSSC-------------H.---------.....VMQQQ-CCQQLPQI....................P--QQSRYQ--A
B6UKL2_TRITU/171-285PRSDC-------------Q.---------.....VMQQQ-CCQQLAQI....................P--QQLQCA--A
A2Y665_ORYSI/48-178RRPGA-------------L.---------.....GLRMQ-CCQQLQDV....................S--RECRCA--A
D2DII3_WHEAT/197-341QQSIC-------------H.---------.....VMQQQ-CCQQLRQI....................P--EQSRHE--S
GLU2_MAIZE/128-213CSPQC-------------Q.---------.....SLRQQ-CCQQLRQV....................E--PQHRYQ--A
HOG1_HORVU/166-288QQSSC-------------R.---------.....VMQQQ-CCLQLAQI....................P--EQYKCT--A
HOG3_HORVU/142-276QQNSC-------------Q.---------.....LKRQQ-CCQQLANI...................N.--EQSRCP--A
HOR1_HORVU/143-282QQSSC-------------H.---------.....VLQQQ-CCQQLPQI....................P--EQFRHE--A
HPSE_SOYBN/8-77LGGSL-------------G.---------......TVDD-CCALIGGLGD................IEA--IVCLCI--Q
IAAC1_WHEAT/30-140ISGSA-------------VS---------TEPGNTPRDR-CCKELYDA....................S--QHCRCE--A
IAAC3_WHEAT/43-159SPGKP-------------Y.---------.....LAKLY-CCQELAEI....................S--QQCRCE--A
IAC16_WHEAT/30-134TPGSP-------------Y.---------.....LAKQQ-CCGELANI....................P--QQCRCQ--A
IAA1_HORVU/20-131QVV..-------------..---------....ESIQKD-CCRQIAAI...................GD--EWCICG--A
IAA1_WHEAT/6-115VPE..-------------..---------.....AVLRD-CCQQLAHI....................S--EWCRCG--A
IAA2_HORVU/37-144VPE..-------------..---------.....DVLRD-CCQEVANI...................SN--EWCRCG--D
IAA4_SORBI/7-111GPYGP-------------VD---------P..SPVLKQR-CCRELAAV....................P--SRCRCA--A
IAA5_SORBI/4-106IGPVV-------------PL---------....PVLKER-CCSELEKL....................V--PYCRCG--A
IAAA_HORVU/30-140IAGSP-------------VS---------SEPGDTPKDR-CCQELDEA....................P--QHCRCE--A
IAAE_HORVU/29-137PRLLT-------------S.---------.....DMKRR-CCDELSAI....................P--AYCRCE--A
IAAT_ELECO/6-114PRLAT-------------Q.---------.....EMKAR-CCRQLEAI....................P--AYCRCE--A
B6UHB4_MAIZE/34-143...GP-------------RL---------P..WPELKRR-CCRELADI....................P--AYCRCT--A
LIM1_LILLO/29-88VLPGN-------------N.---------....GAPSEQ-CCSALRAV...................N.--HGCLCE--T
MC1_PINRA/28-88VGLSS-------------NG---------...VK.PSSE-CCDALKGT....................S--TSCVCK--S
MEN8_SILLA/38-98VVPGA-------------VN---------....TNPSQE-CCAALSGV...................N.--HDCMCN--T
NLT11_PARJU/4-91VQGKE-------------K.---------.....EPSKG-CCSGAKRLDGETK..........TGPQRV--HACECI--Q
NLT21_PARJU/35-121VKGEE-------------K.---------.....EPSKE-CCSGTKKLSEEVK..........TTEQKR--EACKCI--V
F2DCX3_HORVD/29-111ARG..-------------.N---------G..AK.PPAA-CCSGVKRLAGAAQ..........STADKQ--AACKCI--K
NLTP1_ARATH/29-114VLQ..-------------.G---------....GVIPPA-CCSGVKNLNSIAK..........TTPDRQ--QACNCI--Q
NLTP1_BRANA/29-113LT.QN-------------G.---------....P.LPRG-CCTGVTNLNNMAR..........TTPDRQ--QACRCL--V
A8YPK3_HORVU/29-113VQGGP-------------G.---------......PSGE-CCNGVRDLHNQAQ..........SSGDRQ--TVCNCL--K
NLTP2_SOLLC/27-110LEGR.-------------..---------.....GPLGG-CCGGVKGLLGAAK..........TPEDRK--TACTCL--K
NLTP1_PRUAR/3-87VRG..-------------.G---------....GAVPPA-CCNGIRNVNNLAR..........TTPDRR--TACNCL--K
NLTP1_TOBAC/27-110LRN..-------------..---------....TGPLGR-CCGGVKALVNSAR..........TTEDRQ--IACTCL--K
NLTP2_HORVU/37-102ILG..-------------.G---------...TK.PSGE-CCGNLR.....................AQ--QGCLCQ--Y
NLTP3_HORVU/29-114ARG..-------------.N---------G..AK.PPVA-CCSGVKRLAGAAQ..........STADKQ--AACRCL--K
B6CQU4_9ROSA/33-119VAN..-------------.G---------....GALNPS-CCTGVRSLYSLAQ..........TTADRQ--SICNCL--K
NLTPA_BRAOT/29-114ITQ..-------------.G---------....GTLPGA-CCTGVSKLNSMAR..........TTPDRQ--QACRCL--E
NLTPA_RICCO/3-88LTGGV-------------A.---------.....SPSAS-CCAGVQNLKTLAP..........TSADRR--AACECI--K
NLTP1_WHEAT/26-110VQGGP-------------G.---------......PSGQ-CCDGVKNLHNQAR..........SQSDRQ--SACNCL--K
NLTPB_RICCO/3-88LTG..-------------.F---------...DTTPSLT-CCAGVMELKRLAP..........TVKDKR--IACECV--K
NLTPC_RICCO/28-112ATG..-------------.K---------...DSKPSQA-CCTGLQQLAQTVK..........TVDDKK--AICRCL--K
NLTP_AMACA/4-90LKG..-------------.T---------G..ATPPPAN-CCAGVRSLKAAAQ..........TVADRR--MACNCM--K
NLTP_BETVU/29-113LQG..-------------.A---------....PGPSAA-CCGGIKSLNSAAA..........SPADRK--TACTCL--K
NLTP_CICAR/27-111LQGGP-------------G.---------......PSAQ-CCGGVRNLNSAAV..........TTPDRQ--AACNCL--K
NLTP_DAUCA/30-116LRSQV-------------NV---------....P.VPLT-CCNVVRGLNNAAR..........TTLDKR--TACGCL--K
NLTP_ELECO/4-90ARG..-------------.A---------G..AA.PSAS-CQSGVRSLNAAAR..........TTADRR--AACNCS--L
NLTP_GERHY/28-112LAA..-------------.G---------...GP.VPPA-CCNGVRGLNNAAK..........TTPDRQ--TACGCL--K
NLTP_HELAN/28-112LTK..-------------.G---------....GAVPPA-CCSGVKSLNSAAK..........TTPDRQ--AACGCL--K
NLTP_PINTA/34-119LIGNA-------------A.---------.....TPAAT-CCPSIRGLDSQVK..........ATPDRQ--AVCNCL--K
NLTP_SPIOL/30-113LKG..-------------.G---------....P.LGGG-CCGGIKALNAAAA..........TTPDRK--TACNCL--K
NLTP_STRHE/10-89ATG..-------------.K---------...DKKPSAA-CCSGLHPLAQTVK..........TVEDNK--AICRCL--K
NLTP_VIGUN/34-99ITGGS-------------K.---------......PSST-CCSKLK.V....................Q--EPCLCN--Y
NLTP6_AMBAR/30-113LTGQ.-------------..---------.....EPSKA-CCTGVNNLNNSRK..........TKADRV--AVCNCI--K
O22110_PICAB/25-104LNA..-------------.T---------....TKPDSS-CCSALISVI.................DKD--SQCLCN--L
O22272_ARATH/48-125LGVGS-------------NE---------....TKPEKS-CCTGIETVL.................QYN--PQCICA--G
NLTP2_SOLPN/27-110LMNR.-------------..---------.....GPLGG-CCGGVKGLLGQAQ..........TTVDRQ--TACTCL--K
O24101_MEDTR/31-102VTGRN-------------P.---------....PRADEA-CCGVLRRA...................N.--LPCLCG--Y
O24355_SILLA/25-110ITGGS-------------P.---------.....SPSDA-CCNGIKTVASTVK..........DKNDAV--LVCNCL--K
O24440_PHAVU/29-112LTK..-------------.G---------....GAVPAS-CCSGVRSLNAAAK..........TTPDRQ--.VCNCL--K
O24485_PINRA/36-122LTTGT-------------PV---------....PQEESS-CCQGVQSLYGDAT..........TTEEIQ--QICTCL--K
O24486_PINRA/39-97VGNNP-------------Q.---------.....DPTPE-CCAVLQTA...................N.--VDCICA--L
O49116_ARATH/29-125VEGIF-------------Q.---------.....QPSPD-CCRGVTHLNNVVKFTSPGSRNRQDSGETE--RVCLCI--E
O49178_ORYSA/42-149ARPRR-------------R.---------.....AVPGD-CCRQFPPV...................DY--SWCRCE--A
O49644_ARATH/39-110DRL..-------------..---------.....KPTED-CCNDLKNAT.................MTQ--VDCLCD--N
O64431_BRACM/21-86ITG..-------------.G---------....GQPSGD-CCAKLK.....................EQ--QPCLCG--F
YLS3_ARATH/36-113VQGKA-------------K.---------.....SPTPD-CCSGLKQVI.................NSD--MKCLCM--I
O65368_ARATH/32-112LDVAV-------------GT---------VIGNP.SDTL-CCSVLQGLVD................LDA--AVCLCT--T
O65369_ARATH/55-137LNGLL-------------DL---------TLGKP.PVEP-CCSLIQGLAD................VEA--AVCLCT--A
O65561_ARATH/29-103VQR..-------------.P---------G.PKVNPSEA-CCRVVKRS....................D--IPCACG--R
O81135_HORVU/27-92IT...-------------.T---------G..AK.PSGA-CCANLG.....................AQ--QGCFCQ--Y
O81410_PICGL/53-146LERRR-------------N.---------.....QPSER-CCEELQRM....................S--PQCRCQ--A
O81872_ARATH/32-107VSNAG-------------PN---------S..QP.PSRS-CCALIRPI....................D--VPCACR--Y
O82439_ARATH/25-107LN.LV-------------DL---------TLGNP.PVKP-CCSLIQGLAD................LEA--AACLCT--A
NLTP2_PRUAR/3-68INSGA-------------P.---------......SPTT-CCQKLR.....................EQ--RPCLCG--Y
F2D8V2_HORVD/31-96IMGNA-------------A.---------......PTAS-CCSKMR.....................EQ--QPCMCQ--Y
P93198_9ROSI/39-132.....-------------..---------.....QHFRQ-CCQQLSQM....................D--EQCQCE--G
P93274_MALDO/2-73...LI-------------HI---------GIGSS.AKDA-CCPVLQGLVD................LDA--AICLCT--T
P93513_9POAL/63-154GKRSC-------------E.---------.....EVRNQ-CCKQLRQT....................T--SRCRCK--A
P93611_WHEAT/84-166LNGLV-------------HA---------VIGSS.ASDK-CCPLLSGVTG................LDA--ALCLCT--T
P93705_DAUCA/264-345LGGLV-------------HV---------GLGDP.NVNK-CCPVLAGLVE................LEA--AVCLCT--T
P93794_WHEAT/195-344QQSIC-------------H.---------.....VMQQQ-CCQQLRQI....................P--EQSRHE--S
PRF1_SOLLC/261-343LGGLI-------------HI---------GIGGS.AKQT-CCPLLGGLVD................LDA--AICLCT--T
PROA_ORYSI/43-134MSQPM-------------A.---------.....LLQQQ-CCMQLQGM....................M--PQCHCG--T
PRO25_ORYSJ/47-143QLINN-------------Q.---------.....VMQQQ-CCQQLRLV....................A--QQSHYQ--A
J7FK20_9POAL/48-138KG.GC-------------Q.---------.....ELLGE-CCSRLGQM....................P--PQCRCN--I
B6Z278_WHEAT/50-140KGGCE-------------H.---------.....EVREK-CCKQLSQI....................A--PQCRCD--S
Q00318_COILA/103-188CSPQC-------------Q.---------.....ALRQQ-CCHQLRQV....................E--PLHRQQ--A
Q06763_SOYBN/68-149LGGLV-------------HI---------GLGDP.VANQ-CCPVLQGLVE................VEA--AVCLCT--T
Q09071_AVESA/48-166RQSTC-------------H.---------.....VMRRQ-CCRQLAQI....................P--RQLRCP--A
Q09072_AVESA/74-212RQAIC-------------Q.---------.....VTRQQ-CCRQLAQI....................P--EQLRCP--A
Q39100_ARATH/48-126LD.LV-------------KV---------S..LP.PTSN-CCALIKGLVD................LEA--AVCLCT--A
ERLI1_ARATH/85-167LSSLL-------------NI---------QLGQP.SAQP-CCSLIQGLVD................LDA--AICLCT--A
Q39332_BRANA/28-112LTN..-------------.G---------...GP.LPSS-CCVAVKSLNQMAQ..........TTPDRR--QVCECL--K
Q39574_CATRO/55-137LGGLI-------------SA---------VIGAP.PKTP-CCSLIEGLAD................LEA--AVCLCT--A
2SS_CUCMA/55-139PWRRE-------------G.---------.....GSFDE-CCRELKNV....................D--EECRCD--M
Q39787_GOSHI/36-131.....-------------..---------.....GYIDS-CCQQLEKM....................D--TQCRCQ--G
Q39928_HELAN/52-143HQQQE-------------Q.---------.....QLLQQ-CCQELQNI....................E--GQCQCE--A
Q40335_MEDSA/84-165LG.LV-------------NV---------IVGSP.ASSK-CCTLIQGLAD................LDA--AVCLCT--A
Q40453_TOBAC/25-114IQNRV-------------KG---------G..GN.PSVP-CCTGINNIYELAK..........TKEDRV--AICNCL--K
Q40654_ORYSJ/41-149TL...-------------.D---------....EQVRRG-CCRQLAGI...................DS--SWCRCD--A
A2X812_ORYSI/52-133LG.LI-------------KA---------KVGVP.PAEP-CCPLLEGLVD................LEA--AVCLCT--A
Q40997_PINST/58-160LQRRR-------------E.---------.....QPSER-CCEELQRM....................S--PHCRCR--A
Q41125_PHAVU/45-126LG.LI-------------GV---------ELGKP.PKTP-CCNLIQGLAD................LEA--AVCLCT--A
Q41168_RAPSA/29-141PQQRP-------------P.---------......LLQQ-CCNELHQE....................E--PPCVCT--T
Q41320_SECCE/55-178PQSEC-------------Q.---------.....VMQQQ-CCQQLAQI....................P--HHLQCA--A
Q41378_9ASTR/24-89FTSSA-------------A.---------......PTAQ-CCTKLK.....................EQ--SPCLCG--Y
Q41543_WHEAT/137-262PRSDC-------------Q.---------.....VMRQQ-CCQQLAQI....................P--QQLQCA--A
Q41848_MAIZE/215-296LSGLI-------------HL---------VIGQE.ARSK-CCPLVQGVAD................LDA--ALCLCT--T
Q42044_ARATH/52-133LG.LV-------------NV---------VVGSP.PKTP-CCTLLQGLAN................LEA--AVCLCT--A
Q42158_ARATH/29-94MTSSS-------------P.---------......QSEA-CCTKLR.....................EQ--QPCLCG--Y
Q42392_ZINVI/30-95ISSSS-------------P.---------......PSSQ-CCAKIK.....................EQ--KPCLCQ--Y
Q42474_ORYSA/65-146LNGAL-------------GV---------NVGHG.PYD.-CCPLLAGLAD................ADA--AVCLCT--A
Q42487_POPNI/58-140LGSLL-------------NV---------TVGTP.PVKP-CCSVIQGLLD................LEA--AVCLCT--A
M0VYA0_HORVD/33-118VTGRA-------------S.---------.....AISKE-CCSGVQGLNGLAR..........SSPDRQ--TACRCL--K
Q43496_SOLLC/28-101CRASV-------------VP---------FSSVP.PSEA-CCASIKAL....................G--QPCLCV--L
Q43522_SOLLC/127-207LN.LV-------------NV---------VVGSP.PTLP-CCSLIQGLAN................LEV--AACLCT--A
F2E1T8_HORVD/29-111AKG..-------------.S---------G..TS.PSAG-CCSGVKRLAGLAR..........STADKQ--ATCRCL--K
Q96232_ASPOF/101-182LGGLV-------------HI---------GLGDP.VVNQ-CCPLIEGLVE................IEA--AVCLCT--T
Q9S7U3_ARATH/46-128LKDLL-------------KI---------QLGTP.PVKP-CCSLLNGLVD................LEA--AACLCT--A
Q9SA59_ARATH/25-103LNGGS-------------S.---------.....SPSWS-CCRQFSTVV.................QSS--PECLCS--V
Q9SBW9_MAIZE/43-101LVPGA-------------P.---------.....DPSAD-CCSALSAV....................S--HECACS--T
Q9SC06_TRIMO/34-125TWGKR-------------SC---------....EEVQNQ-CCQQLRQT....................T--PRCRCK--A
Q9SDS2_CAPAN/27-110LTG..-------------..---------....SGPLGR-CCGGVKGLLGAAK..........TPADRK--TVCSCL--K
Q9SDS4_CAPAN/19-102LQNR.-------------..---------.....GPLGR-CCGVIKDLLKLCK..........TPHERR--KSCKCV--K
F2CY84_HORVD/32-117VQQ..-------------.G---------....GTPARG-CCAGIQNLLAEAN..........NSPDRR--TICGCL--K
Q9SET1_ARATH/222-304LGGLI-------------HI---------GLGKSHAKAE-CCPVLGGLLD................LDA--AVCLCT--T
Q9SHA0_ARATH/27-109TKNPR-------------G.---------.....KVPPV-CCAKVGALI.................RTN--PRCLCA--V
Q9SI70_ARATH/29-101LNT..-------------.T---------....TTPVKE-CCDSIKEAV.................EKE--LTCLCT--I
Q9SKI0_ARATH/208-289LGGLV-------------KI---------GLGDP.AVNK-CCPLLKGLVE................VEA--AACLCT--T
Q9SRS1_ARATH/32-105VAP..-------------.F---------S.TLP.PNGL-CCAAIKTL....................G--QPCLCV--L
Q9ST25_MAIZE/51-132LG.LV-------------KG---------EAGKV.PAEP-CCTLIKGLAD................FEA--AVCLCT--A
Q9STH5_ARATH/42-113IT.QR-------------G.---------....P.PSQE-CCTAVETAL.................TTQ--LSCLCG--F
Q9SU32_ARATH/34-115LN.LI-------------NL---------KLGAP.AMRP-CCSILFGLID................LDV--AVCLCT--A
Q9SUV8_ARATH/28-104.....-------------..---------.....QTVRP-CCTLVDGLDA................YVA--SVCICD--S
Q9SUW7_ARATH/37-117LNL..-------------SL---------ILINNQSVLP-CCTLVTGLDA................ATA--SACICN--A
Q9SUX0_ARATH/37-116LG.LA-------------NV---------TAGDP.RARQ-CCTALNGLTN................VQV--TDCLCF--I
Q9SUX3_ARATH/50-132LNLLN-------------GL---------TPGTP.PVTP-CCSLIEGLVD................LEA--AICLCT--A
Q9SUZ2_ARATH/48-121VAP..-------------.F---------S.PIP.PTEI-CCSAVVTL....................G--RPCLCL--L
SCA_LILLO/25-109ARK..-------------.G---------....GVIPPG-CCAGVRTLNNLAK..........TTPDRQ--TACNCL--K
Q9SXE7_ARATH/212-293LGGLI-------------HI---------GLGNP.VENV-CCPVLQGLLE................LEA--AVCLCT--T
Q9XF30_ORYSI/41-111TL...-------------.F---------G..GP.VPPA-CCAQLR.....................AQ--AACLCA--Y
NLTP5_ARATH/29-114LTR..-------------.G---------...GF.IPRG-CCSGVQRLNSLAR..........TTRDRQ--QACRCI--Q
2SS1_SESIN/54-141NQGQF-------------E.---------......HFRE-CCNELRDV....................K--SHCRCE--A
NLTP8_ARATH/28-112LTSGS-------------G.---------.....NPPET-CCDGVKSLAAATT..........TSADKK--AACQCI--K
NLTL2_ARATH/27-105VTSGS-------------TV---------....VKPEGT-CCSGLKTVV.................RTG--PECLCE--A
Q9ZSL7_BRANA/27-108LM...-------------.K---------G..GP.VPAP-CCAGVSKLNSMAK..........TTPDRQ--QACKCL--K
Q9ZTW2_FRAAN/73-155LNNLL-------------NV---------TIGTP.PVQP-CCTLIQGLAD................LEA--AVCLCT--A
NLTP7_ARATH/29-118LTN..-------------.G---------G..ITSPGPQ-CCNGVRKLNGMVL..........TTLDRR--QACRCI--K
XYP11_ARATH/40-120VQVGS-------------NE---------....IKPEAA-CCPELAGMV.................QSS--PECVCN--L
YY1_ORYSJ/31-94GV.AP-------------AP---------GQPLPAPPAE-CCSALGAV....................S--HDCACG--T
ZEB2_MAIZE/86-172...QC-------------Q.---------.....ALQQQ-CCHQIRQV....................E--PLHRYQ--A
ZM33_MAIZE/45-108SVPPL-------------PG---------QVPPA.PGPE-CCSALGAV....................S--RDCACG--T

PF14368

Q1G3I0_ARATH/16-107E..KC...F.........AT.....G...S...VTPTED-CCTDLKSA-----------.....TS.TQ..VTCLCD--N
Q3ECK0_ARATH/8-101...FN...D.........LN.....T...T...TTPVKE-CCDSIKEA-----------.....VE.KE..LTCLCT--I
B9RBQ4_RICCO/7-100...AE...Y.........LN.....T...T...TTPPDS-CCSSIKDA-----------.....VT.ND..LTCLCN--L
Q9LE56_ARATH/14-113...QP...Y.........LH.....L...A...TPPPAT-CCMPLNEI-----------.....VA.KD..ATCLCA--V
Q0D9K5_ORYSJ/20-116...GG...Y.........LN.....A...T..AAPPPAS-CCGPLREA-----------.....AA.NE..TACLCA--I
Q9SUV6_ARATH/10-114Q..NC...Y.........AT.....L...N...AFPSKE-CCKDLKTA-----------.....SK.RE..VTCLCN--N
C5Z9F1_SORBI/22-116Y..LN...S.........TS.....T...A...AAPAPA-CCGPLREA-----------.....AA.NE..TACLCA--M
C5XVS1_SORBI/14-118...TA...Y.........LK.....T...T...KHPSST-CCTAMHTA-----------.....AA.AE..MPCLCR--L
C3SA92_BRADI/13-112D..YV...Q.........PG....SS...T...ARPGKT-CCGEVKTA-----------.....VS.NPGIVDCLCA--A
Q9LJ85_ARATH/13-108F.ITN...S.........SS.....N...G...TSPSSD-CCNSLRSL-----------.....TT.GG..MGCLCL--I
Q7XIG9_ORYSJ/15-115C..LT...Y.........ITP..GSP...E...ARPAKD-CCAGVKSA-----------.....LG.SPAAVACLCG--A
C5X2J9_SORBI/14-111...LP...Y.........VQQ..GST...Q...GKPTSG-CCTGVKAA-----------.....LK.SPATVACLCA--A
A9S0T9_PHYPA/9-107...NA...S.........RD.....P...R...VKPDKR-CCDAIRQF-----------LPPRKQK.SA..IDCLCR--L
C5Y597_SORBI/23-118...ES...F.........MY....GG...A...AAPSAA-CCAAYEAA-----------.....FD.AD..PFCLCY--V
B9RIH6_RICCO/12-107S..KCQRFV.........IK.....TG.PK...FSPSPS-CCAVVKNV-----------.........D..VACVCD--L
B9RIH3_RICCO/10-107S..KC...YK.......FVE.....KPGPK...VPPSQG-CCQVVKK.-----------........AD..IPCACK--L
A9TY60_PHYPA/11-108K..YM...A.........VN....SN...S...STPTPT-CCSSILAL-----------.....NT.KQ..PDCLCQ--I
B9HP13_POPTR/12-110S..KCS.QF.........VRI..PGP...R...VLPSDA-CCQAAKQV-----------.....TV.GD..LPCVCK--L
C5XAF7_SORBI/6-114T..PC...FSFLTSSGGGSN.....G...S...APPTRE-CCRSLAAL-----------.....VN.AS..TGCACL--V
A9T6D1_PHYPA/9-104...LP...A.........AK.....A...N...VQPSAA-CCRALSSF-----------.....AT.NT.GEDCLCA--A
B9HP10_POPTR/10-105A..QCS.QF.........VH.....K...TGPKTPPSLG-CCQVVKTL-----------.........N..VNCVCR--F
B9RTN3_RICCO/10-113G..YI...S.........SEP..NNM...T...ETPTSQ-CCDALEKA-----------.....FSSSE..GNCFCY--L
B9RIH4_RICCO/10-105S..KCQ.KY.........VVK..QGS...S...AKPSPE-CCKVVKNV-----------.........N..VPCVCS--H
B9RZC4_RICCO/7-99P..SV...T.........GQ.....N...P...AAPSDA-CCAALSK.-----------........AD..LQCLCF--Y
A9SQH6_PHYPA/103-196...YG...Y.........LE.....D...T..LTYPDTS-CCDEVGYL-----------.....YK.LE.GADCFCD--E
B9SEE9_RICCO/14-106N..AC..RD.........IL.....L...G...KAPSPA-CCGRVR..-----------......V.SH..VECICP--A
C5WP26_SORBI/30-121T..TCY.DY.........VQE..GGR...T...LPPSSN-CCATLIGL-----------........TN..VPCVCD--Y
B9SEE8_RICCO/14-105N..ACK.PV.........V......Y...G...RPPSPQ-CCQRIR..-----------......V.TH..IECVCP--V
C5WP25_SORBI/18-110S..TCY.RY.........VQ.....D...EGPMVQPSPH-CCATVSGI-----------........AN..ATCVCD--Y
A9SQH9_PHYPA/117-210C..AS...Y.........LT....DA...T...SYPDNT-CCDVILNM-----------.....YNLRG..ANCFCD--A
B9GVR5_POPTR/18-112...QA...F.........LA.....T...T...TTPPDN-CCNPIKEA-----------.....VA.KE..LPCLCK--L
B9H8A8_POPTR/14-108F.ITG...S.........TN.....N...G...SSPTGS-CCSSFKSL-----------.....MS.TG..MDCACL--L
B9HUT8_POPTR/13-107C..LG...Y.........VSAPPNRV...T...DTATSR-CCDAFSKA-----------.....FNSSD..GNCFCY--L
D7T8D6_VITVI/12-114...SA...A.........GN.....A...K...AKVPPT-CCTKVTAL-----------.....IN.TA..PKCLCA--V
I1PAV8_ORYGL/35-130C..LT...Y.........VEY..RST...L...TRPDKG-CCGALAGV-----------.....VD.GE..AACLCG--L
I1QT58_ORYGL/18-119....A...S.........VY.....D...D...SSMLGP-CCDALGKV-----------.....FK.SD..RACLCQ--I
I1R180_ORYGL/22-119C..RD...F.........MF....GG...A...AVASPA-CCAAYSAA-----------.....FD.AD..PFCLCY--I
Q1G2Y5_ARATH/16-109TGCTS...F.........LT....GG...G...SFPTSD-CCGALKSL-----------.....TG.TG..MDCLCL--I
Q2R222_ORYSJ/12-114C..LP...F.........FKD...KA...A...TAAPEG-CCAGLSSI-----------.....VK.GE..AVCLCH--I
Q75GY5_ORYSJ/27-127...SY...F.........IG.....N...S...STPSDA-CCEQMRAM-----------.....FQ.SQ..APCLCA--A
Q8S077_ORYSJ/23-111S..YC..RA.........GS.....R...E...RAPRRE-CCDAVRG.-----------........AD..FKCLCK--Y
Q9SUV7_ARATH/19-112Q..LC...Y.........FN.....L...D...LTPSEE-CCNDLKSS-----------.....ST.IQ..VNCLCD--N
U5G1T3_POPTR/18-113F..LTN.ST.........AA.....N...G...TSPTAG-CCGALKNL-----------.....TS.NG..MDCFCL--I
U5GQ18_POPTR/24-115C..KP...V.........I......Y...G...KLPSPA-CCERVRV.-----------........SH..VECVCP--V

PF14547

F2DU32_HORVD/35-120L.VLL-------------KL---------KINVP.ANQQ-CCPLIGQL----------------VKLDV--AACLCA--A
D7ME35_ARALL/36-114L..RT-------------SV---------ILNAQ.TVSR-CCTLVAGL----------------DASVA--SVCICN--A
A8MRQ5_ARATH/577-656L.RFF-------------GN---------FLDFR.LAQP-CCTLIRNL----------------SDAEA--AACLCD--L
D7ME37_ARALL/85-164L.SIF-------------DG---------FLGFG.RAQP-CCSLIRNL----------------SDADA--LACLCE--S
D7ME34_ARALL/31-113F.RLS-------------LI---------LINKQ.TVLP-CCTLVAGL----------------DAAAA--SACICN--A
D7ME36_ARALL/7-89L.GLI-------------NL---------TTS...NVAQ-CCSILSGL----------------NAPLV--SVCACE--A
D7MAX1_ARALL/157-241LGGLI-------------HI---------GLGKSYAKAK-CCPLLEGL----------------ASVDA--AVCLCT--T
Q7XTE3_ORYSJ/6-89L.GVV-------------GV---------QAGAH.LGSK-CCALVDGL----------------AAAEA--AACFCT--T
B9S3J8_RICCO/215-298LGGLI-------------HI---------GIGSS.AKDA-CCPVLQGL----------------VDLDA--ALCLCT--T
D7ME38_ARALL/36-117L.GLA-------------NV---------TAGDP.RARQ-CCTAINGL----------------ADVQV--ADCLCF--I
C5Z4Z5_SORBI/237-320LSGLI-------------HL---------VIGQE.ARSK-CCPLVQGI----------------ADLDA--ALCLCT--T
C5Y909_SORBI/46-127L.GAA-------------GL---------QAGAQ.LGSK-CCDVVQGL----------------AAAEA--AACFCT--T
F4JLV4_ARATH/297-375L.AIS-------------DG---------LLTTG.RAEP-CCSIVRNV----------------SDLDA--VTCFCK--S
I1QBL2_ORYGL/229-307G....-------------..---------.IGNSLMKYP-CCSQLYNL----------------QYDTA--AACLCD--A
M4F7Y5_BRARP/170-253LGGLV-------------KI---------GLGDP.AANK-CCPLLKGL----------------VEVEA--AACLCT--T
W4ZSZ5_WHEAT/138-222L.DLI-------------KA---------KVGVPPLNDR-CCPLLNGL----------------VDLDA--AICLCT--A
W5AJU0_WHEAT/30-113L.GLL-------------KL---------KVNVP.RHEP-CCSLLDGL----------------VGLDA--ALCLCA--N

PF05617

M4FC94_BRARP/72-146VIKEILT-----------.N.E.P...........VSRE.CCMKVVSA-------------------.G--KECYLE..I
B9S177_RICCO/41-104IILFFL.-----------.N.GETH..........LGHG.CCQAIRTI-------------------.S--EQCWPN..L
U5FMS5_POPTR/61-132VFNYIFG-----------DE.K.S...........LDYD.TCSE.VTG-------------------SG--KECNDA..L
M1BC58_SOLTU/78-151IFNRILD-----------SG.KYSD..........VE.E.CCAQLLAL-------------------.G--IKCHNA..I
M4FCA2_BRARP/71-146VLREILT-----------.N.K.P...........VSRD.CCLMVVRA-------------------.G--KECYMK..I
M4F146_BRARP/69-143LFTNMVG-----------EG.KPV...........LLAE.CCGELLRI-------------------.G--KDCYLG..T
M4FC93_BRARP/72-147VLKEILT-----------.N.K.P...........ISRE.CCQKVVKA-------------------.G--KECYME..I
EC12_ARATH/45-109IVLFFL.-----------.N.GETK..........LGVD.CCQAVEVI-------------------.T--TDCWPA..M
M4FC76_BRARP/105-178IVKNMLD-----------KT.TTQ...........LTNE.CCLILLKI-------------------.G--KDCQLG..V
D7LVH8_ARALL/44-116VTAEVLY-----------SH.GP............LKQHGCCLEVYHM-------------------.G--RVCLNI..V
M4F8U3_BRARP/34-96IFRSIIS-----------.G.QIGS..........IGHS.CCHAFLGI-------------------.S--TECASH..V
K4CB92_SOLLC/64-137VLNATLH-----------DN.E..D..........IDKK.CCHDLVGM-------------------.G--LKCYKT..L
B9SN88_RICCO/61-124IMNSFTS-----------.L.KF.N..........VDAK.CCQSIQQV-------------------.I--DDCVSA..I
B9SVP5_RICCO/53-119IILFFL.-----------.N.GQTDIT........IGAD.CCSAISII-------------------.A--HNCWPS..M
B9GGT7_POPTR/48-111VLLFFL.-----------.N.GETY..........LRPS.CCHAIRII-------------------.G--HHCWPS..M
I1I7L3_BRADI/74-140ILRWFAS-----------PD.LAVR..........VSRV.CCGILHKV-------------------.G--DRCIRG..L
K7KX58_SOYBN/72-144VFDNLKH-----------NK.N.N...........VTDC.CCGRLVET-------------------.G--LPCHIN..M
K7KX56_SOYBN/72-143VYNKLIH-----------DG.R.............ITKP.CCQELVKN-------------------.G--LQCHTA..M
K7MQC1_SOYBN/160-232FYAGIFY-----------GR.G.T...........ISKD.CCKNVVTD-------------------VG--KTCYDN..M
M0TQL0_MUSAM/66-131VILFFL.-----------.N.GETY..........LGPS.CCRAIRVI-------------------.V--HHCWAAEVM
EC11_ARATH/57-120LILFFL.-----------.N.GETY..........IGPG.CCSAIRTI-------------------.G--RKCWPT..M
B9T247_RICCO/77-140ILHSYAS-----------.H.NI.N..........LDAS.CCSVVDAI-------------------.K--QDCVSP..I
M4FC95_BRARP/79-152VIKEILT-----------.N.E.H...........VSRE.CCLKVVRA-------------------.G--KQCFIE..T
D7KC93_ARALL/38-103IIAVVFG-----------NG.T.............LIES.CCHDLVQE-------------------.G--KVCHDN..L
M4EKA3_BRARP/43-105LYRSVFS-----------.G.KFGN..........VGVA.CCKAFSTI-------------------.D--ANCWPH..M
D7MTL8_ARALL/141-203IYKSVFT-----------.R.KFDN..........VGPM.CCKALSAM-------------------.D--AKCWPQ..M
C5YSL3_SORBI/84-148ILLFFV.-----------.N.GESY..........IGPE.CCVAIRGA-------------------.T--RYCWPA..M
A8MS74_ARATH/69-143.IRDVFS-----------RN.K.S...........FSKD.CCRVLVKG-------------------.G--RKCYTE..W
U5GVU7_POPTR/48-112IILFFL.-----------.N.GETQ..........LGRS.CCQALRTI-------------------.G--EHCWPN..M
Q6ZKQ3_ORYSJ/79-152VLRSVA.-----------.S.LLLHDGERHPWGVHVGAP.CCGVLQTV-------------------.G--DRCFRD..L
K7LY71_SOYBN/49-122VFSAIFF-----------GN.K.T...........VSNG.CCDKLVND-------------------VG--KVCHDD..M
B9SXP3_RICCO/41-109IKEI...-----------...EHSSTTVSSPEMAKLISP.CCQVVNKI-------------------.N--MDCWPY..L
K7KW29_SOYBN/52-115IVTFFL.-----------.N.GKTY..........LGHG.CCQAIRVI-------------------.G--HDCWPN..I
B9HRY2_POPTR/41-112ILYGSFM-----------GK...P...........VTLE.CCQKLLLM-------------------.G--KACDDA..L
M4DW18_BRARP/37-99IVHSFVN-----------.G.EFGT..........IGHS.CCHAFLGL-------------------.S--ADCITE..R
M4DVD8_BRARP/72-146VLLDLFK-----------.N.E.P...........MSRE.CCLMVLHN-------------------.G--EGCNML..F
B9RBY2_RICCO/99-162VMKSAFN-----------HG.QVSE..........IGNA.CCHAILAI-------------------.Q--DNCWPQ..M
B9P5Y5_POPTR/32-100IFVAISA-----------GT.GRIA..........IGPA.CCKVINEL-------------------.T--DVCWAR..L
B9GU63_POPTR/46-117IFLSFSG-----------NN.N.N...........PSDS.CCQKLVAT-------------------.G--IDCHNA..F
M4FC77_BRARP/64-140IFKDMLD-----------ET.TTP...........LTIG.CCRNLLKI-------------------.G--RDCHLV..V
Q8S8C9_ARATH/73-145VMAEIIQ-----------.N.K.S...........ASRD.CCLGIVKA-------------------.G--KECHME..Y
B9SN89_RICCO/73-136IMTSFTS-----------.N.KV.N..........LDAK.CCQSVQQI-------------------.V--DDCISA..I
Q3EBD9_ARATH/70-142VMSEILQ-----------.N.I.P...........TSRY.CCLKMIIY-------------------.G--QECHMV..L
D7MVA2_ARALL/48-118IFQNVLD-----------EKNL.............VTDE.CCRDILKI-------------------.G--KDCHLG..L
B9SVP8_RICCO/47-111IILFFL.-----------.N.GHTD..........IGAD.CCRSIAIF-------------------.T--HNCWPA..M
W5I1G9_WHEAT/44-110IILFFL.-----------.N.GEAY..........LGPG.CCRAIRVI-------------------.E--QRCWAADLM
U5DGU8_AMBTC/38-101VYSFFQ.-----------.T.GKNY..........PGVD.CCEAVLSV-------------------.G--EQCWAS..F
D7MSB1_ARALL/48-110IAKSIFS-----------.G.KFEN..........VEAA.CCKAFLTL-------------------.D--TNCWPQ..M
D7LBY0_ARALL/72-145VLADIIQ-----------.N.K.S...........VSRD.CCRGIVRA-------------------.G--KECHTE..W
Q9LXX9_ARATH/44-121VTDAICT-----------IH.GPMR..........LKHHGCCLEVFHM-------------------.G--RACLKI..V
A7REG6_ARATH/64-136IFNNMLD-----------GT.T.P...........VTNE.CCHDILKT-------------------.G--KDCHLA..L
B9HQH8_POPTR/62-126VASLVLT-----------FQ.KNL...........VGPK.CCSALAVI-------------------.D--DKCKPK..G
M4F9M9_BRARP/52-124IVKFFMS-----------RN.GTAEPGVTGG....IDKD.CCGAIGLI-------------------.G--KECWSV..M
K7N3Y2_SOYBN/45-109VITFFL.-----------.N.GETY..........LGPS.CCQAIRIV-------------------.G--HDCWPD..M
M4FC77_BRARP/213-288ILTDMLD-----------ET.TTP...........LPIE.CCRYLLKI-------------------.G--RDCHLV..V
M4CIW6_BRARP/37-108IISQVFG-----------DG.V.............VSIP.CCKELVQE-------------------.G--KECHDT..L
B9SE79_RICCO/48-112IILFFL.-----------.N.GETY..........LGHS.CCEAIRII-------------------.T--KQCWPT..M
K7KX55_SOYBN/121-191VYQKLIH-----------DK.N.............ITRH.CCKELVKM-------------------.G--KPCHDD..M
K4D4G7_SOLLC/44-108IVAYFT.-----------.I.GTID..........IDLP.CCQAIFVI-------------------.T--HHCWPS..M
B9GGU6_POPTR/50-114IVLFFM.-----------.T.GQAD..........IGPD.CCRAIHTI-------------------.T--HNCWPA..M
U7DW65_POPTR/42-112ISNSIY.-----------NN.N.T...........PSEY.CCQKHITT-------------------.G--KACNND..F
D7LQP6_ARALL/70-141IFNNMLD-----------ET.M.P...........MTDE.CCRDVLNT-------------------.G--KDCHLA..M
A8MQ83_ARATH/72-148VIAYIVQ-----------.N.K.S...........VSRV.CCWGIVKA-------------------.G--KECHKK..W
M4F142_BRARP/86-160IFKNMLD-----------EA.AQV...........LSNE.CCHDLLKI-------------------.S--KDCYLG..M
D7MQQ8_ARALL/38-109IIAVVFE-----------NG.T.............ISDP.CCNDLVKE-------------------.G--KMCHDT..L
U5GKZ5_POPTR/42-112ISNSIY.-----------TN.K.T...........PSEY.CCQKHITT-------------------.G--KACNDD..F
I1IN82_BRADI/69-133MVLFFL.-----------.N.GQSY..........LGRP.CCLAIRTV-------------------.T--AHCWPA..M
K4C587_SOLLC/77-151IFNKIFD-----------NG.KPTD..........VD.E.CCGQLLTL-------------------.G--KKCHHT..I
Q3ECV9_ARATH/81-154VFENMKD-----------EM.M.P...........IINE.CCREILKM-------------------.G--KDCHFR..L
W1PLV8_AMBTC/49-113IILFFM.-----------.N.GETY..........LGKD.CCRGVRVI-------------------.T--RHCWPS..M
K4D4G3_SOLLC/55-119IVLFFV.-----------.N.GETY..........LGQD.CCSAIRII-------------------.E--RQCWPS..M
B9IKH4_POPTR/49-122TLAAIFK-----------NK.R.............IPNK.CCPEVTKF-------------------.S--KICYHA..L
A5AZZ7_VITVI/45-108IILFFL.-----------.N.GQTV..........LGPE.CCQAISII-------------------.T--RNCWPA..M
M0ZZI9_SOLTU/49-111IITSFLR-----------.T.QLRL..........IGPQ.CCKAVLDI-------------------.H--DSCWPK..I
K7KX59_SOYBN/86-158VFDKLMH-----------GK.I.N...........VTKH.CCEKLVKM-------------------.G--ESCHIN..M
I1K1Y8_SOYBN/51-124IFFSVFV-----------GN.Q.T...........VTNR.CCLSLLND-------------------MG--KACHTD..V
D7MTL8_ARALL/48-110ILKSALT-----------.G.KFEN..........VGPT.CCKAFTEL-------------------.D--AKCWPK..I
I1QJT2_ORYGL/79-143VLLSLAL-----------HAPR.............LSGE.CCTVLARA-------------------.G--DKCVAG..V
U5DBS7_AMBTC/38-100LIKFITK-----------KGSN.............PEHE.CCDAVLKI-------------------.G--VECIAN..L
EC14_ARATH/47-111IVLFFL.-----------.N.GETK..........LGVS.CCESVDII-------------------.T--TNCWPA..M
K7KX55_SOYBN/32-108ILGKVLL-----------PFEEPI...........VSTN.CCYKLIQT-------------------.G--YQCHTR..L
Q9LUB3_ARATH/33-97IFRSITN-----------.G.QFGN..........VGPS.CCHAFIGL-------------------.D--TECIPQ..M
I1QY08_ORYGL/55-119IVLFFV.-----------.N.GESY..........LGPD.CCVAIRTV-------------------.T--RRCWPA..M
K7L6R0_SOYBN/36-100IMHFFI.-----------.N.GQAD..........IGPN.CCCAIRVI-------------------.T--HDCWPE..M
M0TA67_MUSAM/60-124IVLFFI.-----------.N.GESY..........LGLD.CCRAIRVI-------------------.T--RHCWTS..M
M1ASC9_SOLTU/60-130IVTTLFK-----------YK.N.............ITSN.CCNELVQS-------------------.G--LECHAT..L
W5I3U0_WHEAT/51-117IILFFL.-----------.N.GEAY..........LGPG.CCRAIRAI-------------------.E--QRCWAADAM
M4DW17_BRARP/37-100IIQSLVN-----------.G.EIGT..........VSHS.CCHAFLGL-------------------.S--ADCITE..R
Q9C924_ARATH/63-134MTEGLID-----------DK...P...........VSED.CCVNFLKI-------------------.G--RECHEG..L
M4EJU1_BRARP/45-107IYKSVVT-----------.G.KFEN..........VGPA.CCKAFTDV-------------------.D--AKCWPT..M
D7LL48_ARALL/69-143.YRDGIS-----------RN.K.S...........TSRD.CCLMIVKA-------------------.G--KQCHTE..L
Q3ECV8_ARATH/86-158VFKNMLD-----------ET.V.P...........ITDE.CCRDILKI-------------------.G--KDCHLG..L
Q9FYN3_ARATH/84-147IAKAFFT-----------.R.KPA...........IGLD.CCASIQKM-------------------.D--EDCDKT..V
U5GF05_POPTR/42-112ISNSIY.-----------TD.K.T...........ASEY.CCQKHVTT-------------------.G--KACHDD..F

PF13016

Q5Z9M9_ORYSJ/30-100ICTMVQSIMQ----------------------------------------------------------------------
Q0D7V8_ORYSJ/32-104I.SIVQAIVQ----------------------------------------------------------------------
AVLBB_WHEAT/153-224IHNVAEAIRH----------------------------------------------------------------------
D2KFG9_WHEAT/47-117IHNVVHAIIL----------------------------------------------------------------------
I1I1L7_BRADI/190-267IRDVVDAIIK----------------------------------------------------------------------
M8A4Q2_TRIUA/135-215IHNTVHAIIM----------------------------------------------------------------------
GDBB_WHEAT/132-208IHSVVHSIIM----------------------------------------------------------------------
GLTA_WHEAT/180-256IRAIIYSII.----------------------------------------------------------------------

PF00234

IAA2_WHEAT/37-143LSSMLRSVYQELGVR...............................................EGK.E.............
PRO28_ORYSJ/47-143IS.SVQAIVQQLRLQQFA..........................................SVYFD.QS............
RAG1_ORYSJ/39-150LDHMLSGIYRELGATEA............................................GHPM.AE............
NLTP1_ORYSI/28-112NAARGIK.........................................................................
NLTP4_ORYSJ/30-115QQTSAMG.........................................................................
B7E7J9_ORYSJ/30-95AKDPRYG.........................................................................
NLTP3_ORYSI/32-117NMASSFR.........................................................................
A9_ARATH/27-87LR..............................................................................
108_SOLLC/35-99MR..............................................................................
14KD_DAUCA/54-136IKANILGK........................................................................
2SS1_ARATH/59-153LKQAAKAVRLQGQ...................................................................
2SS1_BRANA/16-122LRGASKAVKQQIQQQ...............................................EQQ.Q.............
2SS2_ARATH/58-158LRQAARAVSLQGQ...................................................................
2SS5_HELAN/53-148VKQVFREAQQQVQQQQG............................................RQLV.P.............
2SS5_HELAN/190-290IQEVARRVMRQPQQQQ.............................................QQRR.G.............
2SS8_HELAN/49-139IMMMLNEPMW......................................................................
2SSE_BRANA/60-174LKGASKAVRQQVRQQQG............................................QQMQ.G.............
2SSL_PICGL/52-156IQQMLDQSLSYDSFMDSDSQ.....................................EDAPLNQR.RRR..........R
2SS1_BEREX/40-137LRMMMMRMQQEEM...................................................Q...............
B9SA35_RICCO/61-155IKYIAEDQIQQGQ...................................................................
B9SA35_RICCO/162-256LRQAIEQQQSQGQ...................................................................
2SS_SOYBN/43-152LQKIMENQSEEL....................................................................
M4CYI5_BRARP/32-92LR..............................................................................
A6N9I7_ALLCE/31-116GVVNRNP.........................................................................
AVE3_AVESA/69-210IHSVVQAIIMQQQQFFQPQMQQQFFQPQMQQV..............TQGIFQPQMQQVTQGIFQP.QLQQVTQ..GIFQP
CCDP_MAIZE/48-127IKANVLGI........................................................................
FIL1_ANTMA/31-90LR..............................................................................
GDA0_WHEAT/146-275IHNVVHAIILHQQQKQQQQPSSQVSFQQP....................LQQYPLGQGSFRPSQQ.NPQAQG....SVQP
GDA2_WHEAT/143-280IHNVVHAIILHQQHHHHQQQQQQQQQQPLSQV..............SFQQPQQQYPSGQGFFQPS.QQNPQAQ..GSFQP
GDA5_WHEAT/152-306IHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGSVQP
GDA6_WHEAT/155-283IHNVVHAIILHQQQRQQQPSSQVSLQQPQ....................QQYPSGQGFFQPSQQN.PQAQG.....SVQP
GDA8_WHEAT/46-175IHNVVHAIILHQQQQKQQQQPSSQFSFQQ....................PLQQYPLGQGSFRPSQ.QNPQAQ....GSVQ
GDB1_WHEAT/134-288IRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQ.....QQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQP
GDB2_WHEAT/184-310IHSVVHSIIMQQQQQQQQQQGIDIFL.........................PLSQHEQVGQGSLV.QGQGI......IQP
GDB3_WHEAT/87-228IRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQ..............CVSQPQQQSQQQLGQQPQQ.QQLAQG...TFLQP
B6UKL2_TRITU/171-285IHSVAHSIIMQQEQQQGVPILR..................................PLFQLAQGL.GII.........QP
A2Y665_ORYSI/48-178IRRMVRSYEESMPMPLEQGWSSSSSEYYGG..................EGSSSEQGYYGEGSSEE.GYYGEQ....QQQP
D2DII3_WHEAT/197-341IRAIIYSIILQQQQQQQQQQQQQQGQSIIQYQ.............QQQPQQLGQCVSQPLQQLQQ.QLGQQPQ..QQQLA
GLU2_MAIZE/128-213IFGLVLQSILQQQP..................................................Q...............
HOG1_HORVU/166-288IDSIVHAIFMQQGQRQGVQIVQQQP............................QPQQVGQCVLVQ.GQGV.......VQP
HOG3_HORVU/142-276IQTIVHAIVMQQQVQQQVGHGFVQSQL........................QQLGQGMPIQLQQQ.PGQAF......VLP
HOR1_HORVU/143-282IRAIVYSIFLQEQPQQLVEGVSQPQQQLWPQ................QVGQCSFQQPQPQQVGQQ.QQVPQS...AFLQP
HPSE_SOYBN/8-77LRALGI..........................................................................
IAAC1_WHEAT/30-140VRYFIGRRSDPNSSV...............................................LKD.L.............
IAAC3_WHEAT/43-159LRYFIALPVPSQPVDPRSG.......................................NVGESGL.ID...........L
IAC16_WHEAT/30-134LRYFMGPKSRPDQSG...............................................LME.L.............
IAA1_HORVU/20-131LGSMRGSMYKELGVALAD..........................................DKATV.AE............
IAA1_WHEAT/6-115LYSMLDSMYKEHGAQEG............................................QAGT.G.............
IAA2_HORVU/37-144LGSMLRSVYAALGVGG..............................................GPE.E.............
IAA4_SORBI/7-111LGFMMDGVDAPLQD.................................................FR.G.............
IAA5_SORBI/4-106LRTALDSMMTGYEM..................................................R.P.............
IAAA_HORVU/30-140VRYFIGRRSHPDWSV...............................................LKD.L.............
IAAE_HORVU/29-137LRIIMQGVVTWQGAFEG............................................AYFK.DS............
IAAT_ELECO/6-114VRILMDGVVTPSGQHEG............................................RLLQ.DL............
B6UHB4_MAIZE/34-143LSILMDGAIPPGPDAQL...........................................EGRLE.DL............
LIM1_LILLO/29-88IN..............................................................................
MC1_PINRA/28-88VR..............................................................................
MEN8_SILLA/38-98LR..............................................................................
NLT11_PARJU/4-91TAMKTYS.........................................................................
NLT21_PARJU/35-121RATKGIS.........................................................................
F2DCX3_HORVD/29-111SAAGG...........................................................................
NLTP1_ARATH/29-114GAARALG.........................................................................
NLTP1_BRANA/29-113GAANAFP.........................................................................
A8YPK3_HORVU/29-113GIARGIH.........................................................................
NLTP2_SOLLC/27-110SAANSIK.........................................................................
NLTP1_PRUAR/3-87QLSGSIS.........................................................................
NLTP1_TOBAC/27-110SAAGAIS.........................................................................
NLTP2_HORVU/37-102VKDPNYG.........................................................................
NLTP3_HORVU/29-114SLATSIK.........................................................................
B6CQU4_9ROSA/33-119QAVNGIPY........................................................................
NLTPA_BRAOT/29-114TAARALG.........................................................................
NLTPA_RICCO/3-88AAAARFP.........................................................................
NLTP1_WHEAT/26-110GIARGIH.........................................................................
NLTPB_RICCO/3-88TAAARYP.........................................................................
NLTPC_RICCO/28-112ASSKSL..........................................................................
NLTP_AMACA/4-90SAAQKTK.........................................................................
NLTP_BETVU/29-113SAATSIK.........................................................................
NLTP_CICAR/27-111SAAGSIS.........................................................................
NLTP_DAUCA/30-116QTANAVT.........................................................................
NLTP_ELECO/4-90KSAASRV.........................................................................
NLTP_GERHY/28-112GILAANT.........................................................................
NLTP_HELAN/28-112SAYNSIS.........................................................................
NLTP_PINTA/34-119TQAKSY..........................................................................
NLTP_SPIOL/30-113SAANAIK.........................................................................
NLTP_STRHE/10-89TAIKNFS.........................................................................
NLTP_VIGUN/34-99IKNPSLK.........................................................................
NLTP6_AMBAR/30-113ELTKSI..........................................................................
O22110_PICAB/25-104LNSDTVKQ........................................................................
O22272_ARATH/48-125LVSAGEMG........................................................................
NLTP2_SOLPN/27-110SAASSFT.........................................................................
O24101_MEDTR/31-102KSALTYY.........................................................................
O24355_SILLA/25-110DKLVDL..........................................................................
O24440_PHAVU/29-112SAAGAIP.........................................................................
O24485_PINRA/36-122NEAINY..........................................................................
O24486_PINRA/39-97VQ..............................................................................
O49116_ARATH/29-125IMGNANH.........................................................................
O49178_ORYSA/42-149ISHMLGGIYRELGAPDV............................................GHPM.S.............
O49644_ARATH/39-110FLESLSF.........................................................................
O64431_BRACM/21-86SKNPAFA.........................................................................
YLS3_ARATH/36-113IQERNDPDL.......................................................................
O65368_ARATH/32-112IKANILGI........................................................................
O65369_ARATH/55-137LKANILGI........................................................................
O65561_ARATH/29-103ITASVQQ.........................................................................
O81135_HORVU/27-92AKDPALGR........................................................................
O81410_PICGL/53-146IQQTLEDVFMDSDSQDGA..........................................PLNQR.RG............
O81872_ARATH/32-107VSRDVTN.........................................................................
O82439_ARATH/25-107LKASILGI........................................................................
NLTP2_PRUAR/3-68LKNPSLR.........................................................................
F2D8V2_HORVD/31-96ARDPNLK.........................................................................
P93198_9ROSI/39-132LRQVVRRQQQQQG...................................................................
P93274_MALDO/2-73IKAKLLN.........................................................................
P93513_9POAL/63-154IWTSIQGDLSGFK...................................................G...............
P93611_WHEAT/84-166IELKALNI........................................................................
P93705_DAUCA/264-345IKLSLLN.........................................................................
P93794_WHEAT/195-344IRAIIYSIILQQQQQQQQQQQQGQSIIQYQQQQP.........QQLGQCVSQPQQQLQQQLGQQP.QQQQLAH.GTFLQP
PRF1_SOLLC/261-343IRLKLLNI........................................................................
PROA_ORYSI/43-134SCQMMQSMQQVI....................................................................
PRO25_ORYSJ/47-143ISIVQAIVQQLQLQQ...............................................FSG.V.............
J7FK20_9POAL/48-138IQGSIQGDLGGIF...................................................G...............
B6Z278_WHEAT/50-140IRRVIQGRLGGFL...................................................G...............
Q00318_COILA/103-188IFGVVLQSIQQQP...................................................................
Q06763_SOYBN/68-149LKLKLLN.........................................................................
Q09071_AVESA/48-166IHSMVHAIIMQQQQQQLVQAQQM...............................GLVQPQTQMAG.QVFI........QP
Q09072_AVESA/74-212IHSVVQSIILQQQQQQQQFIQPQLQQQVFQP................QLQLQQQVFQPQLQQQVF.QPQLQQ...VFNQP
Q39100_ARATH/48-126LKANVLGI........................................................................
ERLI1_ARATH/85-167LRANVLGI........................................................................
Q39332_BRANA/28-112SAGKEIK.........................................................................
Q39574_CATRO/55-137IKANVLGI........................................................................
2SS_CUCMA/55-139LEEIAREEQRQA....................................................................
Q39787_GOSHI/36-131LRHATMQQMQQMQE..................................................Q.M.............
Q39928_HELAN/52-143VKQVVRDAQRHEQQR...............................................PRV.P.............
Q40335_MEDSA/84-165IKANILGI........................................................................
Q40453_TOBAC/25-114NAFIHAG.........................................................................
Q40654_ORYSJ/41-149LNHMLRIIYREERAADA............................................GHPM.AE............
A2X812_ORYSI/52-133IRGNILGI........................................................................
Q40997_PINST/58-160IEQTLDQSLSFDSSTDSDSQD...................................GAPLNQRRR.RPE..........G
Q41125_PHAVU/45-126LRANVLGI........................................................................
Q41168_RAPSA/29-141LKAASKAVKQQVRQQQG............................................QQGQ.QG............
Q41320_SECCE/55-178IHSVVHAIIMQQEQREGVQILLPQS...........................HQQLVGQGALAQV.QGII.......QPQ
Q41378_9ASTR/24-89LKNPTLK.........................................................................
Q41543_WHEAT/137-262IHSIVHSIIMQQEQQEQRQGVQILVP..........................LSQQQQVGQGTLV.QGQGI......IQP
Q41848_MAIZE/215-296IRARLLN.........................................................................
Q42044_ARATH/52-133LKANVLGI........................................................................
Q42158_ARATH/29-94MRNPTLR.........................................................................
Q42392_ZINVI/30-95MKNPSLK.........................................................................
Q42474_ORYSA/65-146VKANVLGV........................................................................
Q42487_POPNI/58-140IKANILGI........................................................................
M0VYA0_HORVD/33-118SLATSIK.........................................................................
Q43496_SOLLC/28-101INGPPIS.........................................................................
Q43522_SOLLC/127-207IRANILGL........................................................................
F2E1T8_HORVD/29-111SVAGA...........................................................................
Q96232_ASPOF/101-182IRLKLLNI........................................................................
Q9S7U3_ARATH/46-128LKAKVLGI........................................................................
Q9SA59_ARATH/25-103VNSNESSFY.......................................................................
Q9SBW9_MAIZE/43-101MG..............................................................................
Q9SC06_TRIMO/34-125IWTSIQGDLSGFK...................................................G...............
Q9SDS2_CAPAN/27-110SAAGSIG.........................................................................
Q9SDS4_CAPAN/19-102TAANTIK.........................................................................
F2CY84_HORVD/32-117NVANAAP.........................................................................
Q9SET1_ARATH/222-304IKLKLLNI........................................................................
Q9SHA0_ARATH/27-109MLSPLAKK........................................................................
Q9SI70_ARATH/29-101YTSPGLLA........................................................................
Q9SKI0_ARATH/208-289LKLKALDL........................................................................
Q9SRS1_ARATH/32-105AKGPPIV.........................................................................
Q9ST25_MAIZE/51-132IKANVLGV........................................................................
Q9STH5_ARATH/42-113IKSPMLLI........................................................................
Q9SU32_ARATH/34-115LKLSLLGI........................................................................
Q9SUV8_ARATH/28-104IKIYGIS.........................................................................
Q9SUW7_ARATH/37-117VRITIFN.........................................................................
Q9SUX0_ARATH/37-116FRPIPLV.........................................................................
Q9SUX3_ARATH/50-132LKASVLGI........................................................................
Q9SUZ2_ARATH/48-121ANGPPLS.........................................................................
SCA_LILLO/25-109SLVNPSL.........................................................................
Q9SXE7_ARATH/212-293IRLKLLNL........................................................................
Q9XF30_ORYSI/41-111ARSPNYG.........................................................................
NLTP5_ARATH/29-114GAARALG.........................................................................
2SS1_SESIN/54-141LRCMMRQMQQEY....................................................................
NLTP8_ARATH/28-112SVANSV..........................................................................
NLTL2_ARATH/27-105FKNSGSLG........................................................................
Q9ZSL7_BRANA/27-108TAAKN...........................................................................
Q9ZTW2_FRAAN/73-155IRASILGI........................................................................
NLTP7_ARATH/29-118NAARNVG.........................................................................
XYP11_ARATH/40-120YGGGASPRF.......................................................................
YY1_ORYSJ/31-94LD..............................................................................
ZEB2_MAIZE/86-172TYGVVLQSFLQQQ...................................................P...............
ZM33_MAIZE/45-108FS..............................................................................

PF14368

Q1G3I0_ARATH/16-107YIANP..-------------------------------------------------------------------------
Q3ECK0_ARATH/8-101YTSPG..-------------------------------------------------------------------------
B9RBQ4_RICCO/7-100YNTPG..-------------------------------------------------------------------------
Q9LE56_ARATH/14-113FNNVD..-------------------------------------------------------------------------
Q0D9K5_ORYSJ/20-116LTNKA..-------------------------------------------------------------------------
Q9SUV6_ARATH/10-114VIAHP..-------------------------------------------------------------------------
C5Z9F1_SORBI/22-116LLNRA..-------------------------------------------------------------------------
C5XVS1_SORBI/14-118FADPE..-------------------------------------------------------------------------
C3SA92_BRADI/13-112IASKQ..-------------------------------------------------------------------------
Q9LJ85_ARATH/13-108VTGTV..-------------------------------------------------------------------------
Q7XIG9_ORYSJ/15-115LGQ.D..-------------------------------------------------------------------------
C5X2J9_SORBI/14-111FGQ.N..-------------------------------------------------------------------------
A9S0T9_PHYPA/9-107ATSKE..-------------------------------------------------------------------------
C5Y597_SORBI/23-118ADG.TY.-------------------------------------------------------------------------
B9RIH6_RICCO/12-107ITKEI..-------------------------------------------------------------------------
B9RIH3_RICCO/10-107VTSEI..-------------------------------------------------------------------------
A9TY60_PHYPA/11-108MTQLL..-------------------------------------------------------------------------
B9HP13_POPTR/12-110VTPAT..-------------------------------------------------------------------------
C5XAF7_SORBI/6-114LTGAVPL-------------------------------------------------------------------------
A9T6D1_PHYPA/9-104ASS.Q..-------------------------------------------------------------------------
B9HP10_POPTR/10-105VTPQV..-------------------------------------------------------------------------
B9RTN3_RICCO/10-113IKQ.P..-------------------------------------------------------------------------
B9RIH4_RICCO/10-105VTKQI..-------------------------------------------------------------------------
B9RZC4_RICCO/7-99KNNYPW.-------------------------------------------------------------------------
A9SQH6_PHYPA/103-196VRSLT..-------------------------------------------------------------------------
B9SEE9_RICCO/14-106ITPKL..-------------------------------------------------------------------------
C5WP26_SORBI/30-121LGS....-------------------------------------------------------------------------
B9SEE8_RICCO/14-105VTPKL..-------------------------------------------------------------------------
C5WP25_SORBI/18-110LSS....-------------------------------------------------------------------------
A9SQH9_PHYPA/117-210VRSLV..-------------------------------------------------------------------------
B9GVR5_POPTR/18-112YNDPN..-------------------------------------------------------------------------
B9H8A8_POPTR/14-108ITANV..-------------------------------------------------------------------------
B9HUT8_POPTR/13-107IKQPL..-------------------------------------------------------------------------
D7T8D6_VITVI/12-114VLSPL..-------------------------------------------------------------------------
I1PAV8_ORYGL/35-130VGGYG..-------------------------------------------------------------------------
I1QT58_ORYGL/18-119WEMARN.-------------------------------------------------------------------------
I1R180_ORYGL/22-119ADGVYG.-------------------------------------------------------------------------
Q1G2Y5_ARATH/16-109VTAGV..-------------------------------------------------------------------------
Q2R222_ORYSJ/12-114VNHTLE.-------------------------------------------------------------------------
Q75GY5_ORYSJ/27-127VASAP..-------------------------------------------------------------------------
Q8S077_ORYSJ/23-111RDELR..-------------------------------------------------------------------------
Q9SUV7_ARATH/19-112FIAHP..-------------------------------------------------------------------------
U5G1T3_POPTR/18-113VTGSV..-------------------------------------------------------------------------
U5GQ18_POPTR/24-115ITPKL..-------------------------------------------------------------------------

PF14547

F2DU32_HORVD/35-120LKLNVIG.IPI---------------------------------------------------------------------
D7ME35_ARALL/36-114VRISLLNILTI---------------------------------------------------------------------
A8MRQ5_ARATH/577-656VRARRSTLSP.---------------------------------------------------------------------
D7ME37_ARALL/85-164VRAPSGSLPP.---------------------------------------------------------------------
D7ME34_ARALL/31-113VRITIFNFLTI---------------------------------------------------------------------
D7ME36_ARALL/7-89LRLNILNLLGI---------------------------------------------------------------------
D7MAX1_ARALL/157-241IRAKLLN.IDL---------------------------------------------------------------------
Q7XTE3_ORYSJ/6-89IKESVLG.IPT---------------------------------------------------------------------
B9S3J8_RICCO/215-298IKAKLLN.LNI---------------------------------------------------------------------
D7ME38_ARALL/36-117FRP.....LPL---------------------------------------------------------------------
C5Z4Z5_SORBI/237-320IRLRLLN.INI---------------------------------------------------------------------
C5Y909_SORBI/46-127VKETVLG.IPT---------------------------------------------------------------------
F4JLV4_ARATH/297-375VGARRFSLSP.---------------------------------------------------------------------
I1QBL2_ORYGL/229-307MKIDLRVNVDV---------------------------------------------------------------------
M4F7Y5_BRARP/170-253LKLKALN.LKL---------------------------------------------------------------------
W4ZSZ5_WHEAT/138-222IKADVLG.IHI---------------------------------------------------------------------
W5AJU0_WHEAT/30-113IDANVLG.LNL---------------------------------------------------------------------

PF05617

M4FC94_BRARP/72-146SKL.MFRL..Y---------------------------------------------------------------------
B9S177_RICCO/41-104IDTLGFT....---------------------------------------------------------------------
U5FMS5_POPTR/61-132VKY.VAEG..P---------------------------------------------------------------------
M1BC58_SOLTU/78-151MES.TLLS..P---------------------------------------------------------------------
M4FCA2_BRARP/71-146RKF.MFQL..Y---------------------------------------------------------------------
M4F146_BRARP/69-143VQV.ILSR..Y---------------------------------------------------------------------
M4FC93_BRARP/72-147RKL.MFRL..Y---------------------------------------------------------------------
EC12_ARATH/45-109LTSLGFT....---------------------------------------------------------------------
M4FC76_BRARP/105-178AHI.ISSN..T---------------------------------------------------------------------
D7LVH8_ARALL/44-116TKH.VIQTFLP---------------------------------------------------------------------
M4F8U3_BRARP/34-96FVFAP......---------------------------------------------------------------------
K4CB92_SOLLC/64-137IKV.YIGL..P---------------------------------------------------------------------
B9SN88_RICCO/61-124FGNFDNP....---------------------------------------------------------------------
B9SVP5_RICCO/53-119LTSLGFT....---------------------------------------------------------------------
B9GGT7_POPTR/48-111LASLGFT....---------------------------------------------------------------------
I1I7L3_BRADI/74-140FPASPFG....---------------------------------------------------------------------
K7KX58_SOYBN/72-144AKA.LIRT..P---------------------------------------------------------------------
K7KX56_SOYBN/72-143VKS.LIRI..P---------------------------------------------------------------------
K7MQC1_SOYBN/160-232TKY.VLGS..P---------------------------------------------------------------------
M0TQL0_MUSAM/66-131LAALGFT....---------------------------------------------------------------------
EC11_ARATH/57-120IGVLGFT....---------------------------------------------------------------------
B9T247_RICCO/77-140FAHFSNP....---------------------------------------------------------------------
M4FC95_BRARP/79-152NKL.MFQF..Y---------------------------------------------------------------------
D7KC93_ARALL/38-103IKY.IADR..P---------------------------------------------------------------------
M4EKA3_BRARP/43-105FPLNP......---------------------------------------------------------------------
D7MTL8_ARALL/141-203FPLNP......---------------------------------------------------------------------
C5YSL3_SORBI/84-148LASVGFT....---------------------------------------------------------------------
A8MS74_ARATH/69-143MKM.FFQF..Y---------------------------------------------------------------------
U5GVU7_POPTR/48-112IDTLGFT....---------------------------------------------------------------------
Q6ZKQ3_ORYSJ/79-152LTDSPFR....---------------------------------------------------------------------
K7LY71_SOYBN/49-122TKY.ILTL..P---------------------------------------------------------------------
B9SXP3_RICCO/41-109LPSK.......---------------------------------------------------------------------
K7KW29_SOYBN/52-115VASLGFT....---------------------------------------------------------------------
B9HRY2_POPTR/41-112MRV.VLEF..P---------------------------------------------------------------------
M4DW18_BRARP/37-99FAFAP......---------------------------------------------------------------------
M4DVD8_BRARP/72-146AKF.SSRL..Y---------------------------------------------------------------------
B9RBY2_RICCO/99-162FPLPP......---------------------------------------------------------------------
B9P5Y5_POPTR/32-100FPSIPATVESA---------------------------------------------------------------------
B9GU63_POPTR/46-117TEFLESKE..P---------------------------------------------------------------------
M4FC77_BRARP/64-140AKFESVPQ..N---------------------------------------------------------------------
Q8S8C9_ARATH/73-145MKL.FFQM..Y---------------------------------------------------------------------
B9SN89_RICCO/73-136FGHFDNP....---------------------------------------------------------------------
Q3EBD9_ARATH/70-142RNL.LFQT..Y---------------------------------------------------------------------
D7MVA2_ARALL/48-118IKI.IFSS..Y---------------------------------------------------------------------
B9SVP8_RICCO/47-111LTSIGFT....---------------------------------------------------------------------
W5I1G9_WHEAT/44-110LSVIGFT....---------------------------------------------------------------------
U5DGU8_AMBTC/38-101SVPGRLSP...---------------------------------------------------------------------
D7MSB1_ARALL/48-110FPLNP......---------------------------------------------------------------------
D7LBY0_ARALL/72-145MRL.FFQI..Y---------------------------------------------------------------------
Q9LXX9_ARATH/44-121TNH.VIQMFLP---------------------------------------------------------------------
A7REG6_ARATH/64-136VKI.IFST..N---------------------------------------------------------------------
B9HQH8_POPTR/62-126FSFDPFLPPLW---------------------------------------------------------------------
M4F9M9_BRARP/52-124FTSLGLT....---------------------------------------------------------------------
K7N3Y2_SOYBN/45-109IASLGFT....---------------------------------------------------------------------
M4FC77_BRARP/213-288AKYETIPQ..F---------------------------------------------------------------------
M4CIW6_BRARP/37-108VKY.IADR..P---------------------------------------------------------------------
B9SE79_RICCO/48-112IDTLGFT....---------------------------------------------------------------------
K7KX55_SOYBN/121-191VKA.LIRA..P---------------------------------------------------------------------
K4D4G7_SOLLC/44-108LTTLGFT....---------------------------------------------------------------------
B9GGU6_POPTR/50-114FTSLGFT....---------------------------------------------------------------------
U7DW65_POPTR/42-112IKLFMSRL..P---------------------------------------------------------------------
D7LQP6_ARALL/70-141VKI.IFST..K---------------------------------------------------------------------
A8MQ83_ARATH/72-148TGL.FFEM..Y---------------------------------------------------------------------
M4F142_BRARP/86-160TQS.ILSS..Y---------------------------------------------------------------------
D7MQQ8_ARALL/38-109IKY.IADK..P---------------------------------------------------------------------
U5GKZ5_POPTR/42-112IKLFISKV..L---------------------------------------------------------------------
I1IN82_BRADI/69-133LDAVGFT....---------------------------------------------------------------------
K4C587_SOLLC/77-151IES.TIHS..P---------------------------------------------------------------------
Q3ECV9_ARATH/81-154VEG.WSAM..Y---------------------------------------------------------------------
W1PLV8_AMBTC/49-113LTSVGFT....---------------------------------------------------------------------
K4D4G3_SOLLC/55-119LDSLGFT....---------------------------------------------------------------------
B9IKH4_POPTR/49-122GLF.VATT..P---------------------------------------------------------------------
A5AZZ7_VITVI/45-108LTSLGFT....---------------------------------------------------------------------
M0ZZI9_SOLTU/49-111FPF..SS....---------------------------------------------------------------------
K7KX59_SOYBN/86-158AKA.LIRT..P---------------------------------------------------------------------
I1K1Y8_SOYBN/51-124TKY.AVTL..P---------------------------------------------------------------------
D7MTL8_ARALL/48-110FPLNP......---------------------------------------------------------------------
I1QJT2_ORYGL/79-143FSGLPSG....---------------------------------------------------------------------
U5DBS7_AMBTC/38-100LIVGGID....---------------------------------------------------------------------
EC14_ARATH/47-111LTSLGFT....---------------------------------------------------------------------
K7KX55_SOYBN/32-108TQYFLKSS..Q---------------------------------------------------------------------
Q9LUB3_ARATH/33-97FIFAP......---------------------------------------------------------------------
I1QY08_ORYGL/55-119LASIGFT....---------------------------------------------------------------------
K7L6R0_SOYBN/36-100LTSLGYS....---------------------------------------------------------------------
M0TA67_MUSAM/60-124LTTLGFT....---------------------------------------------------------------------
M1ASC9_SOLTU/60-130VKL.LIRL..P---------------------------------------------------------------------
W5I3U0_WHEAT/51-117LSVIGFT....---------------------------------------------------------------------
M4DW17_BRARP/37-100FDFTP......---------------------------------------------------------------------
Q9C924_ARATH/63-134MTF.VFAT..Y---------------------------------------------------------------------
M4EJU1_BRARP/45-107FPLNP......---------------------------------------------------------------------
D7LL48_ARALL/69-143MKL.FLQF..Y---------------------------------------------------------------------
Q3ECV8_ARATH/86-158VKL.IFAT..Y---------------------------------------------------------------------
Q9FYN3_ARATH/84-147FGAYHNP....---------------------------------------------------------------------
U5GF05_POPTR/42-112IKLFISKV..P---------------------------------------------------------------------

PF13016

Q5Z9M9_ORYSJ/30-100----------------------------------------------
Q0D7V8_ORYSJ/32-104----------------------------------------------
AVLBB_WHEAT/153-224----------------------------------------------
D2KFG9_WHEAT/47-117----------------------------------------------
I1I1L7_BRADI/190-267----------------------------------------------
M8A4Q2_TRIUA/135-215----------------------------------------------
GDBB_WHEAT/132-208----------------------------------------------
GLTA_WHEAT/180-256----------------------------------------------

PF00234

IAA2_WHEAT/37-143VLPGCRK-EVM-KLTAASVP-EVCKV....P-IP.NPSGDRAGVC-
PRO28_ORYSJ/47-143QAQAQAM-...-..LALNMP-SICGI....Y-PSY........NT-
RAG1_ORYSJ/39-150VFPGCRR-GDL-ERAAASLP-AFCNV....D-IPNG....PGGVC-
NLTP1_ORYSI/28-112.......-GLN-AGNAASIP-SKCGV....S-VPYTI..SASIDC-
NLTP4_ORYSJ/30-115.......-GLR-PDLVAGIP-SKCGV....N-IPYAI..SPSTDC-
B7E7J9_ORYSJ/30-95......R-YVN-SPNARKAV-SSCGI....A-LPT.........C-
NLTP3_ORYSI/32-117.......-NLN-MGNAASIP-SKCGV....S-VAFPI..STSVDC-
A9_ARATH/27-87.......-...-..AATTLT-SLCNL.....-PSF........DC-
108_SOLLC/35-99.......-...-..IAAQIP-AQCNL....P-PLS.........C-
14KD_DAUCA/54-136......N-LNL-PIALSLVL-NNCGK....Q-VPN......GFEC-
2SS1_ARATH/59-153.HQPMQV-RKI-YQTAKHLP-NVCDI....P-QVD........VC-
2SS1_BRANA/16-122.GKQQMV-NRI-YQTATHLP-KVCNI....P-QVS........VC-
2SS2_ARATH/58-158.HGPFQS-RKI-YKTAKYLP-NICKI....Q-QVG........EC-
2SS5_HELAN/53-148FRGSQQT-QQL-KQKAQILP-NVCNL.....-QSR........RC-
2SS5_HELAN/190-290QFGGQEM-ETA-RRVIQNLP-NQCDL....E-VQQ.........C-
2SS8_HELAN/49-139...IRMR-DQV-MSMAHNLP-IECNL....M-SQP.........C-
2SSE_BRANA/60-174QQMQQVI-SRV-YQTATHLP-RVCNI....R-QVS........IC-
2SSL_PICGL/52-156EGRGREE-EEA-MERAAYLP-NTCNV....R-EPP.......RRC-
2SS1_BEREX/40-137.PRGEQM-RRM-MRLAENIP-SRCNL....S-PMR.........C-
B9SA35_RICCO/61-155.LHGEES-ERV-AQRAGEIV-SSCGV....R-CMR......QTRT-
B9SA35_RICCO/162-256.LQGQDV-FEA-FRTAANLP-SMCGV.....-SPT........EC-
2SS_SOYBN/43-152..EEKQK-KKM-EKELINLA-TMCRF....G-PMI........QC-
M4CYI5_BRARP/32-92.......-...-..AATTFT-TTCNL....P-SL.........DC-
A6N9I7_ALLCE/31-116......G-LRR-NPRFQNIP-RDCRN....T-FVRPFWWRPRIQC-
AVE3_AVESA/69-210QMQGQIE-GMR-AFALQALP-AMCDV....Y-VPP........HC-
CCDP_MAIZE/48-127......H-LNV-PLSLNFIL-NNCGR....I-CPE......DFTC-
FIL1_ANTMA/31-90.......-...-..IASRVP-AQCNL....P-PLS.........C-
GDA0_WHEAT/146-275QQLPQFE-EIR-NLALQTLP-AMCNV....Y-IPP........YC-
GDA2_WHEAT/143-280QQLPQFE-EIR-NLALQTLP-AMCNV....Y-IPP........YC-
GDA5_WHEAT/152-306QQLPQFA-EIR-NLALQTLP-AMCNV....Y-IPP........HC-
GDA6_WHEAT/155-283QQLPQFE-EIR-NLALQTLP-RMCNV....Y-IPP........YC-
GDA8_WHEAT/46-175PQQLPQF-EIR-NLALQTLP-AMCNV....Y-IPP........YC-
GDB1_WHEAT/134-288HQIAHLE-AVT-SIALRTLP-TMCSV....N-VPL........YS-
GDB2_WHEAT/184-310QQPAQLE-AIR-SLVLQTLP-SMCNV....Y-VPP........EC-
GDB3_WHEAT/87-228HQIAQLE-VMT-SIALRILP-TMCSV....N-VPL........YR-
B6UKL2_TRITU/171-285QQPAQLE-GIR-SLVLKTLP-TMCNV....Y-VPP........DC-
A2Y665_ORYSI/48-178GMTRVRL-TRA-RQYAAQLP-SMCRV.....-EPQ........QC-
D2DII3_WHEAT/197-341HQIAQLE-VMT-SIALRTLP-TMCNV....N-VPL.......YET-
GLU2_MAIZE/128-213.SGQVAG-LLA-AQIAQQLT-AMCGL....Q-QPT........PC-
HOG1_HORVU/166-288QQLAQME-AIR-TLVLQSVP-SMCNF....N-VPP........NC-
HOG3_HORVU/142-276QQQAQFK-VVG-SLVIQTLP-MLCNV....H-VPP........YC-
HOR1_HORVU/143-282HQIAQLE-ATT-SIALRTLP-MMCSV....N-VPL........YR-
HPSE_SOYBN/8-77.......-LNL-NRNLQLIL-NSCGR....S-YPS......NATC-
IAAC1_WHEAT/30-140PGCPREP-QRD-FAKVLVTS-GHCNV....M-TVHN....APY.C-
IAAC3_WHEAT/43-159PGCPREM-QWD-FVRLLVAP-GQCNL....A-TIHN....VRY.C-
IAC16_WHEAT/30-134PGCPREV-QMD-FVRILVTP-GYCNL....T-TVHN....TPY.C-
IAA1_HORVU/20-131VFPGCRT-EVM-DRAVASLP-AVCNQ....Y-IPNTN..GTDGVC-
IAA1_WHEAT/6-115AFPRCRR-EVV-KLTAASIT-AVCRL....P-IVVDASGDGAYVC-
IAA2_HORVU/37-144VFPGCQK-DVM-KLLVAGVP-ALCNV....P-IPNEAA.GTRGVC-
IAA4_SORBI/7-111.CTREMQ-RIY-AVSRLTRA-AECNL....P-TIP......GGGC-
IAA5_SORBI/4-106.TCSWGG-LLT-FAPTIVCY-RECNL....R-TLHG....RPF.C-
IAAA_HORVU/30-140PGCPKEP-QRD-FAKVLVTP-GQCNVLTVHN-APY.........C-
IAAE_HORVU/29-137PNCPRER-QTS-YAANLVTP-QECNL....G-TIHG.....SAYC-
IAAT_ELECO/6-114PGCPRQV-QRA-FAPKLVTE-VECNL....A-TIHG....GPF.C-
B6UHB4_MAIZE/34-143PGCPREV-QRG-FAATLVTE-AECNL....A-TISG.....VAEC-
LIM1_LILLO/29-88.......-...-..IISSLP-DHCSL....P-AVN.........C-
MC1_PINRA/28-88.......-...-..AVISLP-AKCNL....P-ALT.........C-
MEN8_SILLA/38-98.......-...-..VASQLP-SSCNL....A-ALN.........C-
NLT11_PARJU/4-91.......-DID-GKLVSEVP-KHCGI....V-DSKLPPIDVNMDC-
NLT21_PARJU/35-121.......-GIK-NELVAEVP-KKCDI....K-TT.LPPITADFDC-
F2DCX3_HORVD/29-111.......-.LN-AGKAAGIP-SMCGV....S-VPYAI..SASVDC-
NLTP1_ARATH/29-114......S-GLN-AGRAAGIP-KACGV....N-IPYKI..STSTNC-
NLTP1_BRANA/29-113.......-TLN-AARAAGLP-KACGV....N-IPYKI..SKSTNC-
A8YPK3_HORVU/29-113.......-NLN-LNNAASIP-SKCNV....N-VPYTI..SPDIDC-
NLTP2_SOLLC/27-110.......-GID-TGKAAGLP-GVCGV....N-IPYKI..SPSTDC-
NLTP1_PRUAR/3-87.......-GVN-PNNAAALP-GKCGV....N-IPYKI..SASTNC-
NLTP1_TOBAC/27-110.......-GIN-LGKAAGLP-STCGV....N-IPYKI..SPSTDC-
NLTP2_HORVU/37-102......H-YVS-SPHARDTL-NLCGI....P-VPH.........C-
NLTP3_HORVU/29-114.......-GIN-MGKVSGVP-GKCGV....S-VPFPI..SMSTDC-
B6CQU4_9ROSA/33-119......T-NAN-AGLAAGLP-GKCGV....N-IPYKI..SPSTDC-
NLTPA_BRAOT/29-114......P-NLN-AGRAAGIP-KACGV....S-VPFPI..STNTNC-
NLTPA_RICCO/3-88.......-TIK-QDAASSLP-KKCGV....D-INIPI..SKTTNC-
NLTP1_WHEAT/26-110.......-NLN-EDNARSIP-PKCGV....N-LPYTI..SLNIDC-
NLTPB_RICCO/3-88.......-NIR-EDAASSLP-YKCGV....V-INVPI..SKTTNC-
NLTPC_RICCO/28-112.......-GIK-DQFLSKIP-AACNI....K-VGFPV..STNTNC-
NLTP_AMACA/4-90.......-SLN-YKVAARLA-SQCGV....R-MSYSV..SPNVNC-
NLTP_BETVU/29-113.......-GIN-YGKAASLP-RQCGV....S-VPYAI..SPNTNC-
NLTP_CICAR/27-111.......-RLN-ANNAAALP-GKCVV....N-IPYKI..STSTNC-
NLTP_DAUCA/30-116.......-GLN-LNAAAGLP-ARCGV....N-IPYKI..SPTTDC-
NLTP_ELECO/4-90......S-GLN-AGKASSIP-GRCGV....R-LPYAI..SASIDC-
NLTP_GERHY/28-112.......-RIN-LNNANSLP-GKCGI....S-IGYKI..TPNIDC-
NLTP_HELAN/28-112.......-GVN-AGNAASFP-GKCGV....S-IPYKI..SPSTDC-
NLTP_PINTA/34-119.......-GVK-LGKAANLP-GLCKV....T-DLNVPI.SPNVDC-
NLTP_SPIOL/30-113.......-GIN-YGKAAGLP-GMCGV....H-IPYAI..SPSTNC-
NLTP_STRHE/10-89.......-RVQ-DRFLGQIP-TPCKIK..GR-LP..........C-
NLTP_VIGUN/34-99......Q-YVN-SPGAKKVL-SNCGV....T-YPN.........C-
NLTP6_AMBAR/30-113.......-AYD-PKRMPLLS-TKCGV....K-PDFPAV.DKNLDC-
O22110_PICAB/25-104......L-GVN-VTQAMKMP-AECGK....N-VSA.......TQC-
O22272_ARATH/48-125......I-ELN-STRALATP-KACKL....S-IAP.......PHC-
NLTP2_SOLPN/27-110.......-GLD-LGKAASLP-STCSV....N-IPYKI..SPSTDC-
O24101_MEDTR/31-102.......-GIN-AKKALALP-GQCGL....Q-TPS........NC-
O24355_SILLA/25-110.......-QYQ-PSLIASLS-DKCSV....S-FK.LPAISKATDC-
O24440_PHAVU/29-112.......-GFN-ANNAGILP-GKCGV....S-IHYNI..STSTNC-
O24485_PINRA/36-122.......-NLN-DRALQSLP-SNCGL....Q-LSFTI..TRDIDC-
O24486_PINRA/39-97.......-...-..STMQLP-SECGL....E-TPQ.........C-
O49116_ARATH/29-125......L-PFL-PAAINNLP-LRCSL....T-LSFPI..SVDMDC-
O49178_ORYSA/42-149EVFRGCR-RGT-WSARRRAP-GVLQV....D-IPNG....GGGVC-
O49644_ARATH/39-110......S-DLS-RTFSAGVL-KKCDV....S-HKY.......M.C-
O64431_BRACM/21-86......Q-YIS-SPNSRKVL-TACGI....P-YPS.........C-
YLS3_ARATH/36-113.....GL-QVN-VSLALALP-SVCHA....T-ADI.......TKC-
O65368_ARATH/32-112......N-IDL-PISLSLLI-NTCGK....K-LPS........DC-
O65369_ARATH/55-137......N-LNL-PISLSLLL-NVCSK....Q-LPP......GFQC-
O65561_ARATH/29-103.......-MID-MDKVVHVT-AFCGK....P-LAH......GTKC-
O81135_HORVU/27-92......Y-ITS-PHARDTLL-S.CGL....A-VPR.........C-
O81410_PICGL/53-146QGRGMEE-EEV-LRRAEELP-NTCNV....P-QSP.......RRC-
O81872_ARATH/32-107.......-YID-MDKVVYVA-RSCGK....K-IPS......GYKC-
O82439_ARATH/25-107.....VN-INL-PINLSVLL-NVCSR....N-APK......SFQC-
NLTP2_PRUAR/3-68......Q-YVN-SPNARKLA-SNCGV....P-VPQ.........C-
F2D8V2_HORVD/31-96......Q-YVD-SPNGKKVM-AACKV....P-VPS.........C-
P93198_9ROSI/39-132.LRGEEM-EEM-VQSARDLP-NECGI....S-SQR.........C-
P93274_MALDO/2-73......I-NLI-IPIVLQVL-IDCGK....T-PPS......GFQC-
P93513_9POAL/63-154.LQQGLK-ART-VQTAKSLP-TQCNI....D-PKF.........C-
P93611_WHEAT/84-166......N-LVL-PIAIQVLV-NQCGK....T-VPS......DFQC-
P93705_DAUCA/264-345......I-NIA-LPVALQLL-ITCGK....T-PPP......GFTC-
P93794_WHEAT/195-344HQIAQLE-VMT-SIAPRTLP-TMCSV....N-VPL.......YET-
PRF1_SOLLC/261-343......N-IIL-PIALQVLI-DDCGK....Y-PPK......DFKC-
PROA_ORYSI/43-134.CAGLGQ-QQM-MKMAMQMP-YMCNM.....-APVNFQLSSCGCC-
PRO25_ORYSJ/47-143YFDQTQA-QAQ-TLLTFNLP-SICGI....Y-PNY........YS-
J7FK20_9POAL/48-138.FQRDRA-SKV-IQEAKNLP-PRCNQ....G-PP..........C-
B6Z278_WHEAT/50-140.IWRGEV-FKQ-LQRAQSLP-SKCNM....G-AD..........C-
Q00318_COILA/103-188.IGQPLA-LMA-AQIAQQLT-VMCGV....R-QPM......TSPC-
Q06763_SOYBN/68-149......L-NIY-VPLALQLL-VTCGK....S-PPP......GYTC-
Q09071_AVESA/48-166QQLSQYQ-TMK-VVAMQTLP-AMCNV....Q-VPP........YC-
Q09072_AVESA/74-212QMQGQIE-GMR-AFALQALP-AMCDV....Y-VPP........QC-
Q39100_ARATH/48-126......N-LNV-PISLNVVL-NHCGK....K-VPS......GFKC-
ERLI1_ARATH/85-167......N-LNV-PISLSVLL-NVCNR....K-VPS......GFQC-
Q39332_BRANA/28-112.......-GLN-IDLVAALP-TTCGV....S-LSYPI..GFNTNC-
Q39574_CATRO/55-137......N-LNV-PVSLTLLL-NVCSK....K-VPE......GFIC-
2SS_CUCMA/55-139..RGQEG-RQM-LQKARNLP-SMCGI.....-RPQ........RC-
Q39787_GOSHI/36-131.GSKQMR-EIM-QKVTKNIM-SECEM.....-EPG........RC-
Q39928_HELAN/52-143FQGSQQS-QQL-KQRAQILP-NVCNL.....-QSR........RC-
Q40335_MEDSA/84-165......N-LNV-PITLSLLL-SACEK....S-IPN......GFQC-
Q40453_TOBAC/25-114.......-NVN-PTLVAELP-KKCGI....S-FN.MPPIDKNYDC-
Q40654_ORYSJ/41-149VFRGCRR-GDI-ERAAASLP-AFCNV....D-IPNG....VGGVC-
A2X812_ORYSI/52-133......N-LNL-PIDLSLIL-NYCGK....T-VPT......GFKC-
Q40997_PINST/58-160RGREEEE-EEA-VERAGELP-DRCNV....R-ESP.......RRC-
Q41125_PHAVU/45-126......N-LNV-PIKLNLLL-NYCGK....K-TPK......DFVC-
Q41168_RAPSA/29-141QQMQQAV-SRI-YQTATHLP-RVCRI....P-QVS........IC-
Q41320_SECCE/55-178QLSQFNV-GIV-LQMLQNLP-TMCNV....Y-VPR........QC-
Q41378_9ASTR/24-89......Q-YIT-NPNAKKVT-STCGV....P-IPN.........C-
Q41543_WHEAT/137-262QQPAQLE-VIR-SSVLQTLA-TMCNV....Y-VPP........YC-
Q41848_MAIZE/215-296......I-NIY-LPIALNLL-ITCGK....H-APS......GFQC-
Q42044_ARATH/52-133......N-LNV-PIDLTLLL-NYCGK....K-VPH......GFQC-
Q42158_ARATH/29-94......Q-YVS-SPNARKVS-NSCKI....P-SPS.........C-
Q42392_ZINVI/30-95......A-YVS-SPNAKKVA-NACGV....P-IPK.........C-
Q42474_ORYSA/65-146......N-LNV-PVELKLIL-NKCGK....T-CPS......DFTC-
Q42487_POPNI/58-140......N-LNI-PLSLSLLL-NVCGK....K-VPK......DFQC-
M0VYA0_HORVD/33-118.......-AIN-MGKVSGVP-GKCGV....S-VPFPI..SMSTDC-
Q43496_SOLLC/28-101.......-GVD-RNMAVQLP-EKCTA....N-FEQ.........C-
Q43522_SOLLC/127-207......N-LNV-PLTLSLIL-NNCGM....N-NS.......GFTC-
F2E1T8_HORVD/29-111.......-.YN-AGRAAGIP-SRCGV....S-VPYTI..SASVDC-
Q96232_ASPOF/101-182......N-LYL-PLALQLLL-T.CGK....T-PPP......GYTC-
Q9S7U3_ARATH/46-128......N-LNV-PVSLSLLL-NVCGK....K-VPS......GFVC-
Q9SA59_ARATH/25-103.....GF-KFN-RTLALNLP-TACNV....Q-TPS......PSLC-
Q9SBW9_MAIZE/43-101.......-...-..IINSLP-GRCHL....A-QAN.........C-
Q9SC06_TRIMO/34-125.LQQGLK-AKT-VQTAKSLP-SKCNI....D-PKY.........C-
Q9SDS2_CAPAN/27-110.......-GIN-VRKAAGLP-NMCGV....N-IPYQI..SPSTDC-
Q9SDS4_CAPAN/19-102.......-GID-FGKAAGLS-GVCGV....K-IPFEI..SPSVDC-
F2CY84_HORVD/32-117......G-GSE-ITRAAALP-SKCNV....N-LPYKI..SPSVDC-
Q9SET1_ARATH/222-304......D-LVL-PIALELLL-D.CGK....T-PPS......DFKC-
Q9SHA0_ARATH/27-109......A-GIN-PGIAIGVP-KRCNI...RN-RPA......GKRC-
Q9SI70_ARATH/29-101.....QF-NVT-TEKALGLS-RRCNV....T-TDL......SA.C-
Q9SKI0_ARATH/208-289......N-LYV-PVALQLLL-T.CGK....N-PPP......GYTC-
Q9SRS1_ARATH/32-105.......-GVD-RTLALHLP-GKCSA....N-FLP.........C-
Q9ST25_MAIZE/51-132......V-IDV-PIKLSALV-NYCGK....C-VPK......GYLC-
Q9STH5_ARATH/42-113......P-FNV-TDFNALFS-KTCGL....T-TDP.......NLC-
Q9SU32_ARATH/34-115......T-IDT-PIHLNLAL-NACGG....T-LPD......GFRC-
Q9SUV8_ARATH/28-104.......-YPF-TVGLVQVL-SLCGA....D-YPPP.....GFRC-
Q9SUW7_ARATH/37-117......F-LTI-NVRVNQVL-RLCRI....I-PPL......GFRC-
Q9SUX0_ARATH/37-116.......-FGI-DVAVREIF-FACNR....V-FPI......GFQC-
Q9SUX3_ARATH/50-132......N-LTL-PINLSLLL-NICNR....E-ASR......DFQF-
Q9SUZ2_ARATH/48-121.......-GID-RSMALQLP-QRCSA....N-FPP.........C-
SCA_LILLO/25-109.......-GLN-AAIVAGIP-GKCGV....N-IPYPI..RMQTDC-
Q9SXE7_ARATH/212-293......N-IFI-PLALQALI-T.CGI....N-PPS......GFVC-
Q9XF30_ORYSI/41-111......S-YIR-SPNAKRLF-TVCGL....P-IPRS....KTNPC-
NLTP5_ARATH/29-114......S-RLN-AGRAARLP-GACRV....R-ISYPI..SARTNC-
2SS1_SESIN/54-141.GMEQEM-QQM-QQMMQYLP-RMCGM....S-YPT........EC-
NLTP8_ARATH/28-112.......-TVK-PELAQALA-SNCGA....S-LPVDA..SPTVDC-
NLTL2_ARATH/27-105......L-TLD-LSKAASLP-SVCKV....A-APP......SARC-
Q9ZSL7_BRANA/27-108.......-.VN-PSLASSLP-GKCGV....S-IPYPI..SMSTNC-
Q9ZTW2_FRAAN/73-155......N-LNI-PIALSLLL-NACGN....Q-VPR......GFQC-
NLTP7_ARATH/29-118......P-GLN-ADRAAGIP-RRCGI....K-IPYSTQIRFNTKC-
XYP11_ARATH/40-120.....GV-KLD-KQRAEQLS-TICGV....K-APS......PSLC-
YY1_ORYSJ/31-94.......-...-..IINSLP-AKCGL....P-RVT.........C-
ZEB2_MAIZE/86-172.QGELAA-LMA-AQVAQQLT-AMCGL....Q-LQQ......PGPC-
ZM33_MAIZE/45-108.......-...-..IINSLP-AKCAL....P-PVS.........C-

PF14368

Q1G3I0_ARATH/16-107....AVS.NIT.GPYSKAIT.TKCGV----F.DKY---.....SC-
Q3ECK0_ARATH/8-101..LLAQF.NVT.TEKALGLS.RRCNV----T.TDL---....SAC-
B9RBQ4_RICCO/7-100..LLESF.KVN.VTQALALT.GRCGV----N.SDL---....SAC-
Q9LE56_ARATH/14-113..MLKSL.NLT.KENALDLP.KACGA----K.ADV---....SLC-
Q0D9K5_ORYSJ/20-116..ALQAF.GVA.PEQGLLLA.KRCGV----T.TDA---....SAC-
Q9SUV6_ARATH/10-114....DPL.....YTNTNQVN.KACGV----L.DKY---.....AC-
C5Z9F1_SORBI/22-116..ALQAF.GVA.PEQGLVLA.RRCNV----T.TDA---....SAC-
C5XVS1_SORBI/14-118..LLATF.NVT.KEQMFKLP.ARCNL----P...V---.....GC-
C3SA92_BRADI/13-112....VQL.PVN.MTRVLALP.AACGG----S.NAV---...FSKC-
Q9LJ85_ARATH/13-108...PFNI.PIN.RTTAVSLP.RACNM----P.RVP---....LQC-
Q7XIG9_ORYSJ/15-115....FGI.KIN.YTRAAALP.AACGG----D.SSA---...LSKC-
C5X2J9_SORBI/14-111....YGI.QVN.LTRAAGLP.AACGE----DPAAL---....SKC-
A9S0T9_PHYPA/9-107...AVAL.KIN.LSAAIAIP.QKCGI----KFEQR---....FYC-
C5Y597_SORBI/23-118.GRATGY.DVD.VAHGLQIP.ARCGQ----G.QPP---...VELC-
B9RIH6_RICCO/12-107....EDM..ID.MDKMVYVA.RSCGK----K.ISA---...GTKC-
B9RIH3_RICCO/10-107....EKI..VS.MEKVVYVA.RTCGV----E.VKP---...GLKC-
A9TY60_PHYPA/11-108..NSTLT.GVN.STKAHQIP.VMCCI----A.VDT---....VKC-
B9HP13_POPTR/12-110....QKV..FS.MDKAVFVA.RTCGL----T.IPP---...GTVC-
C5XAF7_SORBI/6-114PALGGGV.PVN.RTLAVSLP.KACDS----M.SVP---....LQC-
A9T6D1_PHYPA/9-104....QQS.GAK.VEFAKYIP.QKCQL----T.YKA---...GIVC-
B9HP10_POPTR/10-105....E.A.MIS.MEKVVYVA.RTCGV----T.VRA---...GTQC-
B9RTN3_RICCO/10-113..LIFGF.PLN.QSRVVSLP.SVCSE----T.TNF---TSLESIC-
B9RIH4_RICCO/10-105....EDL..IS.MKKVFDVA.KSCGK----K.VTP---...GTKC-
B9RZC4_RICCO/7-99..LLSSY.KID.PNLAMQLP.VKCKL----V.GES---....FHC-
A9SQH6_PHYPA/103-196....ALYPTSN.ANKASSLL.RDCKL----S.AGA---.....SC-
B9SEE9_RICCO/14-106....ASL..IN.VKQAIKLL.QDCGR----K.VPR---...HFKC-
C5WP26_SORBI/30-121.....DL.DID.LDKVFYVC.RSCGV----A.IPR---.....GC-
B9SEE8_RICCO/14-105....AAL..ID.VNRAIRVI.EGCGR----R.VPR---...HFKC-
C5WP25_SORBI/18-110.....LD.DIN.LDKVFYVA.GQCAV----S.IPW---.....FC-
A9SQH9_PHYPA/117-210...ASNP.TLN.ANKARALL.NDCEI----S.AGS---.....TC-
B9GVR5_POPTR/18-112..LFPSL.GIN.VTQAVNLS.QRCGV----T.TNL---....TSC-
B9H8A8_POPTR/14-108...PLQL.PIN.RTLAITLP.RACKM----S.GVP---....MLC-
B9HUT8_POPTR/13-107...IFGF.PLD.ESRVIALP.SACSL----S.SPV---.......-
D7T8D6_VITVI/12-114...AKKA.GIK.PAIAITIP.KRCNI----K.NRP---V..GKKC-
I1PAV8_ORYGL/35-130...AYGV.RVD.AVRALALP.TICRV----D.APP---...PRLC-
I1QT58_ORYGL/18-119..DTRQV.GSNALDGDQQMF.ARCKI----P.GAS---...STIC-
I1R180_ORYGL/22-119..RSTGY.DVN.VTHALEIP.VSCGL----A.TPP---...IELC-
Q1G2Y5_ARATH/16-109...PISI.PIN.RTLAISLP.RACGI----P.GVP---....VQC-
Q2R222_ORYSJ/12-114..RAIGV.DIP.VDRAFALLRDVCRL----S.PPA---D.IISTC-
Q75GY5_ORYSJ/27-127...SPLA.PVL.GGVQSLLP.TACNL----P.PN.---.......-
Q8S077_ORYSJ/23-111....VMG.NID.AARAMQIP.SKCRI----K.GAP---....KSC-
Q9SUV7_ARATH/19-112....SNG.NIS.QARYDLVN.SACGV----A.DKF---.....AC-
U5G1T3_POPTR/18-113...PFSI.PIN.RTLAISLP.RACNM----P.GVP---....VQC-
U5GQ18_POPTR/24-115....AAL..ID.LDRAIRLI.EGCGR----R.VPR---...HFKC-

PF14547

F2DU32_HORVD/35-120--------NLPL..DVPLVL-NYCGR----NATAA------GSNCS
D7ME35_ARALL/36-114--------TL....RLNQVL-GIC.R----ITPPA------GFTCA
A8MRQ5_ARATH/577-656--------......NIIILC-RACGR----RI.PR------GFTCP
D7ME37_ARALL/85-164--------......NIINLY-RTCGR----SI.PP------GFTCP
D7ME34_ARALL/31-113--------NL....RVNQVL-RLC.R----ILPPA------GFRCA
D7ME36_ARALL/7-89--------TINLNLRLNGLL-GLC.R----LPIQP------GYNCL
D7MAX1_ARALL/157-241--------IIPI..ALELLV-D.CGK----TP.PR------GFKCP
Q7XTE3_ORYSJ/6-89--------EWTV..GVSVLV-STC.K----TELPD------GFKCV
B9S3J8_RICCO/215-298--------IIPI..ALEVLV-D.CGK----NP.PP------GFQCP
D7ME38_ARALL/36-117--------VFAIDEAVREIF-FAC.N----RVFPI------GFQCP
C5Z4Z5_SORBI/237-320--------YLPI..ALNLLI-T.CGK----HP.PS------GFQCP
C5Y909_SORBI/46-127--------EWDV..GVGVLA-SACKT----EL.PN------GFKC.
F4JLV4_ARATH/297-375--------......NFGIFF-KVCGR----RI.PQ------GFSCP
I1QBL2_ORYGL/229-307--------DINV..MIDKIL-KLCSK----AG.DS------TVVC.
M4F7Y5_BRARP/170-253--------YVPV..ALQLLL-T.CGK----NP.PP------GYTCS
W4ZSZ5_WHEAT/138-222--------NLPI..HLSLIL-NFCGK----GV.PT------GFMCP
W5AJU0_WHEAT/30-113--------HLPV..DLRLIL-NNCGK----VC.PT------DFRCP

PF05617

M4FC94_BRARP/72-146--------QLK.R.FASQV.----------..SLEINE..VWNRCS
B9S177_RICCO/41-104--------............----------..TEEGDI..LEGYC.
U5FMS5_POPTR/61-132--------MFK.A.NYDFY.----------..LKRGDD..LYNIC.
M1BC58_SOLTU/78-151--------EMK.GVNTTEI.----------..WKNSDK..LWEEC.
M4FCA2_BRARP/71-146--------QLK.R.FASQV.----------..SFKTNE..VWNRCS
M4F146_BRARP/69-143--------EYR.N.IASKA.----------..IPKSKQ..TWNDCV
M4FC93_BRARP/72-147--------QLK.H.FASKV.----------..SFKINK..VWNRCS
EC12_ARATH/45-109--------............----------..SDETNV..LRGFCQ
M4FC76_BRARP/105-178--------EYN.N.IASKA.----------..IPKSKH..TWKDCV
D7LVH8_ARALL/44-116--------KLR....KQDS.----------..LEKSTQ..IWYLC.
M4F8U3_BRARP/34-96--------............----------...FFPPT..LRDHCS
K4CB92_SOLLC/64-137--------KVKDKIDSKVV.----------..KSNVSK..VFKRC.
B9SN88_RICCO/61-124--------............----------...FFGPL..LKLFCS
B9SVP5_RICCO/53-119--------............----------..VEEVNI..LNGYCA
B9GGT7_POPTR/48-111--------............----------..VQEGDI..LLGYCD
I1I7L3_BRADI/74-140--------............----------..QFYDPL..VRNACD
K7KX58_SOYBN/72-144--------EMR.NVDAIEF.----------..LNKGKK..LFDEC.
K7KX56_SOYBN/72-143--------EMR.NANATEL.----------..MKKNSL..IFNHC.
K7MQC1_SOYBN/160-232--------QFK.E.NEAQI.----------..MNRSNQ..IWNYC.
M0TQL0_MUSAM/66-131--------............----------..PQEGDV..LRGYCD
EC11_ARATH/57-120--------............----------..AQEGDM..LQGYCD
B9T247_RICCO/77-140--------............----------...FFGGL..LKQHCS
M4FC95_BRARP/79-152--------QLK.R.FASQV.----------..FFKINE..VWNRCS
D7KC93_ARALL/38-103--------SLV.G.RETQY.----------..........VWSHCV
M4EKA3_BRARP/43-105--------............----------...FFPPL..IKDNCA
D7MTL8_ARALL/141-203--------............----------...FFPPL..LKNECS
C5YSL3_SORBI/84-148--------............----------..AEEADV..LRGFCD
A8MS74_ARATH/69-143--------QLN.R.FSSNA.----------..MIKTNE..TWNKCS
U5GVU7_POPTR/48-112--------............----------..AEEGQI..LEGYCD
Q6ZKQ3_ORYSJ/79-152--------............----------..PLYAPL..VNHVCS
K7LY71_SOYBN/49-122--------KFR.A.HKIQI.----------..LKRSEK..VWFDCD
B9SXP3_RICCO/41-109--------............----------..PEIGKQ..LKNICA
K7KW29_SOYBN/52-115--------............----------..NEETDV..LEGYCD
B9HRY2_POPTR/41-112--------EYK.G.HEEEA.----------..LAGSNK..LWEKCA
M4DW18_BRARP/37-99--------............----------...DFPPT..LRDHCS
M4DVD8_BRARP/72-146--------QLR.R.FTSVAK----------ILLLRTGK..ILSRCS
B9RBY2_RICCO/99-162--------............----------...SFPSR..LKSFCA
B9P5Y5_POPTR/32-100--------............----------..LLRRRR..LIKSC.
B9GU63_POPTR/46-117--------QEN.P...SKI.----------..SLRSLD..IWNHCV
M4FC77_BRARP/64-140--------AFI.DPSAANA.----------..VAKSKY..TWKDCV
Q8S8C9_ARATH/73-145--------ELR.R.FTSKR.----------..FSKTNE..IWNRCS
B9SN89_RICCO/73-136--------............----------...FFGPL..LKKVCS
Q3EBD9_ARATH/70-142--------YYK.P.FASKG.----------..RPRILK..VWNRCS
D7MVA2_ARALL/48-118--------EYK.N.IAS...----------..IPRSKQ..TWNDCV
B9SVP8_RICCO/47-111--------............----------..AEEGNI..LRGYCD
W5I1G9_WHEAT/44-110--------............----------..PEEGDM..LKGYCD
U5DGU8_AMBTC/38-101--------....G.......----------..LVHQ....LNSYC.
D7MSB1_ARALL/48-110--------............----------...FFPPL..LKDICA
D7LBY0_ARALL/72-145--------QLK.R.FSSKR.----------..FSKTNE..IWNRCS
Q9LXX9_ARATH/44-121--------KFE.GVRKQYS.----------..LEKSTY..IMQLC.
A7REG6_ARATH/64-136--------DYK.K.IASKA.----------..IPKSKQ..TWNDCV
B9HQH8_POPTR/62-126--------............----------..........IRKRCA
M4F9M9_BRARP/52-124--------............----------..TMEGNM..LREYCD
K7N3Y2_SOYBN/45-109--------............----------..TEEGDV..LQGYCD
M4FC77_BRARP/213-288--------AYF.DPSASNA.----------..VPKSKY..TWKDCV
M4CIW6_BRARP/37-108--------SLI.G.NESKY.----------..LQKRDE..IWAYCV
B9SE79_RICCO/48-112--------............----------..TEEGDI..LEGYCD
K7KX55_SOYBN/121-191--------DLR.NVDPIQL.----------..LEKSKE..TFDNC.
K4D4G7_SOLLC/44-108--------............----------..LEETNM..LRGYCD
B9GGU6_POPTR/50-114--------............----------..DEEGNI..LRGYCD
U7DW65_POPTR/42-112--------KEK.V...TFV.----------..VATGDQ..IWNHCV
D7LQP6_ARALL/70-141--------DYK.N.IASKA.----------..IPKSKK..AWNDC.
A8MQ83_ARATH/72-148--------QLK.R.FSSKK.----------..FSKTNE..IWNMCS
M4F142_BRARP/86-160--------EYR.F.IASKA.----------..IPKSKQ..TWNDCV
D7MQQ8_ARALL/38-109--------MLI.A.HETEY.----------..LKKSDD..LWNHCV
U5GKZ5_POPTR/42-112--------KEK.V...TFV.----------..VAKGDQ..IWNYCA
I1IN82_BRADI/69-133--------............----------..AREADV..LRGFCD
K4C587_SOLLC/77-151--------EMK.GVNKTAV.----------..WINSEN..LWKRCV
Q3ECV9_ARATH/81-154--------VYG.NSIASKD.----------..IPYSKQ..SWNECV
W1PLV8_AMBTC/49-113--------............----------..AEEGDI..LRGYCD
K4D4G3_SOLLC/55-119--------............----------..SQEGDI..LHGYCD
B9IKH4_POPTR/49-122--------NFV..LTVPEF.----------..FERTEK..VYDHC.
A5AZZ7_VITVI/45-108--------............----------..AEEGNI..LQGYC.
M0ZZI9_SOLTU/49-111--------............----------...LFPLT..LKSFCS
K7KX59_SOYBN/86-158--------EMR.DVDAMQL.----------..LNKGKK..MFDQC.
I1K1Y8_SOYBN/51-124--------LFK.Q.NLTQI.----------..LKRSEK..VWNDCS
D7MTL8_ARALL/48-110--------............----------...LFPPL..LKDGCS
I1QJT2_ORYGL/79-143--------............----------..EKYLPL..VKRICS
U5DBS7_AMBTC/38-100--------............----------..GGFANQ..LYEFC.
EC14_ARATH/47-111--------............----------..PEEANV..LRGFCQ
K7KX55_SOYBN/32-108--------QLK.NVNQTEI.----------..MSKNDK..IFNKCD
Q9LUB3_ARATH/33-97--------............----------...LIPPSRRLRDHCS
I1QY08_ORYGL/55-119--------............----------..AQEADI..LRGFCD
K7L6R0_SOYBN/36-100--------............----------..YHEALS..IRGYCD
M0TA67_MUSAM/60-124--------............----------..TQESDI..LRGYCD
M1ASC9_SOLTU/60-130--------QYE.K.ESKSI.----------..LANSIK..VFDSC.
W5I3U0_WHEAT/51-117--------............----------..AEEGDM..LKGYCD
M4DW17_BRARP/37-100--------............----------..EDFPLA..LRDYCS
Q9C924_ARATH/63-134--------ELK.D.VASAI.----------..LPRSKR..MWNKCV
M4EJU1_BRARP/45-107--------............----------...LFPPL..IKDGCS
D7LL48_ARALL/69-143--------QLK.R.FSSKA.----------..MIKTNE..IWNKCS
Q3ECV8_ARATH/86-158--------EYK.N.KASKG.----------..IPKSKQ..TWNECV
Q9FYN3_ARATH/84-147--------............----------...FFDCV..VKLHCS
U5GF05_POPTR/42-112--------KEK.V...TFV.----------..AAKGDQ..IWNHCA

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window