Sequence alignment for CL0484

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------VPTASLYVFLIGVWY.--------------.YRFRP
Q5TKJ0_ORYSJ/649-804--------------------------------------------LPTIFLYMFMIGLWN.--------------.YRYKP
Q9FJG3_ARATH/893-1049--------------------------------------------VPTLAFYLFVIGAWN.--------------.YRFRS
Q8H2Q5_ORYSJ/856-1011--------------------------------------------LPTIFLYMFLIGLWN.--------------.YRFRP
Q0D8E3_ORYSJ/881-1037--------------------------------------------VPTLTLHVAAVGVWK.--------------.YRRRP
Q9M2D4_ARATH/816-972--------------------------------------------LPVMSLCLFMLGVWN.--------------.YRLRP
Q60EW9_ORYSJ/619-774--------------------------------------------LPTIFLYLFLIGVWY.--------------.YRWRP
Q7XKA3_ORYSJ/864-1021--------------------------------------------LPTVFLYLFVIGVWN.--------------.YRRRP
Q9LZE5_ARATH/588-744--------------------------------------------LSGLHKFL.TRKFWN.--------------.KRENP
Q69T22_ORYSJ/477-632--------------------------------------------LPTVFLYMFMIGLWN.--------------.YRRRP
Q9FI32_ARATH/881-1036--------------------------------------------LPTMFLYMFFIGLWN.--------------.FRSRP
O49435_ARATH/618-774--------------------------------------------VFSMLLYCFVFGLYR.--------------.FGLRP
Q9M366_ARATH/632-795--------------------------------------------LREILKSPRQTYNW.L--------------FYRNVT
Q9SS68_ARATH/861-1017--------------------------------------------LPTVFMYAFLILALR.--------------.FRYRG
Q6EUH5_ORYSJ/624-779--------------------------------------------LPTFFLYKFMLGMRN.--------------.YLRRP
O64492_ARATH/857-1012--------------------------------------------LPCLLLYTAAVGVWR.--------------.FRRRS
F6HMN5_VITVI/841-996--------------------------------------------LPTVFMYAFFIIVLR.--------------.FRYRR
F6I605_VITVI/863-1018--------------------------------------------LPTVFLYMFMIGLWN.--------------.YRGRP
Q6K6B6_ORYSJ/845-999--------------------------------------------LPTAFLAMAFTGLWR.--------------.YRVRS
Q7XR21_ORYSJ/659-814--------------------------------------------LPTAFLYASVAGAWS.--------------.YRRRP
Q7XZZ4_ORYSJ/899-1054--------------------------------------------LPTVCLYLFLVLLWR.--------------.YRARP
Q84TJ7_ARATH/856-1011--------------------------------------------LPTMFLYMFLIGLWN.--------------.YRFRP
Q8RXU9_ARATH/851-1006--------------------------------------------LPTVFLYMAVIGMWN.--------------.YRFKP
Q9FL59_ARATH/639-794--------------------------------------------LPTTFLYMFLIGLWN.--------------.FRFRP
Q9SKA3_ARATH/874-1029--------------------------------------------LPTVFLYLFVIGMWN.--------------.YRYRP

PF06398

Q758I9_ASHGO/63-412PGLSVPIMSRNFVQMNSRLSFPFQVV...NEVIRIANWESTACTLSVGMLYSFVVLRPLV..............TLSSAP
B0YCC5_ASPFC/114-487H.RKSPLLVATPPAITRALAYSHPFILPLNKLAGLLTWTTDDPWQSFLLVAGFWTVVLYS..............DAIILW
A3GFP1_PICST/23-380T...NTNLLVESPILASALSNIFPYLLLLDNVLEVITWTNDDPYQNFLFIVIYSWLVMYW..............HSISYI
Q6BWT4_DEBHA/130-546PNLSIRILTSNFKRLSSKMSSFFVLQ...YGLIHIITWRKPTKTLSFLVFYTSICLWPHL..............ILA.YP
Q6BIC3_DEBHA/22-384TSSSHTQLLTEYPILSSALSNIFPYLLLIDNFLEIVTWTNEDPYQNFILIVLYSVIIMYW..............QILSFI
A3GHG6_PICST/131-541PNLSIRILLSNFKKLAGKMGMFFELQ...YGIIHIITWRKPTKTLTALVLYTTICLWPHL..............VVT.YP
Q0UCD7_PHANO/96-443PNFSIPTMSSNFRRFNSRIGVAFILQ...NRLIHLFTWAEPTQTLSFLFVWTFLCVDPYL..............LPV.LP
Q6BPA3_DEBHA/104-486PPLSVNLISKNSILLNSRLSVPFETI...DGVIKFFNWDNSSFTVGILLVITHIILNPYL..............ILV.LP
A5DFV2_PICGU/131-552PGLSISVIAGNFKALSGRMTGFFTVQ...YGLIHIITWRHPSKTLTFLVFYTATCLWPHL..............VLA.YP
Q0V1J3_PHANO/49-353H.QKSPLLAATPPQITRVLAYSHPFILPLNKLVGLLTWTTGDPWESFLLVASFWAIVMYG..............DAVTRY
A5DFP0_PICGU/28-381P.QASPLLSSTPPTVAKSLVKSYPYLLIVNKALSIFTWTNDDYWVNLIIVCMYSLLVVYF..............ENIITW
Q6BYT2_DEBHA/63-426P.QTSPLLSSTPPSVAKSLVRSYPYLLIVNKFLSIITWTNDDYWINIILVCLYSLAILYF..............ENLVTW
A4GFC7_PICAN/70-420P.QSSPLLSSTPPTVSKSLIKAYPYLIALNKILGVLTWTDDTSYISVLLVTTATLFILYF..............ENFVIY
A7A1K7_YEAS7/58-403V.ATSPLLTSTPPTISKALVKLYPYLILIDEFLNVVTWTGKNIWSSVLMLCLFITTVEYF..............ETLVKY
Q9UV60_YARLL/25-364Q.SMSPLLSSTPPTVTKALAQAYPYILASDKVLGLLTWTEDDQWQSFLLVAVYVTVVMYY..............EYLVIY
Q6CSS7_KLULA/54-399V.ESSPLLNSTPPTVSKALVKLYPYLVVCNEFLGLLTWTSDDIWKSVLMVICYIAVILYF..............QVVVRY
Q59WI8_CANAL/24-381P...TSRLLTESPKLSTALSQIFPYLLLIDNLLEILTWTNEDHYQNFLLLTCYSCIIVYW..............NWVSHV
A3LMZ2_PICST/28-391P.QTSPLLSSTPPTVAKALIKAYPYLLIINKMLSVATWTNDDSWINIVIVAVYSLVILYF..............ESLIIW
Q6CXM3_KLULA/59-410PGLSVPIMSRNFVQMNSRLGAPFMII...DEIIRIFNWTNAAYTLCIMSFYSFLVLKPLP..............VLVSGP
A1CDA3_ASPCL/48-420H.RKSPLLVATPPAITRALAYSHPFILPLNKLAGLLTWTTGDPWQSFLLVAGFWTIVLYS..............DAIILW
A7E6F1_SCLS1/107-489PAFNITTMSNNFRRFNARIGVVFVFQ...AKVIRLLSWKQWSHTLSFLAVYTFVCLDPYL..............LTV.LP
A7TDR4_VANPO/106-455PRLSVPVMSRNFILSNARFGLPFTMV...DEVIYIFSWLNPAYTLSILIIYSFIILKPLP..............SLLSIP
A7TKV5_VANPO/49-397I.VSSPLLSSTPSTISKSLVKIYPYLILADSFLGLVTWTNENIWGSILITLAYIMGILYF..............QNITKY
Q6CN25_KLULA/177-532QTVSVTIMNKNVRALTSRLGAIFELQ...DILIRLLTWRNPSGTLLALIAFTQICFNPML..............LVI.LP
Q6FJ63_CANGA/118-468PSLSVPITSRNFILMNSRLSVPFLVI...DEIIKILNWVDPAYTLSMALIYTLIVLRPLQ..............VLSSLP
A6ZZ68_YEAS7/115-465PKLSVQITSRNFIQMNSRLGVPFMIM...DELIKILNWTNPAYTVSIMFLYTLIILKPFQ..............MLSSLP
Q752S3_ASHGO/50-392V.VSSPLLNSTPPTVTKSLVKLYPYLVIADRALSTLTWTNDDVWESVLMVICYGAGVVYF..............ERLIKF
N1P6V1_YEASC/26-408Q..KPSLIQITPPMISSTLFHAYPLLLIFDNALANIMWLSDDKCLTFIYLTSIWLTISFFIPVETEASHFLPFTKILRLW
A0A023ZM32_YEASX/50-394I.LSSPLLTSTPKTVSRSLVRLYPYLIVVDNFLSIITWSNDNVSANLLGIFLFTVCVLYF..............GFITRY
Q6FJI4_CANGA/13-429Q..KPSLTLVTPVMLSMSLAKIYPLLIIADAALDNLMWICEDPNLPFLYVVLTYLSLSLYSWSWEYPVAGSQMANIILLW
A4GFD2_PICAN/121-493PQLSLNVMSKNAIQLLSRLSVPFVLI...DQVIIIFSWSKPLYTLTFLNVATLLILKPIL...............LLSLP
A4GFN5_PENCH/56-430H.RKSPLLVATPPAITRALAYSHPFLLPLNKLAGLLTWTSGDPWQSFLLVATFWTIVLYS..............DAIILW
A2R1B9_ASPNC/54-425H.RKSPLLVATPPQITRALAYSHPFILPLNKLVGLLTWTTGDGWQSFLLVAGFWTLVLYG..............DVIVTW
A2QGY9_ASPNC/84-515PAFSLPLMANNFRRFNARIGIVFLFQ...TRVERLLSWKQTSHTVSFLFVYSFICLDPHL..............LVI.IP
M9MW28_ASHG1/185-541HPISLIIMSRNLKIMTTKLGLIFEFQ...DSLVRLATWRNPSGTALSLILFSFACFNPML..............VII.LP
Q2UTA0_ASPOR/52-419H.RKSPLLVATPPPITRALAYSHPFILPLNKLVGLLTWTTDDAWQSFLLVSIFWTIVLYG..............DAIILW
A7TEV3_VANPO/152-511QPISASTLGRNMGKLGSKMTAMFDMQ...ETVIRLITWRNPSGTVTLLISMTMLFYNPII..............LLL.LP
A5DUM8_LODEL/24-379P...TSKLLVESPTLASSLSQIFPFLLLIDNFLETITWTNDDHYRNFLIMTLYTCVVMYW..............NIVSQF
PEX32_SCHPO/1-480M.IRAHLFSEPD...NSKLWAKSTGSDAFDLILKVLLWTAPWYYCLTTLFFTWLIILYPR..............PTLACS
F2Z6I0_YARLI/178-534PELSIPLLLRNIAELSKRAGGVMKTQ...TVVLKAIQWQNPCLSISCIFIYTAMCLYPGI..............VFV.LP
A4GFD3_PICAN/18-342T.KVKGQLLNMPPVITSALYAAFPVIFLLDKVLAFLTWTNDDPYTNFIAIAIYIMVVKYW..............TVVACT
Q0CPT8_ASPTN/42-419H.RKSPLLVSTPPPVTRALAYSHPFILPLNKLVGLLTWSTGDAWQSFLLLASFWTLVLYG..............DVIILW
Q6FXX0_CANGA/58-376V.MPSPLLSSTPPSVVRSMVRLYPYLKLTDKALGVLTWSDFSIWNSIVLVPAYLLFVLYY..............EVFVAY
C4YIY7_CANAW/52-403P.QSSPLLSSTPPSVSKALVNSYPYLIIINKLLSITTWTNDDYWVNVVIISLYALVVLYF..............ENLVIW
G2WFM3_YEASK/201-569PVFSATTLGSNFKKLSKKMGSIFELQ...DSIVRLLTWRNPTGTVTSLILFTLICFNPMY..............LVI.LP
A5DUZ7_LODEL/104-459P.QSSPLLSSTPPLVSKALVNAYPYLLIVNKILSIATWTNEDYWVNVVLLALYALFVLYF..............EQVVTW
A7EH28_SCLS1/61-453H.QKSPLLLATPPQITRALAYSHPFLLPLNKLAGLITWTSGDPWESFLLVASFWAFVLYG..............DVVMRY
Q5ANG0_CANAL/154-573PGLSFGILTSNVKQMASKMTNFFALQ...YEVLYIIAWKKPTKTISALVLYTAVCLWPHL..............VLA.YP
Q6FR12_CANGA/140-535PPFSASVLASNMKKLSGKMDSIFEFQ...DNMIRVLTWKTPTVTLTALTIFTLICFDLMN..............VIL.FP
A5DZV8_LODEL/165-601PGLSFPILISNLKQLGSKMTNLFALQ...YEIINIVAWRKPNKTLSVLVLYTAACMWPHL..............ILV.YP
Q2GTD2_CHAGB/75-535H.QKSPLLLATPPQITRALAYSHPFLLPLNRLVGLITWTTNDPWESFLLLAGFWAAVLYG..............DFVVRV
Q6FTU9_CANGA/51-394I.VSSPLLNSTPPTVSKALVKLYPYLIVTDKFLSIVTWTNDNLWLNFLSVLSYFVFVLYF..............QFLVKY

PF08372

Q8S1F8_ORYSJ/928-1080RGPA.GMDARLSQADT..VEADDLEEE-----------------------------------------------------
Q5TKJ0_ORYSJ/649-804RHPP.YMDTKLCHAEF..TNPDELDEE-----------------------------------------------------
Q9FJG3_ARATH/893-1049RAALPHFDPRLSLADA..ADRDELDEE-----------------------------------------------------
Q8H2Q5_ORYSJ/856-1011RFPP.HMNTRISHADM..TNPDELDEE-----------------------------------------------------
Q0D8E3_ORYSJ/881-1037RAPAPHPCVRASMAEA..ADREELDEE-----------------------------------------------------
Q9M2D4_ARATH/816-972RQPP.HMDTRLSFADN..IHPEELNEE-----------------------------------------------------
Q60EW9_ORYSJ/619-774RQPP.HMDTRLSHAES..AHPDELDEE-----------------------------------------------------
Q7XKA3_ORYSJ/864-1021RKPA.HMDTALSHAEAEQVHPDELDEE-----------------------------------------------------
Q9LZE5_ARATH/588-744RSPLIVNDLKLWKLES..PNLDELEEE-----------------------------------------------------
Q69T22_ORYSJ/477-632RHPP.HMDTKMSWAEA..VHPDELDEE-----------------------------------------------------
Q9FI32_ARATH/881-1036RHPP.HMDMKLSWAEA..VGPDELDEE-----------------------------------------------------
O49435_ARATH/618-774RHPP.HMDIKLSKADS..ALPDELDEE-----------------------------------------------------
Q9M366_ARATH/632-795PPPLILVDLKLRKLDS..INLDELAEE-----------------------------------------------------
Q9SS68_ARATH/861-1017RVKVNSVDPRLSCVDS..VAPDELDEE-----------------------------------------------------
Q6EUH5_ORYSJ/624-779KHPW.HVDMRVSHADT..AHPDELDEE-----------------------------------------------------
O64492_ARATH/857-1012RYPP.HMDARISHAET..VFPDELDEE-----------------------------------------------------
F6HMN5_VITVI/841-996RVLL.SMDTRLSYAEA..ISADELDEE-----------------------------------------------------
F6I605_VITVI/863-1018RYPP.HMNTKISYADN..VHPDELDEE-----------------------------------------------------
Q6K6B6_ORYSJ/845-999RHPP.HMEMRLSHADA..ATVDELDEE-----------------------------------------------------
Q7XR21_ORYSJ/659-814RRPP.QADAGLSCAEA..AGADEFDEE-----------------------------------------------------
Q7XZZ4_ORYSJ/899-1054REPT.GMDPRLSHVDS..VSPDELDEE-----------------------------------------------------
Q84TJ7_ARATH/856-1011RYPP.HMNTKISQAEA..VHPDELDEE-----------------------------------------------------
Q8RXU9_ARATH/851-1006RFPP.HMDAKLSYADN..VNSDELDEE-----------------------------------------------------
Q9FL59_ARATH/639-794RHPA.HMDTKVSWAEA..ASPDELDEE-----------------------------------------------------
Q9SKA3_ARATH/874-1029RHPP.HMDARVSQADN..AHPDELDEE-----------------------------------------------------

PF06398

Q758I9_ASHGO/63-412MFYILFAVMVPYYMQI--HAPEPWEEL.....................................................
B0YCC5_ASPFC/114-487GGPILVVVGLILGMYW--RRFSPLSTAAFTGEK...............................................
A3GFP1_PICST/23-380ILPIIMSITFSALVWS--ISSVIYDSK.....................................................
Q6BWT4_DEBHA/130-546MIFLIFGVMLPAYIHR--H.PMRTPELIKVKKRGQSILDFFNSSSDTSVIEDLIGKDYHNDSGSESDSLQPVISKSSDTS
Q6BIC3_DEBHA/22-384IMPILISVTFACFVWS--ISSIIYDSK.....................................................
A3GHG6_PICST/131-541LIFLLFGIIVPGYLHR--H.PMRTPELIKVKKRGQSLFSFLNEGAGEHSIIDDLLSDS............VLGDEGLRPT
Q0UCD7_PHANO/96-443LASLLFFVMVPSFLTR--H.PEPEVHVG....................................................
Q6BPA3_DEBHA/104-486LLLILINIMVPHYLVL--H.PTDRSVLNS...................................................
A5DFV2_PICGU/131-552LLFLLFGIMIPGYIHR--H.PMQTPELIKVRKRGQSL...........................................
Q0V1J3_PHANO/49-353AGPIIVVSGLILGMYT--RRYSPLSST.....................................................
A5DFP0_PICGU/28-381SGHLVVV....AILAL--YALLNHKIT.....................................................
Q6BYT2_DEBHA/63-426SGHLIIV....GIITL--YALLNNKII.....................................................
A4GFC7_PICAN/70-420LGHLSIV....GLIFL--YSIFRSYVE.....................................................
A7A1K7_YEAS7/58-403FGHLAII....AILWG--YSLLDNYIE.....................................................
Q9UV60_YARLL/25-364CGHILAV....GFIWA--FVYIRQSVE.....................................................
Q6CSS7_KLULA/54-399FGHFLFV....GLLWG--YSALDTFVE.....................................................
Q59WI8_CANAL/24-381ILPILMTLAFSSIVWF--ISSIIYDSK.....................................................
A3LMZ2_PICST/28-391FGHIIIV....GIITM--YAFLNNKIV.....................................................
Q6CXM3_KLULA/59-410FVYILFGIMSPTYMDI--HKPDPHMNL.....................................................
A1CDA3_ASPCL/48-420AGPIFVVIGLILGMYW--RRFSPLSSAATTGEK...............................................
A7E6F1_SCLS1/107-489LAVLLLAVLIPSFIAR--H.PAPPTTITTDS.................................................
A7TDR4_VANPO/106-455IFYILFGVMVPQYLYI--HKPETLPYF.....................................................
A7TKV5_VANPO/49-397FGHVVVV....GLLWG--YSLLHQNIE.....................................................
Q6CN25_KLULA/177-532ILYLMFGLMIPGYLHR--H.PLHRGIYLSKRSYGKSLIKSITTG....................................
Q6FJ63_CANGA/118-468ILYLLFGIMVPEYLHI--HEPSENVYL.....................................................
A6ZZ68_YEAS7/115-465IFYLLFCVMVPQYLYI--HKPNPTSYL.....................................................
Q752S3_ASHGO/50-392FGHLVIV....GVLWG--YSLLDKHVE.....................................................
N1P6V1_YEASC/26-408LGIISGAFLFLSFMYY--.....IVSL.....................................................
A0A023ZM32_YEASX/50-394FGHLMIV....GIIWV--YLLIDKHVQ.....................................................
Q6FJI4_CANGA/13-429LELSSGVFLLFAASYF--.....ISSV.....................................................
A4GFD2_PICAN/121-493FFYTCFGIIVPAYMKR--HPPDKHTIL.....................................................
A4GFN5_PENCH/56-430AGPILVVVALILGMYG--RRYSPLSSTTSTGEK...............................................
A2R1B9_ASPNC/54-425TGPLLVVISLILGMYW--RRYSPLSSRAHLSEK...............................................
A2QGY9_ASPNC/84-515FAVLLFFVMVPAFLAR--H.PPPPSTSTSSI.................................................
M9MW28_ASHG1/185-541MLYVLFGLMIPGYLHR--H.PLRRNFYLTKHSYGKSLLATVATG....................................
Q2UTA0_ASPOR/52-419AGPPLVVVGLILGMYW--RRYSPLSTRSISGEK...............................................
A7TEV3_VANPO/152-511LVTLMYMVMIPGYIHR--H.PLHRAIYPSRTSYGRSLLEDIASS....................................
A5DUM8_LODEL/24-379FLPIILVLIFSFFVWL--ISSVVYDSK.....................................................
PEX32_SCHPO/1-480VAAWLFWFTSLDTLEP--..DDRKNTLKASEAVSTSAKTSEETAKPSETREDGEWNTLK...........NTLEADAQNL
F2Z6I0_YARLI/178-534GLLFMYGIMAPAYAEK--H.PLPKEYRPSPWTVKN.............................................
A4GFD3_PICAN/18-342VLPTIIALGTCASLWF--LKTTIDDLR.....................................................
Q0CPT8_ASPTN/42-419AGPLLVVIGLILGMYW--RRYSPLSSSRTVPNENK.............................................
Q6FXX0_CANGA/58-376LGHMIVIFCVLGLMWI--YNFV..........................................................
C4YIY7_CANAW/52-403SGHLILV....AILIS--YALLNNKII.....................................................
G2WFM3_YEASK/201-569IFRFVYGIVVPGYVRK--H.PLQRSIYPLKRNHGSSLLYDVCYE....................................
A5DUZ7_LODEL/104-459LGHLLIA....AAITL--YAVLNNRII.....................................................
A7EH28_SCLS1/61-453AGPLVVVIGLILGMYS--RRYSPLSSTSWTGEKQ..............................................
Q5ANG0_CANAL/154-573LLFVLFGVLIPGFVHR--H.PQRNPELIKVKKRGQSLLSFLFET....................................
Q6FR12_CANGA/140-535MAYIVLVQMTQGYIRR--H.PIRRTIYIKRRAIGRSLIHDLF......................................
A5DZV8_LODEL/165-601LLFVLFGMLLPGYTHR--H.PPRRPDLIKVKSRGQSLFKFLNAT....................................
Q2GTD2_CHAGB/75-535AGPLVLVFVLIGGMYG--RRFSPLSSSGWSEPGLGTADGAAVVAEAKGAKGSRGSKNL............SVDGLPEKNG
Q6FTU9_CANGA/51-394FGHLLII....GIIWC--YSLVDSAVE.....................................................

PF08372

Q8S1F8_ORYSJ/928-1080---------------------FDAVP....PPEVL---------------------------------------------
Q5TKJ0_ORYSJ/649-804---------------------FDSFP.SSRPADIV---------------------------------------------
Q9FJG3_ARATH/893-1049---------------------FDVVP.SNRPPEMV---------------------------------------------
Q8H2Q5_ORYSJ/856-1011---------------------FDTFP.TSKSPDLV---------------------------------------------
Q0D8E3_ORYSJ/881-1037---------------------FDAIP.SSRPPEVV---------------------------------------------
Q9M2D4_ARATH/816-972---------------------FDTFPFSSQDPGIV---------------------------------------------
Q60EW9_ORYSJ/619-774---------------------FDTFP.TSRPPDIV---------------------------------------------
Q7XKA3_ORYSJ/864-1021---------------------FDTFP.TSKPGDVV---------------------------------------------
Q9LZE5_ARATH/588-744---------------------FDSFPSSVSDVNIL---------------------------------------------
Q69T22_ORYSJ/477-632---------------------FDTFP.TSRQQDVV---------------------------------------------
Q9FI32_ARATH/881-1036---------------------FDTFP.TSRSQELV---------------------------------------------
O49435_ARATH/618-774---------------------FDVFP.SSKSGDVL---------------------------------------------
Q9M366_ARATH/632-795---------------------FDSFPSSENDLNIL---------------------------------------------
Q9SS68_ARATH/861-1017---------------------FDGFP.TTRQPEVV---------------------------------------------
Q6EUH5_ORYSJ/624-779---------------------FDEFP.TARPPEVV---------------------------------------------
O64492_ARATH/857-1012---------------------FDTFP.TSRGFDVV---------------------------------------------
F6HMN5_VITVI/841-996---------------------FDSFP.TIKSIDQV---------------------------------------------
F6I605_VITVI/863-1018---------------------FDSFP.TSRGSELV---------------------------------------------
Q6K6B6_ORYSJ/845-999---------------------FDTFP.SSRG.DVV---------------------------------------------
Q7XR21_ORYSJ/659-814---------------------ADTFP.TSRPDGVV---------------------------------------------
Q7XZZ4_ORYSJ/899-1054---------------------FDGLP.SARPADVV---------------------------------------------
Q84TJ7_ARATH/856-1011---------------------FDTFP.TTRNPDMV---------------------------------------------
Q8RXU9_ARATH/851-1006---------------------FDTFP.TVRAPDIV---------------------------------------------
Q9FL59_ARATH/639-794---------------------FDTFP.TSKGQDVV---------------------------------------------
Q9SKA3_ARATH/874-1029---------------------FDTFP.TSRPADIV---------------------------------------------

PF06398

Q758I9_ASHGO/63-412......................GANPIPAAGPALKEPDLPR.......................................
B0YCC5_ASPFC/114-487................RQHQKSVSEGSSHQHETLD.............................................
A3GFP1_PICST/23-380...........................FDEKPTID.............................................
Q6BWT4_DEBHA/130-546SMFSKKPVSASKLKDGDVNERIQKKDKTRHVKSQM.............................................
Q6BIC3_DEBHA/22-384...........................FNEKPTID.............................................
A3GHG6_PICST/131-541FSGSEESSDVLQISPSEVISETSV.STDDSKKPIAKS...........................................
Q0UCD7_PHANO/96-443....................DADLWQGSLSGPPLANARTIK.......................................
Q6BPA3_DEBHA/104-486...................MYFQRNPVPDDGPALRESEIPK.......................................
A5DFV2_PICGU/131-552............LEFLSSSDETSIVDDIVEDRTLRSAENDLDPVSSRSSDTSSAFTQAPISASALSTSSSDVNEKVKKDE
Q0V1J3_PHANO/49-353...........................GWTGEKGQ.............................................
A5DFP0_PICGU/28-381.........................QETNSKPTLD.............................................
Q6BYT2_DEBHA/63-426.........................EETNLHPTLD.............................................
A4GFC7_PICAN/70-420.........................KEQKKSPTLD.............................................
A7A1K7_YEAS7/58-403.........................GTLSSSPTLE.............................................
Q9UV60_YARLL/25-364.........................RRQTSEPSLD.............................................
Q6CSS7_KLULA/54-399.........................TTIKEKPTLD.............................................
Q59WI8_CANAL/24-381...........................YDEKPTIE.............................................
A3LMZ2_PICST/28-391.........................EETNLHPTLD.............................................
Q6CXM3_KLULA/59-410......................DHNPIPARGPPLKNPQLPG.......................................
A1CDA3_ASPCL/48-420................RHQKKASE.TSPHQHETLD.............................................
A7E6F1_SCLS1/107-489..................FTYS......TTGPPIAPAPTVK.......................................
A7TDR4_VANPO/106-455......................DSNPTPAQGPPLRKPAVPE.......................................
A7TKV5_VANPO/49-397.........................DIMSSQPTLD.............................................
Q6CN25_KLULA/177-532....GNTSKLQLRDSIHEFNYEDIDINDLRKANT.VR...........................................
Q6FJ63_CANGA/118-468......................DTNRVPAQGPPLRKAEVPK.......................................
A6ZZ68_YEAS7/115-465......................DNNQTPAQGPPLRRPEVPK.......................................
Q752S3_ASHGO/50-392.........................ETIRDRPTLD.............................................
N1P6V1_YEASC/26-408......................IASLRDTEPPTLD.............................................
A0A023ZM32_YEASX/50-394.........................ETMASCPSLD.............................................
Q6FJI4_CANGA/13-429......................YYNISTSEPPTVD.............................................
A4GFD2_PICAN/121-493.....................QNRNPVPADGPSVSHVDVPR.......................................
A4GFN5_PENCH/56-430................HRTKVAPD.SSLRHQKSLD.............................................
A2R1B9_ASPNC/54-425...............QGHQRAASE.TFPHRHETLD.............................................
A2QGY9_ASPNC/84-515.................TPYYS......YEGPALAPAKTIK.......................................
M9MW28_ASHG1/185-541....GKPASWQSHDDVQEFDYNNLHTDTEEWERALHIK..........................................
Q2UTA0_ASPOR/52-419...............PGHQRAPSE.SSLRHHDSLD.............................................
A7TEV3_VANPO/152-511....GPSNAWYPNNTLVESLNELQSGDSGATSNFSDTNS.........................................
A5DUM8_LODEL/24-379...........................YEEKPTIE.............................................
PEX32_SCHPO/1-480MSGFQMLQRRWSQPKTTTLKTEVKEQQASQSPSVEGENEPAGVKSNEATKPSVT................EEKEKNAEQN
F2Z6I0_YARLI/178-534..............EFDMAADDDTSIRAAQIKRIKAAE..........................................
A4GFD3_PICAN/18-342..........................SETAPPTIE.............................................
Q0CPT8_ASPTN/42-419.............KTSDHQRGPSD.GSLYHHDSLD.............................................
Q6FXX0_CANGA/58-376.........................ESPQDVPILE.............................................
C4YIY7_CANAW/52-403.........................KEANLHPTLD.............................................
G2WFM3_YEASK/201-569....GKNEYSYGQQFFSKSFMDTLESRNQEIDEISELDKRTEN.....................................
A5DUZ7_LODEL/104-459.........................EEASLRPTLD.............................................
A7EH28_SCLS1/61-453..............KKGHKRVESEMTNTKHQKTLD.............................................
Q5ANG0_CANAL/154-573.....PETSIVEDLINEEYLQAS...DEVASSTYSISEETSEVTVSSSMPTD....................SESPKKDD
Q6FR12_CANGA/140-535......HGGKKTNNVLLPSNENDCNGEQENEADLGTSDDCNGTSDENVVISP...................AAAKIDKNI
A5DZV8_LODEL/165-601.....EETSIVEDLVDTEYLKEDADIADVNSTSYTMSEAESDNTKASTAVSVSSQG...........GTESSEKLDKKKE
Q2GTD2_CHAGB/75-535KAANGSAGAGGASGHARNKGSISEVTNTRHQKTLD.............................................
Q6FTU9_CANGA/51-394.........................DTMMSCPSLD.............................................

PF08372

Q8S1F8_ORYSJ/928-1080--------RARYERLR---------------TLAGRVQRVMGDVAAQGERVQALVS----WR..DPRASRIFVGVCLAVA
Q5TKJ0_ORYSJ/649-804--------RMRYDRLR---------------SVGGRVQTVVGDLATQGERAHALLS----WR..DPRATAIFIFLSLVVA
Q9FJG3_ARATH/893-1049--------RLRYDKLR---------------NVGARVQTILGEVAAQGEKMQALVT----WR..DPRATGIFVGLCFFVA
Q8H2Q5_ORYSJ/856-1011--------RMRYDRLR---------------HVAGRIQTVVGDIATQGERLQSLLS----WR..DPRATSMFLLFCLLTA
Q0D8E3_ORYSJ/881-1037--------RARYDRAR---------------MVGARLQAMVGDVATQAERLQALVS----WR..DPRATGVFVALCVFVA
Q9M2D4_ARATH/816-972--------KMRYERLR---------------SIASRAQTVVGDIAGQGERVQALLS----WR..DPRATSIFMVLCLVST
Q60EW9_ORYSJ/619-774--------RMRYDRLR---------------SVAGRIQTVVGDLATQGERLQSLLS----WR..DPRATALFVTFCFVAA
Q7XKA3_ORYSJ/864-1021--------RMRYDRLR---------------SVAGRVQTVVGDLATQGERAQALLS----WR..DPRATSIFVLLSLIIA
Q9LZE5_ARATH/588-744--------RMRYDRIR---------------MVCQRPMILLGDAASQGERLYALLT----FNGDDQLASFYCWLICVLVA
Q69T22_ORYSJ/477-632--------YMRYDRLR---------------SVAGRIQTVVGDMATQGERLQSLLG----WR..DPRATCLFVVFCLVAA
Q9FI32_ARATH/881-1036--------RLRYDRLR---------------SVAGRIQTVVGDIAAQGERIQSLLS----WR..DPRATSLFILFCLAAS
O49435_ARATH/618-774--------KRRYDRLR---------------GIAGRMMIVLGDLATQGERVKSLLS----WR..DPRATSLFLTFCFVSC
Q9M366_ARATH/632-795--------RMRYDRLR---------------KIMENVMLLMGDAATQGERLLAAFT----L.....LERPFVLIILLALC
Q9SS68_ARATH/861-1017--------RIRYDRLR---------------ALAGRAQTLLGDVAAQGERVEALFN----WR..DPRATCIFVVFCLFAS
Q6EUH5_ORYSJ/624-779--------RMRYDKLR---------------SLNARIQEIVGDIATHAERARCVMT----WR..DPRATGLYLLGCLCLA
O64492_ARATH/857-1012--------RMRYDRVR---------------SIAGRVQTVVGDMASQGERVQALLS----WR..DPRATFLFLMFCLLAA
F6HMN5_VITVI/841-996--------RQRYDRLR---------------ILAGRAQTLLGDMAAQGERLEALFN----WR..DPRATGLFVVFCLVAS
F6I605_VITVI/863-1018--------RMRYDRLR---------------SVAGRIQTVVGDVATQGERFQALLS----WR..DPRATTIFLVFCLLVA
Q6K6B6_ORYSJ/845-999--------RFRYDRLR---------------SVAGRVQTVVGDIATQGERMQALLS----WR..DPRATVLFSIACVLAA
Q7XR21_ORYSJ/659-814--------RARYDRLR---------------TVAGRIQAVVSDVATQGERVRSLLA----WR..DPRATAVFTAACLAAA
Q7XZZ4_ORYSJ/899-1054--------RMRYDRLR---------------AVAGRAQTLLGDVAAQGERIEALLS----WR..DPRATAVFAVVCLLAA
Q84TJ7_ARATH/856-1011--------RLRYDRLR---------------SVAGRIQTVIGDLATQGERFQALLS----WR..DPRATAIFVILCFIAA
Q8RXU9_ARATH/851-1006--------KMRYDRLR---------------SVAGKVQSVAGDIAAQGERVQALLS----WR..DPRATAIFVTFCFIIA
Q9FL59_ARATH/639-794--------KMRYDRLR---------------SVAGRIQMVVGDIATQGERFQALLS----WR..DPRATCLFVIFCLVAA
Q9SKA3_ARATH/874-1029--------RMRYDRLR---------------SVGGRVQTVVGDLATQGERIQALLS----WR..DPRATALFIVFALIWA

PF06398

Q758I9_ASHGO/63-412..PVPELSKEFILNLT...............DLQNHMVLYVVCYDFITGLLAKFAF....FA--DENVSAAAFVGLLVLG
B0YCC5_ASPFC/114-487.........EIVETLR...............TFTTRCNILLEPLLELTDFLSTQRTATSATT--RPALTTMFIRILFVTP
A3GFP1_PICST/23-380.........EILHTLH...............NITIRFDMLLRPMKHIP............FK--FKNYVKLLVMSALLTP
Q6BWT4_DEBHA/130-546.........TLFINMR...............DLQNLTTDVLNGINGAEKFWYETAG....FK--DERLSTFIFYGVIAAT
Q6BIC3_DEBHA/22-384.........EVLHTLH...............NITIRFEMLLRPIQHFP............MK--KRNFVKAFIMTFLLTP
A3GHG6_PICST/131-541.......QLALLINMR...............DLQNLTTDLLNGMDLAEKSWFETFG....FK--DEHLSTFIFYGVAAAT
Q0UCD7_PHANO/96-443..PAPEFSKDFFRNMR...............DLQNCMEDFSTIHDAVLAFLTPLTN....FS--NENLSSMLYILLLLLS
Q6BPA3_DEBHA/104-486..PVPEFSNEFILNLT...............DLQNHMLLYVVTYDLILWGTKEFLF....YK--DENISSVVFLGLLILG
A5DFV2_PICGU/131-552KARYVKSQMKLLMNMR...............DLQNLTTDLLQGFDAAEVFWYQTAG....FK--DERLSTFMFYGVILAT
Q0V1J3_PHANO/49-353.........KVHK....................RAESESDIKHHKSLE..............--..DIVDMSL.......
A5DFP0_PICGU/28-381.........DVVQALT...............TTCIKADMLLDPITSLA............LS--AHDIKRLLFTTVFLTP
Q6BYT2_DEBHA/63-426.........DVVQALT...............TTCIKADMLLNPITSLS............LT--AYDIKRLLFTTVFLTP
A4GFC7_PICAN/70-420.........DVVHCLT...............TVSVRADMLLVPVSSLN............LT--SADLRRLLFTSIFLSP
A7A1K7_YEAS7/58-403.........DIALLMN...............RVSLKSDILLSPMVNLG..............--TQDIQRLLYTTVILSP
Q9UV60_YARLL/25-364.........AIVHTLT...............NVTTKANLLLLPITSLS............LT--PRDVTRLAFTTLFLSP
Q6CSS7_KLULA/54-399.........DIVHIIS...............CVYTKADLLLSPLSVWT..............--GNDIKRILLTMAFLSP
Q59WI8_CANAL/24-381.........EVLYTLH...............NITIRCEMLLRPIKHVP............IQ--RKHFIKLVIASIFLTP
A3LMZ2_PICST/28-391.........DVVQALT...............ATCIKADMLLNPITSLS............LT--AYDIKRLLFTTIFLTP
Q6CXM3_KLULA/59-410..PVPEFSKEFILNLT...............DLQNHMTLYVMAYDFVSNFLAKFAY....FK--NENVSSAVFLGLLLFS
A1CDA3_ASPCL/48-420.........EIVETLR...............TFTTRCNILLDPLLELTEFMSTQRTATSATT--KPALTTLFIRILFVTP
A7E6F1_SCLS1/107-489..PVKELSKDFFRNMR...............DLQNCMEDFSQLHDKIISLISPSTN....FS--NEPLSSTLFLFLVVTA
A7TDR4_VANPO/106-455..PASELSQEFVLNLT...............DLQNHMLIYVRVYDFFAKILGSFAF....FT--DEAVSAMAFLILLSFA
A7TKV5_VANPO/49-397.........DIVLMMD...............KVTRKFDMFLSPITILS..............--AQDIRRLLSTTIFLSP
Q6CN25_KLULA/177-532......QSMEFVVNLR...............DLQNLMSTLVSVIDKMEKFMYGTAG....FK--NEQYSTVVFLSCFVVL
Q6FJ63_CANGA/118-468..PVPEFSQEFVLNLT...............DLQNHMLLYVQLYDSIIYVLQKFAF....FV--NEQISAVAFVLLMILA
A6ZZ68_YEAS7/115-465..PVPELSQEFVLNLT...............DLQNHMLLYVKFYDFTLLILQKFAF....FT--NEAISSFYFIVLLIIA
Q752S3_ASHGO/50-392.........DVVQMMS...............RVVAKSDLLLSPVSVLS..............--GNDIKRLLLTMVFLSP
N1P6V1_YEASC/26-408.........EIVVLLE...............SVLDKLEVLRNELNVWKKLKLSFDGVNKECS--GKRLFCRLF..LFGTI
A0A023ZM32_YEASX/50-394.........DIIHVMD...............RVSMKSSAVLSPITILS..............--AQDVRRLLFTIAFLSP
Q6FJI4_CANGA/13-429.........DIILNLE...............SLLDKLETLRNEIMFRRWFKKPI......SK--VKMLQIFVRLVLVLTP
A4GFD2_PICAN/121-493..PVPELSREFVLNFT...............DLQNHMLLYVMSYDFVTSLIVKYLY....FK--DENITIFIFVALLTSG
A4GFN5_PENCH/56-430.........EIVETLR...............IFTTRCNILLEPLLDLTDFLSTQRTPTSATT--KPALTALFIRILLVTP
A2R1B9_ASPNC/54-425.........EIVETLR...............TFTTRCNILLEPLVEFTDFLSTQRTATSATT--RPALTTLFFRILFVTP
A2QGY9_ASPNC/84-515..PASETSKDFFRNMR...............DLQNCMADYSDVHDATVSAFAPLTN....FS--NEKLSSTVFLTCTLMA
M9MW28_ASHG1/185-541......QTMEFIVNLR...............DLQNLMTASVKGIECAEKFVYGDAG....FK--NEHHSTVLFLSGLLVV
Q2UTA0_ASPOR/52-419.........EIVETMR...............AFTTRCNMLLEPFLELTDFLSTQRTATSATT--RPALTTLFFRILFVTP
A7TEV3_VANPO/152-511....VSHSMAVVMNLR...............DVQNITTSLVQVSQATDKFIYGAAG....FK--DERRSTILFFTCFLAT
A5DUM8_LODEL/24-379.........EVLYTLH...............NITVRSEMILRPIKKFP............FT--AKNFKRLFIVTTLLTP
PEX32_SCHPO/1-480KRRERLSISHIVTELAKKDEVSSESGSNEIVNAKLKNEQLDSNFTLLDAYLEPLVHL.HEYS--RRSNTLFFFYLPIVMS
F2Z6I0_YARLI/178-534.....KKPVDVKKSMK...............NFQNATTNLIKALDKLESFLSGPAG....FA--NESLSALIFLLIGFAM
A4GFD3_PICAN/18-342.........EIIDTLI...............NLQARFSYIVEPFSYFGS...........LS--SSDYFNLGFSLIAITP
Q0CPT8_ASPTN/42-419.........EIVESMR...............VFTTRCNILLEPLLELTDFLSTQRTATSATT--RPALTTLFFRILFVTP
Q6FXX0_CANGA/58-376.........DIVLKMN...............RVQYKFDKFIEPVITLK..............--EQDITKLLYVSMLISP
C4YIY7_CANAW/52-403.........DVVQALT...............STCVKADILLSPITSLS............LT--AYDIKRLIFTTLFLTP
G2WFM3_YEASK/201-569.TGELKQGMKVLINLR...............DMQNMTSGTLHVIEAINSFLRKSSS....FQ--NEECSTKRFFTGFLLI
A5DUZ7_LODEL/104-459.........DVVQALN...............ATCLKADMLLLPITSLS............LT--AYDIKRLLFTTVFLTP
A7EH28_SCLS1/61-453.........EIVETLK...............IFTSRCNVLLDPLLQLTDFLSTQRTATSATT--RPALTTLLIRILLVTP
Q5ANG0_CANAL/154-573VAKHRKSQIALLINLR...............DFQNLTTDILKGINNAEKFYYETGG....FK--DERLSTFIFYGVLLST
Q6FR12_CANGA/140-535STYNLNHGTKVVLTLR...............DMQNMTTGTVHLMDAIDKFKYGTAA....FV--DEYKSTSVFFTLLGSV
A5DZV8_LODEL/165-601VSKRRKRNLDLLVNLR...............DMQNSMTDLLKLIEEGETFYYETAG....FK--DERLSTFIFYGVLVAT
Q2GTD2_CHAGB/75-535.........EIVETLR...............EFTARCNILLEPLLELTDFLSTQRTPTSATT--RPALTTLFVRILLCIP
Q6FTU9_CANGA/51-394.........DIVHIMV...............RVSTKADIVLSPLTILN..............--SQDIQRLLFTSAFLSP

PF08372

Q8S1F8_ORYSJ/928-1080VALYAM----------------PS........KMVAVAGGFYYLRHP---------------------------------
Q5TKJ0_ORYSJ/649-804IVLYVT----------------PF........QVLLVIAMLYLLRHP---------------------------------
Q9FJG3_ARATH/893-1049LVLYLV----------------PT........KMVAMASGFYYFRHP---------------------------------
Q8H2Q5_ORYSJ/856-1011VILYVT----------------PF........QVIALCLGFFWMRHP---------------------------------
Q0D8E3_ORYSJ/881-1037MALYVV----------------PI........KVVAVVAGFYYLRHP---------------------------------
Q9M2D4_ARATH/816-972VVLYVV----------------PF........KVFVLLAGLYIMRPP---------------------------------
Q60EW9_ORYSJ/619-774IVLYVT----------------PF........RVVVFLAGLYTLRHP---------------------------------
Q7XKA3_ORYSJ/864-1021VVLYVT----------------PF........QVVAVVVGLYLLRHP---------------------------------
Q9LZE5_ARATH/588-744LCWYNI----------------PM........WLWSLYPIAYWLNFT---------------------------------
Q69T22_ORYSJ/477-632VVLYVT----------------PF........RVVALVAGLYLLRHP---------------------------------
Q9FI32_ARATH/881-1036VVLYAM----------------PF........KAIALASGLYYLRHP---------------------------------
O49435_ARATH/618-774GVICFV----------------SM........KLLLTFLAFYVMRHP---------------------------------
Q9M366_ARATH/632-795YCSMLV----------------VCLGWDLHVRKCLIFVFICYWVQLP---------------------------------
Q9SS68_ARATH/861-1017FLFYIV----------------PF........KVFLLGSGFYYIRHP---------------------------------
Q6EUH5_ORYSJ/624-779VITFSV----------------PF........QAVALLTGFYLMRHP---------------------------------
O64492_ARATH/857-1012VGFYTV----------------PV........KLTVAISGLYYLRPP---------------------------------
F6HMN5_VITVI/841-996LVFYTV----------------PF........RAFVLGWGFYYLRHP---------------------------------
F6I605_VITVI/863-1018LVLYIT----------------PF........QVLALVAGFYHMRHP---------------------------------
Q6K6B6_ORYSJ/845-999VIAYTI----------------PM........KVLVGLWGLYAMRPP---------------------------------
Q7XR21_ORYSJ/659-814VVAYAT----------------PP........RVVALVAGLYLLRHP---------------------------------
Q7XZZ4_ORYSJ/899-1054LVMYAV----------------PF........KLLLLAMGFYYLRHP---------------------------------
Q84TJ7_ARATH/856-1011IVFFIT----------------PI........QIVVALAGFFTMRHP---------------------------------
Q8RXU9_ARATH/851-1006MALYIT----------------PF........KLVALLSGYYFMRHP---------------------------------
Q9FL59_ARATH/639-794MILYVT----------------PF........KIIALAGGMFWMRHP---------------------------------
Q9SKA3_ARATH/874-1029VFIYVT----------------PF........QVIAIIIGLFMLRHP---------------------------------

PF06398

Q758I9_ASHGO/63-412VFNMLFIE....SLFRWIPL..KL--------LLLACGWGFLIMLHPSCRDACFD.................YISSEETR
B0YCC5_ASPFC/114-487IWIALTL.....PPFYIITT..RR--------VVMTIG.TIILTYHSRPARVSRVILWRSLT....VRRICSMITGLSFS
A3GFP1_PICST/23-380LHWFIV........SYIVPP..QK--------CVWFSG.VFILTYHSPWAFSIRRLLWRSVY....VRIAAVYLTGLDIK
Q6BWT4_DEBHA/130-546SIVLVF........GRFIPW..RL--------IFIQSGWAGLIVCHPNSKKYIMS.................IKKSKKAK
Q6BIC3_DEBHA/22-384IHVLLV........KYVIPP..QK--------VLWLTG.LFMLTYHSAWSFSIRRLLWRSVY....IRIFAFYVTGLNIK
A3GHG6_PICST/131-541SVVLFL........GQFIPW..RL--------IFIQSGWAGILLCHPKSKTFLVE.................LSNAKKAR
Q0UCD7_PHANO/96-443CTLFIS........AHLLPW..RL--------IFLAIGYTLTALGHPTIQDLLAT.................PENEKLLS
Q6BPA3_DEBHA/104-486LHNLFVLPKVVPILFWYLPI..RF--------MLVISIWAVAILFHPVVRNRLLN.................WMYNEETR
A5DFV2_PICGU/131-552SIILFL........GTFIPW..RL--------IFIQSGWAIVLVCHPRSKKYLKA.................LSENKKRK
Q0V1J3_PHANO/49-353........................--------...........SWHSRPARVTRTLMWRSRM....VRKTCAFLTGLDFG
A5DFP0_PICGU/28-381LYLIVT........LVVIPP..RT--------ILLVVG.VYLLTYHSVYMRVTRRIIWKLKI....ARLICFYLTGLDFQ
Q6BYT2_DEBHA/63-426LYLIVT........FLLVKP..RI--------ILLFTG.LHILTYHSSYSRVARKMLWKIKL....VRVLCFYLTGLDFS
A4GFC7_PICAN/70-420GYILVC........YLLFPP..KT--------LLLILV.IFFLTYHSSWSRVTRKLLWRSSI....VRAFCFYNTGLIFE
A7A1K7_YEAS7/58-403IYVMIT........WLLLPP..RS--------LMLMVG.MFLLTYHSPWSKVARRLLWKFKI....VRLLVFYVTGLDLG
Q9UV60_YARLL/25-364LYMFGA........YFFLGP..RK--------FLLTTG.VFFLTYHSMAARVTRAVIWKSKA....IRLVTFYLTGLDFS
Q6CSS7_KLULA/54-399VYVIVS........IFIFSS..QK--------LVLIAG.VYVLTYHSSWSVVTRRLLWKLKV....VRLLVFYITGLDLS
Q59WI8_CANAL/24-381LNFAVS........KTLIPP..QK--------YILFLG.LFLFTFHSPYSFAIRRLLWRSLY....VRIAILYITGLDIK
A3LMZ2_PICST/28-391VYLIVT........FLLIKP..RV--------LLLFSG.LFVLTYHSAYSRVTRRILWKIKL....ARLLVFYLTGLDFS
Q6CXM3_KLULA/59-410CINSLAID....SISSLIPW..KF--------IFLCAGWTFVISLHPKIRDTMFN.................LMYSEETR
A1CDA3_ASPCL/48-420IWIILTL.....PPFYLITT..RR--------VVMSIG.TIILTYHSRPARVSRVILWRSLT....VRRICSMITGLSFS
A7E6F1_SCLS1/107-489AFMFIA........SHLMPW..RF--------IFLTIGWTITSLGHPTIQRQMLTTH.......................
A7TDR4_VANPO/106-455LMNCLFID....TFVNYIPY..KH--------ILLFLGWAVMFSFHPINRDRFLG.................ILNSEETR
A7TKV5_VANPO/49-397IYVVIS........LFIFPP..RT--------LLLVGG.VYILTYQSPWSKVTRRILWKFKA....VRLFVFYLTGLDLG
Q6CN25_KLULA/177-532FLLWII........TPFINW..GL--------MASLLAWSIMTIIHPRVRPTVFG.................LLKKEQLD
Q6FJ63_CANGA/118-468VTNIIFID....VLVRIIPI..KL--------ILVATGWAFIIICHPKYRDNFFN.................KVNSEETR
A6ZZ68_YEAS7/115-465TLNFLYMD....KFIKLIPM..RP--------VLILLGWGFFIASHPSNREYLLT.................KLNSEETR
Q752S3_ASHGO/50-392IYVILT........LFVIPP..RK--------FVLVAG.VYVLTYHSSWSSVTRKLLWRFKL....VRLLAFYVTGLDLS
N1P6V1_YEASC/26-408FQIIIM........RYISPGTYTR--------FFIITG....LIYNTSSFQATLRLLWRFTA....VRNFY.YLGIESFK
A0A023ZM32_YEASX/50-394VYIFLT........VFVLSP..NY--------LMLIGG.LYVLTYHSKLIRRMRRYLWKFRV....VRLLVFFITGLDLG
Q6FJI4_CANGA/13-429VHYVLM........KVITVHNYSK--------LLILFA....LFYHSDWMQVVLRLCWRLLIVRRFYFRVFNYIFGDEYT
A4GFD2_PICAN/121-493ILLTLFGA...QVLSTMLPF.IKV--------TLSVGLWAATIAMHPNYRSSLLD.................MLYSEDTR
A4GFN5_PENCH/56-430VWIGLTL.....PPFYILTT..RR--------IVMAVG.TIVLTYHSRPARVSRVILWRSRA....VRRLCAAATGLSVA
A2R1B9_ASPNC/54-425IWIALTL.....PPLYLITT..RR--------VIMTLG.TIILTYHSRPARVSRVILWRSLT....IRRICSIITGLSFS
A2QGY9_ASPNC/84-515ALLFLT........AHLLPW..RL--------IFLVGGNAAILSMHPSFPDLVQSLA..............EDMLDNTAE
M9MW28_ASHG1/185-541MGLWII........APYINW..SL--------TSAAGAWAALILIHPRVLPMVTA.................YINDDQLE
Q2UTA0_ASPOR/52-419IWIALTL.....PPLHLITT..RR--------VILIIG.TIILTYHSRPARVSRVILWRSLT....VRRICSLITGLSFS
A7TEV3_VANPO/152-511GCLWAL........APYINW..SF--------FFSFNTWLILICIHPNIREHLLK.................LMESDKVE
A5DUM8_LODEL/24-379LQWVLV........KTVLPP..QK--------FLLIAG.IFVFSFNSPHAVAIRKLLWRSLY....LRVLVIYITGVNFK
PEX32_SCHPO/1-480ILIFCL............PT..QA--------LFIVLS.SVFLAWHSPPLQAVLFCIRRISF...FNLLYEKFVIGKTKE
F2Z6I0_YARLI/178-534IGTFFL........SAFIPW..KA--------LQIGAGWGVIIAGHPTLLKRIVA.................ILDELEKS
A4GFD3_PICAN/18-342CYIWLM........TRIFTV..RS--------FLLVFG.VACLSFYSSWSVATRHLLWRSIV....IRKILTFTTGLKFS
Q0CPT8_ASPTN/42-419IWIALTL.....PPLRLITT..RR--------VVLILG.TIILTYHSRPARVARVILWRSLT....IRRICSMITGLSFS
Q6FXX0_CANGA/58-376IYVLLG........CLLGNEFIRF--------NIASFG.VLILTYHSPWCKTLRRLLWKFKF....VRTVIYRVMGIQTY
C4YIY7_CANAW/52-403VYLVVT........FLLIKP..RT--------ILLLTG.VYLLTYHSSYSIVTRRILWKLKI....VRLIFFYLTGLDLS
G2WFM3_YEASK/201-569VFLKIL........SPFVNW..SY--------VCSIFAWCLLIYMHPRAHPKIIS.................FFKTGTMG
A5DUZ7_LODEL/104-459IYLVLT........FLFIRP..RT--------ILLFTG.VFLMTYHSSYSIVIRRILWQIKL....VRLICFYLTGLDLS
A7EH28_SCLS1/61-453IWIILTL.....PPIQVITT..KR--------IALVTG.TIFLTWHSRPNRIARTILWRSSL....VRRICTAITGLHLT
Q5ANG0_CANAL/154-573FGILFV........GKYVPW..RL--------IFIQGGWTGAILCHPNCKKFLVD.................ASKARKAR
Q6FR12_CANGA/140-535ILLVLL........SRFITW..SL--------TISLSAWIGLLSIHPKVHPYVKS..A............KNIMKKPKMK
A5DZV8_LODEL/165-601FGAIFF........GQFIPW..RL--------IFIQSGWIGLTLCHPKVKKFLVD.................FGAAKKRR
Q2GTD2_CHAGB/75-535AWILLTL.....PPLRIITT..RR--------VILILG.TILLTWHARVIRVTRVILWRSAT....LRRVLSLVTGLPFE
Q6FTU9_CANGA/51-394IYILVT........KLIFYP..RT--------LVLFAG.VYVLTYHSSWSKAFRRSLWNFRL....IRLLMFYITGLDMG

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------------------------------------------
Q5TKJ0_ORYSJ/649-804--------------------------------------------------------------------------------
Q9FJG3_ARATH/893-1049--------------------------------------------------------------------------------
Q8H2Q5_ORYSJ/856-1011--------------------------------------------------------------------------------
Q0D8E3_ORYSJ/881-1037--------------------------------------------------------------------------------
Q9M2D4_ARATH/816-972--------------------------------------------------------------------------------
Q60EW9_ORYSJ/619-774--------------------------------------------------------------------------------
Q7XKA3_ORYSJ/864-1021--------------------------------------------------------------------------------
Q9LZE5_ARATH/588-744--------------------------------------------------------------------------------
Q69T22_ORYSJ/477-632--------------------------------------------------------------------------------
Q9FI32_ARATH/881-1036--------------------------------------------------------------------------------
O49435_ARATH/618-774--------------------------------------------------------------------------------
Q9M366_ARATH/632-795--------------------------------------------------------------------------------
Q9SS68_ARATH/861-1017--------------------------------------------------------------------------------
Q6EUH5_ORYSJ/624-779--------------------------------------------------------------------------------
O64492_ARATH/857-1012--------------------------------------------------------------------------------
F6HMN5_VITVI/841-996--------------------------------------------------------------------------------
F6I605_VITVI/863-1018--------------------------------------------------------------------------------
Q6K6B6_ORYSJ/845-999--------------------------------------------------------------------------------
Q7XR21_ORYSJ/659-814--------------------------------------------------------------------------------
Q7XZZ4_ORYSJ/899-1054--------------------------------------------------------------------------------
Q84TJ7_ARATH/856-1011--------------------------------------------------------------------------------
Q8RXU9_ARATH/851-1006--------------------------------------------------------------------------------
Q9FL59_ARATH/639-794--------------------------------------------------------------------------------
Q9SKA3_ARATH/874-1029--------------------------------------------------------------------------------

PF06398

Q758I9_ASHGO/63-412............................................................LKVLTMTNKIEQLIND..YW
B0YCC5_ASPFC/114-487...........................................................LNANQSQSLWAQSHGHA..AS
A3GFP1_PICST/23-380IT....................................K..................KYNPADFQSISRVQSPTSS..DI
Q6BWT4_DEBHA/130-546K..........................................................VKDVKESKEKEGRFERH..DI
Q6BIC3_DEBHA/22-384LD.......................................................RTNQNHFMNISIIHSPNTS..DI
A3GHG6_PICST/131-541AA.......................................................KAPQPEEIIESEVKKFETN..DI
Q0UCD7_PHANO/96-443............................................................DTEHEGRSFLLTISKA..DI
Q6BPA3_DEBHA/104-486............................................................LYFVNLDNQIEEFLLD..LI
A5DFV2_PICGU/131-552AA....................................A..................KPKKVKEEKDEDGPAVYDR.NDI
Q0V1J3_PHANO/49-353DT.......................................................ISADKKGAPPLPPRKKSTQ..EV
A5DFP0_PICGU/28-381............................................................NRN.....HIFAAAFA..KV
Q6BYT2_DEBHA/63-426...........................................................QARNHSLFAAAFAKVHKNAGH
A4GFC7_PICAN/70-420............................................................SGNNEKSSL.FKTAMNKTNK
A7A1K7_YEAS7/58-403............................................................GINKDQ.GI.FATVQKQVKK
Q9UV60_YARLL/25-364............................................................NTKRNLGAFGFTQSPLSVQS
Q6CSS7_KLULA/54-399............................................................GVNKHQGGI.FAAVHKKVKN
Q59WI8_CANAL/24-381IR....................................K..................DYDPNDYQTVSRVASASNSDAEG
A3LMZ2_PICST/28-391............................................................QAKN..SSL.FAAAFAKVQK
Q6CXM3_KLULA/59-410............................................................LRILTKMNHIERIIND..KF
A1CDA3_ASPCL/48-420LDA...................................N.K................SQS.......LWAQSHG....HA
A7E6F1_SCLS1/107-489TA....................................I.V................QPRARPLQ..TNLETFIAH..NI
A7TDR4_VANPO/106-455............................................................LRVLTVTNKLEELMNN..EL
A7TKV5_VANPO/49-397............................................................GINKNQGII..AAVHKQVRK
Q6CN25_KLULA/177-532K.........................................................GK.......EALRRTERY..DI
Q6FJ63_CANGA/118-468............................................................LRLLKLTSSYDDWVND..NL
A6ZZ68_YEAS7/115-465............................................................LKTLTISTNLESKILQ..HL
Q752S3_ASHGO/50-392............................................................GVNKYQGGI.FAAVHKKVKK
N1P6V1_YEASC/26-408ISSFLPK...........................HLKME.QIIPL.......SQGRAITVPLVEVLPKLLRDKKGD..DH
A0A023ZM32_YEASX/50-394............................................................GPDNNR.RL.FASVNKKIRS
Q6FJI4_CANGA/13-429LLGNNSKFGLKTLNLQHIMHLTSNCYLQIPLPLNAVTKMKENHLLEILLLRYLNKNSKALENDDNIIKEFDSKTTA..DV
A4GFD2_PICAN/121-493............................................................LRLLTMSNRLELWLNK..EL
A4GFN5_PENCH/56-430DTL...................................S.S................PQK.......APAQAQGEK..QG
A2R1B9_ASPNC/54-425STV...................................D.K................AQS.......LLMQSQG....HA
A2QGY9_ASPNC/84-515EGPAADKK........................GQESFNL.GGLAMP.....ASPSKAVSLMES...........LA..NI
M9MW28_ASHG1/185-541K.........................................................GK.......VVIENVERY..DI
Q2UTA0_ASPOR/52-419LNV...................................D.K................TPS.......TRTQSHG....HA
A7TEV3_VANPO/152-511E.........................................................GR.......KALEKKERY..DV
A5DUM8_LODEL/24-379VN....................................R..................AFESQEALVISSSSASEGDESEI
PEX32_SCHPO/1-480PAKPVPQP.........................SSNEPP.APSAEN......KQPSVSSPEKKESPATHLLKVIGS..SP
F2Z6I0_YARLI/178-534DD.......................................................EEKPKESPVIAILQKVQKK..EF
A4GFD3_PICAN/18-342........................................................................LVDKNIEL
Q0CPT8_ASPTN/42-419LTV...................................D.K................SKS.......LLTQSHG....HA
Q6FXX0_CANGA/58-376............................................................EVQEPKINL...........
C4YIY7_CANAW/52-403............................................................ETKN..HSL.FAAAFAKV..
G2WFM3_YEASK/201-569K.........................................................EY.......KNLKKREHQALNM
A5DUZ7_LODEL/104-459............................................................QTRN..HSL.FAAAFAKVQS
A7EH28_SCLS1/61-453DELS................................PAA.SGN............DGKPP.......LPPRTSSSS..AD
Q5ANG0_CANAL/154-573AAIEKAK..........................KEEKSV.PEIII.......EEADDTVTQFD...........RN..DI
Q6FR12_CANGA/140-535PE.......................................................NSPQDVAVVMEDNISGEDYNRNI
A5DZV8_LODEL/165-601SKVIQRNA........................EAAQKAD.PTAETTS....NKGLKQLLTQLD...........RN..DI
Q2GTD2_CHAGB/75-535GTTE................................AAS.ATT............AATKSATSSAAMSNAKTPSTPGGAK
Q6FTU9_CANGA/51-394............................................................GINKHY.TI.FTSVNDQIKK

PF08372

Q8S1F8_ORYSJ/928-1080---------------------------------------------------------MFRD.PMPPAAVNFF--------
Q5TKJ0_ORYSJ/649-804---------------------------------------------------------RFRS.RMPSVPFNFY--------
Q9FJG3_ARATH/893-1049---------------------------------------------------------IFRD.RKPSPVLNFF--------
Q8H2Q5_ORYSJ/856-1011---------------------------------------------------------RFRH.KVPSAPVNFF--------
Q0D8E3_ORYSJ/881-1037---------------------------------------------------------MFRD.RMPAPAINFF--------
Q9M2D4_ARATH/816-972---------------------------------------------------------RFRG.KTPPGPINFF--------
Q60EW9_ORYSJ/619-774---------------------------------------------------------RFRH.KMPSVPLNFF--------
Q7XKA3_ORYSJ/864-1021---------------------------------------------------------RFRS.KQPSVPFNFY--------
Q9LZE5_ARATH/588-744---------------------------------------------------------PLRN.DMPCGVSNFF--------
Q69T22_ORYSJ/477-632---------------------------------------------------------RFRS.RLPAVPSNFF--------
Q9FI32_ARATH/881-1036---------------------------------------------------------KFRS.KLPSLPSNFF--------
O49435_ARATH/618-774---------------------------------------------------------RVRVFDIPSIPQNFF--------
Q9M366_ARATH/632-795---------------------------------------------------------WFRN.NLPDGSLNFF--------
Q9SS68_ARATH/861-1017---------------------------------------------------------RFRD.DMPSVPVNFF--------
Q6EUH5_ORYSJ/624-779---------------------------------------------------------ILRQ.RLPDVVANFF--------
O64492_ARATH/857-1012---------------------------------------------------------RFRR.KLPSRGLSFF--------
F6HMN5_VITVI/841-996---------------------------------------------------------RFRG.DMPSVPFNFF--------
F6I605_VITVI/863-1018---------------------------------------------------------RFRG.RLPSAPINFF--------
Q6K6B6_ORYSJ/845-999---------------------------------------------------------RFRS.RMPSPLMNFF--------
Q7XR21_ORYSJ/659-814---------------------------------------------------------RFRS.RMPSAAGNFF--------
Q7XZZ4_ORYSJ/899-1054---------------------------------------------------------RFRG.DMPSAGFNFF--------
Q84TJ7_ARATH/856-1011---------------------------------------------------------RFRH.RLPSVPVNFF--------
Q8RXU9_ARATH/851-1006---------------------------------------------------------KLRH.RIPSAPVNFF--------
Q9FL59_ARATH/639-794---------------------------------------------------------KFRS.KMPSAPSNFF--------
Q9SKA3_ARATH/874-1029---------------------------------------------------------RFRS.RMPSVPANFF--------

PF06398

Q758I9_ASHGO/63-412D......YCEPRET.R.......................QAAIFEIQKFDRRTK...EWRTAGFSSDDYTLL.......S
B0YCC5_ASPFC/114-487I......ATRRRGD.S..................SGVRFTFVLYENQRRW.LGI...GWTYSLFPSERAAWT.......D
A3GFP1_PICST/23-380EELNNVPLLTDFKI.LKKSM.........VSPTQLKQIILFELLENERRW.IGL...GWSNLLLPNERANFV.......H
Q6BWT4_DEBHA/130-546I......IDDSAEI.R.......................IVEVFELQNKNMSNN...QWSFHRYTSNMFDIK.......N
Q6BIC3_DEBHA/22-384E.....DFDENQKP.LQLLGDFKILKKTVISPTQLRQVVTFEILENERRW.VGV...GWSKFVLPGDRPSYC.......Y
A3GHG6_PICST/131-541I......VDDAPER.R.......................IVEIFELQKKSILHE...KWTFYSYSGNIFDTK.......K
Q0UCD7_PHANO/96-443E......LEPTQES.R.......................EVEIFELQHRALHDEH.GEYEGFMFSSSPYSPL.......S
Q6BPA3_DEBHA/104-486V......KVDDEQV.K...................IETKQVEIFELQRYDKTSK...IWELNGFTNDFYTIN.......S
A5DFV2_PICGU/131-552I......IDDAPEV.R.......................ICEIFELQVKSLTKN...EWSFYCFTSSAFDVK.......N
Q0V1J3_PHANO/49-353A......ASLAAKR.RP...............ESTGVRFTFSIYENQRRW.LGI...GWTSSMLAYERASWT.......D
A5DFP0_PICGU/28-381Q......KGNTNNG.LG..............DPNKPVRFAYVVYENQRRW.LGI...GWTANLLSYERAPWT.......D
Q6BYT2_DEBHA/63-426S......LDLSSEA.S.................NKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTPWT.......D
A4GFC7_PICAN/70-420K......LKE...V.TRKA..........GGKHSGPVRFTYVLYENQRRW.LGV...GWTPNLLSYERTPWT.......D
A7A1K7_YEAS7/58-403L......AS....T.ENSNG.........VLSDSKPIRFTYVLYENQRRW.LGI...GWKPSMLSYERTPWT.......D
Q9UV60_YARLL/25-364................K...............DGKPVRFTYVLYENQRRW.LGI...GWTANLLAYERTPWT.......D
Q6CSS7_KLULA/54-399L......SS....S.SIGT..........DADDGKPIRFTYVLYENQRRW.LGI...GWTANMLTYERSSWT.......D
Q59WI8_CANAL/24-381LGG..IPVLSDFKI.IKKRV.........VSPTQLKQTVVFEVLENERRW.LGV...GWSSLLYPSERPNFC.......Y
A3LMZ2_PICST/28-391N......AGFDNKS.SEG............VSSNKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTPWT.......D
Q6CXM3_KLULA/59-410D......SYEPRER.R.......................EASIFELQRFNAEEK...SWELVGYSTDEYALF.......S
A1CDA3_ASPCL/48-420..........ATIA.TRR............RGDSSGVRFTFVIYENQRRW.LGI...GWTYSLFPSERAPWT.......D
A7E6F1_SCLS1/107-489I......LDSSPET.R.......................EVEIFELQKLSRAG....EWEHWLFSTSPYDPL.......S
A7TDR4_VANPO/106-455K......TVEASER.K.......................LVAVYEIQKLG.EKS...EWVPIGFSNDSYTLF.......S
A7TKV5_VANPO/49-397L......SSPTQTD.VSQP..........GAMPNKTIRFTYVLYENQRRW.IGI...GWTSSMLSYERTPWT.......D
Q6CN25_KLULA/177-532L......LDEPVET.R.......................WVEVFEIQMQGITEQ...EWSPYMYSTQVFDKS.......D
Q6FJ63_CANGA/118-468G......YVEARET.K.......................VVIIYEMQKYKDKHK...EWHPVGYANDDFTLF.......S
A6ZZ68_YEAS7/115-465K......LIEAREH.R.......................LVMIFEIQKYLPEYK...EWRPVGFSDDDYSLF.......S
Q752S3_ASHGO/50-392L......SG.......TNG...........ADDGKPIRFTYVLYENQRRW.LAI...GWTSNMLSYERSSWT.......D
N1P6V1_YEASC/26-408I......HILQLLL.NEQKD.........NFGNEDLKILEIEVYENQRRWYQNK...NWSTKLLPYERQNYCIEI.KNTD
A0A023ZM32_YEASX/50-394F......VW....N.EVGN..........TSNTKKTVLFKVALFENQRRW.LGI...GWTSTMLSYERASWT.......D
Q6FJI4_CANGA/13-429V......PKENTTD.ESATT.........SYNSSKVKIKEIVVFENQRKWKYK....GWISKMLPYERPQFTTNCNNKYN
A4GFD2_PICAN/121-493N......LREQKEV.K.......................ETEIFELQHLNPETH...NWQLICFSSDPYPAN.......S
A4GFN5_PENCH/56-430..........LNIS.TRR............RGNNAGVRFTFVVYENQRRW.LGI...GWTYSLFPAERDPWT.......D
A2R1B9_ASPNC/54-425..........MSIA.TRR............RGDSSGVRFTFVISENQRRW.LGI...GWTYSLFPSERAAWT.......D
A2QGY9_ASPNC/84-515S......LDSSPEE.R.......................EVEVFEIQYRSLAPYSESQWEHFLFSPMPYDPL.......S
M9MW28_ASHG1/185-541L......LDEKPEE.R.......................YLELFEIYKQRLTSD...EWDFYLLSSYAFDPT.......D
Q2UTA0_ASPOR/52-419..........ASVA.TRR............RGESSGVRFTFILYENQRRW.LGI...GWTYSLFPSERAAWT.......D
A7TEV3_VANPO/152-511I......LDEKPEV.K.......................HVEIFEILEQGITPH...HWKFYKFSNQVFDPH.......D
A5DUM8_LODEL/24-379LT....PVLSNFKV.VKKKM.........ISPTRLKQSVVFEVLENERRW.FGI...GWSSMLYPNERPNFC.......F
PEX32_SCHPO/1-480Y......VVHSNHT.NNTLT.........DKESSDPTEKCLYLIEHQRYW.VGV...GWLNRTLPTDPPNFT.......N
F2Z6I0_YARLI/178-534I......NDEPPQG.E.......................TVEIFELQRQGLTPR...QWDSWVFTSLVYDLG.......S
A4GFD3_PICAN/18-342T......VLNDFQI..S..............NIGTGKTVEFHILQNQRRW.LGV...GWSNTLLPFERGPFT.......T
Q0CPT8_ASPTN/42-419..........ASIA.TRR............RGDSSGVRFTFVLYENQRRW.LGI...GWTYSLFPSERAAWT.......D
Q6FXX0_CANGA/58-376.................................DKKYKFTYVLYENQRRW.LGI...GWKSSMLSYERTPWT.......D
C4YIY7_CANAW/52-403.............S.SSGT..........SSKSNKPVRFTYVIYENQRKW.LGI...GWTSNLLSYERTPWT.......D
G2WFM3_YEASK/201-569I......FDEQPET.K.......................FIEIFEIYKKALLPN...DWKFFRYSNRIFDPQ.......D
A5DUZ7_LODEL/104-459N............S.QDGL..........GRGSTKPVRFTYVIYENQRRW.LGI...GWTSNLLSYERTAWT.......D
A7EH28_SCLS1/61-453A......TLVADAA.ITR............RLEAPGVKFTFIIYENQRRW.VGL...GWTTSLFAYERSAWT.......D
Q5ANG0_CANAL/154-573I......VDDSPEA.R.......................TVEIYELQIKSILKH...SWTFYRYSTTIYDKN.......N
Q6FR12_CANGA/140-535I......LDEPPDV.K.......................YVEVYEIYKRGLLPT...DWEFFKFSSTIFDPT.......D
A5DZV8_LODEL/165-601I......VDDSPEV.R.......................LVEVYELEIKSILQN...DWKFYRYSNTIYDRL.......N
Q2GTD2_CHAGB/75-535S......PRESELTKALRRA.........RGGRGTGVRFTFIIYENQRRW.VGI...GWTTSLFGYERPAWT.......D
Q6FTU9_CANGA/51-394L......TG....P.KKAD...........GSSNEPIRFTYVLYENQRRW.IGI...GWTSSMLSYERSAWT.......D

PF08372

Q8S1F8_ORYSJ/928-1080------RRLPS--------------------------LSDRML-------------------------------------
Q5TKJ0_ORYSJ/649-804------RRLPA--------------------------KSDMLL-------------------------------------
Q9FJG3_ARATH/893-1049------RRLPS--------------------------LSDRLM-------------------------------------
Q8H2Q5_ORYSJ/856-1011------RRLPA--------------------------KTDSLL-------------------------------------
Q0D8E3_ORYSJ/881-1037------RRLPS--------------------------MSERIM-------------------------------------
Q9M2D4_ARATH/816-972------RRLPA--------------------------KTDCML-------------------------------------
Q60EW9_ORYSJ/619-774------RRLPA--------------------------RTDSML-------------------------------------
Q7XKA3_ORYSJ/864-1021------KRLPA--------------------------KSDVLL-------------------------------------
Q9LZE5_ARATH/588-744------RRLP.--------------------------.TNEVL-------------------------------------
Q69T22_ORYSJ/477-632------RRLPS--------------------------RADSML-------------------------------------
Q9FI32_ARATH/881-1036------KRLPS--------------------------STDSLL-------------------------------------
O49435_ARATH/618-774------RRLPS--------------------------RADSIL-------------------------------------
Q9M366_ARATH/632-795------RRLPS--------------------------NEDLMF-------------------------------------
Q9SS68_ARATH/861-1017------RRLPS--------------------------MSDQIL-------------------------------------
Q6EUH5_ORYSJ/624-779------RRLPC--------------------------KVDCLL-------------------------------------
O64492_ARATH/857-1012------RRLPS--------------------------RADSLL-------------------------------------
F6HMN5_VITVI/841-996------RRLPS--------------------------LSDQIL-------------------------------------
F6I605_VITVI/863-1018------RRLPA--------------------------KTDSML-------------------------------------
Q6K6B6_ORYSJ/845-999------RRLPS--------------------------KADSLL-------------------------------------
Q7XR21_ORYSJ/659-814------KRLPS--------------------------RADTML-------------------------------------
Q7XZZ4_ORYSJ/899-1054------RRLPS--------------------------NSDRVL-------------------------------------
Q84TJ7_ARATH/856-1011------RRLPA--------------------------RTDSML-------------------------------------
Q8RXU9_ARATH/851-1006------RRLPA--------------------------MTDSML-------------------------------------
Q9FL59_ARATH/639-794------RKLPS--------------------------KADCML-------------------------------------
Q9SKA3_ARATH/874-1029------KRLPA--------------------------KSDMLL-------------------------------------

PF06398

Q758I9_ASHGO/63-412KLRIAEEPIDS......................SATSLDDVKPPL.....................DWKWLG........
B0YCC5_ASPFC/114-487E...HLNPAPS..........................KDDFELPHVQA...............GNAKWRWVE........
A3GFP1_PICST/23-380E..KSLAAAPS......................VENTRDDYPFPIFEND.............IYSYSWDWLD........
Q6BWT4_DEBHA/130-546HARAAGKR.PL......................GVDDLSKVLPPP.....................DWKFDMG.......
Q6BIC3_DEBHA/22-384E..QSMKPSPS.......................ISNDESFNFPIFEND.............LYTYSWEWLE........
A3GHG6_PICST/131-541KTRLAGKR.PG......................GVDHLSKVVPPK.....................DWLFDFG.......
Q0UCD7_PHANO/96-443PARISGDK.PR......................GTPFFEDVLPPR.....................GWRWAD........
Q6BPA3_DEBHA/104-486PMRKLKQEYLKGKNNDKNDDEEDGEKSENVDINTVPHINAIKPPI.....................DWEFNE........
A5DFV2_PICGU/131-552STRSAGKK.PQ......................GVNHLYKILPPP.....................DWKFDMS.......
Q0V1J3_PHANO/49-353E...HLNAVPP..........................KDQFELPEVEG...............GQSRWRWVQ........
A5DFP0_PICGU/28-381E...FLNESPS..........................VDKFELPSPDNDYSSGS...SAMPMASGATWRWVD........
Q6BYT2_DEBHA/63-426E...FLNESSS..........................LESFQLPNNENNDYSFGAQQSQQLSGSDTTWRWVD........
A4GFC7_PICAN/70-420E...FLNEAES..........................PDNFELPQLND..............DSGMYWRWID........
A7A1K7_YEAS7/58-403E...FLNEAPS..........................PENFHLPEET................NTMVWRWVD........
Q9UV60_YARLL/25-364E...FLNEVTP..........................PSEFKLPDTEG...............TGMKWQWVD........
Q6CSS7_KLULA/54-399E...FLNEAPS..........................PEQFKLPEEA................SGMAWRWVD........
Q59WI8_CANAL/24-381EG..SYNLAPN......................ITVHKENFPFPVFEND.............LYAYSWEWID........
A3LMZ2_PICST/28-391E...FLNESSS..........................IESFKLPNTSDDKNFNNP.SESLGRINGATWRWVD........
Q6CXM3_KLULA/59-410ESRMKELSTSQI....................PNVQTLAEVKPPA.....................EWDWLL........
A1CDA3_ASPCL/48-420E...HLNAVPP..........................KDDFELPEVQG...............GNAKWRWAE........
A7E6F1_SCLS1/107-489SMRIEIGR.PI......................GCRFFEDVKSPR.....................GWEWSE........
A7TDR4_VANPO/106-455TLRINEQKIER.....................RCASHLEEVMPPI.....................DWEWVN........
A7TKV5_VANPO/49-397E...FLNQAPS..........................PEDFTLPEES................SDLTWKWVD........
Q6CN25_KLULA/177-532PYRKSQKP.PP......................GAHSMDDLKPPP.....................TWTFDS........
Q6FJ63_CANGA/118-468QFRINENAIES.....................VAVPSLDSISPPT.....................GWEWAE........
A6ZZ68_YEAS7/115-465SLRIYQRRIEE.....................NSVKSLEEIEPPK.....................DWEWEA........
Q752S3_ASHGO/50-392E...FLNEAPP..........................PEKFKLPEEN................GGMVWRWVD........
N1P6V1_YEASC/26-408GTLTMRSCLPP........................DGLGEEELPN.....................NWHWIN........
A0A023ZM32_YEASX/50-394E...FLNTSPS..........................PEVFTLPEEQ................SGMAWEWHD........
Q6FJI4_CANGA/13-429DPGAYITESPE..........................QLDLQVPP.....................DWSWIE........
A4GFD2_PICAN/121-493HTRLNNLPLV.......................GTLHLSQVKPPE.....................GWRFVDVETAVNTR
A4GFN5_PENCH/56-430E...HMNPVNP..........................KDSFELPEVQT...............GDAKWRWVE........
A2R1B9_ASPNC/54-425E...HLNHVPS..........................KEEFELPGVAN...............GNAQWRWVE........
A2QGY9_ASPNC/84-515PSRIAGDR.PK......................GCRFFEDVQPPS.....................GWAWKG........
M9MW28_ASHG1/185-541KYRKSQRP.PP......................GVTNIDEVVPPS.....................MWSFDR........
Q2UTA0_ASPOR/52-419E...HLNNVPS..........................KDEFELPEVQS...............GNAKWRWVE........
A7TEV3_VANPO/152-511QYRKLQQP.PP......................GVDNLKDIEPPR.....................TWYFDE........
A5DUM8_LODEL/24-379EK..TMEVAPS......................ITTEPDDFPFPVFEND.............VYSYQWNWSD........
PEX32_SCHPO/1-480AGSTDPVAEPT...........................AQLLPPD.....................GLAWID........
F2Z6I0_YARLI/178-534SWRQAKKR.PP......................GAPFLGDVEAPE.....................GWLFSK........
A4GFD3_PICAN/18-342ED..LEKSWDS..........................LESFQFPEITQ...............ATCRWRWLD........
Q0CPT8_ASPTN/42-419E...HLNQVPS..........................KDEFELPQVQS...............GNAKWRWVE........
Q6FXX0_CANGA/58-376E...FLNEAPK..........................PSDFQLPN....................KEWKWLD........
C4YIY7_CANAW/52-403E...FLNESSS..........................IDSFKLPNAADDATN......GDSNMQGATWRWVD........
G2WFM3_YEASK/201-569PYRRAQQF.PP......................GVDSLADVIPPT.....................GWSFDP........
A5DUZ7_LODEL/104-459E...FLNESSS..........................IETFKLPNTTDSNNLP.....ITSDIEGASWRWVD........
A7EH28_SCLS1/61-453E...HLNPVPP..........................KEEFELPDVEG...............GGARWRWVK........
Q5ANG0_CANAL/154-573KARIAGKR.PP......................GVDHLSKVYPPN.....................DWKFDFG.......
Q6FR12_CANGA/140-535TYRKALQL.PP......................GVDKIEEIKPPA.....................GWAFDE........
A5DZV8_LODEL/165-601KNRLSGKR.PP......................GVDHLSKVFPPT.....................DWKFDAE.......
Q2GTD2_CHAGB/75-535E...HNNAVPP..........................RAEFELPEVED..............GSNMRWQWAE........
Q6FTU9_CANGA/51-394E...FLNAAPP..........................ITEFTLPEGD................SGLEWKWID........

PF08372

Q8S1F8_ORYSJ/928-1080--------------------------------------------------------------------------------
Q5TKJ0_ORYSJ/649-804--------------------------------------------------------------------------------
Q9FJG3_ARATH/893-1049--------------------------------------------------------------------------------
Q8H2Q5_ORYSJ/856-1011--------------------------------------------------------------------------------
Q0D8E3_ORYSJ/881-1037--------------------------------------------------------------------------------
Q9M2D4_ARATH/816-972--------------------------------------------------------------------------------
Q60EW9_ORYSJ/619-774--------------------------------------------------------------------------------
Q7XKA3_ORYSJ/864-1021--------------------------------------------------------------------------------
Q9LZE5_ARATH/588-744--------------------------------------------------------------------------------
Q69T22_ORYSJ/477-632--------------------------------------------------------------------------------
Q9FI32_ARATH/881-1036--------------------------------------------------------------------------------
O49435_ARATH/618-774--------------------------------------------------------------------------------
Q9M366_ARATH/632-795--------------------------------------------------------------------------------
Q9SS68_ARATH/861-1017--------------------------------------------------------------------------------
Q6EUH5_ORYSJ/624-779--------------------------------------------------------------------------------
O64492_ARATH/857-1012--------------------------------------------------------------------------------
F6HMN5_VITVI/841-996--------------------------------------------------------------------------------
F6I605_VITVI/863-1018--------------------------------------------------------------------------------
Q6K6B6_ORYSJ/845-999--------------------------------------------------------------------------------
Q7XR21_ORYSJ/659-814--------------------------------------------------------------------------------
Q7XZZ4_ORYSJ/899-1054--------------------------------------------------------------------------------
Q84TJ7_ARATH/856-1011--------------------------------------------------------------------------------
Q8RXU9_ARATH/851-1006--------------------------------------------------------------------------------
Q9FL59_ARATH/639-794--------------------------------------------------------------------------------
Q9SKA3_ARATH/874-1029--------------------------------------------------------------------------------

PF06398

Q758I9_ASHGO/63-412.KYDWVLDLEPRQWVTDGFV..QYVDIDAETK...............WVYD.............................
B0YCC5_ASPFC/114-487.GSEWRIEGADDTNSK...........ADGKAADG..........GGWIYY.............................
A3GFP1_PICST/23-380..TDWRLDSD....FN...........NKGSKD.............GWVYY.............................
Q6BWT4_DEBHA/130-546YANKWEIDIDPQKFFKERNINNPYLQVHEDEKE.............GWIYD.............................
Q6BIC3_DEBHA/22-384..TNWKVDKE.................FNKGKGS...........EGWVYY.............................
A3GHG6_PICST/131-541FANKWTIDYEPQEFLRQRSLE.SKNLVIREGEKS............GWIYD.............................
Q0UCD7_PHANO/96-443..KKWTLDLLSREWVEDRCV..TGVEVEIEGER..............WVTD.............................
Q6BPA3_DEBHA/104-486..ESWKLDLNVNDWVNSNLLA.DLVMIDTDEK...............WVYD.............................
A5DFV2_PICGU/131-552YADNWHVDKEPQNFLKERSW..DKLNMFVIKEDED..........EGWMYD.............................
Q0V1J3_PHANO/49-353.GSSWKIETG..GDTK...........TTTKDDA............GWIYY.............................
A5DFP0_PICGU/28-381..KSWRLDLTNDGAIT...........LNKRSKTTADP....GPDEGFIYY.............................
Q6BYT2_DEBHA/63-426..KTWRLDLTNDGAIT...........LQNNKRSKTTAN..PATDEGYIYY.............................
A4GFC7_PICAN/70-420..KTWRLDLTNDGALQ...........LPSSKYKTTAD...PKPDEGFIYY.............................
A7A1K7_YEAS7/58-403..KTWRLDMTNDGAIQ...........VPNSKARTSAD...PSPDEGFIYY.............................
Q9UV60_YARLL/25-364..PTWRLDCTNDGALV...........IIGNKALSTPD...PSPSEGWIYY.............................
Q6CSS7_KLULA/54-399..KTWRLDMTNDGAIQ...........LSSTRPKTTAS...PGADDGFIYY.............................
Q59WI8_CANAL/24-381..DDWSLELE.......................YQKS.....KAHDGWVYF.............................
A3LMZ2_PICST/28-391..KAWRLDLTNDGAIT...........LTNSKRSKTTAN..PSPDEGFIFY.............................
Q6CXM3_KLULA/59-410.NVDWTLDLHPTEWVSAGFI..QYVDVDNETK...............WVYD.............................
A1CDA3_ASPCL/48-420.GSEWRIEGA...DG............TKDKSESKAA......DGGGWIYY.............................
A7E6F1_SCLS1/107-489.K.KWALDLWSREWVEERII..TGVEVETEGER..............WVYDIKYEGEEEDSVGVLD.........AGSRS
A7TDR4_VANPO/106-455.NSKWVLDLEPTEWVERNFV..QFVEIDSETK...............WVYD.............................
A7TKV5_VANPO/49-397..KSWRLDLTNDGAIQ...........LPSSKQRTTAS...PGADEGFIYY.............................
Q6CN25_KLULA/177-532.NSEWTTDTNVEQWATERG....LEMTRIEGD...............YLVD.............................
Q6FJ63_CANGA/118-468.NSSWVLDLDPTGWVEEGFI..QFVQIDPETK...............WVYD.............................
A6ZZ68_YEAS7/115-465.NSHWVLDLDPKEWVEDEFI..QYVEIDSETK...............WVYD.............................
Q752S3_ASHGO/50-392..KTWRLDLTNDGAIH...........LPSSRSKTTAS...PNSDDGFIYY.............................
N1P6V1_YEASC/26-408..DNWDGTD......................................WIYS.............................
A0A023ZM32_YEASX/50-394..KDWMLDLTNDGIIQ...........LPASAAKTKVK...PGADEGFIYY.............................
Q6FJI4_CANGA/13-429..KEWTVSS......................................WVYS.............................
A4GFD2_PICAN/121-493SVDGWLLDLTPEGWIKENFLN.ETMDIDEDEK...............WCYDL............................
A4GFN5_PENCH/56-430.GSEWRIEGA...DN............FNGKSDSKGS......TGEGWIYY.............................
A2R1B9_ASPNC/54-425.GSDWRIEGA...D.............ESGKSDAKA.......DGGGWVYY.............................
A2QGY9_ASPNC/84-515.K.KWELDLDCREWVVERMI..TGVGFEVSGSPSESGMT..SGEIGGWVWDLPPASSRYEEAVSTLAYDVLDSINPSKGH
M9MW28_ASHG1/185-541.NSKWEVDYDVKGWAQERG.....LSLEINGE...............FLVD.............................
Q2UTA0_ASPOR/52-419.GSEWRIDGA...D..................DASAK......DGGGWIYY.............................
A7TEV3_VANPO/152-511.NAPWEVDPNAKKWSEERG.....LNLTISGQ...............YLVD.............................
A5DUM8_LODEL/24-379..ESWKVDQE.......................FNRS.....KSIEGWVYY.............................
PEX32_SCHPO/1-480..DKWSISP......................................WTFT.............................
F2Z6I0_YARLI/178-534.MHDWEVDMNPNEWVGERGLG.RCTEMDNDE................WVYD.............................
A4GFD3_PICAN/18-342..AKWKTDDS.......................FAP........GEGWIYY.............................
Q0CPT8_ASPTN/42-419.GSEWRIDGG...DG............ANDKADTKST......DGGGWVYY.............................
Q6FXX0_CANGA/58-376..SEWKLDLSNDGAIE...........VPGERFLTNP.....KENDGYIYY.............................
C4YIY7_CANAW/52-403..KTWRLDLTNDGAIT...........LSSSKRSKTTAN..PTNDEGFIYY.............................
G2WFM3_YEASK/201-569.NFEWKIDNDVDRWVVERG.....LNLPITGE...............FLFD.............................
A5DUZ7_LODEL/104-459..KTWRLDLTNDGAIT...........LPASKHSKTTAN..PTSDEGFVYY.............................
A7EH28_SCLS1/61-453.GSRWRVEGAAEHDE............GGSNPKAESD......GGAGWIYY.............................
Q5ANG0_CANAL/154-573LVNKWNLDTKPKEFLRERSL...NPNLFIVKNDES..........QGWIYD.............................
Q6FR12_CANGA/140-535.NSSWIIDKNPEIWAIERG.....LQLPVEEG...............FLVD.............................
A5DZV8_LODEL/165-601FVNKWVLDTNPMDFIKQRTL...DASLFVIKDDEN..........EGWIYD.............................
Q2GTD2_CHAGB/75-535.GSRWRVDGVQDEAV............TPIDDKTDGWDYDGPGGRMGWVYY.............................
Q6FTU9_CANGA/51-394..KEWRLDLTNDGSIQ...........LPSSKMKTTAN...PSSDDGFIYS.............................

PF08372

Q8S1F8_ORYSJ/928-1080-------------------------------------
Q5TKJ0_ORYSJ/649-804-------------------------------------
Q9FJG3_ARATH/893-1049-------------------------------------
Q8H2Q5_ORYSJ/856-1011-------------------------------------
Q0D8E3_ORYSJ/881-1037-------------------------------------
Q9M2D4_ARATH/816-972-------------------------------------
Q60EW9_ORYSJ/619-774-------------------------------------
Q7XKA3_ORYSJ/864-1021-------------------------------------
Q9LZE5_ARATH/588-744-------------------------------------
Q69T22_ORYSJ/477-632-------------------------------------
Q9FI32_ARATH/881-1036-------------------------------------
O49435_ARATH/618-774-------------------------------------
Q9M366_ARATH/632-795-------------------------------------
Q9SS68_ARATH/861-1017-------------------------------------
Q6EUH5_ORYSJ/624-779-------------------------------------
O64492_ARATH/857-1012-------------------------------------
F6HMN5_VITVI/841-996-------------------------------------
F6I605_VITVI/863-1018-------------------------------------
Q6K6B6_ORYSJ/845-999-------------------------------------
Q7XR21_ORYSJ/659-814-------------------------------------
Q7XZZ4_ORYSJ/899-1054-------------------------------------
Q84TJ7_ARATH/856-1011-------------------------------------
Q8RXU9_ARATH/851-1006-------------------------------------
Q9FL59_ARATH/639-794-------------------------------------
Q9SKA3_ARATH/874-1029-------------------------------------

PF06398

Q758I9_ASHGO/63-412....................LNFDGTRGQYRRRRWIR
B0YCC5_ASPFC/114-487..........DNK..WNDGRRGQDGWDRYTRRRKWCR
A3GFP1_PICST/23-380..........DNN..WTNGSN.RDGFSKYTRSRKWIR
Q6BWT4_DEBHA/130-546................KLDGVDNSDSSYEFRRRRLSR
Q6BIC3_DEBHA/22-384..........DNN..WSTESY.SDGFSKFTRSRKWVR
A3GHG6_PICST/131-541...............KDVESQ.SSDITYEFRRRRLYR
Q0UCD7_PHANO/96-443....................LHYEVLESDGEREKAKR
Q6BPA3_DEBHA/104-486....................LESLTTPEFFRRRRWVR
A5DFV2_PICGU/131-552................NEDMIENKDEQFDFRRRRLTR
Q0V1J3_PHANO/49-353..........DNK..WRDGRRGLDGWGRYTRRRKWYR
A5DFP0_PICGU/28-381..........DNV..WKKPST.EDSYSKYTRRRRWVR
Q6BYT2_DEBHA/63-426..........DNT..WKKPST.EDSFSKYTRRRRWIR
A4GFC7_PICAN/70-420..........DNT..WKNPST.EDSFSKYTRRRRWIR
A7A1K7_YEAS7/58-403..........DNT..WKKPSK.EDSFSKYTRRRRWVR
Q9UV60_YARLL/25-364..........DNT..WKRPTA.DDSFSKYTRRRRWVR
Q6CSS7_KLULA/54-399..........DNT..WKKPST.EDSFSKYTRRRRWIR
Q59WI8_CANAL/24-381..........DSN..WGNGRV.RDGFSRYTRSRKWTR
A3LMZ2_PICST/28-391..........DNT..WKKPTT.EDSFSKYTRRRRWIR
Q6CXM3_KLULA/59-410....................VELNGERGQYRRRRWVK
A1CDA3_ASPCL/48-420..........DNK..WNDGRRGQDGWDRYTRRRKWCR
A7E6F1_SCLS1/107-489NMGSVKGKKGVPVSWEESSDVDGVGRRGEWRRRRWIR
A7TDR4_VANPO/106-455....................VNIDGNRGSYRRRMWTN
A7TKV5_VANPO/49-397..........DNT..WKKPST.SDSFSKYTRRRRWIR
Q6CN25_KLULA/177-532...........................DQFKRKRLIR
Q6FJ63_CANGA/118-468....................INLDGKRGKYRRRLWTN
A6ZZ68_YEAS7/115-465....................LNLDGQRGSYRRRMWTN
Q752S3_ASHGO/50-392..........DNT..WKKPST.EDSFSKYTRRRRWIR
N1P6V1_YEASC/26-408..........DSA..WKEIGQ.YSSLESFTRSRKWKR
A0A023ZM32_YEASX/50-394..........DNT..WNNPSA.TDTYKKYTRRRRWIR
Q6FJI4_CANGA/13-429..........DTD..WNVTGT.MDSLEGYTRSRIWKR
A4GFD2_PICAN/121-493.........VTKFSYQAGLTTNEKKIRGEVRRRRWIR
A4GFN5_PENCH/56-430..........DNK..WNDGRRGQDGWDRYTRRRKWYR
A2R1B9_ASPNC/54-425..........DNK..WNDGRRGQDGWDRYTRRRKWCR
A2QGY9_ASPNC/84-515DWKGRKKGKERVSQDYEEKVHTGSHVTGEWRRRRWIR
M9MW28_ASHG1/185-541...........................DSFKRRRLTR
Q2UTA0_ASPOR/52-419..........DNK..WNDGRRGQDGWDRYTRRRKWCR
A7TEV3_VANPO/152-511...........................DQFKRRRLTR
A5DUM8_LODEL/24-379..........DNS..WEHPRY.QDGFSKYTRSRKWAR
PEX32_SCHPO/1-480..........DTF..WAQPAK.TQFRTAFTRSREWRR
F2Z6I0_YARLI/178-534.....................VEKGVRGEWRRRRFIR
A4GFD3_PICAN/18-342..........NNS..WEEPSN.TDSLTRFTRTKRWKR
Q0CPT8_ASPTN/42-419..........DNK..WNDGRRGQDGWDRYTRRRRWCR
Q6FXX0_CANGA/58-376..........DNT..WKNPSI.EDTFSKYTRRRRWIR
C4YIY7_CANAW/52-403..........DNT..WKKPST.EDTFSKYTRRRRWIR
G2WFM3_YEASK/201-569...........................PMFKRRRLIH
A5DUZ7_LODEL/104-459..........DNV..WKKPTT.EDSFSKYTRRRRWIR
A7EH28_SCLS1/61-453..........DNK..WQNGRRGQDGWGKYTRRRKWYR
Q5ANG0_CANAL/154-573................NMEGIVYSDIVYEFRRRRLYR
Q6FR12_CANGA/140-535...........................PMFKRRRLVR
A5DZV8_LODEL/165-601................NMKNVVNLEIVYEFRRRRLYR
Q2GTD2_CHAGB/75-535..........DNK..WQNGRRGQDGWGRWTRRRKWYR
Q6FTU9_CANGA/51-394..........DNT..WKNPST.EDSFSKYTRRRRWIR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window