Sequence alignment for CL0488

PF05751

Q1GSI8_SPHAL/8-156KPFTGWHMTAILVAFFATVVAVNFTMARLAMSTFG.GKVVENSYVASQQYNKLL.....ARAEAQDQLGWT.PTVTRDP.
A1S6J4_SHEAM/9-149KQFWPW....FLIILPMCAVIASFATLKIAMDNSD.SLVAEEYYKKGKAINMDL.....SKIQYARQIGMQ.FLVSVND.
Q21I02_SACD2/16-179KEFWGW....FVFAPLIFIACVCSVLLTVAYSLKD.DVVTDDYYKKGRMINNTF.....AATRAAQDLGLT.AMVAIDA.
Q6LR37_PHOPR/8-149KQFWPW....FVIALPASSVVYSLTAVYIFSQNQV.DLVAEDYYKKGKAINVDI.....SRLRVADALKLH.ATVAVEE.
Q2JYE5_RHIEC/5-154RGFTGWHMLLATSAFFAVVIAVNVTMAVYASSSWS.GLVVENTYVASQEFNGKA.....AAMKAMAASGIE.GALFLKG.
A5FGU4_FLAJ1/2-147KINWGTGIVIAFALFMTFILYFVFEVQSNSKYDND..LVVEEYYKHDTHFQEEM.....ARIQNAHDLQHK.PSIKFEE.
B4SD27_PELPB/2-141KL........FLYLIYPLFFFAMGCGIYVAYNNAE.GLVDKNYYENGKHYFAA......KEVEQKLDVAIS.KPDSLKM.
A4AMY8_MARSH/2-147KINWGTGIVLAFIAFIGFILFFVVKMSIDTKANHD..LVTEEYYKEELAYQKEI.....DAENNAKKLSSN.LKIQKSL.
Q3AQV0_CHLCH/1-137MKL.......TLYIIYTIFFIAMGCGIYIGFQTAD.GLVDNNYYHNSTNYFQT......KAREEKLGIVIN.KPDTLTI.
Q3IHH4_PSEHT/8-149KNFWPW....FLIFFPSAAIIGCISLFFTAIGNGP.DMVVDDYYKKGKAINLEL.....TKFDKAKALYLH.GELNVTS.
Q16AS2_ROSDO/3-148KELTGRHVAFILCSAFFVIITVNLTLAFNAVSTFP.GLEVKNSYVASQSFD........KDREVQQSLGWS.VRADARG.
A7ICH9_XANP2/16-170RELTGRAVLLILLAFFGVVIVVNVIMARFAVATFA.GVETESSYKAGLAFSAEH.....RAAEAQVARHWN.VNVELASP
B5EHP1_GEOBB/13-152RV........VLVTLFGIFIAGMAATFFASGMLAS.RVTDPDYYRNGLNYDRT......RSGARNPGLKWT.LTATLAG.
A3QEF7_SHELP/9-149KQFWPW....FLIILPLCAVFASVNLMLLAVENKD.SLVSEDYYKDGKAINMDL.....RKIKHAKQLGLQ.FELHLTQ.
B3EK73_CHLPB/2-141KI........FLYCLYAVFLFAMGTGFYAAFSSYD.GLVDSNYYEKSSGYFTT......KALEDSLGLKIV.LPESLGK.
Q483P5_COLP3/7-147REPWAW....LVFILPFTAVVAGIATYIIANTNPD.TLVVGDYYKKGKSINLEV.....GKVKMAQKLGMR.FALQLKD.
Q0C2U8_HYPNA/13-170GKMKGWHALLWFLGFFGFMFVVNGIFLWAAITSFP.GEDVEKSYLTGLDYNQEL.....ARRAHQEAAGWN.AEIGISGT
Q15U51_PSEA6/17-158KQFWPW....FLITIPVCSMILSFNMLRFAFDGQD.AMVVDDYYKQGKAINISL.....EKIQAAKALNIQ.TELNVTE.
A7HTB3_PARL1/13-168PKLTGRRTLMLFAGFFIVVFGMNGLMVFQALSTFD.GVEVEGAYQKGRAYNHLL.....ARMEAQEKLGWK.AAIDVAPA
A4CGK5_ROBBH/2-147KINWGTGIVIAFIGFIGFILYFVIQASADPRAEHD..MVTDSYYKKELEYQQEL.....NASANLKASGGG.VTVRRLP.
Q5P0X1_AROAE/15-156QQGWPW....FLIAIPATAVVAGAVTLWLAISSWD.GLVVDDYYQQGKTIEKTI.....GRSIRAREMGLV.ADFRLRA.
Q28KJ3_JANSC/7-153RKLTGWHVFGIFGGCFGIIIGVNLFMAFQAVSTFP.GLEVSSSYADSQTFD........LRRHAQDALGWE.ASVEAAD.
Q12N45_SHEDO/8-148KQFWPW....FLIVLPLCAVVASLSTLYIAITNSD.SLVKDDYYKDGKAINMDL.....RKIKQAKHLGIK.FLITKEG.
A1U1K2_MARAV/12-154RQPWFW....FLTIFPLASIMWGITALTVSSSMDN.SLVTDDYSKQGRGINMSI.....ARDEKAADLKMA.GTLSLNG.
A1K558_AZOSB/15-157RQGWPW....FLIAIPATAIVAGVITLILAIRSWD.GLVVDDYYREGKAFVQTI.....ERTERAKQLGLS.AQLNVST.
Q3SL28_THIDA/14-155REPWPW....FLISLPAAAVVGGIATVWIAATNAD.GLVVGDYYKAGLAINQVL.....ARDEEARRLDLR.ATLQTED.
Q21DE7_RHOPB/9-164RPLTGGVVLASLLAFFAVVLGVNMTMMLLAIETLP.GTEVDSAYSASIRYSNEI.....AAARDQAQRDWR.VNARVERQ
A0LA58_MAGSM/12-165AGGWPWAIAGVVMAV..AVIGVNFYMWYSGSQSAT.GLVIEGRFKKGMTYDKEM.....EQYKNQVALGWK.ITQDSSQL
Q1GDJ5_RUEST/10-155RQFTGKHMLAVCVGAFGIIISVNLYMAYSAVSTFP.GVEVKNSYVASQQFD........TRRAAQEALGWS.VYASAIG.
A4XVJ9_PSEMY/14-157KQFWPW....FILFLLGYSVVQGLTLLTIATKNPP.GLISDDYYDVGKGINQSL.....EREKLAERLQLH.GQMVLDE.
C1DEL8_AZOVD/13-156KQFWAW....FVIAILLCSVVLGTSLLVISIREAD.SLVVDNYYDAGKGINTSL.....EREHLARRLGVQ.ARLELHE.
A8LQC6_DINSH/7-152KEFTGRHMLMVMLGAFGVIITVNLTMAYNAIGTFP.GLEVKNSYVASQNFD........KNRASQQALGWT.TDVRLDD.
A5WG98_PSYWF/20-178KN...YMVLVFVIGLPLFVVVACLWFVYYSVQIKD.TVVRDDWYMDGKTLYQDV.....SRDKLAHDLDLS.GDMIFDKD
Q2VZ04_MAGSA/6-160QRKPGWWYPYIFVGGFMVVLAVNFTMAYFANSTFS.GISTERPYEKGLAFNQTL.....EAARKQEALNWS.VDLQVEPA
A1B346_PARDP/3-148RELTGRHVLIITLGAFGTIIAVNVFMAVKAVGTFP.GLEVKNSYVASQSFD........RDRDAQAALNWT.VTPEYDG.
A1STG2_PSYIN/11-150KQFWPW....FLILLPLLSVVRGVVTVIIAADNKP.DMVVDDYYSKGKAINNDL.....ALIKKARANNIS.ASITQSG.
Q5E598_VIBF1/7-148KQFWPW....FLIILPATVVVACISTFVLFVENDV.DLVAEDYYKKGKAINVDL.....SKIKVAQELSIH.AQVRNLN.
Q9A8E8_CAUCR/16-164GQITGWHVLIGVVTFFALIIAVDVVFMVLAYRTFS.GQVASNPYEAGLAFNKTL.....AQREREAALGWA.AAVETVD.
Q2RP26_RHORT/6-166ARPRGWWYPYIFVGAFGVVLAVNLTLLYFATSTFN.GLVTTTAFEEGVAYNREI.....AAARAQETLGWT.AKAALEPR
Q4FTN2_PSYA2/18-175KN...YMVVIFVIGMPAFVVIACIWFVYYSYQIRD.SVVRDDWYMDGKTLYHDV.....SRDKLTYDLDLH.GQMQFANN
Q0A7G7_ALKEH/19-161KEFWCW....FVFAPPILVVPMGLGLVYTAVTNQD.PLVIDDHFDTGRATYRNF.....ERELVAYDMGLS.ARVRVPR.
Q7NYV3_CHRVO/14-158KEPWPW....ILFGLPAVSVVVGIFFLMAAIKSDD.GLVTDDYYKKGKAINMEL.....RRDKAAAQMGLS.AQLMFGS.
A9CIZ0_AGRT5/11-160FVFTGWHMLGVMVLFFGTVITVNMIMAWNAVHSWS.GLVVPNTYVASQQFNAKA.....EAAKARAATGIK.GRLVVDE.
B0SVV1_CAUSK/10-158RGLTGYHVLAMVVTFFLVIIGADVFFSVLAYRTFS.GEVASNPYEAGLAFNRTL.....AQRRREAALGWS.AQVATPR.
Q989H7_RHILO/9-158REFTGRHMLLTILGFFGVIIAVNLTMATLASTSWT.GLVVENTYVASQQFNRKA.....EEGRAQAALGWT.GKLTIAR.
A6GYS4_FLAPJ/2-147KINWGTGIVIAFALFISFILYFVFKVQSNAKYDNE..LVVEEYYKHDAKFGDEM.....IRAENAQDLKLK.PIITVAA.
Q47I57_DECAR/16-158KERWPW....ILMAGPAVVIVAGVITLWLAVVSND.GLVTDDYYKQGLAVNQQL.....HREHQAGNLGLH.ADVMRAG.
Q5QYZ3_IDILO/7-149KQFWPW....FLISLPVTVMIVCGVIIYLSVSQGGVSMVVDDYYKRGKTINAII.....EHVEEAQRRNIS.FEFTADK.
Q0AQJ0_MARMM/6-156NPLRGWHVLILILMFFGVTIGVNATFVTLALSSHP.GEDVPRSYVQGLNYNDTL.....DRRNAQAALGWS.ARVNQVD.
Q082F5_SHEFN/9-149KQFWPW....FLIILPMCAVIASLTTLKIALDNSD.SLVAEDYYKQGKAINMDL.....RKIKYAQQIGMK.FLVTVDD.
Q7UQF5_RHOBA/18-174ERRAKRFYIGLVLLLFAIQATILGTALKLAIGDPA.LAVVPDYHQAALNWDESY.....RASLASDRLGWN.VDVIVSKV
A3HZP4_9BACT/2-140N..WGKGIMLSIIGFICVVM....TMVVISVRMDGIELVTDSYYEKEIVYQNQI.....DKEQVTLDQGKDVISLNSQK.
Q5LMP2_RUEPO/4-149RTFTGKHAAMVFVGAFGIIIGVNILLAYSAIKTFP.GLEVKNSYVASQEFD........TRRDAQEALGWH.VRADATG.
Q2SJS8_HAHCH/16-158KEKWVW....LLIGLPASSVLFSILMVTLAVQGKD.TLVKDDYYKDGLAINQEL.....AKDRIAQNYGLS.AQTRIDE.
A7ZBM8_CAMC1/4-151KSFWPY....GIVLSIMAIILACAATIVVAINNPV..EMDSTYMQSHQSVDENITFIKESEARFDEKFGLK.FEPEFKA.
Q2G564_NOVAD/9-156RPFTGKKMAAILVAFFAVVISVNVLMARLATSTFG.GVVVNDSYLAGQHFNRWL.....KEAKVEQALGWK.GDLARDG.
A4G5L0_HERAR/19-162KHRWPW....LLMLGPFIVVIAGSITIWIAVSRQD.ALVVDDYYKQGKAINQDL.....RRDRVATDLGVR.FSAQYDV.
A0KKM1_AERHH/7-147RQFWPW....FIIALPTAAVIGSISTAIIASKDGV.NLVAEDYYKQGKEINQDL.....SKFDRSEALNIH.IALEVNG.
B7VNQ0_VIBSL/7-147KQFWPW....FLIALPATVVIWTIMTVIVFTQNSV.DLVTEDYYKKGKGINVDI.....SKVNIAKELGLS.ASVNEKG.
D5ARP9_RHOCB/3-145KPLTGRKVLLMFVAFFGLIIAVNVTMAVQAVKTFP.GLEVANSYVASQTFD........ADRAAQERLGWT.VKPAYAD.
H7C6J2_BRADU/5-157.PLTGTKVFLMLVAFFGVVIGVNVTMMKLAIATLP.GTDVDSPYAAGLTYDREI.....SAAQDQAARKWK.VNAHIERA
M1FE17_9ALTE/12-150RQPWFW....FLTIAPLAAITWSMTMLVVAVNMED.SMVSDDYSKEGRGINLEL.....ARDDKATELKLA.ADIQFNG.
Q3J017_RHOS4/3-147.EMTGRKVLAITVGAFGVIIAVNLLMAFKAISTFP.GLEVDNPYVASQTFD........VERASQQALGWT.LVADYDEA
Q4KFE8_PSEF5/12-155KHLWPW....IIIGILACSVTLTLSMVTIAVNNPD.NLVNDNYYEAGKGINRSL.....DRELLAQTLKMR.ANVHLDE.
Q5F7Y6_NEIG1/12-159KHVWPW....VLMAGPIFVVIASVAMFFVAQQHAT.DLVTDDYYKDGKHIDIQL.....HRDEEAVRRHIG.VQVLISP.
Q7MKV3_VIBVY/7-147KQFWPW....FLIILPLTVVVWTIVTVVIFSQNSV.SLVAEDYYKKGKGINIDI.....SKLNVAKELGLN.ATVSSDN.
Q88F39_PSEPK/12-153KHLWPW....IIIGILTTSVCLSLTMVSIAVHNPD.NLVNDNYYEAGKGINRSL.....DRELLAQQLGLK.ASVHLDE.
Q9I3G7_PSEAE/12-155KHFWAW....FIVALLATSVVLGLSLVTIAVRNQD.TLVTDNYYEAGKGINRSL.....ERENLAVRLQVH.AKVKVDD.
Q9KS23_VIBCH/7-147KQFWPW....FLIILPLTVVIWTVVTVIVFANNSV.SLVTEDYYKKGKGINIDL.....TKINVAKELGLN.ATVHSEG.
V6F3Y5_9PROT/13-164.....WWYPYIFVAGFGVVLAVNGTLAYFATSTFT.GISTTDAYEKGRLYNQNL.....ALAKAQAEMGWQ.VDTKLVPA

PF13115

Q746W9_GEOSL/44-126--------------------TAWSDRTEVFLE.HP-ELEP....GKGAT.L.L.------------------..IY...-
A1VWA5_POLNA/163-251--------------------NSVSNVYRVALV.PP-A.QAP..AINQMH.S.W.------------------..KV...-
A5V049_ROSS1/45-129--------------------HRVVDGLTISLE.RP-A.QP....IALRDYA.F.------------------..VA...-
A6LXM8_CLOB8/40-131--------------------SVNGINAELTFN.KD-N.KV....KTGDN.D.V.------------------..MI...-
A6Q3F7_NITSB/22-102--------------------HVKYRGFKIDII.ST-K.PL....SVGAN.S.F.------------------..LF...-
A6Q5F8_NITSB/58-139--------------------KAFHKKYDVVLV.T.-Q.KL....SYPNA.I.F.------------------..EF...-
A7HPZ4_PARL1/27-116--------------------GAQSQTYKFEAV.SE-E.IP....VGERV.R.I.------------------..EV...-
A7IP68_XANP2/27-115--------------------RAEINDYEFRLV.QT-D..I....KQGDG.A.I.------------------..VA...-
A8EQX3_ARCB4/26-110--------------------KNQVDGYDVEIT.ST-R.DL....SAGSN.E.L.------------------..FA...-
A8FGJ5_BACP2/27-111--------------------GEVPELLEVKLT.GP-E.QV....EKNES.V.I.------------------..VK...-
A8HZ24_AZOC5/116-197--------------------DQNARGWTVNLI.V.-D.PG....ADGAR.T.V.------------------..TI...-
A9B390_HERA2/31-114--------------------EKTVDGVTLKLI.SE-S.PL...SQNTDQ.T.W.------------------..VI...-
A9B7Z4_HERA2/24-105--------------------PSDDPRLNISLE.QT-P..S....TMAVQ.T.I.------------------..VL...-
A9WES2_CHLAA/30-114--------------------TQTVDGLTITLE.TP-D.RPR..INTAVD.F.V.------------------..VL...-
B1LY15_METRJ/27-114--------------------RADVKDYRFELV.QP-D..A....KVGEA.I.L.------------------..AVR..-
B1WYP1_CYAA5/497-584--------------------RMGQTNVSINLV.SS-P.EV....KIGDA.E.F.------------------..IF...-
B1YKE0_EXIS2/156-236--------------------HATVEGLSVHYM.GA-K.TM....KAGSKLP.V.------------------..SF...-
B3EK73_CHLPB/46-128--------------------KALEDSLGLKIV.LP-E.SL....GKGLN.T.V.------------------..DV...-
B7GLB0_ANOFW/24-107--------------------EDELAYLDVKMA.VE-E.KL....PANEEVE.L.------------------..AC...-
B9EAD1_MACCJ/40-124--------------------DKKVQPLTVDLT.VP-E.HV....EKGKTVE.I.------------------..KA...-
B9K633_AGRVS/26-114--------------------LAGAQDYEFQAV.QT-E..I....KQGPA.A.T.------------------..VS...-
B9L0M8_THERP/30-115--------------------RAEQFKLDILAI.SP-E.PP....IVGPA.E.I.------------------..QL...-
C0QPP0_PERMH/30-115--------------------ELISDSYKVVIV.SD-Q.PP....HVGVN.K.W.------------------.KVY...-
C0ZAX9_BREBN/28-112--------------------FQPGAPVEAAFTLEP-K.EL....VAGDTVT.F.------------------..SV...-
C0ZAX9_BREBN/159-241--------------------HANAETVDYHFS.PA-D.NI....KVATP.T.A.------------------.LTV...-
C1F725_ACIC5/414-503--------------------SRAAQTAQIALS.TI-P.SP...PQKGSD.A.V.------------------..QV...-
C3KQE8_RHISN/26-114--------------------FAAATDYEFQLV.QP-E.VA....QGPEA.T.V.------------------..AV...-
C4L0I5_EXISA/150-231--------------------HHHHAGADITLD.PK-E.AT....AGEEQ.P.F.------------------..MV...-
C5A944_BURGB/61-150--------------------PTSGGTYVVTLV.PP-E.PP...AALPLN.R.I.------------------..HAWRV-
C5D7X8_GEOSW/26-109--------------------EEKPAMLEVQLQ.TP-D.HI....ELNKE.T.T.------------------..LS...-
C6D1K7_PAESJ/33-118--------------------SPFLDDLTISME...-D.TP....NTGDT.T.A.------------------..HAY.K-
C8X421_DESRD/182-271--------------------TVQSEDGAFTVS.YS-P.VP...GRVLMN.Q.I.------------------..HSWEI-
C8XBL3_NAKMY/492-575--------------------TVALGNDQIRLR.LT-..PA....TAGVN.S.L.------------------..EF...-
D1C6E0_SPHTD/29-114--------------------SEAPSNYQVTLA.VE-P.SP...AAVGPA.T.V.------------------..TV...-
D1CB68_THET1/449-533--------------------EAKADSATIALS.VD-P.AF....AGVTN.S.I.------------------..DV...-
E3I1Y9_RHOVT/22-110--------------------FAGANDYEFQAV.SN-D..F....KAGSG.R.D.------------------..VA...-
E6U1E9_BACCJ/34-124--------------------EHGSNELNFDIV.EV-E.ILMEEEVDPNT.E.I.------------------..SI...-
D2RWQ8_HALTV/29-117--------------------TQELDGYDVTFG.GA-D.EP...LVTGER.M.WL------------------EFEI...-
D3DI34_HYDTT/30-118--------------------ISEYKVYTGRLV.FA-S.KP....KVGKN.S.A.------------------..LL...-
D3E8S1_GEOS4/32-116--------------------DVMAEPIIVELS.LT-PESI....KAGEK.V.L.------------------..IE...-
D3EJT0_GEOS4/33-118--------------------LYADGQLRMEIQ.TV-S.SA....AEPMQ.E.T.------------------..VFE.L-
D3FV91_BACPE/36-120--------------------DQVVTDWSMNVA.GL-D.EF...YQTGEA.VDI.------------------..HL...-
D3FYN6_BACPE/31-115--------------------DDQLTPIEVELV.LP-D.QA....EINEE.V.L.------------------..FE...-
D3UXD2_XENBS/654-746--------------------MIDTDRTEFKPE.NG-N.LN....QEGDS.TDL.------------------..VL...-
O25884_HELPY/24-108--------------------TLKANDLEVKIK.SV-G.NP....IKGDN.T.F.------------------..IL...-
O67207_AQUAE/26-107--------------------RLKQKEVEVVIY.SK-D.GK...IKSGGN.E.I.------------------..RV...-
YTKA_BACSU/28-111--------------------AETPEVLDVKLT.GP-E.KV....NPGES.A.A.------------------.YEA...-
Q11N13_CHESB/27-115--------------------WAGIQDYEFQLV.QP-..EI....KQGNA.A.V.------------------..IAV.R-
Q1QM81_NITHX/28-116--------------------LANINDYKFELV.D.-Q.TV....QAGPD.K.V.------------------..IT...-
Q20XF5_RHOPB/26-115--------------------RADVKDYEFKLL.DP-..VI....TAGKD.K.I.------------------..VAV.K-
Q30S73_SULDN/23-110--------------------MKDSDDLHAMLS.SE-K.VL....SQGSN.K.I.------------------..IV...-
Q65FU6_BACLD/29-113--------------------DEEPKVLTAKLA.TP-E.SA...AKNEKA.V.I.------------------..KA...-
Q89KH4_BRADU/55-143--------------------RAEIKNYEFQLM.QP-..TV....KAGAD.R.I.------------------..VTV.R-
Q8ELE7_OCEIH/32-115--------------------YKKETPLEIDIQ.VP-E.YI....EAKEN.TEV.------------------..TF...-
Q92UF4_RHIME/47-135--------------------YAAATDYRFELV.EP-..EI....AEGPE.A.I.------------------..VA...-
Q98L62_RHILO/78-166--------------------KTDNGLYMASFV.PE-R.GV...VRQGEL.ESW.------------------..LL...-
Q9KDX1_BACHD/57-141--------------------EQLITDWEKEVVGLE-K.GV....MSGKA.TDI.------------------.HVF...-
Q9KF19_BACHD/29-113--------------------IEQLSPIEVELL.YE-E.AL....ASGENMT.F.------------------..DV...-
Q2K7A4_RHIEC/32-118--------------------.AAAQDYEFQPI.ST-..EV....NQGQG.SLV.------------------..SV...-
Q6N9W4_RHOPA/25-111--------------------.AGAGDYTFEPK.TP-..EM....KKGDDVT.V.------------------..AIR..-
Q81MD9_BACAN/28-112--------------------EQKLEAVKVAVQ.TN-PKEI....KPGEK.TEV.------------------..QA...-
Q81RX5_BACAN/443-524--------------------...DNGYEMTLN.VS-..PN....KVGQN.I.F.------------------..HI...-
U5LE16_9BACI/35-115--------------------....EILEAKLV.VP-E.KV....ELNEEIT.L.------------------..SV...-

PF05751

Q1GSI8_SPHAL/8-156........DRRVRIDIR..KDGEP.LA-DL-S-VGATASHPL----GRTPPLALRF------V...AAEDG..GWRSVEP
A1S6J4_SHEAM/9-149.........GAITLE....QHGGP.AY-DA-A-LNTSFYHPT----LADRDFAGLL------T...QDATK..LYRI...
Q21I02_SACD2/16-179.........TAENITV.SLNATSP.VF-AP-E-ITLIFSHPM----ESGLDKKYKL------VR.QPGSNETAVYTA...
Q6LR37_PHOPR/8-149.........NQIAVKF...DKGEL.RS-NP-N-LRVTFTHRT----LANQDFTQMV------S...ADLKG..TYHF...
Q2JYE5_RHIEC/5-154.........SEIRYDIHE.QGGAP.AI-ID-E-VTLNFKRPV----GDHEDFSLAL------R...KTGEG..RFEADHE
A5FGU4_FLAJ1/2-147.........EGVKVTF...PATFE.SD-KI-K-GNILLYRPS----NKKFDFDTQI------A....LTNS..SIVIPHK
B4SD27_PELPB/2-141.........GSNEIHISVTSHGKP.LE-DA-A-LSLFVGNLS----STRYDSTLTM------Q...EEAPG..IYHTTAA
A4AMY8_MARSH/2-147.........GGLMVQF...PDNIN.PE-KI-K-GKVSLYRPS----NKHLDFDLPI------S....LSNS..HLLIPDK
Q3AQV0_CHLCH/1-137.........GTNTFTVAVTSHGKP.FE-QG-N-ISLLLGNVS----TNNNDTTLTM------Q...ETAPG..IYQTTIS
Q3IHH4_PSEHT/8-149.........ERVGFKF...TKGDT.SN-IH-A-LKLSFYHRT----IKAHDFEATL------T...PNANQ..EFTA...
Q16AS2_ROSDO/3-148.........GQVLLSVTD.AAGQP.VE-VA-T-LDATLGRAT----HVKDDSTPDF------K....FDGK..RYVAPAD
A7ICH9_XANP2/16-170G.....NEARVVTIRVLD.PSGMP.LS-QL-T-PDGRFAHPT----DARRDVDLDL------K...PLGDG..RYRATAV
B5EHP1_GEOBB/13-152.........RDLLVRVCD.EKGAP.VA-GG-S-LSL...HPG----KKTDSSALPL------QL.AESAPG..VFRTSLP
A3QEF7_SHELP/9-149.........DELTLT....QHGGE.PY-TA-A-LNVSFYHPT----LQEKDFAEVA------T...ADGNQ..VYHI...
B3EK73_CHLPB/2-141.........GLNTVDVAVFVNGKP.LE-QA-T-VTLFAGLVS----SEKYDGIHKM------V...EHLPG..FYRGEVP
Q483P5_COLP3/7-147.........NELIIK....PTGIE.KV-FP-L-LNVSFFHPT----LEERDFYLAL------T...QDGNG..YFRH...
Q0C2U8_HYPNA/13-170N......QGFLLTSRLMT.RDGSA.LP-VF-G-TQAQLRHPT----DRALDRVVTL------T...PAGGG..EYVAELG
Q15U51_PSEA6/17-158.........KDVSVRF...ISGAP.QT-GA-A-LRLAFYHVT----QAPKDQTIDL------F...RDAQG..IYRG...
A7HTB3_PARL1/13-168S.....NGDTALTVTFTD.AAGAP.LE-GL-A-VHGTFWRPV----AAGEDRRMSL------T...ETAPG..IYTAVFA
A4CGK5_ROBBH/2-147.........DGLAIRL...PERMD.PA-AI-R-GTIGMYRPS----DDNLDFEWPI------Q....PGDS..LQRIPSD
Q5P0X1_AROAE/15-156.........EEVSVRL...GAAQGIPL-PP-T-VVLTIAHPT----RAGQDQKLLL------....KGRDG..TFAG...
Q28KJ3_JANSC/7-153.........DTLALTLVD.AEGRP.VY-PA-E-LEVLLTRPT----TRADDQVLAL------T...RGPNG..TLTAPAD
Q12N45_SHEDO/8-148.........NSLVLS....QEGGP.AY-QA-A-LNFELFHPT----IEAKDFKLLA------T...ADANY..HYRI...
A1U1K2_MARAV/12-154.........RSATLDL..STVNGA.AD-YP-Y-LVFNLYHPT----LSGQDKTIQF------T...QVAPG..QYRG...
A1K558_AZOSB/15-157.........DRVLIVL.SSSVPSV.TL-PG-T-VRLTVSHPT----KGGLDQEMVV------....TGRDG..VFEV...
Q3SL28_THIDA/14-155.........GSLALSL....GGRLAMH-PE-R-LTLVLAHPT----RAGMDQTLVL------H...HAGAG..RYRT...
Q21DE7_RHOPB/9-164P.....DGSASLRVEARD.RNGAP.LA-GL-T-FSGRLERPA----DKRADKEVIL------A...EIGDG..VYRGNAV
A0LA58_MAGSM/12-165ML....NQERPLTITVLD.KTDQP.IQ-GA-H-VQGSLIRPI----GAGSDVNFML------A...ESSPG..VYVGLVT
Q1GDJ5_RUEST/10-155.........NEVKLEISD.RDGQP.VE-VA-S-LTATLGRAT----HVRDDQKPQF------R....FDGS..AYVAPAE
A4XVJ9_PSEMY/14-157.........ATGTVELQLEGNSRP...-.Q-Q-LVLNLISPT----QPERDRRIIL------Q...PSADG..MYRG...
C1DEL8_AZOVD/13-156.........ADGIAEIRLTGNSHP...-.Q-Q-LVLNLISPT----QEEKDRRIVL------Q...PQTGD..LYRG...
A8LQC6_DINSH/7-152.........GVLHLVFTD.KQGQP.VR-AE-L-LSVTLGRST----HVRDDQTPPF------R....WTGR..DFTAPVD
A5WG98_PSYWF/20-178GTVTFTLHYPSDSLKSGKLHDGTPLYY-PK-K-LNLSISHAT----DISKDRDGVL------T...HTQGN..KYTS...
Q2VZ04_MAGSA/6-160A.....NHGAHVTITYKD.AAGHP.VD-GM-E-VKALFVRPT----AKGHDREVRL------A...PVGPG..AYATLQE
A1B346_PARDP/3-148.........RELTLAIRD.AEGYP.AP-VQ-G-LEVTVGRPT----HMRDDRRPEF------T....YAGG..LFRAPLA
A1STG2_PSYIN/11-150.........DELIIDL.....SGV.QD-KS-S-IQLFLYHST----QAERDLSQLL------T...ADGSG..RYRY...
Q5E598_VIBF1/7-148.........NVIEIKL...DKGKL.EH-NP-A-IKAIFTHRT----LPNHDFSQVL------T...SDAKG..IYRI...
Q9A8E8_CAUCR/16-164........GDAVIVRVRD.RAGRP.LD-RL-S-LTGSLARPA----TEVGKQTLNF------K...PLGDG..RYRATAR
Q2RP26_RHORT/6-166AGGVEGSWPADLVVSLTS.AENQPLLR-DL-A-VTAQIRRPT----QAGFDQALTL------T...AGTDG..RWHAPLV
Q4FTN2_PSYA2/18-175GDVVFYLNYPEQSLQSGKLINGSPLNY-PE-T-LDLSISHAT----DIKKDHDVVL------K...HLEGN..KYSA...
Q0A7G7_ALKEH/19-161.........EGGELSLVLQGKNAE.AK-PE-H-LRLTL.EPR----TGADDVVAEL------E...LGADG..VYRG...
Q7NYV3_CHRVO/14-158.........DGRSLRL...VTASKVKL-PD-T-LSLRMIHPA----QDDYDLSAVM------T...MAGPN..LYQGILP
A9CIZ0_AGRT5/11-160.........KTVRYEVFH.PETGP.VD-TD-T-VTAHFRRPV----GESQNFDMEL------T...PVSTG..VFTAAHD
B0SVV1_CAUSK/10-158........PGVVALRVKD.RAGAP.LS-RL-S-LTGVLERPA----TETGRQVLTF------E...PAGDG..WYTARAE
Q989H7_RHILO/9-158.........SEVRYSLSD.TTGKP.VP-LH-G-VKILFRHPA----YEAGDKAVTL------A...LVSDQ..EFAAQHL
A6GYS4_FLAPJ/2-147.........EAISIVF...PNTFI.PK-KI-K-GKVSLYRPS----NKNLDFEIPI------S....LTNT..TLLIPKK
Q47I57_DECAR/16-158...........ANIRLLIAADGDA.KL-PS-A-LFLKLAHPT----RAGQDQSVQM------S...SEGQG..FYSG...
Q5QYZ3_IDILO/7-149.........GLFTLKY...ASGQP.EE-LS-A-LRVFFIHAT----QDEKDFTRML------T...VASDG..TYRA...
Q0AQJ0_MARMM/6-156.........GDLVLAIDD.ADGAA.VA-GL-Q-LAGQLIHPA----DTGADCDLAF------T...EARPG..VYRSTLP
Q082F5_SHEFN/9-149.........QELTIT....QHGGP.EY-RA-A-LNVRFYHPT----IEAKDFSLNA------T...ADANY..VYHI...
Q7UQF5_RHOBA/18-174SD...SKGQRAISVELHN.QQGKT.LD-DL-N-VDAVVYRHA----DAGAFQAVDL------P...STGEG..RYLGMAS
A3HZP4_9BACT/2-140.........KVVLIDL.........PH-GV-K-GTLHLYRPS----DVSLDKILPL------Q...GKENG..KIEVPVG
Q5LMP2_RUEPO/4-149.........GLVVLSITD.RAGKP.VE-VS-E-LKAVLGRAT----HVQEDFAPDF------A....FDGT..AYVAKAE
Q2SJS8_HAHCH/16-158........EGRIKLML...TSGIPIKK-AE-R-LNIQFIHPT----LAEHDYKVAL------I...AQEDG...YYG...
A7ZBM8_CAMC1/4-151.........LQGKFKFHLTPKNGE.IS-SL-S-YEILLTRPQ----TNKNNKTLNA------S...WQENN..LVSESVS
Q2G564_NOVAD/9-156........QGHAEIALFD.SMGKP.IS-AA-R-VTAIAEHPL----GRRPLADLVL------H...ETLPG..VYAAPL.
A4G5L0_HERAR/19-162.........PTRMLTG.SVANTAR.QA-TG-N-LNMRLIHAT----IPEKDLVLLL------Q...PDQNG..NFAV...
A0KKM1_AERHH/7-147.........NELTLKP...LSGDI.PA-GQ-A-LYLSLFHPT----LAGMDSEHMV------T...ADGNG..VYRLLLD
B7VNQ0_VIBSL/7-147.........NSVIITL...EKGKL.DH-FP-A-INAMFVHRT----LPDRDFTQLL------T...ADAKG..NYTMTLD
D5ARP9_RHOCB/3-145.........GVLSLDIRD.RAGQP.AP-LG-Q-LEVLVGRTT----MAAEDRTPQM------T....RTDG..VYSAPLS
H7C6J2_BRADU/5-157T.....DGGAVLQVEARD.ASGQP.VS-GL-K-FGGRLERPT----DKRADLSVEL------S...EAGIG..IYRGNAA
M1FE17_9ALTE/12-150.........RQLSLDL.....TST.ED-FP-Y-LVLNLFHPT----LDKYDRVLQF------R...RESAG..HYTAQMN
Q3J017_RHOS4/3-147........AREISLRFTG.ADGRP.AA-VS-A-LDVLVGRTT----EASDDRQPEF------V....LRDG..AFRAPQD
Q4KFE8_PSEF5/12-155.........LTGEVELRL...SGD.SQ-PK-T-LELNLISPT----QPEKDRKITL------AR.SETEHG..RYIGQLT
Q5F7Y6_NEIG1/12-159.........DMNAAKVF..VGGEF.DG-KQ-P-LNLLLMHPT----RKADDQTVAL------KPVGSAQNGRAEYEAVFK
Q7MKV3_VIBVY/7-147.........NVIVIEF...SKGDL.PH-FP-A-LTATFTHRT----LPDRDFTQLL------T...ADAKG..VYRLSLD
Q88F39_PSEPK/12-153.........LTGEVDLRL...TGS.SG-PQ-N-LELNLISPT----QPEKDRKVLL------S...RVEAG..RYVGQLE
Q9I3G7_PSEAE/12-155.........LTGEVEV...RLTGN.SR-PD-R-LTLNLISPT----QPEKDRRVEL------LR.SNSDRE..RYVGQLT
Q9KS23_VIBCH/7-147.........STVIIEF...DKGQL.AH-FP-A-IQAMFAHRT----LPDRDFSQLI------T...ADAKG..IYRLNLE
V6F3Y5_9PROT/13-164STA..DGHKVDVRISYRD.RDGKG.VD-GL-K-VTAGMVRPT----VAGYDHEVAL------P...SMGGG..VYGGVFA

PF13115

Q746W9_GEOSL/44-126---------.L..TRT...ADWKP-LA.SS.E.VHLVITPPA.....GTPL.TVAA....K.GTK....PG--LYRAE.A
A1VWA5_POLNA/163-251---------.K..LAA...PDGTP-VH.GA.K.FAVDGGMPQHG..HGLPT.QPRV....T.REV...ENG--TYALDGM
A5V049_ROSS1/45-129---------.T...IT..DAGDQP-VE.AT.L.VYFDFTMPQME......M.GVHQ....P.IAD.RLGPG--KYGVR.T
A6LXM8_CLOB8/40-131---------.T..LHD...DKDKE-IE.NA.D.VKISAEMDKNSDMGMD.M.NGKKPIEVS.LEN..SKDG--QYMGK.I
A6Q3F7_NITSB/22-102---------.H...IN...K..KN-IK.DL.K...VKFFMPAMP..GMPYM.ESWA....K.IEK...NDQ--GYQAN.V
A6Q5F8_NITSB/58-139---------.K..ILD...KSGSP-VS.DA.K.VTVLFTRPE.....TSKF.DKKT....S.AIY...RNG--EYITE.V
A7HPZ4_PARL1/27-116---------.R..LHD...PSGKP-VP.AG.D.IDIVSTRLDMGPDGMAMM.DTPL....K.PVP.ADAPD--VIVFE.T
A7IP68_XANP2/27-115---------.VRLIDR...RSGKP-VP.DA.V.IFASRIDMAPD..GMPTM.AAPI....E.AVP.STEPG--VYRFK.T
A8EQX3_ARCB4/26-110---------.N...IT...KDGKA-VT.TA.K.VKVKFFMPEMP..GMPYM.EHEG....E.GSL...AGD--KYKMT.I
A8FGJ5_BACP2/27-111---------AA...VT...YGDTP-VD.DA.DDVQFEVWKD.....GDKDN.SKMI....Q.PKK..ENKG--VYELH.T
A8HZ24_AZOC5/116-197---------.E..AKD...AAGRP-LV.GY.D.VDARFAHPA.D....ARQ.DVTV....D.LHE..IGGG--RYRGA.A
A9B390_HERA2/31-114---------.N...VT...QNGQP-VD.NA.D.VYLDIDMPSMP......M.GQNK....P.LAK.GEGNG--NYRAQ.G
A9B7Z4_HERA2/24-105---------.S...IS...DGATP-LE.NA.K.VQIEATMTH.A..GMPS...QIV....Q.LEP..LGAG--KYQAN.I
A9WES2_CHLAA/30-114---------.L...HD...QQGNA-IN.DA.Y.VYLDLDMPAMP...MG.V.TRPV....A.TPD...GPG--RYWAR.T
B1LY15_METRJ/27-114---------LV...DR...RTGKP-VP.DA.V.VFAKRLDMAPD..AMEEM.ATKV....EQLPS..TEPG--IYRFK.A
B1WYP1_CYAA5/497-584---------.EI.VDS...KNKKP-LQ.IE.S.LDIKATMP.MK..NMAPM.TAKV....E.VKP.ESQIG--KFKAE.T
B1YKE0_EXIS2/156-236---------.H...VF...LNGKP-LQ..A.D.VQIEVIEP.....GVEK..HTYL....L.LTK...KSD--QYVGE.V
B3EK73_CHLPB/46-128---------.A...VF...VNGKP-LE.QA.T.VT..LFAGLVS..SEKYD.GIHK....M.VEH...LPG--FYRGE.V
B7GLB0_ANOFW/24-107---------.F...VT...YGDEK-VT.DASE.VKFEVWKH......GEEN.RQMI....E.GKH..VGDG--KYVAR.Y
B9EAD1_MACCJ/40-124---------.L...VK...HGKEK-VN.DA.D..EVMFEVIK.D..GDTKN.SVKE....K.VKE..AKDG--VYTFT.Y
B9K633_AGRVS/26-114---------VRL.IDK...RTGKT-VP.DA.V.IFTTRMDMAPD..GMETM.TTKV....D.LAT.SGEPG--VYAFT.T
B9L0M8_THERP/30-115---------.R..LRD...QRGQP-LT.GLGT.IEVEGTMSH.A..GMEP...VIV....R.ARE..AGDG--IYVTQDF
C0QPP0_PERMH/30-115---------.V...YT...KDGSA-VT.DA.S.VKINGYMPPMP..GMPEM.SFDY....P.VKN...TGQ--FYESD.V
C0ZAX9_BREBN/28-112---------.K...VT...QDGQP-VD.DA.KEVKFEWWKD.....GQEKH.ETIP....A.SLQ...GDG--VYTAQ.Q
C0ZAX9_BREBN/159-241---------.H...LM...KDNKA-LD.KA.T.VKFEFWRGT.....DQKH.SFVD....A.TET...AAG--QYDGN.V
C1F725_ACIC5/414-503---------.T...LT..GADGKP-VS.GA.H.VSATFYMPAMPAMGMAAM.HVAS....T.LTD..KGQG--IYEGS.L
C3KQE8_RHISN/26-114---------.RL.IDK...RTSKP-VP.DA.V.IFSTRLDMAPE..GMEAM.TTSV....EEMPS..TEPG--VYSFK.T
C4L0I5_EXISA/150-231---------.H...VM...IEDEM-LA.GA.D.VQLEIFQD......GAEK.HEWV....K.LEE..ADAG--MYKGA.H
C5A944_BURGB/61-150---------AL...SR...ASGEP-VS.GA.R.IDVAGGMPQHG..HGLP..TRPR....V.VSA...GGG--GYRLEGM
C5D7X8_GEOSW/26-109---------CI...VT...YGGEK-VN.DA.DEVKFEVWKH......GSEK.HEML....T.AKN..DGDG--KYSVK.K
C6D1K7_PAESJ/33-118---------LT..IKN...STGSL-VD.VD.L.VRINLSMS.MQ..GMNH..KMKA....Q.MER..SALG--EYKTK.V
C8X421_DESRD/182-271---------TV...RD...QNGDP-VR..A.V.VTADGDMPQHG..HGLPT.RPEV....S.TTE...QTG--VYLVEGL
C8XBL3_NAKMY/492-575---------.T..VVD...AGGQP-VSPVS.D.PEVSVTMPA.A..GVGPL.TRPV....S.ATG....PG--AYQAV.L
D1C6E0_SPHTD/29-114---------.T...IR..DQDNAP-VT.GA.T.VEVEGNMSH.A..GMKPV.FADA....H.HQ....GDG--QYVTEGF
D1CB68_THET1/449-533---------.E...LS...NGGLP-VS.NA.SEVLVRFSNPA.E..GIS...QSEA....K.ARN..IGNG--HYTLYGP
E3I1Y9_RHOVT/22-110---------VRL.IHK...PTGKP-VT.GA.V.LFRSRLDMSPD..GMGDM.TGKL....A.ADA.SSEPG--LYRFK.A
E6U1E9_BACCJ/34-124---------.QA.YVT...QGDDK-VN.DA.SEVMFEIWEQ..G..AKEESDFIEA....T.LTE...EDG--VYEIT.Y
D2RWQ8_HALTV/29-117---------.V...DN...ETGEP-VD.GQ.A.ETLTVSIDA.S..GSE...KTPL....E.VSEKHGEPG--VYEAP.V
D3DI34_HYDTT/30-118---------.YI.FYT...KSNNP-IN.KKLN.LEVVPWMTEHE..HGSTE.IPKV....S.LGM...KAG--EYKITSL
D3E8S1_GEOS4/32-116---------AK...VT...QAGSP-VE.DA.N..DVEFEVTL.E..GGG.V.QAKV....P.VKH..DQGG--VYKME.K
D3EJT0_GEOS4/33-118---------FV...TE...LPEKP-IT.DA.D.IELHIAMPD.....MFCG.VFPA....E.VVE..SKPG--VYSAT.A
D3FV91_BACPE/36-120---------FL...ED...AEGHP-IE.DA.N.VSVLLDRPETV....HHM..NKV....M.HKV...EGG--LYETE.A
D3FYN6_BACPE/31-115---------SH...VT...QGDDL-VE.DA.NEVVYEVWQ...E..GQKDS.SEMI....E.ATD..QDGN--NYMLT.H
D3UXD2_XENBS/654-746---------.N..LKD...KDGNP-IT.GA.A.DKITLTDDKNELYGQNPA.PSLG....A.VREDPPGSG--IYKAK.V
O25884_HELPY/24-108---------.S...PT...LKGKA-LE.KA.I.VRVQFMMPEMP..GMPAM.KEMA....Q.VSE...KNG--LYEAK.T
O67207_AQUAE/26-107---------.E...VK........-PP.KE.I.KEFYFYMPPMP..GMNEM.RDVA....K.LEK..KGEG--VYEGF.V
YTKA_BACSU/28-111---------.A...VS...YGDEA-VT.DA.DEVEFEVWKE.....GEKDA.SQMF....K.VKQ...EKG--VYRLE.T
Q11N13_CHESB/27-115---------LV...DK...RSGKA-VP.DA.V.IFAQRVDMAPD..GMEMM.AAPI....E.AMP.STEPG--VYRFK.A
Q1QM81_NITHX/28-116---------.VRLMDT...KTGKP-VP.DA.V.IFATRLDMAPD..GMQEM.ATKI....T.QTP.GSEPG--VYKFK.A
Q20XF5_RHOPB/26-115---------LV...NK...TTGQP-VS.DA.V.IFATRLDMAPE..GMAEM.ATKI....A.LQPGSTEPG--VYKFK.A
Q30S73_SULDN/23-110---------.E...LNRGGHGGAV-VD.AK.D.VRIKFFMPEMP..GMPYM.ESKE....I.CKK...IDN--LFECN.V
Q65FU6_BACLD/29-113---------.T...VL...YGEEP-VA.DA.DEVEFECWKA.....GSKED.SELI....K.AKN..EGKG--VYSME.K
Q89KH4_BRADU/55-143---------LV...NK...TSGKT-VP.DA.V.VFASRLDMAPD..GMQEM.ATKV....T.PMP.GTEPG--TYRFK.A
Q8ELE7_OCEIH/32-115---------.E...LS...QNGES-VS.TLDD.LSVTTWMVD.......SE.TTKQ....L.VAE.NVGNG--EYSVE.T
Q92UF4_RHIME/47-135---------.VRLIDE...RTKVP-VS.GA.I.IFAPRLDMALE..GMEAM.TTAV....E.AMP.SREPG--VYRFR.T
Q98L62_RHILO/78-166---------.T..LKT...KTGAS-VE.RA.A.IAISGGMPQHN..HGLP...TSP....Q.VTD.YLGDG--RYRIEGL
Q9KDX1_BACHD/57-141---------.L...YD...ENREP-IK.DA.N.VSVTFDKPG......AVH.QLNK....I.MHH..VEDG--LYETE.V
Q9KF19_BACHD/29-113---------.L...VT...QNEAP-VE.DARE.VIVEFWQE.....GAKEE.SDMI....E.STN..EGGG--VYRVT.Y
Q2K7A4_RHIEC/32-118---------.RL.VDK...RTGKP-VP.DA.V.IFTTRMDMAPE..GMEMM.TTPV....E.AAA.STEPG--VYAFK.T
Q6N9W4_RHOPA/25-111---------LT...HK...TTGKP-VE.GA.V.IFKTRVDMAPD..NMADM.VSPV....T.ALP.SPEPG--VYAFK.T
Q81MD9_BACAN/28-112---------.L...VT...QGKEK-VT.DA.DDVKFEVWKA.....GDE.K.HEML....E.GKH..KGKG--VYAVE.K
Q81RX5_BACAN/443-524---------.T..LKD...ENGQP-VT.DM.EQIILTTQSLDM...NMGKG.SFKV....S.AVS....PG--EYEAEGM
U5LE16_9BACI/35-115---------.E...VV...QGEEA-VE.DA.DEVKFEIWQE.....GNQEE.SEML....P.AEH..TGKG--IYQAA.K

PF05751

Q1GSI8_SPHAL/8-156L.-....AEGRQRLDI..............RISRGTDEARYRIDLK
A1S6J4_SHEAM/9-149IP-S.QPISGFWEVRI................ESFDGKWRLQKRLE
Q21I02_SACD2/16-179AT-E.APIKGRHYLQLSYYVDAPKAMRTEEDPDPKVEAWRVVGELD
Q6LR37_PHOPR/8-149NS-P.EPLQGPWFIEV................EAFDGDWMLQGRVN
Q2JYE5_RHIEC/5-154V.-....AGGDWIVEA.............ISRRNGMVVMHEAKRFD
A5FGU4_FLAJ1/2-147KL-....IKGRWDVNM..............EWQYEGKKYLTKEVIY
B4SD27_PELPB/2-141IP-....FKGVWFVRI................DLVKQQLRATRKWF
A4AMY8_MARSH/2-147RL-....LDGRWDIKI..............EWEYLEKPYLFKKSIT
Q3AQV0_CHLCH/1-137IP-....YKGKWFTRL....................ELYHQQQLIT
Q3IHH4_PSEHT/8-149LL-D.GFTDGAYSVFI................EPIDGSWKLKENIT
Q16AS2_ROSDO/3-148L.-....APGNWNIRM.............SATSADGRVFRQRVILH
A7ICH9_XANP2/16-170A.-....GPGQWDLVI.............DFAQGGERQFRSKNRVQ
B5EHP1_GEOBB/13-152VS-AQSELQGVLLFT..................RGEASASQRVVFF
A3QEF7_SHELP/9-149AL-N.SPLQGSWEVRL................EGFDGTWRIQKRLE
B3EK73_CHLPB/2-141IP-....FSGTWLINV................DVATETIKTNRKWF
Q483P5_COLP3/7-147HF-D.KDISGKWKLTL................TSFENNWKIQDTLS
Q0C2U8_HYPNA/13-170DL-....HAGAWSVNIAA..........DVDPETDGFEFRASREII
Q15U51_PSEA6/17-158SA-E.NDLTGKWQVAL................MPHDQVWKIQQTLS
A7HTB3_PARL1/13-168LA-....HSGNWLVRI.............SGTGPQGETFTEEQRVF
A4CGK5_ROBBH/2-147RL-....VEGRWDLRI..............DWEYHGEKYLYRTRLT
Q5P0X1_AROAE/15-156AV-V.PLSTGRWLIQL................EDEAQTWRLSETIL
Q28KJ3_JANSC/7-153L.-....DAGRWRLRL.............TGAARDGTEYRHNITFT
Q12N45_SHEDO/8-148QL-P.ENITGTWEVKL................ESFDSQWRIQQRVN
A1U1K2_MARAV/12-154QL-L.EDVSGRWYYDL................QGPDNDWRVKGEVR
A1K558_AZOSB/15-157KI-S.PLATGRWLFQI................EDEPRAWRMNGAAY
Q3SL28_THIDA/14-155AL-P.ALPAGKWHAQL................SDDTRAWRLSGVVY
Q21DE7_RHOPB/9-164GV-....SPGQWDLVI.............EGDSTGNRMFLSKNRLV
A0LA58_MAGSM/12-165PH-....LIGSWYVQA..............TITRGDELYVYKKRIQ
Q1GDJ5_RUEST/10-155L.-....APGNWNIRM.............IARAEDGTEFTQRVILH
A4XVJ9_PSEMY/14-157QM-V.DMVTGRRFVEL..............LGEEGSQQWRLFEEET
C1DEL8_AZOVD/13-156QM-Q.DAVQGRRFVEI..............LGREGEKDWRLFEEKT
A8LQC6_DINSH/7-152L.-....DGGNWNIRL.............VAQAEDGTQFRQRMVFY
A5WG98_PSYWF/20-178HI-DLDGLESKYYVQV...............SNEGKLNWRLREVGK
Q2VZ04_MAGSA/6-160LP-....LSGVWDMTL..............LASAKDTPYSVLRRIV
A1B346_PARDP/3-148L.-....APGTWNIHL.............TATAPDGTVFRQRIDHY
A1STG2_PSYIN/11-150QS-E.QLLSGKWQIRI................EPFDKSWRLQKRVA
Q5E598_VIBF1/7-148TL-Q.EPITGPWFIEL................LPHDSSWMVQGRIN
Q9A8E8_CAUCR/16-164..-....LGGAWDLRA..............TARDAQNAFELEARLV
Q2RP26_RHORT/6-166LP-....FAGQWEVRV..............VATRGQAVFRMRDRFV
Q4FTN2_PSYA2/18-175QV-DIDPLKAKYYLQV...............SHEGKDDWRMQD.VA
Q0A7G7_ALKEH/19-161QV-R..AVSNRRYLHL................EPLDGRWRIIGELD
Q7NYV3_CHRVO/14-158KI-P..VNANHWYVQL................EDHDKKWRIQGEWK
A9CIZ0_AGRT5/11-160M.-....LPGQWIVEV.............TAVKEGRIIVHEGTRIA
B0SVV1_CAUSK/10-158..-....LAGAWDLRA..............EARDGQNLLEIETRLV
Q989H7_RHILO/9-158P.-....RDGVWIVEV.............DADAGLTEPYRDVRRIM
A6GYS4_FLAPJ/2-147SL-....VGGRWDINM..............EWQYDGKSYLTKEIVY
Q47I57_DECAR/16-158KL-A.AEVTGRWLVSI................EDPAGQWRLQGEWQ
Q5QYZ3_IDILO/7-149DI-P.EEIEGKWTITV................EPFNEVWKVSEKYQ
Q0AQJ0_MARMM/6-156CG-....EAGDWRLRV.............HTVDGPPFEMMHALRLP
Q082F5_SHEFN/9-149PL-D.AAITGPWEVRI................EGFDAKWRIQQRID
Q7UQF5_RHOBA/18-174MP-....QQGLWQLEV..............TVDGAGEPMTLSRTLE
A3HZP4_9BACT/2-140KL-....KAGYWKAQL..............NWEENGVAYYQEKKMT
Q5LMP2_RUEPO/4-149L.-....GDGNWNIRM.............VARAEDGTEFVQRVVLH
Q2SJS8_HAHCH/16-158IM-P.SPIEGRRYIQL................SDADGTWRLKGESW
A7ZBM8_CAMC1/4-151L.-....KEGRWQLLL................RLNDKQDTRYYKFD
Q2G564_NOVAD/9-156..-....EAGRWRLRV..............TVEAEGKVWRTVGEVL
A4G5L0_HERAR/19-162AL-P.VLEMGRWQVLV................ENEQRDWRLNGHWS
A0KKM1_AERHH/7-147KP-....LTGKWHVRV................DAFNHEWRLQETV.
B7VNQ0_VIBSL/7-147HE-....MQGPWFIEL................SPHDSEWLVQGRM.
D5ARP9_RHOCB/3-145L.-....APGAWLIHL.............SATSADGVLFRQRL...
H7C6J2_BRADU/5-157SV-....APGQWDLVI.............EGEARGTRVFLSRNR..
M1FE17_9ALTE/12-150EN-....IEGRWYYDL................RGPTNEWRLKGEA.
Q3J017_RHOS4/3-147L.-....ARGKWMLRV.............EATSPSGTAFRQRLD..
Q4KFE8_PSEF5/12-155DQ-....VEGRRFVEL..............LGVEGDKTWRMFEE..
Q5F7Y6_NEIG1/12-159TL-...PPANHWYVRV................EDAAGVWRVENKW.
Q7MKV3_VIBVY/7-147HK-....MEGPWFIEL................QPHDQKWLVQGRV.
Q88F39_PSEPK/12-153DK-....VDGRRFVEL..............LGSEGGQVWRLFEE..
Q9I3G7_PSEAE/12-155DA-....VEGRRFVEL..............LGQEGSGQWRLFEE..
Q9KS23_VIBCH/7-147NE-....LQGPWFIEL................TPHDGQWLVQGRV.
V6F3Y5_9PROT/13-164LP-....LAGVWDMDV..............AAVGEGVAYQHAQRF.

PF13115

Q746W9_GEOSL/44-126TF.P---AKGAYRLTV-----------------------------V
A1VWA5_POLNA/163-251KF.S---MTGWWEVKL-----------------------------A
A5V049_ROSS1/45-129LY.S---MEGDWRITV-----------------------------V
A6LXM8_CLOB8/40-131NF.T---DKGKWVITA-----------------------------N
A6Q3F7_NITSB/22-102KL.P---MAGTWQVHI-----------------------------F
A6Q5F8_NITSB/58-139QL.P---LEGRWNIEL-----------------------------K
A7HPZ4_PARL1/27-116KI.V---MAGRWALTI-----------------------------E
A7IP68_XANP2/27-115NL.M---MAGGWRLSL-----------------------------G
A8EQX3_ARCB4/26-110NF.C---MNGTWQYQL-----------------------------K
A8FGJ5_BACP2/27-111AF.K---KDGLYIIQV-----------------------------H
A8HZ24_AZOC5/116-197NV..---HAGQWELIV-----------------------------D
A9B390_HERA2/31-114IY.T---MGGAWAVSV-----------------------------F
A9B7Z4_HERA2/24-105DF.S---MLGEWVLIV-----------------------------N
A9WES2_CHLAA/30-114AY.T---MEGLWEITV-----------------------------V
B1LY15_METRJ/27-114KL.S---MQGRWRLSL-----------------------------A
B1WYP1_CYAA5/497-584FL.G---MKGEWSISV-----------------------------E
B1YKE0_EXIS2/156-236SL.T---HPGKTIIRL-----------------------------H
B3EK73_CHLPB/46-128PI.P---FSGTWLINV-----------------------------D
B7GLB0_ANOFW/24-107TF.E---TKGTYAVVA-----------------------------H
B9EAD1_MACCJ/40-124NF.K---EDGTYNIIS-----------------------------H
B9K633_AGRVS/26-114NL.S---MEGGWRFQV-----------------------------A
B9L0M8_THERP/30-115RF.T---MAGDWIIIA-----------------------------R
C0QPP0_PERMH/30-115NL.S---MSGTWQITI-----------------------------V
C0ZAX9_BREBN/28-112TM.N---EPGSYFVYY-----------------------------H
C0ZAX9_BREBN/159-241QF.P---TAGDYTVKV-----------------------------H
C1F725_ACIC5/414-503RL.G---SGGTWQVTI-----------------------------T
C3KQE8_RHISN/26-114NL.S---MEGGWRFKL-----------------------------A
C4L0I5_EXISA/150-231TF.A---ESGAYNVQV-----------------------------H
C5A944_BURGB/61-150KF.S---MPGWWTITL-----------------------------K
C5D7X8_GEOSW/26-109TF.T---EPGTYSVIS-----------------------------H
C6D1K7_PAESJ/33-118YL.P---MNGDWRAIV-----------------------------S
C8X421_DESRD/182-271KF.H---MPGWWRVIL-----------------------------T
C8XBL3_NAKMY/492-575DL.P---LSGQWTIAI-----------------------------S
D1C6E0_SPHTD/29-114EF.T---MGGDWILTA-----------------------------R
D1CB68_THET1/449-533YF.G---IAGDWQVQI-----------------------------V
E3I1Y9_RHOVT/22-110DL.T---MAGSWALKL-----------------------------M
E6U1E9_BACCJ/34-124VF.S---EENLYFVQP-----------------------------H
D2RWQ8_HALTV/29-117IF.T---EPGEYVVHL-----------------------------E
D3DI34_HYDTT/30-118TF.T---MPGKWQIYV-----------------------------K
D3E8S1_GEOS4/32-116TF.E---EAGTYRIVS-----------------------------H
D3EJT0_GEOS4/33-118IP.V---MQGLWEAEA-----------------------------V
D3FV91_BACPE/36-120IF.S---LPGTWIGMV-----------------------------E
D3FYN6_BACPE/31-115VF.E---EEGRYHVQT-----------------------------H
D3UXD2_XENBS/654-746TAGQ---KKGTWKITP-----------------------------A
O25884_HELPY/24-108NL.S---MNGTWQVRV-----------------------------D
O67207_AQUAE/26-107NI.S---MDGPWEIRI-----------------------------M
YTKA_BACSU/28-111TF.K---EDGVYTVQS-----------------------------H
Q11N13_CHESB/27-115QI.S---MVGGWRLSL-----------------------------G
Q1QM81_NITHX/28-116TF.G---MAGRWQLSL-----------------------------G
Q20XF5_RHOPB/26-115TF.G---MEGKWLLSL-----------------------------G
Q30S73_SULDN/23-110NF.A---MNGTWQYQL-----------------------------F
Q65FU6_BACLD/29-113AF.P---EDGHYKVQV-----------------------------H
Q89KH4_BRADU/55-143TF.G---MAGRWQLSL-----------------------------G
Q8ELE7_OCEIH/32-115SF.D---QDGIYHMKV-----------------------------T
Q92UF4_RHIME/47-135DL.G---MEGGWRFKL-----------------------------A
Q98L62_RHILO/78-166KF.T---MSGWWQLRF-----------------------------A
Q9KDX1_BACHD/57-141IF.S---DGGHWIGEL-----------------------------A
Q9KF19_BACHD/29-113EF.P---EDGLYFVQP-----------------------------H
Q2K7A4_RHIEC/32-118DF.T---MAGGWRFKL-----------------------------.
Q6N9W4_RHOPA/25-111DL.P---MAGRYQVTL-----------------------------.
Q81MD9_BACAN/28-112TF.E---TDGVYHIIA-----------------------------H
Q81RX5_BACAN/443-524YI.N---MTGNWNIQV-----------------------------H
U5LE16_9BACI/35-115TF.G---KDGDYIVQV-----------------------------H

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window