Sequence alignment for CL0489

PF13144

D3VCD6_XENNA/99-221GPYLVSKRT--IHRSAVL---------TEKDFQIK--TGSLDKLP-N-DII-RN------------------RK--A--I
C5AEH4_BURGB/386-508GNYYVAAHA--LAPGDVL---------TAADLVAH--EGDLTMLP-L-AVI--TDP----------------AQ--A--V
B2JJ15_PARP8/300-422ATYFVAARS--IAPGELL---------SSSDLVAR--DGDLTVLP-Q-AVI--T-------------------DASQ--V
Q82XH3_NITEU/106-228TRVVHAAQP--VSMGKQL---------EAQDIVSK--EADLVRIP-G-EVA--TD-----------------PD--Q--V
Q1GZW7_METFK/111-233AEYLVAAAP--LAQGHII---------TEQDLAKS--HGDLAKLP-P-GVF--T-------------------DASQ--A
C6XBV3_METGS/118-240GQYLVAAAP--LAQGRVV---------DSGDLLFE--SGDLAQLP-P-GIF--TD-----------------PE--Q--A
C6WVB1_METML/141-263AQYLVAAVP--LAQGRVV---------TADDLLFQ--SGDLTQLP-A-GIF--T-------------------DLAQ--A
C7RLC6_ACCPU/110-232GTYLLTARQ--LTAGQIV---------ADSDVLMQ--GGDLGALP-A-GVL--T-------------------DPAQ--A
D5CMW8_SIDLE/115-235VDMLVASRP--LAQNTVL---------SASDFRLQ--NGELGQ-P-G-ILI--D------------------PQ--Q--A
Q7NZC3_CHRVO/97-219RLGVVLNRA--MMAGETI---------SGGDVRLV--DISNPALA-G-NVL--T-------------------DASQ--A
Q8EC91_SHEON/113-233FPVVVATEP--LAPGELI---------SPTQVEIR--YVDQNSLR-GMQFS--D------------------IN--Q--L
Q12PP0_SHEDO/113-233YPVVVADNV--LSPGALI---------TRDSLNIA--FVDQYSLR-G-QFF--TE-----------------IE--Q--I
Q085Q4_SHEFN/113-233YPVVVANQL--LSPDQII---------GEHHLQVM--YVDQYSLK-G-QFF--S-------------------DITT--L
A8AKH6_CITK8/134-257LPVVIAKNS--LERGQVL---------SASDVSIK--KLNISSTR-G-NYL--TD-----------------PD--E--A
O26012_HELPY/96-217MQAFKSVSA--IKKDENI---------TANNTQKE--RILFGALS-N-PLL--E-------------------G--A--I
D3UGB6_HELM1/98-220LKVVFAKIG--IKKSQDI---------TKENTLIK--TIPLGALQ-N-SPI-GL-------------------S--D--I
Q7VGG2_HELHP/182-304LEVLKSTQN--INVNDTL---------TPQNTRAE--RITFERVG-A-EYI-ST-------------------Q--E--I
Q30RI0_SULDN/167-288VEVYKSKDS--LKKDTNL---------SPSNTFKK--SVRLDRFR-D-KPL--Q-------------------N--I-YK
A6Q2L6_NITSB/116-236ANVVVAVHD--IPRGSLI---------QKKDLAVQ--KMV--THG-K-NYP--D------------------LQ--E--I
Q2LT22_SYNAS/119-242RDVALSARP--LERNRNI---------SEHDILIV--KKWFSRLP-Q-DLL--AD-----------------PE--R--I
A7HLB5_FERNB/194-315RKIAVSKRR--IEKEEII---------GLNDVEFV--EYNIYSLNKM-PVF--E-------------------E--D--L
Q1MQD1_LAWIP/205-326QPVPSVGKP--LNRGDYV---------NPEDVTWI--NKNIAFLR-D-DIW--D-------------------G--K--G
C6C0E1_DESAD/212-333KPVPCPVRP--INRKELV---------TPDLITWK--SKNMAHLG-N-QVW--D-------------------G--K--G
A1T0H6_PSYIN/110-231MAVATTASS--LPRGHSL---------QPEDIVFR--EQRIRN---N-DYY-PN-------------------V--A-GL
B5YIX3_THEYD/106-229TRVYITQIP--LKRGEVI---------TEEKIMEI--KQPLSRLPVG-AIT--D-------------------K--N-LL
B9M0F7_GEODF/101-224AEMVVAVRP--LERGEVI---------DAADVAVQ--KRGLSRLQ-G-RFV--RD-----------------VD--E--V
A5G8Y0_GEOUR/113-236ADVVVAVRP--LERGEVI---------GNGDIAVQ--KRDLAKMQ-G-KTC-RT------------------AE--E--A
A1AUM2_PELPD/113-236VDMVVTVRQ--INHGSVI---------TTADLALR--KQDIAAVQ-G-RYLART-------------------E--D--A
B3EAV3_GEOLS/118-241TEMVTASRQ--LLAGTVL---------TEADLQLQ--KQDLAQAG-G-LPV--KN-----------------IT--D--A
B8FK20_DESAL/199-322APVVVATRK--LDRMDVL---------TAGDVTVE--MRNLSRLP-D-GVV--T-------------------DPKE--V
C0QA41_DESAH/185-308DRVVCATRN--LSRGEIL---------APKDLCLK--RINVSKIP-D-NYL--TR-----------------LD--S--L
A4YXW0_BRASO/195-318VEAVVLTRN--IDRNEVI---------RAGDLQTE--RRPKVELGGAEPAS--R-------------------E--L--A
Q218W9_RHOPB/216-338VDAAVLARG--VERNEVL---------KSSDVVVE--RRPKAEIG-G-DAA-SR-------------------D--D--A
Q89I10_BRADU/194-316VEVAVLTRD--IDRADLL---------KSSDVALE--RRPKAEVT-G-EAA-SR-------------------D--R--T
Q6N2Z6_RHOPA/206-328VVATVLTRP--VQRNEVI---------KVSDIVIE--RRPKSEVA-S-DAA-SR-------------------D--A--A
Q2W1H7_MAGSA/190-313ARIPVLAHA--MGRGDVI---------REDDIQWV--DVREEVVR-R-DII--S-------------------N--ARML
C5BRR4_TERTT/102-225EEVVIAAGA--IGRGAQI---------TAGDVVTQ--RMNTSHLT-G-GYL--R-------------------D-PA-RV
Q21IK3_SACD2/118-241SEIVVASRT--LRRGATI---------SEADLNVQ--VINIARYG-S-GHV--Q-------------------D--AQRI
A4XW92_PSEMY/127-250RQVAVLTRP--LKRLSVV---------KASDLSMV--ERDVGQLA-Q-GYL--T-------------------DPTQ--A
A4VJC5_PSEU5/125-248RQVIVANRS--LLRDSRL---------SEADVSLA--ERDVSNLT-Q-GYL--TR-----------------MD--E--V
Q885A9_PSESM/123-246RNVVTVMRP--LKRDAIV---------TEEDIAMR--ERDVSSLG-Q-GFL-AS------------------LD--Q--A
A1WUE8_HALHL/136-260TEMVVATRN--LRRGQRV---------SAGDLRTA--TRDARRIR-G-EFY--R-------------------D-PA-PL
Q0AA93_ALKEH/113-236VEVLVAARP--LRRGERL---------RADSVTTE--RRQLASLH-R-PYE--TE-----------------AE--H--L
B5EEG7_GEOBB/121-244ADMVVAART--LERGEVL---------LASDLSVA--KRDLSLAR-G-GYL--KE-----------------PD--E--A
B7VKL6_VIBA3/126-246VPLVTTTRS--LARGEIV---------GQYDVTTA--MISLNKFRRQ-GFT--T------------------PQ--Q--V
F9ZN65_ACICS/101-224QKIVVAAHS--LTAGTVL---------TAGDLALM--PGNAASLA-G-TPL--SS-----------------LS--E--A
M1FC75_9ALTE/108-230GQALVASRP--LARGERL---------RADMVSLQ--TVVVNASR-R-GTI-AK------------------AQ--S--I
A0A5P8YL94_YERPE/108-230GRYAVAVRR--LAAGEKI---------SAQDIQMK--QGRLDTLP-P-GAL-LD------------------AH--F--A
Q0WIV5_YERPE/108-231LPIWVAKQT--LERGRKV---------QADDIELK--KKNITGVQ-G-GYI--TD-----------------PD--E--I
Q5E3M1_ALIF1/133-253MPLVTAISS--LSRGHTI---------SSSDLTLT--MVNSRTYQRG-GYI--N------------------VD--D--L
Q6LTR6_PHOPR/113-233LPRVVAATP--LARGLVL---------NASHLSVK--LVESRFQR-G-IVF--EQ-----------------PA--E--I
Q9HYP6_PSEAE/107-230RQVVVAVQP--LKRAHVL---------EDADIALV--ERDVGLLT-Q-GYL--T-------------------DPAR--V

PF08666

Q88EQ9_PSEPK/126-187-DVVVVTRP--LKRDNTV---------GEGDVALR--ERDVGTLG-Q-GFL--TE-----------------LD--Q--A
Q30WJ5_DESAG/229-289TGVPAAAFP--VNRGDLL---------GPDAVTMV--RKNRA-FM-R-GDP--WDG------------------------
UXAA_BACSU/11-82DNVLLALRD--IQKGERLH-------AYGVSIEVK--DDIKRGHK-I-ALQ--SIKEND---------SIVKYG--F--P
Q3ACL1_CARHZ/14-89DNVATVIED--INLGDVV--------VFEILGKTQ--EIIAR-EN-I-PIY--HKIAIKEVR---VGEYVYKYG--Q--K
Q6L322_PICTO/14-89DNVATLLEG--SKAGEKV---------QLKGLTCE--KSI---IC-N-QDI--PSGHKIAIKNIKLGESVIKYG--E--I
Q726U8_DESVH/286-344RRGLYARTR--LAAGHIL---------RAEDVTAL--RP-----V-A-ALP--ASA----------------LD--A--V
O05573_MYCTU/54-116SEVVVAAHD--LRPGTAL---------TPGDVRLE--KRSATTLP-D-GSQ--AD-----------------LD--A--V
PSEI_HELPY/279-337ARSLFVIKD--IQKGEAL---------TENNIKAL--RP-----N-L-GLH--PKF----------------YK--E--I
FLGA_AQUAE/101-160CRVLVAKRD--IYPGERL---------NFSNVEER--EIYLE-RC-P-QNF--KEN-----------------------F
O83573_TREPA/310-372NRSLHYLHA--YPRGTVL---------QKENLVIV--RSEAN-LS-A-GEA--PEH----------------AN--L--F
FLAD_CAUVC/127-187VEVLAYARS--LSAGEIV---------QPQDLIWV--KMA--GAP-A-DAP--RDA-----------------D--A--V
SPSE_BACSU/303-365YRGIFTTAP--IQKGEAF---------SEDNIAVL--RPGQK--P-Q-GLH--PRF----------------FE--L--L
GARD_ECOLI/22-92DNVAIIVNDNGLKAGTRF----------PDGLELI--EHIPQGHK-V-ALL--DIPANG---------EIIRYG--E--V
FLGA_SALTY/95-157GNYVAVAAP--IARGGKL---------TPANVTLK--RGRLDQLP-P-RTV--LD-----------------IR--Q--I
UXAA_ECOLI/10-81DNVAVALAD--LAEGTEVS-------VDNQTVTLR--QDVARGHK-F-ALT--DIAKGA---------NVIKYG--L--P
Q2RLM1_MOOTA/49-111TQVIVPAHN--INAYTQI---------KPGDLTWR--QVPVGAVE-P-GTA--RKP-----------------D--D--L
Q2RLM6_MOOTA/36-97VEVVKAVRF--IPAGERI---------TADSITTV--RVPES-MA-S-GLA--TNP-----------------K--D--L
Q2SBN4_HAHCH/292-350RRSIYASRD--INAGETI---------TENDIIAK--RPG------L-GIS--PIF----------------WD--Q--V
Q2W0T1_MAGSA/43-111VEILIINRD--VPSGAAL---------AGDDLRYE--SWPKAAVS-P-RLV--TRKPG-----------EDSKA--A--F
Q2W9F8_MAGSA/290-348RRSLYVVED--LHPGEII---------TEDKVRSI--RPG------Y-GLE--PKF----------------LP--E--I
Q2WB91_MAGSA/292-350RRSLFAARA--LAAGAVM---------TEEDLIAL--RPG------G-GIS--PMQ----------------VD--M--V
Q2Y6G9_NITMU/29-91ATVIVASRD--IDVGTRL---------TPDMLQPS--DWPRATVP-E-GSF--QDA-----------------K--L--L
Q2Y9F0_NITMU/124-186AEYLVSTRP--LRQGQVI---------DASDLTSR--KGDLTQLP-P-GIV--TD-----------------WN--Q--A
Q2YJ36_BRUA2/19-88DDVAVARVP--VRAGDPI---------GIDEITAR--ELIGRGHK-V-ALR--AIPAGR---------EVLKYG--Q--V
Q30V22_DESAG/280-338RRSVYAAQD--IAAGQLF---------TEDNLTVL--RP-----A-H-GVC--ATR----------------YE--D--F
Q30W96_DESAG/291-350YASVVAIRD--IRAGDIL---------SKDNIWVK--RPG----T-G-EIL--ARD----------------YE--R--V
Q30YU0_DESAG/42-104VMLAVAAAD--MTKGTRI---------RAEQITMA--EFLLQTAP-A-GAF--SSA-----------------D--E--L
Q31EV3_HYDCU/54-117HSIVVASRD--IYRGEKI---------EADDVKVL--NVPMEGLV-V-KGV--IIN----------------PQ--N--A
Q39YJ9_GEOMG/112-173DTVVVLRA---LERGDVI---------GAADVTVQ--RRDLS-TL-T-GRV--YRS----------------AD--E--V
Q3A3R8_PELCD/46-108TEIVVAAAD--VNIGTRL---------DQTLLAMA--QWPKASVP-K-GAF--ED-----------------IE--Q--V
Q3A5F3_PELCD/116-177APVAVAAAD--LPRGTIL---------QAEDLSMV--TMDLAGLR-A-PCL--DAQ--------------------Q--M
Q3ACP5_CARHZ/12-87DNVATAVQN--LSKNEEVLVD---VNGKELRIKLI--DNIPFGHK-F-ALK--EIEMGA---------NVVKYG--E--V
A6TKR5_ALKMQ/11-82DNVVVALTD--LKNGEIIE-------LGDLQVVLQ--EEIKRGHK-F-ALK--EITQGE---------HILKYG--A--P
Q3IDV3_PSET1/113-175APVVVANVN--LARGEVI---------TAAHLSIE--MRSTHFIR-V-QYL--DNP-----------------A--L--L
Q3IY78_RHOS4/16-74AETVVAART--VRALSIL---------GPEDLALA--PQD----M-P-GAL--AE-----------------LS--Q--A
Q3J1Z1_RHOS4/353-418GVVAVAKRD--LKAGEVL---------DGIGGFTA--YGQ--CEN-M-ETF--VSEQL------------LPMG--L--A
Q3J7R0_NITOC/110-172GKVLVATHS--ISSGFPL---------SLVDLRLE--RRDLSELR-Q-GYL--NEP-----------------A--Q--A
Q3SID7_THIDA/113-175AAYAVTRHP--VPANHVL---------TEADLTLR--EGNL-GNL-P-TDV--ARD----------------VG--A--L
A8L8R3_FRASN/61-126RQWVVAAAD--LPAGHIV---------VDSDLTTA--TA----HL-D-GAM--SDRYYP----------GDRRS--E--L
A8L8Y3_FRASN/55-120ADAVVLTRP--LNRGELI---------ETGDLAIA--RVSVEGTG-V-RLA--SPQA--------------ARE--S--L
A8L6N9_FRASN/66-128EPVLVLARP--VTVGHVL---------VAADVREV--RVAAD--G-V-DTV--PAG---------------ERD--S--V
Q3Y3F8_ENTFD/15-86DSVVVALTP--IPKQTQLT-------IDQQTITTL--EDIPQGHK-I-ALG--DLKAGD---------NVIKYG--Y--P
A6W5H2_KINRD/344-409EVVTTAKTD--LAAGKEI---------DRLGGYDS--YGVA--ET-Y-AIT--KAQNL------------LPMG--V--A
A6WH12_KINRD/89-151HDVLALARD--VPAGQKI---------TAEDLRVA--EVN----G-S-GFS--AVIK-------------EHAD--Q--V
FLGA_AGRFC/36-98PMALVPVRT--IYPGEAI---------SPEQVKSV--EVTNPNIS-A-GYA--SD-----------------IS--E--V
A3DD33_HUNT2/49-113IVVVKASGG--IPANTLI---------TKDNIGKY--SIIRK-EF-N-DDM--ITYD--------------KVD--S--I
Q4FMC1_PELUB/347-412DVAAYAKKD--LKIGERL---------DGEGGFCA--RG----KL-I-TSK--KSKDEK----------ILPLG--L--T
FLGA_RHIME/42-104PTAVIPKQT--IYPGEKL---------DASMLEVV--DV-----T-N-PDL--RDGYV------------RSID--E--V
Y1065_METJA/277-335RRSIVAKRN--IKKGEYL---------SVDNISFK--RPG------R-GIE--TKY----------------LS--I--I
Q5KYJ2_GEOKA/13-88DNVATALDF--IPAGSVVKIT---YQNREQDITIK--QPIEFGHK-F-AIV--PIKQGE---------DVLKYG--E--V
Q5QUG9_IDILO/118-180KNVVTAASP--MAPGQMI---------SESDLVFS--EVDLNRVR-S-NVF--TD-----------------MT--A--L
Q5WIW4_BACSK/10-81DDVLIVLNE--AAKGDVIS-------VGQQQLELA--EPVERGHK-V-ALR--DIREGE---------PVLKYG--F--P
Q5WKX1_BACSK/12-83DNVIVSLKD--LQKDQRIQ-------FKEEHIPLS--RDVPSGHK-I-AIR--DIAVGE---------DIVKYG--F--P
Q5YPT3_NOCFA/56-118IPVVVAARE--LPPGTVL---------AAADLTVA--PHEAGSLP-A-GAV--RDP-----------------A--V--L
Q67SH0_SYMTH/35-97FTVLTVVRE--VPPYTPV---------GPDAVQFA--AVPRE-SV-P-ADA--ITD----------------PS--A--L
W4TZD3_CUTAC/51-114DQVLVMTRA--VGQGDIV---------RNADIGLT--SVAVDRAV-A-TIP--ASQ----------------LD--K--I
Q6AJR9_DESPS/191-252APVLVAREA--LRRDTEL---------SPNNFSII--RRDISNIS-D-PLF--SAR--------------------Q--A
Q6AN09_DESPS/44-106TDIAVAVKD--MSRGSKI---------GSEDVQMA--TYLQETLP-S-GHF--TD-----------------LE--Q--V
Q6D6I0_PECAS/98-160GNYVISSRP--INRGTAL---------TEKDISLT--KGRLD-LL-P-LRP--ILT----------------LQ--G--A
Q6D931_PECAS/45-111VAVLVAAKA--LHPGDFI---------DSASLRWD--ETD----K-P-VSR--TFNFIR---------GKDSQS--L--L
Q6FFQ4_ACIAD/13-84DNVAIVVNDHGLEKQTVI---------EEYQLTLV--DDVPQGHK-V-LLK--ALKKDE---------AIIRYG--E--I
Q6LH47_PHOPR/14-85DNVIVALKR--LHSNTNIV-------ISGRKISLK--QEVEKGHK-I-AVS--DIKQGQ---------MLIKYG--E--Y
Q6LW32_PHOPR/128-190RQLVVAKMT--LNRHQEI---------TPLMLSMK--RSNVAYLR-H-GYF--TSK-----------------Q--A--L
Q6MBR1_PARUW/291-349RPSLYFVED--LEQGEKI---------QLHHIRSV--RP-----N-K-GLP--PKE----------------ID--K--I
Q72F65_DESVH/294-352RRSLVAARA--IPAGKVL---------EPADLTWK--RP-----A-H-GIS--PRC----------------YD--E--V
Q74B32_GEOSL/292-350RRSLVTRRA--LPQGHVL---------VEADLDAK--RPG------T-GIS--PAE----------------MT--Y--A
Q7M7S8_WOLSU/280-338KRSLFVCEK--IQKGERF---------TPKNLRSI--RPG------H-GLP--PKH----------------LN--E--I
Q7N5N4_PHOLL/95-157GNYLVTRRA--ISRNDVL---------SDKDFQVR--RGLLERLP-H-DLV--INK-----------------N--E--I
Q7NR94_CHRVO/277-337RRGVFATRP--VAAGEAL---------TADNVSFA--FPP---VE-G-QLT--ANE----------------WS--K--Y
Q7NXC7_CHRVO/112-173ARVAVAARD--LPAGVAL---------APQDVAWA--RRPV-GDP-A-DLF--GQA-----------------S--P--P
Q7UGK2_RHOBA/68-130VEIFVTAKT--IDIAEEI---------TADKIRLE--QWPADRVP-T-GAS--GK-----------------LE--D--V
Q7UJ28_RHOBA/334-396TAVVVARRP--LQRGHRV---------GPGDVHFQ--PSPVN-EL-S-GDR--VMD----------------VD--E--V
Q7UKI4_RHOBA/121-189DNVWMAAWA--LVAGETI---------GNLRIAGS--AVPA-GHK-V-AAQ--AIPAGE---------LVIKFG--Q--P
Q7VHQ5_HELHP/291-349ARSIWVSAD--IKKGEKF---------THKNLSVV--RP-----S-G-GEH--PRY----------------LH--K--I
Q7VVV9_BORPE/50-114VASLVAALD--LEAGTPL---------HDELVAVR--DMPQAWLP-A-GAL--LPD---------------EAA--R--L
Q7VX28_BORPE/49-109YPVVVAGKP--IAAGDRL---------AADLLKIE--RWPVQ--P-A-NGY--AES-----------------E--A--L
Q7VYH0_BORPE/112-174GQYYVAARQ--IAPGKTI---------EAADLTTR--DGDLVALP-P-GVI--TDA-----------------A--A--I
Q82IA2_STRAW/13-75VAAYRLRND--IAPYKEL---------SADQFEKV--SMPRR-WL-S-KTA--VTD----------------LA--Q--I
Q82RG0_STRAW/65-128TEVVTVARD--VQVGQVL---------SEEDLGKA--SIALD--P-A-VKA--VRAG--------------DLD--S--V
Q83GV3_TROWT/38-99SQVYVATRP--LSIGDKF---------DAKQFSIV--EANLG--A-N-LDK--YIT----------------PG--S--L
Q87M38_VIBPA/44-106HPVVVATME--LEPGTIL---------DEKHLTTK--LMEVD-WI-D-DET--LKV----------------PE--Q--A
Q893U6_CLOTE/293-351IRSLVVNRD--IMKGEVI---------KKEDLVAL--RPG------Y-GIK--PYD----------------KE--K--I
Q89HL9_BRADU/296-354AKSLVAARD--IEAGTVI---------SDDDIAVK--SPG------Q-GLS--PLK----------------MP--A--L
Q89PI8_BRADU/60-126VGYFVAARP--LSRGTLA---------RDEDFAVR--SALPERLP-A-GAI--LETP-------------DAKA--G--L
Q8A711_BACTN/288-346ERSIATRKY--IPAGSII---------QESDIHLL--SPG------D-GYK--WID----------------KK--N--V
Q8AAH9_BACTN/12-83DNVAVAIVN--LPAGEHLS-------VDGIEITLN--EDIPAGHK-F-ALK--DFAEGE---------NVIKYG--Y--P
Q8D3G4_WIGBR/100-162TEYYVASKL--IRSGTII---------SEKDIKIV--YGNTKNIP-Q-NII--LSN-----------------Q--K--I
Q8FR13_COREF/43-105PRVVVFSRD--IPAGTEI---------TDQDLELR--RIPAD-LV-P-DQV--IRI----------------PE--E--A
Q8G440_BIFLO/63-125EPMVVAARS--IRRGDII---------LAADVQLA--DMPVS-AI-G-PSW--ACN----------------IE--D--V
Q8NS06_CORGL/43-105PTAVVIVQE--IPAGTKV---------EASDLGLQ--AIPTSLLP-S-TSY--DS-----------------ID--D--V
Q8R8C9_CALS4/30-96VNVVAAAKP--INAGTVI---------TQDMLTTK--SIPAS--L-A-ADL--VKN----------------PQ--E--I
Q8RIB8_FUSNN/291-351RRGIYITKS--LKAGHIL---------SREDLIAL--RPI---KI-D-GIQ--PYE----------------ID--L--L
A9CKJ4_AGRFC/46-114VNVLISSVN--LPVGSRL---------NDSSMRWT--PWPQGNVV-D-SFI--TQAKR-----------PDAIT--E--L
Q8XQX9_RALSO/47-107YPVVVTVKP--LEAGKPI---------TADQVGVE--SLP---IN-P-ADA--FSE----------------VN--K--V
Q8XSX6_RALSO/171-233GTYYVAARQ--LPPGKTL---------DMGDLEAR--TGDLSALP-P-SVI--LQP-----------------A--D--A
Q97H26_CLOAB/292-350SRSLFVVKD--IKKGETF---------TKENVKSI--RP-----A-F-GLK--TKY----------------IE--E--V
Q97HN6_CLOAB/39-101KDVIIASKD--IKQGTAI---------DKSSLKKV--EYYRECVN-S-DSV--TN-----------------ME--Y--M
Q97L66_CLOAB/11-82DNVVVALND--LNKGDVIE-------IDGKVITAE--EPVKKGHK-I-AIT--DIQKNS---------NIYKYG--F--P
Q97YR1_SACS2/11-89DNVGVAIAD--IKTGQEVEGIYIEDMTQGPKIKAI--SDIPLGHK-I-ALK--DIRQSD---------IVIKYG--R--P
Q9ACY4_STRCO/61-124TRVLALARD--VPAGQAL---------TSADVTVA--EVSADAAL-S-PLP--ATD----------------KS--S--V
Q9CMH3_PASMU/50-121ITLAELKRD--IKAGSLL---------QVEDYSLT--EI---KVT-E-DNP--LTNNDLTD-----VLALSKFK--T--L
Q9HW95_PSEAE/56-116KPVLVASRD--LPALAVI---------GRDDLSVE--LLRTA--P-V-GSY--DRP-----------------E--A--L
Q9KQ04_VIBCH/133-195IPLITAATP--LSRGQMI---------SAQDVTLS--MVDLLRFR-R-QGF--STP-----------------E--N--V
SIAS_DROME/312-371GKSIVAARN--LNKGYRL---------QLADMAIK--VS----EP-S-GLT--AED----------------FL--D--L
Q9X1M7_THEMA/158-220RNVVVLKRN--INVGDVI---------KEEDVRLE--KRNVF-EI-Y-GEP--FFD----------------VS--E--V
A9W9R9_CHLAA/350-414-TVAYAKRD--LYPGEVI---------DALGGFTV--YGM------I-EQF--EKAHRD---------GEVPLG--L--I
A9WEA1_CHLAA/52-115-SVVQARVD--LEANTLL--------NDPSLLDVV--EVP------V-TEF--DEANE-----------FSNIN--D--V
A9WH46_CHLAA/47-108-PVVILARD--VPYGQQI---------SADDLAVV--LLPRH-RP-V-QLT--GIS---------------SPA--L--A
G1UB98_HAEDU/57-126-TTVTLNHD--IEKGTLL---------QPEDYTVS--ELTVP-EN-S-PLV--ESDVKEL-------VDSAANK--S--L
Q5ZX25_LEGPH/110-170--VLVAKRA--LLKGTKI---------SNSDIYQT--ELDVQKLK-Q-GYF--TDS-----------------K--E--L
Q5ZXG3_LEGPH/301-358-TCLVAKQK--LQPGSLI---------SLDNTTFA--FP-----C-K-GVP--TQY----------------WD--L--V
NEUBH_LEGPH/298-355-RSITLRRD--LVKGAQI---------SKEDLILL--RPG------T-GIA--PSE----------------IS--N--I
Q63I81_BURPS/38-97-PVAVAATD--VSLGEPL---------GPNQLRIV--NWPTASVP-P-GAF--TD-----------------LK--P--L
Q63M73_BURPS/17-88DNCLIAATR--LCAGQAVT-------IDGERVVLA--QTVELGHK-I-ARA--PLAAND---------KVLRYG--A--P
Q63YB9_BURPS/184-244-TYYVAARQ--IAPGETL---------TAADLVAR--DGDLTLLP-L-AVI--TDA-----------------Q--Q--A
Q6MRH1_BDEBA/43-103-RVVVAKED--IAEMQTI---------YDTMVETK--ELPADFIQ-P-DAI--TIP-----------------D--E--I
Q7CQZ0_SALTY/29-104DCVATAITA--LKAGETATMF---IGEREISVVLH--QDVPFGHK-F-AIC--DVPFHG---------EVYKYG--E--S
Q7DDU0_NEIMB/292-349--SVVADKD--IKKGELL---------SGDNLWVK--RPG------N-GDF--SVN---------------EYE--T--L
Q87WJ9_PSESM/19-89DNVVVVVNDQGVPAGTEF---------DNGLVTVD--NVPQS-HK-V-STV--DLAVGE---------AIIRYG--H--T
Q88J15_PSEPK/19-87DNVVIARQA--LLPGVRL---------DAEAITVR--QPIPSGHK-L-ATE--PVAQGQ---------PLRRYG--Q--I
Q8DZE3_STRA5/278-334-KSVVALKP--IKKGDIY---------SIENITVK--RPG------N-GIS--PMN----------------WY--D--I
Q8F2V2_LEPIN/174-234VTVLKAKRS--LNQGIKI---------TNEDFQEE--EIFTS----E-EIL--DSP----------------GN--E--L
Q8P5U5_XANCP/20-89DNVAIVVNDGGAPPGATF----------QDGMTAI--EHIPQGHK-I-ALQ--ALHKGT---------AVRRLG--A--V
Q8P9B1_XANCP/157-217-DVLVLRRG--ITSGETI---------SLADISIE--KRDAARIV-G-AVL--AD-----------------PA--T--A
Q8Y9I2_LISMO/331-395-TVAVAKKD--IAAGEKL---------DGIGGFCV--RGVLE--T-H-VDM--ATNGH------------IPIG--L--I

PF16976

Q89UH7_BRADU/120-232GFMAAI-----LPTGMRA---------ISTEIS-P--ETGAGGFILP-NDR--VDVLLT----RRLKNPDPS--NGA--P
D0IVZ7_COMT2/112-228-GLALK-----VSEGERA---------VAVKVD-E--NIGVGNRIRP-GDF--VDVFFA-----------LRRDGNE--I
A4YM09_BRASO/100-211GFMAAI-----LPAGMRA---------VSTEIS-P--ETGAGGFILP-NDR--VDVILS----KRERNPDQ---PNA--G
C6WWK8_METML/106-215GGLSAV-----IAEGNRA---------MTVRVN-D--VVGVAGFALP-GNY--VDIVVN--------TEDESVKAEN--V
A5VFZ0_SPHWW/118-231GFLAAA-----LGPGMRA---------VTISVS-A--QSGVAGFVFP-GDR--VDLMLT---------QEVPGGGDG--P
Q31EV3_HYDCU/126-245-SVEAL-----LEKTRRA---------IRLPIE-P--DTGLLGIISP-GDH--VDVISV-------------FESAD--S
B8IRF4_METNO/115-230GFLATV-----LPSGKRA---------VAVRIS-A--ENTAGGFILP-SDR--VDVIHT---------FAPQAQGEG--A
E6VYP1_PSEA9/114-222GGVSAL-----IEPGKRA---------MSVKGN-A--VMGLAGFVRP-GDR--VDVIVS-----------LVQGRGN--Q
Q1H0S6_METFK/108-234-PAAQL-----LKHGERG---------VAIKVD-E--VVGVGGFIQP-GDH--VDVLVY-----------INSSNGM--T
U5RQQ6_9CLOT/107-227DELNLK-----IDNDYRA---------ISISVT-G--DSGVSGLLKP-KDY--VDIIVY--------TSEKRDGIKV--V
G8WR76_STREN/95-203-----A-----LAPGQQE---------LAIMID-A--ATGVPGEIHP-GDS--VNIYAT-----------FPGNQQQ--G
D4Z3U8_SPHJU/119-231GFLAAA-----LGPGMRA---------VTVPVS-A--QNSVAGFVFP-GDR--VDLVLT---------QSVSGGGEG--E
Q63TZ8_BURPS/132-248GFLAAA-----LKPGMRA---------ISVAID-D--VSGNAGLIEP-GDY--VDVLLT-----QQLAAPGGTPADP--Q
A5G038_ACICJ/111-225GFLAAV-----LQPGMRA---------VSVGVD-A--ITGAAGLIWP-GDH--VDLLLT--------QHLTGANLLP--T
B6JJC5_OLICO/117-227GFMAAI-----LPSGMRA---------VSTEIS-P--ETGAGGFILP-NDR--VDVMLS----RRQRNPD----SNG--G
Q028Y9_SOLUE/108-216GGLAAM-----IPSGMRA---------VAVRVN-E--VVGVAGFVVP-GMH--VDILIS----------GNTPGGDG--N
A1SLD1_NOCSJ/117-225-----------IPPGQMA---------VSVNLT-D--AARVSGFLNP-GSE--VAVFLN-------------GVDQQ--T
D5XCW7_THEPJ/108-236-SLSYQ-----VPLGSRA---------MSVPIN-E--VTGVGGLVRP-GDR--VDVIGT--IELETSNPASNQQTGP--T
Q01YZ0_SOLUE/109-214AGLGPM-----IPTGMRA---------ISVRVN-D--VVGVAGFVLP-GMR--VDVLVT-------------GKPLN--R
Q11KR6_CHESB/117-225GFLSGQ-----LPSGKRA---------IAVRVT-A--ESAAGGFILP-NDR--VDLIHT----------SVLSGQSG--G
F6IDN7_9SPHN/116-237TKLAIR-----VPRGMRA---------VSIETT-A--EIAVAGLVRP-GDR--VDVQVV------YPGSDAISGARG--S
F2NFB3_DESAR/52-159-NLTEN-----IPVGMRA---------VSIKVD-E--VTGVSRKVIK-GDW--VDVLAT------------TPLPGS--P
W0PA57_ADVMD/118-225QAFSQK-----IRTGRRA---------VTIPVD-A--INSVSGMLVP-GDL--IDLYVS---------------FEY--R
Q1LH51_CUPMC/106-220-GLARQ-----IPDGARA---------MAVAVD-E--VIGVGNQVQP-GDF--VDVFVV-----------LRRDSQE--I
Q2LSW2_SYNAS/111-219GGVAAV-----ITPSKRA---------MSVKVD-K--VVGVSGYIHP-GNR--VDVLVT-----------LNEQRGE--V
Q12AH8_POLSJ/105-215GGLSAV-----VAEGKRA---------MTVRVN-D--VVGVAGFALP-GNF--VDILVN-------TQDEPGKGGAG--K
Q0KCZ7_CUPNH/127-250-DFSDL-----LKPGKRA---------FTIEVD-M--VNSTAKMLKP-GNH--VDLFLI---------SSTSPTAAG--T
D4ZHC0_SHEVD/115-236GFLSVS-----LRPGYRA---------VSVPVD-Q--VTANSGLVGP-GDF--VDVLLL-----ASQEQELRTRGND--T
L0F839_DESDL/112-224-----------LNGNKEA---------ISVSIKSF--AQGLSGKLIS-GDI--VSVIAP--------------DYKK--Q
B7J8D7_ACIF2/111-240-GLATQ-----VPEGDVA---------MAIDVN-K--AIAVGDHLQP-GDY--VDVFTT--------LAGDQMTMHG--G
G2IKH0_SPHSK/122-234GFLAAA-----LGPGMRA---------VTVPVS-V--QSSVAGFVFP-GDR--VDLMLT---------QSVVGGGEG--E
G0AIA4_COLFT/109-239SGLAVK-----LADGERA---------VAIPVD-E--IVGAGNRVQA-GDY--VDVFFT------------LKQGQD--S
K0C9R2_ALCDB/111-225NRLARA-----VPAGFRA---------FSIGID-D--VVATGGLLQP-GDL--VDVLAH-----------FKNGGGD--D
Q63I81_BURPS/105-212GGLSAV-----IAPGHRA---------ITVRVN-D--VVGVAGFALP-GNY--VDVIVN----------TQEQSKAD--P
F6IMZ3_9SPHN/117-227GFLAAA-----LGPGMRA---------VTIPVS-A--KTGVGGFVFP-GDR--VDLVLT-----------QQVKGEG--D
A9HX71_BORPD/116-233QGLAQQ-----LRDGERA---------VAVPVD-E--IVGAGNRITP-GDL--VDVFFA------------LEKDNE--V
E1VJY8_9GAMM/122-230--IVSL-----LEPGERA---------ITIPVG-K--EDTISGFLRP-GSR--VDLFLT---------------LKD--G
B1LX60_METRJ/118-231GFMAAI-----LPPGMRA---------VAIVTD-SRGTNSAGGFILP-NDR--VDVIRT-------FRDESNSRANN--S
A7HP59_PARL1/143-258-GIAAL-----VPEGQRA---------FAIRIA-E--EDIVGGFLQA-GDR--VDVFAT--FPGAVYGQQGGLGQRE--G
Q72A79_DESVH/111-219GGVSTM-----IAPGMRA---------VAVKGN-K--VMGLAGFIRP-GNR--VDIMVT-----------IDDETRE--K
A4J6C8_DESRM/108-214GDLALL-----IPEGQRA---------LTVAVD-D--VSGVAGLLQP-GDH--VDIIVT-------------FDYEG--E
D6Z1Q4_DESAT/119-232SELAHV-----LDPDERA---------VAIVVN-D--AIGVGGFLAP-GDH--VDVLLY-----------LAADQRR--R
U5VVB9_9ACTN/116-227---AVG-----VPDGDLG---------VSVEVT-M--APGVAEKVAA-GDK--VTVFVT------------YPKDAR--P
D5C113_NITHN/113-218STLSAI-----VPRDKRA---------VTVRVN-D--VIGVAGFLLP-GNQ--VDVLSS------------RKIDRS--Q
E1QL90_DESB2/113-220AGLAAA-----IKPGWRA---------VTISAD-E--VVGVAGYLKV-GDR--VDVIAT------------VKGLDQ--G
Q0A6N2_ALKEH/120-234-QVSRG-----LLPGERA---------VAISVD-D--VIGVGGYLSP-GDR--VDVMLY--------------LSQR--G
Q5P397_AROAE/104-213GGLSAV-----VPEGKRA---------ITVRVN-D--VIGVAGFTLP-GNY--VDIMVN--------TENTGANRNS--A
F6IPU7_9SPHN/112-220-TLSAN-----LPAGQYA---------VAVPIS-A--VAAAGGFIRP-GDT--VDVLLT---------RKIPGDGAA--A
B9TEV5_RICCO/111-225GFLAAT-----LKPDMRA---------VSVAID-D--VSGNAGLIQP-GDY--VDLLLT--------QQMDHRTDSP--D
F2K0W1_MARM1/119-252GFIASV-----LKPGMRA---------VAIPAD-V--VTSNAGLISG-GDR--VDVILSLKRDYEQGADNNPLATIK--L
Q82IA2_STRAW/80-188-----------LAAGQQE---------IAIMID-A--STGVAGKINP-GSR--VNIYAT------------FKAPSD--K
M4U3D5_9GAMM/115-236AFLSVL-----LRPGYRA---------VSVGVD-H--ITANSGLIRP-GDH--VDVLLL-----ASKEKELRSTGNE--T
H7C7J3_CAUVC/150-260GYLSVV-----LTPGKRA---------MSVPVT-S--DTAVGGFILP-GDR--VDVLST--------RDAPAAGDQG--G
B8DJ20_DESVM/112-220GGVSTL-----IAPGMRA---------VAVKGN-K--VLGLSGFIRP-GNR--VDVLVT-----------LDDETRE--K
D7CPP6_SYNLT/108-220NKLAYA-----VPMGKRA---------VSVPVN-A--VSGVSGLVRP-GDR--VDVIAT-----------VELASGQ--E
Q2G9E8_NOVAD/117-229GFLAAA-----LGAGMRA---------VTIPVS-A--RTGVAGFVFP-GDH--IDLVLT---------QTVKGTGEG--M
Q0VT54_ALCBS/118-228NRLAQS-----VPAQFRA---------FAIDID-N--ASAVGGLLEP-GDL--VDVLVH-------------FRKGQ--D
Q0ASM6_MARMM/117-228GFMAAV-----LTPGMRA---------VAVPIS-A--ETGAGGFILP-NDR--VDVIVS-------FEEETEGRRGA--G
C6XQ22_HIRBI/128-241GFMAAV-----LTPGMRA---------VAVEIS-A--ETAAGGFIFP-NDH--VDVLLT-------FEVDVERPTGI--T
G8B059_9PROT/111-226GFLAAV-----LSPGSRA---------VSVAVD-A--VSATGGLIWP-GDR--VDLILT-------QNFESQAGRDL--R
G4RFS2_PELHB/120-233GYLSAV-----IGQGMRA---------VSISVN-P--DSASGGYIVP-NDR--VDIVLT-----------------R--S
Q11B62_CHESB/119-229SFLAAI-----LPPGKRA---------VATRIA-A--DTSAGGFILP-NDR--VDVIMT----------RRADEGSS--P
W8T5C2_PEPAC/106-215SYFSYN-----IPKNQRA---------VTLEVD-S--VAGVADLIRP-GDY--VDLITY-------------FGAKD--P
Q2W0T1_MAGSA/117-235GVMAGL-----LAPGMRA---------ISIAIT-N--PTAVSGFVTP-GDR--VDVVLASDIKKSEEGINAEAGSGL--L
L0E0I1_THIND/118-238SQLART-----LRPGERA---------LAVAVD-D--VVGAGGYIAP-GDH--VDLLLY---------LKETGARAG--P
E1SM34_FERBD/106-212SVLASL-----IAPNMRA---------VTIRVN-D--VVGVAGFLLP-GNR--VDVLVT-----------LAKRRSA--D
W5WV44_BDEBC/111-236-GIALQ-----VAPSKRA---------ITIPVD-E--VRGVAKLIRP-GDR--VDIFAA-----------VDAGRGM--N
C5AGY3_BURGB/109-229SGMADL-----VKPGERA---------VAIKVD-E--NNAVGNHMRP-GNF--VDVFVNLKRDAAGGLPGTNSSGPE--I
Q89WL1_BRADU/117-231GFMAAI-----LPSGMRA---------VSTDVT-A--ETSAGGFILP-NDR--VDIVLT----RRLKNPDVNGPTAG--N
A5D2B5_PELTS/108-222DGLAFM-----LQPGKRA---------VTVAVN-E--VSGLAGLIKP-GDR--VDVVGT---------FDLQGAPGQ--E
B2JQB8_PARP8/125-239RDFSDM-----LPAGQRA---------LTFEID-A--VNSTASMLRP-GNR--VDMYWV----------GTQAYASA--G
U4KID3_9VIBR/116-224---HYV-----IAANRVP---------YAIEVS-P--SDVIGGVISH-GSM--IDVVAL-----SLPDSELASNNSL--R
D0J7X0_COMT2/105-214GGLAAV-----IAPGKRA---------MTVRVN-D--VVGVAGFALP-GNY--VDVVVN--------AQQEQNGKTE--E
F2J2R1_POLGS/118-225GFMAAI-----LPKGKRA---------IAVGVE-A--ETTAGGFILP-GDK--VDVILT------------RSSDSN--R
Q6D931_PECAS/117-259GFVAAV-----LRKGMRA---------ISVPTS-A--IASNAGLVSA-GDR--VDVILSMKRDDQAELPPSRNQPVV--M
A0KI89_AERHH/122-243HYLSAM-----MAPGMRA---------VTLALG-R--EAASHGLIRP-GNR--VDVILT----SKHTHQRNAQGAEV--T
M1P550_DESSD/125-243--FSGT-----IQSGHRA---------ITIQVD-E--VNSISGMIKP-GNS--IDLFTR-------MSGKSFSNSSS--G
Q92YL7_RHIME/113-222GYLSSL-----LPSGKRA---------IAVRVT-A--ESTAGGFILP-NDH--VDVIHT---------VARPDASGD--A
B2A8J9_NATTJ/117-228NKLSEV-----IPENKRA---------MSVAVD-Q--VSGVAGFIQA-GDY--VDVVAT-------KDEEDREGQEP--S
Q1GU26_SPHAL/118-234GFLAAA-----LGPGMRA---------ITVKVS-Q--EQGVAGFVFP-GDR--VDVVLT-----QTIEVEEGSTYPD--D
B7VGJ2_VIBA3/113-222QYLQAV-----IRPGFVP---------YNVTVP-G--RDVLGGTIAV-GDL--VDISVL---STPDQNLSSEDTVSD--I
V6F008_MAGGM/115-232GILAGM-----LAPGMRA---------VSVAIS-N--ASAVSGFVVP-GDR--VDVVLA-ADFQRADSEAAGKGGGA--I
Q89PI8_BRADU/132-244GFLASV-----LAPDSRA---------ISIKVD-E--ESGVSGLIRP-GDH--VDVLLT----------QVFEKADP--A
E6WXD7_PSEUU/115-229-QFSRL-----IPRGKVA---------YTLSVD-E--NNSISGMIAP-GDL--IDILFL---------KDKDESSGA--R
C9ZGN6_STRSW/108-217-----------LEAGQQE---------IAILID-A--STGVAGKINP-GSR--VNIYAT-----------FEEKDSD--S
Q2G867_NOVAD/76-184ATLAAA-----LPPGMVA---------VSLPIS-D--VTGVSGFVRP-GDL--VDIILT---------RQIPGEGAG--Q
Q140S5_PARXL/104-219SGLAER-----VEVGERA---------LAVRVD-E--GNAVGNRLRP-GNF--VDVFFTLKRDG-----GSMGNGGE--I
Q1QR64_NITHX/115-225GFMAAI-----LPTGMRA---------ISTEIS-P--ETGAGGFILP-NDR--VDVILS----QRDKNPD----HPN--A
Q2ND44_ERYLH/117-228GFLAAA-----LGPGMRA---------ITVPVS-A--NTGVAGFVFP-GDR--VDLMLT-----------QAVKGEE--T
R6MM56_9FIRM/107-215-RFDKA-----VSEGKRL---------IAVSVPSN--AASVANQLKA-GDK--VTVAYY-----------------A--D
I3ZLI3_TERRK/106-211TGLSTR-----IPQGMRA---------LSLKSD-Q--VVGVAGYLLP-GTR--VDVLVT-------------FHTPA--S
K4KZ78_9FIRM/113-220DSFSLT-----VPSGKRA---------VAIPVD-L--VGSVSYKVKP-GDH--VDVLIT----------MDIKDSQG--N
N0B187_9BACI/63-169-----K-----ISPNKRA---------ISIAVD-Q--VKGVSGLIRP-GNF--VDVIAF-------------IPESP--E
Q24NN8_DESHY/111-220-----S-----LNGDKRA---------ISVSIKSF--AQGLSGKLIS-GDI--VSVIAP--------------DYKK--Q
Q0K4T9_CUPNH/107-221-GLATQ-----VREGERA---------VAVSVD-E--VIGVGNQVQP-GDY--VDVFLV-----------LRRDQQE--I
Q30YU0_DESAG/112-219-GVSTM-----ISPGKRA---------VAVKGN-N--VLGMAGFIRP-GNH--VDVLVT-----------IDDNRRP--Q
Q6N2G9_RHOPA/120-231GFMAAI-----LPTGMRA---------VSTEIS-P--ETSAGGFILP-NDK--VDVILT----KRDKSSDI---PGA--K
E6SL92_THEM7/109-216DGLAYR-----LPEGTRA---------LTVAAD-P--VIAVGGFVQP-GDR--VDVFIG-----------LPGGQPG--V
Q9HW95_PSEAE/119-234GPLART-----IRPDERA---------MAIAVD-E--VVGGGGFVLP-GDY--VDVMLF-----------VRDERDG--E
A5VC45_SPHWW/112-235DKLALR-----VPVGMRA---------ISIDTT-S--EIAVAGLVRP-GDR--VDIQVV------YPGTDAIAGLRG--P
C4KA68_THASP/116-223-TLSAQ-----LAPGRRA---------TTIPVD-E--TSSLSGLLRP-GDR--IDLLAT---------------VQR--D
Q2ILR9_ANADE/128-239HGLAAI-----LPPGMRA---------AAVRVN-D--VVGVSGFIHP-GDS--VDVIVV---------MRPESNGNS--N
Q13S63_PARXL/125-253RDFSDV-----LRPGTRA---------LTVEID-T--VNATALLLRP-GNH--VDVYWV--------GKVFHEDHTS--D
Q87VT5_PSESM/165-287GTLARM-----IRPYERA---------LALQVD-E--VTGASGQLSP-GDY--VDVLLY------------LPEDAS--N
A7HHF1_ANADF/131-240AGLAAV-----LPAGMRA---------VAVRVN-D--VVGVAGFLHP-GDA--VDVIVT-----------MSPSGGG--G
B5EAZ1_GEOBB/109-217GIMTYM-----VPDGHRA---------VTVSVN-E--VAGVAGFITP-NSR--VDVLLT----------IPRPGSTN--E
D9QLA1_BRESC/159-271GYMAAY-----LEPGMRA---------MAIGVS-V--ESAAGGFILP-GDR--VDVIVT------VEQQAGNDDDAG--R
Q08YN3_STIAD/110-219ERLSTK-----VQKKGRA---------VTIEAK-S--TTSVGGWIRP-NDH--VDVIGT-------------FRDPQ--T
A1S3F8_SHEAM/120-233-QFSDL-----LQEGQRA---------VTIDIN-E--ENSTAGMLVP-SDL--VDLFLS-----------YTVENGD--S
R7XWH8_9ACTN/115-231-----V-----IPDNKIA---------ISVELT-D--PERVAGFVNP-GSE--VAIFIS-----ADPVRILPDGKEL--K
C8VVN4_DESAS/111-223-----N-----LNGDKQA---------ISVSIKNF--AGGLSGKLIS-GDI--VSVIAP--------------DYKK--Q
Q220L1_RHOFT/103-212GGLSAV-----VPQGKRA---------MTVRVN-D--VVGVAGFALP-GTF--VDVMVN--------TQDEGGQRND--R
K4L4M6_9FIRM/106-229-KLDRI-----AKDDKRL---------VTISVPSI--AAGLSSHLKS-GDI--VTAAVF-----SNQRKEGDASQST--S
F6AB48_PSEF1/126-247GPLARM-----IRPHERA---------LAVAVD-E--VIGGGGHLSP-GDY--VDVLIY------------LRQGEG--N
V5SAW1_9RHIZ/117-227GVLAAI-----LPAGMRA---------ISTRIK-E--ETAVGNLILP-NDR--VDVILI----------RRVRGRSG--G
E8WXZ6_GRATM/107-212PGLAAR-----IPAGMRA---------ISLKSD-E--IMGVAGFLSP-GSH--LDVLVT-------------YRTDK--N
B8ERR4_METSB/120-238RFLAAV-----LKPGRRA---------LSVSVD-A--AQSAAGLVLP-GDY--VDVILT---------QDFGDKIDI--G
E8RQ62_ASTEC/159-266GFMAVM-----LAPGMRA---------MAVPVT-V--ESTAGGFILP-GDR--VDIVVS-----------TELQSNG--Q
Q7VX28_BORPE/111-228-GLARH-----LAPGERA---------VTIAVD-E--LSGAQNRILP-GDL--VDVFVV------------MDRGIE--V
A5UYL2_ROSS1/121-236ESVSQE-----IPPGYVL---------FAFPIV-D--LLGQSNLIED-GDR--IDLYLT---LNTPLDASAAPAPDQ--A
Q63TS0_BURPS/109-224-GLADQ-----IAPGERA---------VAIKVD-D--TNAVGNRLRP-GNF--VDVFVNLKREG-----GFGATGSE--I
D5EFJ2_AMICL/111-219--VAFQ-----LPDGRVA---------IALPID-E--VIAAGGLLRP-GDY--VDVFHV-------------YREKD--A
B8IGQ2_METNO/119-232GFLSAI-----LPSGMRA---------VAISID-ARGSNTAGGFILP-NDR--VDVLRT-------HRDEEAARATK--S
D8PF28_9BACT/116-231GGVAAV-----THPEKRA---------VAVKVD-D--VVAVGGFIKP-GDR--VDVLTT------------VRRPGK--T
A9WMZ1_RENSM/117-224-SLLTG-----TPAGSVA---------VPLRLS----DAGTAKLVAP-GQL--VTVVLT-------------NEDST--G
A6WWU0_OCHA4/118-230SFMSSI-----LPPGMRA---------VATQIN-A--ESSAGGFILP-NDF--VDVIMT--------RRKPDNGDKS--L
A0LIC9_SYNFM/117-223GGVSAV-----VSVGKRA---------IAVAGD-K--VIGLAGFIQP-GNF--VDVLVT------------IRDTQE--K
R4L5S2_9ACTN/119-228-----------VPEKQLG---------ISVEVS-M--APGVAEKVAA-GDR--VTVFVT------------YPRDAR--A
A9BV49_DELAS/129-265-GLALQ-----LEPGQRA---------LAIAIR-E--QMAAGHHVRP-GDF--VDVYFT----------LDGKSDQA--P

PF13144

D3VCD6_XENNA/99-221QN-----GIAIRNIPAGQSITRNM--------------------IRRPWAIKAGQNVVVTVDG-HHFQVRYEGKAINNAA
C5AEH4_BURGB/386-508GG-----TSLVR-VAAGLPLRQDM--------------------LRSASSVTIGQTVRVVAAG-QGFSISSEGSVMNNAG
B2JJ15_PARP8/300-422VG-----SVALMRVSPGLPLRRDM--------------------LKSAEAVSIGQSVKVVAQG-PGFAISAEGSAMNNAS
Q82XH3_NITEU/106-228IG-----KVATTFLASGQPIRTHQ--------------------LRAPHVISRGQKVRLTATG-AGFAVSMEGEALAAAA
Q1GZW7_METFK/111-233IG-----RAVYVPLSAGTVLRQEM--------------------LRVLPVVQQGQKVILNTMG-EGFKVSAEGTALTSAG
C6XBV3_METGS/118-240IG-----RIVNISMNAGTVLRQEM--------------------LKASPVVQQGQTVTLITRG-KGFSISAEGHALNNAT
C6WVB1_METML/141-263QG-----RIVNISMTAGTVLRQEM--------------------LKVSPVVQQGQTVMVTSSG-KGFRVSAEGKAMTKAN
C7RLC6_ACCPU/110-232RG-----KTVRSSVAAGQPLRGDL--------------------LIAPWSVQQGQSVKLVSTG-TGFTVSNEGKALNNAS
D5CMW8_SIDLE/115-235IG-----KTLRFPIGAGQVLRQDM--------------------LRAPYVVIQGKTTSVRVKD-TGFYVSATGQALNNGA
Q7NZC3_CHRVO/97-219VG-----QVLRSGAPAGAWVRNFM--------------------VRAPYLVRSNQRVKVQAQG-DGFSAEAEGTALGNAA
Q8EC91_SHEON/113-233SG-----VRVKRRVAKNNPIFANN--------------------L---CFVCKNDAVSIYVRS-SNFVLKTVGEALQDGN
Q12PP0_SHEDO/113-233IG-----SRVKRRVAKDAPILSGN--------------------L---CFVCKGDPVSIFART-ENIVIKTSGEALNDGN
Q085Q4_SHEFN/113-233IG-----SRVKRRVAKDSPVLSNN--------------------L---CFVCKGDTVSIYAKT-TNVEIKTLGEALRDGN
A8AKH6_CITK8/134-257IG-----LTVKRRIRELQPITLTQ--------------------LESPVLVERGQRVLMIAEQ-GGVEARTMGEAMKKGR
O26012_HELPY/96-217DK-----VSAKNFIPPNTLLSTDK--------------------TQALIIVRKNDIITGVYEE-GQISIEISLKALENGA
D3UGB6_HELM1/98-220DN-----ISAKIFIPSGGMIVNSL--------------------VANKILIRKNDSFLAIYKE-GNMQIQLTLIAKQDGA
Q7VGG2_HELHP/182-304YN-----SGAKSYIRVDTAITKDK--------------------IKPRIIVKKGDKIRVFSRE-GGITTEIVLVARQNAV
Q30RI0_SULDN/167-288TS-----LQVKRHIQKDAILTIRD--------------------VEIADVVKRDSNINVTMHR-DGMDITFSAKAQKDAK
A6Q2L6_NITSB/116-236IG-----SVARVNIYKNRKITRYM--------------------IEPNYAVKKRQNVRIIYAK-GPIRIELLGLALQNGK
Q2LT22_SYNAS/119-242IG-----KRLLRSIKERSTFTASM--------------------LREPILFKKGKVVKVICDN-GVLSITTLGLAEEEGT
A7HLB5_FERNB/194-315PV-----MADKV-FQKGEIIDGKY--------------------ISDVPLIVKGQVVKAISIV-GGVMVSTLVQALENGN
Q1MQD1_LAWIP/205-326GP-----WQIKRSIGIGQPIYQSD--------------------LEPLAVVRKGDIIKLNYNK-GSIRLSVNVEALENGT
C6C0E1_DESAD/212-333GP-----WRVKVPVGTGQPIMRSS--------------------IEPAPVIARGDKVTLMFRG-KNLKLTVPVEALEDAG
A1T0H6_PSYIN/110-231AG-----KKTKRKLRAGSIIKKKD--------------------IIIEYAVIRKSEVSIIFKQ-DSFSLSTLGIALKSGQ
B5YIX3_THEYD/106-229IG-----KVVKRSLTRGLIIKEDY--------------------LYSGMPVKKGSKVDVIINT-GQVMIMTEGVLKSDAV
B9M0F7_GEODF/101-224VG-----KRVRTAIRGNNPIRPDF--------------------LERVPLIKSGQLVTIVAEN-ESLRITAAGKARNSGA
A5G8Y0_GEOUR/113-236VG-----KRVRTAIRGNNPIRADY--------------------LEKISLVKSGQLVTIVVEN-DALRITAAGRARNSGA
A1AUM2_PELPD/113-236VG-----KKARVTLRPNAAIRSDQ--------------------LEKVPLIRAGQLVTIIAEN-ERMRITATGKSKSAGA
B3EAV3_GEOLS/118-241VG-----KKLRITVRAGTPIRSNQ--------------------LVSVPVVVSGQLVTIIAEN-AGVRITVSGRARSAGG
B8FK20_DESAL/199-322RG-----MRLRQDMDAGEHMLSRM--------------------LEKPPLVERGEDVTIMAEN-GVLSITAIGLAKESGG
C0QA41_DESAH/185-308VG-----MRLKQSLASNGFFRENM--------------------VEDSPLINRGDNVVLVARK-GNMRIVATGVADQEGR
A4YXW0_BRASO/195-318VG-----MQMRRPVRAGQALKATD--------------------LAKPDLVQRDQTVTLIYQT-AGIYLTTRGKALESGT
Q218W9_RHOPB/216-338VG-----MQARRQLRAGQALRLVD--------------------LSKPDLVSRDQAVTLIYQS-TGLYLTVRGKALESGT
Q89I10_BRADU/194-316IG-----MQLRRPMRAGTPIRVAD--------------------IVKPDFVQRDQNVTIIYQV-PGLYLTTRGKAIESGA
Q6N2Z6_RHOPA/206-328IG-----MQARQTLRSGQVLRSAD--------------------LAKPDLVTRDQGVTLIYRA-AGIYLTARGKALDTGA
Q2W1H7_MAGSA/190-313VG-----QEPRYQLRAGVPVRTNE--------------------VQKPVVVAKNSSVTIMLRS-KFMTLTAQGRAIEDGS
C5BRR4_TERTT/102-225VG-----LEARRMLRPGEIIKLNQ--------------------VKAPDVVKKGQTVVLEARS-SALRVVTEATALTNGG
Q21IK3_SACD2/118-241IG-----QELTRSVNAGEAIKLSH--------------------VRPAQVVSKGDTVVIEVRG-NMIAVAVNGEALENGH
A4XW92_PSEMY/127-250IG-----KKLTRQLNSDQIITPAH--------------------LQVAEVIRRGDQVVISASG-GTVNVRMPGEALTDGA
A4VJC5_PSEU5/125-248LG-----NKLTRPVQPDQVIAPNQ--------------------MELAEVVRKGDQVVITARS-GAINVRMPGEAMADGA
Q885A9_PSESM/123-246VG-----QKVVRQMVIDQVITPVA--------------------LEQPQMIHKGDQVVIIARS-GSLAVRMPGEAMSDGG
A1WUE8_HALHL/136-260IG-----QAVRRSLREGAAITGNH--------------------VQPPRLVERNDRVTITAGNGGAIQISSRGRALEHGQ
Q0AA93_ALKEH/113-236IG-----KELRRSLRRGDLIAGNA--------------------LAAPQLVQRGRSVTLRAGG-GRVQVTGQGKALESGV
B5EEG7_GEOBB/121-244AG-----LRVKATMRANTPVRKDN--------------------LEKVPVVKSGQMVTILAEN-DVVKVTASGRAKGAGA
B7VKL6_VIBA3/126-246IG-----AKVKKNLRPGDVVERGD--------------------I---CVVCRNEKVIIQAVK-GGMTITTKGTALTDGS
F9ZN65_ACICS/101-224TG-----RTLRFGTVAGQPITQSM--------------------LAAPIWVHGGNNVTLVAEG-DGVRITTLAQAIENGH
M1FC75_9ALTE/108-230IG-----MEVRRPINSGSLITPDL--------------------LAAPDAVERGDHVMITASS-GSFTVSSRGKALANAA
A0A5P8YL94_YERPE/108-230QG-----AVSQRQINAGQPLTRNM--------------------LRRLWLVKAGQDVPVLAQG-DGFNVNSNGKAMNNGA
Q0WIV5_YERPE/108-231LG-----LTIKRRIRQLQAVIPSQ--------------------LEQPVLVTRNQHVLMLAAQ-DGIEAQMLGIAQKNGR
Q5E3M1_ALIF1/133-253VG-----ARIKRSVRAGETVEKND--------------------I---CMVCRNDSVIIKAVK-GELSIITKGTALGDGA
Q6LTR6_PHOPR/113-233IG-----SKVKRTVNIGEAVQGND--------------------I---CLVCRNDAVMIKAGN-GGLNIITNGTALSDGA
Q9HYP6_PSEAE/107-230VG-----QKLRRPVVNDQVLAPVF--------------------LEQAEAVRKGDQVVILART-ATINVKMPGEALSDGA

PF08666

Q88EQ9_PSEPK/126-187VG-----MKMLRPTVIDQVLTPQH--------------------LE----------------------------------
Q30WJ5_DESAG/229-289KGG---PWRLTRAVGQGQVIYAAD--------------------LE----------------------------------
UXAA_BACSU/11-82IG------HASQDISIGEHIHVHN--------------------TK----------------------------------
Q3ACL1_CARHZ/14-89IG------VATRDIQIGEHVHSHN--------------------LS----------------------------------
Q6L322_PICTO/14-89IG------RATKEIKIGDYVHIHN--------------------ID----------------------------------
Q726U8_DESVH/286-344LG-----RPCPCDLAPLAPIPASM--------------------LP----------------------------------
O05573_MYCTU/54-116VG-----STLASPTRRGEVLTDVR--------------------LL----------------------------------
PSEI_HELPY/279-337LG-----QKASKFLKANTPLSADD--------------------IE----------------------------------
FLGA_AQUAE/101-160VN-----FVALKEIKKGTIVRRSY--------------------LK----------------------------------
O83573_TREPA/310-372VG-----AVLQRSVHAGEGARFGD--------------------II----------------------------------
FLAD_CAUVC/127-187IG-----LAAKRPLREGAPVGMKD--------------------VA----------------------------------
SPSE_BACSU/303-365TS----GVRAVRDIPADTGIVWDD--------------------IL----------------------------------
GARD_ECOLI/22-92IG------YAVRAIPRGSWIDESM--------------------VV----------------------------------
FLGA_SALTY/95-157QD-----AVSLRDLAPGQPVQLTM--------------------IR----------------------------------
UXAA_ECOLI/10-81IG------YALADIAAGVHVHAHN--------------------TR----------------------------------
Q2RLM1_MOOTA/49-111VG-----KVALAELYQGEQVRLER--------------------VG----------------------------------
Q2RLM6_MOOTA/36-97EG-----KEAKVSLLKDQFVWKDA--------------------AG----------------------------------
Q2SBN4_HAHCH/292-350IG-----KKMRTSINNDEPLTWPH--------------------FE----------------------------------
Q2W0T1_MAGSA/43-111VG-----MIARRPLAEGEPVSAAT--------------------TF----------------------------------
Q2W9F8_MAGSA/290-348LG-----RKARKAVPRGTAFDWSM--------------------IE----------------------------------
Q2WB91_MAGSA/292-350VG-----RRLTRAVAEGTLLEWSD--------------------LA----------------------------------
Q2Y6G9_NITMU/29-91DT-----RVVKVNLVRGEPLLEAK--------------------LA----------------------------------
Q2Y9F0_NITMU/124-186IG-----RTLGGNLPFGSPLRQDM--------------------LR----------------------------------
Q2YJ36_BRUA2/19-88IG------VATRDIAPGEHVHLQN--------------------LA----------------------------------
Q30V22_DESAG/280-338LG-----RRAPRSMGAHEVLTAAD--------------------LQ----------------------------------
Q30W96_DESAG/291-350LG-----RVAKRPLQKNAQLAWDD--------------------FD----------------------------------
Q30YU0_DESAG/42-104TG-----RVLASAVTAGEPITPAR--------------------LV----------------------------------
Q31EV3_HYDCU/54-117VG-----HVAHQKIYAGEWILAKK--------------------LK----------------------------------
Q39YJ9_GEOMG/112-173IG-----KRARMPVRANMPLRGDQ--------------------LE----------------------------------
Q3A3R8_PELCD/46-108VG-----RVSVSKMVTGTPILAAE--------------------LA----------------------------------
Q3A5F3_PELCD/116-177VG-----KKLRRPVRMGAPFTQTG--------------------LE----------------------------------
Q3ACP5_CARHZ/12-87IG------RATKSIKVGEHVHVHN--------------------IE----------------------------------
A6TKR5_ALKMQ/11-82IG------YATQTIAKGHWVHSHN--------------------TK----------------------------------
Q3IDV3_PSET1/113-175IG-----SRSKRNIRSGMPLLLSQ--------------------IC----------------------------------
Q3IY78_RHOS4/16-74LG-----QEARVTLYAGRPVRAAD--------------------LG----------------------------------
Q3J1Z1_RHOS4/353-418EG-----GVLLRDIPRDQALTFAD--------------------VR----------------------------------
Q3J7R0_NITOC/110-172VG-----KRLKRPVGLGAIITPGM--------------------LE----------------------------------
Q3SID7_THIDA/113-175LG-----YRTVSGLAAGAPLRAAL--------------------LR----------------------------------
A8L8R3_FRASN/61-126LG-----ATLARPVSSGELLSGAD--------------------FA----------------------------------
A8L8Y3_FRASN/55-120VG-----RQALLDLPAGTLVTPEM--------------------AG----------------------------------
A8L6N9_FRASN/66-128LG-----KPVAYSLPAGTVLSRAA--------------------VG----------------------------------
Q3Y3F8_ENTFD/15-86IG------HVTTDVTAGQWLHTHN--------------------VK----------------------------------
A6W5H2_KINRD/344-409EG-----AVLKHAVKKDQVLTYDD--------------------VV----------------------------------
A6WH12_KINRD/89-151VG-----STAISSLPEGALLTNKM--------------------YQ----------------------------------
FLGA_AGRFC/36-98EG-----MISKQTLLPGRTIPIAA--------------------LR----------------------------------
A3DD33_HUNT2/49-113LN-----KYSLYYLRNGAPIYYDQ--------------------LT----------------------------------
Q4FMC1_PELUB/347-412DG-----AIVKKDINKDQSIRLDD--------------------VE----------------------------------
FLGA_RHIME/42-104DG-----MVTKRTLLPGRVILASA--------------------LR----------------------------------
Y1065_METJA/277-335LN-----RKIKNDKEEDDIIYWDD--------------------LL----------------------------------
Q5KYJ2_GEOKA/13-88IG------VASNDIAEGEHVHVHN--------------------VE----------------------------------
Q5QUG9_IDILO/118-180VG-----ARIKKRIAAGQAISASD--------------------TC----------------------------------
Q5WIW4_BACSK/10-81IG------IAKQAIATGEWVHTHN--------------------LK----------------------------------
Q5WKX1_BACSK/12-83IG------KASKPIQKGDWVHTDN--------------------VV----------------------------------
Q5YPT3_NOCFA/56-118TG-----ATLTAAMHPGEVFTDLR--------------------VV----------------------------------
Q67SH0_SYMTH/35-97EG-----RYTRALLIPGTILREAH--------------------LV----------------------------------
W4TZD3_CUTAC/51-114VG-----RHALVDLSPGQLLGSHS--------------------VG----------------------------------
Q6AJR9_DESPS/191-252EG-----QRLRRRIRKDDVIRASS--------------------LE----------------------------------
Q6AN09_DESPS/44-106VG-----RIVLSPLTTTEPILNSD--------------------LA----------------------------------
Q6D6I0_PECAS/98-160QG-----AVILRDLTPGQVITTSM--------------------IR----------------------------------
Q6D931_PECAS/45-111LG-----ATLRETVAEGTPLTSNV--------------------LV----------------------------------
Q6FFQ4_ACIAD/13-84IG------YANADLEAGRWVNESV--------------------TR----------------------------------
Q6LH47_PHOPR/14-85FG------HATKNIDAGEWVHSHN--------------------VK----------------------------------
Q6LW32_PHOPR/128-190TG-----LTSRRKIVAGKIISPRM--------------------VE----------------------------------
Q6MBR1_PARUW/291-349IG-----LTINQSIAKGTPVTWDL--------------------FN----------------------------------
Q72F65_DESVH/294-352VG-----MKARADIAEDTVLKWGH--------------------LE----------------------------------
Q74B32_GEOSL/292-350LG-----RRLARDMQEDDVIRWED--------------------LV----------------------------------
Q7M7S8_WOLSU/280-338LG-----KEAACDIERGEPLTWEM--------------------VR----------------------------------
Q7N5N4_PHOLL/95-157KN-----SIAIRNIPAGQAITHNM--------------------LR----------------------------------
Q7NR94_CHRVO/277-337VR-----YTAKTPIAADAPVMAAD--------------------LE----------------------------------
Q7NXC7_CHRVO/112-173QG-----LASRTPLRQDQPLRRRQ--------------------LQ----------------------------------
Q7UGK2_RHOBA/68-130EG-----KFARQRFYEGEPVMPVK--------------------LM----------------------------------
Q7UJ28_RHOBA/334-396MG-----MEVVGLIRSGVPLRPSD--------------------FA----------------------------------
Q7UKI4_RHOBA/121-189IG------KASCDIGVGEHVHSHN--------------------LV----------------------------------
Q7VHQ5_HELHP/291-349LG-----KSAKVALKAAQPLRLSD--------------------VK----------------------------------
Q7VVV9_BORPE/50-114DG-----AVLRAPVKAGEALQAAL--------------------LS----------------------------------
Q7VX28_BORPE/49-109LG-----QMVRQDIPAGEPVTAPM--------------------LA----------------------------------
Q7VYH0_BORPE/112-174LG-----MRPAHRIAAGQPIKGAG--------------------LR----------------------------------
Q82IA2_STRAW/13-75RG-----KIAVTQLEKGSLLQTDM--------------------IV----------------------------------
Q82RG0_STRAW/65-128VG-----KRAAVELRPGSLLAPSQ--------------------VT----------------------------------
Q83GV3_TROWT/38-99PN-----AVFNRPIMPGEFLPKSA--------------------LV----------------------------------
Q87M38_VIBPA/44-106LG-----RIVANTIYAGELVNPNR--------------------LA----------------------------------
Q893U6_CLOTE/293-351IG-----LKIKKELKSGTVLTWDC--------------------FK----------------------------------
Q89HL9_BRADU/296-354IG-----KILKRKMAADDYFFQSD--------------------LD----------------------------------
Q89PI8_BRADU/60-126TG-----SLVRKFVEAGSPITLQD--------------------VL----------------------------------
Q8A711_BACTN/288-346IG-----HFAKQDISANEIIYPDF--------------------IE----------------------------------
Q8AAH9_BACTN/12-83IG------HARMAKKQGDWMNETN--------------------IK----------------------------------
Q8D3G4_WIGBR/100-162SG-----KISTISIGIGQPITTSM--------------------LK----------------------------------
Q8FR13_COREF/43-105LG-----RITASSVTAGEWVTAPR--------------------FV----------------------------------
Q8G440_BIFLO/63-125VG-----KVAQIDIEAADPISTHM--------------------AR----------------------------------
Q8NS06_CORGL/43-105VG-----LVAASTLSSGEIATKPR--------------------FV----------------------------------
Q8R8C9_CALS4/30-96VGKSLNTSRVKGDFIPHSIVMQKG--------------------LE----------------------------------
Q8RIB8_FUSNN/291-351LG-----KKLTKNIESDSYLTWKD--------------------VE----------------------------------
A9CKJ4_AGRFC/46-114AG-----TVVRLPLFEGEPIRPEK--------------------VV----------------------------------
Q8XQX9_RALSO/47-107VG-----REPIVPIGIGVPLIGSQ--------------------LS----------------------------------
Q8XSX6_RALSO/171-233VG-----RVLLTSLAPNQPLRAES--------------------LR----------------------------------
Q97H26_CLOAB/292-350IG-----KKARVDVKKGTPLDWNL--------------------LE----------------------------------
Q97HN6_CLOAB/39-101GN-----KYASENIYKGEVISKKR--------------------VL----------------------------------
Q97L66_CLOAB/11-82IG------HALEEIKKGQWVHTHN--------------------IK----------------------------------
Q97YR1_SACS2/11-89IG------SAIKDIKVGEHVHVHN--------------------IR----------------------------------
Q9ACY4_STRCO/61-124VG-----KRTAVDLRKGGLLLASH--------------------LA----------------------------------
Q9CMH3_PASMU/50-121QG-----HLVAENLKSGSLLSPST--------------------VI----------------------------------
Q9HW95_PSEAE/56-116LG-----KRVWVAVPAGSILSAAT--------------------LE----------------------------------
Q9KQ04_VIBCH/133-195IG-----AKIKKNIRVGDVIEQND--------------------VC----------------------------------
SIAS_DROME/312-371VG-----KELADNIGEDEPILGNS--------------------II----------------------------------
Q9X1M7_THEMA/158-220VG-----KISRRYLKEGTVLTADM--------------------VK----------------------------------
A9W9R9_CHLAA/350-414VG-----ATVIRPIKAHCPIHYDE--------------------VE----------------------------------
A9WEA1_CHLAA/52-115LG-----KLLINPVVAGQSIRKDN--------------------IR----------------------------------
A9WH46_CHLAA/47-108VG-----QYAARHLAANDLLQPSM--------------------L-----------------------------------
G1UB98_HAEDU/57-126QG-----FLVAENLSKGSLLNQKV--------------------L-----------------------------------
Q5ZX25_LEGPH/110-170IG-----LVCKHDITPNSPLNPFN--------------------IE----------------------------------
Q5ZXG3_LEGPH/301-358NG-----WELQNKVSIGEPIKWSD--------------------IK----------------------------------
NEUBH_LEGPH/298-355VG-----SRLSMNLSAGTTLLWEH--------------------IE----------------------------------
Q63I81_BURPS/38-97EG-----RVVRTSLARGEPVLGTK--------------------------------------------------------
Q63M73_BURPS/17-88IG------HVTREVARGEHLHTHN--------------------LV----------------------------------
Q63YB9_BURPS/184-244VG-----ATALTRVAAGLPLRRDL--------------------L-----------------------------------
Q6MRH1_BDEBA/43-103IG-----NVAAVPIRKGQMVVKNN--------------------L-----------------------------------
Q7CQZ0_SALTY/29-104IG------RATQEIKSGDYVHVHN--------------------VE----------------------------------
Q7DDU0_NEIMB/292-349FG-----KVAACNIRKGAQIKKTD--------------------IE----------------------------------
Q87WJ9_PSESM/19-89IG------YALQPIPRGSWVREDQ--------------------LR----------------------------------
Q88J15_PSEPK/19-87IG------FASQAIDAGDHVHVHN--------------------V-----------------------------------
Q8DZE3_STRA5/278-334LG-----QEAQDDFEEDEVIRDSR--------------------F-----------------------------------
Q8F2V2_LEPIN/174-234LG-----STLLKNMNEGEIFRKKH--------------------VR----------------------------------
Q8P5U5_XANCP/20-89IG------TAADDIARGAWVSEQL--------------------L-----------------------------------
Q8P9B1_XANCP/157-217VG-----KTARRILPAGTLLSAND--------------------L-----------------------------------
Q8Y9I2_LISMO/331-395SG----EVVARRNIKAGTFITDED--------------------V-----------------------------------

PF16976

Q89UH7_BRADU/120-232DI-----VTSEIILANIRVLAIDQ----------------------------APKEKDGQNTVV--------GKT-----
D0IVZ7_COMT2/112-228DQ-----SQARLLLSRKRVLAYGA---------------------ASVDALSSAEKTEGKQANG--------PDN--ART
A4YM09_BRASO/100-211DV-----VSSEIILANIRVLAIDQ----------------------------APKEKDGQTTVV--------GKT-----
C6WWK8_METML/106-215NK-----SISKIVLEHIMVLAVAQ-----------------------------EQNRDETKPKV--------VNA-----
A5VFZ0_SPHWW/118-231PL-----KAAETIIRNIRVLAADQ---------------------------RTDKTVDEEGKTV--------VAN--TSN
Q31EV3_HYDCU/126-245KR-----MVSRTILQNITVLSIGI-------------ENQMRASTADSEEDNQNLFANKQASNK--------KSM-----
B8IRF4_METNO/115-230RE-----HRSRTILKNVPVLAIDQ----------------------TVDEAQKADKGKGKSVVI--------GKT-----
E6VYP1_PSEA9/114-222EE-----PVTKLVLERVKVLATGT---------------------------ELQAPDTEGKAAS--------VDV-----
Q1H0S6_METFK/108-234TD-----SSAQSILRDVRVISYGD-----------ALQQNVSSSNVSPGPASMLADNGSTSKPQ--------ALS--GHS
U5RQQ6_9CLOT/107-227RP-----DEAKIVLQNIQVLAVDK---------------------QISRDNKESNSNKSSDNGK--------APT--NFL
G8WR76_STREN/95-203GR-----NESRIIVTGARVLKIGR-------------------------QTPISQTSDQTDARA--------TRQ--AVP
D4Z3U8_SPHJU/119-231PL-----KVSETILRNLRVLATDQ----------------------------RMDALGDDGKPV--------VQT--YSN
Q63TZ8_BURPS/132-248RA-----VESETIAARLRVLAVGS-------------------------AFQRPKDDAAQPNTR--------ART-----
A5G038_ACICJ/111-225QR-----VAAETVLSDVRVIAIDQ------------------------RLVQGASGTHPAAKNT--------ART-----
B6JJC5_OLICO/117-227EM-----VSSEIILSDVRVLAIDQ----------------------------TIEEKNGQKVVV--------GKT-----
Q028Y9_SOLUE/108-216LG-----TLTKTLLQNIEVLSAGQ----------------------------DFKKDNEGKPIM--------VQV-----
A1SLD1_NOCSJ/117-225GQ-----TFTRLLLSRVTVLGVGS----------------------TAPVATTTTDDTGAQTVE--------QLP--RTL
D5XCW7_THEPJ/108-236QT-----TVAHVLLQNVEVLAVGD---------------NFTPATNRAVNQGKEDAKNNQSDTG--------AKN-----
Q01YZ0_SOLUE/109-214AD-----TETQTVLQNITVLSAGQ----------------------------TITTDGRSQPIM--------APV-----
Q11KR6_CHESB/117-225EQ-----VSSRTILSNIRVLAVDQ----------------------------NASGESDGEAVV--------AKT-----
F6IDN7_9SPHN/116-237GR-----SEAETLLQMVQVLAVGE-------------------TIVGTRQPSGVEAQVSSPPPP--------ARN-----
F2NFB3_DESAR/52-159HT-----SVARLVLDRVQVFDVTL-----------------------------EADTKGQSKQK--------GEK--DWT
W0PA57_ADVMD/118-225RK-----RITAPLLQGVLVLATGS---------------------------DSRQTDAAEESGQ--------STA--FST
Q1LH51_CUPMC/106-220PQ-----SQTRMLLSRLRVLAYGT-----------------------GAVNEAPKQQGEQMMAR--------REG--AKT
Q2LSW2_SYNAS/111-219TA-----PVTKIVLENILVLASGP---------------------------EFNETKKGEKPAN--------VDV-----
Q12AH8_POLSJ/105-215DQ-----TISKIVLERILVLAIAQ-----------------------------ESSRDETKPKV--------VNA-----
Q0KCZ7_CUPNH/127-250DK-----QTARLLMSDMLVLATGQ---------DVRPRDYGEA----MAAQAAEGAEGVDTNPD--------YDS-----
D4ZHC0_SHEVD/115-236QS-----LYVKTIARNVRVLAFNH-----------------------AVKVEQYIAAQKEYKGF--------IPD--DSA
L0F839_DESDL/112-224GS-----TVIPPELTYVEVIGVTA-----------------STGYDTDSEQSSGDEDTGKNEDE--------KQL--PAT
B7J8D7_ACIF2/111-240WP-----TQSRLLLADLRVLAVGP--------QTVVRHVAQGEPSAFGPAAGSAGSSNQPPREP--------PST-----
G2IKH0_SPHSK/122-234PL-----KVAETILRNLRVLATDQ----------------------------RTNAVGEDGQPV--------VQT--FSN
G0AIA4_COLFT/109-239EK-----TQSRLLMSRLHVLSYGA---------AVIGAAPAGSSGGVVPSQQASQPSQPAQPSQ--------QAQPIART
K0C9R2_ALCDB/111-225SQ-----PTAMVLLNSIEVMAVYG------------------------KLEDTPTDPEAEQQQR--------RGR--NAT
Q63I81_BURPS/105-212QQ-----SISKIVLEKILVLAVAQ-----------------------------QVSRDDTAPKV--------VNA-----
F6IMZ3_9SPHN/117-227PL-----RTSETILRNLRVLATDQ----------------------------TTDNEVVDGKTV--------VKA--FRT
A9HX71_BORPD/116-233KG-----SQVRLLQSRVRVLAYGA--------------------QSIDGPPVASDKPVVQRGAS--------PAP--ARS
E1VJY8_9GAMM/122-230AV-----SRTAPFLQRVKVIATGT------------------------ELNDGIPRELKDPKKL--------QKT--FSD
B1LX60_METRJ/118-231DV-----QLSQTILTDIRVLAIGQ----------------------------LVQEKNGTNVVT--------GET-----
A7HP59_PARL1/143-258DQ-----SKSALLLQDMQVLAVGP----------------------------ALSHQAGQVNAG--------ART-----
Q72A79_DESVH/111-219AK-----ARTKVILAGIKVLATGT---------------------------ELRQEGDDTATSP--------VEV-----
A4J6C8_DESRM/108-214QT-----SLSTLLLQNIQVLAVGQ---------------------------SLDNTPKAEKKTS--------SQT-----
D6Z1Q4_DESAT/119-232QP-----AQARILLARQRLLAYGQ-------------------------APAAAKAGTQPARGA--------GRG--SDT
U5VVB9_9ACTN/116-227SD-----QKTRILLPDATVISITT---------------------GPPSDVTPAPTSTRNNRAV--------AQS---YP
D5C113_NITHN/113-218NK-----VQIETILQNLKVLAVDQ-----------------------------TASQDKNQPLV--------VRA-----
E1QL90_DESB2/113-220KE-----AVARLALQDLEVLAVSH---------------------------QAEQDGKKPPKLK--------GQV-----
Q0A6N2_ALKEH/120-234VG-----EIGRLLHPNIRVLAYGE--------------------DLAIPPDGVVDRRDEEGTQR--------QRG--ART
Q5P397_AROAE/104-213DQ-----MISKIVLERILVLAVAQ-----------------------------EANRDETKPKV--------VNA-----
F6IPU7_9SPHN/112-220DD-----KMTDVVLSTVPVLAIDV----------------------------DASEKSTEPTAA--------GKT-----
B9TEV5_RICCO/111-225LA-----VSSETVVERVRVLAVGS------------------------ELSRPKTSDAPDANNR--------ART-----
F2K0W1_MARM1/119-252PK-----LASQTLLRNVRVLSLNG-------------TLDAFREKVQKVESKKEKKTDSNKRKS--------YET-----
Q82IA2_STRAW/80-188GK-----DQSKVIVENARVLDVGK------------------------LTALDPGQSSDQRRRT--------ASE--AVP
M4U3D5_9GAMM/115-236RS-----LYVKTIVQNVRVLALND-----------------------ALQIDRYQEEKKRNKGM--------LPE--KSA
H7C7J3_CAUVC/150-260KV-----MIAETVLQNIRVLALDQ----------------------------ATAAEKDAKSIV--------AAT-----
B8DJ20_DESVM/112-220SK-----SRTKLVLENVRVLATGT---------------------------ELKQEGDDTSTSS--------VDV-----
D7CPP6_SYNLT/108-220NV-----AVTSFILQDVEVLAVDQ-----------------------NLDETKPVPAAKEEAAP--------ATT-----
Q2G9E8_NOVAD/117-229AL-----KASETILKNLRVLATDQ----------------------------STEQEQVEGKTR--------VRT--FST
Q0VT54_ALCBS/118-228EQ-----PTSMILLKAIEVLAVKG-------------------------QLQDADKTDEEKEKS--------RSR--NAT
Q0ASM6_MARMM/117-228RA-----FVARTIVENARVLAIDQ----------------------------SFSSEADDEVAV--------GET-----
C6XQ22_HIRBI/128-241EE-----TAIDTILNNVRVLAIDG--------------------------YYRPVEEEAGDAVV--------GHR-----
G8B059_9PROT/111-226SR-----AVGETVLQNLRVIAIDQ------------------------QLGEAGMAKNGPDGRI--------PRT-----
G4RFS2_PELHB/120-233GG-----DYSETILSNVRVLAIGT-------------------RLGEVGTTGGQADPENPSSQV--------FES--AEI
Q11B62_CHESB/119-229NG-----FITETVLENIRVLAIDQ---------------------------TIHEDEEGRRVKL--------GET-----
W8T5C2_PEPAC/106-215YN-----DVAKDMLQNVIVLAVDK---------------------DFTIGKEPIVAEGSEGNRR----------------
Q2W0T1_MAGSA/117-235LR-----YGAETVLADLRVLAIDQ----------------------------QITRGRDGAPIQ--------GKT-----
L0E0I1_THIND/118-238AR-----ESAQVVVSDLRVLSYEL--------------------RLDLPPDGAAEDTDGERDGQ--------RRS--NRT
E1SM34_FERBD/106-212ET-----AQTEVVLSNLKVLAVDQ-----------------------------RANQDSNQPVL--------VRA-----
W5WV44_BDEBC/111-236QR-----REVFTMMSDVVVLATGV----------------------SVVNNIPRMFELDSTGKNLTQIALTGDTK--YTT
C5AGY3_BURGB/109-229PK-----TQAKLLLSKIRVLAFGD-----------------------------ATTARDPSGGA--------AGG--VRT
Q89WL1_BRADU/117-231DL-----ILSEVILTNIRVLAIDQ----------------------------APKEKDGQNAVV--------GKT-----
A5D2B5_PELTS/108-222KS-----SITSILIQDVDVLSTDQ-----------------------ATIPLQENGQNGKKEAP--------ART-----
B2JQB8_PARP8/125-239ER-----KAVRLLLPGVLVLATGR-------------------------SVNARDAGDVDEPAS--------ASR--YDT
U4KID3_9VIBR/116-224RT-----MSITPVLIGVKALQIKN----------------------------PISTQSGDMDNS--------DIQ--KVS
D0J7X0_COMT2/105-214SR-----QISKTVLENVLVLAVAQ-----------------------------EADRDETKPKV--------VSA-----
F2J2R1_POLGS/118-225SN-----ARSETILENVRVLAIDT----------------------------TTAGEQDEKSLS-------PDRT-----
Q6D931_PECAS/117-259PL-----LASQTIVRDLRVLALNDKTGTPIYPR----FDVAEDGTVLDATAKSRESAVRSRPTT--------YQT-----
A0KI89_AERHH/122-243SK-----QSAEIILTDIKLLAIDA------------------QVTDIAALNGTVAAQDNFDQVA----------------
M1P550_DESSD/125-243SR-----EAIIPVLEDVLVLATDK----------------------IAARPNEDEFKNLDSEDR--------RRA--YNT
Q92YL7_RHIME/113-222GK-----VVSRAILSNIRVLAVDQ----------------------------TVSQASDGASVI--------GKT-----
B2A8J9_NATTJ/117-228QD-----SSSEIILDNLQVLAVGD----------------------------RILYSRQELVQE-------------VST
Q1GU26_SPHAL/118-234QI-----FTAETIVRNIRVLATDQ----------------------------RYDAEDETGKTP--------VRT--FGS
B7VGJ2_VIBA3/113-222QH-----LTMVPLLAQIPVLDMVT-----------------------------SEKAVSTLTLE--------KET--QVT
V6F008_MAGGM/115-232VR-----YAAETVLADVKVLAVDQ----------------------------QFSKGKDGPTIQ--------GKT-----
Q89PI8_BRADU/132-244RR-----ALSEVVLGNVRVIAIDQ------------------------EIVQGGRTVSSLAGKQ--------AQT-----
E6WXD7_PSEUU/115-229TG-----ALALPLLQQVRVLATGT-------------------------RIGERVAPDGRPADD--------GQG--FSS
C9ZGN6_STRSW/108-217KK-----DTSKLMVTDARVIDVGK------------------------LTPLESGQSSSDRRRT--------ATE--AVP
Q2G867_NOVAD/76-184QD-----KMTDVILRQVAVLGIDQ-----------------------------VADKSKTEAVV--------GKT-----
Q140S5_PARXL/104-219DR-----TQARLLMSKVRVLAFGN-----------------------------ATASGDSAGDP--------NGM--VRT
Q1QR64_NITHX/115-225NS-----VNSETILSNVRVLAVDQ----------------------------TIEEKNGQKVVV--------GKT-----
Q2ND44_ERYLH/117-228DL-----KATETILRNLRVLATDQ---------------------------TTEQTTNEAGKTV--------VRA--FRT
R6MM56_9FIRM/107-215DT-----VIIDDTLKGIEIYSVEN------------------------EDAQNLENVQGSEDKE--------DTI--AAN
I3ZLI3_TERRK/106-211PD-----AVTSTVLQDAQILTAGQ----------------------------KMQPDPDGKAST--------VDV-----
K4KZ78_9FIRM/113-220QR-----TITSLAAQDVLVLNTGD--------------------------TILKEGETAENPGS----------------
N0B187_9BACI/63-169GP-----AKTEILLQGIKVLAVGS-------------------------QTGKTIKSIEPASEL--------ALT--YPS
Q24NN8_DESHY/111-220GA-----TVIPPELTYVEVIGVTA-----------------STGYDT-----GAGEQIKDGGEE--------REL--PAT
Q0K4T9_CUPNH/107-221PE-----SQARMLLSRLRVLAYGV-----------------------ASVNRPQNAKPEQMMAR--------QEG--AKT
Q30YU0_DESAG/112-219DK-----AVTKTVLENIRVLATGT---------------------------ELEQQGDDTATSP--------VDI-----
Q6N2G9_RHOPA/120-231DT-----VTSTTILTNVRVLAIDQ----------------------------LPKEREGQNVVV--------GKT-----
E6SL92_THEM7/109-216AQ-----PEVRLLVENVLVLAVQQ-------------------------------QTAAEGQPA--------GEG--LTH
Q9HW95_PSEAE/119-234ST-----PLAQLVLPGVRVLTYGE-------------------------RIAVGSDGQDRSNQE--------KDPRPPRT
A5VC45_SPHWW/112-235GG-----SQAATLLQMVEVLAVGQ-----------------VVIGSGPANEDKSVSSFESQPPQ--------ARN-----
C4KA68_THASP/116-223HH-----HLTLPLLQGVRVLATGS--------------------------RTRPGEDDGAGDLL--------GGS--FGT
Q2ILR9_ANADE/128-239PA-----YFSKIILQNVPVLAVGK--------------------------ELERNERSLEKSLP--------ATV-----
Q13S63_PARXL/125-253EK-----KVAQLVMPNVLVLATGE---------------DMRPRDAGEAAQQDQANANSSAMSR--------QAGMGYTT
Q87VT5_PSESM/165-287PS-----RSSQVVVPALRILGVGG----------------LLGPDRDGKPVQ-NISADERFKQE--------QQRINART
A7HHF1_ANADF/131-240QA-----PMSKIILQNVRVLAVGK--------------------------EVERADRAFDKAIP--------ATV-----
B5EAZ1_GEOBB/109-217RD-----NISKIILQNVPVLATGQ----------------------------VTEQKEGGKPGV--------VPT-----
D9QLA1_BRESC/159-271AK-----FASRIVMQNVKVLAIDQ----------------------------STRAGDDQQAVV--------GAT-----
Q08YN3_STIAD/110-219DE-----NVAVTLLQNVIVLATGK------------------------ITGTTNVNLIPENQRD-------------YSN
A1S3F8_SHEAM/120-233ER-----VKMELLIEKAQVLATGK--------------------------------RSIDVHPELVNSIYDNPDS--YNT
R7XWH8_9ACTN/115-231LA-----PYTRLLLPKVEVVGVGT----------------------TSIAARTTKTEDGEEEVE--------QVA--RTI
C8VVN4_DESAS/111-223GM-----TVIPPELTYVEVIGVTA-----------------STGYDTDQ-QDTGTDSSAKDDSE--------KQL--PAT
Q220L1_RHOFT/103-212DR-----SVSKIVLERILVLAVAQ-----------------------------EADRDSTKPRV--------VNA-----
K4L4M6_9FIRM/106-229AQ-----VILYPELKGLEVYSVEN-------------------ARTQSTAQVRKQQAENQQSSS--------DPI--PKA
F6AB48_PSEF1/126-247AE-----QTAQVVIPALRLLSVGD----------------TLGITNEGEAAQLPADADEERRRR--------RNA--PTT
V5SAW1_9RHIZ/117-227ED-----YVSDLLFGNVRVLAIGQ--------------------------QIETKEGRKTADGS--------AAT-----
E8WXZ6_GRATM/107-212PE-----PVTLTVLQDAEVLAAGQ----------------------------KIQPDPDGKPVT--------ATV-----
B8ERR4_METSB/120-238RR-----TVSETVLWNVRVIAVDQ-------------------SLDAQTSTVAEHTALGAESHI--------PKT-----
E8RQ62_ASTEC/159-266TT-----HVAKPVLRNVKVLAVDQ----------------------------TVEAKSDQPSVI--------GAT-----
Q7VX28_BORPE/111-228PG-----TQTRLLQSRIKVLAYGQ-------------------RSVDGPPQGEEKPSVAQRGQP--------PAA--PRN
A5UYL2_ROSS1/121-236TA-----PTTALTLQNVQVLKVLR--------------------------QAPREGETKTPATA----------------
Q63TS0_BURPS/109-224AQ-----TQARLLLSRVRVLSFGD-----------------------------ATVERDGTPGP--------TGA-GART
D5EFJ2_AMICL/111-219VS-----PTSRLLLSRVKVLALGG--------------------------VLTRKEEKEGTKEK--------EML--ARS
B8IGQ2_METNO/119-232DV-----QVTETILKNVRVLAVGQ----------------------------TVQERNGERVVT--------GDT-----
D8PF28_9BACT/116-231DD-----PVTKVVLENVRVLAMGQ-------------------DTERAAQTDKAAKNQETKLSV--------PSV-----
A9WMZ1_RENSM/117-224RA-----ENGTVLAASIPVLWSQT-----------------------------------GAQTANGNSWLPGKEA--DGL
A6WWU0_OCHA4/118-230TP-----FTTETVLQNVRVLAIDQ---------------------------AIQEDEQGRKVMV--------GQT-----
A0LIC9_SYNFM/117-223TP-----STSKVVLENVKVLATGT----------------------------VIDKKAGTEPGP--------VDV-----
R4L5S2_9ACTN/119-228SE-----QQTRVLLPAATVISITS---------------------GQPTDIRPMPTSTRSARTS--------ATD--TYP
A9BV49_DELAS/129-265VD-----AQTRLLLARSRVLAYGS--GSVERPPMPAVQRQAQQDKESAGSSLRRASAADQTGQR--------PEN--VQS

PF13144

D3VCD6_XENNA/99-221SFDNIRVRL-NSG--QVITGEAQENGSVKM
C5AEH4_BURGB/386-508PGQQVRVRLAA-G--QIVTAVVKDGNTVEV
B2JJ15_PARP8/300-422PGQPVKVRTAN-G--QIIQGVVKDAGTVEI
Q82XH3_NITEU/106-228AGEVVQVRN-HTG--RIIRGIARAGGVVEI
Q1GZW7_METFK/111-233DGQRVKVKVGN-G--RVVSGLARRGGLIEV
C6XBV3_METGS/118-240DGQLVRVKVAN-G--QVVSGIARNGGKIEV
C6WVB1_METML/141-263EGQVVQVKV-ASG--QVVSGIARQGGQVEV
C7RLC6_ACCPU/110-232EGQVAQVRT-ASG--QVVSGVARGLGIVEV
D5CMW8_SIDLE/115-235EGQNVQVRM-YSG--QVVIGTAAADGSVEV
Q7NZC3_CHRVO/97-219QGDQISVRL-STG--RVVLGVVQADGSVAV
Q8EC91_SHEON/113-233IGDQIRVKNSSSN--KELDATVTAIGEVEV
Q12PP0_SHEDO/113-233EGDTIRVKNSISN--RELDAQVTGIGEVEV
Q085Q4_SHEFN/113-233IDEVIRVKNSNTS--KQFDAVVIGVGEVEV
A8AKH6_CITK8/134-257KGEMIKVKNESSE--RVVSAIVADAGVVKM
O26012_HELPY/96-217LNQIIQAKNLESN--KILKAKVLSSSKAQI
D3UGB6_HELM1/98-220KDAIIEAYNPESK--KTLRVRVLSNAMGEI
Q7VGG2_HELHP/182-304HNEIINAQNPNSG--KIIRVKITDEGKGEI
Q30RI0_SULDN/167-288VNDIINVQN-SSG--KILKVKVTGSNSAEI
A6Q2L6_NITSB/116-236RGDIIKVKNISTN--KVLECKVLSDGVVQF
Q2LT22_SYNAS/119-242LGATVKIKNISSN--KIIHAKVIGNSVVKV
A7HLB5_FERNB/194-315VGKVISVKNLENG--VIIKGTIQEDGTIIV
Q1MQD1_LAWIP/205-326HGSFIQVRNLQSK--KIVHATVVDSNTVEI
C6C0E1_DESAD/212-333VGQNITVRNLQSK--RKVVATVVNAQTVQV
A1T0H6_PSYIN/110-231LGDLIKVKNKRSG--NIITTTVIGKNKVSV
B5YIX3_THEYD/106-229VGGNARVQCFQTG--KEIVGKLVGKDKVRV
B9M0F7_GEODF/101-224EGDTVMVRNLASQ--KELPARVIDAETVKV
A5G8Y0_GEOUR/113-236EGDTVMVQNLASQ--KEVAARVVDATTVKV
A1AUM2_PELPD/113-236EGDTITVQNLGSL--KELPARVLDSTTVLI
B3EAV3_GEOLS/118-241VGELIRVQNLVSN--KEIPARVVDASTVEV
B8FK20_DESAL/199-322LGDAIEVENKMSE--KIITCRVTGPAQVEV
C0QA41_DESAH/185-308LGDQIQVNNLTTN--RVVSGRISGPKTVDV
A4YXW0_BRASO/195-318EGDVVSVLNLQSK--RTITGRVIGRGQVSI
Q218W9_RHOPB/216-338EGDVVNVINLQSK--RTVAGTVIGRGQVAV
Q89I10_BRADU/194-316EGDTVSVLNLQSK--RTLTGVVTGRGQITV
Q6N2Z6_RHOPA/206-328EGDVVNVLNLQSK--RTITGTVIGRGQVAI
Q2W1H7_MAGSA/190-313VGDVIRVTNVQSK--QTVDAKIEGPGQVSV
C5BRR4_TERTT/102-225VGEQIKVRNNRSQ--RIVDAQVTGPGTVRV
Q21IK3_SACD2/118-241VGKQIRVRNNQSK--RVVDGVVSGPGRVSI
A4XW92_PSEMY/127-250PGQQINVRNLRSQ--RVIRARVVGPGQVEV
A4VJC5_PSEU5/125-248PGKQIPVKNQRSG--RVVKARVIGPGHVEV
Q885A9_PSESM/123-246FNEQIRVKNLNSQ--RVIKANVTGPGQVEV
A1WUE8_HALHL/136-260EGERIRVENLDSG--REIQARVVGEGQVRV
Q0AA93_ALKEH/113-236LGDIVRVEAGSSG--RVVEGRVAGESLVEV
B5EEG7_GEOBB/121-244PGDVITVQNLSSQ--KEIAARVVDAATVKV
B7VKL6_VIBA3/126-246MGDQVRVKNDKSQ--RIIEGIVTSMSEVTV
F9ZN65_ACICS/101-224PGQSILVRNLQSG--RVVRGTVTAVATVRV
M1FC75_9ALTE/108-230IGEQVLVENLQSS--RTIKGRVTAPGQVL-
A0A5P8YL94_YERPE/108-230AQETIRVRM-PSG--QIVSGTVADDGTIRI
Q0WIV5_YERPE/108-231KGELIKVKNLSSG--RVVTATVDGSGRVRM
Q5E3M1_ALIF1/133-253LGDKVNVKNDKSN--RIVNGIVTSVGEISI
Q6LTR6_PHOPR/113-233LGEQIRVQNTKSK--RIIDGIVSAVGEVTV
Q9HYP6_PSEAE/107-230PGQQIRVRNLRSQ--RIIKARVIEPGTVEV

PF08666

Q88EQ9_PSEPK/126-187------------------------------
Q30WJ5_DESAG/229-289------------------------------
UXAA_BACSU/11-82------------------------------
Q3ACL1_CARHZ/14-89------------------------------
Q6L322_PICTO/14-89------------------------------
Q726U8_DESVH/286-344------------------------------
O05573_MYCTU/54-116------------------------------
PSEI_HELPY/279-337------------------------------
FLGA_AQUAE/101-160------------------------------
O83573_TREPA/310-372------------------------------
FLAD_CAUVC/127-187------------------------------
SPSE_BACSU/303-365------------------------------
GARD_ECOLI/22-92------------------------------
FLGA_SALTY/95-157------------------------------
UXAA_ECOLI/10-81------------------------------
Q2RLM1_MOOTA/49-111------------------------------
Q2RLM6_MOOTA/36-97------------------------------
Q2SBN4_HAHCH/292-350------------------------------
Q2W0T1_MAGSA/43-111------------------------------
Q2W9F8_MAGSA/290-348------------------------------
Q2WB91_MAGSA/292-350------------------------------
Q2Y6G9_NITMU/29-91------------------------------
Q2Y9F0_NITMU/124-186------------------------------
Q2YJ36_BRUA2/19-88------------------------------
Q30V22_DESAG/280-338------------------------------
Q30W96_DESAG/291-350------------------------------
Q30YU0_DESAG/42-104------------------------------
Q31EV3_HYDCU/54-117------------------------------
Q39YJ9_GEOMG/112-173------------------------------
Q3A3R8_PELCD/46-108------------------------------
Q3A5F3_PELCD/116-177------------------------------
Q3ACP5_CARHZ/12-87------------------------------
A6TKR5_ALKMQ/11-82------------------------------
Q3IDV3_PSET1/113-175------------------------------
Q3IY78_RHOS4/16-74------------------------------
Q3J1Z1_RHOS4/353-418------------------------------
Q3J7R0_NITOC/110-172------------------------------
Q3SID7_THIDA/113-175------------------------------
A8L8R3_FRASN/61-126------------------------------
A8L8Y3_FRASN/55-120------------------------------
A8L6N9_FRASN/66-128------------------------------
Q3Y3F8_ENTFD/15-86------------------------------
A6W5H2_KINRD/344-409------------------------------
A6WH12_KINRD/89-151------------------------------
FLGA_AGRFC/36-98------------------------------
A3DD33_HUNT2/49-113------------------------------
Q4FMC1_PELUB/347-412------------------------------
FLGA_RHIME/42-104------------------------------
Y1065_METJA/277-335------------------------------
Q5KYJ2_GEOKA/13-88------------------------------
Q5QUG9_IDILO/118-180------------------------------
Q5WIW4_BACSK/10-81------------------------------
Q5WKX1_BACSK/12-83------------------------------
Q5YPT3_NOCFA/56-118------------------------------
Q67SH0_SYMTH/35-97------------------------------
W4TZD3_CUTAC/51-114------------------------------
Q6AJR9_DESPS/191-252------------------------------
Q6AN09_DESPS/44-106------------------------------
Q6D6I0_PECAS/98-160------------------------------
Q6D931_PECAS/45-111------------------------------
Q6FFQ4_ACIAD/13-84------------------------------
Q6LH47_PHOPR/14-85------------------------------
Q6LW32_PHOPR/128-190------------------------------
Q6MBR1_PARUW/291-349------------------------------
Q72F65_DESVH/294-352------------------------------
Q74B32_GEOSL/292-350------------------------------
Q7M7S8_WOLSU/280-338------------------------------
Q7N5N4_PHOLL/95-157------------------------------
Q7NR94_CHRVO/277-337------------------------------
Q7NXC7_CHRVO/112-173------------------------------
Q7UGK2_RHOBA/68-130------------------------------
Q7UJ28_RHOBA/334-396------------------------------
Q7UKI4_RHOBA/121-189------------------------------
Q7VHQ5_HELHP/291-349------------------------------
Q7VVV9_BORPE/50-114------------------------------
Q7VX28_BORPE/49-109------------------------------
Q7VYH0_BORPE/112-174------------------------------
Q82IA2_STRAW/13-75------------------------------
Q82RG0_STRAW/65-128------------------------------
Q83GV3_TROWT/38-99------------------------------
Q87M38_VIBPA/44-106------------------------------
Q893U6_CLOTE/293-351------------------------------
Q89HL9_BRADU/296-354------------------------------
Q89PI8_BRADU/60-126------------------------------
Q8A711_BACTN/288-346------------------------------
Q8AAH9_BACTN/12-83------------------------------
Q8D3G4_WIGBR/100-162------------------------------
Q8FR13_COREF/43-105------------------------------
Q8G440_BIFLO/63-125------------------------------
Q8NS06_CORGL/43-105------------------------------
Q8R8C9_CALS4/30-96------------------------------
Q8RIB8_FUSNN/291-351------------------------------
A9CKJ4_AGRFC/46-114------------------------------
Q8XQX9_RALSO/47-107------------------------------
Q8XSX6_RALSO/171-233------------------------------
Q97H26_CLOAB/292-350------------------------------
Q97HN6_CLOAB/39-101------------------------------
Q97L66_CLOAB/11-82------------------------------
Q97YR1_SACS2/11-89------------------------------
Q9ACY4_STRCO/61-124------------------------------
Q9CMH3_PASMU/50-121------------------------------
Q9HW95_PSEAE/56-116------------------------------
Q9KQ04_VIBCH/133-195------------------------------
SIAS_DROME/312-371------------------------------
Q9X1M7_THEMA/158-220------------------------------
A9W9R9_CHLAA/350-414------------------------------
A9WEA1_CHLAA/52-115------------------------------
A9WH46_CHLAA/47-108------------------------------
G1UB98_HAEDU/57-126------------------------------
Q5ZX25_LEGPH/110-170------------------------------
Q5ZXG3_LEGPH/301-358------------------------------
NEUBH_LEGPH/298-355------------------------------
Q63I81_BURPS/38-97------------------------------
Q63M73_BURPS/17-88------------------------------
Q63YB9_BURPS/184-244------------------------------
Q6MRH1_BDEBA/43-103------------------------------
Q7CQZ0_SALTY/29-104------------------------------
Q7DDU0_NEIMB/292-349------------------------------
Q87WJ9_PSESM/19-89------------------------------
Q88J15_PSEPK/19-87------------------------------
Q8DZE3_STRA5/278-334------------------------------
Q8F2V2_LEPIN/174-234------------------------------
Q8P5U5_XANCP/20-89------------------------------
Q8P9B1_XANCP/157-217------------------------------
Q8Y9I2_LISMO/331-395------------------------------

PF16976

Q89UH7_BRADU/120-232VTLELNPTQTATL--SAARQSG-TLSLALR
D0IVZ7_COMT2/112-228AVLAVPVAEVSQL--LLGGSNG-SLLLALR
A4YM09_BRASO/100-211VTLELKPEQAETL--ARARQTG-TLSLALR
C6WWK8_METML/106-215VTLEVTPAQAEKL--DLARSVG-TLSLVLR
A5VFZ0_SPHWW/118-231VTLEATPKIAEKI--AVAQTIG-QLSLALR
Q31EV3_HYDCU/126-245VALDVDTTQAEKL--ALAMNVG-AIHLLLR
B8IRF4_METNO/115-230ATLELDSRQAEIL--AAAEAAG-TLSLSLR
E6VYP1_PSEA9/114-222YTLELTPDESERL--ALAATQG-TLNFALR
Q1H0S6_METFK/108-234AVIAVKEEDVSRL--MLAASGG-TLRLSLR
U5RQQ6_9CLOT/107-227VTLSVKVSDLEKV--VLAQSIG-SIKLALR
G8WR76_STREN/95-203VAFALTTLDAQRV--AYAESFATHVRLAL-
D4Z3U8_SPHJU/119-231VTIEVTPKIAEKI--AVAQTIG-SLSLSLR
Q63TZ8_BURPS/132-248VTFEVSSRDAQVI--TVGAHLG-ALSLALR
A5G038_ACICJ/111-225VTLEVTPEQAERV--EVAAHLG-PLSLIVR
B6JJC5_OLICO/117-227ATLELKPAQAEML--TRSRQSG-TLTLALR
Q028Y9_SOLUE/108-216VNLLVTPEQAEQL--SLASNQT-TIQLILR
A1SLD1_NOCSJ/117-225LTIAVDQKQAQKV--LFASSNG-ELAFALL
D5XCW7_THEPJ/108-236VTLAIPADKMQAL--TLMLDHG-KVTLALR
Q01YZ0_SOLUE/109-214VTLLVTPGEAEAL--TLANTEG-HIQLVLR
Q11KR6_CHESB/117-225ATLEVEPDQIPIV--TAAEASG-TISLALR
F6IDN7_9SPHN/116-237VTLALSPEQVSAL--TLARSTG-SLTLSLR
F2NFB3_DESAR/52-159VTLLVTPDQGATL--LAAASQA-KISLLAR
W0PA57_ADVMD/118-225VTLDTAPEEAARL--VAARQAG-TITALLR
Q1LH51_CUPMC/106-220AVLSVPLEQVGTL--VMAQQAG-RLMLALR
Q2LSW2_SYNAS/111-219ITLEVTPEEGEKL--ALASTEG-KIQLALR
Q12AH8_POLSJ/105-215VTLELTPDQAEKL--DLARSVG-TLSLVLR
Q0KCZ7_CUPNH/127-250LTLMVSPEQAARL--ALAQKVG-SLRAVLR
D4ZHC0_SHEVD/115-236VTLEVLPKQANRI--ILANQLG-ILTLVLR
L0F839_DESDL/112-224VTLLASPEQAKIL--AELDADG-KLHLSL-
B7J8D7_ACIF2/111-240VVLQVPVASAATL--ALASGQG-HLLLALR
G2IKH0_SPHSK/122-234VTLEVTPRMAEKI--SVAQTVG-AITLSLR
G0AIA4_COLFT/109-239AVLATPVADVNRL--LLATQNG-KLMLALR
K0C9R2_ALCDB/111-225AVLAVPREELPKL--FLADSNG-DLRLALA
Q63I81_BURPS/105-212VTLEVSPEQAEKL--DLARSVG-TLSLVLR
F6IMZ3_9SPHN/117-227VTIEVTPRIAEKV--AVAQEIG-TLSLSLR
A9HX71_BORPD/116-233ALLAVPVERVNEL--LLASRSG-HLQLALR
E1VJY8_9GAMM/122-230VTLAVTPVQATKL--IHSQSVG-DIAMVLR
B1LX60_METRJ/118-231ATLAVTPAQAETL--ALAQKVG-ALTLSLR
A7HP59_PARL1/143-258VTVAAPPNALARL--ALAGRLG-HITLAIR
Q72A79_DESVH/111-219YTLEVTPEQAELL--SLAASRG-ELHFALR
A4J6C8_DESRM/108-214VTLSVQPGQATPL--TLATERG-SIRLMLR
D6Z1Q4_DESAT/119-232AVLAVRTEDAPKL--LLAAQVG-TLHLALH
U5VVB9_9ACTN/116-227ATLAVDQDDAVRL--VHAAQTG-SIYLGL-
D5C113_NITHN/113-218VTLEADPKQAEKL--FKATEEG-TIQLVLR
E1QL90_DESB2/113-220LTLLARPADAERL--ALAAGEG-KILLALR
Q0A6N2_ALKEH/120-234AVLALPEEDVATL--LLADSAG-TLRLAAR
Q5P397_AROAE/104-213VTLEVTPEQAERL--DLARSVG-NLSLVLR
F6IPU7_9SPHN/112-220ATLQVDTLGAQKL--ALAQQLG-VLSLALR
B9TEV5_RICCO/111-225VTLEVTPHMAEVV--SVAARLG-SLSFALR
F2K0W1_MARM1/119-252VTLEVLPKDVERL--TVAREVG-ILQLALR
Q82IA2_STRAW/80-188ITFALDTADAQRV--AYAESFAEHVRLALV
M4U3D5_9GAMM/115-236VTLEVLPAQANTV--ILANQLG-TLSMLLR
H7C7J3_CAUVC/150-260ATLEVGPVEAEAL--ARAKAGG-PITLALR
B8DJ20_DESVM/112-220YTLEISPPQAEPL--ALAASRG-ELHFALR
D7CPP6_SYNLT/108-220VTLAVTPEEARPL--VLASEQG-SIRLALR
Q2G9E8_NOVAD/117-229VTLEVTPKIAEKI--AVAQTIG-TISLSLR
Q0VT54_ALCBS/118-228AVLAIPREALPKL--LLADSNG-ELRLAM-
Q0ASM6_MARMM/117-228ATLELTPDQARAV--SVAVARG-EIALVLR
C6XQ22_HIRBI/128-241ATLELSKQDAMVL--MAAQERG-DLSLVLR
G8B059_9PROT/111-226VTLEVTARQSETV--TVAAAMG-KLSLALR
G4RFS2_PELHB/120-233ATLELTPAQAETI--LQSGSMG-RLTLVLR
Q11B62_CHESB/119-229ATLELTPEEAEVI--TVAQQLADRLTLSLR
W8T5C2_PEPAC/106-215ITVAVNVWDAEKI--VFAQDYG-KVHLVLR
Q2W0T1_MAGSA/117-235ATLEVTPKQAEIL--TVAGMMG-TLQLSLR
L0E0I1_THIND/118-238AVLAVPEDEAPKV--MLAANAG-SLRLALH
E1SM34_FERBD/106-212VTLEVTLEQAEEL--MSARSRG-NIQLALR
W5WV44_BDEBC/111-236ITVEATPKEAQDLFYILSTAPG-NLFFALR
C5AGY3_BURGB/109-229AVLAVPTAQIDAL--TLAEASG-NLTLALR
Q89WL1_BRADU/117-231VTLELKPDQVATL--TAARQGG-TLQLALR
A5D2B5_PELTS/108-222VTLSVTPEQAQPL--VLCSEKG-TIRLILR
B2JQB8_PARP8/125-239VTMQVPAADAPRI--VLAQKMG-TLRLILR
U4KID3_9VIBR/116-224VILELTRKQVAKL--TVAKRIS-EL-----
D0J7X0_COMT2/105-214VTLELSPEDAEKL--DLARSVG-NLSLVLR
F2J2R1_POLGS/118-225ATLELSLEQAEVV--AQAQQIG-TISLALR
Q6D931_PECAS/117-259VTLEVTPQQAEAL--AVAKELG-MLHLALR
A0KI89_AERHH/122-243VTFELAPSAAARL--LLAHRLG-ELALVLR
M1P550_DESSD/125-243LTLEVTPKEAAIV--AIAESRG-ELISILR
Q92YL7_RHIME/113-222ATLEVDPEQISAV--AAAEASG-TVSLALR
B2A8J9_NATTJ/117-228VTLAVNRNEATEL--THAEEEH-VIRLLLQ
Q1GU26_SPHAL/118-234VTLEATPEIAEKI--AVAQGMG-RLSLALR
B7VGJ2_VIBA3/113-222LILQVTNQQLAQL--TVAQRI---------
V6F008_MAGGM/115-232ATLEVSPDQAEIL--VTAGLMG-QLSLILR
Q89PI8_BRADU/132-244VSLELAPDQVKKI--TVAKQIG-TISLAVR
E6WXD7_PSEUU/115-229VTLELDHGQAKTL--AVASEAG-SLRVLLR
C9ZGN6_STRSW/108-217ITFALDTADAQRV--AFAESFAEHVRLALV
Q2G867_NOVAD/76-184ATVQVDTLGAQKL--ALARELG-TLSLGLR
Q140S5_PARXL/104-219AVLAVPVADVDRL--TLAESAG-RLIFALR
Q1QR64_NITHX/115-225ATLELKPEQAEML--ARSRQMG-TLSLALR
Q2ND44_ERYLH/117-228VTLEVTPKIAEKV--AVAQTLG-TLSLALR
R6MM56_9FIRM/107-215VTLIATEEQAAKL--INAEYSG-KLHIILE
I3ZLI3_TERRK/106-211VTLLVTPADAEKV--VLASAQG-TVHFVLR
K4KZ78_9FIRM/113-220YVLAMSVSQSMAV--TLGSEKG-SIRLLLR
N0B187_9BACI/63-169VTVEVTPEQAVSI--ATVSVKG-SLTLMLR
Q24NN8_DESHY/111-220VTLLVAPEQGKIL--AELEAEG-KLHLSLV
Q0K4T9_CUPNH/107-221AVLSVPLEQVSRL--AMAQQSG-RLLLALR
Q30YU0_DESAG/112-219YTLEMLPREVEVL--SLAASRG-EVHFSLR
Q6N2G9_RHOPA/120-231ATLELTGDQAEVL--TRARQSG-TLSLALR
E6SL92_THEM7/109-216LTLAVSPAHAAAI--VLAEQEG-RLRLALR
Q9HW95_PSEAE/119-234AVLAVPEDGVARL--MLASQAG-SLRLAIR
A5VC45_SPHWW/112-235VTLALTPADVSTL--SLAKARG-AIYLSLR
C4KA68_THASP/116-223LTLDLSEEEATRL--VAARALA-RLTAVLR
Q2ILR9_ANADE/128-239ATLMVDSEQSEKL--ALAQTKG-NILLTLR
Q13S63_PARXL/125-253VTLEIPVDDVARV--ALAQKIG-GLRLILR
Q87VT5_PSESM/165-287VTVAVPEALLARL--MLASQTG-ILRLAVR
A7HHF1_ANADF/131-240ATLMVDSEQSEKL--ALAATKG-QILLSLR
B5EAZ1_GEOBB/109-217VTLDVTPIEAEKL--IVGTKKG-SLQLLLR
D9QLA1_BRESC/159-271ATLEVAPQDAEVV--ALAKAAG-TLSLVLR
Q08YN3_STIAD/110-219ISLLVIPEEAEIL--VLASELG-NLTLSLR
A1S3F8_SHEAM/120-233VTLALSTEDAIRV--SLAKGRG-KFVTLLR
R7XWH8_9ACTN/115-231LTVAVDQKEAERL--IYAARNG-DVSFAM-
C8VVN4_DESAS/111-223VTLLVSPEQSKIL--AELESDG-KLHLSL-
Q220L1_RHOFT/103-212VTLEVTPRDAEML--DLARSVG-TLSLVLR
K4L4M6_9FIRM/106-229VTLIASEAQAAKL--IEAEYTG-KLHLI--
F6AB48_PSEF1/126-247AVLAVPEALLTRF--MLATQVG-SLRLAVR
V5SAW1_9RHIZ/117-227ATLELTARQAELL--ALANSMG-EISLTLR
E8WXZ6_GRATM/107-212VTLLLTPEDAQRA--VLASSQG-AIHFILR
B8ERR4_METSB/120-238VTLEMFERQAETL--LVAAQLG-KFQLAVR
E8RQ62_ASTEC/159-266ATLEVRPEEGEAL--AQAKAQG-PLSLMLR
Q7VX28_BORPE/111-228AMLAVPVERVNEL--LLAAKAG-RLQLVLR
A5UYL2_ROSS1/121-236LLCAMRPEDAIIL--KHIKDTGGTIDFALR
Q63TS0_BURPS/109-224AVLAVPTAQVDAL--TLAEASG-RLVLALR
D5EFJ2_AMICL/111-219AVVEVSPEEAAVA--AWAQSLG-SVWLALR
B8IGQ2_METNO/119-232ATLELTPAQAEQI--TLAQKVG-QLSLALR
D8PF28_9BACT/116-231MTLEVAPDEAEKL--ALASTEG-KVQLALR
A9WMZ1_RENSM/117-224VVVAASAEQSKTL--AGASTRG-KISLVLV
A6WWU0_OCHA4/118-230ATLEVTPEQAEII--TVAQQMADRLTLALR
A0LIC9_SYNFM/117-223FTLEVTPEEAERL--AFAASLG-KLHFALR
R4L5S2_9ACTN/119-228VTLAVDQEDATRL--VHAAQTA-EIYLGL-
A9BV49_DELAS/129-265AVLAVPLDDVERL--TLAEKFG-QLTLALR

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window