Sequence alignment for CL0493

PF02378

B7J380_BORBZ/28-365RDGFTFSMPFLIVGSFILLLVN.............LPFTDSQTLLYQ....QWYVDLMAKYKG-----------------
B9AAA6_BORBG/17-354SKALRVPISILPVSCLLIGIGS............VFSNSSSIVYVDK....IFIQNVLG....-----------------
PTU3C_STACT/16-359GKALMLPVAILPAAGILLTFGN.............AMHNEQILHFAP....WMQHHYIQLISQ-----------------
A0A017I7U5_ECOLX/111-396IGTMSPLIPAIIGGSMVKLLAM.........................ILEMSGVLTKGSPTLT-----------------
P94865_LACCA/25-344RDGFIACMPIIIFSSIFMMVAY.............VPN.............AWGFYWPDNVTN-----------------
J7JNY4_BACIU/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLNK..........IMNASMLTSFQS-----------------
D2BPU6_LACLK/26-390KNGMLFAMPFIIVGSIFLILAN.............IPIPPVAKWLSD...........NGWSA-----------------
J7HPY1_MYCGT/28-366SNGLMIPIAVLPLAGIFLGIGDA...........ISSNSSGIVGVKFF.GE............-----------------
O07656_ECOLX/14-353GKAFMYPIALLSVCGMMLGLGSG...........LASD..DMAKLIPFLAIPIIKTILD....-----------------
A0A017INW7_ECOLX/19-361GKTFMLPVALLSFCGIMLGIGSS...........LSSH..DVITLIPVLGNPVLQAIFT....-----------------
F0K639_CLOAE/28-347RDGFLSCMPVILFSSIFLLIAC.............VPN.............AWGFYWPNNVND-----------------
PTLCB_STAAU/29-349RDGFISAMPVILFSSIFLLIAY.............VPN.............IFGFKWDKGMEA-----------------
F0K514_CLOAE/28-372KDGVIITMPLTLVGSIFLLIAN.............FPIKSWNSWMTA........IFGPNWAV-----------------
D4QR60_ENTFC/107-385SESMTPILEPIICAGLLAAVLS.........................IASLTGIISPDSSTYH-----------------
J7JTD7_BACIU/29-359RDGIILTMPLIIIGSVFLILTS.............LPIPGYADFMAS........VFGNEWAD-----------------
Q9CJ32_LACLA/29-420RDSFIGMLPATLAGALAAMISAIVTTFPSAIQQMMLGATAFSKLAPEKVWTLANTPIIGDLNN-----------------
Q9ZHJ9_CLOBE/108-393GDVFVPIIPVLVATGLFMGLRG.........................L.LTNLGVQMNENFVL-----------------
PTMCB_BACHD/19-279SGMIMPNIGAFIAWGLITALFI................................PTGWWPNEQ-----------------
A0A009DVA0_ECOLX/13-320GKSLMLPVSVLPIAGILLGVGS.............................ANFSWLPAVVSH-----------------
Q9K7V5_BACHD/18-254FVTALSFMALGLFSSLIIGLII...............................RTIGDVTQFE-----------------
E6P283_ECOD1/9-347GGAMFTPVLLFPFAGIVVGLAIL...........LQNP..MFVGESLTDPNSLFAQIVH....-----------------
I6TZV0_STRMG/111-420SDIFVPIIPALVAGGLLMALNN...............FLTSEGLF.GTKSLVQQFPIIKGSSD-----------------
O51590_BORBU/12-348GRSFMLPIAILPAAGLLLGIGGS...........LSNP..ETVRTYSFLNIFFLQSVFK....-----------------
K7DWE1_LACLC/28-348RDGFIAGMPVILFSSIFILIAY.............VPN.............AWGFHWSKDIET-----------------
B9LY78_BORBG/18-378GKAFMLPIALLPAAGILLGIGGA...........FTNE..TMIQAYGLEEVLGKGTVANSILY-----------------
J7JKU5_BACIU/9-293GKSFMLPIAVLPAVGIILALGR.................EDVFNIP.................-----------------
B1RZB9_STREE/29-359REGFMMAMPLILVGSLFLILIS.............WPQEAFTNWLNS...........VGLLS-----------------
P96159_VIBFU/17-357GKTFMLPVALLAFSGILLGVGSS...........FSSS..AIKEAIPFLDNAPFEYLFM....-----------------
Q98R81_MYCPU/304-616MSGISYMLPFVVFGGIIISIGFL...........IDTIYGATSGISSDPKFLANFGSNHIVAK-----------------
B1X6L2_ECODH/11-300GRALQLPIAVLPVAALLLRFGQ.................PDLLNVA.................-----------------
J7JJ76_BACIU/13-314GRALMTPVAVLPAAGLLLRFGD.................KDLLNIP.................-----------------
PTSBC_STAXY/110-413SDIFVPIIPAIVAGGLLMGINN...............ILTAPGIFYDNQSLIEVQNQFSGLAE-----------------
PTG3C_STACT/13-344GKALMLPVAILPAAGLLLALGN.............AFQGDALQSLMPFIKAEGFQNVAK....-----------------
A0A016QY08_KLEPN/110-395SNIFVPIIPAIVASGLLMGLLG.........................MVKTYGWVDPSNALYI-----------------
Q97SS4_STRPN/34-364KDGMLAILPLTVVGSLFLIMGQ.............LPFEGLNKSIAS........VFGANWTE-----------------
A0A017HY88_ECOLX/133-409MAGVSAALPFVIGGGILVALANM...........LVQFGLPYT.........DMSKGAPSFTW-----------------
J0XFC0_STREE/12-284LTAISYMIPIVCGAGFLVAIGLA...........MGGGVPD...........ALVAGKFTIWD-----------------
A0A017I737_ECOLX/18-278TAMVIPNIGAFIAWGFITALFI................................PTGWLPNEH-----------------
A7X3X2_STAA1/22-268AGVVIALVPNALLGEVLKIFKS...................................GNEILE-----------------
PTS3B_PEDPE/111-411SDIFIPIVPALVAGGLLMALNN...............VLTAEHLF.MAKSVVEVYPGLKGIAE-----------------
PTG3C_MYCPN/40-387SNGLMIPIAVLPIAGIFLGVGDA...........IAGNAGDLTGLRYF.GL............-----------------
E8VEA9_BACST/9-346GSAMFVPVLLFAFAGIIVGISTL...........FKNK..TLMG.PLADPDGFWYQCWY....-----------------
J7JTG0_BACIU/29-359RDGIILTMPLIIIGSFFLIIGN.............LPIPGYAEFMAK........TFGSSWSE-----------------
A0A017IAK3_ECOLX/118-401ATIFTPLIPGFIAAGLLLGIAT....................LIATVMHVPADAQGTLPDALN-----------------
Q97QL8_STRPN/28-347RDGFIAGMPVILFSSIFILIAF.............VPN.............SWGFKWSDEVVA-----------------
Q9K614_BACHD/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLDQ..........LMNEGALATFRE-----------------
J3WKQ3_MYCGT/303-598LSGVSYMLPFVVFGGILIALSFL...........IDINNANNAG........GNFGTINPVAN-----------------
J1R4G5_STREE/27-356RDAFVTVMPLYILAGLIVLLNN........................TVFKWIFQGDTLTRFQY-----------------
P94470_GEOSE/110-394SNIFVPIIPAIVASGLLMGPLG.........................MMKAFKWVAPDSPLYV-----------------
Q45579_BACIU/119-390ASIFIPLIPALVASGLITGITK.........................AIIQAGWLSADSQIAI-----------------
A1F3C7_VIBCL/35-354RDGFIVAMPFIIVGSFILIFAF.............PPFAEDTTNVFG....RVWLNFATTHFD-----------------
E8VJP2_BACST/13-354GRALMLPVAILPAAGILLAIGN.............AMQNKDMIQVLHFLSNDNVQLVAG....-----------------
F0LVD8_VIBFN/11-324GKALMVPVATLPAAAILMGVGYWIDPNGWGANSALAG..........................-----------------
A5LK37_STREE/28-353KDGFIATMPLIMFSSFLMIIIM.............IPK.............NFGVELPSPAIV-----------------
G6T801_STREE/32-373TAAGMAAVPFTIVGSMFLVFSI.............LPQAFSFWPIVA....DIFSASFDKFTS-----------------

PF13303

C4Z6R4_EUBE2/32-372-IDALGAMAQGLFCSLLIGTIL--------------------NTLGTQLHIGFLTNTVATVSG.................
A8FGC2_BACP2/18-332-IEALSYMALGLFATLVVGLIL--------------------KTAGGLLSL...........P.................
Q5WEA3_BACSK/19-333-IKAMGQMTFGLFATLIIGLII--------------------KTAGEQFGI...........A.................
B9DKL9_STACT/10-331-IQGLSYMTLGLFGSLIIGLIM--------------------QTIGKQTLILAL......NLH.................
B1YKF4_EXIS2/16-335-ITVLSYMALGLFSSLIMGLIL--------------------KTIGEGLITKGI......DAE.................
Q03V93_LEUMM/32-373-FDVSQGISNAILAVLGMGLLM--------------------ASIGNIFHY...........T.................
B9E8P3_MACCJ/18-343-EKGAQGISAGIFVALGVGMLL--------------------KSMGGLLHI...........D.................
Q5WK09_BACSK/10-334-YKASAGVANAVLVTLGIGLLF--------------------ESFGNIFGW...........S.................
B1YJH3_EXIS2/10-334-VKVSAGMANAVLVTLGVGLLI--------------------ETFGNLLHI...........E.................
C3PGV6_CORA7/34-371-MKVLNGISIAVVVSLVPQALL--------------------GELAKALLPLWS......GAS.................
C4LGW0_CORK4/38-376-MNVLNGISVAVVVALVPQALL--------------------GELFKALLPVFP......QGK.................
C4L4Z6_EXISA/15-349-MNVLNGLSMAILIALIPSALL--------------------GELTKAILPYFP......SLQ.................
Q036G8_LACC3/10-344-MNILNGLSVGIIVALVPGAIL--------------------NAIVKLLLPSFP......QLA.................
D1AVH7_STRM9/11-347-MKVLNGTAIGIVVGLIPNAVL--------------------GGLFGYLEQFNP......VFG.................
Q1GB97_LACDA/16-354-MKVLNGSATAIIVSLLPSAIL--------------------STFLTPFAGSNA......IVA.................
Q6LQ05_PHOPR/28-337-SAAMSGLADAAIATFLVEAIH--------------------KYVMGNLLGI..........G.................
Q8XP04_CLOPE/28-342-MKAMGALAGAACASFLVEAFH--------------------SSFFGNVLNI..........E.................
Q2G165_STAA8/1-310-MRAMGALANAAIATFLVEAFN--------------------KYVGGEVFGI..........K.................
C4L1G3_EXISA/28-337-MKAMGALAGAAIASFLVEAFN--------------------AYAIGGLLPL..........P.................
A9NFH9_ACHLI/27-386-SKTLNGMTFGIFGTIVVGAII--------------------QTLGIITGID..........V.................
Q4FQB6_PSYA2/23-363-IDAFTGMALGLFVTLIAGLII--------------------SQIGGWLNL...........P.................
D1ARE5_SEBTE/14-338-VKILNGMALGLMASLVTGVIL--------------------KQIGTYLNI...........Q.................
A8MEB1_ALKOO/15-347-TKALNGMALGLFSSLIIGLIL--------------------KQIGELTNI...........S.................
B2A7K6_NATTJ/25-344-IEVLGFMAQGLFASLIIGVIL--------------------NEIGVQLGIT..........F.................
C7RED4_ANAPD/18-331-IDALGAMAFGLFASLLVGTIL--------------------NSLGQSLHIP..........Y.................
A0PXE9_CLONN/19-346-.KVLAGTATGIVVGLIPNAIL--------------------GAIFKGLINTSP......IFS.................
B2GDR1_LACF3/19-361-.NLSAAIANAILVTLGMGLLM--------------------QTVAGFVHW...........Q.................
F4BRJ2_CARS1/10-335-YKASSGIANAIFVTIGIGLLL--------------------ETIGNMTGL...........T.................
F5WSR4_ERYRF/12-343-.KILQGAAMGIVVGLIPNAIF--------------------GEIFKALGSHFA......VFA.................
Q03W61_LEUMM/33-377-YKVSAAVSNAILVTLGMGLLL--------------------QTIAGFIHW...........A.................
Q1GBH7_LACDA/16-349-.NILNGIGLGVIAALVPAAIL--------------------GQLMKALLGVAP.....AFAQ.................
Q2FV51_STAA8/15-348-.RVLSGVAIGIVAGLVPNAIL--------------------GEIFKYFMDYHP......IFK.................
Q56343_TREPA/13-343-MKILNGSSAGIVIGLVPPAIA--------------------GELFRALAPLSP......LFA.................
Q5FLN1_LACAC/11-342-.NILSGVSSGVVIALVPGALV--------------------NEIMKSISDVWP......AAQ.................
Q81XJ8_BACAN/10-333-FKASAGIAQGIFVSLGIGLLI--------------------ENIGRIVDI...........P.................
Q834J3_ENTFA/18-343-.KVLAGTASGTIIALIPNAVL--------------------GAILKYFAEYK.......IIE.................
Q839R1_ENTFA/29-330-.KSLSALSGAACATFLPEAFL--------------------RYAVGGVFHL..........D.................
Q8XMA5_CLOPE/20-350-.KVLAGTATGIVVGLIPNAIL--------------------GSIFKGLIGVSP......IFS.................
Q8Y5C0_LISMO/10-334-YKASMGIANAVLVTLGIGLLL--------------------QTIGQMTGI...........S.................
Q9A0B4_STRP1/15-348-.KVLAGTAIAIVVALIPNAIL--------------------ATFLKPLLPNM.......AAA.................
Q9A1Q9_STRP1/29-336-.KAMGALASAACASFLVEAFQ--------------------DSFFGKVLGF..........Q.................
R5FBU1_9CLOT/24-338-IDALGAMAFGLFASLLIGTIF--------------------GTLGQQFQI...........E.................
R5J6K1_9FIRM/19-358-.VAMNGMALGLFSTLIIGLII--------------------NQIGQAIPGSL........GS.................
R6FZL0_9FIRM/39-416-IDAMGAMALGLFASLLIGTII--------------------KTLAENVGTTG.......LMAALAAITDTGELAAKVAG
R6RMS6_9FIRM/1-317-......MACGIFATLIMGMFL--------------------RQIANLFPSDF........NS.................

PF02378

B7J380_BORBZ/28-365---------NLVQPFYVSMGIMSIFVVFGIGYNLSNHY......KLSGIT..GGFLSLYTFLILAGQSDWIPYGGDAAKW
B9AAA6_BORBG/17-354---------LMKAIGNAILLNMPLIFSIGISIGV..AR......MGQGTAALGGLIGYLTFNI..TENYFIEAFSGLVEA
PTU3C_STACT/16-359---------IMEASGQVIFDNLPLLFAMGTALGL..A.......GGDGVAGIAALVGYLIMSATMGKIAGITIDDIFSYA
A0A017I7U5_ECOLX/111-396---------ILNVIGDGAFFFLPLMVAASAAIKF..........KTNMSLAIAIAGVLVHPS...FIELMAKAAQG....
P94865_LACCA/25-344---------TLMVAYKYSMGLLALFVAGTTAKNLTDSK......NLELPK..TNQINPVAVIVASEISFVILSILT....
J7JNY4_BACIU/26-350---------HFGIASTATMGIMSVFVVFGIGYYLSKSY......QVEAVF..GGAIALVSFLLLTPFIIQPETGDA....
D2BPU6_LACLK/26-390---------IFTQAFNVSFGILAIWAAVGIGYSYVKEA......GFGDVALQGGLTSLSAFFIVQSLSIANPITAALATG
J7HPY1_MYCGT/28-366---------FIKQGGNVVFANLPILFAVAIAITF.S........QDAGVAGFSAFVFWATMNA..FMSSLIIPVDANNTA
O07656_ECOLX/14-353---------FIVSLGLFAFVNLPVLFAIAIPLGLLKDK......EDKAYGAFSGLIGFMAMHL..GTNFYLKQHDLLVV.
A0A017INW7_ECOLX/19-361---------WMSKIGSFAFSFLPVMFCIAIPLGL..AR......ENKGVAAFAGFIGYAVMNL..AVNFWLTNKGILPTT
F0K639_CLOAE/28-347---------ILMKAYNYSMGILALLMVATIAKSLTDSI......NGKLPK..LRQINNVSVMIVSIICFILIGVQP....
PTLCB_STAAU/29-349---------ILMKPYNYTMGLVAFLVAGTTAKSLTDSF......NRKLES..TNQINFISTMQAAMCGFLFLASDP....
F0K514_CLOAE/28-372---------PLTQVSGSTFDIMAIAAVIGIAAQYSKNE......GQDPVT..AGLLGAVAFLIIMPSYSPINIGDKVGG.
D4QR60_ENTFC/107-385---------IFDALRSAVFYFLPILMAMSCAKRL..........GASPYLAVALAATILSSSINDVK.............
J7JTD7_BACIU/29-359---------KLGYPVNASFDIMAMIAAFGIAYRLAESY......GVDALS..AGAISIAAFLLATPFEVPFTPHGSTE..
Q9CJ32_LACLA/29-420---------ISALVNQGTLTVIGLIFAFSWGYNLARAY......GVNDLA..GGIVSLATLFAGLPNQMGKFTAALGTGK
Q9ZHJ9_CLOBE/108-393---------FTQVLTDTAFAFLPALVAWSTMKKF..........GGTPVIGIVIGLMLVSPSLPNAYAVAAGTATP....
PTMCB_BACHD/19-279---------LAELVGPMITYLLPLLIGYTGGKMIYD........VRGGVVGAAATMGVVV....................
A0A009DVA0_ECOLX/13-320---------VMAEAGGSVFANMPLIFAIGVALGF..T.......NNDGVSALAAVVAYGIMVKTMAVVAPLVLHLP....
Q9K7V5_BACHD/18-254---------LMHNIGVLAMSLMGPAIGVAVAYGL..........QAPRLVLFSALIAGAA....................
E6P283_ECOD1/9-347---------IIEEGGWTVFRNMPLIFAVGLPIGL..AK......QAQGRACLAVMVSFLTWNY..FINAMGMTWGSYFGV
I6TZV0_STRMG/111-420---------MIQLMSAAPFWFLPILVGISAAKRF..........GANQFLGASIGMIMVAPGAANIIGLAANAPISKAA.
O51590_BORBU/12-348---------IMSASGSIIFSNLAPIFSIGIAVGL..AK......SDKGTSGIAAFIGYLVMNA..TIGVLIDVSGRAE..
K7DWE1_LACLC/28-348---------FLMTPYSYSMGILAFFVGGTTAKALTDSK......NRDLPA..TNQINFLSTMLASMVGFLLMAAEP....
B9LY78_BORBG/18-378---------LMKYTGEVIFANLPLMFAAAIPIGL..AK......VEKGTAALAGVVGFLVMHQ..TINGILYIQGITPES
J7JKU5_BACIU/9-293---------FVYQAGTAVFDHLPLIFAIGIAIGI..SK......DSNGAAGLSGAISYLMLDA.................
B1RZB9_STREE/29-359---------ILTTMNQSTVAIISLVACFGIAYRLSEGY......GTDGPS..AGIIALSSFVLMAPRFSSMVYDKNGE..
P96159_VIBFU/17-357---------WMTKIGLVAFIYLPVMFAVAIPLGL..AR......EEKGVAGFAGFVGYAAFNL..AINFFLTVAGVLDS.
Q98R81_MYCPU/304-616---------WFNRLGGIAFSIMVAILAAYITYSL..........VGRQGLLPGFVIGFISSGRLKDTYSFLTDSLTN...
B1X6L2_ECODH/11-300---------FIAQAGGAIFDNLALIFAIGVASSW..SK......DSAGAAALAGAVGYFVLTK.................
J7JJ76_BACIU/13-314---------IIKDAGGVVFDNLPLIFAVGVAIGL..A.......GGEGVAGLAAVIGYLILTV..TLDNMGKLLGL....
PTSBC_STAXY/110-413---------MINIFANAPFTLLPILIGFSAAKRF..........GGNAYLGAALGMILVHPELMSAYDYPKALEAGKE..
PTG3C_STACT/13-344---------MMEGAGGIIFDNLAIIFALGVAIGL..A.......SGDGVAAIAAFVGFIVLNK..TMGMFLGVTPEKA..
A0A016QY08_KLEPN/110-395---------MLDMCSSAAFIILPILIGFTAAREF..........GGNPYLGATLGGILTHPALTNAWGVAAGFH......
Q97SS4_STRPN/34-364---------PFMQVYSGTFAIMGLISCFSIAYSYAKNS......GVEALP..AGVLSVSAFFILLRSSYIPKQGEA....
A0A017HY88_ECOLX/133-409---------VVESIGYLGFTFMIPIMGAYIASSI..........ADKPAFAPAFLVCYLANDK.................
J0XFC0_STREE/12-284---------ALATMGGKALGLLPVVIATGLSYSI..........AGKPGIAPGFVVGLIANS..................
A0A017I737_ECOLX/18-278---------FAKIVGPMITYLLPVMIGSTGGHLVGG........KRGAVMGGIGTIGVIV....................
A7X3X2_STAA1/22-268---------LTYQLVILIQLFMAFIIGVLAAHQFKFNG......AGAAIVGTSAMIGSGAVV..................
PTS3B_PEDPE/111-411---------MINAMASAPFTFLPILLGFSATKRF..........GGNPYLGATMGMIMVLPSLVNGYSVATTMAAGK...
PTG3C_MYCPN/40-387---------FIKNGGDVVFANLPILFAIAIAITF.S........QDAGVAGFSAFVFWAAMNG..FMSSLILPFDKAGKI
E8VEA9_BACST/9-346---------IIEQGGWTVFNQMPLLFAIGIPVAL..AK......KAQARACLEALTVYLTFNY..FVSAILTVWGGAFGV
J7JTG0_BACIU/29-359---------KLAYPVDATFEIMGLVAAFGIAYRLAEKY......GVDALS..AGAISLAAFLLATPYQVPFMPDGATK..
A0A017IAK3_ECOLX/118-401---------FMKVFSKGLFTFLVILVGYNAAQAF..........GGTGVNGAIIAALFLLGYNPAATTGY..........
Q97QL8_STRPN/28-347---------FLMKPYSYSMGILALLVAGTTAKSLTDSV......NRSMEK..TNQIKYMSTLLAAIVGLLMLAADP....
Q9K614_BACHD/26-350---------SFSIASSATMGMMSVFVAFGIGYYLSKSY......NVEAIF..GGAIALVSFFILTPFMVETEAGEV....
J3WKQ3_MYCGT/303-598---------WLNKLGGISFSLIVPILSAYIAYAL..........VSRQGLLPGFVVGLISSGQ......FLLNIVLT...
J1R4G5_STREE/27-356---------WGITIANGTLSISGMIIAVMVGYFLAKNR......DFENPLA.ASMLSLVSLIVMMPNTVSVVPDGAKD..
P94470_GEOSE/110-394---------LLDMFSSAAFIILPILIGFSAAKEF..........GGTPFLGAVIGGIMTHPALLNPWGLAEAKPN.....
Q45579_BACIU/119-390---------ILTVIGSGLFTYLGILVGINASKEF..........GGTPALGALAGILIINPE..................
A1F3C7_VIBCL/35-354---------IIMMPFNMSMGIMTIFVSLGVAYSLAKAY......KMDGIT..SAVLSLMSFLLVAAPA............
E8VJP2_BACST/13-354---------VMESAGQIVFDNLPLLFAVGVAIGL..A.......NGDGVAGIAAIIGYLVMNV..SMSAVLLANGTIPSD
F0LVD8_VIBFN/11-324---------FLIKAGAAIIDNMSWLFAVGVAYGM..SK......DKDGAAALAGLVCMYVVTTLLSPGAVAQIQGI....
A5LK37_STREE/28-353---------WMRKVYMLTMGVLGIIVSGTVGKSLVGNV......NRKMPH..GKVINDISAMLAAICSYLVLTVTLVV..
G6T801_STREE/32-373---------LYMVANYATMGSLSLYFVLSLAYELTKIYAEEEELNMNPLN..GALLALMAFVMTVPQIIFDGGMMKTVTS

PF13303

C4Z6R4_EUBE2/32-372.........VNYTVGGLASAMSGPAMAVAIGYAL----------KCPPLVLFSLITVGFASNA....-------------
A8FGC2_BACP2/18-332.........LIIKMGTLAMGLMGPAIGVAVAYRL----------QASPLVIFASVVSGAAGA.....-------------
Q5WEA3_BACSK/19-333.........AFLEIGELAMDLYGAAIGAAVALAL----------GAPSFVVLATIVCGTAGA.....-------------
B9DKL9_STACT/10-331.........FLAEIGTVAMGLTGAAIGGAIAYGL----------GAQPLVVFSCIIVGSLGYDKFG.-------------
B1YKF4_EXIS2/16-335.........ILVTVGQQAIALTGPAIGVAVAFAL----------EAPPLVLFSAVAVGAFGYEA...-------------
Q03V93_LEUMM/32-373.........PLIQAGLMGQKMLAPALGVGIAMMM----------RANILTTGAALIAATVGSNAVYF-------------
B9E8P3_MACCJ/18-343.........LLVLFGTISMLILAPALGGAIAYSL----------GANGITLVSAMVAATIGGNALKE-------------
Q5WK09_BACSK/10-334.........AFVTIGSITKILLAPAIGAGIAYQL----------GGNTLVIYAAMASSTVGGNAISF-------------
B1YJH3_EXIS2/10-334.........MLLTIGGVAKVLLAPALGAGIAYQL----------GGNTLVLFSAMIAATIGGAALQP-------------
C3PGV6_CORA7/34-371.........TVIALTGLAASLLPVMIGVLVGIEF----------KMTPIQTAAVGIASFCGSGVATV-------------
C4LGW0_CORK4/38-376.........EIIGMVSVASSMLPIAIGLLVAMQF----------KMTHIQTATVAISAVMGSGVVKG-------------
C4L4Z6_EXISA/15-349.........FILDATTIAMRLLPAIIGLAVAMQF----------GRSILEAGTIAIATYVGSGAVRI-------------
Q036G8_LACC3/10-344.........VVTYMTGAAMTLLPALSAVCVGMLA----------KFTPIQTSSLALAAIVGAGNYHL-------------
D1AVH7_STRM9/11-347.........ILRQICVDIQWLVAPMIGFLVGLQF----------GFNPMKSAIIMSATWIASGALVR-------------
Q1GB97_LACDA/16-354.........NLLHIVTVFQYFFAVMCGFSTAKQF----------NLGYTEAACVGGAAFLGSGCMTA-------------
Q6LQ05_PHOPR/28-337.........YLAEFGNLVGGMGGVAAATLVMLRV----------GVQPVFAMVTGLA..........-------------
Q8XP04_CLOPE/28-342.........FLKKVGDANGSLGGVAAAILVPLAL----------GVSPVYSVLIGLS..........-------------
Q2G165_STAA8/1-310.........FLEELGDAAGGLGGVAAAGLTALAI----------GVSPVYALVIAAA..........-------------
C4L1G3_EXISA/28-337.........LYEEVGQAAGALSGPAAAALVAIAL----------GINPVYSLMIGLS..........-------------
A9NFH9_ACHLI/27-386.........LNLRVAPVLTSLLGMGIGLSIGLSL----------KVDGLKLIMLSVAGGIGTLVKID-------------
Q4FQB6_PSYA2/23-363.........ALIAVGKLASVLMGAGIGVGIAYYL----------KAPTLVMLSCLVAGMLGAHSEAL-------------
D1ARE5_SEBTE/14-338.........ELIMFGQVAQYMMGPAIGAGVALSL----------EAPPLGVFASVVCGMLGAGTIKY-------------
A8MEB1_ALKOO/15-347.........MLVYFGQVAQFLMGPAIGAGVAYSV----------GAPPLAVFASIATGAIGANTISL-------------
B2A7K6_NATTJ/25-344.........LSETVWPIANEMTGPAIGAAVAFGL----------KAPPLVVFASTITGYAGA.....-------------
C7RED4_ANAPD/18-331.........LTDRLWPLANSASGAAIAVAIAASL----------NAPKLVLFASTIVGLGAY.....-------------
A0PXE9_CLONN/19-346.........VLYNAVNIMQFIVPVLVGVLVALQF----------QLGPMQTVVVGAAVFLGSGAYKV-------------
B2GDR1_LACF3/19-361.........PLFEAGTLAQALLAPALGLAVASQL----------EATTLVTFSTIISATVAANAVSF-------------
F4BRJ2_CARS1/10-335.........ILVIIGTAVKMLMAPAIGAGIAVML----------GGNTLTIFSAMAAGAIGAGAIQT-------------
F5WSR4_ERYRF/12-343.........TLAGIVFAIQFTVPVLVGMFSSLEF----------KLNGLQMASVIGAAFIGSGAARL-------------
Q03W61_LEUMM/33-377.........PMVQMGAITKIMLPAAFGAAIASQM----------KTNTMVMFSAMAASAVGANAVFF-------------
Q1GBH7_LACDA/16-349.........TVINITTFTQSLLAAMAGFCAAYLF----------QMNMIQMCSVAAAAMIGSGAVTF-------------
Q2FV51_STAA8/15-348.........TLLGVVVAIQFTVPALIGALVAMKF----------DLSPLAIAVVASAAYVGSGAAQF-------------
Q56343_TREPA/13-343.........ALYHVVLPIQFSVPALIGTLVGLQF----------HCSAPEVATLAFVSVIASGNVTL-------------
Q5FLN1_LACAC/11-342.........SVLAMTTLMQDLLAVFAGLCVSYLL----------KFNLIQSGSVTAAAMIASGAFQM-------------
Q81XJ8_BACAN/10-333.........LLITIGVVAKSLMAPAIGAGIAFML----------GANGLVIFSAMVAGAIGAGSISI-------------
Q834J3_ENTFA/18-343.........MIIHAAQIFQLATPLIIGGLIAFQF----------GLTPQKMMIAGGAAFAGSGVIKF-------------
Q839R1_ENTFA/29-330.........YVSQIGETMGSLGGLAAGALVPLAF----------GISPVFSIILGLS..........-------------
Q8XMA5_CLOPE/20-350.........TFYNAVNIMQFIVPVLVGVLVGLQF----------ELNAMQSVIVGAAVFLGSGAFKV-------------
Q8Y5C0_LISMO/10-334.........FLATVGAIGKTMLIPGIGVGIAMCL----------HANTLVTISAAASAVIGGGAVAT-------------
Q9A0B4_STRP1/15-348.........EFLHIVQVFQFFTPIMAGFLIGQQF----------KFNPMQQLAVGGAAYIGSGAWAY-------------
Q9A1Q9_STRP1/29-336.........FLSEVGGANGSLSGVAAAILVAIAI----------GVSPGYAVLIGLS..........-------------
R5FBU1_9CLOT/24-338.........IFNVIADYAKSATGAALGIAIAHAL----------KAPQLVLFSAATVGIAGN.....-------------
R5J6K1_9FIRM/19-358.........FLVSISPVAMALTGPVIGIGIATSL----------ESPKLVTLSSGVVGFIGAFGAVF-------------
R6FZL0_9FIRM/39-416LSMLNRFCWILWQIGNYATMVTGVAMAAAIGYAL----------DAPPLVLFSLCAVGQATNT....-------------
R6RMS6_9FIRM/1-317.........TLIHLSGIATGLTGIGIGVGVACQL----------QEAPLVILCAGIAGMLGGD....-------------

PF02378

B7J380_BORBZ/28-365G........IQPN..................SWFPVIDARYFSAQGVFTAIIAAIFSVEVYKFLVQ.KNMAIKLPESVPP
B9AAA6_BORBG/17-354E........TMSS..................VGRINFFGVQTLNTGIAGSLAVGLLVGYLHNKFYN.....MKLPKPFVF
PTU3C_STACT/16-359D........GAK.TLGQ..........SAKDPAHALVLGIPTLQTGVFGGIIIGALAAWCYNKFYN.....IQLPQFLGF
A0A017I7U5_ECOLX/111-396................................EHVEFALIPVTAVKYTYTVIPALVMTWCLSYIER..WV.....DSITP
P94865_LACCA/25-344................................LKTGVDLTYMGTQGLICAYIVGLIVPNIYYVCIK.NNVTIKLPAQVPG
J7JNY4_BACIU/26-350................................ITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQ.KNLTIKMPAGVPP
D2BPU6_LACLK/26-390KEASGIGNLTGTQATAAFEKLPHAMQVFLNNPVTGVLNLTWNGGQGMIAAIIIGILSGWAYSAMMK.AGWKITLPEQVPS
J7HPY1_MYCGT/28-366S.......GYNI.LYWK..........AVPQSAIASTLGLNSLSTSVFGGIIVGALTAYLYNKFYA.....IRLPDVIGF
O07656_ECOLX/14-353..........AD.QM..............STHGQTIILGIQSYNTSVLGGIVAGLLVASMYKKIVN.....LRIPESLGS
A0A017INW7_ECOLX/19-361..........DA.AV.............LKANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHN.....IRLPDALAF
F0K639_CLOAE/28-347................................IKGGFSSDFMGTKGLLSAFVVAFIVPNIYKLFVK.NNVTIKLPEEVPH
PTLCB_STAAU/29-349...............................AKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVK.RNITIKMPKEVPP
F0K514_CLOAE/28-372..........IV.MK.............HADKVQSVIPKAWTGGKGMIAALIIGVLTGYIYSWFLK.RDIRIKLPESVPS
D4QR60_ENTFC/107-385.................................GLELFGIGLPQITYSNSFIPILLAIWFMGYVTK..VVKRVIPNTLQY
J7JTD7_BACIU/29-359.............S................IMVGGGIPITLLGSKGLFVAMLIALFSTEIYRYIIQ.KNIVFKMPDGVPP
Q9CJ32_LACLA/29-420AGV....AATDK.LNGVL.......GDQGLAAWKPLFASAHLDAGAYFTVIIMGALAVIIYAKLML.ADITIKMPESVPP
Q9ZHJ9_CLOBE/108-393...............................I.NLTILGLNIPVVGYQGSVLPALVLGIIAAKTQK..ALKKVVPDVLDL
PTMCB_BACHD/19-279........................................GADIPMFIGAMIMGPLGGFLIKKVDQ..VLQPKVRSGFEM
A0A009DVA0_ECOLX/13-320.................................AEEIASKHLADTGVLGGIISGAIAAYMFNRFYR.....IKLPEYLGF
Q9K7V5_BACHD/18-254........................................GAELGGPAGSFVAALLATEVGKVVAG..............
E6P283_ECOD1/9-347.........DFT.QDA............VAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFD.....KKLPVFLGI
I6TZV0_STRMG/111-420..........TI.GA..............YTG.FWNIFGLHVTQASYTYQVIPVLVAVWLLSILEK..FFHKRLPSAVDF
O51590_BORBU/12-348...........S.F...............SSGAVGFVLGIKTLETGVFGGVVVGILTYYLHSRFNK.....VDLPKVLGF
K7DWE1_LACLC/28-348...............................AKEGGFLTAFMGTKGLLTAFIAAFVTVNVYKVCVK.NNVTIRMPEDVPP
B9LY78_BORBG/18-378ASL....KALLE.LGMPET......AATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHN.....IQLPTFLAF
J7JKU5_BACIU/9-293..................................ATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKD.....TKLPEYLGF
B1RZB9_STREE/29-359...........Q.V...............KQLFGGAIPFSSLNASSLFMAITIGLVTAEIYRMFIQ.RGITIKMPSGVPD
P96159_VIBFU/17-357..........QS.ER..............VAYGVKNIIGIESIDTGILGAVVVGVIVAKLHQRFYT.....FKMPDALAF
Q98R81_MYCPU/304-616...............................NYGLSPDKVLETGSGFVGAILGGFFAATMLILMSK..YIFSKLPKNLYG
B1X6L2_ECODH/11-300..................................AMVTINPEINMGVLAGIITGLVGGAAYNRWSD.....IKLPDFLSF
J7JJ76_BACIU/13-314................................QPPYEGAEHLIDMGVFGGIIIGLLAAYLYKRFSS.....IELHPVLGF
PTSBC_STAXY/110-413..............................IP.HWNLFGLEINQVGYQGQVLPMLVATYILATIEK..GLRKVIPTVLDN
PTG3C_STACT/13-344...........A.D...............AATGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYN.....ISLPSYLGF
A0A016QY08_KLEPN/110-395.................................TMNFFGIEVAMIGYQGTVFPVLLAVWFMSMVEK..RLRRVIPDALDL
Q97SS4_STRPN/34-364................................IGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIK.RKIVIKMPEQVPQ
A0A017HY88_ECOLX/133-409....................................ALLGTQSGAGFLGAVVLGLAIGYFVFWFRK..V...RLGKALQP
J0XFC0_STREE/12-284..........................................VGSGFIGGILGGYIAGFLVQAIIK..KV..KVPNWIKG
A0A017I737_ECOLX/18-278........................................GAEIPMFLGSMIMGPLGGLVIKYVDK..ALEKRIPAGFEM
A7X3X2_STAA1/22-268.................................YSNNSFMLKGIGDIINTSLVVIIACLIYMVLQN.......KLGSFEL
PTS3B_PEDPE/111-411..............................MV.YWNVFGLHVAQAGYQGQVLPVLGVAFILATLEK..FFHKHIKGAFDF
PTG3C_MYCPN/40-387ITD...TSTPIA.GFKVLY......NKSVPVHAIATTLGLRTLSTSVFGGIIVGALTSVLYKKFYA.....IRLPDVIGF
E8VEA9_BACST/9-346.........DMN.QEV............GGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFD.....KKLPDFLGI
J7JTG0_BACIU/29-359.............E................IMVGGGIPLSLMGSKGLFVAMIIAMVSTEIYRLIIQ.RNLVFKMPDGVPP
A0A017IAK3_ECOLX/118-401.................................YAGFHDFFGLPIDPRGNIIGVLIAAWACARIEG..MVRRFMPDDLDM
Q97QL8_STRPN/28-347...............................I.ESGLATGFLGTKGLLSAFLAAFVTVAIYKVCVK.NNVTIRMPDEVPP
Q9K614_BACHD/26-350................................VQGVIPLDRLGAKGMFLAMMTAFLSAEIYRRIVQ.RNITIKMPPGVPP
J3WKQ3_MYCGT/303-598...............................NGTIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQN..YIYKKLPQSLQG
J1R4G5_STREE/27-356.............A................VNISGVLSFNNTGTGAMFAGVIVAIIATELFIELSNVKALQMNLGENIPP
P94470_GEOSE/110-394.................................YMHFLGFDIAMVGYQGTVVPILLATYVMCKIER..GLRNVVPHTVSL
Q45579_BACIU/119-390.................................IAKISLFGEELLPGRGGLIGVLFAAIFIAYTEQ..FIRRFIPQSLDI
A1F3C7_VIBCL/35-354................................KEDSLSMAHMGGTGIFTAVMCAFFAVELYRFMKK.HNITIRMPEQVPP
E8VJP2_BACST/13-354S........VER.AKFF..........TENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYT.....IELPQYLGF
F0LVD8_VIBFN/11-324................................AASEVPAAFSKIQNQFVGILVGIISAEIYNRYSA.....VELHKALAF
A5LK37_STREE/28-353...........D.E................KTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK.RDITIHLPKEVPG
G6T801_STREE/32-373.........LKE.GAV............IADGWAMGNVVARFGTTGIFTAIIMAIVTVLIYRMCVK.HNWVIKMPEAVPE

PF13303

C4Z6R4_EUBE2/32-372-------------...........................LGGAGGPLAVYFVAIIAAEAGKMIS.------.KETKIDI
A8FGC2_BACP2/18-332-------------.............................ELGGPAGSFVAALIGVEIGKLVS.------.GETKIDI
Q5WEA3_BACSK/19-333-------------.............................VYGGPAGSFLAAVVAAETGKLVF.------.GSTKVDI
B9DKL9_STACT/10-331-------------...............................GGAVGAFVATLIATELSRFYA.------.AKTKIDI
B1YKF4_EXIS2/16-335-------------...............................GGPAGSYVAAVIATEIGKLIS.------.KTTRLDI
Q03V93_LEUMM/32-373-------------TSAVSPAT..HTATGWVADQAAGSL..VMTSGQPVSAVLAALLAVLVGNWLT.------.GKTPLDM
B9E8P3_MACCJ/18-343-------------....................VDGAF..TIQTGLPIGAIIGAIVATYVGKKVT.------.GKTILDM
Q5WK09_BACSK/10-334-------------....................VEGLP..VLAPGQPVSAVIAAVAATYVGKRIT.------.GKTKLDM
B1YJH3_EXIS2/10-334-------------...................TDAGL...VLVPGQPISALLAAAVAVFVGKRMT.------.GKTKFDM
C3PGV6_CORA7/34-371-------------..................NPEGGFF..LKGTGLVINSGITAAIAVGLLLFIG.------DRLKNYSI
C4LGW0_CORK4/38-376-------------...................INSDEFLQLKGTGLVINTGLTAAFAVIMILLIG.------DRLKSYTI
C4L4Z6_EXISA/15-349-------------...................DEGAFV..MAGIGDVITAGVTAAIATLLVMKLA.------PHLKTYTV
Q036G8_LACC3/10-344-------------...................TKTGLT..VAGTGDVINLAITLAIGYLLIVLLG.------DALKAYTI
D1AVH7_STRM9/11-347-------------....................VDGVL..KIGLGDLINVMLIAGIAAYVTMLLG.------EKLGSLTI
Q1GB97_LACDA/16-354-------------VTTT...........VKGVTTTSFQ..LAGMGDVINTMLTAAVAVLFIKWVG.------NRFGSLGI
Q6LQ05_PHOPR/28-337-------------...........................MIHLG.ILEGFIVGYLFSFIAPLFKK------YLAEGIDV
Q8XP04_CLOPE/28-342-------------...........................CSGLG.ILPGFIAGYLMSFVVKFLEE------KLPSGLDL
Q2G165_STAA8/1-310-------------...........................CGGM.DLLPGFFAGYMIGYVMKYTEK------YVPDGVDL
C4L1G3_EXISA/28-337-------------...........................VSGFG.ILPGFFAGYILALAGTRINR------YLPTGVDM
A9NFH9_ACHLI/27-386-------------..................FSMPGWFDPVKVSNNPITAYFVVIGAYFAIQAIF.------RKKTAYDL
Q4FQB6_PSYA2/23-363-------------MAGNL.........FIAQEAGPATF..AALPGNPIGAYLASVFAYRAGTWVA.------.GKTKLDI
D1ARE5_SEBTE/14-338-------------....................GGSSY..ILASGEPVGSLAASVAGALASKAVF.------.GKTKCDI
A8MEB1_ALKOO/15-347-------------...................TEQGVF..AIIVGEPVGAFIAALMGAEVVKWIA.------.GKTKVDI
B2A7K6_NATTJ/25-344-------------.............................DLGGPAGALIAAVLGAEFGKIVS.------.KETKVDI
C7RED4_ANAPD/18-331-------------.............................ELGGPVGVFLATIFGVEFGKLVS.------.KSTKLDI
A0PXE9_CLONN/19-346-------------...................TSNGVQ..MIGIGDLINTMLVACIAVYFVRLIG.------NKLKSLTI
B2GDR1_LACF3/19-361-------------VQTASTATAMQSVGGAAHPLVVGNA..VFSTGQPVSAVAAALLAALLGKWLS.------.GKTPLDM
F4BRJ2_CARS1/10-335-------------...................TADGMI..TIATGEPIGCLIAATIATFVGKRIS.------.GKTPLDM
F5WSR4_ERYRF/12-343-------------...................VEGAWV..LKGTGDLINTMLTVAVAILIIRWYN.------NRIPNLAI
Q03W61_LEUMM/33-377-------------TDKAVEGV...TATGYAGAQAAGSA..IMTTGQPISAVMAGVIAVLFGKWLS.------.GKTPLDM
Q1GBH7_LACDA/16-349-------------...................KNGLIM..VAGTGDVINIGLTITLAILLIKLIG.------NKLGSYTT
Q2FV51_STAA8/15-348-------------...................KNGAWM..ITGIGDLINTMITAAIAVLFILLIQ.------HRVGSMAL
Q56343_TREPA/13-343-------------...................QNGAWL..ITGIGDVINVMLISALAIILVRALR.------GKLGSLTI
Q5FLN1_LACAC/11-342-------------...................KNNQII..LSGSGDVINIALTIFIAAIMVKYLT.------PRLGSYTI
Q81XJ8_BACAN/10-333-------------...................TEAGL...IIKTGEPIGALLTATLAVYIGKRLS.------.GKTALDM
Q834J3_ENTFA/18-343-------------N.................SEVKGFI..GAGTGDIINIMITASVAVLLLLVID.------KKFGSVEI
Q839R1_ENTFA/29-330-------------...........................LIKVS.LLPAFITAYLLSFVVEQMQK------RIPEGIDL
Q8XMA5_CLOPE/20-350-------------...................TEAGVQ..MVGIGDLINIMLVSCIAVFVIRLIG.------NKLGSLTI
Q8Y5C0_LISMO/10-334-------------...................LAGGGV..AITSGEPVGAILAVIVAVWTGKRVT.------.GKTKFDM
Q9A0B4_STRP1/15-348-------------TEVI...........QKGVATGTFQ..LRGIGDLINMMITASLAVLAVKYFG.------NKFGSLTI
Q9A1Q9_STRP1/29-336-------------...........................VSGTG.IIPGFVAGYVVSFLIKWMEK------NIPGGLDL
R5FBU1_9CLOT/24-338-------------.............................ALGGPVGALVATIVAAELGKIVS.------.KETRLDI
R5J6K1_9FIRM/19-358-------------ANG............KIINSFGQLI..IKGSGDPLGAFIAVVIAAEVGRLVS.------.GKTKIDI
R6FZL0_9FIRM/39-416-------------...........................LGGSGGPLAVLFVAILACEAGKLVS.------.KETKIDI
R6RMS6_9FIRM/1-317-------------...........................AAGPSAFLCSFLAAFTAIELSRLFV.------.KKTRFDL

PF02378

B7J380_BORBZ/28-365AV.....LKSFEALIPVV.ALSIVAQSVNIAIQSSLGSLFPEIIMSMFR....PVLQISDTLVGTLTISFIVHILWFCG-
B9AAA6_BORBG/17-354FS.....ECHFVPIVIILPFCVFLAIFFCLIWSSFDDLIASLG...LF.......VFRFE.YFGSFLYGFLNRLLLPLG-
PTU3C_STACT/16-359FA.....GKRFVPIITSL.VAIVTGIVLSFVWPPVQDGLNNLS...NF.......LLGKNLALTTFIFGIIERSLIPFG-
A0A017I7U5_ECOLX/111-396AVTKNFLKPMLIVLIAAPLAILLIGPIGIWIGSAISALVYT..............IHGYLGWLSVAIMGALWPLLVMTG-
P94865_LACCA/25-344NI.....AQSFKDLIPMGLSVTA.FWLFGVGFKAATGTVLPRWIIQVLS....PLFQASDSYLGLALIAGAMAFFWFCG-
J7JNY4_BACIU/26-350AV.....AKSFAALIPAFITLTV.FLLINVMVTLFFKTNMHDVIYHAIQA...PLVGLGSGIIPTLIAVFFIQILWFFG-
D2BPU6_LACLK/26-390NV.....ANQFTSMIPTGVIVVAATVVYALFDKIGHTDAVT.FIYHWLSV...PLQGLGGSFGGIIIISLLVPFFWFFG-
J7HPY1_MYCGT/28-366FS.....GTRFVPIICMT.IAIPVALLLLMVWPGVSILLNLIGTGLGI.......LGGRGYGANSLIFGYIERALIPFG-
O07656_ECOLX/14-353YS.....GPRLVPIITLI.VMSGFGLIIPFIWPPFFNLFMLIG...HW.......ISTSG.PVGYFFYAVAERVTIPFG-
A0A017INW7_ECOLX/19-361FG.....GTRFVPIISSL.VMGLVGLVIPLVWPIFAMGISGLG...HM.......INSAG.DFGPMLFGTGERLLLPFG-
F0K639_CLOAE/28-347NV.....AQTFEDLIPLAASVLF.FWLFDLVFRQVTGEVFSSWILDVLK....PLFTAADGYVGLAVIYGAMAMFWFVG-
PTLCB_STAAU/29-349NI.....SQVFKDLIPFS.AVIIILYALDLVIRNSFKSNVAEGILKLFE....PLFTAADGWIGVTIIFGAFALFWFVG-
F0K514_CLOAE/28-372GV.....SNAFSALIPGAVIITGSMLIFIFF.NIVTGATALEWIYKVLQI...PLQGITDSLGGAIAIPFVISFFWWFG-
D4QR60_ENTFC/107-385FL.....TPLLVMLITLPATLLIFGPLGFYMGEGIIGFFNLL.............MKYVGSWFVMMLYSALQPFIIMLG-
J7JTD7_BACIU/29-359AV.....SKSFVALIPGFIIVLL.VWLARLLIEMTPFQSLHNVVGDLLGT...PLSILGGSLGGSLIAEFVQMLLWSCG-
Q9CJ32_LACLA/29-420AV.....AKAFLAIIPTIAALYIVGLIYYIIGKLTNDSVIN.LITHYIAE...PFQILSQNIFSVLIVTLFVSVFWFFG-
Q9ZHJ9_CLOBE/108-393IV.....TPFITLLFSMVLGLLIVGPIMHNAEQLIFGAIKG..............FMGLPFGLGGLVVGGVHQLIVVTG-
PTMCB_BACHD/19-279LVN..NFSAGILAAILAIVAFLGIGPVVVSFSNVLASGVEVIIGAGLLPL...ASIFIEPAKVLFLNNAINHGILSPIG-
A0A009DVA0_ECOLX/13-320FA.....GKRFVPIISGL.AAIFTGVVLSFIWPPIGSAIQTFS...QW.......AAYQNPVVAFGIYGFIERCLVPFG-
Q9K7V5_BACHD/18-254.......ETKIDIIVTPFVTVIVGFLTAQFIGPVIQSGMSGLGATIMW.......ATEQRPIIMGIVVATLMGLALTAP-
E6P283_ECOD1/9-347FQ.....GTSYVVIIAFL.VMIPCAWLTLLGWPKVQMGIESLQ...AF.......LRSAG.ALGVWVYTFLERILIPTG-
I6TZV0_STRMG/111-420TF.....TPLLSVIITGFLTFIVIGPVMKEVSDWLTNGIVW..............LYDTTGFLGMGVFGALYSPVVMTG-
O51590_BORBU/12-348FS.....GSRFVPIIVSF.SSIFLAVIMFLVWPFVQSGINKVG...GL.......VDSTG.YIGTLIYGIFLRMLGPFG-
K7DWE1_LACLC/28-348NI.....SQVFKDLIPFTVSVVL.LYGLELLVKGTLGVTVAESIGTLIA....PLFSAADGYLGITLIFGAYAFFWFVG-
B9LY78_BORBG/18-378FG.....GTRFVPIVTTM.AMFVVGIFLTFIWPFIQGAMTSFG...RI.......VEQSG.LFGTFAYGAIKRSLIPFG-
J7JKU5_BACIU/9-293FS.....GRRLVPILTAI.ITIILAGIFGVVWPPIQSCINSFG...EW.......MLGLG.GIGAGIFGLFNRLLIPLG-
B1RZB9_STREE/29-359VV.....SKSFSALLSGFTTFVLWALVLKGLEAAGVAGGLNGLLGAIVGT...PLKLIAGTLPGMILCVIVNSFFWFCG-
P96159_VIBFU/17-357FG.....GARFVPIISAL.VLGVVGVFIPFVWPYFAAGINGIG...HV.......IESAG.DFGPMLFGTGERLLLPIG-
Q98R81_MYCPU/304-616IR.....DILFIPILGTLTIAFVF.WVLNIVFIYINYGLTILL............LIIETRREIIWLLGLILGIMMAVD-
B1X6L2_ECODH/11-300FG.....GKRFVPIATGF.FCLVLAAIFGYVWPPVQHAIHAGG...EW.......IVSAG.ALGSGIFGFINRLLIPTG-
J7JJ76_BACIU/13-314FS.....GKRFVPIITSV.SSLVIGVIFSFVWPLIQNGINAAS............SLIADSTVGLFFYATIYRLLIPFG-
PTSBC_STAXY/110-413LL.....TPLLAILSTGFITFSFVGPLTRTLGYWLSDGLTW..............LYEFGGAIGGLIFGLLYAPIVITG-
PTG3C_STACT/13-344FA.....GKRFVPIMMAT.CSFILAFPMAIIWPSIQGGLNAFS...EG.......LLASNTGLAVFLFGFIKRLLIPFG-
A0A016QY08_KLEPN/110-395IL.....TPFLTVIISGFIALLLIGPAGRALGDGISFILST..............LISHAGWLAGLLFGGLYSVIVITG-
Q97SS4_STRPN/34-364AI.....AKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYSAIQV...PLQGLTGSLYGAIGIAFFISFLWWFG-
A0A017HY88_ECOLX/133-409LL.....GSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHFL............NTIPPSM..KFAAAFLVGAMLAFD-
J0XFC0_STREE/12-284LM.....PTLIIPFVASLVSSLIMIYIIGAPIAAFTNWLTSLL............QSLGSAS..NGLMGAVIGILSAVD-
A0A017I737_ECOLX/18-278VIN..NFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPL...LSVINEPAKVLFLNNAIDQGVYYPLG-
A7X3X2_STAA1/22-268II.....LPVLVPIVSGGIGLITLPYIRKITQAIGNVIHS...............FTDLNPLLMSILISVAFSLLMVTP-
PTS3B_PEDPE/111-411TF.....TPMFAIVITGFLTFTIVGPVLRTVSDALTNGLVG..............LYNSTGWIGMGIFGLLYSAIVITG-
PTG3C_MYCPN/40-387FS.....GTRFVPIICFV.VAIPVALILLMIWPAVSIGLNAIGTGLGF.......LGGKGYGANSLIFGYIERSLIPFG-
E8VEA9_BACST/9-346FQ.....GSTYIVMISFF.IMIPIALAVSYIWPMVQSGIGSLQ...SF.......LVASG.AVGVWIYTFLERILIPTG-
J7JTG0_BACIU/29-359AV.....SKSFVALIPGFAVIFL.IWAARLIVEATPFESLHNIVSVLLGT...PLSILGGSLGGSLVAEAVKMLLWACG-
A0A017IAK3_ECOLX/118-401LL.....TSLITLLITATLAYLIIMPLGGWLFEGMSWLF................MHLNSNPFGCAVLAGLFLIAVVFG-
Q97QL8_STRPN/28-347NI.....SQVFKDVIPFTLSVVS.LYALDLLARYFVGSSVAESIGKFFA....PLFSAADGYLGITIIFGAFAFFWFVG-
Q9K614_BACHD/26-350AV.....AKSFAALIPAVLTLTV.FLAINVFVSQLFHTNMHDVIYQAVQA...PLVGLGSGIIPTLIAIFFIQILWFFG-
J3WKQ3_MYCGT/303-598IK.....NILFIPLFGTLFTAGLF.WVINIPLIYLNYGLSLFL............NIMNSPI.LAPLLGFVIGLMMCFD-
J1R4G5_STREE/27-356AV.....SRSFSVLLPVMTVISLFGVVSALLFNIT.GMNLISIITIFIQE...PIRHIGTSLIGVIIIYSLGNMLWLFG-
P94470_GEOSE/110-394LV.....VPFVTVISTGFITILAIGPLGNLLGDGITTVLNF..............IYHYGGALAGLIFGGLYSMIVITG-
Q45579_BACIU/119-390IV.....TPTVSLLITGIVTYVVFMPLGGFISDAIASGLLS..............ILDIGGIAAGFILGATFLPLVVTG-
A1F3C7_VIBCL/35-354AI.....ARSFEVLLPVLAIFLT.LYPLSLFVQAEYGMLIPDAVMAMFK....PLISASNTLPAIIGALLVCQLLWFAG-
E8VJP2_BACST/13-354FA.....GKRFVPIVTSI.SALILGLIMLVIWPPIQHGLNAFS...TG.......LVEANPTLAAFIFGVIERSLIPFG-
F0LVD8_VIBFN/11-324FS.....GKRLVPILTSF.VGIVLSFVLMYIWPAIYGGLVHFG...ES.......IQGMG.ATGAGIYAFFNRLLIPVG-
A5LK37_STREE/28-353AI.....SQAFRDIFPFSFVLLI.SGLLDIVSRFSLDVPFAQVFQQLLT....PIFKGAESYPAMMLIWFMCALLWFVG-
G6T801_STREE/32-373GV.....SRGFTALVPGFVVAFVVIFINGLLVAMGTD......IFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVG-

PF13303

C4Z6R4_EUBE2/32-372LV-----TPLVTIGVGTGVAAL.IAPALGKAAMKIGELIML--------------ATNLQPFLMGIAVSVLVGIALTLP.
A8FGC2_BACP2/18-332IL-----TPLVTIITGFFTATL.IGPGIEAMMTGLGRLIMW--------------GTDQSPLIMGMLVATIVGLALSSP.
Q5WEA3_BACSK/19-333LV-----TPIVTIMSGFAVAWL.LGPAISFVMESISGAIAW--------------ATDQQPLMMSIVVAILMGWALTAP.
B9DKL9_STACT/10-331II-----SPLLTLIIGGAVAKF.IGPFLNDFMVSLGKMIML--------------ATDQRPLIMGILVAVIFGLALTAP.
B1YKF4_EXIS2/16-335IL-----TPFITLLIGFVSGKY.VGAWIGTLMTDLGEIIRW--------------GTEREPLVMGIFVATVMGLALTAP.
Q03V93_LEUMM/32-373ML-----VPLGAVLAGTFFGLA.TASVTTPFLNWVSEELAS--------------TMKINPFLGAFVVAVVWFLFLMTP.
B9E8P3_MACCJ/18-343MA-----VPVSAVLAGSLVGYY.LARVVEPALVVISKSIAQ--------------SVEGQPLISSVVIALVFAVIVMTP.
Q5WK09_BACSK/10-334MA-----IPFSGIFVGGLVGLV.MAAVTTPMLEWISAQLAT--------------SVQGSPIIAPMAIALTWSILLMTP.
B1YJH3_EXIS2/10-334MV-----IPVSAVLAGGFTGLG.AAAVTTPLLTRFSAMVTA--------------SVESSPIATSLVIALIFSVLLMSP.
C3PGV6_CORA7/34-371LL-----LSTIVTLVAGTIGWAVTFPIVKVFTLWLGNLVNG--------------ATTLQPVLMGVVLAVLFAIMIVSP.
C4LGW0_CORK4/38-376LV-----LPPTVIVIAGGLGKFVTYPAVLVFTKWLGNLVVG--------------AADLQPIVMGLILGIAFGVMMASP.
C4L4Z6_EXISA/15-349IV-----MPMTIIVVAGGIGTF.LLTYISQITTYIGLLIMT--------------MTDLQPVLMGILIAMAFSLIIVSP.
Q036G8_LACC3/10-344LL-----IPSLVLVIAGGIGML.TLGPVSSITKYIGVVVHD--------------VTALQPIVMGVLMGIIFAVLIVSP.
D1AVH7_STRM9/11-347VL-----QPIIVGVGVGFLGLL.MLPYVKHISTTIGYGINS--------------FTTLQPILMCILIAMSFSILIVSP.
Q1GB97_LACDA/16-354VF-----FPILAGTGVGFLGSL.IKPYVSLVTTAIGDVINT--------------FTKLAPYSMCILIAMSFAIIIVTP.
Q6LQ05_PHOPR/28-337IL-----GVLILAPLARLVGFF.ISPALDLLMGTLANMITE--------------ATSLSPLIMGFLLGGLIKMVCTSP.
Q8XP04_CLOPE/28-342IV-----IIVVATPLTRIIGDF.TAPVVDSTLLKIGQVLIA--------------SANSNPITMGIILGGIITVVATAP.
Q2G165_STAA8/1-310IG-----SIVILAPLARLIAVL.LTPVVNSTLIRIGDIIQS--------------STNTNPIIMGIILGGIITVVGTAP.
C4L1G3_EXISA/28-337IF-----YVIVMAPLARLVATG.VDPLVTNTLEQIGAVIEL--------------AATQNPVVMGLVLGGIVTVVSTSP.
A9NFH9_ACHLI/27-386FF-----IPIVGILSAVLVTYL.ISWPIDRFMEMIYSTIKF--------------FMQLEPFVTSAFVALIFGILLTLPF
Q4FQB6_PSYA2/23-363LL-----VPLLVCAVALAVCAL.LNPPVVAVVNAIGQGIQA--------------ATTLQPLLMGIVIAVVVGILLTMP.
D1ARE5_SEBTE/14-338IV-----VPGITIIAGGVISIF.ASPYISRFMMLIGNIINK--------------STNLNPLPMGILVALIMGIIITSP.
A8MEB1_ALKOO/15-347VL-----VPAATIVMGGVAGTF.IAPSIASIMKILGNVINT--------------VTELHPIPMGILLSVLMGMILTLP.
B2A7K6_NATTJ/25-344VV-----TPAVTILVGVLAGSL.VGPGVDALMRGLGVIIME--------------ATEMQPVPMGIIVAVVIGLTLTFP.
C7RED4_ANAPD/18-331II-----TPSVTIIVGILVGDL.IGPYVASFMKAIGLFIMK--------------ATELRPFFMGIVVAFTIGMALTLP.
A0PXE9_CLONN/19-346LL-----LPIVGAAVG.VIGII.TLPYVRQITVAIGNVINN--------------FAVLQPLLMCILISVSFSILIISP.
B2GDR1_LACF3/19-361VL-----VPMVVSFVGTFVGFG.LASVVTPALTATSAWIAA--------------SIKVNTVLGSMVISAVWALFLMTP.
F4BRJ2_CARS1/10-335MA-----IPITAVLAGGVAGYY.LNLVIAPFLNMVSAFISA--------------SVAGSPIIGAAVISVIGGLVLMSP.
F5WSR4_ERYRF/12-343VI-----TPIIGGVIPGFIGLL.TLPYVGKITGLLGSLIAN--------------FTTLQPLLMMILIAVCFALIIVTP.
Q03W61_LEUMM/33-377VI-----VPAATTIVGTVSGYY.LAAVTTPALVAIGKFIAS--------------SVAVNPIIGTAIVAMAFGAMTMTP.
Q1GBH7_LACDA/16-349IL-----LPIIVLVVGGGIGLL.ILPYVKTVTTFIGMIVMA--------------FTKLQPLLMGVLIGMSFAAMIVSP.
Q2FV51_STAA8/15-348IV-----FPTVVGGISGAIGVL.ILPYTKMITTAIGNMVNG--------------FTELQPIVMSILISMVFSLIIISP.
Q56343_TREPA/13-343IA-----LPVIVAVVAGGVGSF.SLPYVKMITLFVGRVIAT--------------FIALQPLLMSILLSMSFSLIIISP.
Q5FLN1_LACAC/11-342LI-----LPLAVAVLAGGIGQL.MLPYTKLITGMIGNVVAG--------------MTDFQPLIMGMFMGVAFATLVITP.
Q81XJ8_BACAN/10-333ML-----VPFAAILGSGLVGIW.LSHNITPVLNAVGAFIKD--------------SSAGSPFIASIVIAVVWGLLLISP.
Q834J3_ENTFA/18-343IA-----LPIVVGVGAGLFGML.IYPYVTQITVAIGKVINN--------------FTDFQPIIMSILIACSFAALIISP.
Q839R1_ENTFA/29-330LV-----VILVIPVAASLVAGF.IQPVVLGVLEVIGGTILS--------------AVDGNPYVMGAILGAIIPIVGMTP.
Q8XMA5_CLOPE/20-350LL-----LPIIAGAGVGIIGMF.MLPYVRQITIVIGDIMNN--------------FTTLQPLLMCILISVSFSILIISP.
Q8Y5C0_LISMO/10-334IL-----IPGVSLLAGGLSGIL.FAKIMAPILASVSLGISS--------------LIGGSPLISSMIIAFVFGLLILSP.
Q9A0B4_STRP1/15-348IL-----LPITIGTGVGYIGWK.FLPYVSYVTTLIGQGINS--------------FTTLQPILMSILIAVAFSLIIVSP.
Q9A1Q9_STRP1/29-336IS-----IIIVGAPLTRFLAQL.ITPVINSTLLTIGDILTS--------------SANSNPIIMGMILGGTIVVVATAP.
R5FBU1_9CLOT/24-338IV-----TPGITIISGVLVAQF.VGPGVAGFMNWFGNLVKT--------------ATEMQPFIMGILVSALIGIALTLP.
R5J6K1_9FIRM/19-358IV-----TPLVTIITGSLIAVL.LGPRLLYAMKSIGSFIQM--------------ATNLAPFTMGLVISVVMGMLLTLP.
R6FZL0_9FIRM/39-416LV-----TPAVTIIVGVGCAMV.LAPIFKTICDSLGTFIGW--------------ATNLQPFFMGIIISVVVGVVLTLP.
R6RMS6_9FIRM/1-317FL-----CPLTGFLCGELINLL.LETPLSYFIQEFGNCVNW--------------GAQQQPLLMGIIVAVLMSIAVIFP.

PF02378

B7J380_BORBZ/28-365LHGTNVIIALLNPI..........-----------.ILSNLDSNIRALS.........DNL................PLP
B9AAA6_BORBG/17-354LHSILSFPFEFTSL..........-----------.GGVEIVNGDTVRG.........LKNIFYAQLLDPSLGKFSSGFA
PTU3C_STACT/16-359LHHIFYAPFWFEFG..........-----------..HYVNESGNLVRGDQRIWMAQYQDGVP.............FTAG
A0A017I7U5_ECOLX/111-396MHRVFTPTIIQTIAETGK...EGM-----------VMPSEIG......................................
P94865_LACCA/25-344VQGPSIVQPAVVPI..........-----------.MIANTAANLQQYQ.........AGQ................HVS
J7JNY4_BACIU/26-350LHGQIIINSVMDPI..........-----------.WNTLQVENLSAYT.........AGK................EIP
D2BPU6_LACLK/26-390VHGGIIMGAITSAF..........-----------.LIPNTFANASLYQ.........SHKLS............LANGA
J7HPY1_MYCGT/28-366VHHAFYAPLWYTSA..........-----------.GGSLQEIANQQVWI.......R......................
O07656_ECOLX/14-353LNHLVTSVFRFTPI..........-----------.GGSAVIGGEEYYGTLNMFMAYVKENAVI...........PLDLA
A0A017INW7_ECOLX/19-361LHHILVALIRFTDA..........-----------.GGTQEVCGQTVSGALTIFQAQLSCPTTHG........FSESATR
F0K639_CLOAE/28-347IHGPSIVEPAVTAI..........-----------.YIANVEANLKLHQ.........AGH................HAT
PTLCB_STAAU/29-349IHGPSIVEPAIAAI..........-----------.TYANIEANFKLLQ.........AGE................HAD
F0K514_CLOAE/28-372VHGATLIGGVMNSI..........-----------.YQANTLANQDVFK.........AGHKLIA........SGAGKNA
D4QR60_ENTFC/107-385AGNFIMPVVASLIAAN......GY-----------DPAFISS......................................
J7JTD7_BACIU/29-359IHGASIIGGIMAPI..........-----------.WYGAMDANRLAFQ.........AGE................ALP
Q9CJ32_LACLA/29-420LHGPNVLAPVLDGI..........-----------.WGPLGLNNQALYFQV....HSQGIRDLIA........KGAVDKA
Q9ZHJ9_CLOBE/108-393VHHALNALEVELLSST.......G-----------KDAFNAM......................................
PTMCB_BACHD/19-279IDQAASAGKSILF...........-----------.............................................
A0A009DVA0_ECOLX/13-320LHHIWNVPFQMQIG..........-----------..EYTNAAGQVFHGDIPRYMAGDP...................TA
Q9K7V5_BACHD/18-254ISSAALAIMLELSG..........-----------.............................................
E6P283_ECOD1/9-347LHHFIYGQFIF.............-----------.GPAAVEGGIQMYWAQHLQEFSLSAEPLKS.........LFPEGG
I6TZV0_STRMG/111-420LHQSFPAIETQLISAFQN..GTGH-----------GDFIFVT......................................
O51590_BORBU/12-348LHHIFYLPFWTTGL..........-----------.GGSVIIDGKLIEGTQNIFFAELAAQGTDR.........FFIGTS
K7DWE1_LACLC/28-348IHGPSIVEPAIAAI..........-----------.TYANIDVNLHLIQ.........AGQ................HAD
B9LY78_BORBG/18-378LHHIFYLPFWQTAV..........-----------.GGTLEINNELISGAQNIFFKQLADPNTVH........FEVAKGT
J7JKU5_BACIU/9-293LHHVLNNIFWFQFG..........-----------.......EYNGVTGDLARFFAKDPT..................AG
B1RZB9_STREE/29-359VNGGQVLNAFVDPV..........-----------.WLQFTTENQEAVA.........AGQ................TLQ
P96159_VIBFU/17-357LHHILVALIRFTEA..........-----------.GGTMDVCGQTVSGALNIFYSELSCADTTT........FTPEVTA
Q98R81_MYCPU/304-616LGGPINKAAYVFGTLTLAQ.MQGK-----------GTIAMAS......................................
B1X6L2_ECODH/11-300LHQVLNTIAWFQIG..........-----------..EFTNAAGTVFHGDINRFYAGDGT..................AG
J7JJ76_BACIU/13-314LHHIFYTPFYFMMG..........-----------.EYTDPSTGNTVTGDLTRFFAGDPT..................AG
PTSBC_STAXY/110-413MHHSFIAIETQLIADSS....STG-----------GSFIFPI......................................
PTG3C_STACT/13-344LHHIFHAPFWFEFG..........-----------..SYKNAAGQIIHGDQRIFIEQIRDNVP.............LTAG
A0A016QY08_KLEPN/110-395IHHSFHAIEAGLLGNPS.....IG-----------VNFLLPI......................................
Q97SS4_STRPN/34-364VHGQSVVNGVVTAL..........-----------.LLSNLDANKAMLA.........SANLS............LENGA
A0A017HY88_ECOLX/133-409MGGPINKTAWFFCFSLL....EKH-----------IYDWYAI......................................
J0XFC0_STREE/12-284FGGPLNKTVYAFVLTLQAEGVKEP-----------LTALQLV......................................
A0A017I737_ECOLX/18-278MQQASVNGKSIFF...........-----------.............................................
A7X3X2_STAA1/22-268ISLVAIATAISLNG..........-----------.............................................
PTS3B_PEDPE/111-411LHQTFPAIETQLLANVA....KTG-----------GSFIFPV......................................
PTG3C_MYCPN/40-387VHHAFYAPLWYTSA..........-----------.GGSLQEIVNQQVWI.......R....................PD
E8VEA9_BACST/9-346LHHFIYTPFIY.............-----------.GPAVAEGGIVTYWAQHLGEYSQSAKPLKE.........LFPQGG
J7JTG0_BACIU/29-359LHGANIVGGVMAPI..........-----------.WYGAMDANRIAFQ.........AGE................ELP
A0A017IAK3_ECOLX/118-401VHQGFIPVYLALMDSQ.......G-----------FNSLFPI......................................
Q97QL8_STRPN/28-347IHGPSIVEPAIAAI..........-----------.TYANAEVNLNLLQ.........QGM................HAD
Q9K614_BACHD/26-350LHGQVIINSVMDPI..........-----------.WNTLMIENLEAYT.........NGE................PVP
J3WKQ3_MYCGT/303-598LGGPINKAAYVFGVVSLQ..NQNA-----------GTISMAA......................................
J1R4G5_STREE/27-356IHQAVIYSAILEPL..........-----------.LLINITENITAAN.........NGQ................AIP
P94470_GEOSE/110-394VHHSFHAIEANLLAKL.......G-----------VNYLLPI......................................
Q45579_BACIU/119-390LHQGLTPMHMELINSI.......G-----------NDPLLPI......................................
A1F3C7_VIBCL/35-354IHGAAIVVGLLSPI..........-----------.FLTNISANIDAFV.........TGQ................PVP
E8VJP2_BACST/13-354LHHIFYSPFWYEFF..........-----------..SYKSAAGEIIRGDQRIFMAQIKDGVQ.............LTAG
F0LVD8_VIBFN/11-324LHHALNSVFWFDVA..........-----------...........GINDIPNFLGGAKSIAEGT........GIVGVTG
A5LK37_STREE/28-353IHGPSIVLPAVTAL..........-----------.QLSNMEENAQLLA.........NGQ................FPY
G6T801_STREE/32-373IHGANIVFAFVSPI..........-----------.ALANMAENAAGGH...............................

PF13303

C4Z6R4_EUBE2/32-372ISSAAICAAFGLTG.....................LAGGAAVAGCCAQMV..GFAVMSFKENRWGGLVSQGIGTSMLQMG
A8FGC2_BACP2/18-332ISSAALALMLDLSG.....................LAAGAATIGCCAQMV..GFAAAGFRENRFGGLAAVGIGTSKLQLP
Q5WEA3_BACSK/19-333ISSAAIGLMLGLEG.....................AVACAAAIGCAGQMV..GFAVASFRENRFGGLLALGIGTSMLQMP
B9DKL9_STACT/10-331ISSAALALMLDLSG.....................LAAGAATIGCCAQMV..GFAVTSYKDNGVGGLISVGIGTSMLQVP
B1YKF4_EXIS2/16-335ISSAALGIMLGLDG.....................LAAGAATIGCAAQMI..GFGVISYRDNGIGGFIAQGIGTSMLQVG
Q03V93_LEUMM/32-373ASSAALAIAVMLDP.....................LSGGAALVGTTAGFV..MYTAMGWKQNDLGANLAQIIVTPKVQFP
B9E8P3_MACCJ/18-343ASSAALVIVLQLDP.....................ASSAAALVGISAQFV..GYTAMGLKDNDLGGFLAQLVCTPKVQFP
Q5WK09_BACSK/10-334ASSAALAIALQMDP.....................ISSGAALIGCTAQFV..GFTLMSWKQNDAGALLAQGLVTPKVQFP
B1YJH3_EXIS2/10-334ASSAALAIALQLDP.....................VASAAALIGCSAQFV..GFTLMAYRQTDPGGLIASFFVTPKVQFP
C3PGV6_CORA7/34-371VSTVGIATAIFIDG.....................IASGTANLGAVAAGF..TLLVAGWRVNGFATSILHVLGSPKVQMA
C4LGW0_CORK4/38-376ISTVGIATAIFLSG.....................IASGVANVGCCAVAF..TMMWAGWKVNGPGGSLVHVVGSAKVQVA
C4L4Z6_EXISA/15-349ISTVGIATAISLSG.....................VAAGAANLGVVAAGF..GLAIAGWQANATGTSIAHFLGSPKIQMA
Q036G8_LACC3/10-344ISTVGIATAISLTG.....................IGAGSANLGIVGAGF..ALATYGWKANSFGTSLAHFLGSPKMQMA
D1AVH7_STRM9/11-347ISTVAIGIAIGLSG.....................LASGSANIGVSATAA..VLVIGSWAVNKAGVTIAVGMGGMKMMMP
Q1GB97_LACDA/16-354LSTVAISVAIGLAG.....................MGSAAAGFGLASTAA..FLFWATLKVDKPGVQVAIFLGVIKMMMP
Q6LQ05_PHOPR/28-337LSSMALTAMLGLTG.....................LPMGIAAMACVGGSFTNGYVFHTLKLGKSCNTVSVML.EPLTQAH
Q8XP04_CLOPE/28-342LSSMALTAMLGLTG.....................APMAIGALSVFGSSFLNFVLFQKMKFGSKKDTISVAI.EPLTQAD
Q2G165_STAA8/1-310LSSMALTALLGLTG.....................VPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAVSI.EPLSQAD
C4L1G3_EXISA/28-337LSSMALTAMLGLTG.....................VPMAIAALALTASISMNYLLFRQLKIGTKKDQLSVAI.EPLTQAD
A9NFH9_ACHLI/27-386ISSAGVAIAVFSVPFGVGNAL......AIPDPIAIAAMCAAAIGCSTQMV..GFSVQTLRKNNLGSIFTVGLASSMFQFK
Q4FQB6_PSYA2/23-363TSSAAICIAIGLGG.....................VAGGAAVVGCAAHMI..GFAVASFKDNGISGVVSQGLGTSMLQIP
D1ARE5_SEBTE/14-338ISSAAVAISLGLSG.....................LSAGAATIGCACHMV..GFAVAGYKDNGFNGLISHGLGTSKLQMA
A8MEB1_ALKOO/15-347ISSAALSISLGLNG.....................LAAGAAVVGCCTQMV..GFAVASYKENGIGGLIAQGLGTSMLQVP
B2A7K6_NATTJ/25-344ISSVALTIMLDLEG.....................LAAGAAAVGCASQMI..GFAVASYKENGVGGLIAQGLGTSMLQIP
C7RED4_ANAPD/18-331ISSAAICMMLSLEG.....................LAGGAATVGCCAQMI..GFAVISYKDNGLEGLLAQGLGTSMFQVP
A0PXE9_CLONN/19-346ISTVAIGIAIGITG.....................LGAGAAAIGVAACTA..VLVIGSRLVNESGVTLSVLLGAMKMMMP
B2GDR1_LACF3/19-361ASSAALAVALTLDP.....................ISAAAAAIGTTAQFV..GYTAMSWRQNTPGANIAQFVVTPKVQFP
F4BRJ2_CARS1/10-335ASSAAIAIALNLDP.....................VSSAAMLVGTTSMYI..GFSFVSMRQNNLGGFLAQFVCTPKVQLP
F5WSR4_ERYRF/12-343LSTVAIAYAISLAG.....................LGSGAANVGIAATVF..TLAYGSSKVNNKGTTFALFFAGPKMLMP
Q03W61_LEUMM/33-377ASAAALAVAIGATGVT.................SPEAAGAILIGTTAVFV..GFPAMSFHENKIGATIAQGIVTPKIQFP
Q1GBH7_LACDA/16-349ISSVGIAVAIGLTG.....................VASGAANLGITGAAY..TLGIMSYSVNGMGTTLAHFIGTPKIQMT
Q2FV51_STAA8/15-348LSTVAIAFAIGITG.....................LAAGSASIGISATEA..VLIIGTSKVNRLGVPLSVFFGGVKMMIP
Q56343_TREPA/13-343VSSVAVGIAVGLTG.....................LASGAANIGVSSCAM..TLIVGTMRVNKIGVPLAMFAGAMKMLMP
Q5FLN1_LACAC/11-342VSSVGIAMAIGVEG.....................IASGSANLGITAGAF..TLAIMSSKVNGFGTTIAHFLGTPKIQMA
Q81XJ8_BACAN/10-333ASSAALAIALSLDG.....................VAGGAALAGCVAQFI..GFSVISAKENNLGGILAQALCTPKVQLP
Q834J3_ENTFA/18-343ITTVAIGLAIQLNG.....................LSAGAAAMGIAATTV..VLVINSWNVNQSGVTLAVSLGGMKMMMP
Q839R1_ENTFA/29-330LSSMVLTALIGLTG.....................VPMAVGALTCYGSSIVNAALFKKLKLGTASTPLAVAI.EPLTQVD
Q8XMA5_CLOPE/20-350ISTVAIGIAIGITG.....................LGAGAAAIGVTACTA..VLVAGSRRVNQSGVTLSVLLGAMKMMMP
Q8Y5C0_LISMO/10-334ASSAALAIALQLDP.....................TASAAALIGCSVQFV..SFAVLSYRDNNWGAFFAQLICTPKLQTP
Q9A0B4_STRP1/15-348ISTVAIGLAIGLNG.....................MAAGAASMGIASTAA..VLVWATLKVNKSGVPIAIALGAMKMMMP
Q9A1Q9_STRP1/29-336LSSMALTAMLGLTG.....................IPMAIGALSVFGSSFMNGVLFYRLKLGERKDNIAFAI.EPLTQAD
R5FBU1_9CLOT/24-338ISSAAICIALSLDG.....................LAGGAATAGCCAQMI..GFAVMSYRENKIGGLMAQGLGTSMLQMG
R5J6K1_9FIRM/19-358ISSAAISIILGLSG.....................ISAGASAVGCCSQMI..GFAVITYHVNGLNGALANGLGTSMLQVP
R6FZL0_9FIRM/39-416ISSAAICAAVGISGGAVIAGVVDGSISMEVWNGLALAGGAATVGCCCNML..GFAVISYPDNGVGGLVAQGLGTSMLQVP
R6RMS6_9FIRM/1-317IGTAALGVIAGLSG.....................PAAGAATIGCCCSMV..GMAVASYRENGFSGLLSIGTGTPLLLLP

PF02378

B7J380_BORBZ/28-365HILAGGFLDS........FVYIGGAGATLGLAI-------------AMMLSK---.SQHLKAIGRLSFA...........
B9AAA6_BORBG/17-354KISSGFYLS..........IMFGLPGAALGVYK-------------GIVHED---KNKVAALLFSGALT...........
PTU3C_STACT/16-359AFTTGKYPF..........MMFGLPAAAFAIYR-------------QAKPER---RKVVGGLMLSAALT...........
A0A017I7U5_ECOLX/111-396...................ANLSLGGSSLAVAW-------------...KTK---NPELRQTALAAAAS...........
P94865_LACCA/25-344HVLAMNT.MD.......YVMNFGGTGATLVVPF-------------IMLFAA---RSAQLKAVGKAAFV...........
J7JNY4_BACIU/26-350HIISKPFMEI.......YTVGMGGTGMTLAIVF-------------TILIFM---KSRQMKQVSKLGLA...........
D2BPU6_LACLK/26-390HIVTNEFYNN........FINLSGSGITFGLII-------------FTIFFA---RSEQMKSIGKVELV...........
J7HPY1_MYCGT/28-366.APGSDYVT..........RVIGWEDFNTPGKW-------------VIPAAL---ANGTSGMMNGATTTGQDSTSALSKY
O07656_ECOLX/14-353GKMEQGKLM..........IQYGLAGAALAMYR-------------TAHAQN---RKAIKALLISGVLT...........
A0A017INW7_ECOLX/19-361FLSQGKMPA..........FLGGLPGAALAMYH-------------CARPEN---RHKIKGLLISGLIA...........
F0K639_CLOAE/28-347YVLTHGT.SY.......FIATIGGTGATLMLTV-------------MFAFIA---KSKQLKAVGRTSII...........
PTLCB_STAAU/29-349KIITSGT.QM.......FIVTFGGTGATLVVPF-------------MFMWMT---KSKRNKAIGRASVV...........
F0K514_CLOAE/28-372HIVCQQFQDN........FVTLGGSGITLGLVA-------------ACFLFA---RSQRLKQLGKLALV...........
D4QR60_ENTFC/107-385...................CTISDIAVGGAMLG-------------YFLRTR---NLKQKQLFGTVTL............
J7JTD7_BACIU/29-359SIFTTQFFQI........WINVGGSGATLALVL-------------TMLVRS---RSKQMKQLGRLGIG...........
Q9CJ32_LACLA/29-420HAINGDYVNLWVRGSWDAFAWFGGSGGTITLVI-------------AIILFS---KRKDYKIVGRLGLA...........
Q9ZHJ9_CLOBE/108-393...................ITCGIVAQGAAALA-------------VAVKTK---DKKKRSLYISSAI............
PTMCB_BACHD/19-279...................LLETNPGPGLGVLL-------------AFMVFG---KGMAKQSAPGAAVI...........
A0A009DVA0_ECOLX/13-320GKLSGGFLF..........KMYGLPAAAIAIWH-------------SAKPEN---RAKVGGIMISAALT...........
Q9K7V5_BACHD/18-254...................IAAGAATVGCAAQM-------------VGFAVS---SYRENGWAGIFSLG...........
E6P283_ECOD1/9-347FALHGN..S..........KIFGAVGISLAMYF-------------TAAPEN---RVKVAGLLIPATLT...........
I6TZV0_STRMG/111-420...................ASMANVAQGAATFA-------------IYFLTK---.DKKMKGLSSSSGV...........
O51590_BORBU/12-348RFMSGRFIT..........MMFGLPGAALALYY-------------TAKREE---RTKVFGLLMSSALT...........
K7DWE1_LACLC/28-348KVITSGT.QM.......FIATMGGTGATLIVPF-------------LFMWIC---KSDRNRAIGRASVV...........
B9LY78_BORBG/18-378RFFSGEFVV..........MIFGLPGAALAMYH-------------TSKPEN---KKNVASLLLSASFT...........
J7JKU5_BACIU/9-293TYMTGFFPI..........MMFGLPAACLAMVV-------------TAKPSK---RKATAGMMIGFALT...........
B1RZB9_STREE/29-359HIITLPFKDL........FVFIGGGGATIGLAI-------------CLFLFS---KSRANKTLGKLAII...........
P96159_VIBFU/17-357FLSQGKMPT..........FLGGLPGAALAMYH-------------CARPEN---RSKIKALLISGVVA...........
Q98R81_MYCPU/304-616...................VMIAGMTPPLGISV-------------SMFLHK---KLWSKQDIEAGKIS...........
B1X6L2_ECODH/11-300MFMSGFFPI..........MMFGLPGAALAMYF-------------AAPKER---RPMVGGMLLSVAVT...........
J7JJ76_BACIU/13-314RFMMGDFPY..........MIFCLPAVALAIIH-------------TARPEK---KKMISGVMISAALT...........
PTSBC_STAXY/110-413...................ATMSNIAQGAAALA-------------AFFIIK---ENKKLKGVASAAGV...........
PTG3C_STACT/13-344KFMQGEFPV..........MMFGLPAAALAIYQ-------------TAKKEN---KKVVAGLMLSGALT...........
A0A016QY08_KLEPN/110-395...................WAMANVAQGGACFA-------------VWFKTK---.DAKIKAITLPSAF...........
Q97SS4_STRPN/34-364HIVTQQFLDS........FLILSGSGITFGLVV-------------AMLFAA---KSKQYQALGKVAAF...........
A0A017HY88_ECOLX/133-409...................VGVVALMPPVAAGL-------------ATFIAP---KLFTRQEKEAASSA...........
J0XFC0_STREE/12-284...................NTATPVGFGLAYFI-------------AKLLKK---NIYTQEEIETLKSA...........
A0A017I737_ECOLX/18-278...................MVASNPGPGLGLLL-------------AFTLFG---KGMSKRSAPGAMII...........
A7X3X2_STAA1/22-268...................LGSGAANLGIVAAC-------------VTFLFG---SLRVNSIGVNAVLL...........
PTS3B_PEDPE/111-411...................ASMANIGQGAATLA-------------IFFATK---.SQKQKALTSSAGV...........
PTG3C_MYCPN/40-387FHLSDNYVA..........RVIGWVDPNNSSMY-------------IIPGAL---NGQNGSSTGNTMSKDLNGALSAYM.
E8VEA9_BACST/9-346FALHGN..S..........KIFGIPGIALAFYV-------------TAKKEK---KKLVAGLLIPVTLT...........
J7JTG0_BACIU/29-359KIFTQQFFDI........WVNIGGSGATLALVV-------------TMFLRA---RSKQMKQLGKLAVG...........
A0A017IAK3_ECOLX/118-401...................LSMAGAGQVGAALA-------------LYWRAQ---PHSALRSQVRGAII...........
Q97QL8_STRPN/28-347KILTSGT.QM.......FIVTMGGTGATLVVPF-------------MFMWLT---KSKRNRAIGRASVV...........
Q9K614_BACHD/26-350NIISKPFIEI.......FTVGMGGTGMTLAVVF-------------AILLFM---KSQQLKQVGKLGIG...........
J3WKQ3_MYCGT/303-598...................AMLSGMVPPLSIAL-------------AASIRK---SCFDKQELPAAYAC...........
J1R4G5_STREE/27-356HIINLSQIQT........FALMGGSGSTLCLLI-------------ATFLVS---RNAVSKNVAKLSFG...........
P94470_GEOSE/110-394...................WSMANVAQGGAGLA-------------VFVKAK---.SLKTKEVALPSAL...........
Q45579_BACIU/119-390...................LAMGGAGQVGAAFA-------------VFVKTK---KTTLRKAIAGGLP............
A1F3C7_VIBCL/35-354NIFTQPFWDF........YIFIGGSGATLALVI-------------.LMSFS---RSAHLKSIGRMSAV...........
E8VJP2_BACST/13-354TFMTGKYPF..........MMFGLPAAALAIYH-------------EAKPQN---KKLVAGIMGSAALT...........
F0LVD8_VIBFN/11-324MYQAGFFPI..........MMFGLPGAALAMYH-------------TSTAKN---KEKVAGIMIAAAFA...........
A5LK37_STREE/28-353HSLTPNF.GN.......YIAAIGGTGATFVVPF-------------ILIFFM---RSKQLKSVGKATIT...........
G6T801_STREE/32-373FAVAGEFSNM........FVIAGGSGATLGLCL-------------YIAFAS---KSEQLKAIGRASVV...........

PF13303

C4Z6R4_EUBE2/32-372NIIKNPR.IWIAP------IVTSAITGPMATCL.......FKLQMNGTPVSS...GMGTCGLVGQIGVYSGWIADIANGT
A8FGC2_BACP2/18-332NIVKNPL.ILIPP------TVAGLILAPIGIIG.......FGMV..NNAAGA...GMGTSGLVGQLMTLT........VM
Q5WEA3_BACSK/19-333NILKNPL.ILIPP------TIAGAVSAPIGTIW.......FGLI..NNAAGS...GMGTSGLVGPIMTFT........EM
B9DKL9_STACT/10-331NILMNPA.ILIPP------TVASAIIAPIMTTL.......FPMT..NNAAGA...GMGTSGFIGQIMTIN........TM
B1YKF4_EXIS2/16-335NIIRNPW.TIVPP------TLAGALLAPFATVL.......LTLE..SNPEGS...GMGTSGLVGPLMMLK........TM
Q03V93_LEUMM/32-373NLLKSPL.LLFGP------ALIAGVSAIFAVGI.......FNFK..VPYAIA...GLGLNGFIAPIAL............
B9E8P3_MACCJ/18-343NIVNNPK.ITIAP------LVAAAVSGPVAILW.......FKMG..VPYEIG...GIGLCGFIAPMQIL...........
Q5WK09_BACSK/10-334NLIKNPR.LCLPP------FAAAIICAPIASLA.......FQFQ..VSYELA...GLGLNSLIAPITIF...........
B1YJH3_EXIS2/10-334NIVKNPR.LVVAP------FLAAMISAPIATLV.......LSLE..VPYELA...GLGLNSMIAPLNIF...........
C3PGV6_CORA7/34-371NMLSKPV.TFLPV------ICSAAVLGGVGGAL........GIS..GTPISA...GFGISGLMGPLAALN.........Y
C4LGW0_CORK4/38-376NMMRRPV.ALLPA------IVACGVSGIVAGIF........RVQ..GTPISA...GFGISGLVGPLAALN.........A
C4L4Z6_EXISA/15-349NFVRRPI.MMLPI------LANAAILGALAGIL........KIE..GTPISA...GFGVSGLIGPVNALHL.......MP
Q036G8_LACC3/10-344NILSRPK.LFLPM------AINAGILGGIGAAL........NIQ..GTPASA...GFGFSGLVGPLAALD........AM
D1AVH7_STRM9/11-347NIVKNPI.MILPI------LTTSSISGLVVRIL........GIT..GDKVSS...GFGFVGLVGPIKAMSDY.....AVN
Q1GB97_LACDA/16-354NFLRYPV.IGIPI------ALTAAISTLSVPIL........GMQ..GTPASG...GFGLIGAVSPLAAY...........
Q6LQ05_PHOPR/28-337IVTRNPVPIFMSN------FIGGAFAGTIAAYF........GII..NDAPGS...AAPIPGLLASIAFN...........
Q8XP04_CLOPE/28-342IITANPIPIYVTN------FIGGALCGIIIVLM........GLT..NMSPGT...ATPIAGFAVMFAYN...........
Q2G165_STAA8/1-310IVSANPIPIYITN------FFGGAIAGLIIAMS........GLI..NDATGT...ATPIAGFLVMFGFN...........
C4L1G3_EXISA/28-337LISANPIPIYSVN------FVGGAIAGLIVAMT........GMI..NDAPGS...AAGIPGLLVMYGFN...........
A9NFH9_ACHLI/27-386NVMRKPI.VWAPT------LIASFILAPLSYFIFDGYQWFINLIPVGHQFSAVWAGMGTSGLVGILQPL...........
Q4FQB6_PSYA2/23-363NVLRKPI.ILLPA------VIASAIVGPIATVG.......FELA..CTATGA...GMGTAGLVGVFGVIEA.......SQ
D1ARE5_SEBTE/14-338NSIKNPL.ILVPP------MAASVILGGVGAAI.......FKME..NNKIGA...GMGTSGLVGQFTTF...........
A8MEB1_ALKOO/15-347NIIRNPF.VWIPP------TLASAFLGPLSTTI.......IRME..NNSIGA...GMGTSGLVGQFGAFTTM.....VAQ
B2A7K6_NATTJ/25-344NVVSKPK.LLIPP------TLTAAILGPMVTAV.......FPMY..NLAMGA...GMGTSGLVGQFGAIA........AM
C7RED4_ANAPD/18-331NIIKNPW.IWLPP------TLASAILAPIGTLV.......FKMK..NTPLGS...GMGTSGLVGQIGTI...........
A0PXE9_CLONN/19-346NLVAYPI.IAVPI------ILNGIISGIGAYIF........HIV..GTPSSA...GFGLVGLVGPLASI...........
B2GDR1_LACF3/19-361NLILNPW.QMVPA------LVAAIVCAPLATTL.......SGLR..AAYTVG...GLGLNSFIAPIYFW...........
F4BRJ2_CARS1/10-335NIVKNPR.ILIGP------TLAAAVAAPISTVA.......LGFT..APSALA...GLGFCSLIAPLNIF...........
F5WSR4_ERYRF/12-343NYLKNPI.MSLPI------AINAAVTGVVAYIF........QIQ..GTTASA...GFGITGLAGPINAYS........FM
Q03W61_LEUMM/33-377NLTENPA.LIIPP------MIGAAIAAPIATIA.......FNVT..APFSMA...GIGFNSFIVPLALA...........
Q1GBH7_LACDA/16-349NMLEKPK.LFVPV------LLSSALSGLLAAIF........NLQ..GTPNSA...GFGFSGLIGPLAAYA.........K
Q2FV51_STAA8/15-348NMVKYPI.LMLPI------LTTAIVSGLVSALV........GIH..GTKESA...GFGFIGMVGPINAFKF.......ME
Q56343_TREPA/13-343NWIRYPI.LNIPL------LLNGLVCGVLAWLF........NLQ..GTPASA...GFGFIGLVGPINAYR........LM
Q5FLN1_LACAC/11-342NVLKNPK.LFIPV------SASAAIAGLVGAIF........QIS..GTPNSA...GFGSTGLIGPLTAYQ........NM
Q81XJ8_BACAN/10-333NITKNPM.ILVPT------VVASAIVGPVSALI.......FQLE..AGKEIA...GLGLSSLIAPINLI...........
Q834J3_ENTFA/18-343NLFKYPI.ILIPC------LFTATISAIPVVLF........NIS..GTPQSA...GFGLVGLVGPLASL...........
Q839R1_ENTFA/29-330IISSNPIPIYATN------LFSGMVSGIVVTFF........GLK..VPVTGM...ATPWAGLLVTLGNN...........
Q8XMA5_CLOPE/20-350NLVEYPI.IAVPI------IANGILSGIGAYLF........NIL..GTPNSA...GFGIVGLVGPLAAI...........
Q8Y5C0_LISMO/10-334NIIRKPS.LMLVP------LLTTLIAGPLGVMV.......FHIQ..AASEVA...GLGLCAFVAPLYLI...........
Q9A0B4_STRP1/15-348NFLKHPI.MAIPM------VFTAAISSLTVPLF........NLV..GTPASS...GFGLVGAVGPIASL...........
Q9A1Q9_STRP1/29-336VTSANPIPIYVTN------FVGGAACGVLIALM........KLV..NDTPGT...ATPIAGFAVMFAYN...........
R5FBU1_9CLOT/24-338NIVPNPR.IWIPP------TLASMITGPIATMV.......FRLE..NIPAGS...GMGTCGLVGPIGVYT.........A
R5J6K1_9FIRM/19-358NILKKPV.IWIPP------IVSSAILGPISSVV.......LKMI..NNPAGA...GMGTAGLVGPLMAWQS......MAP
R6FZL0_9FIRM/39-416NLMRKPV.LWIPP------VLTSAILGPVATCI.......FQLRNNGAAISS...GMGTAGLVGPIGIITGWS..NMPKG
R6RMS6_9FIRM/1-317NILKNPF.LLLPP------ILSSAILGPLGVLL.......GKMQ..NSPNGS...GLGTMGLMGQTTTWET.......MT

PF02378

B7J380_BORBZ/28-365.........-...PGLFNINEPIMFGAPIVL-------NPI.LGIPFLLIP
B9AAA6_BORBG/17-354.........-...AFLTGITEPLEFLFIFTA-------PLL.YFVHAAYSG
PTU3C_STACT/16-359.........-...SFLTGITEPLEFSFLFVA-------PIL.YVAHVILAG
A0A017I7U5_ECOLX/111-396.........-...AIMAGISEPALYGVAIRL-------KRP..LIASLISG
P94865_LACCA/25-344.........-...PCTFGVNEPVLFGMPIIM-------NPI.FFIPFLATP
J7JNY4_BACIU/26-350.........-...PGIFNVNEPIIFGLPIVM-------NPI.IIVPWVLAP
D2BPU6_LACLK/26-390.........-...PGLFNINEPFLFGLPLVL-------NPV.LALPFFLVP
J7HPY1_MYCGT/28-366MSKESTNFL-SWKELVDGLTRKGNFDELAKN-------GLL........DG
O07656_ECOLX/14-353.........-...VIIGGVSEPIEFLFLFVS-------PLL.FVFHAFMNG
A0A017INW7_ECOLX/19-361.........-...CVVGGTTEPLEFLFLFVA-------PVL.YVIHALLTG
F0K639_CLOAE/28-347.........-...PVCFAVNEPILFGAPIVL-------NPI.FFVPFILTP
PTLCB_STAAU/29-349.........-...PTFFGVNEPILFGAPLVL-------NPV.FFIPFVLAP
F0K514_CLOAE/28-372.........-...PGCFNINEPVLFGLPIVL-------NPL.MFIPFLICP
D4QR60_ENTFC/107-385.........-...SAVLGVTEPAIYGVFVKY-------RRP..FVAVMIGG
J7JTD7_BACIU/29-359.........-...PALFNINEPIIFGMPIVM-------NPL.LIVPFIIAP
Q9CJ32_LACLA/29-420.........-...PGIFNINEPVLFGLPVVL-------NAI.FFIPFAVAP
Q9ZHJ9_CLOBE/108-393.........-...PAFLGITEPAIFGVNLRF-------IKP..FIFGCAGG
PTMCB_BACHD/19-279.........-...HFAGGIHEIY...FPYIL-------MKPTLILAVIAGG
A0A009DVA0_ECOLX/13-320.........-...SFLTGITEPIEFSFMFVA-------PIL.YIIHAILAG
Q9K7V5_BACHD/18-254.........-.........IGTSMLQVPNIV-------KNPLIILPPTIAG
E6P283_ECOD1/9-347.........-...AMLVGITEPLEFTFLFIS-------PLL.FAVHAVLAA
I6TZV0_STRMG/111-420.........-...SALLGITEPALFGVNLKY-------RFP..FFCALIGS
O51590_BORBU/12-348.........-...SFLTGITEPLEFSFLFVA-------PIL.YVVHATFDG
K7DWE1_LACLC/28-348.........-...PTFFGVNEPILFGAPIVL-------NPI.FFVPFIFAP
B9LY78_BORBG/18-378.........-...SMLTGITEPLEFAFLFAA-------PALYYFIYVPLFG
J7JKU5_BACIU/9-293.........-...AFITGITEPIEFAFMFLS-------PLL.YAVHAVLTG
B1RZB9_STREE/29-359.........-...PSIFNINTAILFTFPTVL-------NPI.MLIPFIATP
P96159_VIBFU/17-357.........-...CIVGGITEPLEFLFLFVA-------PVL.YVVHAILTG
Q98R81_MYCPU/304-616.........-...NILFGLSFISEGAIPYTS-------RNTKVMIPSNIIG
B1X6L2_ECODH/11-300.........-...AFLTGVTEPLEFLFMFLA-------PLL.YLLHALLTG
J7JJ76_BACIU/13-314.........-...SMLTGITEPVEFSFLFVA-------PVL.YLINSILAG
PTSBC_STAXY/110-413.........-...SALLGITEPAMFGVNLKL-------RYP..FIGAIVGS
PTG3C_STACT/13-344.........-...SFLTGITEPLEFSFLFVA-------PLL.FFIHAVLDG
A0A016QY08_KLEPN/110-395.........-...SAMLGITEAAIFGINLRF-------VKP..FIAALVGG
Q97SS4_STRPN/34-364.........-...PAIFNVNEPVVFGFPIVM-------NPV.MFVPFILVP
A0A017HY88_ECOLX/133-409.........-...I.VVGATVATEPAIPYAL-------AAPLPMITANTLA
J0XFC0_STREE/12-284.........-...V.PMGIVNIVEGVIPIVM-------NNLVPGLIATGIG
A0A017I737_ECOLX/18-278.........-...HFLGGIHELY...FPYVL-------MKPLTIIAMIAGG
A7X3X2_STAA1/22-268.........-.........IGAAKMMIPVYL-------KNLIISIPLTING
PTS3B_PEDPE/111-411.........-...SALLGITEPAIFGVNLKM-------KFP..FVFAAIAS
PTG3C_MYCPN/40-387.SKESTAFL-TWKDLVDGLTFKGNFDKMAEN-------GLL........DG
E8VEA9_BACST/9-346.........-...AIVAGITEPIEFTFLFIS-------PFL.FAVHAVLAA
J7JTG0_BACIU/29-359.........-...PAIFNINEPIIFGMPIVM-------NPM.LLLPFIITP
A0A017IAK3_ECOLX/118-401.........-...PGLLGVGEPLIYGVTLPR-------MKP..FVTACLGG
Q97QL8_STRPN/28-347.........-...PTFFGVNEPILFGAPLVL-------NPI.FFIPFIFAP
Q9K614_BACHD/26-350.........-...PGLFNVNEPIIFGLPIVM-------NPL.IIVPWILSP
J3WKQ3_MYCGT/303-598.........-...Y.LMGLSFISEGAIPFVV-------KKPKVMLTANLIA
J1R4G5_STREE/27-356.........-...PGIFNINEPVLFGYPIVY-------NIS.LAIPFITVP
P94470_GEOSE/110-394.........-...SAFLGITEPVIFGVNLKY-------RKP..FIAAAIGG
Q45579_BACIU/119-390.........-...SGLLGIGEPLIFGVTLPL-------GRP..VFNSMFRS
A1F3C7_VIBCL/35-354.........-...PGFFQINEPVIFGSPVVM-------NPI.LFLPFVFAP
E8VJP2_BACST/13-354.........-...SFLTGITEPLEFSFLFVA-------PVL.FAIHCLFAG
F0LVD8_VIBFN/11-324.........-...AFFTGVTEPLEFSFMFLA-------PML.YVLHALLTG
A5LK37_STREE/28-353.........-...PVLFAVNEPLLFGMPVIL-------NPY.LFVPFLMTP
G6T801_STREE/32-373.........-...PALFNINEPLIFGLPIIY-------NPA.LAIPFILAP

PF13303

C4Z6R4_EUBE2/32-372KAAIT..GFDWAGMILISFILPAVICPLI.NML....LKKIGWVKDGDMKL
A8FGC2_BACP2/18-332.GFHP..SV.FLAITLLHIVGPAVISLVVSEWM.....RKKGYIQFGDLTI
Q5WEA3_BACSK/19-333.GYSG..SL.FIQVILCYVIIPAVCAFIVSEWM.....RRKGWIKWNDMHI
B9DKL9_STACT/10-331.GASA..KT.WILIAVFQIILPAVVSYLLYRVC.....KNAGWIKDGDQKI
B1YKF4_EXIS2/16-335.GFEG..EY.YLAVFVLCFLAPALISYLIYRIL.....RRMGRIKDGDLKI
Q03V93_LEUMM/32-373ATSDP..RG.FVLMIVFGAVVPTVAGLVFYYVL.....KKLGKTKKNDLHL
B9E8P3_MACCJ/18-343NDQGI..VA.FTQFMIAGVFLPLVVTYVLHYGV....ARRFNHVKAGDLAL
Q5WK09_BACSK/10-334STQGI..TG.LFIFIGTGIILPGIISLALYELI.....KRIGWAKTGDLHI
B1YJH3_EXIS2/10-334VNQGF..NA.FLIFFATGVVLPGVLTLVFYRMT.....TMAGWTKMGDLRL
C3PGV6_CORA7/34-371EGWGWSAGN.VMIITFVYVILPLALALLFCWLF....EKVLHLTRAEYFSL
C4LGW0_CORK4/38-376DGWGWSVRN.ILVVALVYAVVPCVSAFFAVKLF....DKKLGVTNENMYAL
C4L4Z6_EXISA/15-349GGFAL..FN.VLLVIVLFGLIPVALGIFFYRVF.....ERATLVKSDHYRL
Q036G8_LACC3/10-344GSVTV..GN.VLELTLLFFILPIALAYASHVLF....TKTLHYQDPEDYAL
D1AVH7_STRM9/11-347GITGL..KA.LTFVIIAYFVVPFGVALISHIVY....TKVLKVYKAEIYKF
Q1GB97_LACDA/16-354.NAGF..YN.VLVLVIVWVVVPFAVGYLMKKIF....VDWTKIYKPEYFIS
Q6LQ05_PHOPR/28-337...PP..ST.LFMAASAAAVAGLLGGVIGVKIY.....RTFLQERVPLQQF
Q8XP04_CLOPE/28-342...PA..FK.VLIASLACVVVSAGSGYLGYLLFKNYKIHTVDEIRGNDLEV
Q2G165_STAA8/1-310...HP..TT.IVIYGVVMAIVGALAGYLGSIVF.....KKYPIVTKQDMIN
C4L1G3_EXISA/28-337...DW..QT.VTFTAVVLFILGIGFGLIGSRLF.....KNFPIVRHTEKVE
A9NFH9_ACHLI/27-386TITNF..SLDGWLFVSSMILFPLVLVFWLDVVF.....IKLNWYTENDLIL
Q4FQB6_PSYA2/23-363EIMST..SQLWTAIILLMFVLPAVIAGVVAYMM.....RRFGWLVDGDMKL
D1ARE5_SEBTE/14-338EVMGE..KS.LIPMLLLHFIFPAVIALLVSGIM.....RKTGLIKQGDMKI
A8MEB1_ALKOO/15-347NGESV..ISVMAKIAILHFILPAILTFFIAQFM.....RSKGWIKDGDMKL
B2A7K6_NATTJ/25-344EGAGMGGAAMYIQILVFHFVAPAVLAYAISQFM.....RKKGHIQDGDLKL
C7RED4_ANAPD/18-331NAMGI..SA.IFKVILLHIILPAILSYIIYRLM.....KNKGLIKDGDMKI
A0PXE9_CLONN/19-346.NSPT..GS.VFRAAMAFIVVPFVGAFLIDILC....RKVLHLYDVSIYK.
B2GDR1_LACF3/19-361.GQGT..NQ.FVAYMLWGIVMPAVISVFLFQVM.....KKFGLVKDNQLHL
F4BRJ2_CARS1/10-335VSQGS..GS.FAVYILTACLVPIAITVVVNKVL.....EKASWLRKGDMAL
F5WSR4_ERYRF/12-343TATPV..VR.IIILLVQYLVVPLGIAMVTHTIF.....TKMDLYKNEIFT.
Q03W61_LEUMM/33-377.GSNP..AA.FAAYMIIGVGVPVIVSFVGYRFM.....RKMGWAKPQQLHL
Q1GBH7_LACDA/16-349MTPGW..GS.IILLTVLYVVYPVALGFFMRWLF....IDRLSFAQAEDLRL
Q2FV51_STAA8/15-348VDSAW..LS.VLLIVVAFFVVPFVTAWLADIIY....RKVFRLYTNDIFK.
Q56343_TREPA/13-343AYTPM..VR.AGILFLVYFVLSFLAAYLIDFIL....VDRLKLYRRE....
Q5FLN1_LACAC/11-342TTGGP..IT.IIFLILLFMGMPLMLGLIMRYIF....IQKLCFVKEEDL..
Q81XJ8_BACAN/10-333SSEGW..EV.VPAMVITYIIIPVAVSYILYIAL.....KKAGRIHSGDMT.
Q834J3_ENTFA/18-343...DA..GLGILPLLFSWFVVPIVAGLFSKFLF....EKVLKIYDSK....
Q839R1_ENTFA/29-330...AI..QT.TLLAVAIITVVSLMFGFLGALVF.....KRYRIE.......
Q8XMA5_CLOPE/20-350NTPGA..TNAIFGVIMAFFVIPFVGAFIIEWFC....RKVIHLYDENIFK.
Q8Y5C0_LISMO/10-334ANYGF..ST.LAAFILVAVVLPGVIALVVRPFL.....IKKERLKTGDLT.
Q9A0B4_STRP1/15-348..AGG..SS.ILIIILAWIIVPFAVAFAAHKVS....KDILKLYKEDIF..
Q9A1Q9_STRP1/29-336...PV..AK.VLITALGCIIISLIVGYIGGSVF.....KNYRLVTKQELQ.
R5FBU1_9CLOT/24-338MGGGT..SM.WVGILLVCFLLPAVLTFVFGEVL.....RRMGWIKDGDLKL
R5J6K1_9FIRM/19-358NVSGA..IL.LMEILAMHFVLPAIISLAVFKFM.....VSKKIVSPEDYKL
R6FZL0_9FIRM/39-416YAPGA..FD.WVGMILVCFILPVVLSWAIGKFM.....RKKGWIKEGDLKV
R6RMS6_9FIRM/1-317AGEAP..QMVFLKILLFHFILPGVLTLFIANGM.....RKLNLIKSQDML.

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window