Sequence alignment for CL0493

PF13303

C4Z6R4_EUBE2/32-372-IDALGAMAQGLFCSLLIGTIL--------------------NTLGTQLHIGFLTNTVATVSG.................
A8FGC2_BACP2/18-332-IEALSYMALGLFATLVVGLIL--------------------KTAGGLLSL...........P.................
Q5WEA3_BACSK/19-333-IKAMGQMTFGLFATLIIGLII--------------------KTAGEQFGI...........A.................
B9DKL9_STACT/10-331-IQGLSYMTLGLFGSLIIGLIM--------------------QTIGKQTLILAL......NLH.................
B1YKF4_EXIS2/16-335-ITVLSYMALGLFSSLIMGLIL--------------------KTIGEGLITKGI......DAE.................
Q03V93_LEUMM/32-373-FDVSQGISNAILAVLGMGLLM--------------------ASIGNIFHY...........T.................
B9E8P3_MACCJ/18-343-EKGAQGISAGIFVALGVGMLL--------------------KSMGGLLHI...........D.................
Q5WK09_BACSK/10-334-YKASAGVANAVLVTLGIGLLF--------------------ESFGNIFGW...........S.................
B1YJH3_EXIS2/10-334-VKVSAGMANAVLVTLGVGLLI--------------------ETFGNLLHI...........E.................
C3PGV6_CORA7/34-371-MKVLNGISIAVVVSLVPQALL--------------------GELAKALLPLWS......GAS.................
C4LGW0_CORK4/38-376-MNVLNGISVAVVVALVPQALL--------------------GELFKALLPVFP......QGK.................
C4L4Z6_EXISA/15-349-MNVLNGLSMAILIALIPSALL--------------------GELTKAILPYFP......SLQ.................
Q036G8_LACC3/10-344-MNILNGLSVGIIVALVPGAIL--------------------NAIVKLLLPSFP......QLA.................
D1AVH7_STRM9/11-347-MKVLNGTAIGIVVGLIPNAVL--------------------GGLFGYLEQFNP......VFG.................
Q1GB97_LACDA/16-354-MKVLNGSATAIIVSLLPSAIL--------------------STFLTPFAGSNA......IVA.................
Q6LQ05_PHOPR/28-337-SAAMSGLADAAIATFLVEAIH--------------------KYVMGNLLGI..........G.................
Q8XP04_CLOPE/28-342-MKAMGALAGAACASFLVEAFH--------------------SSFFGNVLNI..........E.................
Q2G165_STAA8/1-310-MRAMGALANAAIATFLVEAFN--------------------KYVGGEVFGI..........K.................
C4L1G3_EXISA/28-337-MKAMGALAGAAIASFLVEAFN--------------------AYAIGGLLPL..........P.................
A9NFH9_ACHLI/27-386-SKTLNGMTFGIFGTIVVGAII--------------------QTLGIITGID..........V.................
Q4FQB6_PSYA2/23-363-IDAFTGMALGLFVTLIAGLII--------------------SQIGGWLNL...........P.................
D1ARE5_SEBTE/14-338-VKILNGMALGLMASLVTGVIL--------------------KQIGTYLNI...........Q.................
A8MEB1_ALKOO/15-347-TKALNGMALGLFSSLIIGLIL--------------------KQIGELTNI...........S.................
B2A7K6_NATTJ/25-344-IEVLGFMAQGLFASLIIGVIL--------------------NEIGVQLGIT..........F.................
C7RED4_ANAPD/18-331-IDALGAMAFGLFASLLVGTIL--------------------NSLGQSLHIP..........Y.................
A0PXE9_CLONN/19-346-.KVLAGTATGIVVGLIPNAIL--------------------GAIFKGLINTSP......IFS.................
B2GDR1_LACF3/19-361-.NLSAAIANAILVTLGMGLLM--------------------QTVAGFVHW...........Q.................
F4BRJ2_CARS1/10-335-YKASSGIANAIFVTIGIGLLL--------------------ETIGNMTGL...........T.................
F5WSR4_ERYRF/12-343-.KILQGAAMGIVVGLIPNAIF--------------------GEIFKALGSHFA......VFA.................
Q03W61_LEUMM/33-377-YKVSAAVSNAILVTLGMGLLL--------------------QTIAGFIHW...........A.................
Q1GBH7_LACDA/16-349-.NILNGIGLGVIAALVPAAIL--------------------GQLMKALLGVAP.....AFAQ.................
Q2FV51_STAA8/15-348-.RVLSGVAIGIVAGLVPNAIL--------------------GEIFKYFMDYHP......IFK.................
Q56343_TREPA/13-343-MKILNGSSAGIVIGLVPPAIA--------------------GELFRALAPLSP......LFA.................
Q5FLN1_LACAC/11-342-.NILSGVSSGVVIALVPGALV--------------------NEIMKSISDVWP......AAQ.................
Q81XJ8_BACAN/10-333-FKASAGIAQGIFVSLGIGLLI--------------------ENIGRIVDI...........P.................
Q834J3_ENTFA/18-343-.KVLAGTASGTIIALIPNAVL--------------------GAILKYFAEYK.......IIE.................
Q839R1_ENTFA/29-330-.KSLSALSGAACATFLPEAFL--------------------RYAVGGVFHL..........D.................
Q8XMA5_CLOPE/20-350-.KVLAGTATGIVVGLIPNAIL--------------------GSIFKGLIGVSP......IFS.................
Q8Y5C0_LISMO/10-334-YKASMGIANAVLVTLGIGLLL--------------------QTIGQMTGI...........S.................
Q9A0B4_STRP1/15-348-.KVLAGTAIAIVVALIPNAIL--------------------ATFLKPLLPNM.......AAA.................
Q9A1Q9_STRP1/29-336-.KAMGALASAACASFLVEAFQ--------------------DSFFGKVLGF..........Q.................
R5FBU1_9CLOT/24-338-IDALGAMAFGLFASLLIGTIF--------------------GTLGQQFQI...........E.................
R5J6K1_9FIRM/19-358-.VAMNGMALGLFSTLIIGLII--------------------NQIGQAIPGSL........GS.................
R6FZL0_9FIRM/39-416-IDAMGAMALGLFASLLIGTII--------------------KTLAENVGTTG.......LMAALAAITDTGELAAKVAG
R6RMS6_9FIRM/1-317-......MACGIFATLIMGMFL--------------------RQIANLFPSDF........NS.................

PF02378

O50980_BORBU/28-365RDGFTFSMPFLIVGSFILLLVN.............LPFTDSQTLLYQ....QWYVDLMAKYKG-----------------
O51143_BORBU/17-354SKALRVPISILPVSCLLIGIGS............VFSNSSSIVYVDK....IFIQNVLG....-----------------
PTU3C_STACT/16-359GKALMLPVAILPAAGILLTFGN.............AMHNEQILHFAP....WMQHHYIQLISQ-----------------
PTIBC_ECOLI/111-396IGTMSPLIPAIIGGSMVKLLAM.........................ILEMSGVLTKGSPTLT-----------------
P94865_LACCA/25-344RDGFIACMPIIIFSSIFMMVAY.............VPN.............AWGFYWPDNVTN-----------------
PTEC_BACSU/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLNK..........IMNASMLTSFQS-----------------
Q9CHB4_LACLA/26-390KNGMLFAMPFIIVGSIFLILAN.............IPIPPVAKWLSD...........NGWSA-----------------
PTG3C_MYCGE/28-366SNGLMIPIAVLPLAGIFLGIGDA...........ISSNSSGIVGVKFF.GE............-----------------
O07656_ECOLX/14-353GKAFMYPIALLSVCGMMLGLGSG...........LASD..DMAKLIPFLAIPIIKTILD....-----------------
PTOCB_ECOLI/19-361GKTFMLPVALLSFCGIMLGIGSS...........LSSH..DVITLIPVLGNPVLQAIFT....-----------------
Q97EZ1_CLOAB/28-347RDGFLSCMPVILFSSIFLLIAC.............VPN.............AWGFYWPNNVND-----------------
PTLCB_STAAU/29-349RDGFISAMPVILFSSIFLLIAY.............VPN.............IFGFKWDKGMEA-----------------
Q97M14_CLOAB/28-372KDGVIITMPLTLVGSIFLLIAN.............FPIKSWNSWMTA........IFGPNWAV-----------------
L2MUH8_ENTFC/107-385SESMTPILEPIICAGLLAAVLS.........................IASLTGIISPDSSTYH-----------------
YWBA_BACSU/29-359RDGIILTMPLIIIGSVFLILTS.............LPIPGYADFMAS........VFGNEWAD-----------------
Q9CJ32_LACLA/29-420RDSFIGMLPATLAGALAAMISAIVTTFPSAIQQMMLGATAFSKLAPEKVWTLANTPIIGDLNN-----------------
Q9ZHJ9_CLOBE/108-393GDVFVPIIPVLVATGLFMGLRG.........................L.LTNLGVQMNENFVL-----------------
PTMCB_BACHD/19-279SGMIMPNIGAFIAWGLITALFI................................PTGWWPNEQ-----------------
E2XFH0_SHIDY/13-320GKSLMLPVSVLPIAGILLGVGS.............................ANFSWLPAVVSH-----------------
Q9K7V5_BACHD/18-254FVTALSFMALGLFSSLIIGLII...............................RTIGDVTQFE-----------------
PTXC_ECOLI/9-347GGAMFTPVLLFPFAGIVVGLAIL...........LQNP..MFVGESLTDPNSLFAQIVH....-----------------
PTS3B_STRMU/111-420SDIFVPIIPALVAGGLLMALNN...............FLTSEGLF.GTKSLVQQFPIIKGSSD-----------------
O51590_BORBU/12-348GRSFMLPIAILPAAGLLLGIGGS...........LSNP..ETVRTYSFLNIFFLQSVFK....-----------------
K7DWE1_LACLC/28-348RDGFIAGMPVILFSSIFILIAY.............VPN.............AWGFHWSKDIET-----------------
O51000_BORBU/18-378GKAFMLPIALLPAAGILLGIGGA...........FTNE..TMIQAYGLEEVLGKGTVANSILY-----------------
PTWCB_BACSU/9-293GKSFMLPIAVLPAVGIILALGR.................EDVFNIP.................-----------------
G6R7L8_STREE/29-359REGFMMAMPLILVGSLFLILIS.............WPQEAFTNWLNS...........VGLLS-----------------
P96159_VIBFU/17-357GKTFMLPVALLAFSGILLGVGSS...........FSSS..AIKEAIPFLDNAPFEYLFM....-----------------
Q98R81_MYCPU/304-616MSGISYMLPFVVFGGIIISIGFL...........IDTIYGATSGISSDPKFLANFGSNHIVAK-----------------
PTW3C_ECOLI/11-300GRALQLPIAVLPVAALLLRFGQ.................PDLLNVA.................-----------------
PTW3C_BACSU/13-314GRALMTPVAVLPAAGLLLRFGD.................KDLLNIP.................-----------------
PTSBC_STAXY/110-413SDIFVPIIPAIVAGGLLMGINN...............ILTAPGIFYDNQSLIEVQNQFSGLAE-----------------
PTG3C_STACT/13-344GKALMLPVAILPAAGLLLALGN.............AFQGDALQSLMPFIKAEGFQNVAK....-----------------
A6T5U3_KLEP7/110-395SNIFVPIIPAIVASGLLMGLLG.........................MVKTYGWVDPSNALYI-----------------
PTFLB_ECOLI/133-409MAGVSAALPFVIGGGILVALANM...........LVQFGLPYT.........DMSKGAPSFTW-----------------
PTMCB_ECOLI/18-278TAMVIPNIGAFIAWGFITALFI................................PTGWLPNEH-----------------
PTS3B_PEDPE/111-411SDIFIPIVPALVAGGLLMALNN...............VLTAEHLF.MAKSVVEVYPGLKGIAE-----------------
PTG3C_MYCPN/40-387SNGLMIPIAVLPIAGIFLGVGDA...........IAGNAGDLTGLRYF.GL............-----------------
PTOCB_BACSU/9-346GSAMFVPVLLFAFAGIIVGISTL...........FKNK..TLMG.PLADPDGFWYQCWY....-----------------
PTJC_BACSU/29-359RDGIILTMPLIIIGSFFLIIGN.............LPIPGYAEFMAK........TFGSSWSE-----------------
PTYBC_ECOLI/118-401ATIFTPLIPGFIAAGLLLGIAT....................LIATVMHVPADAQGTLPDALN-----------------
Q9K614_BACHD/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLDQ..........LMNEGALATFRE-----------------
PTF3A_MYCGE/303-598LSGVSYMLPFVVFGGILIALSFL...........IDINNANNAG........GNFGTINPVAN-----------------
P94470_GEOSE/110-394SNIFVPIIPAIVASGLLMGPLG.........................MMKAFKWVAPDSPLYV-----------------
Q45579_BACIU/119-390ASIFIPLIPALVASGLITGITK.........................AIIQAGWLSADSQIAI-----------------
Q9KSH4_VIBCH/35-354RDGFIVAMPFIIVGSFILIFAF.............PPFAEDTTNVFG....RVWLNFATTHFD-----------------
PTG3C_BACSU/13-354GRALMLPVAILPAAGILLAIGN.............AMQNKDMIQVLHFLSNDNVQLVAG....-----------------
F0LVD8_VIBFN/11-324GKALMVPVATLPAAAILMGVGYWIDPNGWGANSALAG..........................-----------------
A5LK37_STREE/28-353KDGFIATMPLIMFSSFLMIIIM.............IPK.............NFGVELPSPAIV-----------------

PF13303

C4Z6R4_EUBE2/32-372.........VNYTVGGLASAMSGPAMAVAIGYALKCPPLVLFSLITVGFASNA....-----------------------
A8FGC2_BACP2/18-332.........LIIKMGTLAMGLMGPAIGVAVAYRLQASPLVIFASVVSGAAGA.....-----------------------
Q5WEA3_BACSK/19-333.........AFLEIGELAMDLYGAAIGAAVALALGAPSFVVLATIVCGTAGA.....-----------------------
B9DKL9_STACT/10-331.........FLAEIGTVAMGLTGAAIGGAIAYGLGAQPLVVFSCIIVGSLGYDKFG.-----------------------
B1YKF4_EXIS2/16-335.........ILVTVGQQAIALTGPAIGVAVAFALEAPPLVLFSAVAVGAFGYEA...-----------------------
Q03V93_LEUMM/32-373.........PLIQAGLMGQKMLAPALGVGIAMMMRANILTTGAALIAATVGSNAVYF-----------------------
B9E8P3_MACCJ/18-343.........LLVLFGTISMLILAPALGGAIAYSLGANGITLVSAMVAATIGGNALKE-----------------------
Q5WK09_BACSK/10-334.........AFVTIGSITKILLAPAIGAGIAYQLGGNTLVIYAAMASSTVGGNAISF-----------------------
B1YJH3_EXIS2/10-334.........MLLTIGGVAKVLLAPALGAGIAYQLGGNTLVLFSAMIAATIGGAALQP-----------------------
C3PGV6_CORA7/34-371.........TVIALTGLAASLLPVMIGVLVGIEFKMTPIQTAAVGIASFCGSGVATV-----------------------
C4LGW0_CORK4/38-376.........EIIGMVSVASSMLPIAIGLLVAMQFKMTHIQTATVAISAVMGSGVVKG-----------------------
C4L4Z6_EXISA/15-349.........FILDATTIAMRLLPAIIGLAVAMQFGRSILEAGTIAIATYVGSGAVRI-----------------------
Q036G8_LACC3/10-344.........VVTYMTGAAMTLLPALSAVCVGMLAKFTPIQTSSLALAAIVGAGNYHL-----------------------
D1AVH7_STRM9/11-347.........ILRQICVDIQWLVAPMIGFLVGLQFGFNPMKSAIIMSATWIASGALVR-----------------------
Q1GB97_LACDA/16-354.........NLLHIVTVFQYFFAVMCGFSTAKQFNLGYTEAACVGGAAFLGSGCMTA-----------------------
Q6LQ05_PHOPR/28-337.........YLAEFGNLVGGMGGVAAATLVMLRVGVQPVFAMVTGLA..........-----------------------
Q8XP04_CLOPE/28-342.........FLKKVGDANGSLGGVAAAILVPLALGVSPVYSVLIGLS..........-----------------------
Q2G165_STAA8/1-310.........FLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAA..........-----------------------
C4L1G3_EXISA/28-337.........LYEEVGQAAGALSGPAAAALVAIALGINPVYSLMIGLS..........-----------------------
A9NFH9_ACHLI/27-386.........LNLRVAPVLTSLLGMGIGLSIGLSLKVDGLKLIMLSVAGGIGTLVKID-----------------------
Q4FQB6_PSYA2/23-363.........ALIAVGKLASVLMGAGIGVGIAYYLKAPTLVMLSCLVAGMLGAHSEAL-----------------------
D1ARE5_SEBTE/14-338.........ELIMFGQVAQYMMGPAIGAGVALSLEAPPLGVFASVVCGMLGAGTIKY-----------------------
A8MEB1_ALKOO/15-347.........MLVYFGQVAQFLMGPAIGAGVAYSVGAPPLAVFASIATGAIGANTISL-----------------------
B2A7K6_NATTJ/25-344.........LSETVWPIANEMTGPAIGAAVAFGLKAPPLVVFASTITGYAGA.....-----------------------
C7RED4_ANAPD/18-331.........LTDRLWPLANSASGAAIAVAIAASLNAPKLVLFASTIVGLGAY.....-----------------------
A0PXE9_CLONN/19-346.........VLYNAVNIMQFIVPVLVGVLVALQFQLGPMQTVVVGAAVFLGSGAYKV-----------------------
B2GDR1_LACF3/19-361.........PLFEAGTLAQALLAPALGLAVASQLEATTLVTFSTIISATVAANAVSF-----------------------
F4BRJ2_CARS1/10-335.........ILVIIGTAVKMLMAPAIGAGIAVMLGGNTLTIFSAMAAGAIGAGAIQT-----------------------
F5WSR4_ERYRF/12-343.........TLAGIVFAIQFTVPVLVGMFSSLEFKLNGLQMASVIGAAFIGSGAARL-----------------------
Q03W61_LEUMM/33-377.........PMVQMGAITKIMLPAAFGAAIASQMKTNTMVMFSAMAASAVGANAVFF-----------------------
Q1GBH7_LACDA/16-349.........TVINITTFTQSLLAAMAGFCAAYLFQMNMIQMCSVAAAAMIGSGAVTF-----------------------
Q2FV51_STAA8/15-348.........TLLGVVVAIQFTVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQF-----------------------
Q56343_TREPA/13-343.........ALYHVVLPIQFSVPALIGTLVGLQFHCSAPEVATLAFVSVIASGNVTL-----------------------
Q5FLN1_LACAC/11-342.........SVLAMTTLMQDLLAVFAGLCVSYLLKFNLIQSGSVTAAAMIASGAFQM-----------------------
Q81XJ8_BACAN/10-333.........LLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISI-----------------------
Q834J3_ENTFA/18-343.........MIIHAAQIFQLATPLIIGGLIAFQFGLTPQKMMIAGGAAFAGSGVIKF-----------------------
Q839R1_ENTFA/29-330.........YVSQIGETMGSLGGLAAGALVPLAFGISPVFSIILGLS..........-----------------------
Q8XMA5_CLOPE/20-350.........TFYNAVNIMQFIVPVLVGVLVGLQFELNAMQSVIVGAAVFLGSGAFKV-----------------------
Q8Y5C0_LISMO/10-334.........FLATVGAIGKTMLIPGIGVGIAMCLHANTLVTISAAASAVIGGGAVAT-----------------------
Q9A0B4_STRP1/15-348.........EFLHIVQVFQFFTPIMAGFLIGQQFKFNPMQQLAVGGAAYIGSGAWAY-----------------------
Q9A1Q9_STRP1/29-336.........FLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLS..........-----------------------
R5FBU1_9CLOT/24-338.........IFNVIADYAKSATGAALGIAIAHALKAPQLVLFSAATVGIAGN.....-----------------------
R5J6K1_9FIRM/19-358.........FLVSISPVAMALTGPVIGIGIATSLESPKLVTLSSGVVGFIGAFGAVF-----------------------
R6FZL0_9FIRM/39-416LSMLNRFCWILWQIGNYATMVTGVAMAAAIGYALDAPPLVLFSLCAVGQATNT....-----------------------
R6RMS6_9FIRM/1-317.........TLIHLSGIATGLTGIGIGVGVACQLQEAPLVILCAGIAGMLGGD....-----------------------

PF02378

O50980_BORBU/28-365---------NLVQPFYVSMGIMSIFVVFGIGYNLSNHYKLSGIT..GGFLSLYTFLILAGQSDWIPYGGDAAKWG.....
O51143_BORBU/17-354---------LMKAIGNAILLNMPLIFSIGISIGV..ARMGQGTAALGGLIGYLTFNI..TENYFIEAFSGLVEAE.....
PTU3C_STACT/16-359---------IMEASGQVIFDNLPLLFAMGTALGL..A.GGDGVAGIAALVGYLIMSATMGKIAGITIDDIFSYAD.....
PTIBC_ECOLI/111-396---------ILNVIGDGAFFFLPLMVAASAAIKF....KTNMSLAIAIAGVLVHPS...FIELMAKAAQG..........
P94865_LACCA/25-344---------TLMVAYKYSMGLLALFVAGTTAKNLTDSKNLELPK..TNQINPVAVIVASEISFVILSILT..........
PTEC_BACSU/26-350---------HFGIASTATMGIMSVFVVFGIGYYLSKSYQVEAVF..GGAIALVSFLLLTPFIIQPETGDA..........
Q9CHB4_LACLA/26-390---------IFTQAFNVSFGILAIWAAVGIGYSYVKEAGFGDVALQGGLTSLSAFFIVQSLSIANPITAALATGKEASGI
PTG3C_MYCGE/28-366---------FIKQGGNVVFANLPILFAVAIAITF.S..QDAGVAGFSAFVFWATMNA..FMSSLIIPVDANNTAS.....
O07656_ECOLX/14-353---------FIVSLGLFAFVNLPVLFAIAIPLGLLKDKEDKAYGAFSGLIGFMAMHL..GTNFYLKQHDLLVV.......
PTOCB_ECOLI/19-361---------WMSKIGSFAFSFLPVMFCIAIPLGL..ARENKGVAAFAGFIGYAVMNL..AVNFWLTNKGILPTT......
Q97EZ1_CLOAB/28-347---------ILMKAYNYSMGILALLMVATIAKSLTDSINGKLPK..LRQINNVSVMIVSIICFILIGVQP..........
PTLCB_STAAU/29-349---------ILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLES..TNQINFISTMQAAMCGFLFLASDP..........
Q97M14_CLOAB/28-372---------PLTQVSGSTFDIMAIAAVIGIAAQYSKNEGQDPVT..AGLLGAVAFLIIMPSYSPINIGDKVGG.......
L2MUH8_ENTFC/107-385---------IFDALRSAVFYFLPILMAMSCAKRL....GASPYLAVALAATILSSSINDVK...................
YWBA_BACSU/29-359---------KLGYPVNASFDIMAMIAAFGIAYRLAESYGVDALS..AGAISIAAFLLATPFEVPFTPHGSTE........
Q9CJ32_LACLA/29-420---------ISALVNQGTLTVIGLIFAFSWGYNLARAYGVNDLA..GGIVSLATLFAGLPNQMGKFTAALGTGKAGV...
Q9ZHJ9_CLOBE/108-393---------FTQVLTDTAFAFLPALVAWSTMKKF....GGTPVIGIVIGLMLVSPSLPNAYAVAAGTATP..........
PTMCB_BACHD/19-279---------LAELVGPMITYLLPLLIGYTGGKMIYD..VRGGVVGAAATMGVVV..........................
E2XFH0_SHIDY/13-320---------VMAEAGGSVFANMPLIFAIGVALGF..T.NNDGVSALAAVVAYGIMVKTMAVVAPLVLHLP..........
Q9K7V5_BACHD/18-254---------LMHNIGVLAMSLMGPAIGVAVAYGL....QAPRLVLFSALIAGAA..........................
PTXC_ECOLI/9-347---------IIEEGGWTVFRNMPLIFAVGLPIGL..AKQAQGRACLAVMVSFLTWNY..FINAMGMTWGSYFGV......
PTS3B_STRMU/111-420---------MIQLMSAAPFWFLPILVGISAAKRF....GANQFLGASIGMIMVAPGAANIIGLAANAPISKAA.......
O51590_BORBU/12-348---------IMSASGSIIFSNLAPIFSIGIAVGL..AKSDKGTSGIAAFIGYLVMNA..TIGVLIDVSGRAE........
K7DWE1_LACLC/28-348---------FLMTPYSYSMGILAFFVGGTTAKALTDSKNRDLPA..TNQINFLSTMLASMVGFLLMAAEP..........
O51000_BORBU/18-378---------LMKYTGEVIFANLPLMFAAAIPIGL..AKVEKGTAALAGVVGFLVMHQ..TINGILYIQGITPESASL...
PTWCB_BACSU/9-293---------FVYQAGTAVFDHLPLIFAIGIAIGI..SKDSNGAAGLSGAISYLMLDA.......................
G6R7L8_STREE/29-359---------ILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPS..AGIIALSSFVLMAPRFSSMVYDKNGE........
P96159_VIBFU/17-357---------WMTKIGLVAFIYLPVMFAVAIPLGL..AREEKGVAGFAGFVGYAAFNL..AINFFLTVAGVLDS.......
Q98R81_MYCPU/304-616---------WFNRLGGIAFSIMVAILAAYITYSL....VGRQGLLPGFVIGFISSGRLKDTYSFLTDSLTN.........
PTW3C_ECOLI/11-300---------FIAQAGGAIFDNLALIFAIGVASSW..SKDSAGAAALAGAVGYFVLTK.......................
PTW3C_BACSU/13-314---------IIKDAGGVVFDNLPLIFAVGVAIGL..A.GGEGVAGLAAVIGYLILTV..TLDNMGKLLGL..........
PTSBC_STAXY/110-413---------MINIFANAPFTLLPILIGFSAAKRF....GGNAYLGAALGMILVHPELMSAYDYPKALEAGKE........
PTG3C_STACT/13-344---------MMEGAGGIIFDNLAIIFALGVAIGL..A.SGDGVAAIAAFVGFIVLNK..TMGMFLGVTPEKA........
A6T5U3_KLEP7/110-395---------MLDMCSSAAFIILPILIGFTAAREF....GGNPYLGATLGGILTHPALTNAWGVAAGFH............
PTFLB_ECOLI/133-409---------VVESIGYLGFTFMIPIMGAYIASSI....ADKPAFAPAFLVCYLANDK.......................
PTMCB_ECOLI/18-278---------FAKIVGPMITYLLPVMIGSTGGHLVGG..KRGAVMGGIGTIGVIV..........................
PTS3B_PEDPE/111-411---------MINAMASAPFTFLPILLGFSATKRF....GGNPYLGATMGMIMVLPSLVNGYSVATTMAAGK.........
PTG3C_MYCPN/40-387---------FIKNGGDVVFANLPILFAIAIAITF.S..QDAGVAGFSAFVFWAAMNG..FMSSLILPFDKAGKIITD...
PTOCB_BACSU/9-346---------IIEQGGWTVFNQMPLLFAIGIPVAL..AKKAQARACLEALTVYLTFNY..FVSAILTVWGGAFGV......
PTJC_BACSU/29-359---------KLAYPVDATFEIMGLVAAFGIAYRLAEKYGVDALS..AGAISLAAFLLATPYQVPFMPDGATK........
PTYBC_ECOLI/118-401---------FMKVFSKGLFTFLVILVGYNAAQAF....GGTGVNGAIIAALFLLGYNPAATTGY................
Q9K614_BACHD/26-350---------SFSIASSATMGMMSVFVAFGIGYYLSKSYNVEAIF..GGAIALVSFFILTPFMVETEAGEV..........
PTF3A_MYCGE/303-598---------WLNKLGGISFSLIVPILSAYIAYAL....VSRQGLLPGFVVGLISSGQ......FLLNIVLT.........
P94470_GEOSE/110-394---------LLDMFSSAAFIILPILIGFSAAKEF....GGTPFLGAVIGGIMTHPALLNPWGLAEAKPN...........
Q45579_BACIU/119-390---------ILTVIGSGLFTYLGILVGINASKEF....GGTPALGALAGILIINPE........................
Q9KSH4_VIBCH/35-354---------IIMMPFNMSMGIMTIFVSLGVAYSLAKAYKMDGIT..SAVLSLMSFLLVAAPA..................
PTG3C_BACSU/13-354---------VMESAGQIVFDNLPLLFAVGVAIGL..A.NGDGVAGIAAIIGYLVMNV..SMSAVLLANGTIPSDS.....
F0LVD8_VIBFN/11-324---------FLIKAGAAIIDNMSWLFAVGVAYGM..SKDKDGAAALAGLVCMYVVTTLLSPGAVAQIQGI..........
A5LK37_STREE/28-353---------WMRKVYMLTMGVLGIIVSGTVGKSLVGNVNRKMPH..GKVINDISAMLAAICSYLVLTVTLVV........

PF13303

C4Z6R4_EUBE2/32-372-------...........................LGGAGGPLAVYFVAIIAAEAGKMIS.-----.KETKIDILV-----
A8FGC2_BACP2/18-332-------.............................ELGGPAGSFVAALIGVEIGKLVS.-----.GETKIDIIL-----
Q5WEA3_BACSK/19-333-------.............................VYGGPAGSFLAAVVAAETGKLVF.-----.GSTKVDILV-----
B9DKL9_STACT/10-331-------...............................GGAVGAFVATLIATELSRFYA.-----.AKTKIDIII-----
B1YKF4_EXIS2/16-335-------...............................GGPAGSYVAAVIATEIGKLIS.-----.KTTRLDIIL-----
Q03V93_LEUMM/32-373-------TSAVSPAT..HTATGWVADQAAGSL..VMTSGQPVSAVLAALLAVLVGNWLT.-----.GKTPLDMML-----
B9E8P3_MACCJ/18-343-------....................VDGAF..TIQTGLPIGAIIGAIVATYVGKKVT.-----.GKTILDMMA-----
Q5WK09_BACSK/10-334-------....................VEGLP..VLAPGQPVSAVIAAVAATYVGKRIT.-----.GKTKLDMMA-----
B1YJH3_EXIS2/10-334-------...................TDAGL...VLVPGQPISALLAAAVAVFVGKRMT.-----.GKTKFDMMV-----
C3PGV6_CORA7/34-371-------..................NPEGGFF..LKGTGLVINSGITAAIAVGLLLFIG.-----DRLKNYSILL-----
C4LGW0_CORK4/38-376-------...................INSDEFLQLKGTGLVINTGLTAAFAVIMILLIG.-----DRLKSYTILV-----
C4L4Z6_EXISA/15-349-------...................DEGAFV..MAGIGDVITAGVTAAIATLLVMKLA.-----PHLKTYTVIV-----
Q036G8_LACC3/10-344-------...................TKTGLT..VAGTGDVINLAITLAIGYLLIVLLG.-----DALKAYTILL-----
D1AVH7_STRM9/11-347-------....................VDGVL..KIGLGDLINVMLIAGIAAYVTMLLG.-----EKLGSLTIVL-----
Q1GB97_LACDA/16-354-------VTTT...........VKGVTTTSFQ..LAGMGDVINTMLTAAVAVLFIKWVG.-----NRFGSLGIVF-----
Q6LQ05_PHOPR/28-337-------...........................MIHLG.ILEGFIVGYLFSFIAPLFKK-----YLAEGIDVIL-----
Q8XP04_CLOPE/28-342-------...........................CSGLG.ILPGFIAGYLMSFVVKFLEE-----KLPSGLDLIV-----
Q2G165_STAA8/1-310-------...........................CGGM.DLLPGFFAGYMIGYVMKYTEK-----YVPDGVDLIG-----
C4L1G3_EXISA/28-337-------...........................VSGFG.ILPGFFAGYILALAGTRINR-----YLPTGVDMIF-----
A9NFH9_ACHLI/27-386-------..................FSMPGWFDPVKVSNNPITAYFVVIGAYFAIQAIF.-----RKKTAYDLFF-----
Q4FQB6_PSYA2/23-363-------MAGNL.........FIAQEAGPATF..AALPGNPIGAYLASVFAYRAGTWVA.-----.GKTKLDILL-----
D1ARE5_SEBTE/14-338-------....................GGSSY..ILASGEPVGSLAASVAGALASKAVF.-----.GKTKCDIIV-----
A8MEB1_ALKOO/15-347-------...................TEQGVF..AIIVGEPVGAFIAALMGAEVVKWIA.-----.GKTKVDIVL-----
B2A7K6_NATTJ/25-344-------.............................DLGGPAGALIAAVLGAEFGKIVS.-----.KETKVDIVV-----
C7RED4_ANAPD/18-331-------.............................ELGGPVGVFLATIFGVEFGKLVS.-----.KSTKLDIII-----
A0PXE9_CLONN/19-346-------...................TSNGVQ..MIGIGDLINTMLVACIAVYFVRLIG.-----NKLKSLTILL-----
B2GDR1_LACF3/19-361-------VQTASTATAMQSVGGAAHPLVVGNA..VFSTGQPVSAVAAALLAALLGKWLS.-----.GKTPLDMVL-----
F4BRJ2_CARS1/10-335-------...................TADGMI..TIATGEPIGCLIAATIATFVGKRIS.-----.GKTPLDMMA-----
F5WSR4_ERYRF/12-343-------...................VEGAWV..LKGTGDLINTMLTVAVAILIIRWYN.-----NRIPNLAIVI-----
Q03W61_LEUMM/33-377-------TDKAVEGV...TATGYAGAQAAGSA..IMTTGQPISAVMAGVIAVLFGKWLS.-----.GKTPLDMVI-----
Q1GBH7_LACDA/16-349-------...................KNGLIM..VAGTGDVINIGLTITLAILLIKLIG.-----NKLGSYTTIL-----
Q2FV51_STAA8/15-348-------...................KNGAWM..ITGIGDLINTMITAAIAVLFILLIQ.-----HRVGSMALIV-----
Q56343_TREPA/13-343-------...................QNGAWL..ITGIGDVINVMLISALAIILVRALR.-----GKLGSLTIIA-----
Q5FLN1_LACAC/11-342-------...................KNNQII..LSGSGDVINIALTIFIAAIMVKYLT.-----PRLGSYTILI-----
Q81XJ8_BACAN/10-333-------...................TEAGL...IIKTGEPIGALLTATLAVYIGKRLS.-----.GKTALDMML-----
Q834J3_ENTFA/18-343-------N.................SEVKGFI..GAGTGDIINIMITASVAVLLLLVID.-----KKFGSVEIIA-----
Q839R1_ENTFA/29-330-------...........................LIKVS.LLPAFITAYLLSFVVEQMQK-----RIPEGIDLLV-----
Q8XMA5_CLOPE/20-350-------...................TEAGVQ..MVGIGDLINIMLVSCIAVFVIRLIG.-----NKLGSLTILL-----
Q8Y5C0_LISMO/10-334-------...................LAGGGV..AITSGEPVGAILAVIVAVWTGKRVT.-----.GKTKFDMIL-----
Q9A0B4_STRP1/15-348-------TEVI...........QKGVATGTFQ..LRGIGDLINMMITASLAVLAVKYFG.-----NKFGSLTIIL-----
Q9A1Q9_STRP1/29-336-------...........................VSGTG.IIPGFVAGYVVSFLIKWMEK-----NIPGGLDLIS-----
R5FBU1_9CLOT/24-338-------.............................ALGGPVGALVATIVAAELGKIVS.-----.KETRLDIIV-----
R5J6K1_9FIRM/19-358-------ANG............KIINSFGQLI..IKGSGDPLGAFIAVVIAAEVGRLVS.-----.GKTKIDIIV-----
R6FZL0_9FIRM/39-416-------...........................LGGSGGPLAVLFVAILACEAGKLVS.-----.KETKIDILV-----
R6RMS6_9FIRM/1-317-------...........................AAGPSAFLCSFLAAFTAIELSRLFV.-----.KKTRFDLFL-----

PF02378

O50980_BORBU/28-365...IQPN..................SWFPVIDARYFSAQGVFTAIIAAIFSVEVYKFLVQKNMAIKLPESVPPAV.....
O51143_BORBU/17-354...TMSS..................VGRINFFGVQTLNTGIAGSLAVGLLVGYLHNKFYN....MKLPKPFVFFS.....
PTU3C_STACT/16-359...GAK.TLGQ..........SAKDPAHALVLGIPTLQTGVFGGIIIGALAAWCYNKFYN....IQLPQFLGFFA.....
PTIBC_ECOLI/111-396..........................EHVEFALIPVTAVKYTYTVIPALVMTWCLSYIER.WV.....DSITPAVTKNFL
P94865_LACCA/25-344..........................LKTGVDLTYMGTQGLICAYIVGLIVPNIYYVCIKNNVTIKLPAQVPGNI.....
PTEC_BACSU/26-350..........................ITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQKNLTIKMPAGVPPAV.....
Q9CHB4_LACLA/26-390GNLTGTQATAAFEKLPHAMQVFLNNPVTGVLNLTWNGGQGMIAAIIIGILSGWAYSAMMKAGWKITLPEQVPSNV.....
PTG3C_MYCGE/28-366..GYNI.LYWK..........AVPQSAIASTLGLNSLSTSVFGGIIVGALTAYLYNKFYA....IRLPDVIGFFS.....
O07656_ECOLX/14-353....AD.QM..............STHGQTIILGIQSYNTSVLGGIVAGLLVASMYKKIVN....LRIPESLGSYS.....
PTOCB_ECOLI/19-361....DA.AV.............LKANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHN....IRLPDALAFFG.....
Q97EZ1_CLOAB/28-347..........................IKGGFSSDFMGTKGLLSAFVVAFIVPNIYKLFVKNNVTIKLPEEVPHNV.....
PTLCB_STAAU/29-349.........................AKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNI.....
Q97M14_CLOAB/28-372....IV.MK.............HADKVQSVIPKAWTGGKGMIAALIIGVLTGYIYSWFLKRDIRIKLPESVPSGV.....
L2MUH8_ENTFC/107-385...........................GLELFGIGLPQITYSNSFIPILLAIWFMGYVTK.VVKRVIPNTLQYFL.....
YWBA_BACSU/29-359.......S................IMVGGGIPITLLGSKGLFVAMLIALFSTEIYRYIIQKNIVFKMPDGVPPAV.....
Q9CJ32_LACLA/29-420.AATDK.LNGVL.......GDQGLAAWKPLFASAHLDAGAYFTVIIMGALAVIIYAKLMLADITIKMPESVPPAV.....
Q9ZHJ9_CLOBE/108-393.........................I.NLTILGLNIPVVGYQGSVLPALVLGIIAAKTQK.ALKKVVPDVLDLIV.....
PTMCB_BACHD/19-279..................................GADIPMFIGAMIMGPLGGFLIKKVDQ.VLQPKVRSGFEMLVN..NF
E2XFH0_SHIDY/13-320...........................AEEIASKHLADTGVLGGIISGAIAAYMFNRFYR....IKLPEYLGFFA.....
Q9K7V5_BACHD/18-254..................................GAELGGPAGSFVAALLATEVGKVVAG....................
PTXC_ECOLI/9-347...DFT.QDA............VAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFD....KKLPVFLGIFQ.....
PTS3B_STRMU/111-420....TI.GA..............YTG.FWNIFGLHVTQASYTYQVIPVLVAVWLLSILEK.FFHKRLPSAVDFTF.....
O51590_BORBU/12-348.....S.F...............SSGAVGFVLGIKTLETGVFGGVVVGILTYYLHSRFNK....VDLPKVLGFFS.....
K7DWE1_LACLC/28-348.........................AKEGGFLTAFMGTKGLLTAFIAAFVTVNVYKVCVKNNVTIRMPEDVPPNI.....
O51000_BORBU/18-378.KALLE.LGMPET......AATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHN....IQLPTFLAFFG.....
PTWCB_BACSU/9-293............................ATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKD....TKLPEYLGFFS.....
G6R7L8_STREE/29-359.....Q.V...............KQLFGGAIPFSSLNASSLFMAITIGLVTAEIYRMFIQRGITIKMPSGVPDVV.....
P96159_VIBFU/17-357....QS.ER..............VAYGVKNIIGIESIDTGILGAVVVGVIVAKLHQRFYT....FKMPDALAFFG.....
Q98R81_MYCPU/304-616.........................NYGLSPDKVLETGSGFVGAILGGFFAATMLILMSK.YIFSKLPKNLYGIR.....
PTW3C_ECOLI/11-300............................AMVTINPEINMGVLAGIITGLVGGAAYNRWSD....IKLPDFLSFFG.....
PTW3C_BACSU/13-314..........................QPPYEGAEHLIDMGVFGGIIIGLLAAYLYKRFSS....IELHPVLGFFS.....
PTSBC_STAXY/110-413........................IP.HWNLFGLEINQVGYQGQVLPMLVATYILATIEK.GLRKVIPTVLDNLL.....
PTG3C_STACT/13-344.....A.D...............AATGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYN....ISLPSYLGFFA.....
A6T5U3_KLEP7/110-395...........................TMNFFGIEVAMIGYQGTVFPVLLAVWFMSMVEK.RLRRVIPDALDLIL.....
PTFLB_ECOLI/133-409..............................ALLGTQSGAGFLGAVVLGLAIGYFVFWFRK.V...RLGKALQPLL.....
PTMCB_ECOLI/18-278..................................GAEIPMFLGSMIMGPLGGLVIKYVDK.ALEKRIPAGFEMVIN..NF
PTS3B_PEDPE/111-411........................MV.YWNVFGLHVAQAGYQGQVLPVLGVAFILATLEK.FFHKHIKGAFDFTF.....
PTG3C_MYCPN/40-387TSTPIA.GFKVLY......NKSVPVHAIATTLGLRTLSTSVFGGIIVGALTSVLYKKFYA....IRLPDVIGFFS.....
PTOCB_BACSU/9-346...DMN.QEV............GGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFD....KKLPDFLGIFQ.....
PTJC_BACSU/29-359.......E................IMVGGGIPLSLMGSKGLFVAMIIAMVSTEIYRLIIQRNLVFKMPDGVPPAV.....
PTYBC_ECOLI/118-401...........................YAGFHDFFGLPIDPRGNIIGVLIAAWACARIEG.MVRRFMPDDLDMLL.....
Q9K614_BACHD/26-350..........................VQGVIPLDRLGAKGMFLAMMTAFLSAEIYRRIVQRNITIKMPPGVPPAV.....
PTF3A_MYCGE/303-598.........................NGTIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQN.YIYKKLPQSLQGIK.....
P94470_GEOSE/110-394...........................YMHFLGFDIAMVGYQGTVVPILLATYVMCKIER.GLRNVVPHTVSLLV.....
Q45579_BACIU/119-390...........................IAKISLFGEELLPGRGGLIGVLFAAIFIAYTEQ.FIRRFIPQSLDIIV.....
Q9KSH4_VIBCH/35-354..........................KEDSLSMAHMGGTGIFTAVMCAFFAVELYRFMKKHNITIRMPEQVPPAI.....
PTG3C_BACSU/13-354...VER.AKFF..........TENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYT....IELPQYLGFFA.....
F0LVD8_VIBFN/11-324..........................AASEVPAAFSKIQNQFVGILVGIISAEIYNRYSA....VELHKALAFFS.....
A5LK37_STREE/28-353.....D.E................KTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIKRDITIHLPKEVPGAI.....

PF13303

C4Z6R4_EUBE2/32-372TPLVTIGVGTGVAAL.IAPALGKAAMKIGELIML-----------ATNLQPFLMGIAVSVLVGIALTLP.ISSAAICAAF
A8FGC2_BACP2/18-332TPLVTIITGFFTATL.IGPGIEAMMTGLGRLIMW-----------GTDQSPLIMGMLVATIVGLALSSP.ISSAALALML
Q5WEA3_BACSK/19-333TPIVTIMSGFAVAWL.LGPAISFVMESISGAIAW-----------ATDQQPLMMSIVVAILMGWALTAP.ISSAAIGLML
B9DKL9_STACT/10-331SPLLTLIIGGAVAKF.IGPFLNDFMVSLGKMIML-----------ATDQRPLIMGILVAVIFGLALTAP.ISSAALALML
B1YKF4_EXIS2/16-335TPFITLLIGFVSGKY.VGAWIGTLMTDLGEIIRW-----------GTEREPLVMGIFVATVMGLALTAP.ISSAALGIML
Q03V93_LEUMM/32-373VPLGAVLAGTFFGLA.TASVTTPFLNWVSEELAS-----------TMKINPFLGAFVVAVVWFLFLMTP.ASSAALAIAV
B9E8P3_MACCJ/18-343VPVSAVLAGSLVGYY.LARVVEPALVVISKSIAQ-----------SVEGQPLISSVVIALVFAVIVMTP.ASSAALVIVL
Q5WK09_BACSK/10-334IPFSGIFVGGLVGLV.MAAVTTPMLEWISAQLAT-----------SVQGSPIIAPMAIALTWSILLMTP.ASSAALAIAL
B1YJH3_EXIS2/10-334IPVSAVLAGGFTGLG.AAAVTTPLLTRFSAMVTA-----------SVESSPIATSLVIALIFSVLLMSP.ASSAALAIAL
C3PGV6_CORA7/34-371LSTIVTLVAGTIGWAVTFPIVKVFTLWLGNLVNG-----------ATTLQPVLMGVVLAVLFAIMIVSP.VSTVGIATAI
C4LGW0_CORK4/38-376LPPTVIVIAGGLGKFVTYPAVLVFTKWLGNLVVG-----------AADLQPIVMGLILGIAFGVMMASP.ISTVGIATAI
C4L4Z6_EXISA/15-349MPMTIIVVAGGIGTF.LLTYISQITTYIGLLIMT-----------MTDLQPVLMGILIAMAFSLIIVSP.ISTVGIATAI
Q036G8_LACC3/10-344IPSLVLVIAGGIGML.TLGPVSSITKYIGVVVHD-----------VTALQPIVMGVLMGIIFAVLIVSP.ISTVGIATAI
D1AVH7_STRM9/11-347QPIIVGVGVGFLGLL.MLPYVKHISTTIGYGINS-----------FTTLQPILMCILIAMSFSILIVSP.ISTVAIGIAI
Q1GB97_LACDA/16-354FPILAGTGVGFLGSL.IKPYVSLVTTAIGDVINT-----------FTKLAPYSMCILIAMSFAIIIVTP.LSTVAISVAI
Q6LQ05_PHOPR/28-337GVLILAPLARLVGFF.ISPALDLLMGTLANMITE-----------ATSLSPLIMGFLLGGLIKMVCTSP.LSSMALTAML
Q8XP04_CLOPE/28-342IIVVATPLTRIIGDF.TAPVVDSTLLKIGQVLIA-----------SANSNPITMGIILGGIITVVATAP.LSSMALTAML
Q2G165_STAA8/1-310SIVILAPLARLIAVL.LTPVVNSTLIRIGDIIQS-----------STNTNPIIMGIILGGIITVVGTAP.LSSMALTALL
C4L1G3_EXISA/28-337YVIVMAPLARLVATG.VDPLVTNTLEQIGAVIEL-----------AATQNPVVMGLVLGGIVTVVSTSP.LSSMALTAML
A9NFH9_ACHLI/27-386IPIVGILSAVLVTYL.ISWPIDRFMEMIYSTIKF-----------FMQLEPFVTSAFVALIFGILLTLPFISSAGVAIAV
Q4FQB6_PSYA2/23-363VPLLVCAVALAVCAL.LNPPVVAVVNAIGQGIQA-----------ATTLQPLLMGIVIAVVVGILLTMP.TSSAAICIAI
D1ARE5_SEBTE/14-338VPGITIIAGGVISIF.ASPYISRFMMLIGNIINK-----------STNLNPLPMGILVALIMGIIITSP.ISSAAVAISL
A8MEB1_ALKOO/15-347VPAATIVMGGVAGTF.IAPSIASIMKILGNVINT-----------VTELHPIPMGILLSVLMGMILTLP.ISSAALSISL
B2A7K6_NATTJ/25-344TPAVTILVGVLAGSL.VGPGVDALMRGLGVIIME-----------ATEMQPVPMGIIVAVVIGLTLTFP.ISSVALTIML
C7RED4_ANAPD/18-331TPSVTIIVGILVGDL.IGPYVASFMKAIGLFIMK-----------ATELRPFFMGIVVAFTIGMALTLP.ISSAAICMML
A0PXE9_CLONN/19-346LPIVGAAVG.VIGII.TLPYVRQITVAIGNVINN-----------FAVLQPLLMCILISVSFSILIISP.ISTVAIGIAI
B2GDR1_LACF3/19-361VPMVVSFVGTFVGFG.LASVVTPALTATSAWIAA-----------SIKVNTVLGSMVISAVWALFLMTP.ASSAALAVAL
F4BRJ2_CARS1/10-335IPITAVLAGGVAGYY.LNLVIAPFLNMVSAFISA-----------SVAGSPIIGAAVISVIGGLVLMSP.ASSAAIAIAL
F5WSR4_ERYRF/12-343TPIIGGVIPGFIGLL.TLPYVGKITGLLGSLIAN-----------FTTLQPLLMMILIAVCFALIIVTP.LSTVAIAYAI
Q03W61_LEUMM/33-377VPAATTIVGTVSGYY.LAAVTTPALVAIGKFIAS-----------SVAVNPIIGTAIVAMAFGAMTMTP.ASAAALAVAI
Q1GBH7_LACDA/16-349LPIIVLVVGGGIGLL.ILPYVKTVTTFIGMIVMA-----------FTKLQPLLMGVLIGMSFAAMIVSP.ISSVGIAVAI
Q2FV51_STAA8/15-348FPTVVGGISGAIGVL.ILPYTKMITTAIGNMVNG-----------FTELQPIVMSILISMVFSLIIISP.LSTVAIAFAI
Q56343_TREPA/13-343LPVIVAVVAGGVGSF.SLPYVKMITLFVGRVIAT-----------FIALQPLLMSILLSMSFSLIIISP.VSSVAVGIAV
Q5FLN1_LACAC/11-342LPLAVAVLAGGIGQL.MLPYTKLITGMIGNVVAG-----------MTDFQPLIMGMFMGVAFATLVITP.VSSVGIAMAI
Q81XJ8_BACAN/10-333VPFAAILGSGLVGIW.LSHNITPVLNAVGAFIKD-----------SSAGSPFIASIVIAVVWGLLLISP.ASSAALAIAL
Q834J3_ENTFA/18-343LPIVVGVGAGLFGML.IYPYVTQITVAIGKVINN-----------FTDFQPIIMSILIACSFAALIISP.ITTVAIGLAI
Q839R1_ENTFA/29-330VILVIPVAASLVAGF.IQPVVLGVLEVIGGTILS-----------AVDGNPYVMGAILGAIIPIVGMTP.LSSMVLTALI
Q8XMA5_CLOPE/20-350LPIIAGAGVGIIGMF.MLPYVRQITIVIGDIMNN-----------FTTLQPLLMCILISVSFSILIISP.ISTVAIGIAI
Q8Y5C0_LISMO/10-334IPGVSLLAGGLSGIL.FAKIMAPILASVSLGISS-----------LIGGSPLISSMIIAFVFGLLILSP.ASSAALAIAL
Q9A0B4_STRP1/15-348LPITIGTGVGYIGWK.FLPYVSYVTTLIGQGINS-----------FTTLQPILMSILIAVAFSLIIVSP.ISTVAIGLAI
Q9A1Q9_STRP1/29-336IIIVGAPLTRFLAQL.ITPVINSTLLTIGDILTS-----------SANSNPIIMGMILGGTIVVVATAP.LSSMALTAML
R5FBU1_9CLOT/24-338TPGITIISGVLVAQF.VGPGVAGFMNWFGNLVKT-----------ATEMQPFIMGILVSALIGIALTLP.ISSAAICIAL
R5J6K1_9FIRM/19-358TPLVTIITGSLIAVL.LGPRLLYAMKSIGSFIQM-----------ATNLAPFTMGLVISVVMGMLLTLP.ISSAAISIIL
R6FZL0_9FIRM/39-416TPAVTIIVGVGCAMV.LAPIFKTICDSLGTFIGW-----------ATNLQPFFMGIIISVVVGVVLTLP.ISSAAICAAV
R6RMS6_9FIRM/1-317CPLTGFLCGELINLL.LETPLSYFIQEFGNCVNW-----------GAQQQPLLMGIIVAVLMSIAVIFP.IGTAALGVIA

PF02378

O50980_BORBU/28-365LKSFEALIPVV.ALSIVAQSVNIAIQSSLGSLFPEIIMSMFR.PVLQISDTLVGTLTISFIVHILWFCG-LHGTNVIIAL
O51143_BORBU/17-354ECHFVPIVIILPFCVFLAIFFCLIWSSFDDLIASLG...LF....VFRFE.YFGSFLYGFLNRLLLPLG-LHSILSFPFE
PTU3C_STACT/16-359GKRFVPIITSL.VAIVTGIVLSFVWPPVQDGLNNLS...NF....LLGKNLALTTFIFGIIERSLIPFG-LHHIFYAPFW
PTIBC_ECOLI/111-396KPMLIVLIAAPLAILLIGPIGIWIGSAISALVYT...........IHGYLGWLSVAIMGALWPLLVMTG-MHRVFTPTII
P94865_LACCA/25-344AQSFKDLIPMGLSVTA.FWLFGVGFKAATGTVLPRWIIQVLS.PLFQASDSYLGLALIAGAMAFFWFCG-VQGPSIVQPA
PTEC_BACSU/26-350AKSFAALIPAFITLTV.FLLINVMVTLFFKTNMHDVIYHAIQAPLVGLGSGIIPTLIAVFFIQILWFFG-LHGQIIINSV
Q9CHB4_LACLA/26-390ANQFTSMIPTGVIVVAATVVYALFDKIGHTDAVT.FIYHWLSVPLQGLGGSFGGIIIISLLVPFFWFFG-VHGGIIMGAI
PTG3C_MYCGE/28-366GTRFVPIICMT.IAIPVALLLLMVWPGVSILLNLIGTGLGI....LGGRGYGANSLIFGYIERALIPFG-VHHAFYAPLW
O07656_ECOLX/14-353GPRLVPIITLI.VMSGFGLIIPFIWPPFFNLFMLIG...HW....ISTSG.PVGYFFYAVAERVTIPFG-LNHLVTSVFR
PTOCB_ECOLI/19-361GTRFVPIISSL.VMGLVGLVIPLVWPIFAMGISGLG...HM....INSAG.DFGPMLFGTGERLLLPFG-LHHILVALIR
Q97EZ1_CLOAB/28-347AQTFEDLIPLAASVLF.FWLFDLVFRQVTGEVFSSWILDVLK.PLFTAADGYVGLAVIYGAMAMFWFVG-IHGPSIVEPA
PTLCB_STAAU/29-349SQVFKDLIPFS.AVIIILYALDLVIRNSFKSNVAEGILKLFE.PLFTAADGWIGVTIIFGAFALFWFVG-IHGPSIVEPA
Q97M14_CLOAB/28-372SNAFSALIPGAVIITGSMLIFIFF.NIVTGATALEWIYKVLQIPLQGITDSLGGAIAIPFVISFFWWFG-VHGATLIGGV
L2MUH8_ENTFC/107-385TPLLVMLITLPATLLIFGPLGFYMGEGIIGFFNLL..........MKYVGSWFVMMLYSALQPFIIMLG-AGNFIMPVVA
YWBA_BACSU/29-359SKSFVALIPGFIIVLL.VWLARLLIEMTPFQSLHNVVGDLLGTPLSILGGSLGGSLIAEFVQMLLWSCG-IHGASIIGGI
Q9CJ32_LACLA/29-420AKAFLAIIPTIAALYIVGLIYYIIGKLTNDSVIN.LITHYIAEPFQILSQNIFSVLIVTLFVSVFWFFG-LHGPNVLAPV
Q9ZHJ9_CLOBE/108-393TPFITLLFSMVLGLLIVGPIMHNAEQLIFGAIKG...........FMGLPFGLGGLVVGGVHQLIVVTG-VHHALNALEV
PTMCB_BACHD/19-279SAGILAAILAIVAFLGIGPVVVSFSNVLASGVEVIIGAGLLPLASIFIEPAKVLFLNNAINHGILSPIG-IDQAASAGKS
E2XFH0_SHIDY/13-320GKRFVPIISGL.AAIFTGVVLSFIWPPIGSAIQTFS...QW....AAYQNPVVAFGIYGFIERCLVPFG-LHHIWNVPFQ
Q9K7V5_BACHD/18-254ETKIDIIVTPFVTVIVGFLTAQFIGPVIQSGMSGLGATIMW....ATEQRPIIMGIVVATLMGLALTAP-ISSAALAIML
PTXC_ECOLI/9-347GTSYVVIIAFL.VMIPCAWLTLLGWPKVQMGIESLQ...AF....LRSAG.ALGVWVYTFLERILIPTG-LHHFIYGQFI
PTS3B_STRMU/111-420TPLLSVIITGFLTFIVIGPVMKEVSDWLTNGIVW...........LYDTTGFLGMGVFGALYSPVVMTG-LHQSFPAIET
O51590_BORBU/12-348GSRFVPIIVSF.SSIFLAVIMFLVWPFVQSGINKVG...GL....VDSTG.YIGTLIYGIFLRMLGPFG-LHHIFYLPFW
K7DWE1_LACLC/28-348SQVFKDLIPFTVSVVL.LYGLELLVKGTLGVTVAESIGTLIA.PLFSAADGYLGITLIFGAYAFFWFVG-IHGPSIVEPA
O51000_BORBU/18-378GTRFVPIVTTM.AMFVVGIFLTFIWPFIQGAMTSFG...RI....VEQSG.LFGTFAYGAIKRSLIPFG-LHHIFYLPFW
PTWCB_BACSU/9-293GRRLVPILTAI.ITIILAGIFGVVWPPIQSCINSFG...EW....MLGLG.GIGAGIFGLFNRLLIPLG-LHHVLNNIFW
G6R7L8_STREE/29-359SKSFSALLSGFTTFVLWALVLKGLEAAGVAGGLNGLLGAIVGTPLKLIAGTLPGMILCVIVNSFFWFCG-VNGGQVLNAF
P96159_VIBFU/17-357GARFVPIISAL.VLGVVGVFIPFVWPYFAAGINGIG...HV....IESAG.DFGPMLFGTGERLLLPIG-LHHILVALIR
Q98R81_MYCPU/304-616DILFIPILGTLTIAFVF.WVLNIVFIYINYGLTILL.........LIIETRREIIWLLGLILGIMMAVD-LGGPINKAAY
PTW3C_ECOLI/11-300GKRFVPIATGF.FCLVLAAIFGYVWPPVQHAIHAGG...EW....IVSAG.ALGSGIFGFINRLLIPTG-LHQVLNTIAW
PTW3C_BACSU/13-314GKRFVPIITSV.SSLVIGVIFSFVWPLIQNGINAAS.........SLIADSTVGLFFYATIYRLLIPFG-LHHIFYTPFY
PTSBC_STAXY/110-413TPLLAILSTGFITFSFVGPLTRTLGYWLSDGLTW...........LYEFGGAIGGLIFGLLYAPIVITG-MHHSFIAIET
PTG3C_STACT/13-344GKRFVPIMMAT.CSFILAFPMAIIWPSIQGGLNAFS...EG....LLASNTGLAVFLFGFIKRLLIPFG-LHHIFHAPFW
A6T5U3_KLEP7/110-395TPFLTVIISGFIALLLIGPAGRALGDGISFILST...........LISHAGWLAGLLFGGLYSVIVITG-IHHSFHAIEA
PTFLB_ECOLI/133-409GSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHFL.........NTIPPSM..KFAAAFLVGAMLAFD-MGGPINKTAW
PTMCB_ECOLI/18-278SLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSVINEPAKVLFLNNAIDQGVYYPLG-MQQASVNGKS
PTS3B_PEDPE/111-411TPMFAIVITGFLTFTIVGPVLRTVSDALTNGLVG...........LYNSTGWIGMGIFGLLYSAIVITG-LHQTFPAIET
PTG3C_MYCPN/40-387GTRFVPIICFV.VAIPVALILLMIWPAVSIGLNAIGTGLGF....LGGKGYGANSLIFGYIERSLIPFG-VHHAFYAPLW
PTOCB_BACSU/9-346GSTYIVMISFF.IMIPIALAVSYIWPMVQSGIGSLQ...SF....LVASG.AVGVWIYTFLERILIPTG-LHHFIYTPFI
PTJC_BACSU/29-359SKSFVALIPGFAVIFL.IWAARLIVEATPFESLHNIVSVLLGTPLSILGGSLGGSLVAEAVKMLLWACG-LHGANIVGGV
PTYBC_ECOLI/118-401TSLITLLITATLAYLIIMPLGGWLFEGMSWLF.............MHLNSNPFGCAVLAGLFLIAVVFG-VHQGFIPVYL
Q9K614_BACHD/26-350AKSFAALIPAVLTLTV.FLAINVFVSQLFHTNMHDVIYQAVQAPLVGLGSGIIPTLIAIFFIQILWFFG-LHGQVIINSV
PTF3A_MYCGE/303-598NILFIPLFGTLFTAGLF.WVINIPLIYLNYGLSLFL.........NIMNSPI.LAPLLGFVIGLMMCFD-LGGPINKAAY
P94470_GEOSE/110-394VPFVTVISTGFITILAIGPLGNLLGDGITTVLNF...........IYHYGGALAGLIFGGLYSMIVITG-VHHSFHAIEA
Q45579_BACIU/119-390TPTVSLLITGIVTYVVFMPLGGFISDAIASGLLS...........ILDIGGIAAGFILGATFLPLVVTG-LHQGLTPMHM
Q9KSH4_VIBCH/35-354ARSFEVLLPVLAIFLT.LYPLSLFVQAEYGMLIPDAVMAMFK.PLISASNTLPAIIGALLVCQLLWFAG-IHGAAIVVGL
PTG3C_BACSU/13-354GKRFVPIVTSI.SALILGLIMLVIWPPIQHGLNAFS...TG....LVEANPTLAAFIFGVIERSLIPFG-LHHIFYSPFW
F0LVD8_VIBFN/11-324GKRLVPILTSF.VGIVLSFVLMYIWPAIYGGLVHFG...ES....IQGMG.ATGAGIYAFFNRLLIPVG-LHHALNSVFW
A5LK37_STREE/28-353SQAFRDIFPFSFVLLI.SGLLDIVSRFSLDVPFAQVFQQLLT.PIFKGAESYPAMMLIWFMCALLWFVG-IHGPSIVLPA

PF13303

C4Z6R4_EUBE2/32-372GLTG.....................LAGGAAVAGCCAQMV..GFAVMSFKENRWGGLVSQGIGTSMLQMGNIIKNPR.IW
A8FGC2_BACP2/18-332DLSG.....................LAAGAATIGCCAQMV..GFAAAGFRENRFGGLAAVGIGTSKLQLPNIVKNPL.IL
Q5WEA3_BACSK/19-333GLEG.....................AVACAAAIGCAGQMV..GFAVASFRENRFGGLLALGIGTSMLQMPNILKNPL.IL
B9DKL9_STACT/10-331DLSG.....................LAAGAATIGCCAQMV..GFAVTSYKDNGVGGLISVGIGTSMLQVPNILMNPA.IL
B1YKF4_EXIS2/16-335GLDG.....................LAAGAATIGCAAQMI..GFGVISYRDNGIGGFIAQGIGTSMLQVGNIIRNPW.TI
Q03V93_LEUMM/32-373MLDP.....................LSGGAALVGTTAGFV..MYTAMGWKQNDLGANLAQIIVTPKVQFPNLLKSPL.LL
B9E8P3_MACCJ/18-343QLDP.....................ASSAAALVGISAQFV..GYTAMGLKDNDLGGFLAQLVCTPKVQFPNIVNNPK.IT
Q5WK09_BACSK/10-334QMDP.....................ISSGAALIGCTAQFV..GFTLMSWKQNDAGALLAQGLVTPKVQFPNLIKNPR.LC
B1YJH3_EXIS2/10-334QLDP.....................VASAAALIGCSAQFV..GFTLMAYRQTDPGGLIASFFVTPKVQFPNIVKNPR.LV
C3PGV6_CORA7/34-371FIDG.....................IASGTANLGAVAAGF..TLLVAGWRVNGFATSILHVLGSPKVQMANMLSKPV.TF
C4LGW0_CORK4/38-376FLSG.....................IASGVANVGCCAVAF..TMMWAGWKVNGPGGSLVHVVGSAKVQVANMMRRPV.AL
C4L4Z6_EXISA/15-349SLSG.....................VAAGAANLGVVAAGF..GLAIAGWQANATGTSIAHFLGSPKIQMANFVRRPI.MM
Q036G8_LACC3/10-344SLTG.....................IGAGSANLGIVGAGF..ALATYGWKANSFGTSLAHFLGSPKMQMANILSRPK.LF
D1AVH7_STRM9/11-347GLSG.....................LASGSANIGVSATAA..VLVIGSWAVNKAGVTIAVGMGGMKMMMPNIVKNPI.MI
Q1GB97_LACDA/16-354GLAG.....................MGSAAAGFGLASTAA..FLFWATLKVDKPGVQVAIFLGVIKMMMPNFLRYPV.IG
Q6LQ05_PHOPR/28-337GLTG.....................LPMGIAAMACVGGSFTNGYVFHTLKLGKSCNTVSVML.EPLTQAHIVTRNPVPIF
Q8XP04_CLOPE/28-342GLTG.....................APMAIGALSVFGSSFLNFVLFQKMKFGSKKDTISVAI.EPLTQADIITANPIPIY
Q2G165_STAA8/1-310GLTG.....................VPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAVSI.EPLSQADIVSANPIPIY
C4L1G3_EXISA/28-337GLTG.....................VPMAIAALALTASISMNYLLFRQLKIGTKKDQLSVAI.EPLTQADLISANPIPIY
A9NFH9_ACHLI/27-386FSVPFGVGNAL......AIPDPIAIAAMCAAAIGCSTQMV..GFSVQTLRKNNLGSIFTVGLASSMFQFKNVMRKPI.VW
Q4FQB6_PSYA2/23-363GLGG.....................VAGGAAVVGCAAHMI..GFAVASFKDNGISGVVSQGLGTSMLQIPNVLRKPI.IL
D1ARE5_SEBTE/14-338GLSG.....................LSAGAATIGCACHMV..GFAVAGYKDNGFNGLISHGLGTSKLQMANSIKNPL.IL
A8MEB1_ALKOO/15-347GLNG.....................LAAGAAVVGCCTQMV..GFAVASYKENGIGGLIAQGLGTSMLQVPNIIRNPF.VW
B2A7K6_NATTJ/25-344DLEG.....................LAAGAAAVGCASQMI..GFAVASYKENGVGGLIAQGLGTSMLQIPNVVSKPK.LL
C7RED4_ANAPD/18-331SLEG.....................LAGGAATVGCCAQMI..GFAVISYKDNGLEGLLAQGLGTSMFQVPNIIKNPW.IW
A0PXE9_CLONN/19-346GITG.....................LGAGAAAIGVAACTA..VLVIGSRLVNESGVTLSVLLGAMKMMMPNLVAYPI.IA
B2GDR1_LACF3/19-361TLDP.....................ISAAAAAIGTTAQFV..GYTAMSWRQNTPGANIAQFVVTPKVQFPNLILNPW.QM
F4BRJ2_CARS1/10-335NLDP.....................VSSAAMLVGTTSMYI..GFSFVSMRQNNLGGFLAQFVCTPKVQLPNIVKNPR.IL
F5WSR4_ERYRF/12-343SLAG.....................LGSGAANVGIAATVF..TLAYGSSKVNNKGTTFALFFAGPKMLMPNYLKNPI.MS
Q03W61_LEUMM/33-377GATGVT.................SPEAAGAILIGTTAVFV..GFPAMSFHENKIGATIAQGIVTPKIQFPNLTENPA.LI
Q1GBH7_LACDA/16-349GLTG.....................VASGAANLGITGAAY..TLGIMSYSVNGMGTTLAHFIGTPKIQMTNMLEKPK.LF
Q2FV51_STAA8/15-348GITG.....................LAAGSASIGISATEA..VLIIGTSKVNRLGVPLSVFFGGVKMMIPNMVKYPI.LM
Q56343_TREPA/13-343GLTG.....................LASGAANIGVSSCAM..TLIVGTMRVNKIGVPLAMFAGAMKMLMPNWIRYPI.LN
Q5FLN1_LACAC/11-342GVEG.....................IASGSANLGITAGAF..TLAIMSSKVNGFGTTIAHFLGTPKIQMANVLKNPK.LF
Q81XJ8_BACAN/10-333SLDG.....................VAGGAALAGCVAQFI..GFSVISAKENNLGGILAQALCTPKVQLPNITKNPM.IL
Q834J3_ENTFA/18-343QLNG.....................LSAGAAAMGIAATTV..VLVINSWNVNQSGVTLAVSLGGMKMMMPNLFKYPI.IL
Q839R1_ENTFA/29-330GLTG.....................VPMAVGALTCYGSSIVNAALFKKLKLGTASTPLAVAI.EPLTQVDIISSNPIPIY
Q8XMA5_CLOPE/20-350GITG.....................LGAGAAAIGVTACTA..VLVAGSRRVNQSGVTLSVLLGAMKMMMPNLVEYPI.IA
Q8Y5C0_LISMO/10-334QLDP.....................TASAAALIGCSVQFV..SFAVLSYRDNNWGAFFAQLICTPKLQTPNIIRKPS.LM
Q9A0B4_STRP1/15-348GLNG.....................MAAGAASMGIASTAA..VLVWATLKVNKSGVPIAIALGAMKMMMPNFLKHPI.MA
Q9A1Q9_STRP1/29-336GLTG.....................IPMAIGALSVFGSSFMNGVLFYRLKLGERKDNIAFAI.EPLTQADVTSANPIPIY
R5FBU1_9CLOT/24-338SLDG.....................LAGGAATAGCCAQMI..GFAVMSYRENKIGGLMAQGLGTSMLQMGNIVPNPR.IW
R5J6K1_9FIRM/19-358GLSG.....................ISAGASAVGCCSQMI..GFAVITYHVNGLNGALANGLGTSMLQVPNILKKPV.IW
R6FZL0_9FIRM/39-416GISGGAVIAGVVDGSISMEVWNGLALAGGAATVGCCCNML..GFAVISYPDNGVGGLVAQGLGTSMLQVPNLMRKPV.LW
R6RMS6_9FIRM/1-317GLSG.....................PAAGAATIGCCCSMV..GMAVASYRENGFSGLLSIGTGTPLLLLPNILKNPF.LL

PF02378

O50980_BORBU/28-365LNPI------------..........ILSNLDSNIRALS.........DNL................PLPHILAGGFLDS
O51143_BORBU/17-354FTSL------------..........GGVEIVNGDTVRG.........LKNIFYAQLLDPSLGKFSSGFAKISSGFYLS.
PTU3C_STACT/16-359FEFG------------...........HYVNESGNLVRGDQRIWMAQYQDGVP.............FTAGAFTTGKYPF.
PTIBC_ECOLI/111-396QTIA------------ETGK..EGMVMPSEIG................................................
P94865_LACCA/25-344VVPI------------..........MIANTAANLQQYQ.........AGQ................HVSHVLAMNT.MD
PTEC_BACSU/26-350MDPI------------..........WNTLQVENLSAYT.........AGK................EIPHIISKPFMEI
Q9CHB4_LACLA/26-390TSAF------------..........LIPNTFANASLYQ.........SHKLS............LANGAHIVTNEFYNN
PTG3C_MYCGE/28-366YTSA------------..........GGSLQEIANQQVWI.......R.......................APGSDYVT.
O07656_ECOLX/14-353FTPI------------..........GGSAVIGGEEYYGTLNMFMAYVKENAVI...........PLDLAGKMEQGKLM.
PTOCB_ECOLI/19-361FTDA------------..........GGTQEVCGQTVSGALTIFQAQLSCPTTHG........FSESATRFLSQGKMPA.
Q97EZ1_CLOAB/28-347VTAI------------..........YIANVEANLKLHQ.........AGH................HATYVLTHGT.SY
PTLCB_STAAU/29-349IAAI------------..........TYANIEANFKLLQ.........AGE................HADKIITSGT.QM
Q97M14_CLOAB/28-372MNSI------------..........YQANTLANQDVFK.........AGHKLIA........SGAGKNAHIVCQQFQDN
L2MUH8_ENTFC/107-385SLIA------------AN.....GYDPAFISS................................................
YWBA_BACSU/29-359MAPI------------..........WYGAMDANRLAFQ.........AGE................ALPSIFTTQFFQI
Q9CJ32_LACLA/29-420LDGI------------..........WGPLGLNNQALYFQV....HSQGIRDLIA........KGAVDKAHAINGDYVNL
Q9ZHJ9_CLOBE/108-393ELLS------------ST......GKDAFNAM................................................
PTMCB_BACHD/19-279ILF.------------................................................................
E2XFH0_SHIDY/13-320MQIG------------...........EYTNAAGQVFHGDIPRYMAGDP...................TAGKLSGGFLF.
Q9K7V5_BACHD/18-254ELSG------------................................................................
PTXC_ECOLI/9-347F...------------..........GPAAVEGGIQMYWAQHLQEFSLSAEPLKS.........LFPEGGFALHGN..S.
PTS3B_STRMU/111-420QLIS------------AFQN.GTGHGDFIFVT................................................
O51590_BORBU/12-348TTGL------------..........GGSVIIDGKLIEGTQNIFFAELAAQGTDR.........FFIGTSRFMSGRFIT.
K7DWE1_LACLC/28-348IAAI------------..........TYANIDVNLHLIQ.........AGQ................HADKVITSGT.QM
O51000_BORBU/18-378QTAV------------..........GGTLEINNELISGAQNIFFKQLADPNTVH........FEVAKGTRFFSGEFVV.
PTWCB_BACSU/9-293FQFG------------................EYNGVTGDLARFFAKDPT..................AGTYMTGFFPI.
G6R7L8_STREE/29-359VDPV------------..........WLQFTTENQEAVA.........AGQ................TLQHIITLPFKDL
P96159_VIBFU/17-357FTEA------------..........GGTMDVCGQTVSGALNIFYSELSCADTTT........FTPEVTAFLSQGKMPT.
Q98R81_MYCPU/304-616VFGT------------LTLAQMQGKGTIAMAS................................................
PTW3C_ECOLI/11-300FQIG------------...........EFTNAAGTVFHGDINRFYAGDGT..................AGMFMSGFFPI.
PTW3C_BACSU/13-314FMMG------------..........EYTDPSTGNTVTGDLTRFFAGDPT..................AGRFMMGDFPY.
PTSBC_STAXY/110-413QLIA------------DSS...STGGSFIFPI................................................
PTG3C_STACT/13-344FEFG------------...........SYKNAAGQIIHGDQRIFIEQIRDNVP.............LTAGKFMQGEFPV.
A6T5U3_KLEP7/110-395GLLG------------NPS....IGVNFLLPI................................................
PTFLB_ECOLI/133-409FFCF------------SLL...EKHIYDWYAI................................................
PTMCB_ECOLI/18-278IFF.------------................................................................
PTS3B_PEDPE/111-411QLLA------------NVA...KTGGSFIFPV................................................
PTG3C_MYCPN/40-387YTSA------------..........GGSLQEIVNQQVWI.......R....................PDFHLSDNYVA.
PTOCB_BACSU/9-346Y...------------..........GPAVAEGGIVTYWAQHLGEYSQSAKPLKE.........LFPQGGFALHGN..S.
PTJC_BACSU/29-359MAPI------------..........WYGAMDANRIAFQ.........AGE................ELPKIFTQQFFDI
PTYBC_ECOLI/118-401ALMD------------SQ......GFNSLFPI................................................
Q9K614_BACHD/26-350MDPI------------..........WNTLMIENLEAYT.........NGE................PVPNIISKPFIEI
PTF3A_MYCGE/303-598VFGV------------VSLQ.NQNAGTISMAA................................................
P94470_GEOSE/110-394NLLA------------KL......GVNYLLPI................................................
Q45579_BACIU/119-390ELIN------------SI......GNDPLLPI................................................
Q9KSH4_VIBCH/35-354LSPI------------..........FLTNISANIDAFV.........TGQ................PVPNIFTQPFWDF
PTG3C_BACSU/13-354YEFF------------...........SYKSAAGEIIRGDQRIFMAQIKDGVQ.............LTAGTFMTGKYPF.
F0LVD8_VIBFN/11-324FDVA------------....................GINDIPNFLGGAKSIAEGT........GIVGVTGMYQAGFFPI.
A5LK37_STREE/28-353VTAL------------..........QLSNMEENAQLLA.........NGQ................FPYHSLTPNF.GN

PF13303

C4Z6R4_EUBE2/32-372IAP------IVTSAITGPMATCL.......FKLQMNGTPVSS...GMGTCGLVGQIGVYSGWIADIANGTKAAIT..GFD
A8FGC2_BACP2/18-332IPP------TVAGLILAPIGIIG.......FGMV..NNAAGA...GMGTSGLVGQLMTLT........VM.GFHP..SV.
Q5WEA3_BACSK/19-333IPP------TIAGAVSAPIGTIW.......FGLI..NNAAGS...GMGTSGLVGPIMTFT........EM.GYSG..SL.
B9DKL9_STACT/10-331IPP------TVASAIIAPIMTTL.......FPMT..NNAAGA...GMGTSGFIGQIMTIN........TM.GASA..KT.
B1YKF4_EXIS2/16-335VPP------TLAGALLAPFATVL.......LTLE..SNPEGS...GMGTSGLVGPLMMLK........TM.GFEG..EY.
Q03V93_LEUMM/32-373FGP------ALIAGVSAIFAVGI.......FNFK..VPYAIA...GLGLNGFIAPIAL............ATSDP..RG.
B9E8P3_MACCJ/18-343IAP------LVAAAVSGPVAILW.......FKMG..VPYEIG...GIGLCGFIAPMQIL...........NDQGI..VA.
Q5WK09_BACSK/10-334LPP------FAAAIICAPIASLA.......FQFQ..VSYELA...GLGLNSLIAPITIF...........STQGI..TG.
B1YJH3_EXIS2/10-334VAP------FLAAMISAPIATLV.......LSLE..VPYELA...GLGLNSMIAPLNIF...........VNQGF..NA.
C3PGV6_CORA7/34-371LPV------ICSAAVLGGVGGAL........GIS..GTPISA...GFGISGLMGPLAALN.........YEGWGWSAGN.
C4LGW0_CORK4/38-376LPA------IVACGVSGIVAGIF........RVQ..GTPISA...GFGISGLVGPLAALN.........ADGWGWSVRN.
C4L4Z6_EXISA/15-349LPI------LANAAILGALAGIL........KIE..GTPISA...GFGVSGLIGPVNALHL.......MPGGFAL..FN.
Q036G8_LACC3/10-344LPM------AINAGILGGIGAAL........NIQ..GTPASA...GFGFSGLVGPLAALD........AMGSVTV..GN.
D1AVH7_STRM9/11-347LPI------LTTSSISGLVVRIL........GIT..GDKVSS...GFGFVGLVGPIKAMSDY.....AVNGITGL..KA.
Q1GB97_LACDA/16-354IPI------ALTAAISTLSVPIL........GMQ..GTPASG...GFGLIGAVSPLAAY............NAGF..YN.
Q6LQ05_PHOPR/28-337MSN------FIGGAFAGTIAAYF........GII..NDAPGS...AAPIPGLLASIAFN..............PP..ST.
Q8XP04_CLOPE/28-342VTN------FIGGALCGIIIVLM........GLT..NMSPGT...ATPIAGFAVMFAYN..............PA..FK.
Q2G165_STAA8/1-310ITN------FFGGAIAGLIIAMS........GLI..NDATGT...ATPIAGFLVMFGFN..............HP..TT.
C4L1G3_EXISA/28-337SVN------FVGGAIAGLIVAMT........GMI..NDAPGS...AAGIPGLLVMYGFN..............DW..QT.
A9NFH9_ACHLI/27-386APT------LIASFILAPLSYFIFDGYQWFINLIPVGHQFSAVWAGMGTSGLVGILQPL...........TITNF..SLD
Q4FQB6_PSYA2/23-363LPA------VIASAIVGPIATVG.......FELA..CTATGA...GMGTAGLVGVFGVIEA.......SQEIMST..SQL
D1ARE5_SEBTE/14-338VPP------MAASVILGGVGAAI.......FKME..NNKIGA...GMGTSGLVGQFTTF...........EVMGE..KS.
A8MEB1_ALKOO/15-347IPP------TLASAFLGPLSTTI.......IRME..NNSIGA...GMGTSGLVGQFGAFTTM.....VAQNGESV..ISV
B2A7K6_NATTJ/25-344IPP------TLTAAILGPMVTAV.......FPMY..NLAMGA...GMGTSGLVGQFGAIA........AMEGAGMGGAAM
C7RED4_ANAPD/18-331LPP------TLASAILAPIGTLV.......FKMK..NTPLGS...GMGTSGLVGQIGTI...........NAMGI..SA.
A0PXE9_CLONN/19-346VPI------ILNGIISGIGAYIF........HIV..GTPSSA...GFGLVGLVGPLASI............NSPT..GS.
B2GDR1_LACF3/19-361VPA------LVAAIVCAPLATTL.......SGLR..AAYTVG...GLGLNSFIAPIYFW............GQGT..NQ.
F4BRJ2_CARS1/10-335IGP------TLAAAVAAPISTVA.......LGFT..APSALA...GLGFCSLIAPLNIF...........VSQGS..GS.
F5WSR4_ERYRF/12-343LPI------AINAAVTGVVAYIF........QIQ..GTTASA...GFGITGLAGPINAYS........FMTATPV..VR.
Q03W61_LEUMM/33-377IPP------MIGAAIAAPIATIA.......FNVT..APFSMA...GIGFNSFIVPLALA............GSNP..AA.
Q1GBH7_LACDA/16-349VPV------LLSSALSGLLAAIF........NLQ..GTPNSA...GFGFSGLIGPLAAYA.........KMTPGW..GS.
Q2FV51_STAA8/15-348LPI------LTTAIVSGLVSALV........GIH..GTKESA...GFGFIGMVGPINAFKF.......MEVDSAW..LS.
Q56343_TREPA/13-343IPL------LLNGLVCGVLAWLF........NLQ..GTPASA...GFGFIGLVGPINAYR........LMAYTPM..VR.
Q5FLN1_LACAC/11-342IPV------SASAAIAGLVGAIF........QIS..GTPNSA...GFGSTGLIGPLTAYQ........NMTTGGP..IT.
Q81XJ8_BACAN/10-333VPT------VVASAIVGPVSALI.......FQLE..AGKEIA...GLGLSSLIAPINLI...........SSEGW..EV.
Q834J3_ENTFA/18-343IPC------LFTATISAIPVVLF........NIS..GTPQSA...GFGLVGLVGPLASL..............DA..GLG
Q839R1_ENTFA/29-330ATN------LFSGMVSGIVVTFF........GLK..VPVTGM...ATPWAGLLVTLGNN..............AI..QT.
Q8XMA5_CLOPE/20-350VPI------IANGILSGIGAYLF........NIL..GTPNSA...GFGIVGLVGPLAAI...........NTPGA..TNA
Q8Y5C0_LISMO/10-334LVP------LLTTLIAGPLGVMV.......FHIQ..AASEVA...GLGLCAFVAPLYLI...........ANYGF..ST.
Q9A0B4_STRP1/15-348IPM------VFTAAISSLTVPLF........NLV..GTPASS...GFGLVGAVGPIASL.............AGG..SS.
Q9A1Q9_STRP1/29-336VTN------FVGGAACGVLIALM........KLV..NDTPGT...ATPIAGFAVMFAYN..............PV..AK.
R5FBU1_9CLOT/24-338IPP------TLASMITGPIATMV.......FRLE..NIPAGS...GMGTCGLVGPIGVYT.........AMGGGT..SM.
R5J6K1_9FIRM/19-358IPP------IVSSAILGPISSVV.......LKMI..NNPAGA...GMGTAGLVGPLMAWQS......MAPNVSGA..IL.
R6FZL0_9FIRM/39-416IPP------VLTSAILGPVATCI.......FQLRNNGAAISS...GMGTAGLVGPIGIITGWS..NMPKGYAPGA..FD.
R6RMS6_9FIRM/1-317LPP------ILSSAILGPLGVLL.......GKMQ..NSPNGS...GLGTMGLMGQTTTWET.......MTAGEAP..QMV

PF02378

O50980_BORBU/28-365........FVYIGGAGATLGLAI-------------AMMLSK---.SQHLKAIGRLSFA....................-
O51143_BORBU/17-354.........IMFGLPGAALGVYK-------------GIVHED---KNKVAALLFSGALT....................-
PTU3C_STACT/16-359.........MMFGLPAAAFAIYR-------------QAKPER---RKVVGGLMLSAALT....................-
PTIBC_ECOLI/111-396.........ANLSLGGSSLAVAW-------------...KTK---NPELRQTALAAAAS....................-
P94865_LACCA/25-344.......YVMNFGGTGATLVVPF-------------IMLFAA---RSAQLKAVGKAAFV....................-
PTEC_BACSU/26-350.......YTVGMGGTGMTLAIVF-------------TILIFM---KSRQMKQVSKLGLA....................-
Q9CHB4_LACLA/26-390........FINLSGSGITFGLII-------------FTIFFA---RSEQMKSIGKVELV....................-
PTG3C_MYCGE/28-366.........RVIGWEDFNTPGKW-------------VIPAAL---ANGTSGMMNGATTTGQDSTSALSKYMSKESTNFL-
O07656_ECOLX/14-353.........IQYGLAGAALAMYR-------------TAHAQN---RKAIKALLISGVLT....................-
PTOCB_ECOLI/19-361.........FLGGLPGAALAMYH-------------CARPEN---RHKIKGLLISGLIA....................-
Q97EZ1_CLOAB/28-347.......FIATIGGTGATLMLTV-------------MFAFIA---KSKQLKAVGRTSII....................-
PTLCB_STAAU/29-349.......FIVTFGGTGATLVVPF-------------MFMWMT---KSKRNKAIGRASVV....................-
Q97M14_CLOAB/28-372........FVTLGGSGITLGLVA-------------ACFLFA---RSQRLKQLGKLALV....................-
L2MUH8_ENTFC/107-385.........CTISDIAVGGAMLG-------------YFLRTR---NLKQKQLFGTVTL.....................-
YWBA_BACSU/29-359........WINVGGSGATLALVL-------------TMLVRS---RSKQMKQLGRLGIG....................-
Q9CJ32_LACLA/29-420WVRGSWDAFAWFGGSGGTITLVI-------------AIILFS---KRKDYKIVGRLGLA....................-
Q9ZHJ9_CLOBE/108-393.........ITCGIVAQGAAALA-------------VAVKTK---DKKKRSLYISSAI.....................-
PTMCB_BACHD/19-279.........LLETNPGPGLGVLL-------------AFMVFG---KGMAKQSAPGAAVI....................-
E2XFH0_SHIDY/13-320.........KMYGLPAAAIAIWH-------------SAKPEN---RAKVGGIMISAALT....................-
Q9K7V5_BACHD/18-254.........IAAGAATVGCAAQM-------------VGFAVS---SYRENGWAGIFSLG....................-
PTXC_ECOLI/9-347.........KIFGAVGISLAMYF-------------TAAPEN---RVKVAGLLIPATLT....................-
PTS3B_STRMU/111-420.........ASMANVAQGAATFA-------------IYFLTK---.DKKMKGLSSSSGV....................-
O51590_BORBU/12-348.........MMFGLPGAALALYY-------------TAKREE---RTKVFGLLMSSALT....................-
K7DWE1_LACLC/28-348.......FIATMGGTGATLIVPF-------------LFMWIC---KSDRNRAIGRASVV....................-
O51000_BORBU/18-378.........MIFGLPGAALAMYH-------------TSKPEN---KKNVASLLLSASFT....................-
PTWCB_BACSU/9-293.........MMFGLPAACLAMVV-------------TAKPSK---RKATAGMMIGFALT....................-
G6R7L8_STREE/29-359........FVFIGGGGATIGLAI-------------CLFLFS---KSRANKTLGKLAII....................-
P96159_VIBFU/17-357.........FLGGLPGAALAMYH-------------CARPEN---RSKIKALLISGVVA....................-
Q98R81_MYCPU/304-616.........VMIAGMTPPLGISV-------------SMFLHK---KLWSKQDIEAGKIS....................-
PTW3C_ECOLI/11-300.........MMFGLPGAALAMYF-------------AAPKER---RPMVGGMLLSVAVT....................-
PTW3C_BACSU/13-314.........MIFCLPAVALAIIH-------------TARPEK---KKMISGVMISAALT....................-
PTSBC_STAXY/110-413.........ATMSNIAQGAAALA-------------AFFIIK---ENKKLKGVASAAGV....................-
PTG3C_STACT/13-344.........MMFGLPAAALAIYQ-------------TAKKEN---KKVVAGLMLSGALT....................-
A6T5U3_KLEP7/110-395.........WAMANVAQGGACFA-------------VWFKTK---.DAKIKAITLPSAF....................-
PTFLB_ECOLI/133-409.........VGVVALMPPVAAGL-------------ATFIAP---KLFTRQEKEAASSA....................-
PTMCB_ECOLI/18-278.........MVASNPGPGLGLLL-------------AFTLFG---KGMSKRSAPGAMII....................-
PTS3B_PEDPE/111-411.........ASMANIGQGAATLA-------------IFFATK---.SQKQKALTSSAGV....................-
PTG3C_MYCPN/40-387.........RVIGWVDPNNSSMY-------------IIPGAL---NGQNGSSTGNTMSKDLNGALSAYM..SKESTAFL-
PTOCB_BACSU/9-346.........KIFGIPGIALAFYV-------------TAKKEK---KKLVAGLLIPVTLT....................-
PTJC_BACSU/29-359........WVNIGGSGATLALVV-------------TMFLRA---RSKQMKQLGKLAVG....................-
PTYBC_ECOLI/118-401.........LSMAGAGQVGAALA-------------LYWRAQ---PHSALRSQVRGAII....................-
Q9K614_BACHD/26-350.......FTVGMGGTGMTLAVVF-------------AILLFM---KSQQLKQVGKLGIG....................-
PTF3A_MYCGE/303-598.........AMLSGMVPPLSIAL-------------AASIRK---SCFDKQELPAAYAC....................-
P94470_GEOSE/110-394.........WSMANVAQGGAGLA-------------VFVKAK---.SLKTKEVALPSAL....................-
Q45579_BACIU/119-390.........LAMGGAGQVGAAFA-------------VFVKTK---KTTLRKAIAGGLP.....................-
Q9KSH4_VIBCH/35-354........YIFIGGSGATLALVI-------------.LMSFS---RSAHLKSIGRMSAV....................-
PTG3C_BACSU/13-354.........MMFGLPAAALAIYH-------------EAKPQN---KKLVAGIMGSAALT....................-
F0LVD8_VIBFN/11-324.........MMFGLPGAALAMYH-------------TSTAKN---KEKVAGIMIAAAFA....................-
A5LK37_STREE/28-353.......YIAAIGGTGATFVVPF-------------ILIFFM---RSKQLKSVGKATIT....................-

PF13303

C4Z6R4_EUBE2/32-372WAGMILISFILPAVICPLI.NML....LKKIGWVKDGDMKL
A8FGC2_BACP2/18-332FLAITLLHIVGPAVISLVVSEWM.....RKKGYIQFGDLTI
Q5WEA3_BACSK/19-333FIQVILCYVIIPAVCAFIVSEWM.....RRKGWIKWNDMHI
B9DKL9_STACT/10-331WILIAVFQIILPAVVSYLLYRVC.....KNAGWIKDGDQKI
B1YKF4_EXIS2/16-335YLAVFVLCFLAPALISYLIYRIL.....RRMGRIKDGDLKI
Q03V93_LEUMM/32-373FVLMIVFGAVVPTVAGLVFYYVL.....KKLGKTKKNDLHL
B9E8P3_MACCJ/18-343FTQFMIAGVFLPLVVTYVLHYGV....ARRFNHVKAGDLAL
Q5WK09_BACSK/10-334LFIFIGTGIILPGIISLALYELI.....KRIGWAKTGDLHI
B1YJH3_EXIS2/10-334FLIFFATGVVLPGVLTLVFYRMT.....TMAGWTKMGDLRL
C3PGV6_CORA7/34-371VMIITFVYVILPLALALLFCWLF....EKVLHLTRAEYFSL
C4LGW0_CORK4/38-376ILVVALVYAVVPCVSAFFAVKLF....DKKLGVTNENMYAL
C4L4Z6_EXISA/15-349VLLVIVLFGLIPVALGIFFYRVF.....ERATLVKSDHYRL
Q036G8_LACC3/10-344VLELTLLFFILPIALAYASHVLF....TKTLHYQDPEDYAL
D1AVH7_STRM9/11-347LTFVIIAYFVVPFGVALISHIVY....TKVLKVYKAEIYKF
Q1GB97_LACDA/16-354VLVLVIVWVVVPFAVGYLMKKIF....VDWTKIYKPEYFIS
Q6LQ05_PHOPR/28-337LFMAASAAAVAGLLGGVIGVKIY.....RTFLQERVPLQQF
Q8XP04_CLOPE/28-342VLIASLACVVVSAGSGYLGYLLFKNYKIHTVDEIRGNDLEV
Q2G165_STAA8/1-310IVIYGVVMAIVGALAGYLGSIVF.....KKYPIVTKQDMIN
C4L1G3_EXISA/28-337VTFTAVVLFILGIGFGLIGSRLF.....KNFPIVRHTEKVE
A9NFH9_ACHLI/27-386GWLFVSSMILFPLVLVFWLDVVF.....IKLNWYTENDLIL
Q4FQB6_PSYA2/23-363WTAIILLMFVLPAVIAGVVAYMM.....RRFGWLVDGDMKL
D1ARE5_SEBTE/14-338LIPMLLLHFIFPAVIALLVSGIM.....RKTGLIKQGDMKI
A8MEB1_ALKOO/15-347MAKIAILHFILPAILTFFIAQFM.....RSKGWIKDGDMKL
B2A7K6_NATTJ/25-344YIQILVFHFVAPAVLAYAISQFM.....RKKGHIQDGDLKL
C7RED4_ANAPD/18-331IFKVILLHIILPAILSYIIYRLM.....KNKGLIKDGDMKI
A0PXE9_CLONN/19-346VFRAAMAFIVVPFVGAFLIDILC....RKVLHLYDVSIYK.
B2GDR1_LACF3/19-361FVAYMLWGIVMPAVISVFLFQVM.....KKFGLVKDNQLHL
F4BRJ2_CARS1/10-335FAVYILTACLVPIAITVVVNKVL.....EKASWLRKGDMAL
F5WSR4_ERYRF/12-343IIILLVQYLVVPLGIAMVTHTIF.....TKMDLYKNEIFT.
Q03W61_LEUMM/33-377FAAYMIIGVGVPVIVSFVGYRFM.....RKMGWAKPQQLHL
Q1GBH7_LACDA/16-349IILLTVLYVVYPVALGFFMRWLF....IDRLSFAQAEDLRL
Q2FV51_STAA8/15-348VLLIVVAFFVVPFVTAWLADIIY....RKVFRLYTNDIFK.
Q56343_TREPA/13-343AGILFLVYFVLSFLAAYLIDFIL....VDRLKLYRRE....
Q5FLN1_LACAC/11-342IIFLILLFMGMPLMLGLIMRYIF....IQKLCFVKEEDL..
Q81XJ8_BACAN/10-333VPAMVITYIIIPVAVSYILYIAL.....KKAGRIHSGDMT.
Q834J3_ENTFA/18-343ILPLLFSWFVVPIVAGLFSKFLF....EKVLKIYDSK....
Q839R1_ENTFA/29-330TLLAVAIITVVSLMFGFLGALVF.....KRYRIE.......
Q8XMA5_CLOPE/20-350IFGVIMAFFVIPFVGAFIIEWFC....RKVIHLYDENIFK.
Q8Y5C0_LISMO/10-334LAAFILVAVVLPGVIALVVRPFL.....IKKERLKTGDLT.
Q9A0B4_STRP1/15-348ILIIILAWIIVPFAVAFAAHKVS....KDILKLYKEDIF..
Q9A1Q9_STRP1/29-336VLITALGCIIISLIVGYIGGSVF.....KNYRLVTKQELQ.
R5FBU1_9CLOT/24-338WVGILLVCFLLPAVLTFVFGEVL.....RRMGWIKDGDLKL
R5J6K1_9FIRM/19-358LMEILAMHFVLPAIISLAVFKFM.....VSKKIVSPEDYKL
R6FZL0_9FIRM/39-416WVGMILVCFILPVVLSWAIGKFM.....RKKGWIKEGDLKV
R6RMS6_9FIRM/1-317FLKILLFHFILPGVLTLFIANGM.....RKLNLIKSQDML.

PF02378

O50980_BORBU/28-365...PGLFNINEPIMFGAPIVL-------NPI.LGIPFLLIP
O51143_BORBU/17-354...AFLTGITEPLEFLFIFTA-------PLL.YFVHAAYSG
PTU3C_STACT/16-359...SFLTGITEPLEFSFLFVA-------PIL.YVAHVILAG
PTIBC_ECOLI/111-396...AIMAGISEPALYGVAIRL-------KRP..LIASLISG
P94865_LACCA/25-344...PCTFGVNEPVLFGMPIIM-------NPI.FFIPFLATP
PTEC_BACSU/26-350...PGIFNVNEPIIFGLPIVM-------NPI.IIVPWVLAP
Q9CHB4_LACLA/26-390...PGLFNINEPFLFGLPLVL-------NPV.LALPFFLVP
PTG3C_MYCGE/28-366SWKELVDGLTRKGNFDELAKN-------GLL........DG
O07656_ECOLX/14-353...VIIGGVSEPIEFLFLFVS-------PLL.FVFHAFMNG
PTOCB_ECOLI/19-361...CVVGGTTEPLEFLFLFVA-------PVL.YVIHALLTG
Q97EZ1_CLOAB/28-347...PVCFAVNEPILFGAPIVL-------NPI.FFVPFILTP
PTLCB_STAAU/29-349...PTFFGVNEPILFGAPLVL-------NPV.FFIPFVLAP
Q97M14_CLOAB/28-372...PGCFNINEPVLFGLPIVL-------NPL.MFIPFLICP
L2MUH8_ENTFC/107-385...SAVLGVTEPAIYGVFVKY-------RRP..FVAVMIGG
YWBA_BACSU/29-359...PALFNINEPIIFGMPIVM-------NPL.LIVPFIIAP
Q9CJ32_LACLA/29-420...PGIFNINEPVLFGLPVVL-------NAI.FFIPFAVAP
Q9ZHJ9_CLOBE/108-393...PAFLGITEPAIFGVNLRF-------IKP..FIFGCAGG
PTMCB_BACHD/19-279...HFAGGIHEIY...FPYIL-------MKPTLILAVIAGG
E2XFH0_SHIDY/13-320...SFLTGITEPIEFSFMFVA-------PIL.YIIHAILAG
Q9K7V5_BACHD/18-254.........IGTSMLQVPNIV-------KNPLIILPPTIAG
PTXC_ECOLI/9-347...AMLVGITEPLEFTFLFIS-------PLL.FAVHAVLAA
PTS3B_STRMU/111-420...SALLGITEPALFGVNLKY-------RFP..FFCALIGS
O51590_BORBU/12-348...SFLTGITEPLEFSFLFVA-------PIL.YVVHATFDG
K7DWE1_LACLC/28-348...PTFFGVNEPILFGAPIVL-------NPI.FFVPFIFAP
O51000_BORBU/18-378...SMLTGITEPLEFAFLFAA-------PALYYFIYVPLFG
PTWCB_BACSU/9-293...AFITGITEPIEFAFMFLS-------PLL.YAVHAVLTG
G6R7L8_STREE/29-359...PSIFNINTAILFTFPTVL-------NPI.MLIPFIATP
P96159_VIBFU/17-357...CIVGGITEPLEFLFLFVA-------PVL.YVVHAILTG
Q98R81_MYCPU/304-616...NILFGLSFISEGAIPYTS-------RNTKVMIPSNIIG
PTW3C_ECOLI/11-300...AFLTGVTEPLEFLFMFLA-------PLL.YLLHALLTG
PTW3C_BACSU/13-314...SMLTGITEPVEFSFLFVA-------PVL.YLINSILAG
PTSBC_STAXY/110-413...SALLGITEPAMFGVNLKL-------RYP..FIGAIVGS
PTG3C_STACT/13-344...SFLTGITEPLEFSFLFVA-------PLL.FFIHAVLDG
A6T5U3_KLEP7/110-395...SAMLGITEAAIFGINLRF-------VKP..FIAALVGG
PTFLB_ECOLI/133-409...I.VVGATVATEPAIPYAL-------AAPLPMITANTLA
PTMCB_ECOLI/18-278...HFLGGIHELY...FPYVL-------MKPLTIIAMIAGG
PTS3B_PEDPE/111-411...SALLGITEPAIFGVNLKM-------KFP..FVFAAIAS
PTG3C_MYCPN/40-387TWKDLVDGLTFKGNFDKMAEN-------GLL........DG
PTOCB_BACSU/9-346...AIVAGITEPIEFTFLFIS-------PFL.FAVHAVLAA
PTJC_BACSU/29-359...PAIFNINEPIIFGMPIVM-------NPM.LLLPFIITP
PTYBC_ECOLI/118-401...PGLLGVGEPLIYGVTLPR-------MKP..FVTACLGG
Q9K614_BACHD/26-350...PGLFNVNEPIIFGLPIVM-------NPL.IIVPWILSP
PTF3A_MYCGE/303-598...Y.LMGLSFISEGAIPFVV-------KKPKVMLTANLIA
P94470_GEOSE/110-394...SAFLGITEPVIFGVNLKY-------RKP..FIAAAIGG
Q45579_BACIU/119-390...SGLLGIGEPLIFGVTLPL-------GRP..VFNSMFRS
Q9KSH4_VIBCH/35-354...PGFFQINEPVIFGSPVVM-------NPI.LFLPFVFAP
PTG3C_BACSU/13-354...SFLTGITEPLEFSFLFVA-------PVL.FAIHCLFAG
F0LVD8_VIBFN/11-324...AFFTGVTEPLEFSFMFLA-------PML.YVLHALLTG
A5LK37_STREE/28-353...PVLFAVNEPLLFGMPVIL-------NPY.LFVPFLMTP

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window