Sequence alignment for CL0493

PF02378

O50980_BORBU/28-365RDGFTFSMPFLIVGSFILLLVN.............LPFTDSQTLLYQ....QWYVDLMAKYKG-----------------
O51143_BORBU/17-354SKALRVPISILPVSCLLIGIGS............VFSNSSSIVYVDK....IFIQNVLG....-----------------
PTU3C_STACT/16-359GKALMLPVAILPAAGILLTFGN.............AMHNEQILHFAP....WMQHHYIQLISQ-----------------
PTIBC_ECOLI/111-396IGTMSPLIPAIIGGSMVKLLAM.........................ILEMSGVLTKGSPTLT-----------------
P94865_LACCA/25-344RDGFIACMPIIIFSSIFMMVAY.............VPN.............AWGFYWPDNVTN-----------------
PTEC_BACSU/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLNK..........IMNASMLTSFQS-----------------
Q9CHB4_LACLA/26-390KNGMLFAMPFIIVGSIFLILAN.............IPIPPVAKWLSD...........NGWSA-----------------
PTG3C_MYCGE/28-366SNGLMIPIAVLPLAGIFLGIGDA...........ISSNSSGIVGVKFF.GE............-----------------
O07656_ECOLX/14-353GKAFMYPIALLSVCGMMLGLGSG...........LASD..DMAKLIPFLAIPIIKTILD....-----------------
PTOCB_ECOLI/19-361GKTFMLPVALLSFCGIMLGIGSS...........LSSH..DVITLIPVLGNPVLQAIFT....-----------------
Q97EZ1_CLOAB/28-347RDGFLSCMPVILFSSIFLLIAC.............VPN.............AWGFYWPNNVND-----------------
PTLCB_STAAU/29-349RDGFISAMPVILFSSIFLLIAY.............VPN.............IFGFKWDKGMEA-----------------
Q97M14_CLOAB/28-372KDGVIITMPLTLVGSIFLLIAN.............FPIKSWNSWMTA........IFGPNWAV-----------------
Q9X565_ENTFC/107-385SESMTPILEPIICAGLLAAVLS.........................IASLTGIISPDSSTYH-----------------
YWBA_BACSU/29-359RDGIILTMPLIIIGSVFLILTS.............LPIPGYADFMAS........VFGNEWAD-----------------
Q9CJ32_LACLA/29-420RDSFIGMLPATLAGALAAMISAIVTTFPSAIQQMMLGATAFSKLAPEKVWTLANTPIIGDLNN-----------------
Q9ZHJ9_CLOBE/108-393GDVFVPIIPVLVATGLFMGLRG.........................L.LTNLGVQMNENFVL-----------------
PTMCB_BACHD/19-279SGMIMPNIGAFIAWGLITALFI................................PTGWWPNEQ-----------------
PTGCB_ECOLI/13-320GKSLMLPVSVLPIAGILLGVGS.............................ANFSWLPAVVSH-----------------
Q9K7V5_BACHD/18-254FVTALSFMALGLFSSLIIGLII...............................RTIGDVTQFE-----------------
PTXC_ECOLI/9-347GGAMFTPVLLFPFAGIVVGLAIL...........LQNP..MFVGESLTDPNSLFAQIVH....-----------------
PTS3B_STRMU/111-420SDIFVPIIPALVAGGLLMALNN...............FLTSEGLF.GTKSLVQQFPIIKGSSD-----------------
O51590_BORBU/12-348GRSFMLPIAILPAAGLLLGIGGS...........LSNP..ETVRTYSFLNIFFLQSVFK....-----------------
PTLCB_LACLL/28-348RDGFIAGMPVILFSSIFILIAY.............VPN.............AWGFHWSKDIET-----------------
O51000_BORBU/18-378GKAFMLPIALLPAAGILLGIGGA...........FTNE..TMIQAYGLEEVLGKGTVANSILY-----------------
PTWCB_BACSU/9-293GKSFMLPIAVLPAVGIILALGR.................EDVFNIP.................-----------------
Q97SB2_STRPN/29-359REGFMMAMPLILVGSLFLILIS.............WPQEAFTNWLNS...........VGLLS-----------------
P96159_VIBFU/17-357GKTFMLPVALLAFSGILLGVGSS...........FSSS..AIKEAIPFLDNAPFEYLFM....-----------------
Q98R81_MYCPU/304-616MSGISYMLPFVVFGGIIISIGFL...........IDTIYGATSGISSDPKFLANFGSNHIVAK-----------------
PTW3C_ECOLI/11-300GRALQLPIAVLPVAALLLRFGQ.................PDLLNVA.................-----------------
PTW3C_BACSU/13-314GRALMTPVAVLPAAGLLLRFGD.................KDLLNIP.................-----------------
PTSBC_STAXY/110-413SDIFVPIIPAIVAGGLLMGINN...............ILTAPGIFYDNQSLIEVQNQFSGLAE-----------------
PTG3C_STACT/13-344GKALMLPVAILPAAGLLLALGN.............AFQGDALQSLMPFIKAEGFQNVAK....-----------------
PTSBC_KLEPN/110-395SNIFVPIIPAIVASGLLMGLLG.........................MVKTYGWVDPSNALYI-----------------
Q97SS4_STRPN/34-364KDGMLAILPLTVVGSLFLIMGQ.............LPFEGLNKSIAS........VFGANWTE-----------------
PTFLB_ECOLI/133-409MAGVSAALPFVIGGGILVALANM...........LVQFGLPYT.........DMSKGAPSFTW-----------------
Q97PJ5_STRPN/12-284LTAISYMIPIVCGAGFLVAIGLA...........MGGGVPD...........ALVAGKFTIWD-----------------
PTMCB_ECOLI/18-278TAMVIPNIGAFIAWGFITALFI................................PTGWLPNEH-----------------
Q99T19_STAAM/22-268AGVVIALVPNALLGEVLKIFKS...................................GNEILE-----------------
PTS3B_PEDPE/111-411SDIFIPIVPALVAGGLLMALNN...............VLTAEHLF.MAKSVVEVYPGLKGIAE-----------------
PTG3C_MYCPN/40-387SNGLMIPIAVLPIAGIFLGVGDA...........IAGNAGDLTGLRYF.GL............-----------------
PTOCB_BACSU/9-346GSAMFVPVLLFAFAGIIVGISTL...........FKNK..TLMG.PLADPDGFWYQCWY....-----------------
PTJC_BACSU/29-359RDGIILTMPLIIIGSFFLIIGN.............LPIPGYAEFMAK........TFGSSWSE-----------------
PTYBC_ECOLI/118-401ATIFTPLIPGFIAAGLLLGIAT....................LIATVMHVPADAQGTLPDALN-----------------
Q97QL8_STRPN/28-347RDGFIAGMPVILFSSIFILIAF.............VPN.............SWGFKWSDEVVA-----------------
Q9K614_BACHD/26-350RDAFMLAFPLTIFGSIFVVLTN.............LPFLDQ..........LMNEGALATFRE-----------------
PTF3A_MYCGE/303-598LSGVSYMLPFVVFGGILIALSFL...........IDINNANNAG........GNFGTINPVAN-----------------
Q97NK4_STRPN/27-356RDAFVTVMPLYILAGLIVLLNN........................TVFKWIFQGDTLTRFQY-----------------
P94470_GEOSE/110-394SNIFVPIIPAIVASGLLMGPLG.........................MMKAFKWVAPDSPLYV-----------------
Q45579_BACIU/119-390ASIFIPLIPALVASGLITGITK.........................AIIQAGWLSADSQIAI-----------------
Q9KSH4_VIBCH/35-354RDGFIVAMPFIIVGSFILIFAF.............PPFAEDTTNVFG....RVWLNFATTHFD-----------------
PTG3C_BACSU/13-354GRALMLPVAILPAAGILLAIGN.............AMQNKDMIQVLHFLSNDNVQLVAG....-----------------
P96161_VIBFU/11-324GKALMVPVATLPAAAILMGVGYWIDPNGWGANSALAG..........................-----------------
Q97SA8_STRPN/28-353KDGFIATMPLIMFSSFLMIIIM.............IPK.............NFGVELPSPAIV-----------------
Q97SM0_STRPN/32-373TAAGMAAVPFTIVGSMFLVFSI.............LPQAFSFWPIVA....DIFSASFDKFTS-----------------

PF13303

C5EQ30_9FIRM/26-340-IDALGAMAFGLFASLLIGTIF--------------------GTLGQQFGI...........E.................
C4Z6R4_EUBE2/32-372-IDALGAMAQGLFCSLLIGTIL--------------------NTLGTQLHIGFLTNTVATVSG.................
C0EWH1_9FIRM/39-416-IDAMGAMALGLFASLLIGTII--------------------KTLAENVGTTGLMAALAAITDTGELAAKVAGLSMLNRF
A8FGC2_BACP2/18-332-IEALSYMALGLFATLVVGLIL--------------------KTAGGLLSL...........P.................
Q5WEA3_BACSK/19-333-IKAMGQMTFGLFATLIIGLII--------------------KTAGEQFGI...........A.................
B9DKL9_STACT/10-331-IQGLSYMTLGLFGSLIIGLIM--------------------QTIGKQTLILALNL......H.................
B1YKF4_EXIS2/16-335-ITVLSYMALGLFSSLIMGLIL--------------------KTIGEGLITKGIDA......E.................
B1MXX5_LEUCK/33-377-YNTSAAVSNAILVTLGMGLLL--------------------QTIAGFIHW...........A.................
D0DT31_LACFE/18-361-YNISAAIANAILVTLGMGLLM--------------------QTVAGFVHW...........Q.................
Q03V93_LEUMM/32-373-FDVSQGISNAILAVLGMGLLM--------------------ASIGNIFHY...........T.................
C5RB87_WEIPA/18-359-FLVSQGVSNTVLVFLGIGLLV--------------------NTVGTTIHW...........D.................
A0NIU9_OENOE/71-420-YTVSQGISNAVLVILGISILL--------------------NTAGNLLHW...........A.................
B9E8P3_MACCJ/18-343-EKGAQGISAGIFVALGVGMLL--------------------KSMGGLLHI...........D.................
A8UDI3_9LACT/10-335-YKASSGIANAIFVTIGVGLLL--------------------ETIGNMTGL...........S.................
Q5WK09_BACSK/10-334-YKASAGVANAVLVTLGIGLLF--------------------ESFGNIFGW...........S.................
B1YJH3_EXIS2/10-334-VKVSAGMANAVLVTLGVGLLI--------------------ETFGNLLHI...........E.................
A8U505_9LACT/11-335-YKASQGIAAAVVVTLGIGLLI--------------------QSIGELIGF...........S.................
D3UQE0_LISSS/10-335-YKASMGIANAVLVTLGIGLLL--------------------QTIGQMTGI...........S.................
B5V7G8_BACCE/10-334-FKASAGIAQGIFVSLGIGLLI--------------------ENIGRIVDI...........P.................
C3PGV6_CORA7/34-371-MKVLNGISIAVVVSLVPQALL--------------------GELAKALLPLWSGA......S.................
C4LGW0_CORK4/38-376-MNVLNGISVAVVVALVPQALL--------------------GELFKALLPVFPQG......K.................
C4L4Z6_EXISA/15-349-MNVLNGLSMAILIALIPSALL--------------------GELTKAILPYFPSL......Q.................
B2UXX4_CLOBA/12-340-NKILTGMSIGIIVALVPSALL--------------------GELAKLVGF...........Q.................
C0DVQ7_EIKCO/34-367-MHLLNGSALGIVVALVPGALL--------------------GELFKALTPYCEPL......G.................
D0BM24_9LACT/14-351-MTVLNALALGVVVTLIPGAIL--------------------GELTKALLPVFPQG......Q.................
C5R7Z0_WEIPA/26-357-LAILNGNASGIIVALIPSAII--------------------SQLLAIMPQTDIV.......K.................
B1MX04_LEUCK/14-346-VDVLNGTSLGIVITLIPSALV--------------------SQFLLLFPTSVVA.......F.................
D3L7I8_OENOE/10-340-LKILNSLSIGVIIALVPGAVL--------------------GSLMKAFGNNPLA.......M.................
Q036G8_LACC3/10-344-MNILNGLSVGIIVALVPGAIL--------------------NAIVKLLLPSFPQL......A.................
C2HMW5_LACAI/10-344-LNILSGVSSGVVIALVPGALV--------------------NEIMKSISDVWPAA......Q.................
Q04BX5_LACDB/15-349-LNILNGIGLGVIAALVPAAIL--------------------GQLMKALLGVAPAFA.....Q.................
E7FUM5_ERYRH/11-344-NKILQGAAMGIVVGLIPNAIF--------------------GEIFKALGSHFAVF......A.................
B2S1Y6_TREPS/13-347-MKILNGSSAGIVIGLVPPAIA--------------------GELFRALAPLSPLF......A.................
D1GTF1_STAA0/14-349-FRVLSGVAIGIVAGLVPNAIL--------------------GEIFKYFMDYHPIF......K.................
C4W7H9_STAWA/14-348-FNILNGLAIAIVVGMLPNAIL--------------------GDLSKYLSQYNEIF......S.................
Q4LA83_STAHJ/9-343-FNVLNGVALAIVVGMIPNAIL--------------------GELSKYLSQYNDIF......T.................
B1BKV2_CLOPF/19-351-NKVLAGTATGIVVGLIPNAIL--------------------GSIFKGLIGVSPIF......S.................
B1BBB5_CLOBO/18-347-NKVLAGTATGIVVGLIPNAIL--------------------GAIFKGLINTSPIF......S.................
D1AVH7_STRM9/11-347-MKVLNGTAIGIVVGLIPNAVL--------------------GGLFGYLEQFNPVF......G.................
C4FU56_9FIRM/15-357-NNVLNGTAIAIVVALIPNAVL--------------------KAALTALQSNYPAIKPYL..V.................
Q1JCC8_STRPB/14-350-NKVLAGTAIAIVVALIPNAIL--------------------ATFLKPLLPNMAA.......A.................
Q1GB97_LACDA/16-354-MKVLNGSATAIIVSLLPSAIL--------------------STFLTPFAGSNAIV......A.................
C0X5P0_ENTFL/17-348-NKVLAGTASGTIIALIPNAVL--------------------GAILKYFAEYKII.......E.................
D3QIY8_STALH/13-347-SNILNAVGAGVVIALLPNALL--------------------GELLKLFKDDYQFL......G.................
C5NX18_9BACL/10-345-NIILNGTALGVVAGLIPNAVL--------------------STLFKYLGTLFAPSVF....T.................
C5R8N8_WEIPA/19-380-FKVLSGSAQGILIGVLPSAVL--------------------KYVIRPFVQSGMGWA.....V.................
D3QHA0_STALH/28-343-KQGLQALSGAACATFLPQAFL--------------------SYAIGGVFHI..........E.................
C7CZN5_ENTFL/12-322-KKSLSALSGAACATFLPEAFL--------------------RYAVGGVFHL..........D.................
Q6LQ05_PHOPR/28-337-SAAMSGLADAAIATFLVEAIH--------------------KYVMGNLLGI..........G.................
B0N9F9_EUBSP/31-341-QLAMSGMANAAIATFLVEAVH--------------------KYITGDLLGL..........D.................
B1KVU1_CLOBM/28-362-SKAMSGLANAAVATFLVEAIH--------------------KYISGNFLNF..........T.................
Q8XP04_CLOPE/28-342-MKAMGALAGAACASFLVEAFH--------------------SSFFGNVLNI..........E.................
Q1J8T2_STRPF/28-337-AKAMGALASAACASFLVEAFQ--------------------DSFFGKVLGF..........Q.................
Q2G165_STAA8/1-310-MRAMGALANAAIATFLVEAFN--------------------KYVGGEVFGI..........K.................
C4L1G3_EXISA/28-337-MKAMGALAGAAIASFLVEAFN--------------------AYAIGGLLPL..........P.................
A9NFH9_ACHLI/27-386-SKTLNGMTFGIFGTIVVGAII--------------------QTLGIITGID..........V.................
Q4FQB6_PSYA2/23-363-IDAFTGMALGLFVTLIAGLII--------------------SQIGGWLNL...........P.................
B1BZ79_9FIRM/8-328-IKALNGMAYGFFCSLIIGTIL--------------------KQLGNFINI...........P.................
C7GYT5_9FIRM/10-349-IDGLTGMAHGLFSTLIIGTIL--------------------VQISKLIPNPYG........G.................
B5CRB7_9FIRM/6-345-IDGLSGMAQGLFATLIIGTII--------------------QQIGLFVGGDYG........N.................
C9LAT9_RUMHA/10-333-IEGAHGMACGIFATLIMGMFL--------------------RQIANLFPSDFN........S.................
D3MUN7_9FIRM/18-358-IVAMNGMALGLFSTLIIGLII--------------------NQIGQAIPGSLG........S.................
D1ARE5_SEBTE/14-338-VKILNGMALGLMASLVTGVIL--------------------KQIGTYLNI...........Q.................
A8MEB1_ALKOO/15-347-TKALNGMALGLFSSLIIGLIL--------------------KQIGELTNI...........S.................
B2A7K6_NATTJ/25-344-IEVLGFMAQGLFASLIIGVIL--------------------NEIGVQLGIT..........F.................
D0Z2R9_LISDA/31-348-VDVMSYMALGLFSSLLIGSIF--------------------NSIGVKFDIP..........L.................
C7RED4_ANAPD/18-331-IDALGAMAFGLFASLLVGTIL--------------------NSLGQSLHIP..........Y.................

PF02378

O50980_BORBU/28-365--NLVQPFYVSMGIMSIFVVFGIGYNLSNHY......KLSGIT..GGFLSLYTFLILAGQSDWIPYGGDAAKWG......
O51143_BORBU/17-354--LMKAIGNAILLNMPLIFSIGISIGV..AR......MGQGTAALGGLIGYLTFNI..TENYFIEAFSGLVEAE......
PTU3C_STACT/16-359--IMEASGQVIFDNLPLLFAMGTALGL..A.......GGDGVAGIAALVGYLIMSATMGKIAGITIDDIFSYAD......
PTIBC_ECOLI/111-396--ILNVIGDGAFFFLPLMVAASAAIKF..........KTNMSLAIAIAGVLVHPS...FIELMAKAAQG...........
P94865_LACCA/25-344--TLMVAYKYSMGLLALFVAGTTAKNLTDSK......NLELPK..TNQINPVAVIVASEISFVILSILT...........
PTEC_BACSU/26-350--HFGIASTATMGIMSVFVVFGIGYYLSKSY......QVEAVF..GGAIALVSFLLLTPFIIQPETGDA...........
Q9CHB4_LACLA/26-390--IFTQAFNVSFGILAIWAAVGIGYSYVKEA......GFGDVALQGGLTSLSAFFIVQSLSIANPITAALATGKEASGIG
PTG3C_MYCGE/28-366--FIKQGGNVVFANLPILFAVAIAITF.S........QDAGVAGFSAFVFWATMNA..FMSSLIIPVDANNTAS......
O07656_ECOLX/14-353--FIVSLGLFAFVNLPVLFAIAIPLGLLKDK......EDKAYGAFSGLIGFMAMHL..GTNFYLKQHDLLVV........
PTOCB_ECOLI/19-361--WMSKIGSFAFSFLPVMFCIAIPLGL..AR......ENKGVAAFAGFIGYAVMNL..AVNFWLTNKGILPTT.......
Q97EZ1_CLOAB/28-347--ILMKAYNYSMGILALLMVATIAKSLTDSI......NGKLPK..LRQINNVSVMIVSIICFILIGVQP...........
PTLCB_STAAU/29-349--ILMKPYNYTMGLVAFLVAGTTAKSLTDSF......NRKLES..TNQINFISTMQAAMCGFLFLASDP...........
Q97M14_CLOAB/28-372--PLTQVSGSTFDIMAIAAVIGIAAQYSKNE......GQDPVT..AGLLGAVAFLIIMPSYSPINIGDKVGG........
Q9X565_ENTFC/107-385--IFDALRSAVFYFLPILMAMSCAKRL..........GASPYLAVALAATILSSSINDVK....................
YWBA_BACSU/29-359--KLGYPVNASFDIMAMIAAFGIAYRLAESY......GVDALS..AGAISIAAFLLATPFEVPFTPHGSTE.........
Q9CJ32_LACLA/29-420--ISALVNQGTLTVIGLIFAFSWGYNLARAY......GVNDLA..GGIVSLATLFAGLPNQMGKFTAALGTGKAGV....
Q9ZHJ9_CLOBE/108-393--FTQVLTDTAFAFLPALVAWSTMKKF..........GGTPVIGIVIGLMLVSPSLPNAYAVAAGTATP...........
PTMCB_BACHD/19-279--LAELVGPMITYLLPLLIGYTGGKMIYD........VRGGVVGAAATMGVVV...........................
PTGCB_ECOLI/13-320--VMAEAGGSVFANMPLIFAIGVALGF..T.......NNDGVSALAAVVAYGIMVKTMAVVAPLVLHLP...........
Q9K7V5_BACHD/18-254--LMHNIGVLAMSLMGPAIGVAVAYGL..........QAPRLVLFSALIAGAA...........................
PTXC_ECOLI/9-347--IIEEGGWTVFRNMPLIFAVGLPIGL..AK......QAQGRACLAVMVSFLTWNY..FINAMGMTWGSYFGV.......
PTS3B_STRMU/111-420--MIQLMSAAPFWFLPILVGISAAKRF..........GANQFLGASIGMIMVAPGAANIIGLAANAPISKAA........
O51590_BORBU/12-348--IMSASGSIIFSNLAPIFSIGIAVGL..AK......SDKGTSGIAAFIGYLVMNA..TIGVLIDVSGRAE.........
PTLCB_LACLL/28-348--FLMTPYSYSMGILAFFVGGTTAKALTDSK......NRDLPA..TNQINFLSTMLASMVGFLLMAAEP...........
O51000_BORBU/18-378--LMKYTGEVIFANLPLMFAAAIPIGL..AK......VEKGTAALAGVVGFLVMHQ..TINGILYIQGITPESASL....
PTWCB_BACSU/9-293--FVYQAGTAVFDHLPLIFAIGIAIGI..SK......DSNGAAGLSGAISYLMLDA........................
Q97SB2_STRPN/29-359--ILTTMNQSTVAIISLVACFGIAYRLSEGY......GTDGPS..AGIIALSSFVLMAPRFSSMVYDKNGE.........
P96159_VIBFU/17-357--WMTKIGLVAFIYLPVMFAVAIPLGL..AR......EEKGVAGFAGFVGYAAFNL..AINFFLTVAGVLDS........
Q98R81_MYCPU/304-616--WFNRLGGIAFSIMVAILAAYITYSL..........VGRQGLLPGFVIGFISSGRLKDTYSFLTDSLTN..........
PTW3C_ECOLI/11-300--FIAQAGGAIFDNLALIFAIGVASSW..SK......DSAGAAALAGAVGYFVLTK........................
PTW3C_BACSU/13-314--IIKDAGGVVFDNLPLIFAVGVAIGL..A.......GGEGVAGLAAVIGYLILTV..TLDNMGKLLGL...........
PTSBC_STAXY/110-413--MINIFANAPFTLLPILIGFSAAKRF..........GGNAYLGAALGMILVHPELMSAYDYPKALEAGKE.........
PTG3C_STACT/13-344--MMEGAGGIIFDNLAIIFALGVAIGL..A.......SGDGVAAIAAFVGFIVLNK..TMGMFLGVTPEKA.........
PTSBC_KLEPN/110-395--MLDMCSSAAFIILPILIGFTAAREF..........GGNPYLGATLGGILTHPALTNAWGVAAGFH.............
Q97SS4_STRPN/34-364--PFMQVYSGTFAIMGLISCFSIAYSYAKNS......GVEALP..AGVLSVSAFFILLRSSYIPKQGEA...........
PTFLB_ECOLI/133-409--VVESIGYLGFTFMIPIMGAYIASSI..........ADKPAFAPAFLVCYLANDK........................
Q97PJ5_STRPN/12-284--ALATMGGKALGLLPVVIATGLSYSI..........AGKPGIAPGFVVGLIANS.........................
PTMCB_ECOLI/18-278--FAKIVGPMITYLLPVMIGSTGGHLVGG........KRGAVMGGIGTIGVIV...........................
Q99T19_STAAM/22-268--LTYQLVILIQLFMAFIIGVLAAHQFKFNG......AGAAIVGTSAMIGSGAVV.........................
PTS3B_PEDPE/111-411--MINAMASAPFTFLPILLGFSATKRF..........GGNPYLGATMGMIMVLPSLVNGYSVATTMAAGK..........
PTG3C_MYCPN/40-387--FIKNGGDVVFANLPILFAIAIAITF.S........QDAGVAGFSAFVFWAAMNG..FMSSLILPFDKAGKIITD...T
PTOCB_BACSU/9-346--IIEQGGWTVFNQMPLLFAIGIPVAL..AK......KAQARACLEALTVYLTFNY..FVSAILTVWGGAFGV.......
PTJC_BACSU/29-359--KLAYPVDATFEIMGLVAAFGIAYRLAEKY......GVDALS..AGAISLAAFLLATPYQVPFMPDGATK.........
PTYBC_ECOLI/118-401--FMKVFSKGLFTFLVILVGYNAAQAF..........GGTGVNGAIIAALFLLGYNPAATTGY.................
Q97QL8_STRPN/28-347--FLMKPYSYSMGILALLVAGTTAKSLTDSV......NRSMEK..TNQIKYMSTLLAAIVGLLMLAADP...........
Q9K614_BACHD/26-350--SFSIASSATMGMMSVFVAFGIGYYLSKSY......NVEAIF..GGAIALVSFFILTPFMVETEAGEV...........
PTF3A_MYCGE/303-598--WLNKLGGISFSLIVPILSAYIAYAL..........VSRQGLLPGFVVGLISSGQ......FLLNIVLT..........
Q97NK4_STRPN/27-356--WGITIANGTLSISGMIIAVMVGYFLAKNR......DFENPLA.ASMLSLVSLIVMMPNTVSVVPDGAKD.........
P94470_GEOSE/110-394--LLDMFSSAAFIILPILIGFSAAKEF..........GGTPFLGAVIGGIMTHPALLNPWGLAEAKPN............
Q45579_BACIU/119-390--ILTVIGSGLFTYLGILVGINASKEF..........GGTPALGALAGILIINPE.........................
Q9KSH4_VIBCH/35-354--IIMMPFNMSMGIMTIFVSLGVAYSLAKAY......KMDGIT..SAVLSLMSFLLVAAPA...................
PTG3C_BACSU/13-354--VMESAGQIVFDNLPLLFAVGVAIGL..A.......NGDGVAGIAAIIGYLVMNV..SMSAVLLANGTIPSDS......
P96161_VIBFU/11-324--FLIKAGAAIIDNMSWLFAVGVAYGM..SK......DKDGAAALAGLVCMYVVTTLLSPGAVAQIQGI...........
Q97SA8_STRPN/28-353--WMRKVYMLTMGVLGIIVSGTVGKSLVGNV......NRKMPH..GKVINDISAMLAAICSYLVLTVTLVV.........
Q97SM0_STRPN/32-373--LYMVANYATMGSLSLYFVLSLAYELTKIYAEEEELNMNPLN..GALLALMAFVMTVPQIIFDGGMMKTVTS.......

PF13303

C5EQ30_9FIRM/26-340..IFNVIADYAKSATGAALGIAIAHAL----------KAPQLVLFSAATVGIAGN.....--------------------
C4Z6R4_EUBE2/32-372..VNYTVGGLASAMSGPAMAVAIGYAL----------KCPPLVLFSLITVGFASNA....--------------------
C0EWH1_9FIRM/39-416CWILWQIGNYATMVTGVAMAAAIGYAL----------DAPPLVLFSLCAVGQATNT....--------------------
A8FGC2_BACP2/18-332..LIIKMGTLAMGLMGPAIGVAVAYRL----------QASPLVIFASVVSGAAGA.....--------------------
Q5WEA3_BACSK/19-333..AFLEIGELAMDLYGAAIGAAVALAL----------GAPSFVVLATIVCGTAGA.....--------------------
B9DKL9_STACT/10-331..FLAEIGTVAMGLTGAAIGGAIAYGL----------GAQPLVVFSCIIVGSLGYDKFG.--------------------
B1YKF4_EXIS2/16-335..ILVTVGQQAIALTGPAIGVAVAFAL----------EAPPLVLFSAVAVGAFGYEA...--------------------
B1MXX5_LEUCK/33-377..PMVQMGAITKVMLPAAFGAAVASQM----------KTNTMVMFSAMAASTVGANAIFF--------------------
D0DT31_LACFE/18-361..PLFEAGTLAQALLAPALGLAVASQL----------EVTTLVTFSTIISATVAANAVSF--------------------
Q03V93_LEUMM/32-373..PLIQAGLMGQKMLAPALGVGIAMMM----------RANILTTGAALIAATVGSNAVYF--------------------
C5RB87_WEIPA/18-359..ALVQVGNIAQKLLAPALGMAIAVMM----------RTSTLVIGATMIASTVGANSVYF--------------------
A0NIU9_OENOE/71-420..SLQMVGILGQHLLAPAIGAGIAIQL----------RSTTLTTFSAMIAATVGANSIYF--------------------
B9E8P3_MACCJ/18-343..LLVLFGTISMLILAPALGGAIAYSL----------GANGITLVSAMVAATIGGNALKE--------------------
A8UDI3_9LACT/10-335..ILVIIGTAVKMLMAPAIGAGIAVML----------GGNTLTIFSAMAAGAIGAGAIQT--------------------
Q5WK09_BACSK/10-334..AFVTIGSITKILLAPAIGAGIAYQL----------GGNTLVIYAAMASSTVGGNAISF--------------------
B1YJH3_EXIS2/10-334..MLLTIGGVAKVLLAPALGAGIAYQL----------GGNTLVLFSAMIAATIGGAALQP--------------------
A8U505_9LACT/11-335..TLVTIGAVTKTLLIPGLGIGISYYL----------KTDILTMLSATAAGVIGGRAYAF--------------------
D3UQE0_LISSS/10-335..FLVTIGAIGKTMLIPGIGVGIAMCL----------HANTLVTISAAASAVIGGGAVTT--------------------
B5V7G8_BACCE/10-334..LLITIGVVAKSLMAPAIGAGIAFML----------GANGLVIFSAMVAGAIGAGSISI--------------------
C3PGV6_CORA7/34-371..TVIALTGLAASLLPVMIGVLVGIEF----------KMTPIQTAAVGIASFCGSGVATV--------------------
C4LGW0_CORK4/38-376..EIIGMVSVASSMLPIAIGLLVAMQF----------KMTHIQTATVAISAVMGSGVVKG--------------------
C4L4Z6_EXISA/15-349..FILDATTIAMRLLPAIIGLAVAMQF----------GRSILEAGTIAIATYVGSGAVRI--------------------
B2UXX4_CLOBA/12-340..MVVSITTIASRLVALIIGLCIAMQF----------KFTPIQSGTLAIVTMIGSGALKI--------------------
C0DVQ7_EIKCO/34-367..MLTQMIGATNAMVGIAVGVAIGYMF----------KFTPIESISVGLATMAAGGAVRF--------------------
D0BM24_9LACT/14-351..LIIQATQVANTMMGAIIGLMVGHFF----------KFTPIQAGAIALATVFAGGAPGF--------------------
C5R7Z0_WEIPA/26-357..TLTMMVTLAQSTLPIIAAFAVGALL----------KFGTIESASMALATFIASGVVTS--------------------
B1MX04_LEUCK/14-346..KVGFMTTLVQSALPIVSGFAVGQIR----------KMSAIDSGAIALAMFVSSGVVIQ--------------------
D3L7I8_OENOE/10-340..AVGQMTSPSQCLLAVIAAMAAGRAF----------KFTMINSGSMALAAFMGSGSAAV--------------------
Q036G8_LACC3/10-344..VVTYMTGAAMTLLPALSAVCVGMLA----------KFTPIQTSSLALAAIVGAGNYHL--------------------
C2HMW5_LACAI/10-344..SVLAMTTLMQDLLAVFAGLCVSYLL----------KFNLIQSGSVTAAAMIASGAFQM--------------------
Q04BX5_LACDB/15-349..TVINITTFTQSLLAAMAGFCAAYLF----------QMNMIQMCSVAAAAMIGSGAVTF--------------------
E7FUM5_ERYRH/11-344..TLAGIVFAIQFTVPVLVGMFSSLEF----------KLNGLQMASVIGAAFIGSGAARL--------------------
B2S1Y6_TREPS/13-347..ALYHVVLPIQFSVPALIGTLVGLQF----------HCSAPEVATLAFVSVIASGNVTL--------------------
D1GTF1_STAA0/14-349..TLLGVVVAIQFTVPALIGALVAMKF----------DLSPLAIAVVASAAYVGSGAAQF--------------------
C4W7H9_STAWA/14-348..KIAVVVQGIQYTIPILTGVLIAIQF----------NLTQLQTAVVGAATFVGSGATTI--------------------
Q4LA83_STAHJ/9-343..KVAFVTQGIQYSIPILTGVLIAGQF----------KLTQLQTAVTGAAAFVGSGASTF--------------------
B1BKV2_CLOPF/19-351..TFYNAVNIMQFIVPVLVGVLVGLQF----------ELNAMQSVIVGAAVFLGSGAFKV--------------------
B1BBB5_CLOBO/18-347..ILYNAVNIMQLIVPVLVGVLVALQF----------ELGPMQAVVVGAAVFLGSGAYKV--------------------
D1AVH7_STRM9/11-347..ILRQICVDIQWLVAPMIGFLVGLQF----------GFNPMKSAIIMSATWIASGALVR--------------------
C4FU56_9FIRM/15-357..DYLNIITIFQFFIPVMAGFLIAHQF----------NMKPMQMIAVGGATFIGSGAWKA--------------------
Q1JCC8_STRPB/14-350..EFLHIVQVFQFFTPIMAGFLIGQQF----------KFNPMQQLAVGGAAYIGSGAWAY--------------------
Q1GB97_LACDA/16-354..NLLHIVTVFQYFFAVMCGFSTAKQF----------NLGYTEAACVGGAAFLGSGCMTA--------------------
C0X5P0_ENTFL/17-348..MIIHAAQIFQLATPLIIGGLIAFQF----------GLTPQKMMIAGGAAFAGSGVIKF--------------------
D3QIY8_STALH/13-347..MIFQLVTVIQSFMAFIIGVLAAHQF----------KFNGAGATLIGTSAMLGSGAIHI--------------------
C5NX18_9BACL/10-345..TLSQAMYLLQFSIPVLVGVIVGQSL----------KFKPLESAVLGATVLAASGSLTF--------------------
C5R8N8_WEIPA/19-380..DLSAILTLFSSLIPMLIGLAIAMQF----------NMKSLDVGVMAIAVGVACGSIKW--------------------
D3QHA0_STALH/28-343..FLKEIGDLVGGLSGVAVGILTCLKL----------NISPVFAVIVGLVLHDY......--------------------
C7CZN5_ENTFL/12-322..YVSQIGETMGSLGGLAAGALVPLAF----------GISPVFSIILGLSLIKV......--------------------
Q6LQ05_PHOPR/28-337..YLAEFGNLVGGMGGVAAATLVMLRV----------GVQPVFAMVTGLA..........--------------------
B0N9F9_EUBSP/31-341..FFRTVGSTSGSLGGVAAAIMVPISM----------GTSPVLAVVAGVA..........--------------------
B1KVU1_CLOBM/28-362..FLGKVGEVSGSMGGVAAAILVPISM----------GVNPIYAVVAGVA..........--------------------
Q8XP04_CLOPE/28-342..FLKKVGDANGSLGGVAAAILVPLAL----------GVSPVYSVLIGLS..........--------------------
Q1J8T2_STRPF/28-337..FLSEVGGANGSLSGVAAAILVAIAI----------GVSPGYAVLIGLS..........--------------------
Q2G165_STAA8/1-310..FLEELGDAAGGLGGVAAAGLTALAI----------GVSPVYALVIAAA..........--------------------
C4L1G3_EXISA/28-337..LYEEVGQAAGALSGPAAAALVAIAL----------GINPVYSLMIGLS..........--------------------
A9NFH9_ACHLI/27-386..LNLRVAPVLTSLLGMGIGLSIGLSL----------KVDGLKLIMLSVAGGIGTLVKID--------------------
Q4FQB6_PSYA2/23-363..ALIAVGKLASVLMGAGIGVGIAYYL----------KAPTLVMLSCLVAGMLGAHSEAL--------------------
B1BZ79_9FIRM/8-328..QLVTWGETATYLMGPAIGVAISYAI----------DAKGLNLIAAIIAGSIGAGTFNG--------------------
C7GYT5_9FIRM/10-349..YIAIIGQIAMALTGAGIGVGLAGKL----------NASAFVALGSAVAGLVAAHAQSI--------------------
B5CRB7_9FIRM/6-345..LIYMIGKVAAGLTGAGIGVGVARKL----------EAQQLVTVSAAVAGMIGAFASKL--------------------
C9LAT9_RUMHA/10-333..TLIHLSGIATGLTGIGIGVGVACQL----------QEAPLVVLCAGIAGMLGGDA...--------------------
D3MUN7_9FIRM/18-358..FLVSISPVAMALTGPVIGIGIATSL----------ESPKLVTLSSGVVGFIGAFGAVF--------------------
D1ARE5_SEBTE/14-338..ELIMFGQVAQYMMGPAIGAGVALSL----------EAPPLGVFASVVCGMLGAGTIKY--------------------
A8MEB1_ALKOO/15-347..MLVYFGQVAQFLMGPAIGAGVAYSV----------GAPPLAVFASIATGAIGANTISL--------------------
B2A7K6_NATTJ/25-344..LSETVWPIANEMTGPAIGAAVAFGL----------KAPPLVVFASTITGYAGA.....--------------------
D0Z2R9_LISDA/31-348..FTDTLWPLAKQMTGPAIGVAVAYAL----------QAPPLVLFSSVISGAAGA.....--------------------
C7RED4_ANAPD/18-331..LTDRLWPLANSASGAAIAVAIAASL----------NAPKLVLFASTIVGLGAY.....--------------------

PF02378

O50980_BORBU/28-365..IQPN..................SWFPVIDARYFSAQGVFTAIIAAIFSVEVYKFLVQ.KNMAIKLPESVPPAV.....
O51143_BORBU/17-354..TMSS..................VGRINFFGVQTLNTGIAGSLAVGLLVGYLHNKFYN.....MKLPKPFVFFS.....
PTU3C_STACT/16-359..GAK.TLGQ..........SAKDPAHALVLGIPTLQTGVFGGIIIGALAAWCYNKFYN.....IQLPQFLGFFA.....
PTIBC_ECOLI/111-396.........................EHVEFALIPVTAVKYTYTVIPALVMTWCLSYIER..WV.....DSITPAVTKNFL
P94865_LACCA/25-344.........................LKTGVDLTYMGTQGLICAYIVGLIVPNIYYVCIK.NNVTIKLPAQVPGNI.....
PTEC_BACSU/26-350.........................ITGVIPVDRLGAKGMFLGMITAFLSGEIYRRIVQ.KNLTIKMPAGVPPAV.....
Q9CHB4_LACLA/26-390NLTGTQATAAFEKLPHAMQVFLNNPVTGVLNLTWNGGQGMIAAIIIGILSGWAYSAMMK.AGWKITLPEQVPSNV.....
PTG3C_MYCGE/28-366.GYNI.LYWK..........AVPQSAIASTLGLNSLSTSVFGGIIVGALTAYLYNKFYA.....IRLPDVIGFFS.....
O07656_ECOLX/14-353...AD.QM..............STHGQTIILGIQSYNTSVLGGIVAGLLVASMYKKIVN.....LRIPESLGSYS.....
PTOCB_ECOLI/19-361...DA.AV.............LKANNIQSILGIQSIDTGILGAVIAGIIVWMLHERFHN.....IRLPDALAFFG.....
Q97EZ1_CLOAB/28-347.........................IKGGFSSDFMGTKGLLSAFVVAFIVPNIYKLFVK.NNVTIKLPEEVPHNV.....
PTLCB_STAAU/29-349........................AKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVK.RNITIKMPKEVPPNI.....
Q97M14_CLOAB/28-372...IV.MK.............HADKVQSVIPKAWTGGKGMIAALIIGVLTGYIYSWFLK.RDIRIKLPESVPSGV.....
Q9X565_ENTFC/107-385..........................GLELFGIGLPQITYSNSFIPILLAIWFMGYVTK..VVKRVIPNTLQYFL.....
YWBA_BACSU/29-359......S................IMVGGGIPITLLGSKGLFVAMLIALFSTEIYRYIIQ.KNIVFKMPDGVPPAV.....
Q9CJ32_LACLA/29-420AATDK.LNGVL.......GDQGLAAWKPLFASAHLDAGAYFTVIIMGALAVIIYAKLML.ADITIKMPESVPPAV.....
Q9ZHJ9_CLOBE/108-393........................I.NLTILGLNIPVVGYQGSVLPALVLGIIAAKTQK..ALKKVVPDVLDLIV.....
PTMCB_BACHD/19-279.................................GADIPMFIGAMIMGPLGGFLIKKVDQ..VLQPKVRSGFEMLVN..NF
PTGCB_ECOLI/13-320..........................AEEIASKHLADTGVLGGIISGAIAAYMFNRFYR.....IKLPEYLGFFA.....
Q9K7V5_BACHD/18-254.................................GAELGGPAGSFVAALLATEVGKVVAG.....................
PTXC_ECOLI/9-347..DFT.QDA............VAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFD.....KKLPVFLGIFQ.....
PTS3B_STRMU/111-420...TI.GA..............YTG.FWNIFGLHVTQASYTYQVIPVLVAVWLLSILEK..FFHKRLPSAVDFTF.....
O51590_BORBU/12-348....S.F...............SSGAVGFVLGIKTLETGVFGGVVVGILTYYLHSRFNK.....VDLPKVLGFFS.....
PTLCB_LACLL/28-348........................AKEGGFLTAFMGTKGLLTAFIAAFVTVNVYKVCVK.NNVTIRMPEDVPPNI.....
O51000_BORBU/18-378KALLE.LGMPET......AATAKSQEYTSVLGIFSLQMSVMGGLIAGFVAVFLHNRFHN.....IQLPTFLAFFG.....
PTWCB_BACSU/9-293...........................ATKTIDKTNNMAVFGGIIAGLIAGYTYNRFKD.....TKLPEYLGFFS.....
Q97SB2_STRPN/29-359....Q.V...............KQLFGGAIPFSSLNASSLFMAITIGLVTAEIYRMFIQ.RGITIKMPSGVPDVV.....
P96159_VIBFU/17-357...QS.ER..............VAYGVKNIIGIESIDTGILGAVVVGVIVAKLHQRFYT.....FKMPDALAFFG.....
Q98R81_MYCPU/304-616........................NYGLSPDKVLETGSGFVGAILGGFFAATMLILMSK..YIFSKLPKNLYGIR.....
PTW3C_ECOLI/11-300...........................AMVTINPEINMGVLAGIITGLVGGAAYNRWSD.....IKLPDFLSFFG.....
PTW3C_BACSU/13-314.........................QPPYEGAEHLIDMGVFGGIIIGLLAAYLYKRFSS.....IELHPVLGFFS.....
PTSBC_STAXY/110-413.......................IP.HWNLFGLEINQVGYQGQVLPMLVATYILATIEK..GLRKVIPTVLDNLL.....
PTG3C_STACT/13-344....A.D...............AATGFANVLGIPTLQTGVFGGIIIGALAAWCYNKFYN.....ISLPSYLGFFA.....
PTSBC_KLEPN/110-395..........................TMNFFGIEVAMIGYQGTVFPVLLAVWFMSMVEK..RLRRVIPDALDLIL.....
Q97SS4_STRPN/34-364.........................IGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIK.RKIVIKMPEQVPQAI.....
PTFLB_ECOLI/133-409.............................ALLGTQSGAGFLGAVVLGLAIGYFVFWFRK..V...RLGKALQPLL.....
Q97PJ5_STRPN/12-284...................................VGSGFIGGILGGYIAGFLVQAIIK..KV..KVPNWIKGLM.....
PTMCB_ECOLI/18-278.................................GAEIPMFLGSMIMGPLGGLVIKYVDK..ALEKRIPAGFEMVIN..NF
Q99T19_STAAM/22-268..........................YSNNSFMLKGIGDIINTSLVVIIACLIYMVLQN.......KLGSFELII.....
PTS3B_PEDPE/111-411.......................MV.YWNVFGLHVAQAGYQGQVLPVLGVAFILATLEK..FFHKHIKGAFDFTF.....
PTG3C_MYCPN/40-387STPIA.GFKVLY......NKSVPVHAIATTLGLRTLSTSVFGGIIVGALTSVLYKKFYA.....IRLPDVIGFFS.....
PTOCB_BACSU/9-346..DMN.QEV............GGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFD.....KKLPDFLGIFQ.....
PTJC_BACSU/29-359......E................IMVGGGIPLSLMGSKGLFVAMIIAMVSTEIYRLIIQ.RNLVFKMPDGVPPAV.....
PTYBC_ECOLI/118-401..........................YAGFHDFFGLPIDPRGNIIGVLIAAWACARIEG..MVRRFMPDDLDMLL.....
Q97QL8_STRPN/28-347........................I.ESGLATGFLGTKGLLSAFLAAFVTVAIYKVCVK.NNVTIRMPDEVPPNI.....
Q9K614_BACHD/26-350.........................VQGVIPLDRLGAKGMFLAMMTAFLSAEIYRRIVQ.RNITIKMPPGVPPAV.....
PTF3A_MYCGE/303-598........................NGTIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQN..YIYKKLPQSLQGIK.....
Q97NK4_STRPN/27-356......A................VNISGVLSFNNTGTGAMFAGVIVAIIATELFIELSNVKALQMNLGENIPPAV.....
P94470_GEOSE/110-394..........................YMHFLGFDIAMVGYQGTVVPILLATYVMCKIER..GLRNVVPHTVSLLV.....
Q45579_BACIU/119-390..........................IAKISLFGEELLPGRGGLIGVLFAAIFIAYTEQ..FIRRFIPQSLDIIV.....
Q9KSH4_VIBCH/35-354.........................KEDSLSMAHMGGTGIFTAVMCAFFAVELYRFMKK.HNITIRMPEQVPPAI.....
PTG3C_BACSU/13-354..VER.AKFF..........TENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYT.....IELPQYLGFFA.....
P96161_VIBFU/11-324.........................AASEVPAAFSKIQNQFVGILVGIISAEIYNRYSA.....VELHKALAFFS.....
Q97SA8_STRPN/28-353....D.E................KTGSTSLSTNYLGSQGLITSFVSAFITVNVYRFCIK.RDITIHLPKEVPGAI.....
Q97SM0_STRPN/32-373..LKE.GAV............IADGWAMGNVVARFGTTGIFTAIIMAIVTVLIYRMCVK.HNWVIKMPEAVPEGV.....

PF13303

C5EQ30_9FIRM/26-340------.............................TLGGPVGALVATIVAAELGKIVS.----...KETRLDIIV-----
C4Z6R4_EUBE2/32-372------...........................LGGAGGPLAVYFVAIIAAEAGKMIS.----...KETKIDILV-----
C0EWH1_9FIRM/39-416------...........................LGGSGGPLAVLFVAIIACEAGKLVS.----...KETKIDILV-----
A8FGC2_BACP2/18-332------.............................ELGGPAGSFVAALIGVEIGKLVS.----...GETKIDIIL-----
Q5WEA3_BACSK/19-333------.............................VYGGPAGSFLAAVVAAETGKLVF.----...GSTKVDILV-----
B9DKL9_STACT/10-331------...............................GGAVGAFVATLIATELSRFYA.----...AKTKIDIII-----
B1YKF4_EXIS2/16-335------...............................GGPAGSYVAAVIATEIGKLIS.----...KTTRLDIIL-----
B1MXX5_LEUCK/33-377------.....SKTAVQGVTATGFAGTQAVGSTIITTGQPISAVIAAVIAVLFGKWLS.----...GKTPLDMVI-----
D0DT31_LACFE/18-361------VQTASTATAMQSVGGAAHPLVVGNA..VFSTGQPVSAVAAALLAALLGKWLS.----...GKTPLDMVL-----
Q03V93_LEUMM/32-373------..TSAVSPATHTATGWVADQAAGSL..VMTSGQPVSAVLAALLAVLVGNWLT.----...GKTPLDMML-----
C5RB87_WEIPA/18-359------..TSDVATHTMTATGWVAAQDAGSQ..IMTSGQPVSAVLAGVIAAMLGKWMT.----...GKTPLDMVL-----
A0NIU9_OENOE/71-420------..TEAVIKATKTATGWVAPQLSGAT..IVTVGQPVSTVIAGLAAALVGMWLT.----...GKTPLDMFI-----
B9E8P3_MACCJ/18-343------....................VDGAF..TIQTGLPIGAIIGAIVATYVGKKVT.----...GKTILDMMA-----
A8UDI3_9LACT/10-335------...................TADGMI..TIATGEPIGCLIAATIATFVGKRVS.----...GKTPLDMMA-----
Q5WK09_BACSK/10-334------....................VEGLP..VLAPGQPVSAVIAAVAATYVGKRIT.----...GKTKLDMMA-----
B1YJH3_EXIS2/10-334------...................TDAGL...VLVPGQPISALLAAAVAVFVGKRMT.----...GKTKFDMMV-----
A8U505_9LACT/11-335------....................TNGAV..TLKSGEPVGALLAIAIAIIIGTFLF.----...NKTRFNMIL-----
D3UQE0_LISSS/10-335------...................LAGGGV..GITSGEPVGAILAVIVAVWTGKRVT.----...GKTKFDMIL-----
B5V7G8_BACCE/10-334------...................TEAGL...IIKTGEPIGALLTATLAVYIGKRLS.----...GKTALDMML-----
C3PGV6_CORA7/34-371------..................NPEGGFF..LKGTGLVINSGITAAIAVGLLLFIG.----D..RLKNYSILL-----
C4LGW0_CORK4/38-376------...................INSDEFLQLKGTGLVINTGLTAAFAVIMILLIGD----...RLKSYTILV-----
C4L4Z6_EXISA/15-349------...................DEGAFV..MAGIGDVITAGVTAAIATLLVMKLA.----P..HLKTYTVIV-----
B2UXX4_CLOBA/12-340------...................TESGFV..LAGMGDIINAGITAIIATLLIILIG.----D..KLKAYTVLL-----
C0DVQ7_EIKCO/34-367------...................ADGIIQ..LKGTGDIFTMVFTAGIAVGLIVLLRG----...KVRGYAILV-----
D0BM24_9LACT/14-351------.................NPDVKGVV..FAGTGDIITMGVTAAVAAAFILWIG.----D..KAKAYSIIV-----
C5R7Z0_WEIPA/26-357------...................HGGQYV..ISGSGVILNIMLTTFMASLVTIAFH.----K..LLGQLRAVF-----
B1MX04_LEUCK/14-346------...................SQKSMV..ISGTGVILNIILVAILATGLAQLTQ.----V..TFGHLKILI-----
D3L7I8_OENOE/10-340------..................DSKGGFL..VNGPGDIINIGITLVISVLLIKIIQ.----N..RLGTLKVVL-----
Q036G8_LACC3/10-344------...................TKTGLT..VAGTGDVINLAITLAIGYLLIVLLG.----D..ALKAYTILL-----
C2HMW5_LACAI/10-344------...................KNNQII..LSGSGDVINIALTIFIAAIMVKYLTP----...RLGSYTILI-----
Q04BX5_LACDB/15-349------...................KNGLIM..VAGTGDVINIGLTITLAILLIKLIG.----N..KLGSYTTIL-----
E7FUM5_ERYRH/11-344------...................VEGAWV..LKGTGDLINTMLTVAVAILIIRWYN.----N..RIPNLAIVI-----
B2S1Y6_TREPS/13-347------...................QNGAWL..ITGIGDVINVMLISALAIILVRALR.----G..KLGSLTIIA-----
D1GTF1_STAA0/14-349------...................KNGAWM..ITGIGDLINTMITAAIAVLFILLIQH----...RVGSMALIV-----
C4W7H9_STAWA/14-348------...................TNHQWV..ITGIGDLINTMITGAIAVGIILIIGD----...RAGSLNMII-----
Q4LA83_STAHJ/9-343------...................TDNKWV..IVGIGDLINTMITASIAVGIILLIS.----H..KLGSLNMIV-----
B1BKV2_CLOPF/19-351------...................TEAGVQ..MVGIGDLINIMLVSCIAVFVIRLIG.----N..KLGSLTILL-----
B1BBB5_CLOBO/18-347------...................TSNGVQ..MIGIGDLINTMLVAFIAVYFVRLIG.----N..KLKSLTILL-----
D1AVH7_STRM9/11-347------....................VDGVL..KIGLGDLINVMLIAGIAAYVTMLLG.----E..KLGSLTIVL-----
C4FU56_9FIRM/15-357------...........VEATIGDKTGQIFQ..LAGTGDLINAMVTAALAVAVIQLVG.----H..HFGALEIIL-----
Q1JCC8_STRPB/14-350------...........TEVIQKGVATGTFQ..LRGIGDLINMMITASLAVLAVKYFG.----N..RFGSLTIIL-----
Q1GB97_LACDA/16-354------...........VTTTVKGVTTTSFQ..LAGMGDVINTMLTAAVAVLFIKWVGN----...RFGSLGIVF-----
C0X5P0_ENTFL/17-348------.................NSEVKGFI..GAGTGDIINIMITASVAVLLLLVID.----K..KFGSVEIIA-----
D3QIY8_STALH/13-347------...................TTSGVT..LKGIGDIINVILVVIVACFLYLIFQ.----N..KFGSLEMII-----
C5NX18_9BACL/10-345------.................NAQTKAWT..GVPMGDLFNVILITAIGALVLSYVK.----D..KFGAVTIIF-----
C5R8N8_WEIPA/19-380------...ASVPAGFKNPITGVTTTSPSTVYMAAGAGDVINAMIVAAIGVLVIWLIAK----YLGGFGSLAIIL-----
D3QHA0_STALH/28-343------................................KLLPAFIAAYIMAFGIKLIEK----K..VPEGLDLIV-----
C7CZN5_ENTFL/12-322------................................SLLPAFITAYLLSFVVEQMQK----R..IPEGIDLLV-----
Q6LQ05_PHOPR/28-337------...........................MIHLG.ILEGFIVGYLFSFIAPLFKK----Y..LAEGIDVIL-----
B0N9F9_EUBSP/31-341------...........................VGGYG.ILPGFIAGYVIGLIAPVIEK----R..LPEGLNIIG-----
B1KVU1_CLOBM/28-362------...........................IGGYG.ILPGFIAGYIIGLIAPIFDK----K..LPEGLNTIV-----
Q8XP04_CLOPE/28-342------...........................CSGLG.ILPGFIAGYLMSFVVKFLEE----K..LPSGLDLIV-----
Q1J8T2_STRPF/28-337------...........................VSRTG.IIPGFVAGYVVSFLIKWMEK----N..IPGGLDLIS-----
Q2G165_STAA8/1-310------...........................CGGM.DLLPGFFAGYMIGYVMKYTEK----Y..VPDGVDLIG-----
C4L1G3_EXISA/28-337------...........................VSGFG.ILPGFFAGYILALAGTRINR----Y..LPTGVDMIF-----
A9NFH9_ACHLI/27-386------..................FSMPGWFDPVKVSNNPITAYFVVIGAYFAIQAIF.----R..KKTAYDLFF-----
Q4FQB6_PSYA2/23-363------.........MAGNLFIAQEAGPATF..AALPGNPIGAYLASVFAYRAGTWVA.----...GKTKLDILL-----
B1BZ79_9FIRM/8-328------........................N..VASSGNPIAAFVAVIGAVEVTRLIQ.----...GKTPVDILL-----
C7GYT5_9FIRM/10-349------.............LAGTFSVSKGVL..FIGPGEPLGAFTASLVAVEFGIFIS.----...GKTKLDLLL-----
B5CRB7_9FIRM/6-345------.............LAGQLIVDGNLV..LAGPGEPLGAFIAAYLAIEIGILVT.----...GKTKLDIIL-----
C9LAT9_RUMHA/10-333------............................AGPSAFLCSFLAAFTAIELSRLFV.----...KKTRFDLFL-----
D3MUN7_9FIRM/18-358------............ANGKIINSFGQLI..IKGSGDPLGAFIAVVIAAEVGRLVS.----...GKTKIDIIV-----
D1ARE5_SEBTE/14-338------....................GGSSY..ILASGEPVGSLAASVAGALASKAVF.----...GKTKCDIIV-----
A8MEB1_ALKOO/15-347------...................TEQGVF..AIIVGEPVGAFIAALMGAEVVKWIA.----...GKTKVDIVL-----
B2A7K6_NATTJ/25-344------.............................DLGGPAGALIAAVLGAEFGKIVS.----...KETKVDIVV-----
D0Z2R9_LISDA/31-348------.............................MLGGPVGAYVAALIAAESGKLVA.----...GSTKVDILI-----
C7RED4_ANAPD/18-331------.............................ELGGPVGVFLATIFGVEFGKLVS.----...KSTKLDIII-----

PF02378

O50980_BORBU/28-365LKSFEALIPVV.ALSIVAQSVNIAIQSSLGSLFPEIIMSMFR....PVLQISDTLVGTLTISFIVHILWFCG-LHGTNVI
O51143_BORBU/17-354ECHFVPIVIILPFCVFLAIFFCLIWSSFDDLIASLG...LF.......VFRFE.YFGSFLYGFLNRLLLPLG-LHSILSF
PTU3C_STACT/16-359GKRFVPIITSL.VAIVTGIVLSFVWPPVQDGLNNLS...NF.......LLGKNLALTTFIFGIIERSLIPFG-LHHIFYA
PTIBC_ECOLI/111-396KPMLIVLIAAPLAILLIGPIGIWIGSAISALVYT..............IHGYLGWLSVAIMGALWPLLVMTG-MHRVFTP
P94865_LACCA/25-344AQSFKDLIPMGLSVTA.FWLFGVGFKAATGTVLPRWIIQVLS....PLFQASDSYLGLALIAGAMAFFWFCG-VQGPSIV
PTEC_BACSU/26-350AKSFAALIPAFITLTV.FLLINVMVTLFFKTNMHDVIYHAIQA...PLVGLGSGIIPTLIAVFFIQILWFFG-LHGQIII
Q9CHB4_LACLA/26-390ANQFTSMIPTGVIVVAATVVYALFDKIGHTDAVT.FIYHWLSV...PLQGLGGSFGGIIIISLLVPFFWFFG-VHGGIIM
PTG3C_MYCGE/28-366GTRFVPIICMT.IAIPVALLLLMVWPGVSILLNLIGTGLGI.......LGGRGYGANSLIFGYIERALIPFG-VHHAFYA
O07656_ECOLX/14-353GPRLVPIITLI.VMSGFGLIIPFIWPPFFNLFMLIG...HW.......ISTSG.PVGYFFYAVAERVTIPFG-LNHLVTS
PTOCB_ECOLI/19-361GTRFVPIISSL.VMGLVGLVIPLVWPIFAMGISGLG...HM.......INSAG.DFGPMLFGTGERLLLPFG-LHHILVA
Q97EZ1_CLOAB/28-347AQTFEDLIPLAASVLF.FWLFDLVFRQVTGEVFSSWILDVLK....PLFTAADGYVGLAVIYGAMAMFWFVG-IHGPSIV
PTLCB_STAAU/29-349SQVFKDLIPFS.AVIIILYALDLVIRNSFKSNVAEGILKLFE....PLFTAADGWIGVTIIFGAFALFWFVG-IHGPSIV
Q97M14_CLOAB/28-372SNAFSALIPGAVIITGSMLIFIFF.NIVTGATALEWIYKVLQI...PLQGITDSLGGAIAIPFVISFFWWFG-VHGATLI
Q9X565_ENTFC/107-385TPLLVMLITLPATLLIFGPLGFYMGEGIIGFFNLL.............MKYVGSWFVMMLYSALQPFIIMLG-AGNFIMP
YWBA_BACSU/29-359SKSFVALIPGFIIVLL.VWLARLLIEMTPFQSLHNVVGDLLGT...PLSILGGSLGGSLIAEFVQMLLWSCG-IHGASII
Q9CJ32_LACLA/29-420AKAFLAIIPTIAALYIVGLIYYIIGKLTNDSVIN.LITHYIAE...PFQILSQNIFSVLIVTLFVSVFWFFG-LHGPNVL
Q9ZHJ9_CLOBE/108-393TPFITLLFSMVLGLLIVGPIMHNAEQLIFGAIKG..............FMGLPFGLGGLVVGGVHQLIVVTG-VHHALNA
PTMCB_BACHD/19-279SAGILAAILAIVAFLGIGPVVVSFSNVLASGVEVIIGAGLLPL...ASIFIEPAKVLFLNNAINHGILSPIG-IDQAASA
PTGCB_ECOLI/13-320GKRFVPIISGL.AAIFTGVVLSFIWPPIGSAIQTFS...QW.......AAYQNPVVAFGIYGFIERCLVPFG-LHHIWNV
Q9K7V5_BACHD/18-254ETKIDIIVTPFVTVIVGFLTAQFIGPVIQSGMSGLGATIMW.......ATEQRPIIMGIVVATLMGLALTAP-ISSAALA
PTXC_ECOLI/9-347GTSYVVIIAFL.VMIPCAWLTLLGWPKVQMGIESLQ...AF.......LRSAG.ALGVWVYTFLERILIPTG-LHHFIYG
PTS3B_STRMU/111-420TPLLSVIITGFLTFIVIGPVMKEVSDWLTNGIVW..............LYDTTGFLGMGVFGALYSPVVMTG-LHQSFPA
O51590_BORBU/12-348GSRFVPIIVSF.SSIFLAVIMFLVWPFVQSGINKVG...GL.......VDSTG.YIGTLIYGIFLRMLGPFG-LHHIFYL
PTLCB_LACLL/28-348SQVFKDLIPFTVSVVL.LYGLELLVKGTLGVTVAESIGTLIA....PLFSAADGYLGITLIFGAYAFFWFVG-IHGPSIV
O51000_BORBU/18-378GTRFVPIVTTM.AMFVVGIFLTFIWPFIQGAMTSFG...RI.......VEQSG.LFGTFAYGAIKRSLIPFG-LHHIFYL
PTWCB_BACSU/9-293GRRLVPILTAI.ITIILAGIFGVVWPPIQSCINSFG...EW.......MLGLG.GIGAGIFGLFNRLLIPLG-LHHVLNN
Q97SB2_STRPN/29-359SKSFSALLSGFTTFVLWALVLKGLEAAGVAGGLNGLLGAIVGT...PLKLIAGTLPGMILCVIVNSFFWFCG-VNGGQVL
P96159_VIBFU/17-357GARFVPIISAL.VLGVVGVFIPFVWPYFAAGINGIG...HV.......IESAG.DFGPMLFGTGERLLLPIG-LHHILVA
Q98R81_MYCPU/304-616DILFIPILGTLTIAFVF.WVLNIVFIYINYGLTILL............LIIETRREIIWLLGLILGIMMAVD-LGGPINK
PTW3C_ECOLI/11-300GKRFVPIATGF.FCLVLAAIFGYVWPPVQHAIHAGG...EW.......IVSAG.ALGSGIFGFINRLLIPTG-LHQVLNT
PTW3C_BACSU/13-314GKRFVPIITSV.SSLVIGVIFSFVWPLIQNGINAAS............SLIADSTVGLFFYATIYRLLIPFG-LHHIFYT
PTSBC_STAXY/110-413TPLLAILSTGFITFSFVGPLTRTLGYWLSDGLTW..............LYEFGGAIGGLIFGLLYAPIVITG-MHHSFIA
PTG3C_STACT/13-344GKRFVPIMMAT.CSFILAFPMAIIWPSIQGGLNAFS...EG.......LLASNTGLAVFLFGFIKRLLIPFG-LHHIFHA
PTSBC_KLEPN/110-395TPFLTVIISGFIALLLIGPAGRALGDGISFILST..............LISHAGWLAGLLFGGLYSVIVITG-IHHSFHA
Q97SS4_STRPN/34-364AKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYSAIQV...PLQGLTGSLYGAIGIAFFISFLWWFG-VHGQSVV
PTFLB_ECOLI/133-409GSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHFL............NTIPPSM..KFAAAFLVGAMLAFD-MGGPINK
Q97PJ5_STRPN/12-284PTLIIPFVASLVSSLIMIYIIGAPIAAFTNWLTSLL............QSLGSAS..NGLMGAVIGILSAVD-FGGPLNK
PTMCB_ECOLI/18-278SLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPL...LSVINEPAKVLFLNNAIDQGVYYPLG-MQQASVN
Q99T19_STAAM/22-268LPVLVPIVSGGIGLITLPYIRKITQAIGNVIHS...............FTDLNPLLMSILISVAFSLLMVTP-ISLVAIA
PTS3B_PEDPE/111-411TPMFAIVITGFLTFTIVGPVLRTVSDALTNGLVG..............LYNSTGWIGMGIFGLLYSAIVITG-LHQTFPA
PTG3C_MYCPN/40-387GTRFVPIICFV.VAIPVALILLMIWPAVSIGLNAIGTGLGF.......LGGKGYGANSLIFGYIERSLIPFG-VHHAFYA
PTOCB_BACSU/9-346GSTYIVMISFF.IMIPIALAVSYIWPMVQSGIGSLQ...SF.......LVASG.AVGVWIYTFLERILIPTG-LHHFIYT
PTJC_BACSU/29-359SKSFVALIPGFAVIFL.IWAARLIVEATPFESLHNIVSVLLGT...PLSILGGSLGGSLVAEAVKMLLWACG-LHGANIV
PTYBC_ECOLI/118-401TSLITLLITATLAYLIIMPLGGWLFEGMSWLF................MHLNSNPFGCAVLAGLFLIAVVFG-VHQGFIP
Q97QL8_STRPN/28-347SQVFKDVIPFTLSVVS.LYALDLLARYFVGSSVAESIGKFFA....PLFSAADGYLGITIIFGAFAFFWFVG-IHGPSIV
Q9K614_BACHD/26-350AKSFAALIPAVLTLTV.FLAINVFVSQLFHTNMHDVIYQAVQA...PLVGLGSGIIPTLIAIFFIQILWFFG-LHGQVII
PTF3A_MYCGE/303-598NILFIPLFGTLFTAGLF.WVINIPLIYLNYGLSLFL............NIMNSPI.LAPLLGFVIGLMMCFD-LGGPINK
Q97NK4_STRPN/27-356SRSFSVLLPVMTVISLFGVVSALLFNIT.GMNLISIITIFIQE...PIRHIGTSLIGVIIIYSLGNMLWLFG-IHQAVIY
P94470_GEOSE/110-394VPFVTVISTGFITILAIGPLGNLLGDGITTVLNF..............IYHYGGALAGLIFGGLYSMIVITG-VHHSFHA
Q45579_BACIU/119-390TPTVSLLITGIVTYVVFMPLGGFISDAIASGLLS..............ILDIGGIAAGFILGATFLPLVVTG-LHQGLTP
Q9KSH4_VIBCH/35-354ARSFEVLLPVLAIFLT.LYPLSLFVQAEYGMLIPDAVMAMFK....PLISASNTLPAIIGALLVCQLLWFAG-IHGAAIV
PTG3C_BACSU/13-354GKRFVPIVTSI.SALILGLIMLVIWPPIQHGLNAFS...TG.......LVEANPTLAAFIFGVIERSLIPFG-LHHIFYS
P96161_VIBFU/11-324GKRLVPILTSF.VGIVLSFVLMYIWPAIYGGLVHFG...ES.......IQGMG.ATGAGIYAFFNRLLIPVG-LHHALNS
Q97SA8_STRPN/28-353SQAFRDIFPFSFVLLI.SGLLDIVSRFSLDVPFAQVFQQLLT....PIFKGAESYPAMMLIWFMCALLWFVG-IHGPSIV
Q97SM0_STRPN/32-373SRGFTALVPGFVVAFVVIFINGLLVAMGTD......IFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVG-IHGANIV

PF13303

C5EQ30_9FIRM/26-340TPGVTIISGVLIAQF.VGPGVAGFMDWFGNLVKT--------------ATEMQPFIMGILVSALIGIALTLP.ISSAAIC
C4Z6R4_EUBE2/32-372TPLVTIGVGTGVAAL.IAPALGKAAMKIGELIML--------------ATNLQPFLMGIAVSVLVGIALTLP.ISSAAIC
C0EWH1_9FIRM/39-416TPAVTIIVGVGCAMV.LAPIFKTICDSLGTFIGW--------------ATNLQPFFMGIIISVVVGVVLTLP.ISSAAIC
A8FGC2_BACP2/18-332TPLVTIITGFFTATL.IGPGIEAMMTGLGRLIMW--------------GTDQSPLIMGMLVATIVGLALSSP.ISSAALA
Q5WEA3_BACSK/19-333TPIVTIMSGFAVAWL.LGPAISFVMESISGAIAW--------------ATDQQPLMMSIVVAILMGWALTAP.ISSAAIG
B9DKL9_STACT/10-331SPLLTLIIGGAVAKF.IGPFLNDFMVSLGKMIML--------------ATDQRPLIMGILVAVIFGLALTAP.ISSAALA
B1YKF4_EXIS2/16-335TPFITLLIGFVSGKY.VGAWIGTLMTDLGEIIRW--------------GTEREPLVMGIFVATVMGLALTAP.ISSAALG
B1MXX5_LEUCK/33-377VPAATTIVGTVSGYY.LAMVTTPALVAIGHFIAS--------------SVAINPIIGTAVVAMVFGALTMTP.ASAAALA
D0DT31_LACFE/18-361VPMVVTFVGTFVGFG.LASVVTPALTATSAWIAA--------------SIKVNTVLGSMVISAVWALFLMTP.ASSAALA
Q03V93_LEUMM/32-373VPLGAVLAGTFFGLA.TASVTTPFLNWVSEELAS--------------TMKINPFLGAFVVAVVWFLFLMTP.ASSAALA
C5RB87_WEIPA/18-359VPFAVTMVGSIAGLA.LASVTTPALNWVSGALGH--------------TMQVNPVLGSLVVSFAWFVFLMTP.ASSAALA
A0NIU9_OENOE/71-420VPFCATLVGSLVGLA.AASVTTPFLNWVSENLAN--------------TMKVNPVLGAVVVSFAWFWFLMTP.ASSAALA
B9E8P3_MACCJ/18-343VPVSAVLAGSLVGYY.LARVVEPALVVISKSIAQ--------------SVEGQPLISSVVIALVFAVIVMTP.ASSAALV
A8UDI3_9LACT/10-335IPIAAILAGGLAGYY.LNLVIAPFLSTVSAVISA--------------SVAGSPVIGAAVISVVGGLVLMSP.ASSAAIA
Q5WK09_BACSK/10-334IPFSGIFVGGLVGLV.MAAVTTPMLEWISAQLAT--------------SVQGSPIIAPMAIALTWSILLMTP.ASSAALA
B1YJH3_EXIS2/10-334IPVSAVLAGGFTGLG.AAAVTTPLLTRFSAMVTA--------------SVESSPIATSLVIALIFSVLLMSP.ASSAALA
A8U505_9LACT/11-335VPFASILISGLIGFT.LSSPIAFMLNSVSLLITS--------------SVAGYPLLSSMLLGLVFGMLILSP.ASSAAIA
D3UQE0_LISSS/10-335IPGVSLLAGGLSGIV.FAKIMAPILDSVSLGINS--------------LIGGSPLISSMVIAFVFGLLILSP.ASSAALA
B5V7G8_BACCE/10-334VPFAAILGSGLVGIW.LSHNITPVLNAVGAFIKD--------------SSAGSPFIASIVIAVVWGLLLISP.ASSAALA
C3PGV6_CORA7/34-371LSTIVTLVAGTIGWAVTFPIVKVFTLWLGNLVNG--------------ATTLQPVLMGVVLAVLFAIMIVSP.VSTVGIA
C4LGW0_CORK4/38-376LPPTVIVIAGGLGKFVTYPAVLVFTKWLGNLVVG--------------AADLQPIVMGLILGIAFGVMMASP.ISTVGIA
C4L4Z6_EXISA/15-349MPMTIIVVAGGIGTF.LLTYISQITTYIGLLIMT--------------MTDLQPVLMGILIAMAFSLIIVSP.ISTVGIA
B2UXX4_CLOBA/12-340LPTIVITVAGYIGIM.SLPYVGVITSVIGDFVAK--------------LTDLQPALMGTFMSVAFAFIIISP.LSSVGIA
C0DVQ7_EIKCO/34-367VPVVSLFVAGALGRL.AFPYFIAFSQLLGSWIAH--------------LLTLEQTLMAVLIAIAFACLIVSP.VSSVGIA
D0BM24_9LACT/14-351IPTVTLVVIGGIGRL.AQPYIVKITTLIGQGVEF--------------LLTLQPIIMCMLIAMTFCILIVSP.FTTVGIG
C5R7Z0_WEIPA/26-357EPLAVLLVGGGLGLL.TLPVMIAIQDAIGSVVAA--------------ATQTAPLVMGILLGIIFAVLIVSP.LSSVGIA
B1MX04_LEUCK/14-346QPLFLVLVAGGIGLF.TLSPLRQVQVWIGTGVAY--------------ATDFTPIIMGALLGAAFAFLIVSP.LSSVGIA
D3L7I8_OENOE/10-340SPILVLGIAGGLGRL.LFPYVHSITTAIGSAIND--------------LTDLQPLIMGPLMGIIFAVLILSP.ISSVGIA
Q036G8_LACC3/10-344IPSLVLVIAGGIGML.TLGPVSSITKYIGVVVHD--------------VTALQPIVMGVLMGIIFAVLIVSP.ISTVGIA
C2HMW5_LACAI/10-344LPLAVAVLAGGIGQL.MLPYTKLITGMIGNVVAG--------------MTDFQPLIMGMFMGVAFATLVITP.VSSVGIA
Q04BX5_LACDB/15-349LPIIVLVVGGGIGLL.ILPYVKTVTTFIGMIVMA--------------FTKLQPLLMGVLIGMSFAAMIVSP.ISSVGIA
E7FUM5_ERYRH/11-344TPIIGGVIPGFIGLL.TLPYVGKITGLLGSLIAN--------------FTTLQPLLMMILIAVCFALIIVTP.LSTVAIA
B2S1Y6_TREPS/13-347LPVIVAVVAGGVGSF.SLPYVKMITLFVGRVIAT--------------FIALQPLLMSILLSMSFSLIIISP.VSSVAVG
D1GTF1_STAA0/14-349FPTVVVGISGAIGIL.ILPYTKMITTAIGNMVNG--------------FTELQPIVMSILISMVFSLIIISP.LSTVAIA
C4W7H9_STAWA/14-348LPIVAGGIPGLLGLL.LLPYTKLITVGIGNVVNS--------------LTNTQPIIMTILIAVIFSILIVSP.ISAIGIG
Q4LA83_STAHJ/9-343LAIVGGAVAGLIGLL.ILPYTKLITLGLGDVING--------------LTNTQPIIMTILIAMIFSILIVSP.ISSIGIG
B1BKV2_CLOPF/19-351LPIIAGAGVGIIGMF.MLPYVRQITIVIGDIMNN--------------FTTLQPLLMCILISVSFSILIISP.ISTVAIG
B1BBB5_CLOBO/18-347LPIVGAAV.GVIGMI.TLPYIRQITIVIGNIINN--------------FAVLQPLLMCILISVSFSILIISP.ISTVAIG
D1AVH7_STRM9/11-347QPIIVGVGVGFLGLL.MLPYVKHISTTIGYGINS--------------FTTLQPILMCILIAMSFSILIVSP.ISTVAIG
C4FU56_9FIRM/15-357LPIVVGSGVGLLGYK.LLPYVKQVTDTIGHVIET--------------FVQYQPFVMSILICMSFAILILTP.ISTVAIG
Q1JCC8_STRPB/14-350LPITIGTGVGYIGWK.FLPYVSYVTTLIGQGINS--------------FTTLQPILMSILIAVAFSLIIVSP.ISTVAIG
Q1GB97_LACDA/16-354FPILAGTGVGFLGSL.IKPYVSLVTTAIGDVINT--------------FTKLAPYSMCILIAMSFAIIIVTP.LSTVAIS
C0X5P0_ENTFL/17-348LPIVVGVGAGLFGML.IYPYVTQITVAIGKVINN--------------FTDFQPIIMSILIACSFAALIISP.ITTVAIG
D3QIY8_STALH/13-347LPVAIPVLSGIFGLY.TLPYVQTITKALGHMINS--------------FTELNPLLMSILICVTYSLLMVTP.ISLVAIA
C5NX18_9BACL/10-345LPITGGLVAAL.GLV.TLPYTKSLTKLLASLLFE--------------FTTLQPVLMCVLITMAFSFLIVTP.VSTVAMG
C5R8N8_WEIPA/19-380SPIVVGGGVGLIGKE.IAPYVGEVTTWIGKMVQL--------------ATDLQPLPMTIIIAMAFAVIIVTP.VSTVGIA
D3QHA0_STALH/28-343VILVAPAITFGLAHI.ISPGVMAVLRQIGGAVTS--------------VGDNNPYALAIILGLVIPVTGMTP.LSSMVLT
C7CZN5_ENTFL/12-322VILVIPVAASLVAGF.IQPVVLGVLEVIGSTILS--------------AVDGNPYVMGAILGAIIPIVGMTP.LSSMVLT
Q6LQ05_PHOPR/28-337GVLILAPLARLVGFF.ISPALDLLMGTLANMITE--------------ATSLSPLIMGFLLGGLIKMVCTSP.LSSMALT
B0N9F9_EUBSP/31-341GALLIAPMARLIALA.ADPAVNVILARIGGTIAA--------------ATEQSPIVMGFLLGGIIKMICTSP.LSSMALT
B1KVU1_CLOBM/28-362GALLIAPLARFIAMG.IDPVVNATLVNIGQMISV--------------AAQQSPLVMGFLLGGIMKVVCTSP.LSSMAVT
Q8XP04_CLOPE/28-342IIVVATPLTRIIGDF.TAPVVDSTLLKIGQVLIA--------------SANSNPITMGIILGGIITVVATAP.LSSMALT
Q1J8T2_STRPF/28-337IIIVGAPLTRFLAQL.ITPVINSTLLTIGDILTS--------------SANSNPIIMGMILGGTIVVVATAP.LSSMALT
Q2G165_STAA8/1-310SIVILAPLARLIAVL.LTPVVNSTLIRIGDIIQS--------------STNTNPIIMGIILGGIITVVGTAP.LSSMALT
C4L1G3_EXISA/28-337YVIVMAPLARLVATG.VDPLVTNTLEQIGAVIEL--------------AATQNPVVMGLVLGGIVTVVSTSP.LSSMALT
A9NFH9_ACHLI/27-386IPIVGILSAVLVTYL.ISWPIDRFMEMIYSTIKF--------------FMQLEPFVTSAFVALIFGILLTLPFISSAGVA
Q4FQB6_PSYA2/23-363VPLLVCAVALAVCAL.LNPPVVAVVNAIGQGIQA--------------ATTLQPLLMGIVIAVVVGILLTMP.TSSAAIC
B1BZ79_9FIRM/8-328VPFVSILIGGIITLV.VGPYLTEFILWLGQLINT--------------GVNMQPILMSIVVAVLMGMALTAP.ISSAAIG
C7GYT5_9FIRM/10-349TPAFSMLFGSFIGFV.IGPPISKLMLLIGKSIEY--------------GTTYQPFLMGIIVAVIMGMVLTLP.ISSAALG
B5CRB7_9FIRM/6-345TPLVCIGTGSVVGLV.AGPPISKFMAWLGSLINW--------------GTEQQPFLMGIVVSVLMGIFLTLP.ISSAAIG
C9LAT9_RUMHA/10-333CPLTGFLCGELINLL.LETPLSYFIQEFGNCVNW--------------GAQQQPLLMGIIVAVLMSIAVVFP.IGTAALG
D3MUN7_9FIRM/18-358TPLVTIITGSLIAVL.LGPRLLYAMKSIGSFIQM--------------ATNLAPFTMGLVISVVMGMLLTLP.ISSAAIS
D1ARE5_SEBTE/14-338VPGITIIAGGVISIF.ASPYISRFMMLIGNIINK--------------STNLNPLPMGILVALIMGIIITSP.ISSAAVA
A8MEB1_ALKOO/15-347VPAATIVMGGVAGTF.IAPSIASIMKILGNVINT--------------VTELHPIPMGILLSVLMGMILTLP.ISSAALS
B2A7K6_NATTJ/25-344TPAVTILVGVLAGSL.VGPGVDALMRGLGVIIME--------------ATEMQPVPMGIIVAVVIGLTLTFP.ISSVALT
D0Z2R9_LISDA/31-348TPAVTIITGILVGNF.IGPHVNWLMSSLGDLIMA--------------ATQLQPIVMGALVAVLMGMALTLP.ISSAAIA
C7RED4_ANAPD/18-331TPSVTIIVGILVGDL.IGPYVASFMKAIGLFIMK--------------ATELRPFFMGIVVAFTIGMALTLP.ISSAAIC

PF02378

O50980_BORBU/28-365IALLNPI...........ILSN------LDSNIRALS.........DNL................PLPHILAGGFLDS..
O51143_BORBU/17-354PFEFTSL...........GGVE------IVNGDTVRG.........LKNIFYAQLLDPSLGKFSSGFAKISSGFYLS...
PTU3C_STACT/16-359PFWFEFG............HYV------NESGNLVRGDQRIWMAQYQDGVP.............FTAGAFTTGKYPF...
PTIBC_ECOLI/111-396TIIQTIAETGK...EGMVMPSE------IG..................................................
P94865_LACCA/25-344QPAVVPI...........MIAN------TAANLQQYQ.........AGQ................HVSHVLAMNT.MD..
PTEC_BACSU/26-350NSVMDPI...........WNTL------QVENLSAYT.........AGK................EIPHIISKPFMEI..
Q9CHB4_LACLA/26-390GAITSAF...........LIPN------TFANASLYQ.........SHKLS............LANGAHIVTNEFYNN..
PTG3C_MYCGE/28-366PLWYTSA...........GGSL------QEIANQQVWI.......R.......................APGSDYVT...
O07656_ECOLX/14-353VFRFTPI...........GGSA------VIGGEEYYGTLNMFMAYVKENAVI...........PLDLAGKMEQGKLM...
PTOCB_ECOLI/19-361LIRFTDA...........GGTQ------EVCGQTVSGALTIFQAQLSCPTTHG........FSESATRFLSQGKMPA...
Q97EZ1_CLOAB/28-347EPAVTAI...........YIAN------VEANLKLHQ.........AGH................HATYVLTHGT.SY..
PTLCB_STAAU/29-349EPAIAAI...........TYAN------IEANFKLLQ.........AGE................HADKIITSGT.QM..
Q97M14_CLOAB/28-372GGVMNSI...........YQAN------TLANQDVFK.........AGHKLIA........SGAGKNAHIVCQQFQDN..
Q9X565_ENTFC/107-385VVASLIAAN......GYDPAFI------SS..................................................
YWBA_BACSU/29-359GGIMAPI...........WYGA------MDANRLAFQ.........AGE................ALPSIFTTQFFQI..
Q9CJ32_LACLA/29-420APVLDGI...........WGPL------GLNNQALYFQV....HSQGIRDLIA........KGAVDKAHAINGDYVNLWV
Q9ZHJ9_CLOBE/108-393LEVELLSST.......GKDAFN------AM..................................................
PTMCB_BACHD/19-279GKSILF................------....................................................
PTGCB_ECOLI/13-320PFQMQIG............EYT------NAAGQVFHGDIPRYMAGDP...................TAGKLSGGFLF...
Q9K7V5_BACHD/18-254IMLELSG...............------....................................................
PTXC_ECOLI/9-347QFIF..............GPAA------VEGGIQMYWAQHLQEFSLSAEPLKS.........LFPEGGFALHGN..S...
PTS3B_STRMU/111-420IETQLISAFQN..GTGHGDFIF------VT..................................................
O51590_BORBU/12-348PFWTTGL...........GGSV------IIDGKLIEGTQNIFFAELAAQGTDR.........FFIGTSRFMSGRFIT...
PTLCB_LACLL/28-348EPAIAAI...........TYAN------IDVNLHLIQ.........AGQ................HADKVITSGT.QM..
O51000_BORBU/18-378PFWQTAV...........GGTL------EINNELISGAQNIFFKQLADPNTVH........FEVAKGTRFFSGEFVV...
PTWCB_BACSU/9-293IFWFQFG...............------..EYNGVTGDLARFFAKDPT..................AGTYMTGFFPI...
Q97SB2_STRPN/29-359NAFVDPV...........WLQF------TTENQEAVA.........AGQ................TLQHIITLPFKDL..
P96159_VIBFU/17-357LIRFTEA...........GGTM------DVCGQTVSGALNIFYSELSCADTTT........FTPEVTAFLSQGKMPT...
Q98R81_MYCPU/304-616AAYVFGTLTLAQ.MQGKGTIAM------AS..................................................
PTW3C_ECOLI/11-300IAWFQIG............EFT------NAAGTVFHGDINRFYAGDGT..................AGMFMSGFFPI...
PTW3C_BACSU/13-314PFYFMMG...........EYTD------PSTGNTVTGDLTRFFAGDPT..................AGRFMMGDFPY...
PTSBC_STAXY/110-413IETQLIADSS....STGGSFIF------PI..................................................
PTG3C_STACT/13-344PFWFEFG............SYK------NAAGQIIHGDQRIFIEQIRDNVP.............LTAGKFMQGEFPV...
PTSBC_KLEPN/110-395IEAGLLGNPS.....IGVNFLL------PI..................................................
Q97SS4_STRPN/34-364NGVVTAL...........LLSN------LDANKAMLA.........SANLS............LENGAHIVTQQFLDS..
PTFLB_ECOLI/133-409TAWFFCFSLL....EKHIYDWY------AI..................................................
Q97PJ5_STRPN/12-284TVYAFVLTLQAEGVKEPLTALQ------LV..................................................
PTMCB_ECOLI/18-278GKSIFF................------....................................................
Q99T19_STAAM/22-268TAISLNG...............------....................................................
PTS3B_PEDPE/111-411IETQLLANVA....KTGGSFIF------PV..................................................
PTG3C_MYCPN/40-387PLWYTSA...........GGSL------QEIVNQQVWI.......R....................PDFHLSDNYVA...
PTOCB_BACSU/9-346PFIY..............GPAV------AEGGIVTYWAQHLGEYSQSAKPLKE.........LFPQGGFALHGN..S...
PTJC_BACSU/29-359GGVMAPI...........WYGA------MDANRIAFQ.........AGE................ELPKIFTQQFFDI..
PTYBC_ECOLI/118-401VYLALMDSQ.......GFNSLF------PI..................................................
Q97QL8_STRPN/28-347EPAIAAI...........TYAN------AEVNLNLLQ.........QGM................HADKILTSGT.QM..
Q9K614_BACHD/26-350NSVMDPI...........WNTL------MIENLEAYT.........NGE................PVPNIISKPFIEI..
PTF3A_MYCGE/303-598AAYVFGVVSLQ..NQNAGTISM------AA..................................................
Q97NK4_STRPN/27-356SAILEPL...........LLIN------ITENITAAN.........NGQ................AIPHIINLSQIQT..
P94470_GEOSE/110-394IEANLLAKL.......GVNYLL------PI..................................................
Q45579_BACIU/119-390MHMELINSI.......GNDPLL------PI..................................................
Q9KSH4_VIBCH/35-354VGLLSPI...........FLTN------ISANIDAFV.........TGQ................PVPNIFTQPFWDF..
PTG3C_BACSU/13-354PFWYEFF............SYK------SAAGEIIRGDQRIFMAQIKDGVQ.............LTAGTFMTGKYPF...
P96161_VIBFU/11-324VFWFDVA...............------......GINDIPNFLGGAKSIAEGT........GIVGVTGMYQAGFFPI...
Q97SA8_STRPN/28-353LPAVTAL...........QLSN------MEENAQLLA.........NGQ................FPYHSLTPNF.GN..
Q97SM0_STRPN/32-373FAFVSPI...........ALAN------MAENAAGGH...............................FAVAGEFSNM..

PF13303

C5EQ30_9FIRM/26-340IALSLDG.....................LAGGAATAGCCAQMI..GFAVMSYRENKIGGLMAQGLGTSMLQMGNIVLNPR
C4Z6R4_EUBE2/32-372AAFGLTG.....................LAGGAAVAGCCAQMV..GFAVMSFKENRWGGLVSQGIGTSMLQMGNIIKNPR
C0EWH1_9FIRM/39-416AAVGISGGAVIAGVVDGSISMEVWNGLALAGGAATVGCCCNML..GFAVISYPDNGVGGLVAQGLGTSMLQVPNLMRKPV
A8FGC2_BACP2/18-332LMLDLSG.....................LAAGAATIGCCAQMV..GFAAAGFRENRFGGLAAVGIGTSKLQLPNIVKNPL
Q5WEA3_BACSK/19-333LMLGLEG.....................AVACAAAIGCAGQMV..GFAVASFRENRFGGLLALGIGTSMLQMPNILKNPL
B9DKL9_STACT/10-331LMLDLSG.....................LAAGAATIGCCAQMV..GFAVTSYKDNGVGGLISVGIGTSMLQVPNILMNPA
B1YKF4_EXIS2/16-335IMLGLDG.....................LAAGAATIGCAAQMI..GFGVISYRDNGIGGFIAQGIGTSMLQVGNIIRNPW
B1MXX5_LEUCK/33-377VAIGATGVTSP.................EAAGAILIGTTAVFV..GFPAMSFHENKIGATIAQGIVTPKIQFPNLTENPA
D0DT31_LACFE/18-361VALTLDP.....................ISAAAAAIGTTAQFV..GYTAMSWRQNTPGANIAQFVVTPKVQFPNLILNPW
Q03V93_LEUMM/32-373IAVMLDP.....................LSGGAALVGTTAGFV..MYTAMGWKQNDLGANLAQIIVTPKVQFPNLLKSPL
C5RB87_WEIPA/18-359IAVQLDP.....................MSSGAALIGTTVAFV..SFTAMSYDQNTIGGNIAQGLVTPKVQFANLLKRPI
A0NIU9_OENOE/71-420VAVNLDP.....................ISAGAALIGCCAAFS..GYTAMSFNQNDPGANIAQGLITPKVQFPNIIKSPL
B9E8P3_MACCJ/18-343IVLQLDP.....................ASSAAALVGISAQFV..GYTAMGLKDNDLGGFLAQLVCTPKVQFPNIVNNPK
A8UDI3_9LACT/10-335IALNLDP.....................VSSAAMLVGTTSMYI..AFSFVSIRQNNLGGFLAQFVCTPKVQLPNIVKNPR
Q5WK09_BACSK/10-334IALQMDP.....................ISSGAALIGCTAQFV..GFTLMSWKQNDAGALLAQGLVTPKVQFPNLIKNPR
B1YJH3_EXIS2/10-334IALQLDP.....................VASAAALIGCSAQFV..GFTLMAYRQTDPGGLIASFFVTPKVQFPNIVKNPR
A8U505_9LACT/11-335LALQLDG.....................SAGAAALIGCSVQFT..VFAFLSLKDNDAGTFLGQLIITPKLQTGNIIRHPK
D3UQE0_LISSS/10-335IALQLDP.....................TASAAALIGCSVQFV..SFAVLSYRDNNWGAFFAQLICTPKLQTPNIIKKPS
B5V7G8_BACCE/10-334IALSLDG.....................VAGGAALAGCVAQFI..GFSVISAKENNLGGILAQALCTPKVQLPNITKNPI
C3PGV6_CORA7/34-371TAIFIDG.....................IASGTANLGAVAAGF..TLLVAGWRVNGFATSILHVLGSPKVQMANMLSKPV
C4LGW0_CORK4/38-376TAIFLSG.....................IASGVANVGCCAVAF..TMMWAGWKVNGPGGSLVHVVGSAKVQVANMMRRPV
C4L4Z6_EXISA/15-349TAISLSG.....................VAAGAANLGVVAAGF..GLAIAGWQANATGTSIAHFLGSPKIQMANFVRRPI
B2UXX4_CLOBA/12-340LAVSLSG.....................IASGTANLGICAAGF..GLAVLGFSVNGLGTSAAHFLGSPKMQMANFVKNPT
C0DVQ7_EIKCO/34-367TAIHLAG.....................VGSGAANLGICACAF..SLAVAGRRVNPLGTCAAHFVGSPKLSMPNIVAKPK
D0BM24_9LACT/14-351LAIGLSG.....................IGSGAANLGICAAGF..GLAVAGLKVNSVGTCIAHFIGSPKMSMANVIAKPK
C5R7Z0_WEIPA/26-357TAIGLTG.....................IGAGAANTGIVTASL..VLAIMSLKENSWGLFIAHFMGSPKIQMANMLSKPK
B1MX04_LEUCK/14-346TAIGLTG.....................VGSGAANAGIVVASF..TLAAMGASVNPLGGTLAHFIGSPKIQMANMLTKPK
D3L7I8_OENOE/10-340LAIGLSG.....................IGSGSANLGITTASF..TLAVMGASVNSLGGTLSHFIGTPKIQMANMLKTPK
Q036G8_LACC3/10-344TAISLTG.....................IGAGSANLGIVGAGF..ALATYGWKANSFGTSLAHFLGSPKMQMANILSRPK
C2HMW5_LACAI/10-344MAIGVEG.....................IASGSANLGITAGAF..TLAIMSSKVNGFGTTIAHFLGTPKIQMANVLKNPK
Q04BX5_LACDB/15-349VAIGLTG.....................VASGAANLGITGAAY..TLGIMSYSVNGMGTTLAHFIGTPKIQMTNMLEKPK
E7FUM5_ERYRH/11-344YAISLAG.....................LGSGAANVGIAATVF..TLAYGSSKVNNKGTTFALFFAGPKMLMPNYLKNPI
B2S1Y6_TREPS/13-347IAVGLTG.....................LASGAANIGVSSCAM..TLIVGTMRVNKIGVPLAMFAGAMKMLMPNWIRYPI
D1GTF1_STAA0/14-349FAIGITG.....................LAAGSASIGISATEA..VLIIGTSKVNRLGVPLSVFFGGVKMMIPNMVKYPI
C4W7H9_STAWA/14-348IAIGISG.....................LAAGSAAIGVSASAI..MLALGAWRVNKVGVPISVLLGAVKLMMPNTIRHPI
Q4LA83_STAHJ/9-343LAIGISG.....................LAAGSAAVGVAASAI..MLAVGSWRVNKPGVPITVLLGAVKLMMPTLIRHPM
B1BKV2_CLOPF/19-351IAIGITG.....................LGAGAAAIGVTACTA..VLVAGSRRVNQSGVTLSVLLGAMKMMMPNLVKYPI
B1BBB5_CLOBO/18-347IAIGING.....................LGAGAAAIGVAACTA..ILVIGSRMVNESGVTLSILLGAMKMMMPNLVVHPI
D1AVH7_STRM9/11-347IAIGLSG.....................LASGSANIGVSATAA..VLVIGSWAVNKAGVTIAVGMGGMKMMMPNIVKNPI
C4FU56_9FIRM/15-357LAISLTG.....................LSAGAASMGVGTTAL..YLVWATHKKNKPGVPTAIALGAMKMMMPNYLTHPI
Q1JCC8_STRPB/14-350LAIGLNG.....................MAAGAASMGIASTAA..VLVWATLKVNKSGVPIAIALGAMKMMMPNFLKHPI
Q1GB97_LACDA/16-354VAIGLAG.....................MGSAAAGFGLASTAA..FLFWATLKVDKPGVQVAIFLGVIKMMMPNFLRYPV
C0X5P0_ENTFL/17-348LAIQLNG.....................LSAGAAAMGIAATTV..VLVINSWNVNQSGVTLAVSLGGMKMMMPNLFKYPI
D3QIY8_STALH/13-347TAISLDG.....................LGSGAANMGIVAACV..TFIFGSLRVNSAGVNIVLLIGAAKMMIPVYLKHLI
C5NX18_9BACL/10-345LILFTNENY...................VGAGAATLGLVSAAA..VLAIGTFRANSKGASVAILLGAIKLMMPNCARKPQ
C5R8N8_WEIPA/19-380LAITLSG.....................LGSAAAGVGIVATTV..VLLVNSIRVNKVGTTVAIFLGAMKGMMPSVFKKPV
D3QHA0_STALH/28-343SLLGLTG.....................VPMAIGALTCMGSSFVNFVLFRTLKIGGPSKAFAVCI.EPLTQIDLIAQYPL
C7CZN5_ENTFL/12-322ALIGLTG.....................VPMAVGALTCYGSSIVNAALFKKLKLGTASTPLAVAI.EPLTQVDIISSNPI
Q6LQ05_PHOPR/28-337AMLGLTG.....................LPMGIAAMACVGGSFTNGYVFHTLKLGKSCNTVSVML.EPLTQAHIVTRNPV
B0N9F9_EUBSP/31-341AMLGLDG.....................LAMGIAAIACVGGSFTNGLIFARLKLGDRSNILAVML.EPLTQADIITSNPI
B1KVU1_CLOBM/28-362AMLGLQG.....................LAMGIAGIACVGGSFTNGIIFKRLKLGNKSNIIAVML.EPLTQAPIVTKNPI
Q8XP04_CLOPE/28-342AMLGLTG.....................APMAIGALSVFGSSFLNFVLFQKMKFGSKKDTISVAI.EPLTQADIITANPI
Q1J8T2_STRPF/28-337AMLGLTG.....................IPMAIGALSVFGSSFMNGVLFYRLKLGERKDNIAFAI.EPLTQADVTSANPI
Q2G165_STAA8/1-310ALLGLTG.....................VPMAIGAMAAFSSAFMNGTLFHRLKLGDRKSTIAVSI.EPLSQADIVSANPI
C4L1G3_EXISA/28-337AMLGLTG.....................VPMAIAALALTASISMNYLLFRQLKIGTKKDQLSVAI.EPLTQADLISANPI
A9NFH9_ACHLI/27-386IAVFSVPFGVGNALAIPDPIAI......AAMCAAAIGCSTQMV..GFSVQTLRKNNLGSIFTVGLASSMFQFKNVMRKPI
Q4FQB6_PSYA2/23-363IAIGLGG.....................VAGGAAVVGCAAHMI..GFAVASFKDNGISGVVSQGLGTSMLQIPNVLRKPI
B1BZ79_9FIRM/8-328VMLGLNG.....................LAAGAALAGCCGQMI..GFAVMSIDDNDIGDVIAIAIGTSMLQFKNIVKKPV
C7GYT5_9FIRM/10-349IVLGLSG.....................IAAGAATVGCSCQMI..GFAVASFRDNGVNGLITQGIGTSMVQVPNILRKPI
B5CRB7_9FIRM/6-345VILNLSG.....................LAAGAATVGCCCNMI..GFAVASYRENKLGGFVAQGIGTSMLQMPNIIRHPQ
C9LAT9_RUMHA/10-333VIAGLSG.....................PAAGAATIGCCCSMV..GMAVASYRENGFSGLLSIGTGTPLLLLPNILKNPF
D3MUN7_9FIRM/18-358IILGLSG.....................ISAGASAVGCCSQMI..GFAVITYHVNGLNGALANGLGTSMLQVPNILKKPV
D1ARE5_SEBTE/14-338ISLGLSG.....................LSAGAATIGCACHMV..GFAVAGYKDNGFNGLISHGLGTSKLQMANSIKNPL
A8MEB1_ALKOO/15-347ISLGLNG.....................LAAGAAVVGCCTQMV..GFAVASYKENGIGGLIAQGLGTSMLQVPNIIRNPF
B2A7K6_NATTJ/25-344IMLDLEG.....................LAAGAAAVGCASQMI..GFAVASYKENGVGGLIAQGLGTSMLQIPNVVSKPK
D0Z2R9_LISDA/31-348IMLSLNG.....................ISAGAATVGCATQMV..GFAVMSFRENGWGGLVAQGLGTSMLQMPNIIRNYK
C7RED4_ANAPD/18-331MMLSLEG.....................LAGGAATVGCCAQMI..GFAVISYKDNGLEGLLAQGLGTSMFQVPNIIKNPW

PF02378

O50980_BORBU/28-365......FVYIGGAGATLGLAI------------AMMLSK---.SQHLKAIGRLSFA.......................P
O51143_BORBU/17-354.......IMFGLPGAALGVYK------------GIVHED---KNKVAALLFSGALT.......................A
PTU3C_STACT/16-359.......MMFGLPAAAFAIYR------------QAKPER---RKVVGGLMLSAALT.......................S
PTIBC_ECOLI/111-396.......ANLSLGGSSLAVAW------------...KTK---NPELRQTALAAAAS.......................A
P94865_LACCA/25-344.....YVMNFGGTGATLVVPF------------IMLFAA---RSAQLKAVGKAAFV.......................P
PTEC_BACSU/26-350.....YTVGMGGTGMTLAIVF------------TILIFM---KSRQMKQVSKLGLA.......................P
Q9CHB4_LACLA/26-390......FINLSGSGITFGLII------------FTIFFA---RSEQMKSIGKVELV.......................P
PTG3C_MYCGE/28-366.......RVIGWEDFNTPGKW------------VIPAAL---ANGTSGMMNGATTTGQDSTSALSKYMSKESTNFLSWKE
O07656_ECOLX/14-353.......IQYGLAGAALAMYR------------TAHAQN---RKAIKALLISGVLT.......................V
PTOCB_ECOLI/19-361.......FLGGLPGAALAMYH------------CARPEN---RHKIKGLLISGLIA.......................C
Q97EZ1_CLOAB/28-347.....FIATIGGTGATLMLTV------------MFAFIA---KSKQLKAVGRTSII.......................P
PTLCB_STAAU/29-349.....FIVTFGGTGATLVVPF------------MFMWMT---KSKRNKAIGRASVV.......................P
Q97M14_CLOAB/28-372......FVTLGGSGITLGLVA------------ACFLFA---RSQRLKQLGKLALV.......................P
Q9X565_ENTFC/107-385.......CTISDIAVGGAMLG------------YFLRTR---NLKQKQLFGTVTL........................S
YWBA_BACSU/29-359......WINVGGSGATLALVL------------TMLVRS---RSKQMKQLGRLGIG.......................P
Q9CJ32_LACLA/29-420RGSWDAFAWFGGSGGTITLVI------------AIILFS---KRKDYKIVGRLGLA.......................P
Q9ZHJ9_CLOBE/108-393.......ITCGIVAQGAAALA------------VAVKTK---DKKKRSLYISSAI........................P
PTMCB_BACHD/19-279.......LLETNPGPGLGVLL------------AFMVFG---KGMAKQSAPGAAVI.......................H
PTGCB_ECOLI/13-320.......KMYGLPAAAIAIWH------------SAKPEN---RAKVGGIMISAALT.......................S
Q9K7V5_BACHD/18-254.......IAAGAATVGCAAQM------------VGFAVS---SYRENGWAGIFSLG........................
PTXC_ECOLI/9-347.......KIFGAVGISLAMYF------------TAAPEN---RVKVAGLLIPATLT.......................A
PTS3B_STRMU/111-420.......ASMANVAQGAATFA------------IYFLTK---.DKKMKGLSSSSGV.......................S
O51590_BORBU/12-348.......MMFGLPGAALALYY------------TAKREE---RTKVFGLLMSSALT.......................S
PTLCB_LACLL/28-348.....FIATMGGTGATLIVPF------------LFMWIC---KSDRNRAIGRASVV.......................P
O51000_BORBU/18-378.......MIFGLPGAALAMYH------------TSKPEN---KKNVASLLLSASFT.......................S
PTWCB_BACSU/9-293.......MMFGLPAACLAMVV------------TAKPSK---RKATAGMMIGFALT.......................A
Q97SB2_STRPN/29-359......FVFIGGGGATIGLAI------------CLFLFS---KSRANKTLGKLAII.......................P
P96159_VIBFU/17-357.......FLGGLPGAALAMYH------------CARPEN---RSKIKALLISGVVA.......................C
Q98R81_MYCPU/304-616.......VMIAGMTPPLGISV------------SMFLHK---KLWSKQDIEAGKIS.......................N
PTW3C_ECOLI/11-300.......MMFGLPGAALAMYF------------AAPKER---RPMVGGMLLSVAVT.......................A
PTW3C_BACSU/13-314.......MIFCLPAVALAIIH------------TARPEK---KKMISGVMISAALT.......................S
PTSBC_STAXY/110-413.......ATMSNIAQGAAALA------------AFFIIK---ENKKLKGVASAAGV.......................S
PTG3C_STACT/13-344.......MMFGLPAAALAIYQ------------TAKKEN---KKVVAGLMLSGALT.......................S
PTSBC_KLEPN/110-395.......WAMANVAQGGACFA------------VWFKTK---.DAKIKAITLPSAF.......................S
Q97SS4_STRPN/34-364......FLILSGSGITFGLVV------------AMLFAA---KSKQYQALGKVAAF.......................P
PTFLB_ECOLI/133-409.......VGVVALMPPVAAGL------------ATFIAP---KLFTRQEKEAASSA.......................I
Q97PJ5_STRPN/12-284.......NTATPVGFGLAYFI------------AKLLKK---NIYTQEEIETLKSA.......................V
PTMCB_ECOLI/18-278.......MVASNPGPGLGLLL------------AFTLFG---KGMSKRSAPGAMII.......................H
Q99T19_STAAM/22-268.......LGSGAANLGIVAAC------------VTFLFG---SLRVNSIGVNAVLL........................
PTS3B_PEDPE/111-411.......ASMANIGQGAATLA------------IFFATK---.SQKQKALTSSAGV.......................S
PTG3C_MYCPN/40-387.......RVIGWVDPNNSSMY------------IIPGAL---NGQNGSSTGNTMSKDLNGALSAYM..SKESTAFLTWKD
PTOCB_BACSU/9-346.......KIFGIPGIALAFYV------------TAKKEK---KKLVAGLLIPVTLT.......................A
PTJC_BACSU/29-359......WVNIGGSGATLALVV------------TMFLRA---RSKQMKQLGKLAVG.......................P
PTYBC_ECOLI/118-401.......LSMAGAGQVGAALA------------LYWRAQ---PHSALRSQVRGAII.......................P
Q97QL8_STRPN/28-347.....FIVTMGGTGATLVVPF------------MFMWLT---KSKRNRAIGRASVV.......................P
Q9K614_BACHD/26-350.....FTVGMGGTGMTLAVVF------------AILLFM---KSQQLKQVGKLGIG.......................P
PTF3A_MYCGE/303-598.......AMLSGMVPPLSIAL------------AASIRK---SCFDKQELPAAYAC.......................Y
Q97NK4_STRPN/27-356......FALMGGSGSTLCLLI------------ATFLVS---RNAVSKNVAKLSFG.......................P
P94470_GEOSE/110-394.......WSMANVAQGGAGLA------------VFVKAK---.SLKTKEVALPSAL.......................S
Q45579_BACIU/119-390.......LAMGGAGQVGAAFA------------VFVKTK---KTTLRKAIAGGLP........................S
Q9KSH4_VIBCH/35-354......YIFIGGSGATLALVI------------.LMSFS---RSAHLKSIGRMSAV.......................P
PTG3C_BACSU/13-354.......MMFGLPAAALAIYH------------EAKPQN---KKLVAGIMGSAALT.......................S
P96161_VIBFU/11-324.......MMFGLPGAALAMYH------------TSTAKN---KEKVAGIMIAAAFA.......................A
Q97SA8_STRPN/28-353.....YIAAIGGTGATFVVPF------------ILIFFM---RSKQLKSVGKATIT.......................P
Q97SM0_STRPN/32-373......FVIAGGSGATLGLCL------------YIAFAS---KSEQLKAIGRASVV.......................P

PF13303

C5EQ30_9FIRM/26-340.IWIPPTLASMITGPIATMVF.......RLQ..NIPAGS...GMGTCGLVGPIGIYTA..............MGGGS..S
C4Z6R4_EUBE2/32-372.IWIAPIVTSAITGPMATCLF.......KLQMNGTPVSS...GMGTCGLVGQIGVYSGWI.....ADIANGTKAAIT..G
C0EWH1_9FIRM/39-416.LWIPPVLTSAILGPVATCIF.......QLRNNGAAISS...GMGTAGLVGPIGII.......TGWSNMPKGYAPGA..F
A8FGC2_BACP2/18-332.ILIPPTVAGLILAPIGIIGF.......GMV..NNAAGA...GMGTSGLVGQLMTLTVM..............GFHP..S
Q5WEA3_BACSK/19-333.ILIPPTIAGAVSAPIGTIWF.......GLI..NNAAGS...GMGTSGLVGPIMTFTEM..............GYSG..S
B9DKL9_STACT/10-331.ILIPPTVASAIIAPIMTTLF.......PMT..NNAAGA...GMGTSGFIGQIMTINTM..............GASA..K
B1YKF4_EXIS2/16-335.TIVPPTLAGALLAPFATVLL.......TLE..SNPEGS...GMGTSGLVGPLMMLKTM..............GFEG..E
B1MXX5_LEUCK/33-377.LIVPPMIGAAIAAPIATMAF.......HVT..APFAMA...GIGFNSFIVPLALA.................GSNP..V
D0DT31_LACFE/18-361.QMVPALVAAIVCAPLATTLS.......GLR..AAYTVG...GLGLNSFIAPIYFW.................GQGT..S
Q03V93_LEUMM/32-373.LLFGPALIAGVSAIFAVGIF.......NFK..VPYAIA...GLGLNGFIAPIAL.................ATSDP..R
C5RB87_WEIPA/18-359.LAVGPAAIAMVTAVIAVVGF.......GFK..VPYALA...GLGLNSLIAPLWLA.................AHNM..Q
A0NIU9_OENOE/71-420.TAIGPMVSAMLMASLAVTVG.......GFK..VPATLG...GLGFSSLTAPLNILSMSANSG.........FSNGL..S
B9E8P3_MACCJ/18-343.ITIAPLVAAAVSGPVAILWF.......KMG..VPYEIG...GIGLCGFIAPMQIL................NDQGI..V
A8UDI3_9LACT/10-335.ILIGPTVAAAIAAPISTVAL.......GFT..APSALG...GLGFCSLISPLNIF................VSQGA..G
Q5WK09_BACSK/10-334.LCLPPFAAAIICAPIASLAF.......QFQ..VSYELA...GLGLNSLIAPITIF................STQGI..T
B1YJH3_EXIS2/10-334.LVVAPFLAAMISAPIATLVL.......SLE..VPYELA...GLGLNSMIAPLNIF................VNQGF..N
A8U505_9LACT/11-335.VALFPLMLGTILAPLGVLVF.......NLE..ASAEIA...GMGLCALVAIFGIS................SSQGL..A
D3UQE0_LISSS/10-335.LMLVPLLTTLIAGPLGVMVF.......HIQ..ASSEVA...GLGLCAFVAPLYLI................ANYGF..S
B5V7G8_BACCE/10-334.ILVPTVVASAIVGPVSALIF.......QLE..AGKEIA...GLGLSSLIAPINLI................SSEGW..E
C3PGV6_CORA7/34-371.TFLPVICSAAVLGGVGGAL........GIS..GTPISA...GFGISGLMGPLAALNY..............EGWGWSAG
C4LGW0_CORK4/38-376.ALLPAIVACGVSGIVAGIF........RVQ..GTPISA...GFGISGLVGPLAALNA..............DGWGWSVR
C4L4Z6_EXISA/15-349.MMLPILANAAILGALAGIL........KIE..GTPISA...GFGVSGLIGPVNALHLMP............GGFAL..F
B2UXX4_CLOBA/12-340.MIIPVVFNAAIIGLLGALA........GIQ..GTPMSA...GFGISGLIGPINNLNIV..............GYSL..G
C0DVQ7_EIKCO/34-367.LLLPIMLNAALAGVLASLF........QIQ..GTEFSA...GFGISGLIGPVNHLKL..............AGWGA..G
D0BM24_9LACT/14-351.ILLPMLCSSALLGVLAAVF........SIQ..GTPASA...GFGFSGLVGPIYALNLME............NGWTV..G
C5R7Z0_WEIPA/26-357.LFIPVIIASAIAGGISSLL........SMS..GTPFSA...GFGLSGFIGPVTALN...............ESTGN..G
B1MX04_LEUCK/14-346.LFLPTTIGAAIMGAIATMF........DIK..GTAFSA...GFGFSGLIGPLTAYNL..............SNKTV..G
D3L7I8_OENOE/10-340.LFVPIGIVSALAGLEGAIL........NVG..GTPASA...GFGISGLIGPLAAF.................STGT..N
Q036G8_LACC3/10-344.LFLPMAINAGILGGIGAAL........NIQ..GTPASA...GFGFSGLVGPLAAL.............DAMGSVTV..G
C2HMW5_LACAI/10-344.LFIPVSASAAIAGLVGAIF........QIS..GTPNSA...GFGSTGLIGPLTAYQNM.............TTGGP..I
Q04BX5_LACDB/15-349.LFVPVLLSSALSGLLAAIF........NLQ..GTPNSA...GFGFSGLIGPLAAYAKMT............PGWGS...
E7FUM5_ERYRH/11-344.MSLPIAINAAVTGVVAYIF........QIQ..GTTASA...GFGITGLAGPINAYSFM.............TATPV..V
B2S1Y6_TREPS/13-347.LNIPLLLNGLVCGVLAWLF........NLQ..GTPASA...GFGFIGLVGPINAY.............RLMAYTPM..V
D1GTF1_STAA0/14-349.LMLPILTTAIVSGLVSALV........GIH..GTKESA...GFGFIGMVGPINAFKFME............VDSAW..L
C4W7H9_STAWA/14-348.IFLPITCTAAVSGLVGGLL........NIK..GTPDSA...GFGLIGLVGPIKSLNL..............LGTSM..G
Q4LA83_STAHJ/9-343.MMLPIVCTAGVSGFVGGLF........NIK..GTPDSA...GFGLIGLVGPIKSLNL..............LEMGT..A
B1BKV2_CLOPF/19-351.IAVPIIANGILSGIGAYLF........NIL..GTPNSA...GFGIVGLVGPLAAI................NTPGA..T
B1BBB5_CLOBO/18-347.IAVPIILNGILSGIGAYIF........NIV..GTPSSA...GFGLVGLVGPLASI.................NSPT..G
D1AVH7_STRM9/11-347.MILPILTTSSISGLVVRIL........GIT..GDKVSS...GFGFVGLVGPIKAMSDYAVN..........GITGL..K
C4FU56_9FIRM/15-357.MSAGLLLSSAITAVLVPVF........NLT..GTPQTS...GFGLVGLVGPIASL.................PSLG..N
Q1JCC8_STRPB/14-350.MAIPMVFTAAISSLTVPLF........NLV..GTPASS...GFGLVGAVGPIASL..................AGG..N
Q1GB97_LACDA/16-354.IGIPIALTAAISTLSVPIL........GMQ..GTPASG...GFGLIGAVSPLAAY.................NAGF..Y
C0X5P0_ENTFL/17-348.ILIPCLFTATISAIPVVLF........NIS..GTPQSA...GFGLVGLVGPLASL.................DAGL..G
D3QIY8_STALH/13-347.IMIPLAINGVIGGVIAYSI........GIK..GTPLSA...GFGYTGLVGPINALN..............RMTGDV..T
C5NX18_9BACL/10-345.LFLTILTTAAVTGLSGYFL........KIL..GTHESA...GFGIIGLIGPTKSY.................AMNG..G
C5R8N8_WEIPA/19-380.MLFSFMVAAAISALPISFL........NVQ..GTPTSA...GFGWIGFVSPIQSV........VRDVADKAFQTNT..I
D3QHA0_STALH/28-343QLYGTNAIIGMVNACIVTFA........GLV..INVTGM...ATPIAGAIVLFGFN...............KPLPSV..I
C7CZN5_ENTFL/12-322PIYATNLFSGMVSGIVVTFF........GLK..VPVTGM...ATPWAGLLVTLG...................NNAI..Q
Q6LQ05_PHOPR/28-337PIFMSNFIGGAFAGTIAAYF........GII..NDAPGS...AAPIPGLLASIAFN...................PP..S
B0N9F9_EUBSP/31-341PIYCSNFFGGGLAGISAAVF........HIV..NNAPGT...ASPIPGLLAPFAFN...................PP..T
B1KVU1_CLOBM/28-362PIYGSNILGGGLAGLSAAYF........NII..NNAPGT...ASPIPGLLAPFGFN...................DP..K
Q8XP04_CLOPE/28-342PIYVTNFIGGALCGIIIVLM........GLT..NMSPGT...ATPIAGFAVMFAYN...................PA..F
Q1J8T2_STRPF/28-337PIYVTNFVGGAACGVLIALM........KLV..NDTPGT...ATPIAGFAVMFAYN...................PV..A
Q2G165_STAA8/1-310PIYITNFFGGAIAGLIIAMS........GLI..NDATGT...ATPIAGFLVMFGFN...................HP..T
C4L1G3_EXISA/28-337PIYSVNFVGGAIAGLIVAMT........GMI..NDAPGS...AAGIPGLLVMYGFN...................DW..Q
A9NFH9_ACHLI/27-386.VWAPTLIASFILAPLSYFIFDGYQWFINLIPVGHQFSAVWAGMGTSGLVGILQPL................TITNF..S
Q4FQB6_PSYA2/23-363.ILLPAVIASAIVGPIATVGF.......ELA..CTATGA...GMGTAGLVGVFGVIEASQ............EIMST..S
B1BZ79_9FIRM/8-328.IWLPPIIVSAIIAPISTCLL.......NIS..CSSVGS...GMGTAGFVGILEAV................NVMGS..S
C7GYT5_9FIRM/10-349.IWLPPIFASAILGPVSTIVL.......KMT..NLPAGS...GMGTSGLVGQIMTFKSMA............ATTST..S
B5CRB7_9FIRM/6-345.IWIPPILSSAILGPVSTMLL.......HMT..NNATGS...GMGTAGLVGPLMTWQVMT............ASEDP..M
C9LAT9_RUMHA/10-333.LLLPPILSSAILGPLGVLLG.......KMQ..NSPNGS...GLGTMGLMGQTTTWETMT............AGEAP..Q
D3MUN7_9FIRM/18-358.IWIPPIVSSAILGPISSVVL.......KMT..NNPAGA...GMGTAGLVGPLMAW...........QSMAPNVSGA..I
D1ARE5_SEBTE/14-338.ILVPPMAASVILGGVGAAIF.......KME..NNKIGA...GMGTSGLVGQFTTF................EVMGE..K
A8MEB1_ALKOO/15-347.VWIPPTLASAFLGPLSTTII.......RME..NNSIGA...GMGTSGLVGQFGAFTTMVAQ..........NGESV..I
B2A7K6_NATTJ/25-344.LLIPPTLTAAILGPMVTAVF.......PMY..NLAMGA...GMGTSGLVGQFGAIAAM.............EGAGMGGA
D0Z2R9_LISDA/31-348.IWLPTIITSAILGPIATTVF.......ELQ..NTPLGA...GMGTSGFVGQIQTVIAM.............DNTPA..F
C7RED4_ANAPD/18-331.IWLPPTLASAILAPIGTLVF.......KMK..NTPLGS...GMGTSGLVGQIGTI................NAMGI..S

PF02378

O50980_BORBU/28-365GLFNINEPIMFGAPIVLNPI.LGIP------------------------------------FLLIP
O51143_BORBU/17-354FLTGITEPLEFLFIFTAPLL.YFVH------------------------------------AAYSG
PTU3C_STACT/16-359FLTGITEPLEFSFLFVAPIL.YVAH------------------------------------VILAG
PTIBC_ECOLI/111-396IMAGISEPALYGVAIRLKRP..LIA------------------------------------SLISG
P94865_LACCA/25-344CTFGVNEPVLFGMPIIMNPI.FFIP------------------------------------FLATP
PTEC_BACSU/26-350GIFNVNEPIIFGLPIVMNPI.IIVP------------------------------------WVLAP
Q9CHB4_LACLA/26-390GLFNINEPFLFGLPLVLNPV.LALP------------------------------------FFLVP
PTG3C_MYCGE/28-366LVDGLTRKGNFDELAKNGLL.....------------------------------------...DG
O07656_ECOLX/14-353IIGGVSEPIEFLFLFVSPLL.FVFH------------------------------------AFMNG
PTOCB_ECOLI/19-361VVGGTTEPLEFLFLFVAPVL.YVIH------------------------------------ALLTG
Q97EZ1_CLOAB/28-347VCFAVNEPILFGAPIVLNPI.FFVP------------------------------------FILTP
PTLCB_STAAU/29-349TFFGVNEPILFGAPLVLNPV.FFIP------------------------------------FVLAP
Q97M14_CLOAB/28-372GCFNINEPVLFGLPIVLNPL.MFIP------------------------------------FLICP
Q9X565_ENTFC/107-385AVLGVTEPAIYGVFVKYRRP..FVA------------------------------------VMIGG
YWBA_BACSU/29-359ALFNINEPIIFGMPIVMNPL.LIVP------------------------------------FIIAP
Q9CJ32_LACLA/29-420GIFNINEPVLFGLPVVLNAI.FFIP------------------------------------FAVAP
Q9ZHJ9_CLOBE/108-393AFLGITEPAIFGVNLRFIKP..FIF------------------------------------GCAGG
PTMCB_BACHD/19-279FAGGIHEIY...FPYILMKPTLILA------------------------------------VIAGG
PTGCB_ECOLI/13-320FLTGITEPIEFSFMFVAPIL.YIIH------------------------------------AILAG
Q9K7V5_BACHD/18-254.....IGTSMLQVPNIVKNPLIILP------------------------------------PTIAG
PTXC_ECOLI/9-347MLVGITEPLEFTFLFISPLL.FAVH------------------------------------AVLAA
PTS3B_STRMU/111-420ALLGITEPALFGVNLKYRFP..FFC------------------------------------ALIGS
O51590_BORBU/12-348FLTGITEPLEFSFLFVAPIL.YVVH------------------------------------ATFDG
PTLCB_LACLL/28-348TFFGVNEPILFGAPIVLNPI.FFVP------------------------------------FIFAP
O51000_BORBU/18-378MLTGITEPLEFAFLFAAPALYYFIY------------------------------------VPLFG
PTWCB_BACSU/9-293FITGITEPIEFAFMFLSPLL.YAVH------------------------------------AVLTG
Q97SB2_STRPN/29-359SIFNINTAILFTFPTVLNPI.MLIP------------------------------------FIATP
P96159_VIBFU/17-357IVGGITEPLEFLFLFVAPVL.YVVH------------------------------------AILTG
Q98R81_MYCPU/304-616ILFGLSFISEGAIPYTSRNTKVMIP------------------------------------SNIIG
PTW3C_ECOLI/11-300FLTGVTEPLEFLFMFLAPLL.YLLH------------------------------------ALLTG
PTW3C_BACSU/13-314MLTGITEPVEFSFLFVAPVL.YLIN------------------------------------SILAG
PTSBC_STAXY/110-413ALLGITEPAMFGVNLKLRYP..FIG------------------------------------AIVGS
PTG3C_STACT/13-344FLTGITEPLEFSFLFVAPLL.FFIH------------------------------------AVLDG
PTSBC_KLEPN/110-395AMLGITEAAIFGINLRFVKP..FIA------------------------------------ALVGG
Q97SS4_STRPN/34-364AIFNVNEPVVFGFPIVMNPV.MFVP------------------------------------FILVP
PTFLB_ECOLI/133-409.VVGATVATEPAIPYALAAPLPMIT------------------------------------ANTLA
Q97PJ5_STRPN/12-284.PMGIVNIVEGVIPIVMNNLVPGLI------------------------------------ATGIG
PTMCB_ECOLI/18-278FLGGIHELY...FPYVLMKPLTIIA------------------------------------MIAGG
Q99T19_STAAM/22-268.....IGAAKMMIPVYLKNLIISIP------------------------------------LTING
PTS3B_PEDPE/111-411ALLGITEPAIFGVNLKMKFP..FVF------------------------------------AAIAS
PTG3C_MYCPN/40-387LVDGLTFKGNFDKMAENGLL.....------------------------------------...DG
PTOCB_BACSU/9-346IVAGITEPIEFTFLFISPFL.FAVH------------------------------------AVLAA
PTJC_BACSU/29-359AIFNINEPIIFGMPIVMNPM.LLLP------------------------------------FIITP
PTYBC_ECOLI/118-401GLLGVGEPLIYGVTLPRMKP..FVT------------------------------------ACLGG
Q97QL8_STRPN/28-347TFFGVNEPILFGAPLVLNPI.FFIP------------------------------------FIFAP
Q9K614_BACHD/26-350GLFNVNEPIIFGLPIVMNPL.IIVP------------------------------------WILSP
PTF3A_MYCGE/303-598.LMGLSFISEGAIPFVVKKPKVMLT------------------------------------ANLIA
Q97NK4_STRPN/27-356GIFNINEPVLFGYPIVYNIS.LAIP------------------------------------FITVP
P94470_GEOSE/110-394AFLGITEPVIFGVNLKYRKP..FIA------------------------------------AAIGG
Q45579_BACIU/119-390GLLGIGEPLIFGVTLPLGRP..VFN------------------------------------SMFRS
Q9KSH4_VIBCH/35-354GFFQINEPVIFGSPVVMNPI.LFLP------------------------------------FVFAP
PTG3C_BACSU/13-354FLTGITEPLEFSFLFVAPVL.FAIH------------------------------------CLFAG
P96161_VIBFU/11-324FFTGVTEPLEFSFMFLAPML.YVLH------------------------------------ALLTG
Q97SA8_STRPN/28-353VLFAVNEPLLFGMPVILNPY.LFVP------------------------------------FLMTP
Q97SM0_STRPN/32-373ALFNINEPLIFGLPIIYNPA.LAIP------------------------------------FILAP

PF13303

C5EQ30_9FIRM/26-340M.WIGILMVCFVLPAVLTFIFGEIL.........................RKMGWIKEGD.LKL--
C4Z6R4_EUBE2/32-372FDWAGMILISFILPAVICPLI.NML........................LKKIGWVKDGD.MKL--
C0EWH1_9FIRM/39-416D.WVGMILVCFILPVVLSWAI.GKF........................MRKKGWIKEGD.LKV--
A8FGC2_BACP2/18-332V.FLAITLLHIVGPAVISLVVSEWM.........................RKKGYIQFGD.LTI--
Q5WEA3_BACSK/19-333L.FIQVILCYVIIPAVCAFIVSEWM.........................RRKGWIKWND.MHI--
B9DKL9_STACT/10-331T.WILIAVFQIILPAVVSYLLYRVC.........................KNAGWIKDGD.QKI--
B1YKF4_EXIS2/16-335Y.YLAVFVLCFLAPALISYLIYRIL.........................RRMGRIKDGD.LKI--
B1MXX5_LEUCK/33-377A.FAAYMIVGVVVPVIVSFIGYRVM.........................RKMGWAKPNQ.LHL--
D0DT31_LACFE/18-361Q.FVAYVLWGIVMPAVISVFLFQVM.........................KKFGLVKDNQ.LHL--
Q03V93_LEUMM/32-373G.FVLMIVFGAVVPTVAGLVFYYVL.........................KKLGKTKKND.LHL--
C5RB87_WEIPA/18-359G.LILLIVFGVAIPAVLAWFYYRFL.........................RVIGQTRVQD.LRL--
A0NIU9_OENOE/71-420G.LATMLIFGLVGPVVISWLWYKFL.........................KSVGKTREND.LHL--
B9E8P3_MACCJ/18-343A.FTQFMIAGVFLPLVVTYVLHYGV........................ARRFNHVKAGD.LAL--
A8UDI3_9LACT/10-335S.FAVYIVTACLVPIAITVVVNKLL.........................EKASWLRKGD.MAL--
Q5WK09_BACSK/10-334G.LFIFIGTGIILPGIISLALYELI.........................KRIGWAKTGD.LHI--
B1YJH3_EXIS2/10-334A.FLIFFATGVVLPGVLTLVFYRMT.........................TMAGWTKMGD.LRL--
A8U505_9LACT/11-335A.TLSYLFVVLVLPALLSLLF.KPF........................LIKSNLLKPHE.LKI--
D3UQE0_LISSS/10-335T.LAAFILVAVVLPGVIALVVRPML.........................IKKERLKTGD.LTI--
B5V7G8_BACCE/10-334V.VPAMVITYIVIPVAVSYIL.YIA........................LKKAGRIHSGD.MTV--
C3PGV6_CORA7/34-371N.VMIITFVYVILPLALALLFCWLF........................EKVLHLTRAEY.FSL--
C4LGW0_CORK4/38-376N.ILVVALVYAVVPCVSAFFAVKLF........................DKKLGVTNENM.YAL--
C4L4Z6_EXISA/15-349N.VLLVIVLFGLIPVALGIFFYRVF.........................ERATLVKSDH.YRL--
B2UXX4_CLOBA/12-340Q.IINTLVVFIVLPLVVGYVSKIIF........................MDKLKMVKAED.YLI--
C0DVQ7_EIKCO/34-367Q.LAVSLLVFVIVPVAGAFAVDWLF........................VNKLKWIAPED.YKI--
D0BM24_9LACT/14-351N.ILLVAVIFVVAPIIFNIFFIHVF........................EKVVQWIQPED.YKL--
C5R7Z0_WEIPA/26-357I.GLRVVIAFFIVPIAMALIMKYIF........................IDKLQLIDAKD.LKL--
B1MX04_LEUCK/14-346A.VIAILVTFIIFPIAIAVILRWIF........................IVKLRWIQPED.LRL--
D3L7I8_OENOE/10-340N.ILLLLLEFIVIPLALAYLAYLLF........................VKKLHFIQPLD.LKL--
Q036G8_LACC3/10-344N.VLELTLLFFILPIALAYASHVLF........................TKTLHYQDPED.YAL--
C2HMW5_LACAI/10-344T.IIFLILLFMGMPLMLGLIMRYIF........................IQKLCFVKEED.LLI--
Q04BX5_LACDB/15-349..IILLTVLYVVYPVALGFFMRWLF........................IDRLSFAQAED.LRL--
E7FUM5_ERYRH/11-344R.IIILLVQYLVVPLGIAMVTHTIF.........................TKMDLYKNEI.FTF--
B2S1Y6_TREPS/13-347R.AGILFLVYFVLSFLAAYLIDFIL........................VDRLKLYRREL.FIP--
D1GTF1_STAA0/14-349S.VLLIVVAFFVVPFVTAWLADIIY........................RKVFRLYTNDI.FKF--
C4W7H9_STAWA/14-348SGLLLVAITYVIVPIISAIFFNYLF........................VKILKLYKPDV.FIF--
Q4LA83_STAHJ/9-343SGLLIIAIVYIIVPLISALFFHYLF........................VKVLKIYNPNI.FKY--
B1BKV2_CLOPF/19-351NAIFGVIMAFFVIPFVGAFIIEWFC........................RKVIHLYDENI.FKY--
B1BBB5_CLOBO/18-347S.IFGAVIAFIVIPFIGAFFIDLLC........................RKVMHLYDESI.YKY--
D1AVH7_STRM9/11-347A.LTFVIIAYFVVPFGVALISHIVY........................TKVLKVYKAEI.YKF--
C4FU56_9FIRM/15-357N.FLLMLLIWVAVPAVVTFLVHFLF........................TKVLKLYDEEI.FVF--
Q1JCC8_STRPB/14-350S.ILIIILAWIIVPFAVAFAAHKVS........................KDILKLYKEDI.FVF--
Q1GB97_LACDA/16-354N.VLVLVIVWVVVPFAVGYLMKKIF........................VDWTKIYKPEY.FIS--
C0X5P0_ENTFL/17-348..ILPLLFSWFVVPIVAGLFSKFLF........................EKVLKIYDSKIVFAY--
D3QIY8_STALH/13-347MNIILLAFGYFIIPFASAFIIHELC........................KKIIPGYTNDI.YRF--
C5NX18_9BACL/10-345N.LLPILLAFFVIPFVVAFLADRLY........................SDVLKLYKPEA.YKP--
C5R8N8_WEIPA/19-380G.VIPAILVWAIVPIIAGIVVDLLF........................TKVFKLYKPED.FKQ--
D3QHA0_STALH/28-343T.IIVVAVVSIILAYIFGKLISKLN........................ITKTDITIPGQNNQV--
C7CZN5_ENTFL/12-322T.TLLAVAIITVVSLMFGFLGALVF.........................KRYRIEAVDNTPEF--
Q6LQ05_PHOPR/28-337T.LFMAASAAAVAGLLGGVIGVKIY.........................RTFLQERVPL.QQF--
B0N9F9_EUBSP/31-341Q.VLLAVFFAVIGGCAAGLAGSMVF........................CKRIQVPKADS.LAS--
B1KVU1_CLOBM/28-362K.VLIAVTFAIIGGSIGGLVGSVVFKGFAKKDYKLDEIPTNEINEVNDDINNIAGETATE.IAT--
Q8XP04_CLOPE/28-342K.VLIASLACVVVSAGSGYLGYLLF....................KNYKIHTVDEIRGND.LEV--
Q1J8T2_STRPF/28-337K.VLITALGCIIISLIVGYIGGSVF.........................KNYRLVTKQE.LQA--
Q2G165_STAA8/1-310T.IVIYGVVMAIVGALAGYLGSIVF.........................KKYPIVTKQD.MIN--
C4L1G3_EXISA/28-337T.VTFTAVVLFILGIGFGLIGSRLF.........................KNFPIVRHTE.KVE--
A9NFH9_ACHLI/27-386LDGWLFVSSMILFPLVLVFWLDVVF.........................IKLNWYTEND.LIL--
Q4FQB6_PSYA2/23-363QLWTAIILLMFVLPAVIAGVVAYMM.........................RRFGWLVDGD.MKL--
B1BZ79_9FIRM/8-328Y.WLPVIVIDLIAPAFLTYVIFKMF.........................KKLTFIKSGD.LKL--
C7GYT5_9FIRM/10-349TIWTYVILLHFIAPAILTLVFSESF.........................YKLGIIKRGD.MKI--
B5CRB7_9FIRM/6-345IVLVKMITIQFVLPAVVTLGISELM.........................RKKKWIHPGD.MKL--
C9LAT9_RUMHA/10-333MVFLKILLFHFILPGVLTLFIANGM.........................RKLNLIKSQD.MLL--
D3MUN7_9FIRM/18-358L.PMEILAMHFVLPAIISLAV.FKF........................MVSKKIVSPED.YKL--
D1ARE5_SEBTE/14-338S.LIPMLLLHFIFPAVIALLVSGIM.........................RKTGLIKQGD.MKI--
A8MEB1_ALKOO/15-347SVMAKIAILHFILPAILTFFIAQFM.........................RSKGWIKDGD.MKL--
B2A7K6_NATTJ/25-344AMYIQILVFHFVAPAVLAYAISQFM.........................RKKGHIQDGD.LKL--
D0Z2R9_LISDA/31-348TLYSLILLMHFILPATITLFFAEVM.........................RNKGWIKPGD.LTL--
C7RED4_ANAPD/18-331A.IFKVILLHIILPAILSYIIYRLM.........................KNKGLIKDGD.MKI--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window