Sequence alignment for CL0497

PF00043

GSTA2_MOUSE/99-192----------------ILDLTEMIGQ--------------LVLCPPD...............------------------
GSTA3_CHICK/99-192----------------TDDLMGFLLS--------------FPFLSAE...............------------------
GSTA3_MOUSE/99-192----------------VADLEIMILY--------------YPHMPPE...............------------------
GSTM3_HUMAN/108-196----------------VMDFRTQLIR--------------LCYSSDH...............------------------
GSTF3_MAIZE/107-203----------------FHPNASPLVF--------------QLLVRPLL..............------------------
GSTP1_BOVIN/97-188----------------VEDLRCKYVS--------------LIYTNYE...............------------------
GSTM2_CHICK/104-192----------------LMDLRMAFAR--------------LCYSPDF...............------------------
GSTM2_RAT/104-192----------------AMDTRLQLAM--------------VCYSPDF...............------------------
GSTF1_MAIZE/110-201----------------LNPILFQVLI--------------SPMLGG................------------------
GSTM2_HUMAN/104-192----------------FMDSRMQLAK--------------LCYDPDF...............------------------
GSTA1_HUMAN/99-192----------------IADLGEMILL--------------LPVCPPE...............------------------
EF1G_HUMAN/106-198----------------IVPPASTWVF--------------PTLGIMH...............------------------
EF1G1_YEAST/107-199----------------LCIQIANTIV--------------PLKGGAP...............------------------
SYVC_HUMAN/107-198----------------LIPAACGATL--------------PALGLR................------------------
GSTO1_CAEEL/120-219----------------LTAVAHAVPL--------------LFAVMR................------------------
GSTMU_CAVPO/103-191----------------VMDIRMQLIM--------------LCYSPDF...............------------------
GSTX6_SOYBN/99-198----------------FWSKFIDDKI--------------VGAVSKSV..............------------------
GSTA_ECOLI/100-189----------------YIATELHKGF--------------TPLFRPD...............------------------
GSTX1_SOLTU/95-192----------------FWAKYVEDK.--------------GAAVWKSF..............------------------
GSTA4_MOUSE/99-192----------------TQDLMMMIAV--------------APFKTPK...............------------------
GST1_DROME/141-235----------------INDFRLKIAV--------------VSYEPED...............------------------
GSTP1_CAEEL/94-186----------------LRDLHTKYTT--------------MIYRNYE...............------------------
GSTF1_WHEAT/111-210----------------YYPAISPVVF--------------ECIIIPFIIP............------------------
GST1_YEAST/114-218----------------LQPPLMIEFI--------------LSKVKDSGMPFPI.........------------------
URE2_YEAST/223-345----------------HAPMIGQALH--------------FRYFHSQKIASAVERYTDE...------------------
EF1G2_YEAST/104-196----------------VMSNIARPFL--------------SFKGLIP...............------------------
YIBF_ECOLI/96-192----------------LADGIMDAGL--------------VSVREQARP.............------------------
EF1G_SCHPO/99-196----------------FTNSELPGAF--------------RPIIAPRVF.............------------------
B0UTU6_HISS2/103-194----------------..MLRIEQDW--------------YPVLEKA...............------------------
B4EWL4_PROMH/103-189----------------...SEVHKGY--------------SPLFSSD...............------------------
F6V028_XENTR/108-198----------------..PPASAWVF--------------PTLGIMQ...............------------------
G2IN92_9SPHN/107-234----------------FCWCVSTIGW--------------AFGIKAIAQKMSDEEFEEHINK------------------
GST28_SCHMA/104-195----------------..DVEHEYHK--------------TLMKPQE...............------------------
SSPA_ECOLI/102-194----------------.YMHRIEKDW--------------YTLMNTII..............------------------
Q4CXW2_TRYCC/105-198----------------..ATELDAAS--------------EPFVHHA...............------------------

PF13410

A0L6K1_MAGSM/131-194----------------AQI..QQA..--------------......................------------------
A0LDX3_MAGSM/121-185----------------SQW..LAH..--------------......................------------------
A1AV55_RUTMC/124-190----------------KKD..ANK..--------------......................------------------
A1B210_PARDP/196-269----------------QDA..YHD..--------------......................------------------
A1CDY3_ASPCL/184-260----------------QEA..YNQ..--------------......................------------------
A1S3B6_SHEAM/120-184----------------AFW..TSR..--------------......................------------------
A1TQ85_ACIAC/453-519----------------PP....GA..--------------......................------------------
A1U867_MARAV/117-182----------------QQI..FDS..--------------......................------------------
A1WJX2_VEREI/124-191----------------EDW..KTA..--------------......................------------------
A2AJ28_MOUSE/127-207----------------YQQ..LLR..--------------......................------------------
A2Q995_ASPNC/149-217----------------ITN..AQE..--------------......................------------------
A2QH45_ASPNC/187-263----------------QEE..YND..--------------......................------------------
A4RZE0_OSTLU/123-196----------------GMP..RQG..--------------......................------------------
A4YLR1_BRASO/127-234----------------AGR..IARMV--------------APKTADADIARLSEKIR.....------------------
A4YXA6_BRASO/141-211----------------APS..LPL..--------------......................------------------
A5GJY1_SYNPW/170-241----------------RDQ..FQR..--------------......................------------------
A5VCI8_SPHWW/122-190----------------GSD..SAE..--------------......................------------------
A6R8D9_AJECN/127-204----------------IPV..SDE..--------------......................------------------
A6T619_KLEP7/122-188----------------QPW..IAR..--------------......................------------------
A7HP97_PARL1/145-226----------------RAA..LHAQG--------------IGR...................------------------
A7HPN1_PARL1/131-202----------------EEA..IA...--------------......................------------------
A7HWV6_PARL1/136-238----------------AGW..LGAVP--------------EAELGEAAAAFLSR........------------------
A7IBJ5_XANP2/127-190----------------RPK..VET..--------------......................------------------
A7IPF7_XANP2/133-196----------------DDV..TSH..--------------......................------------------
A8BBE3_GIAIC/125-191----------------SEC..IAA..--------------......................------------------
A8GAF3_SERP5/122-189----------------QPW..LDR..--------------......................------------------
A8I0K9_CHLRE/123-191----------------VAA..LEE..--------------......................------------------
A8P0W9_COPC7/143-215----------------PAS..VTPSK--------------......................------------------
A8PWD6_MALGO/165-250----------------ADI..HAAL.--------------......................------------------
A9BRB1_DELAS/118-188----------------DST..RER..--------------......................------------------
A9CJG7_AGRT5/129-216----------------DRV..YFRDS--------------RTKALGRP..............------------------
A9ENK0_SORC5/120-185----------------SSV..MQR..--------------......................------------------
A9G573_SORC5/130-198----------------SAH..HAK..--------------......................------------------
A9G5M8_SORC5/132-224----------------PKL..REELL--------------ARVRENFR..............------------------
A9GLX2_SORC5/161-243----------------EAH.......--------------......................------------------
A9RED4_PHYPA/166-240----------------PVV..QQR..--------------......................------------------
A9RIP1_PHYPA/191-298----------------ELL..TQGGS--------------TVEKFLAWIMLPLLR.......------------------
A9SSZ0_PHYPA/249-317----------------MGA..FEN..--------------......................------------------
A9SZI4_PHYPA/403-470----------------EAR..LNE..--------------......................------------------
A9VD76_MONBE/143-208----------------KDT..LPL..--------------......................------------------
B0CZV3_LACBS/156-232----------------EEQ..IAK..--------------......................------------------
B0DMK1_LACBS/141-206----------------RQQ..LES..--------------......................------------------
B0T373_CAUSK/123-185----------------QDL..FDR..--------------......................------------------
B0U7F7_METS4/125-203----------------FKL..WGG..--------------......................------------------
B0UCA1_METS4/160-231----------------LRP..AEE..--------------......................------------------
B1Y635_LEPCP/144-209----------------LAE..QPA..--------------......................------------------
B2B7D3_PODAN/137-206----------------EAF..NEG..--------------......................------------------
B2GG80_KOCRD/207-280----------------QQA..YDA..--------------......................------------------
B2J7I4_NOSP7/169-243----------------PNE..LAS..--------------......................------------------
B2UK10_RALPJ/126-192----------------RET..AR...--------------......................------------------
B4N5A8_DROWI/142-215----------------PAQ..V....--------------......................------------------
B4R810_PHEZH/136-206----------------RAA..APH..--------------......................------------------
B6GZF3_PENCW/142-236----------------QEY..FRRTR--------------EASLGHRLED............------------------
B6INT9_RHOCS/122-191----------------AGW..VSR..--------------......................------------------
B6IWS7_RHOCS/197-270----------------QDA..YEE..--------------......................------------------
B6JAK1_OLICO/121-185----------------PMW..IAR..--------------......................------------------
B8C0F0_THAPS/181-261----------------GSS..LPG..--------------......................------------------
B8CA81_THAPS/207-302----------------PVA..VTE..--------------......................------------------
B8CLJ2_SHEPW/123-188----------------QQY..YRQ..--------------......................------------------
B8EKE6_METSB/125-187----------------EAI..KSE..--------------......................------------------
B8IAD7_METNO/126-190----------------DKV..IAR..--------------......................------------------
B8LD48_THAPS/125-192----------------DMA..KTQ..--------------......................------------------
B8LWW9_TALSN/704-780----------------QED..YDK..--------------......................------------------
B8MAD4_TALSN/131-201----------------DDQ..VAL..--------------......................------------------
B8MMG1_TALSN/173-241----------------QNWLAIDA..--------------......................------------------
B8NN14_ASPFN/137-207----------------KKE..VERLL--------------V.....................------------------
B8PKG3_POSPM/157-232----------------IRG..GKE..--------------......................------------------
C1E0N8_MICSR/130-200----------------ADR..MAV..--------------......................------------------
C1E269_MICSR/572-669----------------EAS..SDDIV--------------VDVDNV................------------------
C1E340_MICSR/1002-1082----------------AQT..RER..--------------......................------------------
C1E340_MICSR/1335-1412----------------AFR..LNA..--------------......................------------------
C1E340_MICSR/1667-1747----------------PAL..RQR..--------------......................------------------
C1EEB2_MICSR/138-221----------------AAL..RER..--------------......................------------------
C1EFU5_MICSR/220-287----------------QTH..EEL..--------------......................------------------
C1GU35_PARBA/153-226----------------NPL..IAL..--------------......................------------------
C1MTQ1_MICPC/148-219----------------P....GDA..--------------......................------------------
C1MWR5_MICPC/124-195----------------EDN..KAM..--------------......................------------------
C1MYW2_MICPC/249-328----------------AEA..SRR..--------------......................------------------
C3Y1F6_BRAFL/230-307----------------QGM..GRHSQ--------------......................------------------
C5AAI5_BURGB/120-192----------------DET..RER..--------------......................------------------
C5BTC1_TERTT/126-189----------------EGI..LRQ..--------------......................------------------
C5CUS5_VARPS/135-201----------------AVM..LER..--------------......................------------------
C5CZN1_VARPS/195-312----------------KAS..MQTVY--------------DYKVMALERLIADNAGEPELVA------------------
C5D1E8_VARPS/125-190----------------QAL..LDA..--------------......................------------------
C5FDK1_ARTOC/126-203----------------IPV..YDG..--------------......................------------------
C5GMZ6_AJEDR/248-332----------------QEA..YEN..--------------......................------------------
C5KH39_PERM5/146-220----------------DKM..VAG..--------------......................------------------
C5KQA0_PERM5/164-239----------------LPE..VDR..--------------......................------------------
E8RLA4_ASTEC/120-184----------------AVW..LKR..--------------......................------------------
C6XNN1_HIRBI/148-224----------------EQG..LSR..--------------......................------------------
C6XRQ4_HIRBI/121-230----------------EAA..IRAFD--------------EYFVSEKPENRKEMLQDS....------------------
C7YRS8_NECH7/127-221----------------AYY..RDRGD--------------FLGTELN...............------------------
C7ZGQ3_NECH7/146-213----------------AHA..AKL..--------------......................------------------
C7ZM60_NECH7/221-306----------------QYA..YDQ..--------------......................------------------
E6WEX2_PANSA/122-189----------------QPW..LDR..--------------......................------------------
C9SJL3_VERA1/160-242----------------THS..IDN..--------------......................------------------
C9SW24_VERA1/159-239----------------TQG..GDE..--------------......................------------------
D2VLV0_NAEGR/154-242----------------DAV..ITE..--------------......................------------------
D3BDL7_POLPA/178-253----------------QEI..YNT..--------------......................------------------
D3BFK7_POLPA/158-266----------------PVA..VRGML--------------AGVPPMLFGIISRIAK......------------------
D3BS36_POLPA/173-246----------------QAD..YET..--------------......................------------------
D4AIT6_ARTBC/160-238----------------NKA..REE..--------------......................------------------
D4AJL6_ARTBC/139-210----------------PEL..SAN..--------------......................------------------
CLIC1_HUMAN/142-212----------------NYL..TSP..--------------......................------------------
Q012T3_OSTTA/160-232----------------RKT..RSE..--------------......................------------------
Q017S3_OSTTA/231-304----------------QEA..YDQ..--------------......................------------------
Q092M3_STIAD/123-189----------------SAY..LVK..--------------......................------------------
Q0BV02_GRABC/124-186----------------DAV..IER..--------------......................------------------
Q0BWT6_HYPNA/123-219----------------EAF..IKDRE--------------QLSGRPFN..............------------------
Q0C681_HYPNA/120-229----------------AAS..IRVLV--------------QINGGKRPRAYKTPAKQI....------------------
Q0CJU0_ASPTN/163-232----------------EQA..WAA..--------------......................------------------
Q0U052_PHANO/145-222----------------KEE..LEGGY--------------......................------------------
Q0V763_PHANO/145-227----------------KEA..MEAGR--------------......................------------------
Q0V763_PHANO/476-547----------------DEW..VEG..--------------......................------------------
Q119J9_TRIEI/182-256----------------EAQ..LLN..--------------......................------------------
Q11II4_CHESB/120-190----------------QVW..VDR..--------------......................------------------
Q15Y89_PSEA6/118-181----------------KLF..FKL..--------------......................------------------
Q16DN2_ROSDO/135-224----------------AAG..VRRKT--------------LSGLHSQ...............------------------
Q1CXG6_MYXXD/156-248----------------ARF..VARKH--------------QAP...................------------------
Q1LMA0_RALME/129-215----------------KAF..VADRK--------------AMRGDT................------------------
Q219M8_RHOPB/125-189----------------QAW..YDD..--------------......................------------------
Q21NV3_SACD2/125-196----------------DNR..AKD..--------------......................------------------
Q28VM3_JANSC/126-191----------------NDW..FDA..--------------......................------------------
Q2RP79_RHORT/128-193----------------DKW..IDR..--------------......................------------------
Q2Y8A0_NITMU/202-275----------------QSV..YEK..--------------......................------------------
Q3IWV3_RHOS4/128-191----------------PEA..VQA..--------------......................------------------
Q3IXJ7_RHOS4/202-274----------------QEA..YDE..--------------......................------------------
Q3SJZ3_THIDA/124-195----------------DAL..REN..--------------......................------------------
Q47WD3_COLP3/155-230----------------RHS..LEE..--------------......................------------------
Q4KEB7_PSEF5/127-192----------------ARV..RAA..--------------......................------------------
Q4PA85_USTMA/231-359----------------FAE..VKIGR--------------QRWAKVS...............------------------
Q4PBA3_USTMA/148-231----------------KQR..IAF..--------------......................------------------
Q4PEE8_USTMA/196-272----------------QEV..YDK..--------------......................------------------
Q4PH05_USTMA/169-242----------------NTS..LAE..--------------......................------------------
Q54DU4_DICDI/215-290----------------QQE..YTD..--------------......................------------------
Q5K7H9_CRYNJ/151-218----------------DQV..A....--------------......................------------------
Q5LMS6_RUEPO/132-224----------------KPV..TNRIR--------------AQVLRGLD..............------------------
Q5LRR6_RUEPO/138-209----------------EAH..LDR..--------------......................------------------
Q6C3X4_YARLI/164-237----------------ETI..KNQ..--------------......................------------------
GSTL1_ARATH/146-212----------------VKE..TAS..--------------......................------------------
Q7NTJ7_CHRVO/121-190----------------PPW..LER..--------------......................------------------
Q7V893_PROMM/166-242----------------QAG..REQ..--------------......................------------------
Q7VCF4_PROMA/134-205----------------GIE..AEE..--------------......................------------------
Q88AE2_PSESM/125-190----------------DQW..LDN..--------------......................------------------
Q8XXV1_RALSO/117-188----------------DNF..KAR..--------------......................------------------
Q9FL98_ARATH/201-270----------------DVE..VK...--------------......................------------------
GSTL2_ARATH/195-261----------------TNA..ADV..--------------......................------------------
Q9NA74_CAEEL/171-244----------------TFS..REE..--------------......................------------------
B2UD16_RALPJ/121-186----------------.PW..VER..--------------......................------------------
B4EEI7_BURCJ/123-196----------------.PW..VDR..--------------......................------------------
C5AZ79_METEA/124-188----------------AAW..IEG..--------------......................------------------
E7KR93_YEASL/151-241----------------..V..YES..--------------......................------------------
G8PGF5_PSEUV/127-190----------------.DW..VDY..--------------......................------------------
G8PGF6_PSEUV/125-190----------------..W..IER..--------------......................------------------
G8PGT3_PSEUV/202-274----------------QAA..YEE..--------------......................------------------
G8PTB8_PSEUV/192-263----------------QAA..YDE..--------------......................------------------
H3CB38_TETNG/137-223----------------.AL..NER..--------------......................------------------
H3CIP6_TETNG/126-213----------------..A..NEN..--------------......................------------------
GSTX2_MAIZE/128-201----------------.......Q..--------------......................------------------
Q3IY08_RHOS4/123-186----------------EPW..VEG..--------------......................------------------
Q7SF99_NEUCR/240-329----------------..T..IDE..--------------......................------------------
R7G4S4_9FIRM/257-325----------------.....YWD..--------------......................------------------

PF14497

F0X3Q4_CRYPV/161-266SITANNLF........SGW.VQHLMG............................KEGSIEAV------------------
Q5CKJ7_CRYHO/161-266SITANNLF........SGW.VQHLMG............................KEGSIEAV------------------
B8CAA6_THAPS/182-300VKLFPSRI........HEKELYQEHD...........................ELVKFVHSN------------------
A8XWB3_CAEBR/131-230KLFLRAKV........E...FDKGKK....................................------------------
E3N1N5_CAERE/175-274KLFLRAKV.........EFDKGKKEP....................................------------------
EXC4_CAEEL/130-229KLFLRAKV........E...FDKGKK....................................------------------
F1KT43_ASCSU/135-234KVFLRMKI.........DYDREKRTP....................................------------------
A8NYA7_BRUMA/133-234KIFLRSKS........EHD.REQKAS....................................------------------
E1GBX8_LOALO/133-234KIFLRSKS........EHD.REQKGS..........................SPTPVD....------------------
Q24F18_TETTS/217-335QLYWKSHS........KSY.TEQSKR..........................ALVLRVARIQ------------------
F2TJD5_AJEDA/76-203SHHDCADF........VYY.FHWANG..........................TFQPFLGRLM------------------
A6G9D5_9DELT/106-239NTYWAIIR........HRYFVDENWE..............QYRGIVGGLLAPGAPDEVKAQV------------------
E3Q3M1_COLGM/143-285RAYFLVLY........ERW.RDQFDT......MWNDGPFAHFV.........WGAKQISTQA------------------
B2B5D5_PODAN/109-260KLQFFNTR........EQW.VDNYYP...MREGILGQGGAGLP.........WVMQWLIGGK------------------
Q0U682_PHANO/112-249KLFFYNAR........ERW.VDNFYT.......MRDYSMAQLP.........FPQRYIFGYM------------------
A1CCM4_ASPCL/109-245KLCLYHMR........ERW.VDNYYT................MRDHILSTLPAPVRVLVGLL------------------
Q2GX63_CHAGB/116-255KLYFYQVR........ERW.IDNYYV.......MRDNALSAMP.........FFVRFFIGLL------------------
E3M3K7_CAERE/109-240LAYSRGQD........FSW.LRDDRK......IIEDFSLIQLY.........FWRNWIVPQM------------------
D7FWB3_ECTSI/120-218NAVAKLE.........PAWTTLHFNK....................................------------------
F1KXU8_ASCSU/112-193.......A........FAFFIKEVST....................................------------------
E8Z6E4_PFIPI/96-208ALQSALLV........DEA.MALVDG...................................V------------------
A1AB54_ECOK1/45-122................FTF...........................................------------------
C1HKK3_9ESCH/61-138.....FTF........ADY...........................................------------------
E9TQV2_ECOLX/45-122.....FTF........ADY...........................................------------------
E0QYH5_ECOLX/45-128.....FTF........ADYPKRWASD....................................------------------
B5FXM3_TAEGU/120-251NMLLTAELY.......LQW.RDDVTV....EEITHPRYGSPYP.........WPLNRILSYQ------------------
E1BVN1_CHICK/113-243MLLTAELY........LQW.CDDVTV.............EEITHPRYGSPYPWPLNRILSYQ------------------
E9G0M2_DAPPU/109-235HFYWLIVL........QRF.VYTKGK...TLFQIQTSLPSILR.........LMMPIIARKV------------------
E9GQJ6_DAPPU/107-233HLYWVMLV........WRW.IYNGGS....................SLPLIQTDLHFAVRYL------------------
Q9NAG5_CAEEL/170-288NVEKMLDQ........FDPKLFGIFG..........................FLFKLIGSRT------------------
A8XYN3_CAEBR/159-290...KSMSI........SAW.FYRMENTEKMLDLFDPKVFGLFS.........SILKMINSRF------------------
E3MMS1_CAERE/154-288MTEKSMAI........SAW.FYRMENVEKLLDLFDPKVFGLFG.........SLFKMIDSKF------------------
C5LXL1_PERM5/112-245HTFFLCVN........DRW.FNYPDL.....FSQYLGTIQTYP.........VFLRPLVKMI------------------
E2R3Q0_CANFA/144-275HFYWTLAY........CQW.VDNLNE............TRKMLSLSGGGPFSNLLRWVVCHI------------------
G3QJ55_GORGO/197-328HFYWTLAY........CQW.VDNLNE...TRKMLSLSGGGPFS.........NLLRWVVCHI------------------
FAXC_RAT/197-328HFYWTLAY........CQW.VDNLNE...TRKMLSLSGGGPFS.........NLLRWVVCHI------------------
D2HID7_AILME/197-339HFYWTLAY........CQW.VDNLNE...TRKMLSLSGGGPFS.........NLLRWVVCHI------------------
B3S4C5_TRIAD/106-233NTIWAVIVYNRFIED.FEW.FGKCVP...............LP.........WFKYYVFKLM------------------
B3S5C1_TRIAD/137-264NTIWATMVQDRMFECFDEC.MAIYEV................S.........YVFKLVIKYY------------------
B3RZK8_TRIAD/97-224NTFWATIEQARLYDGLDEW.LDLVDV................N.........SSMRSFFKNQ------------------
D0N2R1_PHYIT/80-174................IEWEANTLSP....................................------------------
E3M1A0_CAERE/120-266GFYSRSQT........FKW.IGTDAG.......YGKSFSGIKA.........FFLKRVVVPR------------------
S7UUE1_TOXGO/396-511TMQESLET........FSYLLTHPSF..........................SYFQQLSGRW------------------
B9QR24_TOXGO/404-519TMQESLET........FSYLLTHPSF..........................SYFQQLSGRW------------------
F0VEQ6_NEOCL/393-510TMQESLET........FSYLLTHPSF..........................SYLQQLSGRW------------------
E9J013_SOLIN/261-381TINESYKT........FNW.FSEVGK...........WEEYFP.........SWERLLIVNV------------------
PGES2_MOUSE/252-367TPAEALAS........FDY.IVREGK...............FG.........AVEAAMAKYV------------------
D4AE56_RAT/252-367TPAEALAS........FDY.IVREGK...............FG.........AVEATMAKYV------------------
F1N1J6_BOVIN/250-365TPAEALAS........FDY.IVKEGN........................FGTVEGAMAKYM------------------
F1RRY6_PIG/253-368TPAEALAS........FDY.IVKEGN........................FGTVEGAMAKYM------------------
F1P9X4_CANFA/252-367TPAEALAS........FDY.IVREGK........................FGAVEGAVAKYM------------------
B4YY03_CANFA/250-365TPAEALAS........FDY.IVREGK........................FGAVEGAVAKYM------------------
D8RW70_SELML/135-249STKEALQA........FDY.ITREGN...............FT.........AWERATAKYA------------------
Q9FHX0_ARATH/192-305NTSEALES........FEY.ITTHGN...............FS.........FTERLVAKYA------------------
D3BAJ2_POLPA/71-164IFSFVLSV........ADM.LDSLIK....................................------------------
F1KQF6_ASCSU/105-183DIVEQIQV........DEW.VTSVEE....................................------------------
B2BXI7_ARALL/100-207DPYEKAMA........RFW.AKFVDE...................................Q------------------
D7LL96_ARALL/100-207DPYEKAMA........RFW.AKFVDE...................................Q------------------
B9RCA3_RICCO/93-207KRAKVHAV........LDWHHSNLRR.........................GSVMYVLNTKL------------------
D8QNB8_SELML/101-218DPQQRAQI........DSI.LDWHHG..........................NLRRGATGLF------------------
D8R6V3_SELML/101-218DPQQRAQI........DSI.LDWHHG..........................NLRRGATGLF------------------
B9T6C9_RICCO/29-125DPYERAN.........ARF.LAQFVD....................................------------------
F0WN27_9STRA/91-187....DTAV........DDW.IEWEAS..................................HL------------------
D6WU61_TRICA/72-170AAKAASEY........LEWEAAVLAP....................................------------------
E4UVV4_ARTGP/48-141..AERAEI........ESW.LAEVSR....................................------------------
D4DGR0_TRIVH/48-141..AERAEI........ESW.LCEVRK....................................------------------
D4AT40_ARTBC/48-141..AERAEI........ESW.LGDVRK....................................------------------
F2PV52_TRIEC/48-141..AERAEI........ESW.LGEVSK....................................------------------
F2RVW7_TRIT1/48-141..AERAEI........ESW.LGEVSK....................................------------------
A0A022TE31_TRIRU/48-141..AERAEI........ESW.LGEVSK....................................------------------
C4JDF5_UNCRE/48-138..AEQDEI........NQW.LSQSSD....................................------------------
Q4WZS4_ASPFU/48-138..EEQASI........KQW.LDTISG....................................------------------
B8CBE8_THAPS/169-259CEESVAIV........DQW.VDYALS....................................------------------
F0YCB2_AURAN/642-721SPADAALV........DQW.VELSLS....................................------------------
A3LWB3_PICST/76-162SVLTAELG........NVW.SKFAVD....................................------------------
Q6BKC8_DEBHA/81-164...EQAKS........QEW.VKFALD....................................------------------
Q4U9H7_THEAN/88-189SAFERSDT........SSW.VEFFYS....................................------------------
D8U415_VOLCA/66-148TPEMQAQV........TAW.LTWATI....................................------------------
D8TWM4_VOLCA/86-193AASCEAAA........LAW.VEPFAA..........................KADDAAREAA------------------
F2UBC5_SALR5/67-152NATQATEV........DHW.IDLAQY....................................------------------
Q7Q3I3_ANOGA/70-167DASKVVQR........DEW.LEWSSK..........................RLAPALTH..------------------
B4N9E6_DROWI/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B4HG12_DROSE/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B4PL45_DROYA/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B4QSD7_DROSI/73-152TAIERTQI........DHW.LSFSLT....................................------------------
SYEP_DROME/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B3M314_DROAN/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B3P8B5_DROER/73-152TAIERTQI........DHW.LSFSLT....................................------------------
B4JT86_DROGR/72-151TAIERTQI........DHW.LSFSLT....................................------------------
B4K6U5_DROMO/72-151TAIERTQI........DHW.LSFSLT....................................------------------
X1Y0E9_ANODA/694-773TPIERTQI........DHW.LTYTLS....................................------------------
B0XC16_CULQU/71-150TPIERTQI........DHW.LTYTLS....................................------------------
Q178Q6_AEDAE/71-150TPIERTQI........DHW.LTYTLS....................................------------------
B7PKR5_IXOSC/70-155SALEHTEV........DHW.IEFAVG....................................------------------
C3XZ88_BRAFL/70-155NSLEATEV........DHW.LEFSAG....................................------------------
F1P179_CHICK/71-156NLLEHTEI........DHW.LEFSAT....................................------------------
Q5ZJ86_CHICK/71-156NLLEHTEI........DHW.LEFSAT....................................------------------
B4DKX5_HUMAN/71-156NLMEHTEI........DHW.LEFSAT....................................------------------
SYEP_HUMAN/71-156NLMEHTEI........DHW.LEFSAT....................................------------------
Q3KQZ8_HUMAN/71-156NLMEHTEI........DHW.LEFSAT....................................------------------
Q5RCS2_PONAB/71-156NLMEHTEI........DHW.LEFSAT....................................------------------
F1S9K5_PIG/71-156NLLEHTEI........DHW.LEFSAT....................................------------------
D2HDG9_AILME/57-142NLLEHTEI........DHW.LEFSAT....................................------------------
E2QUR2_CANFA/71-156NLLEHTEI........DHW.LEFSAT....................................------------------
Q6TXE9_RAT/89-174NLMEHTEI........DHW.LEFSAT....................................------------------
B9EIU1_MOUSE/71-156NLMEHTEI........DHW.LEFSAT....................................------------------
E6ZR79_SPORE/78-163DKDQSAQV........NLY.VSQGDN....................................------------------
A8JF35_CHLRE/74-156DAVAACQV........DQW.LDQAGA....................................------------------
D8UHB4_VOLCA/73-156DALSSCQI........DQW.LETAAG....................................------------------
D8SNX9_SELML/72-156DPVTASQV........DEW.LDYSPK....................................------------------
F2DKN7_HORVD/72-156DHIQASHV........DQW.LEYAPL....................................------------------
F2EEU4_HORVD/72-156DDIQAAHV........DQW.LEYASV....................................------------------
B8LRU5_PICSI/72-156DAFATAQI........DEW.VEYATV....................................------------------
D7M5B1_ARALL/74-158NAFDSSQI........DEW.VDYASV....................................------------------
O82462_ARATH/74-158NAFDSSQI........DEW.VDYASV....................................------------------
B9RFS6_RICCO/74-158DACQSSQI........DEW.LDYSSI....................................------------------
A5B9C3_VITVI/77-161DAFESCQI........DEW.LEYAPT....................................------------------
Q4WQV0_ASPFU/145-252GSKEAEEV........TNW.IAFLDK....................................------------------
B6AZ99_9RHOB/67-130NTQINLRL........HGLGIMLQQS....................................------------------
A5DZL4_LODEL/70-158....................ANLVAK....................................------------------
C8V321_EMENI/98-189VDAVADTY........IDWRSQWVAS....................................------------------
Q5B0A6_EMENI/118-205LTWTMARQ........SQW.VASLKG....................................------------------
C1FH64_MICSR/69-170....................VDEVCA....................................------------------
B7FSP9_PHATC/127-244ANAILMNA........IDY.ITNGRS................................SFHP------------------
D6V2C5_9BRAD/95-206LHQLQLTI........TDF.VVEIHD................................AHHP------------------
B2IEI5_BEII9/99-212THQIQLTI........ADL.VAEAHD................................THHP------------------
A0A058V2B3_BORPT/92-203VNQLQLTI........ADL.TAEAHD................................VHHP------------------
A0A038I621_BORBO/92-203VNQLQLTI........ADL.TAEAHD................................VHHP------------------
A3NKT4_BURP6/116-229AHQLQLTV........ADF.VVEIHD................................THHP------------------
A3P6E2_BURP0/99-212AHQLQLTV........ADF.VVEIHD................................THHP------------------
A4LR03_BURPE/99-212AHQLQLTV........ADF.VVEIHD................................THHP------------------
A8EQ36_BURPE/138-251AHQLQLTV........ADF.VVEIHD................................THHP------------------
A8KFZ3_BURPE/116-229AHQLQLTV........ADF.VVEIHD................................THHP------------------
B1H8S8_BURPE/116-229AHQLQLTV........ADF.VVEIHD................................THHP------------------
B2H8F9_BURPE/99-212AHQLQLTV........ADF.VVEIHD................................THHP------------------
C0YD09_BURPE/116-229AHQLQLTV........ADF.VVEIHD................................THHP------------------
C6U522_BURPE/99-212AHQLQLTV........ADF.VVEIHD................................THHP------------------
B4ST55_STRM5/94-204ALQLQLTI........ADL.VAEVHD................................THHP------------------
B2FRQ6_STRMK/94-204ALQLQLTI........ADL.VAEVHD................................THHP------------------
B8L691_9GAMM/94-204ALQLQLTI........ADL.VAEVHD................................THHP------------------
B0RPT3_XANCB/94-204ALQLQMTI........ADL.VAEVHD................................THHP------------------
Q4UXR8_XANC8/106-216ALQLQMTI........ADL.VAEVHD................................THHP------------------
D4SRF8_9XANT/94-204ALQLQMTI........ADL.VAEVHD................................THHP------------------
D4T9D0_9XANT/94-204ALQLQMTI........ADL.VAEVHD................................THHP------------------
F0BY29_9XANT/94-204ALQLQLTI........ADL.VAEVHD................................THHP------------------
Q3BQA5_XANC5/94-204ALQLQLTI........ADL.VAEVHD................................THHP------------------
E9EGB4_METAQ/115-231NQIALTIL........DGF.SNEVHD................................THHP------------------
E9FC33_METAR/114-231INQIALTI........LDCFSNEVHD................................THHP------------------
E6ZKH3_SPORE/113-235LHQLCATA........LDL.NNEVHD................................THHP------------------
Q4PHJ6_USTMA/131-253LHQLCATA........LDL.NNEVHD................................SHHP------------------
B2VRG1_PYRTR/83-207.TTGLIPP........SVW.STDFGK..........................DRAQLIGH..------------------
Q0U0D3_PHANO/77-203.TTGLIPS........SVW.ETSFGT....................................------------------
A1DN79_NEOFI/128-240IVQLVADV........MIWVQNDIFH.................................NRE------------------
D8M558_BLAHO/58-124..FLSISR............KKHLTN....................................------------------
E3RJP3_PYRTT/917-1001MLLTAGII........KAW.LNRRVP....................................------------------
F0XHR1_GROCL/885-987HTFIRLQK........ALI.LQDSWR....................................------------------
E9DTF4_METAQ/750-836RFQGALKLG.......DMW...........................................------------------
Q2GUC8_CHAGB/865-976RLQRGLELS.......GKW.AAALRE....................................------------------
C9SQ13_VERA1/837-927FQQGLALL........DKW...........................................------------------
E3QT63_COLGM/831-957FQQGLSLL........DKWRRLPEFD...........GGKEEG.........KAREEKAKEE------------------
Q55JP4_CRYNB/150-286SYDKALAL........SQLILTHLLPAYLASLPPPSSSRIPFH.........LHFPVPPPLY------------------
B6QBZ6_PENMQ/110-196KPIPRLVA........DNIQMNWLDK....................................------------------
E3QUV0_COLGM/128-262.....FAR........FQYLLHYVEG..........................SFFPVIVQYL------------------
C5JYK1_AJEDS/159-267TESWRRDRYF......MHY.AEGIRD..........................APVPFFIR..------------------
A3K1B8_9RHOB/77-180..AERAAY........LQW.IHFAET................................QASL------------------
B9TLA7_RICCO/51-123....EKQH........QPW.LDRVQR..........................QLLAAL....------------------
F0XEQ7_GROCL/281-416ASTSALVR........AAL.ARQLRM..........................AAAAEVWGAQ------------------
E3RS78_PYRTT/85-191..KINFFV........DTW.FSKANS....................................------------------
Q7D2W7_AGRT5/94-199SAKIVNDA........NDV.LDELTL....................................------------------
A9H2Q5_GLUDA/94-199TMKVVADA........NDV.IDEITL....................................------------------
D7AAL2_STAND/94-199TAKVVNDA........NDV.IDEITL....................................------------------
C5LY40_PERM5/101-214NFAMEAAV........DSA.VDFIAR...............................ELEVP------------------
D7FW72_ECTSI/215-297LAPAERAL........AAW...........................................------------------
C1E4T3_MICSR/78-183PARWATERW.......CEWEATALAP....................................------------------

PF16865

A4I8P2_LEIIN/97-204----------------HQIEFFLAQV------------------------------------------------------
A4I8P2_LEIIN/321-429----------------YEVGFFVENA------------------------------------------------------
Q4CZ29_TRYCC/93-200----------------HRVEFFLGEI------------------------------------------------------

PF04399

Q6D1S0_PECAS/85-210EI--------------EAW--CKSVSNA..VFNLAVPRFTKADFKE..LST....PEARHAY------------------
Q5NRG0_ZYMMO/87-214..--------------..V--LRAMHSFSGIYSLLYPRAVMAPLPE..FAT....QAARRYF------------------
Q5NQ08_ZYMMO/85-214KI--------------ANW--LERVTPL..FSSLIIPRIACAPFED..FAT....TAARAYF------------------
D5QI23_KOMHA/68-196QV--------------GEW--IQATNAI..AFRLILPRDAAAPLEE..FAT....TAARAYF------------------
H2ITY9_RAHAC/85-214SI--------------AAW--LRQVSEY..TGRLLLPRFAAAPLEE..FST....PEARKYF------------------
F2JXW1_MARM1/91-215..--------------...--LGSVNFA..INCLLFPRNIHIGLPE..FET....QSARDYF------------------
F9ZM92_ACICS/93-218.V--------------QAW--RARISDM..LFRLIAP.....TLPQ..YASLGPDPRAMTYY------------------
I0DZW0_PROSM/85-211EI--------------DKW--YNTVSTT..VYKLVVPRFTQADFPE..LRT....PEARAAY------------------
E6WDE9_PANSA/85-214AI--------------TDW--LRHVNSY..VNKLLLPRIADAAFAE..FAT....PEARHYF------------------
Q9CNB4_PASMU/85-214EI--------------EAL--LAEITSY..SNYLLMPRFVKLDLAE..FAT....QSAIDYF------------------
X2GUV6_9GAMM/86-215SI--------------ENL--IKQLQQY..DYKLECPRYIKLGLAE..FAT....QSAINYF------------------
D0NB62_PHYIT/96-224DL--------------AKW--FDTVMPL..LTVLLLPRFHAAPLPE..FTL....KESRDYF------------------
Q7MBY7_VIBVY/84-208SV--------------LDW--QRSAFLP..LQKIGYPRWSNMDLPE..FAT....QSARQAW------------------
Q65TQ1_MANSM/85-215EL--------------EVQ--LKQIGSY..YNHLLLPRFVKLGLAE..YNT....QSALNYF------------------
F4HD49_GALAU/85-214EV--------------SQW--LQKVGSY..YNHLVIPRFTQIGLKE..FAM....PESVEYF------------------
A8AI12_CITK8/69-198AI--------------DEW--LRKVNGY..ANRLLLPRFAKSAFDE..FST....PSARKYF------------------
Q5E4G7_VIBF1/86-215EI--------------SEW--LNAARPL..FAKLTFSRWTQLDLPE..FAR....PEAITWF------------------
K3W8Q1_PYTUL/137-266DI--------------KQW--IKDTAEV..FRLLYHPRFHAAVFPE..FAQ....KESREYY------------------
Q7DD88_NEIMB/82-212EI--------------RAW--LDKVGGY..NDKLVQPRVIKIGLPE..FAT....PEAVKYF------------------
E0SAU3_DICD3/85-214AI--------------DAW--IRRVYEY..APRLLIPRFSRADFEE..FAT....DAGRNYF------------------
M4BU42_HYAAE/154-283EV--------------RQW--ITDTAEV..FRLLYHPRFHAASFAE..FAT....RESREYY------------------
A8GFK9_SERP5/85-214AI--------------AEW--LQRVGSY..SLNLLLPRFANADFEE..FAT....AAARQYF------------------
Q5NH24_FRATT/91-214..--------------...--.TDLEPH..YRRIIYPRIPHHPRNECDFPT....QSAKEYF------------------
X2HAQ1_9NEIS/85-214EI--------------EGW--IKIVDTY..RNFLTLPRCISINLPE..FAT....QNAINYF------------------
A1S8P5_SHEAM/96-225HI--------------AAW--LDKAGYY..SSRLLHPRNVRMGLPE..YGS....EAAIRWY------------------
H3G9G4_PHYRM/122-251EI--------------KQW--IKDSADV..FRLLYHPRFHAAPFAE..FAM....LESREYY------------------
D7FTR2_ECTSI/110-242DL--------------DGW--VSSAAML..MRRLVRPRNAVTPLAE..FQT....RSAREAF------------------
W0L8R1_SERFO/85-214AI--------------ANW--LQHVDGY..RNKLLLPRFANADFEE..FAT....DSARRYF------------------
A6VNZ1_ACTSZ/85-215EL--------------EVW--MKRVGGY..YNHLLLPRFVQLGLAE..FAT....QSAIDYF------------------
A7MM21_CROS8/89-214AI--------------KQW--CESVSTP..LFNLAIPRFTEGDFAE..LAT....PQARRAY------------------
F0YIM1_AURAN/118-251DL--------------KAW--QKSVQQP..LRLLQRPRYVKTYLPE..FVT....RSSKDAF------------------
K7SWA6_GLUOY/88-217EI--------------AHW--LKAGSRA..MYRLFLPRAVCTPLPE..FAT....TSARAGF------------------
F0LUD7_VIBFN/86-215NI--------------AEW--QRQIAPF..NGPLVHPRWMMIELPE..FQL....PEAKAWY------------------
Q9KKV8_VIBCH/84-211AT--------------LDW--QRSAFLP..LQKIGYPRWSNMNLPE..FKT....ASAQQAW------------------
H8L0T2_FRAAD/85-207AI--------------EAW--VKSVWRI..TIRLAVPRFVEGDFPE..LAT....TEAREAF------------------
Q6LNL6_PHOPR/86-215KI--------------AQW--SEKTRPY..SSLLLYPRWLKIDLPE..FQC....QEAKEWF------------------
Q5FQY7_GLUOX/87-216EI--------------AAW--LKKAGTP..LYRLFLPRAAAAPLPE..FAT....TSARAGF------------------
W0HW21_9ENTR/85-214AI--------------GKW--LKDISDT..AQRLLLPRFVRASLEE..FAT....EQARRYF------------------
H3GPY7_PHYRM/353-482DI--------------KRW--IEESAHV..LHALYHPRVHKAPFAE..FAQ....QESRDYY------------------
B2VDJ5_ERWT9/85-214AI--------------SDW--LRHISSY..VNKLLIPRVAEAPFAE..FAT....PEARRYF------------------
U4KES9_9VIBR/86-215KI--------------SGW--LGQSFEF..SGPLLYPRWLMIELPE..YGS....EDAKAWF------------------
Q87J67_VIBPA/85-208.V--------------LDW--QKQAFLP..LQKVGYPRWSNMTLPE..FAT....ETAKQAW------------------
Q15Q78_PSEA6/101-230DV--------------SAW--LKDVNLL..MKQLLYPRWVTSPVKE..FQT....QSAIDYF------------------
C7JHY2_ACEP3/84-213EI--------------SDW--ISRSSSL..LYRQFLPRAAAAPFPE..FST....TSGRAYF------------------
F0YIS1_AURAN/125-254DV--------------ADW--LDRVGDT..RKWLERPRLITMPVPD..FAD..PRDVAYSRW------------------
Q6D468_PECAS/85-214AI--------------AAW--LRKVTEY..TPRLIIPRFAQAAFEE..FAS....APARQYF------------------
G2I7E0_GLUMN/84-212EI--------------SQW--ISDEAR...AYTLMLPRFAAAPLPE..FAT....TAARLYF------------------
B7VSY7_VIBSL/89-209..--------------...--QSRAFPL..TQQIGRPRWWNLDLAE..YRS....AGAKEAW------------------
C9R3A8_AGGAD/85-214EV--------------EAW--LKQVGSY..QNHLVIPRFTRLGLPE..YAT....QSAVDYF------------------

PF11801

A5DPS2_PICGU/93-276AVISLIENKLVRVHQFNLYSNLKNYEGYTRKQFKKYLPFPMMYNQPLKLYNVAQDQVRMAGLL.................
Q6BJD7_DEBHA/112-306SLTSFIENKIHNISQYNLYINTKNYEKYTRKLFQKFFPFPMMYNQPLKFYHSAQRQVQVIGLNSNNP.........GFFS
A5DUS1_LODEL/96-243GLVSQLTETLEIINQYNLFINTTNYEKYTRKLLSNFYPFPMMYNLSLSFYNTAQQKVKLLGL..................
MTX1_PIG/95-225AFMSLLEEKLLPVLIHTFWVDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCG..................
Q1L8P8_DANRE/95-225AFVSLLEEKLLPALVYTLWIDSKNYVDVTRCWYAENIPFPLNFLLPNRMHSQQLEKLRLVRG..................
M9N0R6_ASHG1/82-231SLVCWAAERCGALSDYQLYLNRKNYEQYTRRVFSQLLPWPLWYNTPVQRRERARAQRGGTPA..................
Q6C8L9_YARLI/89-259ALLAYMSS.LQTITEYCLFVDEEAYQKVTRPMFNEFMPFLMQYNVSVRLREQAKDRCCAAGIDT...............A
SAM37_YEAST/113-276SLLNYVDVEISRLTDYQLFLNTKNYNEYTKKLFSKLLYFPMWYNTPLQLRSQARENCEEIIG..................
Q6CII7_KLULA/89-254ALLQFISEELKTCTMYQLYLNPVNYNEYTSKIYSYLLHWPFWYNTPLSARSRARELCRDIMV..................
A1DFG3_NEOFI/97-262AFSSFVESRGQPLLDLSLYVSSENYYNRTSPAYGAILQWPNQWIIPPRLRSAAKSRTEHLGL..................
A7TPA1_VANPO/99-264ALFAFLENKINILVDYQLYLDKKNYDSFTRKQFPKLMYWPMWNYTPSLKRSEVRSNFENVIG..................
A7F5V7_SCLS1/99-263AYSAFIQMHGQPLLDLSLYVSSQNYTEITRPIFNTIQSFPLPYLTPPHLRTEAKKRTEYLGL..................
Q6FU46_CANGA/92-252SAMSMLDSNLKTLNEYQLYLDKNNYITFTRKELSQLLYFPFNFNAAYEYRNRAKEQCVDLEY..................
Q5B6M7_EMENI/97-261AFSSFVESHAQALLDLSLYVTSQNYYNSTSPAYGAILQWPNQWILPPQLHATAKARTEPLGL..................
A6RE67_AJECN/106-259AFSSFLESQGQPLIDLSLYVSSDNYNNATSQAYASFLQWPSQWITPPQIRKLAKKRTEYLGL..................
Q5ALP4_CANAL/109-308GLINLLINKFEYINQYNLYLNNKNYENYTRKLFSSYLPFPMMYNQPSKYYAQAQEQVKILGLSKQKVSFFDFTTGNNEQG
A3LTE5_PICST/98-286ALIAKLQYKVEYIHQYNMFVNSRNYEKYTTKLFQKYLPFPMMYNQPLKLHQNAQEQVQLLGLNKNKT..........GFF

PF14834

D5C687_ENTCC/95-211DLQKRARARQI-----QAWLRSDLVP------------------------------------------------------
A7MH37_CROS8/138-254DIEKRARARQV-----QAWLRSDLGA------------------------------------------------------
A6TBY7_KLEP7/95-211DLQKRARARQI-----QAWLRSDLMP------------------------------------------------------
YFCF_ECOLI/95-211DLENRARARQI-----QAWLRSDLMP------------------------------------------------------

PF00043

GSTA2_MOUSE/99-192----------................QREAKTALAK------------DRT-----KNRYLP-AF--------EK-VLK-
GSTA3_CHICK/99-192----------................DKVKQCAFVV------------EKA-----TSRYFP-AY--------EK-VLK-
GSTA3_MOUSE/99-192----------................EKEASLAKIK------------EQT-----RNRYFP-AF--------EK-VLK-
GSTM3_HUMAN/108-196----------................EKLKPQYLEE------------LPG-----QLKQFS-MF--------LG-KFS-
GSTF3_MAIZE/107-203----------..............GGAPDAAVVEKH------------AEQ-----LAKVLD-VY--------EA-HLA-
GSTP1_BOVIN/97-188----------................AGKE.DYVKA------------LPQ-----HLKPFE-TL--------LS-QNK-
GSTM2_CHICK/104-192----------................EKLKPAYLEQ------------LPG-----KLRQLS-RF--------LG-SRS-
GSTM2_RAT/104-192----------................ERKKPEYLEG------------LPE-----KMKLYS-EF--------LG-KQP-
GSTF1_MAIZE/110-201----------................TTDQKVVDEN------------LEK-----LKKVLE-VY--------EA-RLT-
GSTM2_HUMAN/104-192----------................EKLKPEYLQA------------LPE-----MLKLYS-QF--------LG-KQP-
GSTA1_HUMAN/99-192----------................EKDAKLALIK------------EKI-----KNRYFP-AF--------EK-VLK-
EF1G_HUMAN/106-198----------................HNKQ.ATENA------------KEE-----VRRILG-LL--------DA-YLK-
EF1G1_YEAST/107-199----------................YNKK.SVDSA------------MDA-----VDKIVD-IF--------EN-RLK-
SYVC_HUMAN/107-198----------.................SSAQDPQAV------------LGA-----LGRALS-PL--------EE-WLR-
GSTO1_CAEEL/120-219----------..................DRTLKDEK------------QRK-----VFEVLK-QA--------EN-LLA-
GSTMU_CAVPO/103-191----------................EQKKAEFLEG------------IPD-----KMKLFS-QF--------LG-KLP-
GSTX6_SOYBN/99-198----------...............FTVDEKEREKN------------VEE-----TYEALQ-FL--------EN-ELK-
GSTA_ECOLI/100-189----------.................TPEEYKPTV------------RAQ-----LEKKLQ-YV--------NE-ALK-
GSTX1_SOLTU/95-192----------...............FSKGE.EQEKA------------KEE-----AYEMLK-IL--------DN-EFK-
GSTA4_MOUSE/99-192----------................EKEESYDLIL------------SRA-----KTRYFP-VF--------EK-ILK-
GST1_DROME/141-235----------................EIKE...KKL------------VTL-----NAEVIP-FY--------LE-KLE-
GSTP1_CAEEL/94-186----------................DGKAPYIKDV------------LPG-----ELARLE-KL--------FH-TYK-
GSTF1_WHEAT/111-210----------............GGGAAPNQTVVDES------------LER-----LRGVLG-IY--------EA-RLE-
GST1_YEAST/114-218----------..........SYLARKVADKISQAYS------------SGE-----VKNQFD-FV--------EG-EIS-
URE2_YEAST/223-345----------...VRRVYGVVEMALAERREALVMEL------------DTE-----NAAAYS-AG--------TT-PMS-
EF1G2_YEAST/104-196----------................YNKK.DVDAC------------FVK-----IDNLAA-VF--------DA-RLR-
YIBF_ECOLI/96-192----------..............AAQQSEDELLRQ------------REK-----INRSLD-VL--------EG-YLV-
EF1G_SCHPO/99-196----------..............GAPYDEQAAKEA------------ETA-----IALIFA-RF--------DE-ELA-
B0UTU6_HISS2/103-194----------...............EKGSESERAIA------------LKQ-----LKEEIL-AI--------AP-VFG-
B4EWL4_PROMH/103-189----------.................TPESYLPVV------------KNK-----LKSKFV-YI--------ND-VLS-
F6V028_XENTR/108-198----------................YNKQ.ATEQA------------KEE-----IKAVLG-VL--------DS-HLK-
G2IN92_9SPHN/107-234----------NVPIPEQQLKWRRARNGFPQEMLDEE------------FRK-----VGVSVA-RL--------EE-TLS-
GST28_SCHMA/104-195----------................EKEKITKEIL------------NGK-----VPVLLN-MI--------CE-SLK-
SSPA_ECOLI/102-194----------................NGSASEADAA------------RKQ-----LREELL-AI--------AP-VFG-
Q4CXW2_TRYCC/105-198----------................FRGEPLPANA------------MDR-----VHEVLR-AL--------EA-WLE-

PF13410

A0L6K1_MAGSM/131-194----------........................G.------------REL.....VAQGFA.IL........AQ.RLA.
A0LDX3_MAGSM/121-185----------........................W.------------HGT.....IQRTLD.HL........EQ.QQP.
A1AV55_RUTMC/124-190----------........................A.------------RKI.....LKNNLI.EL........VP.LFA.
A1B210_PARDP/196-269----------........................A.------------VEE.....VFATLE.FL........DE.RLS.
A1CDY3_ASPCL/184-260----------........................A.------------VAV.....VFRALN.KL........EK.LLG.
A1S3B6_SHEAM/120-184----------........................F.------------EEA.....LLRGIR.EL........ER.QGA.
A1TQ85_ACIAC/453-519----------........................A.------------QSQ.....ARAWLV.GL........ED.RLA.
A1U867_MARAV/117-182----------........................A.------------AVA.....INKLWQ.VV........EA.KLE.
A1WJX2_VEREI/124-191----------........................Q.------------LDK.....IETALA.AL........DA.APG.
A2AJ28_MOUSE/127-207----------........................A.------------LTR.....LDSYLRAPL........DH.ELA.
A2Q995_ASPNC/149-217----------........................L.------------RDA.....FNTLVG.AA........DA.QGP.
A2QH45_ASPNC/187-263----------........................K.------------VVR.....VFGALN.KL........ER.IIA.
A4RZE0_OSTLU/123-196----------........................Q.------------IET.....FQRSVR.AL........DD.RLR.
A4YLR1_BRASO/127-234----------.....ARMVERLAYVGSNEANAPQI.------------EQG.....FVEMLD.LL........ER.HLA.
A4YXA6_BRASO/141-211----------........................H.------------LQH.....LHAQYA.WL........KS.ALA.
A5GJY1_SYNPW/170-241----------........................V.------------ASQ.....MEEAIA.AG........GG.CWL.
A5VCI8_SPHWW/122-190----------........................H.------------RTA.....GLGLLA.AL........EE.RLA.
A6R8D9_AJECN/127-204----------........................V.------------RKE.....IERILA.IW........AD.ARR.
A6T619_KLEP7/122-188----------........................V.------------TGQ.....LLAACR.EW........DA.RLA.
A7HP97_PARL1/145-226----------...................HSAEEI.------------YEL.....GAKDLA.AL........AT.LLG.
A7HPN1_PARL1/131-202----------........................C.------------ARR.....IVEMWR.GL........RS.RFG.
A7HWV6_PARL1/136-238----------.......QETLREILGGTAENRPLL.------------QST.....YDELLG.YM........EA.HLA.
A7IBJ5_XANP2/127-190----------.......................LG.------------RDI.....VSQGFS.IL........DA.ALA.
A7IPF7_XANP2/133-196----------........................G.------------REI.....VEQAFA.VL........EK.RLP.
A8BBE3_GIAIC/125-191----------........................YR------------QNR.....ILPGLT.VL........TR.DVL.
A8GAF3_SERP5/122-189----------........................V.------------QGQ.....LLAAYA.EL........EK.QLA.
A8I0K9_CHLRE/123-191----------........................Q.------------LAG.....MDDYLR.QH........EA.Q...
A8P0W9_COPC7/143-215----------.....................DDQG.------------VVN.....AKQFLD.KI........ES.RMV.
A8PWD6_MALGO/165-250----------......................TEN.------------FDN.....AMNALI.QL........EQ.IIT.
A9BRB1_DELAS/118-188----------........................T.------------LAQ.....LDKNVA.AF........AK.LAR.
A9CJG7_AGRT5/129-216----------..............LEDVVANREAE.------------IAA.....FPALLA.PI........RR.MLS.
A9ENK0_SORC5/120-185----------........................Q.------------AAA.....IEAGLD.RL........ER.DAG.
A9G573_SORC5/130-198----------........................Q.------------RTS.....LMNTMS.WL........ED.NAS.
A9G5M8_SORC5/132-224----------.............AMGIGRHSDAEI.------------VEL.....GARSLS.AL........SA.LLG.
A9GLX2_SORC5/161-243----------..........................------------RQT.....QVAVLE.EI........RE.TLA.
A9RED4_PHYPA/166-240----------........................M.------------TQD.....LKSAFA.EL........NN.GKR.
A9RIP1_PHYPA/191-298----------.......RVIYRGLKCNRPGAKEQS.------------LEV.....IDNIFK.EV........DD.ALA.
A9SSZ0_PHYPA/249-317----------........................T.------------MDK.....VNSALQ.TF........GG.....
A9SZI4_PHYPA/403-470----------........................S.------------LAC.....LDDGLE.LH........HK.EGK.
A9VD76_MONBE/143-208----------........................Y.------------FGS.....FDKMAV.AS........ND.E.D.
B0CZV3_LACBS/156-232----------..........................------------EKD.....FHAAID.GA........GE.RVA.
B0DMK1_LACBS/141-206----------........................G.------------VVK.....LKEFLT.LV........ES.LMA.
B0T373_CAUSK/123-185----------........................Q.------------AAA.....LVAGLD.LL........ER.ETP.
B0U7F7_METS4/125-203----------........................A.------------QSD.....IARIVE.IW........EE.ALA.
B0UCA1_METS4/160-231----------........................I.------------YEL.....GRRDIS.AL........AG.ILV.
B1Y635_LEPCP/144-209----------........................V.------------QAD.....LARIVA.MW........TG.CLE.
B2B7D3_PODAN/137-206----------........................L.------------VKD.....LRRINE.VW........EE.GLA.
B2GG80_KOCRD/207-280----------........................A.------------YER.....LWTALD.WV........ED.RLG.
B2J7I4_NOSP7/169-243----------........................L.------------QTA.....FEAKLD.EL........EQ.LLG.
B2UK10_RALPJ/126-192----------..........................------------ANA.....VATLLT.PL........EA.RLQ.
B4N5A8_DROWI/142-215----------........................G.------------DAS.....LYEGLD.IY........EK.ELK.
B4R810_PHEZH/136-206----------........................M.------------RAQ.....WRAYAA.WV........ED.GLS.
B6GZF3_PENCW/142-236----------...........LLDGDKENQVWDGV.------------GEV.....LGAVGD.LI........RT.HNA.
B6INT9_RHOCS/122-191----------........................Q.------------TAA.....LRRAVP.AL........EK.ARF.
B6IWS7_RHOCS/197-270----------........................A.------------AEA.....LFGTLD.WL........EQ.RLE.
B6JAK1_OLICO/121-185----------........................Q.------------IKG.....VEASCA.WL........EA.RLD.
B8C0F0_THAPS/181-261----------........................A.------------MGG.....FLDCLA.KV........DT.ALA.
B8CA81_THAPS/207-302----------........................A.------------KRQ.....FDNALE.AV........ES.ELI.
B8CLJ2_SHEPW/123-188----------........................Q.------------GEL.....FVQQLE.SL........LD.KHP.
B8EKE6_METSB/125-187----------........................G.------------RDI.....VLKALE.TV........NG.ELS.
B8IAD7_METNO/126-190----------........................Q.------------EAA.....ITAVLD.HL........DA.EAA.
B8LD48_THAPS/125-192----------........................F.------------GKL.....IDTHFP.ML.......LDT.FLK.
B8LWW9_TALSN/704-780----------........................A.------------VIP.....VFGALN.LL........EK.IIY.
B8MAD4_TALSN/131-201----------........................A.------------HPS.....FIDGFE.AF........ED.LLV.
B8MMG1_TALSN/173-241----------........................D.------------MRA.....VGESMR.TN........KA.E...
B8NN14_ASPFN/137-207----------....................IWDNA.------------RRT.....TKARLA.EL........NE.RDE.
B8PKG3_POSPM/157-232----------........................F.------------VQA.....IDGLVK.LF........QR.AQR.
C1E0N8_MICSR/130-200----------........................E.------------CER.....IERIIE.IN........GN.G...
C1E269_MICSR/572-669----------...............DEGLNVRSLV.------------QTC.....VSEAFD.TI........ER.LIA.
C1E340_MICSR/1002-1082----------........................L.------------ILL.....IRDSFK.EL........ES.LIS.
C1E340_MICSR/1335-1412----------........................I.------------ASE.....SLNDLD.SM........IG.KLK.
C1E340_MICSR/1667-1747----------........................L.------------INI.....AIDSFA.EL........EG.VIA.
C1EEB2_MICSR/138-221----------........................C.------------NAH.....FRAGLA.EF........EK.MIG.
C1EFU5_MICSR/220-287----------........................W.------------TTS.....LPHHLG.CL........EK.LCD.
C1GU35_PARBA/153-226----------........................W.------------NGR.....RQRALG.AL........DQ.RFK.
C1MTQ1_MICPC/148-219----------........................R.------------RAT.....LAAEVA.KI........ED.QMD.
C1MWR5_MICPC/124-195----------........................W.------------AEA.....FPKHYA.ML........EK.LVV.
C1MYW2_MICPC/249-328----------........................S.------------TRN.....VSSPST.AL........AL.RSK.
C3Y1F6_BRAFL/230-307----------......................EDI.------------NDI.....TEKDIM.AV........SE.FLG.
C5AAI5_BURGB/120-192----------........................V.------------ERQ.....LVSALA.AF........RR.LSR.
C5BTC1_TERTT/126-189----------........................G.------------KSL.....VAKGFN.TI........EK.QFG.
C5CUS5_VARPS/135-201----------........................T.------------AER.....IAHCWH.LM........DT.QID.
C5CZN1_VARPS/195-312----------AYRAKIVKESGGKKVCRDPAFQRAA.------------REQ.....TRQLLI.GL........ER.DLA.
C5D1E8_VARPS/125-190----------........................F.------------ELK.....TRASLQ.ML........ER.EAA.
C5FDK1_ARTOC/126-203----------........................A.------------IKE.....VENCLK.LW........GE.SRR.
C5GMZ6_AJEDR/248-332----------........................A.------------IVP.....LFASLD.RI........ES.HLQ.
C5KH39_PERM5/146-220----------........................A.------------E.K.....FISEVH.LV........PL.RMR.
C5KQA0_PERM5/164-239----------..........................------------KRR.....MKEDIE.AL........SI.ILG.
E8RLA4_ASTEC/120-184----------........................W.------------EEG.....LRRALK.AV........DG.QCV.
C6XNN1_HIRBI/148-224----------........................F.------------EETDRLYLFDKVVS.AL........SN.QLG.
C6XRQ4_HIRBI/121-230----------....IERMMDMFPSMGLNKEMGGVV.------------EKS.....FKRFVK.LL........NV.HLE.
C7YRS8_NECH7/127-221----------..............GSGMDAKKPEA.------------LVE.....LASDIG.FL........EN.ALL.
C7ZGQ3_NECH7/146-213----------........................S.------------LEY.....CKKTLT.HL........SE.YYE.
C7ZM60_NECH7/221-306----------........................D.------------VMA.....LFGALD.RV........EA.HLA.
E6WEX2_PANSA/122-189----------........................V.------------TQQ.....LLAACT.AW........NA.ALE.
C9SJL3_VERA1/160-242----------........................A.------------RSE.....FLNHIR.TL........VR.EMH.
C9SW24_VERA1/159-239----------........................S.------------WEN.....ARPVFA.KA........AA.LLR.
D2VLV0_NAEGR/154-242----------........................Q.------------LPI.....THEKIS.FLVQNGFKPNQK.GRG.
D3BDL7_POLPA/178-253----------........................N.------------VDN.....LFKTFN.EL........EE.RLE.
D3BFK7_POLPA/158-266----------.....SAVGKQLYNAGIGRCPREEI.------------YSV.....AVKDVN.SI........AK.RLG.
D3BS36_POLPA/173-246----------........................K.------------TDK.....FFAALD.DL........EK.HLG.
D4AIT6_ARTBC/160-238----------........................F.------------LGH.....LKDFIL.EM........DE.IGP.
D4AJL6_ARTBC/139-210----------........................L.------------ARK.....LVESFD.WL........ER.ELD.
CLIC1_HUMAN/142-212----------........................L.------------PEE.....VDETSA.ED........EG.VSQ.
Q012T3_OSTTA/160-232----------........................Q.------------IAE.....IKRQLD.VL........ED.VAG.
Q017S3_OSTTA/231-304----------........................A.------------VKD.....LFEALD.DI........NS.ILS.
Q092M3_STIAD/123-189----------........................Q.------------SQR.....VGSVLT.WA........ES.QLH.
Q0BV02_GRABC/124-186----------........................Q.------------RQA.....VLRGLD.FL........ET.ALP.
Q0BWT6_HYPNA/123-219----------..............VAGMKAVAPMM.------------RDQ.....WRARLM.LL........EE.RLA.
Q0C681_HYPNA/120-229----------....AQRMLARLPLVGAEGENAPAL.------------EAS.....YRQFAQ.LL........NA.HLK.
Q0CJU0_ASPTN/163-232----------........................V.------------DGA.....IREVGE.LM........LT.HQA.
Q0U052_PHANO/145-222----------......................AEC.------------LNY.....IRNMVS.FF........EE.TIM.
Q0V763_PHANO/145-227----------......................PDG.------------LQN.....IRNVFD.LF........ES.TFL.
Q0V763_PHANO/476-547----------........................Q.------------KQK.....IVRGLD.RL........QV.AAK.
Q119J9_TRIEI/182-256----------........................L.------------QTI.....FETRLD.QL........EE.TLS.
Q11II4_CHESB/120-190----------........................C.------------RAQ.....IKATIA.VL........EA.DRA.
Q15Y89_PSEA6/118-181----------........................Q.------------KER.....VNNVLA.EL........DG.QVQ.
Q16DN2_ROSDO/135-224----------...............GLGRLSQEER.------------LAR.....IEPDID.AI........TM.RLR.
Q1CXG6_MYXXD/156-248----------..................TDIGAAV.------------QEK.....VIPTLE.RL........RE.SLG.
Q1LMA0_RALME/129-215----------...............NALRMPLPEA.------------DAM.....LHETFE.RL........QE.QFA.
Q219M8_RHOPB/125-189----------........................Q.------------WTR.....VWNGLA.RF........EQ.H.D.
Q21NV3_SACD2/125-196----------........................K.------------LYR.....IATIYT.QL........EQ.QLKA
Q28VM3_JANSC/126-191----------........................Q.------------WVK.....VTRSLD.AL........ER.QWM.
Q2RP79_RHORT/128-193----------........................Q.------------KLA.....IRSTLD.VL........ES.EAG.
Q2Y8A0_NITMU/202-275----------........................A.------------VMV.....LFRCMD.EL........EQ.LLS.
Q3IWV3_RHOS4/128-191----------........................D.------------LAR.....LERIWA.EA........RA.RCS.
Q3IXJ7_RHOS4/202-274----------........................A.------------VAG.....VFEMLD.HL........EY.RLT.
Q3SJZ3_THIDA/124-195----------........................M.------------LKQ.....YAQLDD.FL........LE.HGA.
Q47WD3_COLP3/155-230----------........................I.------------LAI.....SDKSLA.SL........ST.LLA.
Q4KEB7_PSEF5/127-192----------........................A.------------AER.....LYRSWG.LF........AE.QFA.
Q4PA85_USTMA/231-359----------...............GMTQAERDVH.------------VQQ.....AVAKLE.VI........NA.ILTC
Q4PBA3_USTMA/148-231----------........................V.------------RSQ.....LMANLE.AI........ET.HLK.
Q4PEE8_USTMA/196-272----------........................E.------------VDN.....LFLALD.RL........EK.LLS.
Q4PH05_USTMA/169-242----------........................G.------------LAR.....IHSLLE.IV........QS.QAA.
Q54DU4_DICDI/215-290----------........................K.------------FNI.....LFNALD.RI........ED.TLK.
Q5K7H9_CRYNJ/151-218----------........................A.------------RKE.....LISALR.TY........AK.RIK.
Q5LMS6_RUEPO/132-224----------.............FQGMARFSEAER.------------RDR.....VERSFE.AV........TA.LLW.
Q5LRR6_RUEPO/138-209----------........................L.------------LGL.....YRGLDD.FL........VE.HNP.
Q6C3X4_YARLI/164-237----------........................A.------------KIE.....MQQLAD.TI........ENFHLR.
GSTL1_ARATH/146-212----------........................A.------------FDH.....VENALK.KF........DD.....
Q7NTJ7_CHRVO/121-190----------........................I.------------SGQ.....LLAAYD.EL........ER.VFA.
Q7V893_PROMM/166-242----------........................F.------------QIK.....ARMMEQ.QL........SA.EQG.
Q7VCF4_PROMA/134-205----------........................H.------------RKK.....AKEILK.DW........DK.RIK.
Q88AE2_PSESM/125-190----------........................Q.------------QQK.....IERSLS.YF........ER.DAI.
Q8XXV1_RALSO/117-188----------........................V.------------REQ.....LQKNIP.AT........AR.LLK.
Q9FL98_ARATH/201-270----------..........................------------..R.....LYEALD.RC........ED.ILR.
GSTL2_ARATH/195-261----------........................A.------------FDY.....IEQALS.KF........NE.G...
Q9NA74_CAEEL/171-244----------........................V.------------LDQ.....AKKDLD.AI........ST.QLG.
B2UD16_RALPJ/121-186----------........................V.------------HSQ.....LLAAVE.AL........EA.EWK.
B4EEI7_BURCJ/123-196----------........................V.------------LSQ.....LEGAYG.AL........EP.LVA.
C5AZ79_METEA/124-188----------........................Q.------------TAK.....IESALA.WF........EE.QAE.
E7KR93_YEASL/151-241----------........................E.------------VNN.....VFEHLD.KV........EK.ILSD
G8PGF5_PSEUV/127-190----------........................Q.------------QAK.....VDRALT.AF........EN.TPL.
G8PGF6_PSEUV/125-190----------........................Q.------------QGK.....VNRTLK.AF........ND.QPL.
G8PGT3_PSEUV/202-274----------........................A.------------LYP.....LFETLD.WL........ES.KLV.
G8PTB8_PSEUV/192-263----------........................A.------------VRD.....LFDALD.VL........DQ.RLE.
H3CB38_TETNG/137-223----------........................L.------------WKK.....FHSTLE.KL........NA.YLET
H3CIP6_TETNG/126-213----------........................L.------------EKG.....LLKALM.KL........DD.YLGT
GSTX2_MAIZE/128-201----------........................A.------------AED.....TRAALS.LL........EE.AFK.
Q3IY08_RHOS4/123-186----------........................Q.------------WSK.....IARALE.AV........EA.RWM.
Q7SF99_NEUCR/240-329----------........................I.------------RTE.....FHGHLK.AF........AK.EML.
R7G4S4_9FIRM/257-325----------........................A.------------YNS.....FYAAMD.LL........EE.RLE.

PF14497

F0X3Q4_CRYPV/161-266----------LNSPDFFTDG...DITGGPIIT................IFQ-----VEEFVK-SQV.........-...-
Q5CKJ7_CRYHO/161-266----------LNSPDFFTDG...DITGGPVIT................IFQ-----VEEFVK-SQV.........-...-
B8CAA6_THAPS/182-300----------ITTTVYKINS......TGNGRDHDRL............VEA-----YYNTLE-E.M.......QT-RI.-
A8XWB3_CAEBR/131-230----------.......EPS...RVEDLPAQI.KVH............YNR-----VCEQLS-N.I.......DQ-LL.-
E3N1N5_CAERE/175-274----------.............SRVEDLPAQIKVH............YNR-----VCEQLS-N.I.......DQ-LL.-
EXC4_CAEEL/130-229----------.......EPS...RVEDLPAQI.KVH............YNR-----VCEQLS-N.I.......DQ-LL.-
F1KT43_ASCSU/135-234----------......TPVE...SLPPQQAAS................YNK-----LVEQLT-N.I.......DQ-LL.-
A8NYA7_BRUMA/133-234----------.......SPT...PVDSLPPQQ.KAS............YNK-----LVEQLA-N.I.......DQ-LL.-
E1GBX8_LOALO/133-234----------.............SLPPQQKAS................YNK-----LVEQLA-N.I.......DQ-LL.-
Q24F18_TETTS/217-335----------FVQIVTNLWK...NLRSITKDIEAFK..........KTKQD-----VLKLVN-D.W.......KE-ML.-
F2TJD5_AJEDA/76-203----------MLNA...GSG...GGGDGTRGR.DPDANPNPNPRVALWNDR-----LTRSLE-N.L.......DK-RF.-
A6G9D5_9DELT/106-239----------AEGIKAGADSDARGQGYGRHTL.EEA............KVL-----YRHDLQ-A.V.......SD-LL.-
E3Q3M1_COLGM/143-285----------ARGYVNSQLW...FQGVGRYNN.DEV............KKF-----ASEVVM-S.INGFCETSLS-KL.-
B2B5D5_PODAN/109-260----------IYKDIIRTLY...GQGTGRYSS.DEV............RVL-----KEEVWE-A.I.......NA-FVV-
Q0U682_PHANO/112-249----------AYRAILRTLH...GQGTGRLSA.EEV............HSF-----RKEIWE-S.V.......TA-IL.-
A1CCM4_ASPCL/109-245----------IYRGVRATLH...GQGTGRFTA.DEI............RVF-----RREIWE-R.V.......NG-LL.-
Q2GX63_CHAGB/116-255----------AYRSTKARLL...GQGVLRFTD.DEA............KNT-----KLEVWE-N.V.......NA-LL.-
E3M3K7_CAERE/109-240----------QKRTRRRVRG...YGLSGKSAG.KEV............TIR-----TEAMLE-A.L.......AS-LL.-
D7FWB3_ECTSI/120-218----------................AGKTDL.DTD............ERR-----LNNCLE-K.I.......EN-IL.-
F1KXU8_ASCSU/112-193----------.......................D..............PKA-----LETELT-R.L.......DH-YL.-
E8Z6E4_PFIPI/96-208----------VGLAPKDQDK...ALRLQRRAEYAGE............GGG-----LWVAMG-L.L.......EG-RL.-
A1AB54_ECOK1/45-122----------.............ADYPKRWAS.DAP............VIE-----YRKSLY-IWL.......NS-QL.-
C1HKK3_9ESCH/61-138----------................PKRWAS.DAP............VIE-----YRKSLY-IWL.......NS-QL.-
E9TQV2_ECOLX/45-122----------................PKRWAS.DAP............VIE-----YRKSLY-IWL.......NS-QL.-
E0QYH5_ECOLX/45-128----------................APEQLK.KSV.............IE-----YRKSLY-IWL.......NS-QL.-
B5FXM3_TAEGU/120-251----------KQWEVRRKMK...AIGWAGKTL.EQV............LED-----VDQCCH-A.L.......SQ-RL.-
E1BVN1_CHICK/113-243----------KQWEIRRKMK...AIGWAGKSL.EQV............LED-----VDQCCQ-A.L.......SQ-RL.-
E9G0M2_DAPPU/109-235----------KS.....QTQ...AQGMGRHTK.EEA............IEM-----GMKDLR-A.M.......ST-FL.-
E9GQJ6_DAPPU/107-233----------RPVVVGRVKSQASAQGIGRHSQ.TQV............MDM-----GLKDLR-A.I.......SH-FL.-
Q9NAG5_CAEEL/170-288----------YVSALLRRIT...GSDIGFHSR.EDI............INI-----GSEDLK-A.I.......SK-YL.-
A8XYN3_CAEBR/159-290----------YASTLLKRIS...GSDIGFHNR.DDI............IKI-----GSDDLK-S.I.......SK-YL.-
E3MMS1_CAERE/154-288----------YASTLLKRIS...GSDIGFHSR.EDI............IKI-----GSDDLK-A.I.......SK-YL.-
C5LXL1_PERM5/112-245----------AKRRLLGATY...AQGIGRLPE.EER............KNR-----LSQDIS-G.L.......SK-IL.-
E2R3Q0_CANFA/144-275----------TKGIVKREMH...GHGIGRFSE.EEI............YML-----MEKDMR-S.L.......AG-LL.-
G3QJ55_GORGO/197-328----------TKGIVKREMH...GHGIGRFSE.EEI............YML-----MEKDMR-S.L.......AG-LL.-
FAXC_RAT/197-328----------TKGIVKREMH...GHGIGRFSE.EEI............YML-----MEKDMR-S.L.......AG-LL.-
D2HID7_AILME/197-339----------TKGIVKREMH...GHGIGRFSE.EEI............YML-----MEKDMR-S.L.......AG-LL.-
B3S4C5_TRIAD/106-233----------IIPYVKKCMY...GHGMGRHSP.EEI............RHI-----ARGDLM-A.L.......SI-TL.-
B3S5C1_TRIAD/137-264----------FLRVINKYRW...GHGIGRHSS.EEI............RHI-----GAKDLR-A.I.......SV-LL.-
B3RZK8_TRIAD/97-224----------GPKIVKEYSW...GHGIGRHSS.QEI............HHI-----GELDLR-S.F.......SV-IL.-
D0N2R1_PHYIT/80-174----------.......WLR...VAKAASNKN.GEL............AGQ-----LAAMLE-A.........KE-EA.-
E3M1A0_CAERE/120-266----------FERKLKAKCA...GQWIGTLTN.EEK............ISE-----LKKDIN-A.V.......CV-LL.-
S7UUE1_TOXGO/396-511----------TGSVVMRLVA...GQRKKRYAV.DDV............RQA-----LYEALD-D.F.......RR-AF.-
B9QR24_TOXGO/404-519----------TGSVVMRLVA...GQRKKRYAV.DDV............RQA-----LYEALD-D.F.......RR-AF.-
F0VEQ6_NEOCL/393-510----------TGSVVMRLVA...RQRKKRYAV.DDV............RRA-----LYDTLD-D.F.......RR-SF.-
E9J013_SOLIN/261-381----------GAMAMWLIGK...KLKKRHRLK.DDV............RQS-----LYDEAN-Y.W.......LR-GI.-
PGES2_MOUSE/252-367----------GAAAMYLISK...RLKSRHHLQ.DDV............RVD-----LYEAAN-K.W.......VT-AV.-
D4AE56_RAT/252-367----------GAAAMYFISK...RLKSRHHLQ.DDV............RVD-----LYEAAN-K.W.......VT-AV.-
F1N1J6_BOVIN/250-365----------GAAAMYFISK...RLKRRHHLR.DDV............RED-----LYEAAN-K.W.......VA-AV.-
F1RRY6_PIG/253-368----------GAAAMYLISK...RLKSRHHLQ.DDV............RED-----LYEAAN-K.W.......VA-AV.-
F1P9X4_CANFA/252-367----------GAAAMYFISK...RLKSRHHLQ.DDV............RED-----LYEAAD-K.W.......VA-AV.-
B4YY03_CANFA/250-365----------GAAAMYFISK...RLKSRHHLQ.DDV............RED-----LYEAAD-K.W.......VA-AV.-
D8RW70_SELML/135-249----------GAAAMYFISK...RLKKRHNIT.DE.............RAA-----LYEAAN-T.W.......VE-AL.-
Q9FHX0_ARATH/192-305----------GATAMYFVSK...KLKKKYNIT.DE.............RAA-----LYDAAE-T.W.......VD-AL.-
D3BAJ2_POLPA/71-164----------.............AIMGGPEQKQNFE............NVI-----APRLIK-A.W.......ES-KI.-
F1KQF6_ASCSU/105-183----------.......LLE...HGGSK.....DAL............MAL-----VIEKLG-VSH.........-...-
B2BXI7_ARALL/100-207----------ILPVGFMPLV...KAEKGIDVA................IEE-----IREMLM-F.L.......EK-EV.-
D7LL96_ARALL/100-207----------ILPVGFMPLV...KAEKGIDVA................IEE-----IREMLM-F.L.......EK-EV.-
B9RCA3_RICCO/93-207----------G......PVL...GLPVNPQAA.AEG............EKV-----LSCSLE-T.I.......ES-VW.-
D8QNB8_SELML/101-218----------MAEVIF.PMN...GAPKDTKAI.ADA............EKT-----LQSALS-N.I.......ED-IW.-
D8R6V3_SELML/101-218----------LAEVIFPMN....GAPKDTKAI.ADA............EKT-----LQSALS-N.I.......ED-IW.-
B9T6C9_RICCO/29-125----------.......EKQ...QQRRRKLRS................LKE-----LHEQMM-F.I.......EK-EL.-
F0WN27_9STRA/91-187----------APLLLHFEQK...HIDTAHFTN.QLT..............K-----LLQNRE-K.........SC-CL.-
D6WU61_TRICA/72-170----------.......TLA...HVVGGGSKQ.ENL............KAC-----LNSALN-K.L.......NK-VL.-
E4UVV4_ARTGP/48-141----------.............LAESLREGA.DAE............KLG-----LGEQLK-K.I.......NG-HL.-
D4DGR0_TRIVH/48-141----------.............LSDSLKEGA.DAE............KLG-----LGEQLK-K.L.......NA-HL.-
D4AT40_ARTBC/48-141----------.......LSD...SLKEGADAE................KLG-----LGEQLK-K.L.......NA-HL.-
F2PV52_TRIEC/48-141----------.............LSDSLKEGA.DAE............KLG-----LGEQLK-K.L.......NG-HL.-
F2RVW7_TRIT1/48-141----------.......LSD...SLKEGADAE................KLG-----LGEQLK-K.L.......NG-HL.-
A0A022TE31_TRIRU/48-141----------.......LSD...SLKEGADAE................KLG-----LGEQLK-K.L.......NG-HL.-
C4JDF5_UNCRE/48-138----------.............LAQALKKSE................TEG-----ISKLLD-I.V.......NA-HL.-
Q4WZS4_ASPFU/48-138----------.............LQNALTKDD................KSV-----VMAILG-Q.L.......NS-HL.-
B8CBE8_THAPS/169-259----------................LSKFGL................ARR-----ALSIQR-T.L.......DP-LL.-
F0YCB2_AURAN/642-721----------...................YPA................FGD-----GPGLVA-A.L.......AA-RL.-
A3LWB3_PICST/76-162----------.............KLY...VKN................FKE-----LAVDLE-K.L.......DA-HL.-
Q6BKC8_DEBHA/81-164----------.............KLSNKNFKE...................-----LAGDLE-K.L.......DA-HL.-
Q4U9H7_THEAN/88-189----------....RLDFET...KLDKSSVVT.RGS............NSD-----LSKVVV-S.L.......NN-YL.-
D8U415_VOLCA/66-148----------...................ELT.PLM............DDK-----LLKLDQ-H.L.......TS-CT.-
D8TWM4_VOLCA/86-193----------KSDVTTALEQ...LKVDLMAGN.EFL............AGD-----LLTRIK-V.........IR-TA.-
F2UBC5_SALR5/67-152----------...............NLSSKAA.KEA............VTE-----ALQLVT-NQL.......KR-RT.-
Q7Q3I3_ANOGA/70-167----------.............NMAVGSRAD.PNT............KPI-----LNTLVK-M.L.......DD-CL.-
B4N9E6_DROWI/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B4HG12_DROSE/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B4PL45_DROYA/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B4QSD7_DROSI/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
SYEP_DROME/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B3M314_DROAN/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B3P8B5_DROER/73-152----------....................CE.DDI.............SW-----ALSFLD-KSI.......AP-VT.-
B4JT86_DROGR/72-151----------....................CE.DDI.............SW-----AMSFLD-KSI.......AP-VT.-
B4K6U5_DROMO/72-151----------....................CE.DDI.............SW-----AMSFLD-KSI.......AP-VT.-
X1Y0E9_ANODA/694-773----------.........................M............EKD-----PSDELK-Y.L.......NK-CL.-
B0XC16_CULQU/71-150----------.........................M............EKD-----PADELM-Y.L.......NK-CL.-
Q178Q6_AEDAE/71-150----------.........................V............EKD-----PADELK-Y.L.......NK-CL.-
B7PKR5_IXOSC/70-155----------..................RLSQ................SDE-----LPRAVQ-S.L.......DR-AL.-
C3XZ88_BRAFL/70-155----------.....................R.LGC............PAD-----FGDAVQ-Y.L.......NQ-VL.-
F1P179_CHICK/71-156----------..................KLST................ASQ-----FLSAVQ-E.L.......NH-CL.-
Q5ZJ86_CHICK/71-156----------..................KLST................ASQ-----FLSAVQ-E.L.......NH-CL.-
B4DKX5_HUMAN/71-156----------..................KLSS................CDS-----FTSTIN-E.L.......NH-CL.-
SYEP_HUMAN/71-156----------..................KLSS................CDS-----FTSTIN-E.L.......NH-CL.-
Q3KQZ8_HUMAN/71-156----------..................KLSS................CDS-----FTSTIN-E.L.......NH-CL.-
Q5RCS2_PONAB/71-156----------..................KLSS................CDS-----FTSTIN-E.L.......NH-CL.-
F1S9K5_PIG/71-156----------...............KLSSSDL................FTS-----AVKELN-HCL.......SL-RT.-
D2HDG9_AILME/57-142----------..................KLSS................CNL-----FTSAIN-E.L.......NH-CL.-
E2QUR2_CANFA/71-156----------..................KLSS................CNL-----FTSAIN-E.L.......NH-CL.-
Q6TXE9_RAT/89-174----------..................KLSS................CDV-----LTSAIK-E.L.......NH-CL.-
B9EIU1_MOUSE/71-156----------..................KLSS................CDG-----LTSAIN-E.L.......NH-CL.-
E6ZR79_SPORE/78-163----------......LALA...DFQTATAIA.DDL...............-----......-..........DQ-HL.-
A8JF35_CHLRE/74-156----------.............ITPAALEAQ................AAA-----LNDFLQ-L...........-...-
D8UHB4_VOLCA/73-156----------...................IVS................GAA-----LESQCV-A.L.......ND-YL.-
D8SNX9_SELML/72-156----------...................FSA................GAE-----FEECCH-Y.V.......NS-YL.-
F2DKN7_HORVD/72-156----------.......................ILS............GSE-----FEAACS-F.L.......DG-YL.-
F2EEU4_HORVD/72-156----------.......................ILS............GSE-----FEVACS-F.I.......DG-YL.-
B8LRU5_PICSI/72-156----------...................FSA................GAE-----FEKSCT-Y.V.......DN-HL.-
D7M5B1_ARALL/74-158----------...................FSS................GSE-----FENACG-R.V.......DK-YL.-
O82462_ARATH/74-158----------...................FSS................GSE-----FENACG-R.V.......DK-YL.-
B9RFS6_RICCO/74-158----------...................LSS................GSE-----FESACT-Y.I.......DS-YL.-
A5B9C3_VITVI/77-161----------...................FST................GSE-----FENACC-Y.V.......DG-IL.-
Q4WQV0_ASPFU/145-252----------.......TIH...GDNPGETFT................RKA-----LRLYLH-L.........EE-HL.-
B6AZ99_9RHOB/67-130----------.......................DLP............RDR-----L.....-..W.........-...-
A5DZL4_LODEL/70-158----------.............GLNNGYYVH................EWR-----LHMQYC-N.........DR-LE.-
C8V321_EMENI/98-189----------................LKGATD.EYK............NSV-----VPKYYR-I.L.......GQ-YY.-
Q5B0A6_EMENI/118-205----------...................ATD.EYK............NSV-----VPKYYR-I.L.......GQ-YY.-
C1FH64_MICSR/69-170----------VAHEVLYKCPFDADEEVKKAKRLEYA............EGR-----MLQNMS-Y.V.......DS-KL.-
B7FSP9_PHATC/127-244----------VDNHASYKDQ...KEQGDQASL.EFS............QGR-----MKKYLH-H.F.......HK-IV.-
D6V2C5_9BRAD/95-206----------LGPTLYYEDQ...RPQAVKRSD.EFW............KSR-----VPKFLG-Y.F.......ED-IA.-
B2IEI5_BEII9/99-212----------LSAALYYEEQ...KPEALRRAE.YFR............KDR-----IPRFLG-W.F.......EE-IL.-
A0A058V2B3_BORPT/92-203----------VAAGLYYEDQ...QDVALRRAA.DFR............ETR-----MPKFMQ-Y.F.......EQ-AL.-
A0A038I621_BORBO/92-203----------VAAGLYYEDQ...QDVALRRAA.DFR............ETR-----MPKFMQ-Y.F.......EQ-AL.-
A3NKT4_BURP6/116-229----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
A3P6E2_BURP0/99-212----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
A4LR03_BURPE/99-212----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
A8EQ36_BURPE/138-251----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
A8KFZ3_BURPE/116-229----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
B1H8S8_BURPE/116-229----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
B2H8F9_BURPE/99-212----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
C0YD09_BURPE/116-229----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
C6U522_BURPE/99-212----------IAGGLYYEDQ...KAEAAMRAE.DFI............EHR-----LPKFLG-Y.F.......SR-VL.-
B4ST55_STRM5/94-204----------IAVSKYYEDQ...KSEAKARAA.SLR............SER-----LPKFLG-Y.F.......EQ-VL.-
B2FRQ6_STRMK/94-204----------IAASKYYEEQ...KTEAKARAA.SLR............SER-----LPKFLG-Y.F.......EQ-VL.-
B8L691_9GAMM/94-204----------IAASKYYEEQ...KTEAKARAA.SLR............GER-----LPKFLG-H.F.......EQ-VL.-
B0RPT3_XANCB/94-204----------IASMQYYEDQ...KDAARQRAK.DLR............ENR-----LPKFLG-Y.F.......EQ-VL.-
Q4UXR8_XANC8/106-216----------IASMQYYEDQ...KDAARQRAK.DLR............ENR-----LPKFLG-Y.F.......EQ-VL.-
D4SRF8_9XANT/94-204----------IATGLYYEDQ...QAEAAKRAQ.DLR............DNR-----LPKFLG-Y.F.......ER-VL.-
D4T9D0_9XANT/94-204----------IATGLYYEDQ...QAEAAKRAQ.DLR............DNR-----LPKFLG-Y.F.......ER-VL.-
F0BY29_9XANT/94-204----------IATGLYYEDQ...QAEAAKRAQ.DLR............ENR-----LPKFLG-Y.F.......EQ-VL.-
Q3BQA5_XANC5/94-204----------IATGLYYEDQ...QAEAAKRAQ.DLR............ENR-----LPKFLG-Y.F.......EQ-VL.-
E9EGB4_METAQ/115-231----------VAVSDYYEAQ...KPEAKRRAK.SFI............EER-----LPKFLA-Y.I.......QR-VL.-
E9FC33_METAR/114-231----------VALSDYYEAQ...KPEAKRRAK.SFI............GER-----LPKFLA-Y.I.......QR-VL.-
E6ZKH3_SPORE/113-235----------ISTSSYYEEQ...KDEAKKRAA.DFR............AHR-----LPKFLQ-V.F.......EV-AL.-
Q4PHJ6_USTMA/131-253----------ISVSSYYEDQ...REEAQKRAA.DLR............TNR-----IPKFLK-L.F.......ET-AL.-
B2VRG1_PYRTR/83-207----------.......ALS...PAKLGSKIN.QNL.............SN-----LDLHLS-L.L.......EP-MF.-
Q0U0D3_PHANO/77-203----------.......DRS...QLIGHQLDP.EKL............GAK-----IPQNLA-N.L.......DM-HL.-
A1DN79_NEOFI/128-240----------LAVTLGRINKEEQSAAASVYSR................RQW-----KGEMAK-L.........DR-WV.-
D8M558_BLAHO/58-124----------......................................LEN-----LYIRYG-KRF.........-...-
E3RJP3_PYRTT/917-1001----------.............GYEAELRNL................VLR-----LEEEVG-I.L.........-...-
F0XHR1_GROCL/885-987----------.........A...AHKAATSSS.EVL............LSS-----LKGELE-R.W.......NG-YA.-
E9DTF4_METAQ/750-836----------................KQHDKS.TPL............SKT-----LLRELG-T.W.......DE-LA.-
Q2GUC8_CHAGB/865-976----------.VGVQGDGGG...DGEEQQRAS.AEQ............TKA-----LAKLLG-KELAERDGWAKE-AA.-
C9SQ13_VERA1/837-927----------......RAIR...SQETEDVTV.KQP............AKP-----LKRELT-V.W.......ND-YA.-
E3QT63_COLGM/831-957----------KAEERVKEEK...GKEEKGKEE.KEK............KKT-----TRRNLG-P.L.......RR-EL.-
Q55JP4_CRYNB/150-286----------AGLTTPLPAS...LTGDRRDIDIDDV............LRK-----GQEAVD-V.V.......DG-LL.-
B6QBZ6_PENMQ/110-196----------.............QFAVHFPFL.EGQ............LKS-----APGTSD-G.........QR-GG.-
E3QUV0_COLGM/128-262----------LFNVLKSRNVPFLIRPLTSSVA.NQIFSIVILPNAKKHLAM-----LEYFLK-T.........AP-GV.-
C5JYK1_AJEDS/159-267----------.......PVT...KMIASQLHS.ALV............KSD-----LATNLS-F.L.......ED-QL.-
A3K1B8_9RHOB/77-180----------IENLNLQMVFLRPPAKPSPVVV.KLT............VAR-----LRQTLK-G.M.......EA-RL.-
B9TLA7_RICCO/51-123----------.......GLL...EAETDAFDI.DAL............DQA-----AITAAV-T.W.........-...-
F0XEQ7_GROCL/281-416----------GSSGGQQTGH...ETAQIYREA.QAA............LQA-----LATLLE-DGT.......ER-PD.-
E3RS78_PYRTT/85-191----------......YLFK...ILLAASEEDQAKM............SKE-----VVDIVG-KEI.......EP-LL.-
Q7D2W7_AGRT5/94-199----------.............NGGREMWTP.EKW.............QE-----FVPRLQ-K.W.......IR-IF.-
A9H2Q5_GLUDA/94-199----------.........DGGRQMWAEKRWQ.DFI.............PR-----LEKWMS-L.W.......EE-TG.-
D7AAL2_STAND/94-199----------........DG...GREMWTEAKWQEF............VPR-----LKRWMG-I.W.......EA-LA.-
C5LY40_PERM5/101-214----------IALLIYQAMG...AVSPSTRIT.NRA............GQD-----IETALR-E.M.......ER-LL.-
D7FW72_ECTSI/215-297----------.......KEA...GGSVPTEAL.AAL............KHL-----EDKLTG-T.W.........-.L.-
C1E4T3_MICSR/78-183----------.............AVAVACASN.D..............GAS-----LLTLLA-NVL.......EP-HL.-

PF16865

A4I8P2_LEIIN/97-204-----------------GDFIGAAHGLLRDPLSGEK------------RKA-----MDDNAA-YV--------DG-LLA-
A4I8P2_LEIIN/321-429-----------------GYFVGGLMSWIIRG.GEDA------------KAE-----LQWAAG-EL--------EQ-QLA-
Q4CZ29_TRYCC/93-200-----------------GDLVKAYFGLVRDPFNEEK------------RKS-----VDNNTA-YI--------ED-IIA-

PF04399

Q6D1S0_PECAS/85-210----------ILREEKAFG...DLDGLIAKTP.EL-------------IAE-----VEQKLE-AL--------ES-RLA-
Q5NRG0_ZYMMO/87-214----------IRRKEGEVG...SFDQCIKETP.RL-------------IQR-----YEDSLE-QL--------EP-LIQ-
Q5NQ08_ZYMMO/85-214----------ISKKEAQTG...LFSRWLGESE.SL-------------REE-----MNLLLE-EL--------AP-LID-
D5QI23_KOMHA/68-196----------IRGKEKMVG...PFGALLDDSA.GM-------------IAQ-----VDARLR-AL--------VP-LVR-
H2ITY9_RAHAC/85-214----------SDKKQAASG...SFAEHLQHSE.GL-------------VKK-----ISQDLR-AL--------DK-LIV-
F2JXW1_MARM1/91-215----------QRNKEKMIEM..PFSNALSQTK.EH-------------VVK-----VEAALN-QL--------PT-LPL-
F9ZM92_ACICS/93-218----------RNRMESWLG...DTLEGLQKRRKEW-------------YAG-----MEVDLQ-DV--------AA-RV.-
I0DZW0_PROSM/85-211----------IEREERAFG...DLNTLLKETH.TL-------------IVE-----LEPHMD-VL--------DA-WLE-
E6WDE9_PANSA/85-214----------REKKQANIG...DFSELRKHAP.GL-------------IKN-----INDDLR-QL--------DK-LIV-
Q9CNB4_PASMU/85-214----------TKKKTDYVG...DFTQHFNNTP.TY-------------LAR-----LTQDLE-KL--------SA-LVM-
X2GUV6_9GAMM/86-215----------VTSKTKKIG...SFDECLAQTD.TL-------------VSE-----ISKLLN-DL--------EP-LIV-
D0NB62_PHYIT/96-224----------KNKKEKSFG...SFSENLAKSP.ES-------------VKQ-----VNQLLK-EL--------EP-MLH-
Q7MBY7_VIBVY/84-208----------RMKKETDAL...NFDALLQDTP.NI-------------ATE-----VEALIE-RA--------KS-VLN-
Q65TQ1_MANSM/85-215----------IQKKTKSIG...DFAENLANTP.QY-------------LDK-----LNRDLT-LL--------DN-LIL-
F4HD49_GALAU/85-214----------TMKKSKMIG...NFAENLAQTP.QY-------------LAK-----INQDLK-EL--------ND-LIV-
A8AI12_CITK8/69-198----------TEKKEAMIG...DFGENLAHSS.GL-------------IKN-----ISDDLR-AL--------DK-LIV-
Q5E4G7_VIBF1/86-215----------TEKKEEFIEM..SFEQALTNSN.EY-------------INA-----LNPLLV-NA--------NF-ITL-
K3W8Q1_PYTUL/137-266----------RIKKEKTIG...PFKDALAKSP.EL-------------VEE-----ANVYLE-KL--------SD-MFY-
Q7DD88_NEIMB/82-212----------TDKKEKSIG...SFSANLNKTA.QY-------------LER-----INADLQ-EL--------EN-LMD-
E0SAU3_DICD3/85-214----------IHKKEGQIG...SFDTHFSQSA.AL-------------IGQ-----LEGDLQ-AL--------AP-LIV-
M4BU42_HYAAE/154-283----------RVKKEKSIG...MFKDALAKTP.EL-------------VLQ-----ANSYLE-QL--------AS-MFH-
A8GFK9_SERP5/85-214----------TDKKQASIG...DFSTHLADSA.DL-------------IAQ-----LEADLQ-VL--------SG-LIA-
Q5NH24_FRATT/91-214----------INKKSQYIG...DFDALLRNPPYDS-------------IRA-----INQILA-KI--------DP-FI.-
X2HAQ1_9NEIS/85-214----------INKKTAIFG...DFQHHLQNSQ.TY-------------INR-----FNADLI-AL--------SP-LIV-
A1S8P5_SHEAM/96-225----------TEKKTAVIGM..SFEEAFAASG.EY-------------IAA-----LEPLFT-EL--------DL-IPL-
H3G9G4_PHYRM/122-251----------RKKKENTIG...SFDEALAKTP.EL-------------VAQ-----ANTFLE-QL--------AV-MFH-
D7FTR2_ECTSI/110-242----------VRNHPLPEPS..SYEANLKASP.KL-------------IEE-----LERELW-KL--------EG-MIH-
W0L8R1_SERFO/85-214----------TDKKQAAMG...DFTALLADSA.DL-------------IAQ-----LEDDLQ-HL--------AP-LIT-
A6VNZ1_ACTSZ/85-215----------TKKKTEFIG...DFAENLADSQ.QY-------------IER-----LNQDLP-EL--------SQ-LLK-
A7MM21_CROS8/89-214----------TAREEKAFG...DLAALRAQTP.AL-------------LAQ-----VNSDLN-AL--------EP-LVA-
F0YIM1_AURAN/118-251----------VKNHQLPPSREAGLEERQSNDA.AL-------------IAE-----VNEKLK-DL--------EP-LIC-
K7SWA6_GLUOY/88-217----------IRRKEESTG...PFWEILADGS.KE-------------IAE-----LNALLE-KL--------AP-LIQ-
F0LUD7_VIBFN/86-215----------TKNKSAMIGM..SFDDAYAKSA.EF-------------LAP-----MNALLA-QL--------DW-LVL-
Q9KKV8_VIBCH/84-211----------RVKKETTEL...HFESLLKDTS.QI-------------ALQ-----VQACID-AV--------KP-LLK-
H8L0T2_FRAAD/85-207----------RAREIRAFG...DLDALIEQSP.EW-------------IAD-----INHQLQ-AL--------EA-LLA-
Q6LNL6_PHOPR/86-215----------HKKKSATIDE..SFDDAFAHSA.QY-------------ITA-----LNAVLT-EI--------DW-LIL-
Q5FQY7_GLUOX/87-216----------IRRKEPSVG...SFSALLEEKT.DE-------------LTQ-----LNAMLK-EL--------AP-LIR-
W0HW21_9ENTR/85-214----------INKKQASLG...DFEQLLDHTP.GL-------------VKK-----ISQQLR-DL--------DP-LIK-
H3GPY7_PHYRM/353-482----------RTKKEKSMG...SSDEALKRYP.XV-------------VQE-----ANKFLE-QL--------AV-MLY-
B2VDJ5_ERWT9/85-214----------KNKKQGVYG...DFAELKEHSP.GL-------------IKN-----VNDDLR-KL--------DR-LIV-
U4KES9_9VIBR/86-215----------TKNKSAMIGM..SFEEAYANTD.EY-------------LAK-----MNAHLE-QL--------EW-LTL-
Q87J67_VIBPA/85-208----------REKKETEAL...NFEALINDTP.AI-------------AKE-----VAALIE-QT--------KP-LLN-
Q15Q78_PSEA6/101-230----------THKKTKELG...SFAEALANSK.SL-------------IKA-----FEDKLG-EL--------AH-MLH-
C7JHY2_ACEP3/84-213----------IRKKEASTG...PFCEIFNEGT.EA-------------LLP-----LNALLE-DL--------AP-LLP-
F0YIS1_AURAN/125-254----------THEKQGF.....DYDVALEETP.RL-------------LAE-----LKPLLE-EL--------ET-MLR-
Q6D468_PECAS/85-214----------VNKKEAQLG...NFADHLSHSQ.GL-------------IKK-----LNHDLQ-DL--------DP-LIV-
G2I7E0_GLUMN/84-212----------IRNKEDMIG...PFNAALADSA.AL-------------CAS-----TSRALA-RL--------SG-LIQ-
B7VSY7_VIBSL/89-209----------RVSKETEGF...NFEELLEKTP.QY-------------VQL-----INPLLK-DA--------EL-LLE-
C9R3A8_AGGAD/85-214----------TENKEKSIG...DFAEHLANTD.TY-------------LAR-----LAPDLV-QL--------AH-LIQ-

PF11801

A5DPS2_PICGU/93-276PSPPGLFGVFSGSSGPHDEVDEETSEVALSALHERQMTA.....KSNKRELLRQSKNSLKCLNYL--------GE-ILD-
Q6BJD7_DEBHA/112-306ISGSEAVAQTEYFNDENDDDDAEADPVAISSLHEKQLLA.....KSKRKDLLKESRNSLKCLNLV--------NE-YID-
A5DUS1_LODEL/96-243..........DKSKTSLFNFSSNNADVVVAETETVNS.......EQSDSEDVGEEGTNKGISGLH--------ER-YLL-
MTX1_PIG/95-225...............................EHRPEEE......EELEKELYQE...ARECLTLL--------SQ-RLG-
Q1L8P8_DANRE/95-225...............................DPVLEPG......EQLEKELYRD...AFECMTLL--------SQ-RLG-
M9N0R6_ASHG1/82-231...............PAHDAEKELAQHSKTLQATREL.......RERGEKALADAAAEMEYAAAL--------DR-ALQ-
Q6C8L9_YARLI/89-259TPSWAVSATKMASESLTNPKPSMGKLYDQSVEREKQKDA....SKAVSKTVFRLLNSATEIYTDM--------MD-TAT-
SAM37_YEAST/113-276.....SLTLEDDEEFVESKAMESASQLAQSKTFKIAHKN.....KIKGKQELQQVKYNLQFDNRL--------QS-CVS-
Q6CII7_KLULA/89-254..TIPEDEENESTSNHQDELSEKATELAQSKVFKITRDS.....KRQQTKKLQELKNNSRFTTKL--------DN-VLT-
A1DFG3_NEOFI/97-262..SSLDLQAAEDQRKREHSAAVAAGQIPKNLVQRPRDTVSSLLGKTPQQNQFKLEALTAELFEPL--------EE-ILG-
A7TPA1_VANPO/99-264...YLPHSDDKDYLDEKDDLEDVAADMAQSKTFKIKNKL.....KQRKREELKAIGYNLQFNNRL--------VE-LLK-
A7F5V7_SCLS1/99-263........SSLDIDTEDGDKSRDSSIIPESLRRGKQTVSSLLAASPETNAQIRLDALATDFFESI--------QE-LKG-
Q6FU46_CANGA/92-252.......LPVEEKEDEDEDDGPADYELAQSKTFALRGLR.....KRQRAEELKSVRLNRNYMHKL--------LE-FLD-
Q5B6M7_EMENI/97-261..SSLDLEATEEQRKRDHSAAVAAGRIPQNLISRPRETVTNLLGKTPQQHQFRLEALTGELFVPL--------EE-LLD-
A6RE67_AJECN/106-259.TSLDVDVMVEEQRYQARDPSSLASKIPKSLIRKRQAT.............IRLEGLASAFVAPL--------EE-LLG-
Q5ALP4_CANAL/109-308SIDVAPTELINDEDDEEGDEDEDGANVAISSLHERQLLK.....KSKSKQVLKESRNSMKCLILI--------TQ-YI.-
A3LTE5_PICST/98-286DFSGSVNNSEIAETEYINDENEEQDEVALSALHERQLVA.....KSKEKSLLRESKNSLKCLHLL--------ND-YLD-

PF14834

D5C687_ENTCC/95-211-------------IRVERSTDVVFAGVKKPALSTEG------------AQS-----AQKLID-TA--------TS-LLA-
A7MH37_CROS8/138-254-------------LRAERPTDVIFGAARYAPLSADG------------QAA-----ADKLIA-CA--------QA-LLV-
A6TBY7_KLEP7/95-211-------------IREERSTAVVFGGAKMPDLSEAG------------RQS-----AEKLFA-TA--------TM-LLA-
YFCF_ECOLI/95-211-------------IREERPTDVVFAGAKKAPLTAEG------------KAS-----AEKLFA-MA--------EH-LLV-

PF00043

GSTA2_MOUSE/99-192-------------------------------------------S....HGQDY---LVGN-------R----L-------
GSTA3_CHICK/99-192-------------------------------------------D....HGQDF---LVGN-------R----L-------
GSTA3_MOUSE/99-192-------------------------------------------S....HGQDY---LVGN-------R----L-------
GSTM3_HUMAN/108-196-------------------------------------------.........W---FAGE-------K----L-------
GSTF3_MAIZE/107-203-------------------------------------------......RNKY---LAGD-------E----F-------
GSTP1_BOVIN/97-188-------------------------------------------.....GGQAF---IVGD-------Q----I-------
GSTM2_CHICK/104-192-------------------------------------------.........W---FVGD-------K----L-------
GSTM2_RAT/104-192-------------------------------------------.........W---FAGN-------K----I-------
GSTF1_MAIZE/110-201-------------------------------------------......KCKY---LAGD-------F----L-------
GSTM2_HUMAN/104-192-------------------------------------------.........W---FLGD-------K----I-------
GSTA1_HUMAN/99-192-------------------------------------------S....HGQDY---LVGN-------K----L-------
EF1G_HUMAN/106-198-------------------------------------------......TRTF---LVGE-------R----V-------
EF1G1_YEAST/107-199-------------------------------------------......NYTY---LATE-------N----I-------
SYVC_HUMAN/107-198-------------------------------------------......LHTY---LAGE-------A----P-------
GSTO1_CAEEL/120-219-------------------------------------------.......NDF---YAGS-------Q----P-------
GSTMU_CAVPO/103-191-------------------------------------------.........W---FAGN-------K----L-------
GSTX6_SOYBN/99-198-------------------------------------------......DKKF---FGGE-------E----F-------
GSTA_ECOLI/100-189-------------------------------------------......DEHW---ICGQ-------R----F-------
GSTX1_SOLTU/95-192-------------------------------------------......DKKC---FVGD-------K----F-------
GSTA4_MOUSE/99-192-------------------------------------------D....HGEAF---LVGN-------Q----L-------
GST1_DROME/141-235-------------------------------------------QT.VKDNDGH---LALG-------K----L-------
GSTP1_CAEEL/94-186-------------------------------------------.....NGEHY---VIGD-------K----E-------
GSTF1_WHEAT/111-210-------------------------------------------......KSRY---LAGD-------S----I-------
GST1_YEAST/114-218-------------------------------------------.....KNNGY---LVDG-------K----L-------
URE2_YEAST/223-345-------------------------------------------QSRFFDYPVW---LVGD-------K----L-------
EF1G2_YEAST/104-196-------------------------------------------......DYTF---VATE-------N----I-------
YIBF_ECOLI/96-192-------------------------------------------.......DGT---LKTD-------T----V-------
EF1G_SCHPO/99-196-------------------------------------------......SKTY---LVGS-------R----L-------
B0UTU6_HISS2/103-194-------------------------------------------......QSLY---FMSE-------E----F-------
B4EWL4_PROMH/103-189-------------------------------------------......KQKC---VCGD-------H----F-------
F6V028_XENTR/108-198-------------------------------------------......TRTF---LVGE-------R----V-------
G2IN92_9SPHN/107-234-------------------------------------------......KQDY---LVDT-------G----Y-------
GST28_SCHMA/104-195-------------------------------------------G....STGKL---AVGD-------K----V-------
SSPA_ECOLI/102-194-------------------------------------------......QKPY---FLSD-------E----F-------
Q4CXW2_TRYCC/105-198-------------------------------------------......TRTF---LVGE-------R----M-------

PF13410

A0L6K1_MAGSM/131-194......................................AQG...........P---YLFG.......S----F-------
A0LDX3_MAGSM/121-185.......................................A.............---.YQG.......T----L-------
A1AV55_RUTMC/124-190......................................YKA...........F---FKSD.......N----M-------
A1B210_PARDP/196-269......................................QAR...........Y---LHGN.......M----L-------
A1CDY3_ASPCL/184-260......................................KNGG.........PF---ILGD.......Q----L-------
A1S3B6_SHEAM/120-184......................................GS.............---..SD.......R----I-------
A1TQ85_ACIAC/453-519......................................RSA...........Y---LCGS.......R----A-------
A1U867_MARAV/117-182......................................HAP............---YFGG......HD----I-------
A1WJX2_VEREI/124-191......................................QL.............---.TGGA.....GR----A-------
A2AJ28_MOUSE/127-207......................................QEPHLRE...SHRRF---LDGD.......Q----F-------
A2Q995_ASPNC/149-217......................................FF.............---.LGA.......Q----I-------
A2QH45_ASPNC/187-263......................................QNGG.........PF---VLGK.......E----M-------
A4RZE0_OSTLU/123-196......................................GSEG.........NY---LFGA.......D----V-------
A4YLR1_BRASO/127-234......................................LRP...........Y---LFGA.......R----P-------
A4YXA6_BRASO/141-211......................................DGR..........PF---IFGD.......R----P-------
A5GJY1_SYNPW/170-241......................................DPD...........H---PSGA.......T----P-------
A5VCI8_SPHWW/122-190......................................RTA............---HLDG......PA----R-------
A6R8D9_AJECN/127-204......................................KTTARLKALGEADDG---FLFG.......K----F-------
A6T619_KLEP7/122-188......................................DR.............---AAAA.......Q----P-------
A7HP97_PARL1/145-226......................................DKP...........F---FFGD.......I----P-------
A7HPN1_PARL1/131-202......................................QQAAD.......DHG---FLFG.......R----F-------
A7HWV6_PARL1/136-238......................................TQL...........F---LFGS.......R----P-------
A7IBJ5_XANP2/127-190......................................GRD............---YVAG.......S----F-------
A7IPF7_XANP2/133-196......................................AEG...........Y---AVGP.......A----F-------
A8BBE3_GIAIC/125-191......................................SLR............---SLAP.......E----P-------
A8GAF3_SERP5/122-189......................................RAG............---TALA.......V----I-------
A8I0K9_CHLRE/123-191.......................................GP............---LFGG......QH----L-------
A8P0W9_COPC7/143-215......................................PDA..........KF---AFGS.......H----P-------
A8PWD6_MALGO/165-250......................................KVQERLHI.LPETSF---ILGK.......E----P-------
A9BRB1_DELAS/118-188......................................FSP...........F---VAGD.......S----F-------
A9CJG7_AGRT5/129-216......................................FQP............---FIGG......AS----P-------
A9ENK0_SORC5/120-185......................................TL.............---.STE.......L----A-------
A9G573_SORC5/130-198......................................HALA.........AL---PSDR.......D----L-------
A9G5M8_SORC5/132-224......................................DEP...........Y---LFGA.......R----P-------
A9GLX2_SORC5/161-243......................................RAAPPG.....DAPR---TLLG.......R----F-------
A9RED4_PHYPA/166-240......................................QHGKQ.......GRF---FSGS.......Q----F-------
A9RIP1_PHYPA/191-298......................................DGR..........PY---ICGS.......K----F-------
A9SSZ0_PHYPA/249-317.......................................PY............---FLGS.......K----F-------
A9SZI4_PHYPA/403-470......................................HF.............---.LGS.......N----F-------
A9VD76_MONBE/143-208......................................KG.............---.LGDG.....VH----F-------
B0CZV3_LACBS/156-232......................................LKKGLG....LWIES---EGGQ.......D----L-------
B0DMK1_LACBS/141-206......................................PDG...........F---AFGE.......H----P-------
B0T373_CAUSK/123-185......................................P..............---..SD.......R----F-------
B0U7F7_METS4/125-203......................................AHGG.........PY---LFGA.......T----P-------
B0UCA1_METS4/160-231......................................DKP...........F---LLGE.......R----V-------
B1Y635_LEPCP/144-209......................................RFGG.........PW---LFGE.......R----F-------
B2B7D3_PODAN/137-206......................................KFGG.........PF---LAGG.......E----F-------
B2GG80_KOCRD/207-280......................................TRR...........Y---LMGE.......H----I-------
B2J7I4_NOSP7/169-243......................................KYS..........GP---YFLS.......T----F-------
B2UK10_RALPJ/126-192......................................RQR............---YLGG......RA----P-------
B4N5A8_DROWI/142-215......................................RRD..........TP---FFGG......SK----P-------
B4R810_PHEZH/136-206......................................GVD............---FLGG......TK----V-------
B6GZF3_PENCW/142-236......................................DGP...........F---VLGA.......R----P-------
B6INT9_RHOCS/122-191......................................PDG............---EPGEP.....EH----F-------
B6IWS7_RHOCS/197-270......................................TRR...........Y---LLGD.......R----P-------
B6JAK1_OLICO/121-185.......................................Q.............---.LSG.......P----V-------
B8C0F0_THAPS/181-261......................................STSGP.......WFF---DFAD.......H----P-------
B8CA81_THAPS/207-302......................................CDSDE.......NCF---LLPT.......G----F-------
B8CLJ2_SHEPW/123-188......................................QL.............---.LDQ.......A----P-------
B8EKE6_METSB/125-187......................................GKA............---YVAG.......D----F-------
B8IAD7_METNO/126-190.......................................W.............---.TES.......A----L-------
B8LD48_THAPS/125-192......................................DTK...........F---CYSD.......T----P-------
B8LWW9_TALSN/704-780......................................EKGG.........PY---VLGE.......H----L-------
B8MAD4_TALSN/131-201......................................KQGSE......RESY---SFGN.......S----I-------
B8MMG1_TALSN/173-241.......................................GP...........F---VLGA.......Q----P-------
B8NN14_ASPFN/137-207......................................GF.............---.LFG.......S----F-------
B8PKG3_POSPM/157-232......................................EGDIH......CGLW---SEGG.......T----P-------
C1E0N8_MICSR/130-200.......................................GP...........Y---LMGA.......E----V-------
C1E269_MICSR/572-669......................................CSHGDE.....GRMF---LCGK.......A----P-------
C1E340_MICSR/1002-1082......................................KLN..........GP---FVGG......KS----P-------
C1E340_MICSR/1335-1412......................................GPF............---IGGD.......R----P-------
C1E340_MICSR/1667-1747......................................NLN..........GP---FIGG......KT----P-------
C1EEB2_MICSR/138-221......................................GLTT.........PF---IGGD.......T----P-------
C1EFU5_MICSR/220-287......................................ENG...........G---FTST.......G----V-------
C1GU35_PARBA/153-226......................................KRDEGG....DEATW---LAGE.......E----F-------
C1MTQ1_MICPC/148-219......................................DWD..........TF---LCGV.......D----P-------
C1MWR5_MICPC/124-195......................................AGG..........DA---FTST.......G----V-------
C1MYW2_MICPC/249-328......................................ENAD........GPF---ALGS.......R----Y-------
C3Y1F6_BRAFL/230-307......................................EKP...........F---FMGE.......E----P-------
C5AAI5_BURGB/120-192.......................................FE..........PF---LLGD.......T----Y-------
C5BTC1_TERTT/126-189......................................GKT...........G---YLFD.......Q----F-------
C5CUS5_VARPS/135-201......................................EPS..........PY---LLGE.......K----I-------
C5CZN1_VARPS/195-312......................................AGSF.........AC---LNGN.......A----F-------
C5D1E8_VARPS/125-190......................................AL.............---.REA.......P----F-------
C5FDK1_ARTOC/126-203......................................YTVSRLAELKQVDDG---FLFG.......E----F-------
C5GMZ6_AJEDR/248-332......................................SRIAANAS.KNTPTY---YFGD.......T----I-------
C5KH39_PERM5/146-220......................................GPF............---FNGS.......A----M-------
C5KQA0_PERM5/164-239......................................EKK..........YL---VNDD.......K----P-------
E8RLA4_ASTEC/120-184.....................................................---.VSD......AP----P-------
C6XNN1_HIRBI/148-224......................................DST...........Y---MFGE.......N----A-------
C6XRQ4_HIRBI/121-230......................................KHL...........F---IFGG.......R----P-------
C7YRS8_NECH7/127-221......................................ADGR.........DW---IS.GT.....EK----P-------
C7ZGQ3_NECH7/146-213......................................GD.............---NLEDG.....RQ----V-------
C7ZM60_NECH7/221-306......................................ANPG.........PY---WLGN.......N----I-------
E6WEX2_PANSA/122-189......................................QRD............---INPQ.......Q----P-------
C9SJL3_VERA1/160-242......................................PSG..........PW---FLGE.......R----F-------
C9SW24_VERA1/159-239......................................ETEG.........PF---FLGE.......T----V-------
D2VLV0_NAEGR/154-242......................................DF.............---FFGD.......Q----F-------
D3BDL7_POLPA/178-253......................................KSGS.........KY---LFGD.......R----L-------
D3BFK7_POLPA/158-266......................................DSQ...........F---LFND.......K----L-------
D3BS36_POLPA/173-246......................................TTR...........Y---VAGS.......Q----L-------
D4AIT6_ARTBC/160-238......................................FF.............---.HGS.......N----F-------
D4AJL6_ARTBC/139-210......................................DDDD........NNN---NNGA.......A----V-------
CLIC1_HUMAN/142-212......................................RKF............---LDGN.......E----L-------
Q012T3_OSTTA/160-232......................................RDAG.........DF---IAGE.......V----R-------
Q017S3_OSTTA/231-304......................................ESR...........Y---LCGD.......V----F-------
Q092M3_STIAD/123-189......................................GA.............---SFFEK.....PR----L-------
Q0BV02_GRABC/124-186......................................HT.............---...........L----L-------
Q0BWT6_HYPNA/123-219......................................GAK............---GAGGGLYLIGPK----P-------
Q0C681_HYPNA/120-229......................................EHL...........F---IFGG.......H----P-------
Q0CJU0_ASPTN/163-232......................................EGP...........F---ILGA.......R----P-------
Q0U052_PHANO/145-222......................................ADGR.........SW---VFGE......EG----P-------
Q0V763_PHANO/145-227......................................ADGR.........EW---ILGT......NE----P-------
Q0V763_PHANO/476-547......................................DG.............---ILPDPS...AAP----A-------
Q119J9_TRIEI/182-256......................................QYP..........GA---YFLH.......E----F-------
Q11II4_CHESB/120-190......................................NRTG.........EY---WFGR.......D----I-------
Q15Y89_PSEA6/118-181......................................DG.............---.EFA.......N----W-------
Q16DN2_ROSDO/135-224......................................HSH...........F---LFGD.......Q----P-------
Q1CXG6_MYXXD/156-248......................................GRP............---YLLA.......R----F-------
Q1LMA0_RALME/129-215......................................AGV..........LH---VAGP.......M----L-------
Q219M8_RHOPB/125-189......................................ET.............---.LSA.......P----L-------
Q21NV3_SACD2/125-196VA................................GEGGDKP...........T---LLGG.......A----I-------
Q28VM3_JANSC/126-191......................................SH.............---.LYG.......P----V-------
Q2RP79_RHORT/128-193......................................PL.............---.TGA.......P----V-------
Q2Y8A0_NITMU/202-275......................................RQR...........Y---LIGN.......C----I-------
Q3IWV3_RHOS4/128-191......................................TEG...........P---WLCG.......S----Y-------
Q3IXJ7_RHOS4/202-274......................................GDY............---IFGG.......A----L-------
Q3SJZ3_THIDA/124-195......................................PGP............---FLFE.......T----F-------
Q47WD3_COLP3/155-230......................................DKN...........F---FFGD.......T----H-------
Q4KEB7_PSEF5/127-192......................................SRP............---YFGG......AA----P-------
Q4PA85_USTMA/231-359EGGADSTPSHPIASASGGGTSTSTEGSASNGRSASRTRQSV..........WL---AGGD.......Q----P-------
Q4PBA3_USTMA/148-231......................................EGNG.........KF---LFGD.......E----I-------
Q4PEE8_USTMA/196-272......................................DGR..........EY---LVPE......VG----L-------
Q4PH05_USTMA/169-242......................................TQWI.........LP---GTTN.......Q----L-------
Q54DU4_DICDI/215-290......................................RDR..........YL---VVGS......DK----I-------
Q5K7H9_CRYNJ/151-218......................................GPY............---FAGE.......Q----W-------
Q5LMS6_RUEPO/132-224......................................QKP...........F---LFGD.......A----P-------
Q5LRR6_RUEPO/138-209......................................KGT............---WLFD.......G----F-------
Q6C3X4_YARLI/164-237......................................DGR..........DY---LLGS.......E----F-------
GSTL1_ARATH/146-212.......................................GP............---FFLG.......E----L-------
Q7NTJ7_CHRVO/121-190......................................SGW..........PD---IDGG.......V----I-------
Q7V893_PROMM/166-242......................................PWL...........D---PASNTP..TSPC----P-------
Q7VCF4_PROMA/134-205......................................YSVN.........LN---LFND.......S----E-------
Q88AE2_PSESM/125-190......................................TE.............---.LSS.......S----F-------
Q8XXV1_RALSO/117-188......................................FAP...........Y---VAGD.......T----F-------
Q9FL98_ARATH/201-270......................................KQR...........F---LCGN.......T----L-------
GSTL2_ARATH/195-261......................................PF.............---.FLG.......Q----F-------
Q9NA74_CAEEL/171-244......................................DKP...........Y---LFGS.......S----I-------
B2UD16_RALPJ/121-186......................................DAP..........LP---VEEN.......E----L-------
B4EEI7_BURCJ/123-196......................................ATR..........GW---FGGA.......R----L-------
C5AZ79_METEA/124-188......................................AS.............---..GD.......R----V-------
E7KR93_YEASL/151-241KYSKL..........................KAKYGEEDRQKIL.....GEFF---TVGD.......Q----L-------
G8PGF5_PSEUV/127-190......................................PQ.............---VQHN.......S----P-------
G8PGF6_PSEUV/125-190......................................PTP...........A---QTNG.......I----P-------
G8PGT3_PSEUV/202-274......................................KHR...........Y---LTGA.......A----I-------
G8PTB8_PSEUV/192-263......................................RQR...........Y---LLGD.......S----L-------
H3CB38_TETNG/137-223PLPCELD.......................ENPDVSKSS.R..........RF---LDGD.......A----L-------
H3CIP6_TETNG/126-213PHPDEIDE.....................NSSDDVVSSTRP...........F---LDGP.......E----L-------
GSTX2_MAIZE/128-201......................................DRSNG.......RAF---FSGGD.....AA----P-------
Q3IY08_RHOS4/123-186......................................SQ.............---.LQG.......P----L-------
Q7SF99_NEUCR/240-329......................................HASSPSS...SPGPF---FLGD.......K----F-------
R7G4S4_9FIRM/257-325......................................NQR...........F---LFGD.......Y----V-------

PF14497

F0X3Q4_CRYPV/161-266------------------------------................QQYDGPL...TFGS-------D---.A.......
Q5CKJ7_CRYHO/161-266------------------------------................QQYDGPL...TFGS-------D---.A.......
B8CAA6_THAPS/182-300------------------------------.................QKNGGY...LMGS-------S---.M.......
A8XWB3_CAEBR/131-230------------------------------................SERKTRY...LLGN-------S---.M.......
E3N1N5_CAERE/175-274------------------------------................SERKTRY...LLGN-------S---.M.......
EXC4_CAEEL/130-229------------------------------................SERKSRY...LLGN-------S---.M.......
F1KT43_ASCSU/135-234------------------------------................RERSSRY...LLGE-------S---.M.......
A8NYA7_BRUMA/133-234------------------------------................SERNSRY...LLGQ-------S---.M.......
E1GBX8_LOALO/133-234------------------------------................SERNSRY...LLGR-------S---.M.......
Q24F18_TETTS/217-335------------------------------..................EENDY...HGGI-------N---.P.......
F2TJD5_AJEDA/76-203------------------------------...........KPKSEGGDGATW...LAGD-------E---.F.......
A6G9D5_9DELT/106-239------------------------------..................GDNEW...MMGH-------D---AP.......
E3Q3M1_COLGM/143-285------------------------------............SLDSRESREPFWI.LGGQ-------R---.P.......
B2B5D5_PODAN/109-260------------------------------EGRNKTLARRRGNGDNGDDKPFW...VLGG-------E---.GP......
Q0U682_PHANO/112-249------------------------------.........EESRRRAAPSECFW...VLGG-------K---.KP......
A1CCM4_ASPCL/109-245------------------------------.........VAAKAAWRGGEPFW...VLGG-------E---GP.......
Q2GX63_CHAGB/116-255------------------------------.......VGSRNNAYETEKAGPFWI.LGGA-------N---.P.......
E3M3K7_CAERE/109-240------------------------------.................NSNKYF...FDVN-------E---.P.......
D7FWB3_ECTSI/120-218------------------------------.............LKHGPARGPF...LEGD-------D---.L.......
F1KXU8_ASCSU/112-193------------------------------................SEIDTKF...LAAD-------R---.L.......
E8Z6E4_PFIPI/96-208------------------------------................AASAGPF...LLGA-------Q---.L.......
A1AB54_ECOK1/45-122------------------------------..................TAEPY...VFGE-------Q---.L.......
C1HKK3_9ESCH/61-138------------------------------..................TAEPY...VFGE-------Q---.L.......
E9TQV2_ECOLX/45-122------------------------------..................TAEPY...VFGE-------Q---.L.......
E0QYH5_ECOLX/45-128------------------------------..................TAEPY...VFGE-------Q---.L.......
B5FXM3_TAEGU/120-251------------------------------..................GTQPY...FFNK-------H---.P.......
E1BVN1_CHICK/113-243------------------------------..................GTQPY...FFNK-------Q---.P.......
E9G0M2_DAPPU/109-235------------------------------..................GTKPY...FMGE-------K---.P.......
E9GQJ6_DAPPU/107-233------------------------------..................GPKLF...LMGD-------Q---.P.......
Q9NAG5_CAEEL/170-288------------------------------..................GNKHY...FHGF-------K---.P.......
A8XYN3_CAEBR/159-290------------------------------..................GNKHY...FHGF-------K---.P.......
E3MMS1_CAERE/154-288------------------------------..................GNKHY...FHGF-------K---.P.......
C5LXL1_PERM5/112-245------------------------------..................GEKKY...ILSD-------D---.KP......
E2R3Q0_CANFA/144-275------------------------------..................GDKKY...IMGP-------K---.L.......
G3QJ55_GORGO/197-328------------------------------..................GDKKY...IMGP-------K---.L.......
FAXC_RAT/197-328------------------------------..................GDKKY...IMGP-------K---.L.......
D2HID7_AILME/197-339------------------------------..................GDKKY...IMGP-------K---.L.......
B3S4C5_TRIAD/106-233------------------------------..................GNKQF...FLGN-------D---.P.......
B3S5C1_TRIAD/137-264------------------------------..................GDKPF...FMGE-------E---.P.......
B3RZK8_TRIAD/97-224------------------------------..................GSKKY...FLAD-------Y---.P.......
D0N2R1_PHYIT/80-174------------------------------.............RPKNSGDLQF...LFGS-------E---.L.......
E3M1A0_CAERE/120-266------------------------------..................ADKPF...LFGD-------E---.PKTVGYLT
S7UUE1_TOXGO/396-511------------------------------................EESGSPF...FGGA-------E---.P.......
B9QR24_TOXGO/404-519------------------------------................EESGSPF...FGGA-------E---.P.......
F0VEQ6_NEOCL/393-510------------------------------..............EESETPSLF...FGGT-------Q---.P.......
E9J013_SOLIN/261-381------------------------------................KARGTTF...MGGS-------K---.P.......
PGES2_MOUSE/252-367------------------------------.................GKDRPF...MGGQ-------K---.P.......
D4AE56_RAT/252-367------------------------------.................GKDRPF...MGGQ-------K---.P.......
F1N1J6_BOVIN/250-365------------------------------.................GKDRPF...MGGQ-------K---.P.......
F1RRY6_PIG/253-368------------------------------.................GKDRPF...MGGQ-------K---.P.......
F1P9X4_CANFA/252-367------------------------------.................GKDRPF...MGGQ-------K---.P.......
B4YY03_CANFA/250-365------------------------------.................GKDRPF...MGGQ-------K---.P.......
D8RW70_SELML/135-249------------------------------.................DNRNVF...SGGS-------K---.P.......
Q9FHX0_ARATH/192-305------------------------------..................KERPY...LGGS-------K---.P.......
D3BAJ2_POLPA/71-164------------------------------..................NINGH...LFGN-------K---.T.......
F1KQF6_ASCSU/105-183------------------------------......................F...LALN-------R---.L.......
B2BXI7_ARALL/100-207------------------------------..................TGKDF...FGRK-------T---.I.......
D7LL96_ARALL/100-207------------------------------..................TGKDF...FGRK-------T---.I.......
B9RCA3_RICCO/93-207------------------------------................LNDGGPF...LIGG-------D---.QP......
D8QNB8_SELML/101-218------------------------------................LDGNTNF...LGGS-------P---.QP......
D8R6V3_SELML/101-218------------------------------................LDGNTNF...LGGS-------S---QP.......
B9T6C9_RICCO/29-125------------------------------..................IRLEN...VGDG-------R---.L.......
F0WN27_9STRA/91-187------------------------------...................KTPF...LTGE-------S---.I.......
D6WU61_TRICA/72-170------------------------------..................ESQPY...LSEK-------K---.L.......
E4UVV4_ARTGP/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
D4DGR0_TRIVH/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
D4AT40_ARTBC/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
F2PV52_TRIEC/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
F2RVW7_TRIT1/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
A0A022TE31_TRIRU/48-141------------------------------..................AMRTT...MLGV-------K---.P.......
C4JDF5_UNCRE/48-138------------------------------..................ATRTT...VLGA-------K---.P.......
Q4WZS4_ASPFU/48-138------------------------------..................ALRTT...MLGT-------K---.P.......
B8CBE8_THAPS/169-259------------------------------..................VSGTY...IVGH-------S---.V.......
F0YCB2_AURAN/642-721------------------------------..................AAGTW...LVGT-------A---.A.......
A3LWB3_PICST/76-162------------------------------.................N.FKSF...ISGY-------S---.Y.......
Q6BKC8_DEBHA/81-164------------------------------..................NFRSF...VIGY-------S---.Y.......
Q4U9H7_THEAN/88-189------------------------------..................ATKTF...LVAE-------K---.L.......
D8U415_VOLCA/66-148------------------------------......................Y...LVGG-------S---.A.......
D8TWM4_VOLCA/86-193------------------------------..........................RLGD-------S---.L.......
F2UBC5_SALR5/67-152------------------------------......................W...LLGN-------E---.QEP.....
Q7Q3I3_ANOGA/70-167------------------------------..................SNSTF...LTGD-------K---.I.......
B4N9E6_DROWI/73-152------------------------------......................Y...LVAN-------K---.L.......
B4HG12_DROSE/73-152------------------------------......................Y...LVAN-------K---.L.......
B4PL45_DROYA/73-152------------------------------......................Y...LVAN-------K---.L.......
B4QSD7_DROSI/73-152------------------------------......................Y...LVAN-------K---.L.......
SYEP_DROME/73-152------------------------------......................Y...LVAN-------K---.L.......
B3M314_DROAN/73-152------------------------------......................Y...LVAN-------K---.L.......
B3P8B5_DROER/73-152------------------------------......................Y...LVAN-------K---.L.......
B4JT86_DROGR/72-151------------------------------......................Y...LVAN-------K---.L.......
B4K6U5_DROMO/72-151------------------------------......................Y...LVAN-------K---.L.......
X1Y0E9_ANODA/694-773------------------------------..................GPLTY...LVAN-------H---.L.......
B0XC16_CULQU/71-150------------------------------..................APLTF...LVAN-------H---.L.......
Q178Q6_AEDAE/71-150------------------------------...............APLT...F...LVAN-------H---.L.......
B7PKR5_IXOSC/70-155------------------------------..................GSSSY...LVGQ-------R---.A.......
C3XZ88_BRAFL/70-155------------------------------..................GPRTF...LIGH-------A---.A.......
F1P179_CHICK/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
Q5ZJ86_CHICK/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
B4DKX5_HUMAN/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
SYEP_HUMAN/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
Q3KQZ8_HUMAN/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
Q5RCS2_PONAB/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
F1S9K5_PIG/71-156------------------------------......................Y...LVGN-------S---L........
D2HDG9_AILME/57-142------------------------------..................SLRTY...LVGN-------S---.L.......
E2QUR2_CANFA/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
Q6TXE9_RAT/89-174------------------------------..................SLRTY...LVGN-------S---.L.......
B9EIU1_MOUSE/71-156------------------------------..................SLRTY...LVGN-------S---.L.......
E6ZR79_SPORE/78-163------------------------------..................ALRTF...LVGH-------A---.V.......
A8JF35_CHLRE/74-156------------------------------....................RTF...LVGY-------S---.L.......
D8UHB4_VOLCA/73-156------------------------------..................TLRTF...LVGY-------G---.L.......
D8SNX9_SELML/72-156------------------------------..................AMRTF...LVGY-------T---.T.......
F2DKN7_HORVD/72-156------------------------------..................SSRTF...LVGY-------G---.L.......
F2EEU4_HORVD/72-156------------------------------..................ATRTF...LVGY-------G---.L.......
B8LRU5_PICSI/72-156------------------------------..................SLRTF...LVGY-------S---.L.......
D7M5B1_ARALL/74-158------------------------------..................ESRTF...LVGH-------S---.L.......
O82462_ARATH/74-158------------------------------..................ESSTF...LVGH-------S---.L.......
B9RFS6_RICCO/74-158------------------------------..................EKRTF...LVAY-------C---.L.......
A5B9C3_VITVI/77-161------------------------------..................LQRTF...LVGY-------S---.L.......
Q4WQV0_ASPFU/145-252------------------------------................QKAQSPY...LVGK-------K---.WYVCGRPA
B6AZ99_9RHOB/67-130------------------------------..........................MGDL-------G---.........
A5DZL4_LODEL/70-158------------------------------.................QNGTGF...FVGN-------K---.L.......
C8V321_EMENI/98-189------------------------------................SERPGPY...LLGE-------K---.I.......
Q5B0A6_EMENI/118-205------------------------------................SERPGPY...LLGE-------K---.I.......
C1FH64_MICSR/69-170------------------------------................AGSSNGF...LLPG-------G---.I.......
B7FSP9_PHATC/127-244------------------------------..............ARNGGSRKP...VAGG-------E---.FV......
D6V2C5_9BRAD/95-206------------------------------................ARGGGPY...LDGR-------R---.V.......
B2IEI5_BEII9/99-212------------------------------..............ARNPEGDRH...LVGK-------A---.I.......
A0A058V2B3_BORPT/92-203------------------------------.................DRPGGW...LTDM-------G---.RW......
A0A038I621_BORBO/92-203------------------------------.................DRPGGW...LTDM-------G---RW.......
A3NKT4_BURP6/116-229------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
A3P6E2_BURP0/99-212------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
A4LR03_BURPE/99-212------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
A8EQ36_BURPE/138-251------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
A8KFZ3_BURPE/116-229------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
B1H8S8_BURPE/116-229------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
B2H8F9_BURPE/99-212------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
C0YD09_BURPE/116-229------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
C6U522_BURPE/99-212------------------------------..............AHNPHKHGY...MVGA-------H---.L.......
B4ST55_STRM5/94-204------------------------------................AANGGRH...TLRE-------H---.........
B2FRQ6_STRMK/94-204------------------------------................AANGGRH...ALRE-------H---.........
B8L691_9GAMM/94-204------------------------------................AANGGRH...ALRE-------H---.........
B0RPT3_XANCB/94-204------------------------------................QHAGGNH...ILRE-------H---.........
Q4UXR8_XANC8/106-216------------------------------................QHAGGNH...ILRE-------H---.........
D4SRF8_9XANT/94-204------------------------------................QRAGGTH...VLGT-------H---.........
D4T9D0_9XANT/94-204------------------------------................QRAGGTH...VLGT-------H---.........
F0BY29_9XANT/94-204------------------------------................QQAGGTH...VLGT-------H---.........
Q3BQA5_XANC5/94-204------------------------------................QQAGGTH...VLGT-------H---.........
E9EGB4_METAQ/115-231------------------------------.............DGKASGDGPW...LYGG-------K---.L.......
E9FC33_METAR/114-231------------------------------.............DGKASGDGPW...LYGG-------K---.L.......
E6ZKH3_SPORE/113-235------------------------------.......RDNGAGLDEKKSGAAR...LWGT-------T---.T.......
Q4PHJ6_USTMA/131-253------------------------------.......SQDGAGLDQKKQGARR...VWGS-------K---.T.......
B2VRG1_PYRTR/83-207------------------------------..................GSGTW...AIPT-------N---.TP......
Q0U0D3_PHANO/77-203------------------------------..........AMLEPTFKTKGKW...AIPT-------P---.TP......
A1DN79_NEOFI/128-240------------------------------.............SENAQAESISVSGLVGA-------P---.........
D8M558_BLAHO/58-124------------------------------..........................MVSD-------V---.P.......
E3RJP3_PYRTT/917-1001------------------------------...................GGPF...VAGS-------R---.F.......
F0XHR1_GROCL/885-987------------------------------..................SGGKF...IGGG-------S---.AA......
E9DTF4_METAQ/750-836------------------------------................ANTSEVG...VPDS-------T---.P.......
Q2GUC8_CHAGB/865-976------------------------------................TGEAALY...IAGG-------A---.QP......
C9SQ13_VERA1/837-927------------------------------..................AEDES...IAGE-------V---.V.......
E3QT63_COLGM/831-957------------------------------...........AIWEGYAAEADL...IAGP-------S---.I.......
Q55JP4_CRYNB/150-286------------------------------..................RDDGW...ALGA-------K---.RP......
B6QBZ6_PENMQ/110-196------------------------------..........................LCGA-------K---.F.......
E3QUV0_COLGM/128-262------------------------------...............ARGNAAPF...LCGP-------S---.L.......
C5JYK1_AJEDS/159-267------------------------------..............KSSPGKGLF...LCGD-------I---.L.......
A3K1B8_9RHOB/77-180------------------------------...................SGDW...LLEG-------G---.F.......
B9TLA7_RICCO/51-123------------------------------..............................-------.---.........
F0XEQ7_GROCL/281-416------------------------------...........ETDGQTDQAGPF...FFGS-------H---.EP......
E3RS78_PYRTT/85-191------------------------------.................KDAKPF...FGGS-------E---KA.......
Q7D2W7_AGRT5/94-199------------------------------........ADTGARNGLSAASGF...MLGT-------E---KI.......
A9H2Q5_GLUDA/94-199------------------------------............RRHGLTAESGF...LLGG-------D---VP.......
D7AAL2_STAND/94-199------------------------------............ARHGVTAEGGH...LLGT-------A---QA.......
C5LY40_PERM5/101-214------------------------------...............GHEHSHGF...LVPA-------T---TSI......
D7FW72_ECTSI/215-297------------------------------..........................LEGD-------E---.P.......
C1E4T3_MICSR/78-183------------------------------................SATSSTFAFIAGGD-------A---.P.......

PF16865

A4I8P2_LEIIN/97-204--------------------------------------------ANQ.TTGPY---YCDG-------E----F-------
A4I8P2_LEIIN/321-429--------------------------------------------KHPFGEGPF---FGGK-------R----M-------
Q4CZ29_TRYCC/93-200--------------------------------------------EHQ.GDGPY---FLDD-------T----F-------

PF04399

Q6D1S0_PECAS/85-210-----------------------------------------------......---.NIN-------A----I-------
Q5NRG0_ZYMMO/87-214-----------------------------------------------..SPEA---VNG.-------Q----L-------
Q5NQ08_ZYMMO/85-214-----------------------------------------------..ESNA---VNG.-------E----L-------
D5QI23_KOMHA/68-196-----------------------------------------------..APHA---VNG.-------E----L-------
H2ITY9_RAHAC/85-214-----------------------------------------------..EPNA---VNG.-------E----L-------
F2JXW1_MARM1/91-215-----------------------------------------------..PSDH---GN..-------S----I-------
F9ZM92_ACICS/93-218-----------------------------------------------..AVHG---FYTP-------M----F-------
I0DZW0_PROSM/85-211-----------------------------------------------..TRNS---NNI.-------.----.-------
E6WDE9_PANSA/85-214-----------------------------------------------..KPNA---VNG.-------E----L-------
Q9CNB4_PASMU/85-214-----------------------------------------------..GETS---LNQ.-------H----L-------
X2GUV6_9GAMM/86-215-----------------------------------------------..SPQA---CNG.-------Q----L-------
D0NB62_PHYIT/96-224-----------------------------------------------..SSHS---VNA.-------E----L-------
Q7MBY7_VIBVY/84-208-----------------------------------------------..LDSY---QHA.-------T----L-------
Q65TQ1_MANSM/85-215-----------------------------------------------..AQDK---VNGE-------Q----L-------
F4HD49_GALAU/85-214-----------------------------------------------..SPKA---SSG.-------E----L-------
A8AI12_CITK8/69-198-----------------------------------------------..QPNA---VNG.-------E----L-------
Q5E4G7_VIBF1/86-215-----------------------------------------------..PSEK---GN..-------Q----I-------
K3W8Q1_PYTUL/137-266-----------------------------------------------..SNRS---VNE.-------S----L-------
Q7DD88_NEIMB/82-212-----------------------------------------------G.ASDG---ING.-------G----I-------
E0SAU3_DICD3/85-214-----------------------------------------------..SPQA---CNG.-------T----L-------
M4BU42_HYAAE/154-283-----------------------------------------------..TKHT---VNE.-------T----L-------
A8GFK9_SERP5/85-214-----------------------------------------------..APDA---VNG.-------T----L-------
Q5NH24_FRATT/91-214-----------------------------------------------..KTPF---INSE-------K----F-------
X2HAQ1_9NEIS/85-214-----------------------------------------------..NDHG---SNG.-------T----F-------
A1S8P5_SHEAM/96-225-----------------------------------------------..PSER---NN..-------Q----L-------
H3G9G4_PHYRM/122-251-----------------------------------------------..SSHS---VNE.-------T----L-------
D7FTR2_ECTSI/110-242-----------------------------------------------SPTSVA---ADG.-------K----L-------
W0L8R1_SERFO/85-214-----------------------------------------------..SPEA---VNG.-------T----L-------
A6VNZ1_ACTSZ/85-215-----------------------------------------------..AEDK---ANGV-------Q----V-------
A7MM21_CROS8/89-214-----------------------------------------------..GRQA---IDT.-------.----.-------
F0YIM1_AURAN/118-251-----------------------------------------------..CEDC---CTEG-------G----L-------
K7SWA6_GLUOY/88-217-----------------------------------------------..SPEA---VNG.-------T----L-------
F0LUD7_VIBFN/86-215-----------------------------------------------..PSER---GH..-------T----L-------
Q9KKV8_VIBCH/84-211-----------------------------------------------..LHSY---QHV.-------A----L-------
H8L0T2_FRAAD/85-207-----------------------------------------------..AHKG---LNL.-------.----.-------
Q6LNL6_PHOPR/86-215-----------------------------------------------..PSER---DN..-------N----L-------
Q5FQY7_GLUOX/87-216-----------------------------------------------..SPEA---VNG.-------E----L-------
W0HW21_9ENTR/85-214-----------------------------------------------..QPNA---CNG.-------E----L-------
H3GPY7_PHYRM/353-482-----------------------------------------------..SEHS---VNK.-------A----L-------
B2VDJ5_ERWT9/85-214-----------------------------------------------..QSNA---VNG.-------E----L-------
U4KES9_9VIBR/86-215-----------------------------------------------..PSER---GN..-------A----I-------
Q87J67_VIBPA/85-208-----------------------------------------------..LSSE---KQT.-------S----L-------
Q15Q78_PSEA6/101-230-----------------------------------------------..SETG---VNE.-------Q----L-------
C7JHY2_ACEP3/84-213-----------------------------------------------..EPSA---LQG.-------Q----L-------
F0YIS1_AURAN/125-254-----------------------------------------------GREPLS---LNAW-------G----Y-------
Q6D468_PECAS/85-214-----------------------------------------------..QPNA---CNG.-------V----L-------
G2I7E0_GLUMN/84-212-----------------------------------------------..QPGA---VNG.-------T----L-------
B7VSY7_VIBSL/89-209-----------------------------------------------..LENG---ESSL-------P----L-------
C9R3A8_AGGAD/85-214-----------------------------------------------..SDTA---LNG.-------S----L-------

PF11801

A5DPS2_PICGU/93-276---------------------------------DIVKLNHQLNPHRPDDTFAL---IFNE-------S...KI-------
Q6BJD7_DEBHA/112-306---------------------------------YVVSLYQELNSFNKPDEFSY---LFSD-------KASNAI-------
A5DUS1_LODEL/96-243---------------------------------QKS.............KTKE---VLKE-------S....K-------
MTX1_PIG/95-225---------------------------------AQ................KF---FFGD-------A....P-------
Q1L8P8_DANRE/95-225---------------------------------SQ................KF---FFGD-------S....P-------
M9N0R6_ASHG1/82-231---------------------------------PW................IA---VRGA-------A..ATL-------
Q6C8L9_YARLI/89-259---------------------------------ANV.............AKGS---LFST-------V.....-------
SAM37_YEAST/113-276---------------------------------NWL.............AARK---KLDD-------S...VI-------
Q6CII7_KLULA/89-254---------------------------------NWE.............SARQ---SLAS-------A....V-------
A1DFG3_NEOFI/97-262---------------------------------QK................TY---LVSD-------G...DA-------
A7TPA1_VANPO/99-264---------------------------------MW................DT---VRGN-------LNTEIE-------
A7F5V7_SCLS1/99-263---------------------------------KK................RY---LVSD-------S...QI-------
Q6FU46_CANGA/92-252---------------------------------QW................DS---ITDD-------L..PKT-------
Q5B6M7_EMENI/97-261---------------------------------DK................TH---LLGT-------T....P-------
A6RE67_AJECN/106-259---------------------------------RK................GY---LLSS-------E...IP-------
Q5ALP4_CANAL/109-308---------------------------------ERFKTIFQHQQRDSDEEFGF---IFNN-------Q...NP-------
A3LTE5_PICST/98-286---------------------------------YFSKLYEKL..NGNKNSYGF---IFDQ-------K...RA-------

PF14834

D5C687_ENTCC/95-211------------------------------------------------HGNPN---LFGE------------W-------
A7MH37_CROS8/138-254------------------------------------------------HGQQN---LFGE------------W-------
A6TBY7_KLEP7/95-211------------------------------------------------HGGQN---LFGE------------W-------
YFCF_ECOLI/95-211------------------------------------------------LGQPN---LFGE------------W-------

PF00043

GSTA2_MOUSE/99-192-----------TRVD--V..HL-----L---E----LLL...YV------EE-L-----DA--------------SL---
GSTA3_CHICK/99-192-----------SWAD--I..HL-----L---E----AIL...MV------EE-K-----KS--------------DA---
GSTA3_MOUSE/99-192-----------SRAD--I..AL-----V---E----LLY...HV------EE-L-----DP--------------GV---
GSTM3_HUMAN/108-196-----------TFVD--F..LT-----Y---D----ILD...QN------RI-F-----DP--------------KC---
GSTF3_MAIZE/107-203-----------TLAD--ANHAL-----L---P----ALT...SA------RP-P-----RP--------------GC---
GSTP1_BOVIN/97-188-----------SFAD--Y..NL-----L---D----LLR...IH------QV-L-----AP--------------SC---
GSTM2_CHICK/104-192-----------TFVD--F..LA-----Y---D----VLD...QQ------RM-F-----VP--------------DC---
GSTM2_RAT/104-192-----------TYVD--F..LV-----Y---D----VLD...QH------RI-F-----EP--------------KC---
GSTF1_MAIZE/110-201-----------SLAD--L..NH-----V---S----VTL...CL------FA-T-----PY--------------AS---
GSTM2_HUMAN/104-192-----------TFVD--F..IA-----Y---D----VLE...RN------QV-F-----EP--------------SC---
GSTA1_HUMAN/99-192-----------SRAD--I..HL-----V---E----LLY...YV------EE-L-----DS--------------SL---
EF1G_HUMAN/106-198-----------TLAD--I..TV-----V---C----TLL...WL------YK-Q-----VL--------------EP---
EF1G1_YEAST/107-199-----------SLAD--L..VA-----A---S----IFT...RY------FE-S-----LF--------------GT---
SYVC_HUMAN/107-198-----------TLAD--L..AA-----V---T----ALL...LP------FR-Y-----VL--------------DP---
GSTO1_CAEEL/120-219-----------GYPD--Y..LS-----F---P----FFEKIWWS------AS-L-----DG--------------VV---
GSTMU_CAVPO/103-191-----------TYVD--F..LA-----Y---D----VLD...QY------RM-L-----EP--------------KC---
GSTX6_SOYBN/99-198-----------GLVD--I..AA-----V---F----IAF...WI------PI-F-----QE--------------IA---
GSTA_ECOLI/100-189-----------TIAD--A..YL-----F---T----VLR...WA------YA-V-----KL--------------NL---
GSTX1_SOLTU/95-192-----------GFAD--I..VA-----N---G----AAL...YL------GI-L-----EE--------------VS---
GSTA4_MOUSE/99-192-----------SWAD--I..QL-----L---E----AIL...MV------EE-L-----SA--------------PV---
GST1_DROME/141-235-----------TWAD--V..YF-----A---G----ITD..YMN------YM-V-----KR--------------DL---
GSTP1_CAEEL/94-186-----------SYAD--Y..VL-----F---E----ELD...IH------LI-L-----TP--------------NA---
GSTF1_WHEAT/111-210-----------TFAD--L..NH-----I---P----FTF...YF------MT-T-----PY--------------AK---
GST1_YEAST/114-218-----------SGAD--I..LM-----S---F----PLQ...MA------FE-R-----KF--------------AA---
URE2_YEAST/223-345-----------TIAD--L..AF-----V---P----WNN...VV------DR-I-----GI--------------NI---
EF1G2_YEAST/104-196-----------SLGD--L..HA-----A---G----SWA...FG------LA-T-----IL--------------GP---
YIBF_ECOLI/96-192-----------NLAT--I..AI-----A---C----AVG...YL------NF-R-----RV--------------AP---
EF1G_SCHPO/99-196-----------TLAD--I..FF-----T---C----FLK...FG------AT-Y-----VL--------------TK---
B0UTU6_HISS2/103-194-----------SLVD--C..YI-----A---P----LLW...RM------QQ-L-----GV--------------VF---
B4EWL4_PROMH/103-189-----------TVAD--A..YL-----F---T----LSQ...WA------PH-V-----AL--------------DL---
F6V028_XENTR/108-198-----------TLAD--I..AV-----T---C----SLL...WL------YK-Q-----VL--------------EP---
G2IN92_9SPHN/107-234-----------SLAD--I..CN-----F---A----IAN...GL------QR-P-----GG--------------FF---
GST28_SCHMA/104-195-----------TLAD--L..VL-----I---A----VID...HV------TD-L-----DK--------------GF---
SSPA_ECOLI/102-194-----------SLVD--C..YL-----A---P----LLW...RL------PQ-L-----GI--------------EF---
Q4CXW2_TRYCC/105-198-----------TVAD--V..AV-----A---F----ALQ...WH------YR-L-----NG--------------AE---

PF13410

A0L6K1_MAGSM/131-194-----------SIAD..A--AL-----F...Y....VTF--.WA......DR-I.....GL------------..PM...
A0LDX3_MAGSM/121-185-----------TLAQ..L--AL-----G...A....TLG--.YL......DF-R.....LP------------..QL...
A1AV55_RUTMC/124-190-----------TIVD..A--CL-----G...A....LLW--.RL......KK-L.....DI------------.......
A1B210_PARDP/196-269-----------TETD..L--RL-----W...P....TLA--.RF......DA-V.....YH------------..GHFK.
A1CDY3_ASPCL/184-260-----------TELD..L--RA-----Y...T....TLI--.RF......DP-I.....YV------------..QHCKC
A1S3B6_SHEAM/120-184-----------NARS..M--AL-----V...C....LLD--.YM......DY-R.....HP------------..AL...
A1TQ85_ACIAC/453-519-----------ALSD..V--AL-----M...P....FVR--.QY......AG-I.....DR------------...T...
A1U867_MARAV/117-182-----------SPAD..I--LL-----A...V....YSR--.WG......DF-F.....PV------------..DI...
A1WJX2_VEREI/124-191-----------DIGS..I--AV-----G...C....ALW--.YL......DL-R.....FA------------..DL...
A2AJ28_MOUSE/127-207-----------TLAD..C--SL-----L...P....KLH--.IV......DT-VC..AHFR------------..QL...
A2Q995_ASPNC/149-217-----------SFVD..V--QV-----A...P....WII--.RL.....RRA-L.....KP------------..YR...
A2QH45_ASPNC/187-263-----------TELD..V--ML-----Y...T....TLI--.RF......DV-V.....YV------------..EHFKC
A4RZE0_OSTLU/123-196-----------SLAD..I--SI-----W...P....FAE--.RF......QL-A.....MR------------..EFQ..
A4YLR1_BRASO/127-234-----------AYGD..F--GL-----W...G....QFY--ELW......TD-P.....TA------------..GA...
A4YXA6_BRASO/141-211-----------SALD..L--TC-----Y...Q....TTF--.LM.....RKN-C.....PG------------..EV...
A5GJY1_SYNPW/170-241-----------GTAD..L--VF-----I...P....YVE--.RM......NA-SL..AYFK------------..GF...
A5VCI8_SPHWW/122-190-----------GLTD..A--AI-----F...P....FVR--.QF......AE-T.....DR------------..AW...
A6R8D9_AJECN/127-204-----------GIVD..S--FY-----W...P....VLW--.RF......RT-Y.....N.------------...F...
A6T619_KLEP7/122-188-----------DQVL..V--TS-----T...V....VWS--.FI......QL-M.....IP------------..AV...
A7HP97_PARL1/145-226-----------TLAD..A--TV-----F...A....YLV--.NI......AG-P.....EL------------..PSP..
A7HPN1_PARL1/131-202-----------GVAD..A--MY-----A...P....VVT--.RF......ET-Y.....GV------------..DL...
A7HWV6_PARL1/136-238-----------SIAD..F--GL-----Y...G....QLS--.QY......AV-D.....PT------------..TS...
A7IBJ5_XANP2/127-190-----------SAAD..P--IL-----F...Y....VEF--.WA......DK-T.....GM------------..EL...
A7IPF7_XANP2/133-196-----------SIAD..A--AL-----F...Y....NEF--.WA......EK-T.....GI------------..PM...
A8BBE3_GIAIC/125-191-----------LYSD..Y--AV-----L...E....VLY--.YA......DA-E.....YP------------..E....
A8GAF3_SERP5/122-189-----------GSAE..V--SV-----A...V....AWS--.FT......QL-M.....LP------------..EL...
A8I0K9_CHLRE/123-191-----------NGTD..C--SL-----A...P....KLY--.HA......VV-AL..KHFK------------..GW...
A8P0W9_COPC7/143-215-----------TWAD..F--FL-----F...P....LLD--.DL......RA-I.....PA------------...W...
A8PWD6_MALGO/165-250-----------TWVA..V--FL-----F...P....ILR--.DF......RA-T.....NP------------..RMVL.
A9BRB1_DELAS/118-188-----------TLAD..C--CA-----I...V....HLP--.LVS...AASK-I.....VG------------..GR...
A9CJG7_AGRT5/129-216-----------LFAD..Y--IV-----F...G....ALQ--.WA......RI-T.....S.------------..GA...
A9ENK0_SORC5/120-185-----------DIGA..I--SV-----A...C....ALG--.YL......DF-R.....WP------------..DR...
A9G573_SORC5/130-198-----------SYLE..V--AL-----F...C....LVT--.HL......EF-R.....RV------------.......
A9G5M8_SORC5/132-224-----------AGVD..A--TA-----F...A....VLA--.GL......LT-P.....FF------------..DS...
A9GLX2_SORC5/161-243-----------TFAD..I--AM-----S...Q....VLV--.NV......AP-P....AQL------------..KLGAA
A9RED4_PHYPA/166-240-----------TLVD..V--YL-----I...P....TLL--.QV......DV-A.....KF------------FRGV...
A9RIP1_PHYPA/191-298-----------SAAD..V--TF-----A...A....LGG--.PL......VS-P.....PE------------..GG...
A9SSZ0_PHYPA/249-317-----------SLVD..A--VY-----A...P....FLE--.RT......AA-S.....MP------------..YWP..
A9SZI4_PHYPA/403-470-----------TLVD..V--YL-----I...P....FLS--.LM......DL-V.....TY------------IRGF...
A9VD76_MONBE/143-208-----------TFGD..L--AV-----F...E....VVN--.AI......TH-Y.....M.------------..QV...
B0CZV3_LACBS/156-232-----------GWSD..V--MV-----A...P....WIL--.RA......KI-VL...RHY------------..RG...
B0DMK1_LACBS/141-206-----------SWAD..F--FL-----F...P....LIA--.DL......RA-L.....H.------------.......
B0T373_CAUSK/123-185-----------EIGE..I--AV-----A...V....QLG--.YL......DV-R.....QV------------...M...
B0U7F7_METS4/125-203-----------TIAD..A--MY-----A...P....VCT--.RF......VT-Y.....NV------------..GLPPG
B0UCA1_METS4/160-231-----------SSFD..A--TV-----Y...G....FLA--.NG......FY-TP..LPGP------------..FR...
B1Y635_LEPCP/144-209-----------GIAD..A--YY-----A...P....VAS--.RL......RS-Y.....AL------------..PV...
B2B7D3_PODAN/137-206-----------GAVD..A--FF-----A...P....VVL--.RL.....GSY-L.....GA------------..GE...
B2GG80_KOCRD/207-280-----------TEAD..V--RL-----F...T....TLV--.RF......DP-V.....YV------------..SHFK.
B2J7I4_NOSP7/169-243-----------SLVD..I--TY-----S...P....HLD--.RL......AA-NLPVYRGY------------..HL...
B2UK10_RALPJ/126-192-----------CATD..L--AI-----F...P....FVR--.QF......AA-V.....EP------------..DW...
B4N5A8_DROWI/142-215-----------GMLD..Y--MI-----W...P....WCE--.RF......AA-L.....KY------------..TLGE.
B4R810_PHEZH/136-206-----------SLGD..I--AA-----Y...M....NVW--.WL......GA-A.....AP------------AAAE...
B6GZF3_PENCW/142-236-----------SCTD..F--FI-----A...G....SLQ--.ST......RV-V.....DE------------..GV...
B6INT9_RHOCS/122-191-----------DLGD..I--GL-----A...V....ALA--.YL......DF-R.....HA------------..AL...
B6IWS7_RHOCS/197-270-----------TEAD..W--RL-----F...T....TLV--.RF......DT-V.....YY------------..SHFKC
B6JAK1_OLICO/121-185-----------TIGH..I--AI-----G...C....ALG--.YF......DI-R.....FP------------..DD...
B8C0F0_THAPS/181-261-----------TMID..F--IY-----V...S....HVE--.RM.....LAS-C.....AF------------WKGLDL.
B8CA81_THAPS/207-302-----------SAVD..I--LL-----T...N....CCF--.WA......MQ-I.....GW------------..LEKTS
B8CLJ2_SHEPW/123-188-----------CIAD..Y--AI-----Y...P....FIR--.QF......AH-V.....DK------------..AW...
B8EKE6_METSB/125-187-----------SIAD..A--AL-----F...Y....VEF--.WA......DK-T.....NI------------..PL...
B8IAD7_METNO/126-190-----------DLGA..V--AV-----G...T....ALR--.YL......TG-R.....SP------------..EI...
B8LD48_THAPS/125-192-----------TIAD..L--AV-----A...P....MIT--.LL......KG-R.....KK------------.......
B8LWW9_TALSN/704-780-----------TELD..I--RL-----Y...A....TLI--.RF......DA-I.....YV------------..QHFKC
B8MAD4_TALSN/131-201-----------SMAD..V--VL-----V...P....TVD--.QL......VV-Y.....RL------------..DL...
B8MMG1_TALSN/173-241-----------TFTD..F--FL-----A...G....VLQ--.SA......KM-V.....DE------------..GV...
B8NN14_ASPFN/137-207-----------SIAD..A--FF-----W...P....VLW--.RF......RT-Y.....N.------------...L...
B8PKG3_POSPM/157-232-----------SLAD..V--MV-----A...P....WIF--.RA......TN-VL...VHY------------.RGF...
C1E0N8_MICSR/130-200-----------TLAD..L--AL-----W...P....FAE--.RY......EL-A.....MR------------..EFQ..
C1E269_MICSR/572-669-----------GVMD..F--GA-----A...V....DLA--.FFFQPSFEVF-L....AKH------------..DI...
C1E340_MICSR/1002-1082-----------NMAD..A--YL-----A...T....MLF--.WA......HN-A.....LE------------..CGLMP
C1E340_MICSR/1335-1412-----------IQAD..V--FA-----G...T....MLF--.WA......HN-A....IES------------..GFAQI
C1E340_MICSR/1667-1747-----------NQAD..A--FL-----A...T....MLY--.WS......HN-A.....LE------------..CGLSP
C1EEB2_MICSR/138-221-----------SKAD..V--FA-----A...T....TLF--.FS......HN-I.....AE------------..SGLCG
C1EFU5_MICSR/220-287-----------TCGE..M--FL-----W...G....VLH--.QV......VL-L.....AK------------..AF...
C1GU35_PARBA/153-226-----------TAAD..I--IV-----V...F....SLT--.TF......RY-W.....YR------------..Y....
C1MTQ1_MICPC/148-219-----------SVAD..V--VL-----W...P....FVE--.RF......EL-A.....MR------------..EF...
C1MWR5_MICPC/124-195-----------SVGE..F--YL-----W...S....ILH--.QV......SL-M.....AG------------..EAG..
C1MYW2_MICPC/249-328-----------SVYD..V--VA-----S...T....IAP--.RVSI.VLRHY-R.....GF------------..SLG..
C3Y1F6_BRAFL/230-307-----------TEAD..A--TV-----Y...G....FMA--.EI......LW-A.....AP------------..KSSD.
C5AAI5_BURGB/120-192-----------GIAD..V--AA-----Y...I....HLP--.LV......GL-A.....TK------------..AVYG.
C5BTC1_TERTT/126-189-----------TIAD..A--AL-----F...Y....VEF--.WA......NR-T.....EL------------..P....
C5CUS5_VARPS/135-201-----------SMLD..L--YV-----T...V....LSR--.WT......PR-R.....RR------------..F....
C5CZN1_VARPS/195-312-----------SLAD..A--FW-----G...V....NLV--.RL......NY-L.....GL------------..GS...
C5D1E8_VARPS/125-190-----------SIGQ..L--TL-----G...C....ALG--.YL......DY-R.....FD------------..AL...
C5FDK1_ARTOC/126-203-----------SIAD..A--FF-----W...P....VLW--.RF......RT-Y.....N.------------...L...
C5GMZ6_AJEDR/248-332-----------TEAD..I--RL-----Y...T....TIV--.RF......DP-V.....YV------------..QHFKA
C5KH39_PERM5/146-220-----------SIVD..I--AA-----Y...P....WIL--.RS......FL-L.....GY------------..YKGPA
C5KQA0_PERM5/164-239-----------STID..A--TV-----F...G....YLW--.SN.....FDT-D.....S.------------..EFTKY
E8RLA4_ASTEC/120-184-----------GLAE..I--TL-----A...S....AAT--.YI......DF-R.....FP------------..KL...
C6XNN1_HIRBI/148-224-----------TGVD..A--CV-----A...A....FVQ--.GC......ST-PF..FETP------------..MI...
C6XRQ4_HIRBI/121-230-----------SIAD..F--GL-----A...A....QLG--.QL......LK-D....PTP------------..AK...
C7YRS8_NECH7/127-221-----------SLAD..I--EA-----I...W....PFH--.WI......TG-I.....QG------------..ALPE.
C7ZGQ3_NECH7/146-213-----------TIAD..C--VL-----Y...S....MLH--.FA......KD-L.....Y.------------..GL...
C7ZM60_NECH7/221-306-----------SEID..I--RL-----V...W....DTK--.LL.....FNF-V.....T.------------...IIRF
E6WEX2_PANSA/122-189-----------DQVA..I--SS-----A...V....IWG--.FI......QS-I.....IP------------..QV...
C9SJL3_VERA1/160-242-----------SMVD..V--ML-----A...P....WAM--.RL......FL-I.....DH------------..YKPGG
C9SW24_VERA1/159-239-----------SYAD..L--IY-----A...G....ALQ--.FM......RR-T.....AG------------..ESHFQ
D2VLV0_NAEGR/154-242-----------SLLD..G--AL-----I...P....FII--.RF......DS-N.....LR------------..NQYGV
D3BDL7_POLPA/178-253-----------TETD..I--RL-----F...T....TLI--.RF......DI-V.....YY------------..HVM..
D3BFK7_POLPA/158-266-----------SVVD..I--SL-----F...S....MLV--.QL......YY-A.....IE------------..PT...
D3BS36_POLPA/173-246-----------TELD..I--KL-----F...V....TLI--.RF......EP-A.....YY------------..GAY..
D4AIT6_ARTBC/160-238-----------MMPD..I--ML-----A...P....LAI--.RF......WV-I.....DH------------..FKKGG
D4AJL6_ARTBC/139-210-----------HVGH..I--AL-----A...T....ALS--.WL......LF-R.....GV------------..GE...
CLIC1_HUMAN/142-212-----------TLAD..C--NL-----L...P....KLH--.IV......QV-VC..KKYR------------..GF...
Q012T3_OSTTA/160-232-----------SGAD..A--AI-----F...P....TLI--.FC......DF-L.....LP------------.KYF...
Q017S3_OSTTA/231-304-----------TEAD..V--RL-----W...Q....TLI--.RF......DE-V.....YV------------..VYFK.
Q092M3_STIAD/123-189-----------GMAE..L--AL-----L...T....TLD--.FM......VF-R.....NR------------..Y....
Q0BV02_GRABC/124-186-----------DIGS..I--SV-----A...C....ALG--.YL......DL-R.....FS------------..HE...
Q0BWT6_HYPNA/123-219-----------GFVD..V--HA-----Y...M....NVW--.WM......KQ-A.....VP------------..AFA..
Q0C681_HYPNA/120-229-----------SAAD..F--AL-----A...A....QFQ--.QM......LT-D.....PT------------..PA...
Q0CJU0_ASPTN/163-232-----------SYTD..F--FI-----A...G....ALQ--.SA......QT-V.....HE------------..GV...
Q0U052_PHANO/145-222-----------KLAD..I--NA-----L...F....MLD--.FA......AG-L.....QL------------..PE...
Q0V763_PHANO/145-227-----------TVAD..I--DA-----V...W....PFE--.WM......IV-D.....PY------------..MKECL
Q0V763_PHANO/476-547-----------TADE..V--AV-----A...V....ATA--.MT.....GNM-G.....HL------------..GI...
Q119J9_TRIEI/182-256-----------SLVD..I--IY-----T...P....GIT--.RLAA.NLPVF-R.....GY------------..SI...
Q11II4_CHESB/120-190-----------GHAD..I--AV-----A...A....MLR--.HL......AE-A.....HP------------..GM...
Q15Y89_PSEA6/118-181-----------NYPA..I--CL-----F...S....LID--.WV......EF-R.....SL------------.......
Q16DN2_ROSDO/135-224-----------TAAD..A--SV-----A...P....MLA--.AA......TA-S.....P.------------..GV...
Q1CXG6_MYXXD/156-248-----------SFAD..I--AA-----A...L....MLQ--.FV......RP-V.....DD------------..SYLPL
Q1LMA0_RALME/129-215-----------SVAD..F--SL-----Y...H....NIW--.FI......RR-A.....TA------------..LA...
Q219M8_RHOPB/125-189-----------DLAQ..I--AL-----V...C....VLG--.YA......DL-R.....FA------------..DC...
Q21NV3_SACD2/125-196-----------TLAD..I--TA-----L...S....ILP--.LA......HL-V.....KP------------.......
Q28VM3_JANSC/126-191-----------DMGQ..I--SV-----A...C....ALG--.YL......DL-R.....HG------------..DR...
Q2RP79_RHORT/128-193-----------TIGA..V--SL-----G...A....ALG--.YL......DF-R.....FP------------..DI...
Q2Y8A0_NITMU/202-275-----------TEAD..W--RI-----F...T....TLI--.RF......DP-V.....YH------------..GHF..
Q3IWV3_RHOS4/128-191-----------SAAD..V--FF-----A...P....VAA--.RI......AG-Y.....GL------------.......
Q3IXJ7_RHOS4/202-274-----------TETD..I--RI-----F...V....TLI--.RF......DA-A.....YH------------..GLFK.
Q3SJZ3_THIDA/124-195-----------GWAE..T--VF-----T...P....FFQ--.RF......WF-L.....EY------------..YE...
Q47WD3_COLP3/155-230-----------TSFD..A--VV-----Y...S....HLC--.EF.....ISV-R.....F.------------..DN...
Q4KEB7_PSEF5/127-192-----------GALD..I--QA-----A...V....VSR--.WS......GA-R.....EH------------.......
Q4PA85_USTMA/231-359-----------THAD..F--VL-----F...G....WYV--.FT......RA-A.....GQ------------..KTA..
Q4PBA3_USTMA/148-231-----------QYLD..L--SL-----Y...V....PLN--.WV......QT-Q.....LR------------..TGHDL
Q4PEE8_USTMA/196-272-----------SDAD..I--RL-----Y...P....TLA--.RF......DT-A.....YH------------..NLFRC
Q4PH05_USTMA/169-242-----------TWAD..L--FL-----Y...P....ILA--.DL......RA-S.....PA------------..AHF..
Q54DU4_DICDI/215-290-----------TESD..I--KL-----F...S....TLI--.RF......DA-A.....YL------------..QLFK.
Q5K7H9_CRYNJ/151-218-----------TAVD..G--TL-----A...P....FIR--.RL......YI-L.....EK------------..HR...
Q5LMS6_RUEPO/132-224-----------TGAD..L--SV-----A...P....MLA--.AM......RA-T.....PV------------..AT...
Q5LRR6_RUEPO/138-209-----------GLAE..A--VY-----T...P....LFK--.RF......WF-L.....DY------------..YE...
Q6C3X4_YARLI/164-237-----------SAADAEY--AW-----I...PLFLIFIG--.GL......EQ-A.....G.------------.......
GSTL1_ARATH/146-212-----------SLVD..I--AY-----I...P....FIE--.RF......QV-F.....LD------------..EVF..
Q7NTJ7_CHRVO/121-190-----------DQAA..L--TT-----A...V....AWR--.FS......RR-M.....TA------------..DI...
Q7V893_PROMM/166-242-----------GSAD..V--VF-----I...P....YVE--.RM......NA-SL..AYYK------------..GF...
Q7VCF4_PROMA/134-205-----------TIAD..W--SI-----W...P....FVR--.QY......RL-I.....DS------------.VRF...
Q88AE2_PSESM/125-190-----------DVAS..I--SV-----A...A....ALG--.YL......DF-R.....QP------------..EL...
Q8XXV1_RALSO/117-188-----------TIAD..C--AA-----IVHFP....LIS--.SA......TK-I.....IY------------..GE...
Q9FL98_ARATH/201-270-----------TESD..I--RL-----F...V....TVI--.RF......DE-A.....YA------------..VIFK.
GSTL2_ARATH/195-261-----------SLVD..V--AY-----A...P....FIE--.RF......RL-I.....LS------------..DVM..
Q9NA74_CAEEL/171-244-----------KTID..V--TA-----F...A....HLA--.EL......IY-TP..QFSP------------..EIR..
B2UD16_RALPJ/121-186-----------TQAG..V--TV-----A...V....AWA--.FI......QL-M.....VA------------..DR...
B4EEI7_BURCJ/123-196-----------LQSD..V--TV-----A...V....AWR--.FT......QF-M.....AA------------..DYPV.
C5AZ79_METEA/124-188-----------DIGT..I--AL-----A...C....ALG--.YL......DL-R.....FS------------..DI...
E7KR93_YEASL/151-241-----------TEAD..I--RL-----Y...T....TVI--.RF......DP-V.....YV------------..QHFKC
G8PGF5_PSEUV/127-190-----------DAAQ..I--AL-----A...C....ALG--.YL......DL-R.....FA------------..G....
G8PGF6_PSEUV/125-190-----------DCAQ..I--AL-----A...C....SLG--.YL......DL-R.....A.------------..NG...
G8PGT3_PSEUV/202-274-----------TEAD..W--RL-----F...T....TLV--.RF......DP-V.....YV------------..GHF..
G8PTB8_PSEUV/192-263-----------TEVD..W--KL-----F...V....TLI--.RF......DA-V.....YV------------..THF..
H3CB38_TETNG/137-223-----------TLAD..C--NL-----L...P....KLH--.VV......KV-V.....CQ------------..EYC..
H3CIP6_TETNG/126-213-----------TLAD..C--NL-----L...P....KLH--.IV......KV-VC..LKYR------------..SF...
GSTX2_MAIZE/128-201-----------GLLD..L--AL-----G...C....FLP--.AL......RA-C.....ER------------..LHGL.
Q3IY08_RHOS4/123-186-----------DIGQ..I--AM-----G...C....ALD--.YL......DF-R.....HG------------..PR...
Q7SF99_NEUCR/240-329-----------SLVD..I--ML-----A...P....WAK--.RL......FL-I.....DH------------..YKPGG
R7G4S4_9FIRM/257-325-----------TDSD..V--RL-----Y...V....TLA--.RL......DI-R.....YT------------..HQLGH

PF14497

F0X3Q4_CRYPV/161-266...........TIPD--I--FI.....Y---E----FA.....NL.....IN-T-----LF...............P---
Q5CKJ7_CRYHO/161-266...........TIPD--I--FI.....Y---E----FA.....NL.....IN-T-----LF...............P---
B8CAA6_THAPS/182-300...........RFVD--I--VL.....V---I----SL.....IR...LDLA-Y-----QW.........RFGLGRR---
A8XWB3_CAEBR/131-230...........TEYD--C--EL.....M---P----RL.....HH...IRII-G-----LS............LLGF---
E3N1N5_CAERE/175-274...........TEYD--C--EL.....M---P----RL.....HH...IRII-G-----LS............LLGF---
EXC4_CAEEL/130-229...........TEYD--C--EL.....M---P----RL.....HH...IRII-G-----LS............LLGF---
F1KT43_ASCSU/135-234...........TEYD--C--EL.....M---P----RL.....HH...MRIV-G-----QR............LLGF---
A8NYA7_BRUMA/133-234...........TEYD--C--EL.....M---P----RL.....HH...IRIV-G-----QR............LLGF---
E1GBX8_LOALO/133-234...........TEYD--C--EL.....M---P----RL.....HH...IRIV-G-----QR............LLGF---
Q24F18_TETTS/217-335...........DEAD--F--AM.....Y---G----VI.....MA.....KY-N-----SQ............SFQ.---
F2TJD5_AJEDA/76-203...........TAAN--I--MV.....V---F----SL.....TT...FRNW-F-----AY............SLRG---
A6G9D5_9DELT/106-239...........TVLD--A--TA.....F---A----YV......G.....SF-A-----CA............PFDD---
E3Q3M1_COLGM/143-285...........TEAD--F--IV.....Y---G----NL.....AT...VMGT-N-----VN............PVHA---
B2B5D5_PODAN/109-260...........TEAD--C--TL.....Y---G----MV.....AG.....RL-M-----CS.......SAA..PETG---
Q0U682_PHANO/112-249...........TEAD--T--TV.....F---G----FI.....IS...SLVA-T-----AG............PVNK---
A1CCM4_ASPCL/109-245...........SEAD--F--TV.....F---G----FI.....VS...VLVC-D-----AA............PESR---
Q2GX63_CHAGB/116-255...........TEAD--A--TV.....F---G----FI.....AA.....AL-D-----CP..........QAPATE---
E3M3K7_CAERE/109-240...........SWLD--C--KA.....F---A----VL.....VQ.....FK-Y-----TP.......LHNEARLK.---
D7FWB3_ECTSI/120-218...........TIGD--L--RL.AVTTY---H----ML.....AA...FDIE-K-----QW............TFPD---
F1KXU8_ASCSU/112-193...........THID--C--YI.....L---P----KL.....HT.....IR-I-----AA..........AALKQY---
E8Z6E4_PFIPI/96-208...........TIGD--L--YM.....K---K----PL.....VD...MIKD-G-----QF...........EAVEN---
A1AB54_ECOK1/45-122...........TLVD--C--YL.....C---T----MR............TW-G-----..............PGHE---
C1HKK3_9ESCH/61-138...........TLVD--C--YL......---.----.......CT...MRTW-G-----..............PGHE---
E9TQV2_ECOLX/45-122...........TLVD--C--YL.....C---T----MR............TW-G-----..............PGHE---
E0QYH5_ECOLX/45-128...........TLVD--C--YL.....C---T----MR............TW-G-----..............PGHE---
B5FXM3_TAEGU/120-251...........TELD--A--LV.....F---G----HL.....FT...ILTT-Q-----LI........TD..ELSE---
E1BVN1_CHICK/113-243...........TELD--A--LV.....F---G----HL.....FT.....IL-T-----TQ............LITD---
E9G0M2_DAPPU/109-235...........TEMD--C--SM.....F---G----IL.....AQ....VVW-S-----LP........GS..SFES---
E9GQJ6_DAPPU/107-233...........IEVD--C--AI.....F---G----ML.....AQ....ILW-N-----SP...........GSPYR---
Q9NAG5_CAEEL/170-288...........TKVD--A--CI.....F---S----HL.....CQ.....IY-Y-----AP.......YTS..EHR.---
A8XYN3_CAEBR/159-290...........TKVD--A--CL.....F---A----NL.....CQ.....IY-Y-----AP..........YTSEHR---
E3MMS1_CAERE/154-288...........TKVD--A--CI.....F---S----NL.....CQ.....IY-Y-----AP........YT..SEHR---
C5LXL1_PERM5/112-245...........TSVD--A--TV.....F---G----FMWAELGVD...SEYE-K-----VN............AFCQ---
E2R3Q0_CANFA/144-275...........STLD--A--TV.....F---G----HL.....AQ....AMW-T-----LP...........GTRPE---
G3QJ55_GORGO/197-328...........STLD--A--TV.....F---G----HL......A...QAMW-T-----LP...........GTRPE---
FAXC_RAT/197-328...........STLD--A--TV.....F---G----HL......A...QAMW-T-----LP...........GTRPE---
D2HID7_AILME/197-339...........STLD--A--TV.....F---G----HL......A...QAMW-T-----LP...........GTRPE---
B3S4C5_TRIAD/106-233...........TTID--A--CV.....F---G----FI............VN-I-----LS.......GLSEDSWPN---
B3S5C1_TRIAD/137-264...........TRID--A--TM.....F---A----FL.....AL.....LI-F-----GM........PTAAPSYK---
B3RZK8_TRIAD/97-224...........TTVD--A--CM.....F---G----FL.....AN.....ML-Y-----AV........PKSSPCYR---
D0N2R1_PHYIT/80-174...........SLAD--V--VA......---G----VT............LR-A-----AF............KVVK---
E3M1A0_CAERE/120-266REGHGVSFEYWNLID--A--TL.....F---G----HL.....AQ.....IF-Y-----TP............QFTG---
S7UUE1_TOXGO/396-511...........DEVD--L--AV.....F---G----IL.....NS.....TE-G-----CS.............VEK---
B9QR24_TOXGO/404-519...........DEVD--L--AV.....F---G----IL.....NS.....TE-G-----CS............VEK.---
F0VEQ6_NEOCL/393-510...........DEVD--L--AV.....F---G----IL.....NS.....TE-G-----CT............VEK.---
E9J013_SOLIN/261-381...........DLSD--L--AV.....Y---G----IL.....KS.....IE-G-----CD............AFQ.---
PGES2_MOUSE/252-367...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFD.---
D4AE56_RAT/252-367...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFD.---
F1N1J6_BOVIN/250-365...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFD.---
F1RRY6_PIG/253-368...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFE.---
F1P9X4_CANFA/252-367...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFD.---
B4YY03_CANFA/250-365...........NLAD--L--AV.....Y---G----VL.....RV.....ME-G-----LE............AFD.---
D8RW70_SELML/135-249...........NLAD--L--AV.....F---G----VL.....RP.....IR-N-----LD............SGN.---
Q9FHX0_ARATH/192-305...........NLGD--L--AV.....F---G----VL.....RP.....IR-Y-----LR............SGK.---
D3BAJ2_POLPA/71-164...........TWAD--L--AV.....F---N----SV............DY-L-----LW............TKND---
F1KQF6_ASCSU/105-183...........TLAD--L--VV.....W---T----LI..............-.-----..............ANDL---
B2BXI7_ARALL/100-207...........GFLD--M--VA.....G---S----IL.....IPFCLTRAW-E-----CM............GIDM---
D7LL96_ARALL/100-207...........GFLD--M--VA.....G---S----IL.....IPFCLTRAW-E-----CM............GIDM---
B9RCA3_RICCO/93-207...........SIAD--L--SL.....V---C----QI.....MQ.....LE-V-----LD.......END..RNR.---
D8QNB8_SELML/101-218...........SVAD--L--IL.....S---C----EI.....ME...LELL-G-----EE............KYL.---
D8R6V3_SELML/101-218...........SVAD--L--IL.....S---C----EI............ME-L-----EL............LGEE---
B9T6C9_RICCO/29-125...........GYFD--I--VV.....Y---F----IL............YE-F-----LL......IKQVTETGLI---
F0WN27_9STRA/91-187...........TLAD--I--IV......---.----........G...ASLR-T-----SF............AILS---
D6WU61_TRICA/72-170...........NASD--I--VV.....W---C----TL.....YP.....LA-L-----DD............TLAK---
E4UVV4_ARTGP/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
D4DGR0_TRIVH/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
D4AT40_ARTBC/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
F2PV52_TRIEC/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
F2RVW7_TRIT1/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
A0A022TE31_TRIRU/48-141...........SVLD--V--AL.....Y---A----AL.....AP.....VV-E-----KW............TAEQ---
C4JDF5_UNCRE/48-138...........SVVD--I--AL.....Y---A----LL.....GP.....VV-E-----KW............SPEE---
Q4WZS4_ASPFU/48-138...........SVAD--I--AA.....Y---A----LL.....AP.....LV-E-----KW............TPEE---
B8CBE8_THAPS/169-259...........TLAD--V--AL.....F---A----SLGFPSLEE...SKLE-I-----AS................---
F0YCB2_AURAN/642-721...........TLAD--A--CC.....W---A----AV.....TT.......-.-----..............AAAD---
A3LWB3_PICST/76-162...........TTAD--I--AV.....W---G----VL.....RA......N-A-----LM............GSVI---
Q6BKC8_DEBHA/81-164...........SLAD--V--AI.....W---G----VL.....RA.......-.-----.............NALMG---
Q4U9H7_THEAN/88-189...........SPAD--L--VC.....A---V----SL.....DH.....LV-H-----QK............RLDA---
D8U415_VOLCA/66-148...........TLAD--L--VI.....Y---G----LV.....HP.....AV-T-----SF........PAAQTLH.---
D8TWM4_VOLCA/86-193...........TLAD--V--AV.....A---A----AL.....TP.....LF-Q-----SV............LGR.---
F2UBC5_SALR5/67-152...........SMAD--V--AL.....F---A----AL.....RE.....RG-G-----VP............QGV.---
Q7Q3I3_ANOGA/70-167...........SSAD--V--AV.....W---S----LL.....AP.......-.-----..............DGTL---
B4N9E6_DROWI/73-152...........TIAD--F--AL.....F---N----EM.....HS.......-.-----...............RY.---
B4HG12_DROSE/73-152...........TIAD--F--AL.....F---N----EM.....HS.......-.-----...............RY.---
B4PL45_DROYA/73-152...........TIAD--F--AL.....F---N----EM.....HS.......-.-----RY............EFL.---
B4QSD7_DROSI/73-152...........TIAD--F--AL.....F---N----EM.....HS.......-.-----RY............EFL.---
SYEP_DROME/73-152...........TIAD--F--AL.....F---N----EM.....HS.......-.-----RY............EFL.---
B3M314_DROAN/73-152...........TIAD--F--AL.....F---N----EM.....HS...RYEF-L-----AS............KGI.---
B3P8B5_DROER/73-152...........TIAD--F--AL.....F---N----EM.....HS...RYEF-L-----AT............KGI.---
B4JT86_DROGR/72-151...........TIAD--F--AL.....F---N----EM.....HS.......-.-----..............RYEL---
B4K6U5_DROMO/72-151...........TIAD--F--AL.....F---N----EM.....HS...RYEF-L-----SA............KGI.---
X1Y0E9_ANODA/694-773...........TIAD--L--AV.....F---N----EL.....YA.......-.-----.........RYD..ELR.---
B0XC16_CULQU/71-150...........TIAD--L--AV.....F---N----EL............FS-C-----YE............ELK.---
Q178Q6_AEDAE/71-150...........TIAD--L--AV.....Y---N----QL............FS-S-----YD............ELK.---
B7PKR5_IXOSC/70-155...........TIAD--F--TV.....W---G----AL.....FV...SPAW-Q-----GL............LSAK---
C3XZ88_BRAFL/70-155...........TLAD--F--AV.....W---G----AL.....RS...NNLW-L-----NQ.......LDR..GKA.---
F1P179_CHICK/71-156...........SLAD--V--CV.....W---A----VL.....KD......N-N-----IW............QEQL---
Q5ZJ86_CHICK/71-156...........SLAD--V--CV.....W---A----VL.....KD......N-N-----IW............QEQL---
B4DKX5_HUMAN/71-156...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
SYEP_HUMAN/71-156...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
Q3KQZ8_HUMAN/71-156...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
Q5RCS2_PONAB/71-156...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
F1S9K5_PIG/71-156...........SLAD--L--CV.....W---A----TL.....KGNAAWQEQ-L-----QQ............NKA.---
D2HDG9_AILME/57-142...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
E2QUR2_CANFA/71-156...........SLAD--L--CV.....W---A----TL.....KG......N-A-----AW............QEQL---
Q6TXE9_RAT/89-174...........TLAD--L--CV.....W---A----TL.....KG.....NA-A-----CQ............EHLR---
B9EIU1_MOUSE/71-156...........TLAD--L--CV.....W---A----TL.....KG......S-A-----AW............QEHL---
E6ZR79_SPORE/78-163...........TAAD--V--AI.....W---A----AV.............R-A-----SS............PVIG---
A8JF35_CHLRE/74-156...........TLAD--L--AV.....W---G----AL.....QA...SPLW-N-----KV............RGSG---
D8UHB4_VOLCA/73-156...........TLAD--L--AV.....W---G----QL.....HG...SPLW-K-----KI............RTSG---
D8SNX9_SELML/72-156...........TVAD--I--TI.....W---S----SL.....AG.....GG-K-----RW............ESMK---
F2DKN7_HORVD/72-156...........SIAD--I--VV.....W---S----NL.....TG.....TG-Q-----RW............ESLR---
F2EEU4_HORVD/72-156...........SIAD--I--VV.....W---S----NL.....TG.....TG-Q-----RW............ESLR---
B8LRU5_PICSI/72-156...........SVAD--I--AV.....W---S----GL.....AG.....TG-Q-----RW............ESIR---
D7M5B1_ARALL/74-158...........SIAD--V--AI.....W---S----AL.....AG.....TG-Q-----RW............ESLR---
O82462_ARATH/74-158...........SIAD--V--AI.....W---S----AL.....AG.....TG-Q-----RW............ESLR---
B9RFS6_RICCO/74-158...........SIAD--M--AI.....W---S----GL.....AG.....SG-Q-----RW............ESLR---
A5B9C3_VITVI/77-161...........SIAD--I--AI.....W---S----GL.....AG.....SG-Q-----RW............ESLR---
Q4WQV0_ASPFU/145-252TGRRANTCS..TLAD--L--VV.....F---P----YV.....AS...ASQA-N-----LD............LER.---
B6AZ99_9RHOB/67-130...........TIVT--L--EW.....I---A----LF.....EG...AVVP-K-----LE................---
A5DZL4_LODEL/70-158...........TAAD--I--ML....SF---P----IYENIFDNL...EGVK-D-----CT............RDKR---
C8V321_EMENI/98-189...........TYVD--F--AV.....Y---Q----SI.....DN...ERRT-G-----TL............PET.---
Q5B0A6_EMENI/118-205...........TYVD--F--AV.....Y---Q----SI.....DN.....ER-R-----TG.......TLP..ETL.---
C1FH64_MICSR/69-170...........SMAD--L--QV.....Y---M----VV.....HM...IRTG-N-----FD............HIEP---
B7FSP9_PHATC/127-244...........TYAD--F--AL.....F---H----VL.....DA...TIAQ-F-----NT............DFY.---
D6V2C5_9BRAD/95-206...........TYVD--L--SL.....F---Q----IV.....EG.....LR-Y-----AF........PK..RMK.---
B2IEI5_BEII9/99-212...........SYAD--L--SL.....F---Q----TV.....EG.....LL-Y-----AF........PR..STK.---
A0A058V2B3_BORPT/92-203...........SYAD--L--SL.....Y---H----VV.....EG.....LL-H-----AF..........PRRMR.---
A0A038I621_BORBO/92-203...........SYAD--L--SL.....Y---H----VV.....EG.....LL-H-----AF..........PRRMRT---
A3NKT4_BURP6/116-229...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
A3P6E2_BURP0/99-212...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
A4LR03_BURPE/99-212...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
A8EQ36_BURPE/138-251...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
A8KFZ3_BURPE/116-229...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
B1H8S8_BURPE/116-229...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
B2H8F9_BURPE/99-212...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
C0YD09_BURPE/116-229...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
C6U522_BURPE/99-212...........SYVD--L--SM.....F---Q----LI.....EG.....LR-Y-----AF..........PKAFA.---
B4ST55_STRM5/94-204...........SYVD--L--SL.....F---Q----LL.....SG.....LD-Y-----MF..........PRRMQ.---
B2FRQ6_STRMK/94-204...........SYVD--L--SL.....F---Q----LL.....SG.....LD-Y-----MF..........PRRMQ.---
B8L691_9GAMM/94-204...........SYVD--L--SL.....F---Q----LL.....SG.....LD-Y-----MF............PRRM---
B0RPT3_XANCB/94-204...........SYVD--L--SL.....F---Q----LV.....SG.....LE-Y-----MF..........PKRMA.---
Q4UXR8_XANC8/106-216...........SYVD--L--SL.....F---Q----LV.....SG.....LE-Y-----MF..........PKRMA.---
D4SRF8_9XANT/94-204...........SYVD--L--SL.....F---Q----LV.....SG.....LE-Y-----MF..........PKRMA.---
D4T9D0_9XANT/94-204...........SYVD--L--SL.....F---Q----LV.....SG.....LE-Y-----MF............PKRM---
F0BY29_9XANT/94-204...........SYVD--L--SL.....F---Q----LV.....SG.....LE-Y-----MF..........PRRMA.---
Q3BQA5_XANC5/94-204...........SYLD--L--SL.....F---Q----LF.....SG.....LE-Y-----MF..........PKRMA.---
E9EGB4_METAQ/115-231...........TYAD--L--VL.....F---Q----GI.....DG.....TE-F-----AF.......PKTMKKMR.---
E9FC33_METAR/114-231...........TYAD--L--VL.....F---Q----GI.....DG.....TE-F-----AF........PKTMKKMR---
E6ZKH3_SPORE/113-235...........TVAD--L--TL.....F---Q----VV.....DG.....LL-F-----AF...........PKCMQ---
Q4PHJ6_USTMA/131-253...........SVAD--L--TL.....F---Q----VV.....DG.....LQ-Y-----AL...........PKYMQ---
B2VRG1_PYRTR/83-207...........SLAD--I--SLYYQLRW---G----ID...IAAG...RGIS-N-----LS............GGE.---
Q0U0D3_PHANO/77-203...........SLAD--V--SL.....Y---Y----QL.....RW.....GV-D-----IANGRGIENLSG..GGT.---
A1DN79_NEOFI/128-240...........NLAD--F--AL.....L---S----AV............EL-F-----RE............FFNE---
D8M558_BLAHO/58-124...........TIAD--A--FA.....Y---S----TV............ID-M-----ER............KCE.---
E3RJP3_PYRTT/917-1001...........SIAD--A--YV.....W---P----VV.....HV.....LV-G-----EW............EGWD---
F0XHR1_GROCL/885-987...........SLAD--F--AF.....W---P----VL.....YE...LDKT-C-----AN.......GEDGLTGEL---
E9DTF4_METAQ/750-836...........SLAD--F--AV.....W---P----VL.....RA...IVEQ-Y-----GA................---
Q2GUC8_CHAGB/865-976...........GPAD--F--AL.....W---P----VL.....HD...VVQV-C-----GE............DVL.---
C9SQ13_VERA1/837-927...........SIAD--F--AV.....W---P----VL............HD-I-----VQ............TLGE---
E3QT63_COLGM/831-957...........SLAD--F--AV.....W---P----VL.....HA.....IV-E-----ES............GVE.---
Q55JP4_CRYNB/150-286...........TSLD--A--LV.....A---S----HL.....YV.....LF-T-----LP........ED..SFLR---
B6QBZ6_PENMQ/110-196...........NAAD--I--LM....SF---P----II.....AA.......-.-----..............TGRG---
E3QUV0_COLGM/128-262...........TAAD--I--LI....SF---A----LV......T...AEAE-G-----AW........DAMGRWPG---
C5JYK1_AJEDS/159-267...........TGSD--I--LM....SF---P----LE.....AG.......-.-----..............VLRG---
A3K1B8_9RHOB/77-180...........SAAD--I--MM....GF---N----LF.....AA.......-.-----..............PYYV---
B9TLA7_RICCO/51-123...........TFIQ--L--NV.....P---Q----IV.....TP.......-.-----GD................---
F0XEQ7_GROCL/281-416...........SLFD--A--AV.....F---S----YTNLLLEDD...DNNA-S-----AR......FRWQDRTLP.---
E3RS78_PYRTT/85-191...........TLAE--A--LT.....A---P----FI............LR-Y-----YT.......FSKREALPK---
Q7D2W7_AGRT5/94-199...........GVAD--I--VT..AILW---T----TV............AD-R-----FP............AIKG---
A9H2Q5_GLUDA/94-199...........GIAD--V--VT..ATLW---A----TM............AD-R-----FP............PIGA---
D7AAL2_STAND/94-199...........GVAD--I--VT.....S---T----LW.....ST.....MG-D-----RF............PPLQ---
C5LY40_PERM5/101-214...........SLAD--I--FA.....I---T----IM............SE-G-----AA............QGLV---
D7FW72_ECTSI/215-297...........SLAD--V--VV......---G----VT.....AQ...AAIT-A-----LG............EAE.---
C1E4T3_MICSR/78-183...........SLAD--V--VV.....Y---S----AL.....FP.....VL-G-----EE........RAAGVVGL---

PF16865

A4I8P2_LEIIN/97-204-----------TMAD--V--AL-----V---P----FLV---RLKPALMYY.-A-----GY-------------------
A4I8P2_LEIIN/321-429-----------NAGD--V--AI-----L---P----FLV---RAKAFMPEFS-G-----GY-------------------
Q4CZ29_TRYCC/93-200-----------SMAE--V--MV-----V---P----FLA---CFRPVLSYY.-C-----GY-------------------

PF04399

Q6D1S0_PECAS/85-210-----------STTD--F--IL-----F---P----ILLSLTIV------KG.L-----QF-------------------
Q5NRG0_ZYMMO/87-214-----------STDD--I--HL-----F---A----QLRSLSLV------KG.V-----RY-------------------
Q5NQ08_ZYMMO/85-214-----------STDD--F--HL-----F---A----FLRSLSIV------KN.V-----YY-------------------
D5QI23_KOMHA/68-196-----------SSDD--I--HL-----F---A----LLRSLTIV------AG.L-----SW-------------------
H2ITY9_RAHAC/85-214-----------SEDD--I--NL-----W---P----VLRSLSIV------QG.I-----DW-------------------
F2JXW1_MARM1/91-215-----------SWDD--V--LI-----Y---P----TLRNLTMV------RD.L-----SF-------------------
F9ZM92_ACICS/93-218-----------SVAD--T--LI-----T---G----DLTGLRLL------ED.I-----QL-------------------
I0DZW0_PROSM/85-211-----------.MDD--I--II-----F---P----LLRSLSIV------ND.L-----PF-------------------
E6WDE9_PANSA/85-214-----------SEDD--I--NL-----F---P----LLRSLTLV------AG.I-----EW-------------------
Q9CNB4_PASMU/85-214-----------SFED--I--LV-----F---P----LLRNLTCV------KG.L-----RF-------------------
X2GUV6_9GAMM/86-215-----------SLDD--I--CL-----F---P----VLRNLTCV------KG.L-----YF-------------------
D0NB62_PHYIT/96-224-----------SYDD--L--DL-----F---G----RLRGLTLV------KG.T-----EW-------------------
Q7MBY7_VIBVY/84-208-----------.VDE--A--IV-----F---S----ILRGFFSA------AE.I-----QW-------------------
Q65TQ1_MANSM/85-215-----------SVED--I--IL-----F---P----MLRNLTCV------KG.V-----IF-------------------
F4HD49_GALAU/85-214-----------SIED--I--VL-----F---P----VLRNLTIV------KG.I-----EF-------------------
A8AI12_CITK8/69-198-----------SEDD--I--HL-----F---P----LLRNLTLV------AG.I-----NW-------------------
Q5E4G7_VIBF1/86-215-----------TWDD--I--NF-----F---P----FIRNLTVV------KG.L-----DF-------------------
K3W8Q1_PYTUL/137-266-----------SYDD--I--DL-----F---G----RLRGLTLV------KG.L-----KW-------------------
Q7DD88_NEIMB/82-212-----------GMED--I--LV-----F---P----VLRNLTVV------RG.I-----EW-------------------
E0SAU3_DICD3/85-214-----------SLDD--I--NL-----F---A----LLRSLTIV------AD.V-----NV-------------------
M4BU42_HYAAE/154-283-----------SYDD--V--DL-----F---G----RLRGLTIV------RD.L-----KW-------------------
A8GFK9_SERP5/85-214-----------SEDD--I--HL-----F---P----LLRSLSIV------AG.L-----TL-------------------
Q5NH24_FRATT/91-214-----------SWDD--I--NI-----F---P----IFFILTMS------KDLL-----EI-------------------
X2HAQ1_9NEIS/85-214-----------GMED--I--LL-----F---P----LLRNMTMV------KG.I-----EW-------------------
A1S8P5_SHEAM/96-225-----------GYDD--V--LL-----F---P----VLRNLTAV------KG.L-----NV-------------------
H3G9G4_PHYRM/122-251-----------SYDD--I--DL-----F---G----RLRGLTLV------RD.L-----EW-------------------
D7FTR2_ECTSI/110-242-----------SYND--V--EF-----F---P----RMRGLTIV------QG.L-----GI-------------------
W0L8R1_SERFO/85-214-----------SEDD--I--HL-----F---P----VLRSLSIV------AG.V-----AL-------------------
A6VNZ1_ACTSZ/85-215-----------SLED--I--ML-----F---P----MLRNLTCV------NG.L-----VW-------------------
A7MM21_CROS8/89-214-----------..TD--F--IL-----F---P----LLRSLTIV------KG.A-----AF-------------------
F0YIM1_AURAN/118-251-----------SLDD--I--DL-----W---S----RLRSLTIV------KG.L-----VF-------------------
K7SWA6_GLUOY/88-217-----------STDD--I--HL-----F---A----QLHSMSLI------KG.L-----HY-------------------
F0LUD7_VIBFN/86-215-----------SYDD--V--NM-----Y---P----TLRNLTVV------KG.I-----EF-------------------
Q9KKV8_VIBCH/84-211-----------.IDE--A--II-----F---S----ILRGFFSA------PE.I-----QW-------------------
H8L0T2_FRAAD/85-207-----------..AD--F--SL-----F---P----VLRSLTIV------EG.V-----KF-------------------
Q6LNL6_PHOPR/86-215-----------TYDD--V--NL-----F---P----SLRNLTVV------KG.L-----VF-------------------
Q5FQY7_GLUOX/87-216-----------STDD--I--HL-----Y---A----HLHSMSLI------RG.V-----VY-------------------
W0HW21_9ENTR/85-214-----------SEDD--I--HL-----F---P----WLRSLTLV------AG.I-----DW-------------------
H3GPY7_PHYRM/353-482-----------GYDD--I--DL-----F---G----RLRCLTLV------RG.I-----TW-------------------
B2VDJ5_ERWT9/85-214-----------SLDD--I--HL-----F---P----LLRSLSLV------AG.I-----EY-------------------
U4KES9_9VIBR/86-215-----------SYDD--V--NL-----Y---P----HLRNLTVV------KG.I-----QF-------------------
Q87J67_VIBPA/85-208-----------.VDQ--A--IM-----F---S----ILRGFFSA------PE.V-----QW-------------------
Q15Q78_PSEA6/101-230-----------SIDD--I--TL-----F---G----RLRGITLI------KG.L-----TI-------------------
C7JHY2_ACEP3/84-213-----------SYDD--I--HL-----F---A----HLHSFSII------KG.L-----TY-------------------
F0YIS1_AURAN/125-254-----------SVDD--A--IL-----L---P----ILRAMTVT------KA.V-----EW-------------------
Q6D468_PECAS/85-214-----------STDD--F--DL-----F---P----LLRSLSIV------AG.V-----TP-------------------
G2I7E0_GLUMN/84-212-----------SQDD--I--HL-----F---A----YLRGLTIV------AG.L-----EW-------------------
B7VSY7_VIBSL/89-209-----------.IDQ--A--LY-----F---S----MLRGFCVE------PS.I-----EW-------------------
C9R3A8_AGGAD/85-214-----------SLED--I--LV-----F---P----ILRNLTCV------KG.I-----VF-------------------

PF11801

A5DPS2_PICGU/93-276-----------SVAE--L--LL-----F---A----YIHSLTYD------GL-------PD-------------------
Q6BJD7_DEBHA/112-306-----------SSSE--L--LF-----F---A----YIHSLCLP------EL-------PD-------------------
A5DUS1_LODEL/96-243-----------ASMR--C--LM-----K---V----EKYVNEIE------..-------..-------------------
MTX1_PIG/95-225-----------ASLD--A--FV-----F---S----YLALLQQA------KL-------PS-------------------
Q1L8P8_DANRE/95-225-----------SSLD--A--YV-----F---A----HLAPLLKI------KL-------PN-------------------
M9N0R6_ASHG1/82-231-----------GPAE--L--LF-----A---A----HLYVQQ..------QL-------PD-------------------
Q6C8L9_YARLI/89-259-----------STSD--V--FL-----C---A----HLQLQMLP------AL-------PD-------------------
SAM37_YEAST/113-276-----------LSSD--L--LF-----L---A----NLYVQL..------GL-------PD-------------------
Q6CII7_KLULA/89-254-----------LPAD--L--VL-----V---A----HLKVQM..------AL-------PQ-------------------
A1DFG3_NEOFI/97-262-----------TSVD--C--LA-----L---G----YLALILVP------DL-------PY-------------------
A7TPA1_VANPO/99-264-----------ITSD--L--LF-----W---A----NMYILF..------NL-------PT-------------------
A7F5V7_SCLS1/99-263-----------SSLD--C--LA-----L---G----FISLMLYP------EL-------PQ-------------------
Q6FU46_CANGA/92-252-----------SPVP--I--LF-----Y---S----YMYIQLVI------.L-------PN-------------------
Q5B6M7_EMENI/97-261-----------SSLD--C--LS-----V---G----YLSLALVP------DL-------PL-------------------
A6RE67_AJECN/106-259-----------SSQD--C--LA-----L---G----YLSLALVP------NL-------PN-------------------
Q5ALP4_CANAL/109-308-----------SSSE--I--LF-----Y---A----YIFCLTYE------KL-------PD-------------------
A3LTE5_PICST/98-286-----------SSCE--I--LL-----C---A----YVYSLTYE------DL-------PD-------------------

PF14834

D5C687_ENTCC/95-211-----------CIADTDL--AL--------------MLNRLILNGDDVPQLLVD-----YA-------------------
A7MH37_CROS8/138-254-----------SLADTDL--AL--------------MINRLVMHGDPVPEALAD-----YA-------------------
A6TBY7_KLEP7/95-211-----------SIADADL--AL--------------MLNRLVLNGDKVPEALAD-----YA-------------------
YFCF_ECOLI/95-211-----------CIADTDL--AL--------------MINRLVLHGDEVPERLVD-----YA-------------------

PF00043

GSTA2_MOUSE/99-192--------------------L.........T----P-F--PLLKAFKSRISSLP---------
GSTA3_CHICK/99-192--------------------L.........S----G-F--PLLQAFKKRISSIP---------
GSTA3_MOUSE/99-192--------------------V.........D----N-F--PLLKALRSRVSNLP---------
GSTM3_HUMAN/108-196--------------------L.........D----E-F--PNLKAFMCRFEALE---------
GSTF3_MAIZE/107-203--------------------V.........A----A-R--PHVKAWWEAIAARP---------
GSTP1_BOVIN/97-188--------------------L.........D----S-F--PLLSAYVARLNSRP---------
GSTM2_CHICK/104-192--------------------P.........E----L-Q--GNLSQFLQRFEALE---------
GSTM2_RAT/104-192--------------------L.........D----A-F--PNLKDFVARFEGLK---------
GSTF1_MAIZE/110-201--------------------V........LD----A-Y--PHVKAWWSGLMERP---------
GSTM2_HUMAN/104-192--------------------L.........D----A-F--PNLKDFISRFEGLE---------
GSTA1_HUMAN/99-192--------------------I.........S----S-F--PLLKALKTRISNLP---------
EF1G_HUMAN/106-198--------------------S.......FRQ----A-F--PNTNRWFLTCINQP---------
EF1G1_YEAST/107-199--------------------E.......WRA----Q-H--PAIVRWFNTVRASP---------
SYVC_HUMAN/107-198--------------------P.......ARR----I-W--NNVTRWFVTCVRQP---------
GSTO1_CAEEL/120-219--------------------DLPTIEFPGEE----E-Y--PKLTKWFQKMISSD---------
GSTMU_CAVPO/103-191--------------------L.........E----A-F--PNLKDFISRFEGLE---------
GSTX6_SOYBN/99-198--------------------GLQ...LFTSE----K-F--PILYKWSQEFLNHP---------
GSTA_ECOLI/100-189--------------------..........E----G-L--EHIAAFMQRMAERP---------
GSTX1_SOLTU/95-192--------------------GIV...LATSE----K-F--PNFCAWRDEYCTQN---------
GSTA4_MOUSE/99-192--------------------L.........S----D-F--PLLQAFKTRISNIP---------
GST1_DROME/141-235--------------------L.........E----P-Y--PALRGVVDAVNALE---------
GSTP1_CAEEL/94-186--------------------L.........D----G-V--PALKKFHERFAERP---------
GSTF1_WHEAT/111-210--------------------V........FD----D-Y--PKVKAWWEMLMARP---------
GST1_YEAST/114-218--------------------P.........E----D-Y--PAISKWLKTITSEE---------
URE2_YEAST/223-345--------------------K.........I----E-F--PEVYKWTKHMMRRP---------
EF1G2_YEAST/104-196--------------------E.......WRA----K-H--PHLMRWFNTVAASP---------
YIBF_ECOLI/96-192--------------------G.......WCV----D-R--PHLVKLVENLFSRE---------
EF1G_SCHPO/99-196--------------------S.......YLA----K-Y--THIYRYYQTIYHQA---------
B0UTU6_HISS2/103-194--------------------T........GT----G-S--KAIKSYMERVFQRD---------
B4EWL4_PROMH/103-189--------------------..........T----D-L--SHLQDYLARIAQRP---------
F6V028_XENTR/108-198--------------------S.......FRQ----P-F--GNVTRWFVTCVNQP---------
G2IN92_9SPHN/107-234--------------------GDY....VNQE----K-T--PGLCAWLDRINARP---------
GST28_SCHMA/104-195--------------------L........TG----K-Y--PEIHKHRENLLAS.---------
SSPA_ECOLI/102-194--------------------S........GP----G-A--KELKGYMTRVFERD---------
Q4CXW2_TRYCC/105-198--------------------GE.....ALTK----K-Y--RNAYRLYNTVMQQP---------

PF13410

A0L6K1_MAGSM/131-194.....................................P..TACRAHLAC--------------
A0LDX3_MAGSM/121-185....................AWR.......Q....Q.R..PQLQQWYTE--------------
A1AV55_RUTMC/124-190....................VLG.......T....P.G..KAVTNYANR--------------
A1B210_PARDP/196-269.................CARRRL.......I....D.Y..PNLWGYARD--------------
A1CDY3_ASPCL/184-260.................NLGMIR.......H....D.Y..PHIHNWLKN--------------
A1S3B6_SHEAM/120-184....................EWR.......N....L.A..PALTLWFEE--------------
A1TQ85_ACIAC/453-519....................DWD.......A...RP.W..PRLQAWLAA--------------
A1U867_MARAV/117-182....................V..............L.G..PHTRQMVDA--------------
A1WJX2_VEREI/124-191....................GWR.......D....R.Y..RQVGAWYAG--------------
A2AJ28_MOUSE/127-207....................PIP.......A....E.L..SCVRRYLDS--------------
A2Q995_ASPNC/149-217....................GWPD.....PE....P.G..SRWGAWVDA--------------
A2QH45_ASPNC/187-263.................NLGTIR.......H....D.Y..PVLHNWLKG--------------
A4RZE0_OSTLU/123-196..................GYDIA.......E....G.A..EYFAAWLTA--------------
A4YLR1_BRASO/127-234....................LIE.......G....R.A..PHVLAWIHR--------------
A4YXA6_BRASO/141-211....................DKL.......A....G.L..TPLIGWYDR--------------
A5GJY1_SYNPW/170-241....................ALR.......E....A.H..PGIDRWLTA--------------
A5VCI8_SPHWW/122-190....................FDA.......Q....P.M..PHLHDWLAR--------------
A6R8D9_AJECN/127-204....................PLT.......T....A.A..PEAVSWMKK--------------
A6T619_KLEP7/122-188....................VSA.......A....A.F..PHIRALAEK--------------
A7HP97_PARL1/145-226..................LKDAA.......L....R.H..DNLLRHMDR--------------
A7HPN1_PARL1/131-202....................AAM.......G....D.D..GTARAYMNA--------------
A7HWV6_PARL1/136-238....................ELM......KK....K.A..VRLFQWVQL--------------
A7IBJ5_XANP2/127-190.....................................P..ANLAAHYRR--------------
A7IPF7_XANP2/133-196.....................................P..PRVLAHYQR--------------
A8BBE3_GIAIC/125-191.....................LV.......D....Q.F..PPLRELSDG--------------
A8GAF3_SERP5/122-189....................ISA.......D....N.H..PTLAAFAAQ--------------
A8I0K9_CHLRE/123-191....................ELP.......A....R.F..TALHKYLAA--------------
A8P0W9_COPC7/143-215....................E.M.......I....A.S..EKMREWITN--------------
A8PWD6_MALGO/165-250..................AGGSQ.......E....R.L..PLLTNFVQA--------------
A9BRB1_DELAS/118-188....................DVL.......A....D.L..P.VREYLAR--------------
A9CJG7_AGRT5/129-216....................DLF.......A....D.N..DPVRDWFEG--------------
A9ENK0_SORC5/120-185....................AWR.......S....G.R..SGLSRWFDV--------------
A9G573_SORC5/130-198....................LPT.......E....P.Y..PALNGFCRE--------------
A9G5M8_SORC5/132-224....................PLRR....RAE....G.F..ANLTAYTAR--------------
A9GLX2_SORC5/161-243SR............RCFSDPDLR.......D....R.Y..DDLIAWRDE--------------
A9RED4_PHYPA/166-240....................SID.......T....V.N..SHLLSYSRA--------------
A9RIP1_PHYPA/191-298....................AWMP....PLD....A.I.PSEMRDVMKR--------------
A9SSZ0_PHYPA/249-317..................GVKVRG.....ND....R.W..NAVNLWFDA--------------
A9SZI4_PHYPA/403-470....................EIN.......S....S.F..TRLSAYKSA--------------
A9VD76_MONBE/143-208....................SII.......R....P.Y..PNLKEWHDK--------------
B0CZV3_LACBS/156-232....................FDL.......A....K.G..ERFNAWVNR--------------
B0DMK1_LACBS/141-206....................EWN.......V....V.G..RRLNEWMGK--------------
B0T373_CAUSK/123-185....................DWR.......E....G.R..PNLAAWYET--------------
B0U7F7_METS4/125-203S...............AAFRDHV.......M....A.W..PLMQEWIAE--------------
B0UCA1_METS4/160-231....................SMI.......S....E.H..DNVVAYVER--------------
B1Y635_LEPCP/144-209...................................P....APVADYIEH--------------
B2B7D3_PODAN/137-206....................RFL.......G.........ERAKGYMER--------------
B2GG80_KOCRD/207-280.................ASRNKL.......T....E.M..PNLWGYARD--------------
B2J7I4_NOSP7/169-243....................KGN.......P....R.Y..PRINAWFEA--------------
B2UK10_RALPJ/126-192....................FDD.......Q....P.L..PALHAWLAQ--------------
B4N5A8_DROWI/142-215..................DVKLD......PV....R.F..KILLQWEEL--------------
B4R810_PHEZH/136-206....................TLL.......A....G.L..DRVQDWRAR--------------
B6GZF3_PENCW/142-236...................FQKI.......T....K.Y..PGYREVYEA--------------
B6INT9_RHOCS/122-191....................GWR.......S....L.A..PRLADWYDE--------------
B6IWS7_RHOCS/197-270.................NRRQ.I.......R....D.Y..PALWGYVRD--------------
B6JAK1_OLICO/121-185....................PWR.......A....Q.F..PGLAAWHAS--------------
B8C0F0_THAPS/181-261.................RSDTYK.......K....Q.F..SALNAWLDS--------------
B8CA81_THAPS/207-302KMEASSKPTTYDGATKTPIPTPK.......P....L.S..PKLELYLKC--------------
B8CLJ2_SHEPW/123-188....................FEQ.......T....D.Y..KNVQQWLAN--------------
B8EKE6_METSB/125-187.....................................P..DNCLAHYKL--------------
B8IAD7_METNO/126-190....................TWQ.......A....E.R..PRLAGWFGR--------------
B8LD48_THAPS/125-192....................FWE.......K....V.P..EGVKEYYGR--------------
B8LWW9_TALSN/704-780.................NLGTIR.......H....D.Y..PVLNAWLTH--------------
B8MAD4_TALSN/131-201....................DFV.................PNVKRVCLA--------------
B8MMG1_TALSN/173-241....................FQR......IT....K.Y..PGFRDIYEG--------------
B8NN14_ASPFN/137-207....................PLD.......T....A.S..PDALAWMEK--------------
B8PKG3_POSPM/157-232....................Q.L.......P....E.G..TQFRSYVER--------------
C1E0N8_MICSR/130-200..................GVELRE.....MG....P.S..GSLSRWIDA--------------
C1E269_MICSR/572-669....................RFR............A.G..PNCRAWHAR--------------
C1E340_MICSR/1002-1082L..............PQAPCSLK......DM....G.A..PSLRPYLDR--------------
C1E340_MICSR/1335-1412P..............EAPCSLSD.......I....G.C..GALRRYLER--------------
C1E340_MICSR/1667-1747L..............PQAPCSLK......EV....G.A..PSALEYLQR--------------
C1EEB2_MICSR/138-221DPV..........AMDKGASLAD.......L....G.A..PSVVPYLRR--------------
C1EFU5_MICSR/220-287....................A.F.......E....G.R..PKLAAYYER--------------
C1GU35_PARBA/153-226.....................SL.......Q....E.Y..KGILGYLQR--------------
C1MTQ1_MICPC/148-219....................NDT.......ELAEMG.G..KKFSRWMRH--------------
C1MWR5_MICPC/124-195...................KTSL.......D....A.F..PKLKAFYDR--------------
C1MYW2_MICPC/249-328...................AELE......AM....G.L..TKVKAWAEA--------------
C3Y1F6_BRAFL/230-307.................LHALVT.......E....K.C..PNIREYCVR--------------
C5AAI5_BURGB/120-192..................RDLVL.......E....A.G..IDWKAYSKR--------------
C5BTC1_TERTT/126-189...................................L.P..PFCRQHFNT--------------
C5CUS5_VARPS/135-201......................Y.......R....V.A..PRMAQVVRR--------------
C5CZN1_VARPS/195-312.....................MW.......D....A.L..PHVARYADA--------------
C5D1E8_VARPS/125-190....................GWR.......G....A.A..PALAGWFET--------------
C5FDK1_ARTOC/126-203....................PLT.......S....A.T..PEALQWMKH--------------
C5GMZ6_AJEDR/248-332.................NIRDIR.......S....G.Y..PAIHHWLRQ--------------
C5KH39_PERM5/146-220F...............AFDRSSL.......P....Q.L..AELFEWYDR--------------
C5KQA0_PERM5/164-239................MSCCTES.......E....K.Y..DNLMAYYTR--------------
E8RLA4_ASTEC/120-184....................DWH.......A....E.A..PRLVALRDQ--------------
C6XNN1_HIRBI/148-224....................DIM.......H....K.Y..SNLQEHSKR--------------
C6XRQ4_HIRBI/121-230....................IIE.......K....E.G..PFVKAWCEF--------------
C7YRS8_NECH7/127-221..................DRFSP.......S....V.Y..PRVYAWIRR--------------
C7ZGQ3_NECH7/146-213....................HLV.......D....D.L..PNLQRFYGA--------------
C7ZM60_NECH7/221-306DPVYT.......YHFKCNLRDIR.......S....G.Y..PHIHKWLRT--------------
E6WEX2_PANSA/122-189....................VPA.......E....Q.Y..PRLQQVAAQ--------------
C9SJL3_VERA1/160-242VGI..........PPPTKETGEL.......E....T.W..SRWKTWFDA--------------
C9SW24_VERA1/159-239TA.............LGYESEVQ.......S....F.Y..EACARWLER--------------
D2VLV0_NAEGR/154-242DLFK.........PLPTDNETVV.......E....S.L..AIFKKWYQA--------------
D3BDL7_POLPA/178-253..................KCNLKQ.....IQ....Q.Y..TYLKKYLVN--------------
D3BFK7_POLPA/158-266....................PISK....AIK....S.N..KNLVDYIER--------------
D3BS36_POLPA/173-246..................KLNLKT.....IH....D.Y..PVISNYLKD--------------
D4AIT6_ARTBC/160-238LGI..........PAPGKGGNDE.......V....V.W..NRWRMWLAA--------------
D4AJL6_ARTBC/139-210....................DFR.......Q....G.R..PRLAAWFER--------------
CLIC1_HUMAN/142-212....................TIP.......E....A.F..RGVHRYLSN--------------
Q012T3_OSTTA/160-232....................GWK.......S....A.F.GPNLRRAYDA--------------
Q017S3_OSTTA/231-304.................TNKKFI.......H....Q.Y..EHISGYVRE--------------
Q092M3_STIAD/123-189.....................PV.......A....Q.H..PKLVEFQKI--------------
Q0BV02_GRABC/124-186....................DWR.......S....D.H..PRLAQWFET--------------
Q0BWT6_HYPNA/123-219...................DACF.......E....S.A..PLTRAWYDR--------------
Q0C681_HYPNA/120-229....................AWL......ND....R.A..PFVVAWCEN--------------
Q0CJU0_ASPTN/163-232...................FERL.......V....K.Y..PGYREVYEA--------------
Q0U052_PHANO/145-222....................DFIS.....AK....L.Y..PKVFAWFDR--------------
Q0V763_PHANO/145-227.................PQQNFN.......D....RIY..PKVYAWVRR--------------
Q0V763_PHANO/476-547....................DWS.......K....G.R..PQLEAWMKK--------------
Q119J9_TRIEI/182-256....................YNN.......D....R.F..ARINQWLTA--------------
Q11II4_CHESB/120-190....................IDM.......N....G.H..PALRDHAGR--------------
Q15Y89_PSEA6/118-181....................HNL.......K....G.L..NALLEFHQE--------------
Q16DN2_ROSDO/135-224....................TLMGR...MIE....G.N..EVLMAYIAR--------------
Q1CXG6_MYXXD/156-248GPGT.........RAVWSDAELA.......S....R.F..PDLLEWRDG--------------
Q1LMA0_RALME/129-215....................AIL.......D....A.Y..PLVKEWYAR--------------
Q219M8_RHOPB/125-189....................NWR.......Q....A.F..PKLDAFHER--------------
Q21NV3_SACD2/125-196......................L.......S....D.Y..QYLSAYIEA--------------
Q28VM3_JANSC/126-191....................NWR.......S....G.H..DALATWYAR--------------
Q2RP79_RHORT/128-193....................FWR.......D....R.H..PALAGWFED--------------
Q2Y8A0_NITMU/202-275..................KCNLRR.....LV....D.Y..PNLWAYTRE--------------
Q3IWV3_RHOS4/128-191..............................A....V.S..PEAQAYVAA--------------
Q3IXJ7_RHOS4/202-274.................TNRRQI.......A....D.Y..PRLWAYMRR--------------
Q3SJZ3_THIDA/124-195....................DFELP...TAS....R.Y..ARVREWIDA--------------
Q47WD3_COLP3/155-230....................GFESKFTKNAK....R.Y..QNLVQFCQR--------------
Q4KEB7_PSEF5/127-192.....................LR.......D....S.H..PDFLALLQR--------------
Q4PA85_USTMA/231-359...................REIW.......H....A.H..KPIATWVQA--------------
Q4PBA3_USTMA/148-231LPV...........PSKGQQDWR.......Q...YP.F..PRTLSWLAS--------------
Q4PEE8_USTMA/196-272.................NVGMIR.......H....D.Y..PHIHRYLRR--------------
Q4PH05_USTMA/169-242..................VSGDS.......P....N.F..TWLAAWLQR--------------
Q54DU4_DICDI/215-290.................CNKKQI.......K....E.Y..PMLSNYVRE--------------
Q5K7H9_CRYNJ/151-218....................NFD.......E....K.AVGDGWWEYRER--------------
Q5LMS6_RUEPO/132-224....................PLQR....RVA....G.D..RVLSDYIDR--------------
Q5LRR6_RUEPO/138-209....................DFALP...DDP....A.Y..DRVRVWRAA--------------
Q6C3X4_YARLI/164-237....................VTA.......E....A.F..PKFFAWIDR--------------
GSTL1_ARATH/146-212..................KYEII.......I....G.R..PNLAAWIEQ--------------
Q7NTJ7_CHRVO/121-190....................VPE.......T....Q.Y..PALAALSAR--------------
Q7V893_PROMM/166-242....................SLR.......E....E.H..PAIHKWFKA--------------
Q7VCF4_PROMA/134-205....................DKD.......K....E.L..INLRRWLES--------------
Q88AE2_PSESM/125-190....................RWR.......N....T.Y..PRLANWYLE--------------
Q8XXV1_RALSO/117-188....................DLL.......A....P.I..EGLKPYLAR--------------
Q9FL98_ARATH/201-270.................CDKRLV.......R....E.Y..YHLFNYTKD--------------
GSTL2_ARATH/195-261..................NVDIT.......S....G.R..PNLALWIQE--------------
Q9NA74_CAEEL/171-244...................AYID.......E....K.V..PNVMEYVIR--------------
B2UD16_RALPJ/121-186....................VPA.......A....D.Y..PRLVAY...--------------
B4EEI7_BURCJ/123-196.................LARIDP.......A....R.Y..PALAAHSAR--------------
C5AZ79_METEA/124-188....................AWR.......D....D.A..PRLAAWFAR--------------
E7KR93_YEASL/151-241.................NFTSIR.......A....G.Y..PFIHLWVR.--------------
G8PGF5_PSEUV/127-190....................EWR.......K....S.Y..PKLVAWLD.--------------
G8PGF6_PSEUV/125-190....................DWR.......R....E.N..PELVRWHDA--------------
G8PGT3_PSEUV/202-274..................KCNLRR.....IQ....D.Y..PNLSGYLR.--------------
G8PTB8_PSEUV/192-263..................KTDLKR.....LS....D.F..TNLSPYL..--------------
H3CB38_TETNG/137-223..................TYDIC......SC....E.L..RGLTRYLE.--------------
H3CIP6_TETNG/126-213....................TIP.......Q....S.L..TNLWRYLNA--------------
GSTX2_MAIZE/128-201..................SLIDA.......S....A.T..PLLDGWSQR--------------
Q3IY08_RHOS4/123-186....................DWR.......A....A.R..PLLAEWA..--------------
Q7SF99_NEUCR/240-329VGIP........PSGQRGSEVDE.......E....I.W..KRWEEWYKA--------------
R7G4S4_9FIRM/257-325.................TKHPLF............T.Y..KNLWGYA..--------------

PF14497

F0X3Q4_CRYPV/161-266--------------------GIINE............Y--PSIRGLVDAFNE-----------
Q5CKJ7_CRYHO/161-266--------------------GIINE............Y--PSIRGLVDAFNE-----------
B8CAA6_THAPS/182-300--------------------SIREN............Y--PVLLKYLTTILN-----------
A8XWB3_CAEBR/131-230--------------------DIPHN............F--THLWNYILTAYR-----------
E3N1N5_CAERE/175-274--------------------DIPHN............F--THLWNYILTAYR-----------
EXC4_CAEEL/130-229--------------------DIPHN............F--THLWAYILTAYR-----------
F1KT43_ASCSU/135-234--------------------DIPHN............L--TYLWNYVLTAYR-----------
A8NYA7_BRUMA/133-234--------------------DIPLN............L--TYLWNYVLNAYR-----------
E1GBX8_LOALO/133-234--------------------DIPLN............L--TYLWNYVLNAYR-----------
Q24F18_TETTS/217-335--------------------RFIQNEW..........P--ASVRRWLIRMQQ-----------
F2TJD5_AJEDA/76-203--------------------.................Y--DGILGYLAGVGG-----------
A6G9D5_9DELT/106-239--------------------DMGRFAKG.........L--TNLVAHCDRMRA-----------
E3Q3M1_COLGM/143-285--------------------ALIRE............K--PALVEYVGRIHE-----------
B2B5D5_PODAN/109-260--------------------RLVR....G........Y--PALVEYARRIHD-----------
Q0U682_PHANO/112-249--------------------QLVKDE...........C--PAAVEYARRIHE-----------
A1CCM4_ASPCL/109-245--------------------AVVAE............F--PVVMEYAERIHD-----------
Q2GX63_CHAGB/116-255--------------------QIVRS............F--PVIMDYARRIHE-----------
E3M3K7_CAERE/109-240--------------------QFMKDR...........T--PNLMTFVTRMKE-----------
D7FWB3_ECTSI/120-218--------------------K................L--VKLKAHMDLFHG-----------
F1KXU8_ASCSU/112-193--------------------EIPTS............L--HNLWAYMKRGYE-----------
E8Z6E4_PFIPI/96-208--------------------DYVQRH...........F--PRLFEHSQRVEE-----------
A1AB54_ECOK1/45-122--------------------WFQDN............A--PNINAIADAVCQ-----------
C1HKK3_9ESCH/61-138--------------------WFQDN............A--PNINAIADAVCQ-----------
E9TQV2_ECOLX/45-122--------------------WFQDN............A--PNINAIADAVCQ-----------
E0QYH5_ECOLX/45-128--------------------WFQDN............A--PNINAIVDAVCQ-----------
B5FXM3_TAEGU/120-251--------------------KVKN.............Y--SNLTAFCRRIEQ-----------
E1BVN1_CHICK/113-243--------------------ELSEKVKN.........Y--GNLTAFCRRIEQ-----------
E9G0M2_DAPPU/109-235--------------------HMNGE............F--LNLRSFCNRMKS-----------
E9GQJ6_DAPPU/107-233--------------------PLFDGE...........W--INLKMYCHRMKE-----------
Q9NAG5_CAEEL/170-288--------------------DLIDGE...........C--KNLAEYVERIKN-----------
A8XYN3_CAEBR/159-290--------------------DLIVGE...........C--KNLQEYVERIKN-----------
E3MMS1_CAERE/154-288--------------------DLIEGE...........C--KNLVEYIERIKN-----------
C5LXL1_PERM5/112-245--------------------ECKK.............Y--DNLMGYYERMVK-----------
E2R3Q0_CANFA/144-275--------------------RLIKGE...........L--INLAMYCERIRR-----------
G3QJ55_GORGO/197-328--------------------RLIKGE...........L--INLAMYCERIRR-----------
FAXC_RAT/197-328--------------------RLIKGE...........L--INLAMYCERIRR-----------
D2HID7_AILME/197-339--------------------RLIKGKPYKPLQAFRSEL--INLAMYCERIRR-----------
B3S4C5_TRIAD/106-233--------------------KMVREE...........F--SNLVAFSDRMKA-----------
B3S5C1_TRIAD/137-264--------------------LLHSE............L--KNLVDFVYRMKE-----------
B3RZK8_TRIAD/97-224--------------------LLTTE............L--TNLVDYVERMKA-----------
D0N2R1_PHYIT/80-174--------------------EEKDEAAV.........L--QVFRKYVAQLFA-----------
E3M1A0_CAERE/120-266--------------------EIKKYIETT........T--PNLIAYLNRIKE-----------
S7UUE1_TOXGO/396-511--------------------DILQ.............N--SSIVPWLTRMRQ-----------
B9QR24_TOXGO/404-519--------------------DILQ.............N--SSIVPWLTRMRQ-----------
F0VEQ6_NEOCL/393-510--------------------DILQ.............H--SSIGPWLKRMRQ-----------
E9J013_SOLIN/261-381--------------------DLLT.............H--TKIGIWYNAVRE-----------
PGES2_MOUSE/252-367--------------------DLMR.............H--SHIQPWYLRMER-----------
D4AE56_RAT/252-367--------------------DLMR.............H--SHIQPWYLRMER-----------
F1N1J6_BOVIN/250-365--------------------DLMR.............H--THIQPWYLRVEK-----------
F1RRY6_PIG/253-368--------------------DLMR.............H--THIQPWYLRVEK-----------
F1P9X4_CANFA/252-367--------------------DLMR.............H--TRIQPWYLRVEK-----------
B4YY03_CANFA/250-365--------------------DLMR.............H--TRIQPWYLRVEK-----------
D8RW70_SELML/135-249--------------------DMIA.............N--SKIGAWYSRMEQ-----------
Q9FHX0_ARATH/192-305--------------------DMVD.............N--TRIGEWYSRMEN-----------
D3BAJ2_POLPA/71-164--------------------KLFTQ............S--PKCLELHKKLTE-----------
F1KQF6_ASCSU/105-183--------------------KLQK.............E--EPLTEFFEKILH-----------
B2BXI7_ARALL/100-207--------------------TPEDT............F--PELNRWIKKLNE-----------
D7LL96_ARALL/100-207--------------------TPEDT............F--PELNRWIKKLNE-----------
B9RCA3_RICCO/93-207--------------------FLGP.............H--KKVQQWIENIKK-----------
D8QNB8_SELML/101-218--------------------SLLDS............K--QKIRKWLGNVKE-----------
D8R6V3_SELML/101-218--------------------KYLSFLDS.........K--KKIRKWLGNVKE-----------
B9T6C9_RICCO/29-125--------------------DFDK.............F--PAIAQWMGLLGQ-----------
F0WN27_9STRA/91-187--------------------EISTEE...........M--EKYSRYTAHLFA-----------
D6WU61_TRICA/72-170--------------------EYLSN............N--LHVLKWMKSVES-----------
E4UVV4_ARTGP/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
D4DGR0_TRIVH/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
D4AT40_ARTBC/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
F2PV52_TRIEC/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
F2RVW7_TRIT1/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
A0A022TE31_TRIRU/48-141--------------------RTGEDG...........Y--HHIVRHVDFVQN-----------
C4JDF5_UNCRE/48-138--------------------RTGESG...........Y--HHIVRHVDLVQN-----------
Q4WZS4_ASPFU/48-138--------------------RTGEQG...........Y--HHIVRHVDFVQN-----------
B8CBE8_THAPS/169-259--------------------ILPKG............C--PTLR.WMEMISL-----------
F0YCB2_AURAN/642-721--------------------AAAK.............S--ADVARWLKLCES-----------
A3LWB3_PICST/76-162--------------------KNGV.............Y--TNVSRWYSLLAD-----------
Q6BKC8_DEBHA/81-164--------------------SVIKNGV..........Y--TNVSRWYNLLAA-----------
Q4U9H7_THEAN/88-189--------------------EYLEKE...........L--LHLARFLRTVKA-----------
D8U415_VOLCA/66-148--------------------.................F--CNLLRWYDLLQN-----------
D8TWM4_VOLCA/86-193--------------------QLQRH............F--APVVDWLGRCQK-----------
F2UBC5_SALR5/67-152--------------------.................D--SCIARWYATCEA-----------
Q7Q3I3_ANOGA/70-167--------------------KGAVN............I--DNVLRWYRQITA-----------
B4N9E6_DROWI/73-152--------------------EFLSAKGI.........P--QHVQRWYDLITA-----------
B4HG12_DROSE/73-152--------------------EFLAAKGI.........P--QHVQRWYDLITA-----------
B4PL45_DROYA/73-152--------------------A.AKGI...........P--QHVQRWYDLITA-----------
B4QSD7_DROSI/73-152--------------------A.AKGI...........P--QHVQRWYDLITA-----------
SYEP_DROME/73-152--------------------A.AKGI...........P--QHVQRWYDLITA-----------
B3M314_DROAN/73-152--------------------.................P--QHVQRWYDLITA-----------
B3P8B5_DROER/73-152--------------------.................P--QHVQRWYDLITA-----------
B4JT86_DROGR/72-151--------------------LAAKGI...........P--QHVQRWYDLINA-----------
B4K6U5_DROMO/72-151--------------------.................P--QHVQRWYDLINA-----------
X1Y0E9_ANODA/694-773--------------------RIGI.............P--VHVQRWYNLMLA-----------
B0XC16_CULQU/71-150--------------------AVGI.............P--VHVQRFYDLISA-----------
Q178Q6_AEDAE/71-150--------------------AIGI.............P--VHVQRWYDLISA-----------
B7PKR5_IXOSC/70-155--------------------KV...............L--QNVSRWYNLLLS-----------
C3XZ88_BRAFL/70-155--------------------.................P--PHVTRWFRFLEE-----------
F1P179_CHICK/71-156--------------------QQNKA............P--IHAKRWYGFLDV-----------
Q5ZJ86_CHICK/71-156--------------------QQNKA............P--IHAKRWYGFLDV-----------
B4DKX5_HUMAN/71-156--------------------KQKKA............P--VHVKRWFGFLEA-----------
SYEP_HUMAN/71-156--------------------KQKKA............P--VHVKRWFGFLEA-----------
Q3KQZ8_HUMAN/71-156--------------------KQKKA............P--VHVKRWFGFLEA-----------
Q5RCS2_PONAB/71-156--------------------KQKKA............P--VHVKRWFGFLEA-----------
F1S9K5_PIG/71-156--------------------.................P--VHVKRWFGFLEA-----------
D2HDG9_AILME/57-142--------------------KQNKA............P--VHVKRWFGFLEA-----------
E2QUR2_CANFA/71-156--------------------KQNKA............P--VHIKRWFGFLEA-----------
Q6TXE9_RAT/89-174--------------------QSKT.............L--VHVNRWYGFLEA-----------
B9EIU1_MOUSE/71-156--------------------KQNKT............L--VHVKRWFGFLEA-----------
E6ZR79_SPORE/78-163--------------------LVRKGL...........H--KHLQRWFNHIDS-----------
A8JF35_CHLRE/74-156--------------------K................V--PHLARWFAFCSE-----------
D8UHB4_VOLCA/73-156--------------------K................V--PHLARWFTFCSE-----------
D8SNX9_SELML/72-156--------------------KSAK.............F--PHLSRWYDAISV-----------
F2DKN7_HORVD/72-156--------------------RSKK.............Y--QSLVRWFNSVAA-----------
F2EEU4_HORVD/72-156--------------------RSKK.............Y--QSLVRWFNSVAA-----------
B8LRU5_PICSI/72-156--------------------KSKK.............F--QNLVRWFNSILS-----------
D7M5B1_ARALL/74-158--------------------KSKK.............Y--QSLVRWFNSILD-----------
O82462_ARATH/74-158--------------------KSKK.............Y--QSLVRWFNSILD-----------
B9RFS6_RICCO/74-158--------------------KSKK.............Y--QNLVRWFNSISA-----------
A5B9C3_VITVI/77-161--------------------KSKK.............Y--QNLVRWFNSIYA-----------
Q4WQV0_ASPFU/145-252--------------------.................F--PELTTWHDRLVR-----------
B6AZ99_9RHOB/67-130--------------------.................W--PEAVQIYRSDML-----------
A5DZL4_LODEL/70-158--------------------DLRKV............W--PFLDKWCRMIKN-----------
C8V321_EMENI/98-189--------------------...........L.....P--ESLVKLQDAIEA-----------
Q5B0A6_EMENI/118-205--------------------.................P--ESLVKLQDAIEA-----------
C1FH64_MICSR/69-170--------------------EYVDR............F--PNICKNAAAVDA-----------
B7FSP9_PHATC/127-244--------------------DMAWDTTN.........V--PALKDYHAWMKS-----------
D6V2C5_9BRAD/95-206--------------------RFERN............I--PCLVALHERVGA-----------
B2IEI5_BEII9/99-212--------------------RTLKH............V--PRVAALHHAVAQ-----------
A0A058V2B3_BORPT/92-203--------------------TLMHR............Y--PRLMTLHARVAE-----------
A0A038I621_BORBO/92-203--------------------LVHR.............Y--PRLMALHARVAE-----------
A3NKT4_BURP6/116-229--------------------RVAKQ............H--AALIELGDRVAQ-----------
A3P6E2_BURP0/99-212--------------------RVAKQ............H--AALIELGDRVAQ-----------
A4LR03_BURPE/99-212--------------------RVAKQ............H--AALIELGDRVAQ-----------
A8EQ36_BURPE/138-251--------------------RVAKQ............H--AALIELGDRVAQ-----------
A8KFZ3_BURPE/116-229--------------------RVAKQ............H--AALIELGDRVAQ-----------
B1H8S8_BURPE/116-229--------------------RVAKQ............H--AALIELGDRVAQ-----------
B2H8F9_BURPE/99-212--------------------RVAKQ............H--AALIELGDRVAQ-----------
C0YD09_BURPE/116-229--------------------RVAKQ............H--AALIELGDRVAQ-----------
C6U522_BURPE/99-212--------------------RVAKQ............H--AALIELGDRVAQ-----------
B4ST55_STRM5/94-204--------------------ALGQT............L--PLLRALQERVAK-----------
B2FRQ6_STRMK/94-204--------------------ALAPT............L--PLLRALQERVAK-----------
B8L691_9GAMM/94-204--------------------QALAPT...........L--PLLRALHERVAK-----------
B0RPT3_XANCB/94-204--------------------TLATD............I--TGLKALQQRVAQ-----------
Q4UXR8_XANC8/106-216--------------------TLATD............I--TGLKALQQRVAQ-----------
D4SRF8_9XANT/94-204--------------------TLATD............L--PGLKALQQRVAT-----------
D4T9D0_9XANT/94-204--------------------ATLATD...........L--PGLKALQQRVAT-----------
F0BY29_9XANT/94-204--------------------TLAKN............L--PGLKALQRHVAQ-----------
Q3BQA5_XANC5/94-204--------------------RLAKN............L--PGLKALQRHVAQ-----------
E9EGB4_METAQ/115-231--------------------DSGK.............Y--DGVFKLYEVVKE-----------
E9FC33_METAR/114-231--------------------DSGK.............Y--DGVFKLYEAVKE-----------
E6ZKH3_SPORE/113-235--------------------KLKVGGK..........Y--DHVFQLHDQVKA-----------
Q4PHJ6_USTMA/131-253--------------------RLKDQGE..........Y--ENVFVLHSDIRA-----------
B2VRG1_PYRTR/83-207--------------------THDTQEDVMGQVFSQERY--PGLWRWFHAFEA-----------
Q0U0D3_PHANO/77-203--------------------KDTNREDVTAKVWNEQRY--PGLWSWFHAFEK-----------
A1DN79_NEOFI/128-240--------------------DILEG............Y--AALEAWYKRYSE-----------
D8M558_BLAHO/58-124--------------------DSLEG............F--PTLKKWRADFES-----------
E3RJP3_PYRTT/917-1001--------------------KKA..............M--GGLEDWYRKCWK-----------
F0XHR1_GROCL/885-987--------------------KRLK.............L--DHLGEYYGRIKA-----------
E9DTF4_METAQ/750-836--------------------EIFDG............M--GALKGYYERFGE-----------
Q2GUC8_CHAGB/865-976--------------------.................G--EHLRRYYTAFGE-----------
C9SQ13_VERA1/837-927--------------------GVLNG............T--KSLKKYYQAFSE-----------
E3QT63_COLGM/831-957--------------------ALGA.............N--KKLREYYEKVKA-----------
Q55JP4_CRYNB/150-286--------------------GAVQG............K--QGVEKYIERVLD-----------
B6QBZ6_PENMQ/110-196--------------------LITKES...........Y--PEIVAFAERLKN-----------
E3QUV0_COLGM/128-262--------------------GSARAA...........H--PVLFDYVDRLQR-----------
C5JYK1_AJEDS/159-267--------------------LINKEQ...........H--PYLTEYVSRIQE-----------
A3K1B8_9RHOB/77-180--------------------KLEE.............F--PRLAAYKARMEA-----------
B9TLA7_RICCO/51-123--------------------.................F--PRLAAWAARAEA-----------
F0XEQ7_GROCL/281-416--------------------DAVRA............L--PALVRHRVRILE-----------
E3RS78_PYRTT/85-191--------------------SIVSGFDA.........L--PNFSKWAAEVIK-----------
Q7D2W7_AGRT5/94-199--------------------IIEDT............S--PIIWGLSRRVVA-----------
A9H2Q5_GLUDA/94-199--------------------ILDAS............A--PMTAALARRVAD-----------
D7AAL2_STAND/94-199--------------------ALLDET...........A--PLTAALTRRLQA-----------
C5LY40_PERM5/101-214--------------------SLGLAD...........F--PRVRAWWERMTD-----------
D7FW72_ECTSI/215-297--------------------ATST.............L--AKVLAYAQRVGE-----------
C1E4T3_MICSR/78-183--------------------DALDGT...........V--PRVAAWFARCGE-----------

PF16865

A4I8P2_LEIIN/97-204--------------------DVFCK------------A--PRMKALWAAAAQRASVRET----
A4I8P2_LEIIN/321-429--------------------DLFAH------------F--PLLNGLAEAGMATPEAKSV----
Q4CZ29_TRYCC/93-200--------------------DIFHN------------A--PRLKKMYVTSMQRTTVKET----

PF04399

Q6D1S0_PECAS/85-210-------------------------------------G--PNVHAYLERVSTASKVALLTDKA
Q5NRG0_ZYMMO/87-214-------------------------------------P--DKVDRYRHRMADMTGIFLFDAIA
Q5NQ08_ZYMMO/85-214-------------------------------------P--VEVATYLQAMSKASKIGLLDQFA
D5QI23_KOMHA/68-196-------------------------------------P--AEVAQYCRTMSQACGVPLFDTI.
H2ITY9_RAHAC/85-214-------------------------------------P--SRVLAYRDNMAKQTQVNLFTRLA
F2JXW1_MARM1/91-215-------------------------------------P--ERVSTYIKEVSALTNTHTYHDKA
F9ZM92_ACICS/93-218-------------------------------------P--PELTTYFARVEAAAQTTLLP...
I0DZW0_PROSM/85-211-------------------------------------S--TTILNYMKNIAQITGVTLLFSQA
E6WDE9_PANSA/85-214-------------------------------------P--SRVAAYRDNMAKQTQVNLLSSIA
Q9CNB4_PASMU/85-214-------------------------------------P--ARLEKYIKRLSELSKVELYTSQA
X2GUV6_9GAMM/86-215-------------------------------------P--PKVKEYIESMAKLTKVNLFFDKA
D0NB62_PHYIT/96-224-------------------------------------P--TKVREFLEYFSETGDVPLFDNV.
Q7MBY7_VIBVY/84-208-------------------------------------D--SVVKDWMESVSDKTHVPLL....
Q65TQ1_MANSM/85-215-------------------------------------P--TRVKNYVDCMAKMSKIDLFYGNA
F4HD49_GALAU/85-214-------------------------------------P--NKVAAYVKKMSLMSGIELYTERA
A8AI12_CITK8/69-198-------------------------------------P--TRVADYRDNMAKQTQINLLSSMA
Q5E4G7_VIBF1/86-215-------------------------------------P--PHLKNYLEEISDLTGVHLFFDVA
K3W8Q1_PYTUL/137-266-------------------------------------P--TKLREYMDYMSEAADVPLLDSMA
Q7DD88_NEIMB/82-212-------------------------------------P--QKVMGYLMTMSEKSGVPLYFDRA
E0SAU3_DICD3/85-214-------------------------------------P--AAIAAYCDTLSQHADIDLLIEQA
M4BU42_HYAAE/154-283-------------------------------------P--PQLREYLDNMSKKTDILLLDSMA
A8GFK9_SERP5/85-214-------------------------------------P--DNIEAYRNRMAQRSDIPLLFDME
Q5NH24_FRATT/91-214-------------------------------------P--TNITNYIKNIEAKTNIELY....
X2HAQ1_9NEIS/85-214-------------------------------------T--APVLDYMHSISRITRIPLFDDRA
A1S8P5_SHEAM/96-225-------------------------------------G--KRVRSYIDEVAALTKVALFDTTA
H3G9G4_PHYRM/122-251-------------------------------------P--PKLREYIDHMAEKADIPLLDNMA
D7FTR2_ECTSI/110-242-------------------------------------P--PKLRAYLDAVSERVDVPLYDKIA
W0L8R1_SERFO/85-214-------------------------------------P--SNVEAYRNRMAQRCDIPLLFDME
A6VNZ1_ACTSZ/85-215-------------------------------------L--PNIQRYVEQMSALSRVPLYTNRA
A7MM21_CROS8/89-214-------------------------------------G--PQVSAYIERVSAQTGVALLSAQA
F0YIM1_AURAN/118-251-------------------------------------P--PKVRAYMDNLAEKGDCPLYDAIA
K7SWA6_GLUOY/88-217-------------------------------------P--LEVEAYRQVMSEKSGVSLLDMFA
F0LUD7_VIBFN/86-215-------------------------------------P--ARVRQYIDEVTALTHIPLYDDVA
Q9KKV8_VIBCH/84-211-------------------------------------D--SEVRDWMVSVSQKTQVRLLQEP.
H8L0T2_FRAAD/85-207-------------------------------------G--PLAQAYAEHFSAKTGVALLD...
Q6LNL6_PHOPR/86-215-------------------------------------P--TQVRQYIDEVAALTNINLYDNIA
Q5FQY7_GLUOX/87-216-------------------------------------P--AEVEAYRQAMAARSGVGLFDDIA
W0HW21_9ENTR/85-214-------------------------------------P--TRVADYRDNMAKQTQVNLLSSMA
H3GPY7_PHYRM/353-482-------------------------------------P--SNVRELVDFMAEAGDIALLDNMA
B2VDJ5_ERWT9/85-214-------------------------------------P--TRVADYRDNMAKQTQINLLSSLA
U4KES9_9VIBR/86-215-------------------------------------P--THVRQYIDEVTKLTKIRLFDAVA
Q87J67_VIBPA/85-208-------------------------------------D--PAVLHWMATARKATNVPVL....
Q15Q78_PSEA6/101-230-------------------------------------P--PKVGAYLDYFSTTCKIPLFYDVA
C7JHY2_ACEP3/84-213-------------------------------------P--TAVEHYRQALSERSGIPLLDAVA
F0YIS1_AURAN/125-254-------------------------------------P--PRVREYLDTACEAANVDTFA...
Q6D468_PECAS/85-214-------------------------------------P--SRVADYRDNMAKQTQVTLLSSLA
G2I7E0_GLUMN/84-212-------------------------------------P--APVWAYCRHMAQATGIPLLDNMA
B7VSY7_VIBSL/89-209-------------------------------------P--PALEHWLEKQSKTLSIMLL....
C9R3A8_AGGAD/85-214-------------------------------------P--PKVNVYVETLSRLNQVPLYWDKT

PF11801

A5DPS2_PICGU/93-276-------------------------------------H--.AIHDYIR---------------
Q6BJD7_DEBHA/112-306-------------------------------------K--.FIVNYLT---------------
A5DUS1_LODEL/96-243-------------------------------------.--.....SLK---------------
MTX1_PIG/95-225-------------------------------------G--.KLQAHLR---------------
Q1L8P8_DANRE/95-225-------------------------------------G--.KLQQHLN---------------
M9N0R6_ASHG1/82-231-------------------------------------G--ARVTAHLR---------------
Q6C8L9_YARLI/89-259-------------------------------------C--.AVAGLLK---------------
SAM37_YEAST/113-276-------------------------------------G--NRIRSKLE---------------
Q6CII7_KLULA/89-254-------------------------------------G--DLLRSHLR---------------
A1DFG3_NEOFI/97-262-------------------------------------S--.....FLR---------------
A7TPA1_VANPO/99-264-------------------------------------G--NNIKTHIT---------------
A7F5V7_SCLS1/99-263-------------------------------------P--WLSRTMRR---------------
Q6FU46_CANGA/92-252-------------------------------------N--NEICKYLK---------------
Q5B6M7_EMENI/97-261-------------------------------------P--.....WLR---------------
A6RE67_AJECN/106-259-------------------------------------P--.....WLR---------------
Q5ALP4_CANAL/109-308-------------------------------------R--.FIFNYLK---------------
A3LTE5_PICST/98-286-------------------------------------R--.FIYNYLK---------------

PF14834

D5C687_ENTCC/95-211--------------------TFQ--------------WQRASVQRYVALSAK-----------
A7MH37_CROS8/138-254--------------------AFQ--------------WQRASVQRYIALSAR-----------
A6TBY7_KLEP7/95-211--------------------SFQ--------------WQRASIQRYVALSAK-----------
YFCF_ECOLI/95-211--------------------TFQ--------------WQRASVQRFIALSAK-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window